3RLZA

2.0 angstrom x-ray structure of bovine ca(2+)-s100b d63n
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSNGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-B
publication title The effects of CapZ peptide (TRTK12) on the protein dynamics of S100B and S100B D63N
rcsb
source organism Bos taurus
total genus 31
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3rlzA00
1HQVA 5I2QA 1SKTA 3CR2A 3I5GB 2LHIA 4N1FA 4QJ4B 2PASA 3LK1A 4MSPA 3WHTB 4YGBB 4C0JA 1XFVO 1ALWA 2TN4A 1QV1A 2FOTA 4GBAA 4R1EA 2Y1MA 1CTRA 3I5GC 2FCDA 4ZCUA 3QRXA 2LLSA 1DGUA 2LVVA 3VRPA 2G9BA 3BOWB 2ZRSA 2LP3A 1M63B 1LA0A 4GGNA 1DJGA 2HPSA 2NZ0A 4OKHA 2QPTA 1M46A 1KFUS 1C7VA 1LKJA 1RJVA 2M29A 4JPZB 1MR8A 4GPLB 1J7PA 1RTP1 2LVJA 1XFUO 3NSKA 1A4PA 2SCPA 4A4BA 1H4BA 4N5XA 2LUXA 4AQJA 1C07A 2LM5A 5I2OA 5F6TA 1A75A 1X02A 2ZN8A 3VRRA 1SL7A 5HYDA 1K8UA 1CLMA 4HRHA 2FCEA 5D69A 1IQ5A 3A4UB 4PCWA 1SPYA 3K21A 2LVIA 4XJKB 2I18A 4UPGA 3TDUA 4GGFC 4YGAA 1QX2A 1J55A 1J7QA 4DS7A 1B9AA 3O2PA 2CBLA 3EK4A 1CNPA 1SR6B 1ZUZA 2LAPA 1JF0A 3HX4A 3PFVA 5HKWA 4ORBB 1F55A 1KFXS 2G2BA 3DVJA 3DVMA 1EG3A 1N0YA 2KOTA 2PSRA 4PDZA 1A03A 2EHBA 4P2YB 1BF5A 5AEQA 1IQ3A 1FBVA 1JC2A 1K9PA 1FPWA 2DOQA 3VRNA 1KFXL 2JNFA 1JUOA 1TN4A 2F3YA 2JT3A 1CFCA 5JOLA 5HLOA 1S5GZ 1SY9A 1PSBA 3BUNB 5CSFA 2OS8B 1TCOB 2D8NA 3KF9A 1OSAA 1QV0A 2JTTA 4YGEB 1A75B 1FF1A 4MZJA 1PRWA 1IWQA 2PRUA 2HQ8A 1CM1A 2OS8C 2JULA 3SJSA 2JWWA 1CFDA 1RWYA 1S6CA 2GGZA 4WRIA 2JU0A 4FTGA 1K94A 1F4OA 1AHRA 1ODBA 1F70A 1UHJA 1NCYA 2HQWA 2ZKMX 3HCMA 5CSJA 1EL4A 2MRDA 5FYXA 4GAOA 3BUXB 1J7OA 2LE9B 2L50A 2QACA 4QJ5B 1OMVA 2I94A 3SIAA 2BCBA 4ICBA 3WNXB 4XYNA 2KFFA 3CR5X 2M3WA 3SG5A 5K89A 3O78A 2L51A 2LMUA 3OB2B 3LCPC 4YRUA 1S5GY 1M45A 1OZSA 1E8AA 3PLFB 4L9MA 1OOJA 1QIWA 1R6PA 1K95A 1JFKA 4JQ0D 4MZKA 4YBHB 1SL8A 1BU3A 1PK0D 4PE4A 4HSZA 2ZNEA 1Y1AA 3OX6A 4U8DA 3AAKA 3SG3A 1KSMA 1WRZA 2L2EA 2OPOA 3I5FB 2MAZA 2CCMA 1NX0A 1B1GA 1RFJA 1HT9A 1SMGA 1YUTA 3OB1B 3I5FC 2ZFDA 1K2HA 1EXRA 4PE7A 3D10A 4Q04A 1AVSA 5DKRA 4I5KA 2Y1NA 1QX5B 1Y1UA 2KBIA 3SG7A 2F33A 4OV2A 1QS7A 3GK2A 3PSRA 1XK4C 3GOFA 2KBMA 1G4YR 3LK0A 3AKBA 3RM1A 3WHUB 2LLUA 1PVAA 3GK1A 1GQMA 2M1UA 4A4CA 2BCAA 2M7NA 1B4CA 3LL8B 2CTNA 1JWDA 2WCBA 2JC2A 4NDDA 1NP8A 1JBAA 1S36A 4AOMA 2LVKA 4DIRA 1KWOB 2AUCA 4YGCB 3PALA 1LXFC 4M2OA 1KWOC 2LHLA 5PALA 1PSRA 2L5XB 1DJIA 1LA3A 1EG4A 1K90D 4CFQA 5HKZA 1Q80A 1U5IA 1UWOA 2CXJA 3RLZA 3CS1A 4WQ3A 1B8CA 1QTXA 2WC8A 1ZOTB 1DVIA 2NLNA 3VGOA 4TNCA 1DGVA 2CNPA 2KHNA 5G08A 3BUWB 3TS5B 1Y1XA 2LC5A 2JZIA 5ER5A 4PHKA 2K7DA 1AJ4A 1OMDA 2K7OA 1KQMB 4MRXA 4OR9B 5I2LA 3TS5C 1ZFSA 1TRFA 4HRGA 3TZ1A 5AERA 5TNCA 1QIVA 1SYMA 2MBXA 1MXLC 1SR6C 1IGVA 2IS9A 1SW8A 1IJ5A 1YX8A 1BOCA 1G8IA 5KSZA 2M9GA 3KO0A 4AQIA 1K93D 1XYDA 3EK8A 1YRUB 3IQQA 4HREE 1S6IA 2BBNA 5BPJA 4MBEA 2KDHA 1WRKA 2E6WA 3LLEA 1TNWA 1CMFA 1M31A 1C7WA 1MXEA 3PATA 1OMRA 1TNPA 3DD4A 2BECA 1DJXA 4MRYA 1GGWA 1CLLA 1IKUA 1CB1A 1DTLA 2NXQA 1TNQA 1XFZO 1U5IB 1QASA 2LMVA 1NUBA 3AKAA 3KEVA 3C1VA 3AAJA 1SRAA 4MEWA 3DVEA 1XFWO 1MF8B 2O5GA 1PVBA 1EJ3A 1KK7Z 1V1FA 3PM8A 2JXCA 5DKNA 3ICBA 4YI9A 1DJHA 2KSPA 1BT6A 1H8BA 1UHNA 2ZRTA 5KU1A 1J1DA 2MHHA 2K7CA 1DF0A 1XFXO 1A2XA 4WQ2A 1SNLA 2ZN9A 1ZMZA 2PMYA 1BR1B 4PHNA 1KCYA 1NX3A 4YGDB 2H61A 2O60A 2KFHA 5AANA 1WDCB 1CDLA 2L98A 4PHMA 1AK8A 3BXKA 4D1EA 2M7LA 2BL0B 3D0YA 4QJ3B 3E3RA 1EH2A 1AJ5A 3EVRA 3ZNIA 2KI4B 1B8LA 1WY9A 2EGDA 1JF2A 4P5OE 5J3XA 1JFJA 2BL0C 1UUSA 4BY5A 1BR4B 2A4JA 3EK7A 1UHIA 4JWQA 2K0JA 2FJUB 1DMOA 2KI4C 2KAVA 2K2AA 2KYFA 3I5HB 1FI6A 3EVVA 2OTGB 1W7IB 1KK7Y 3EVUA 1YR5A 4OCIA 1KQVA 3NXAA 3WXAA 3I5HC 2OTGC 3NSLA 2K61A 2WNDA 1QATA 5GQQC 1CFFA 2LUCA 3JTDB 1DF0B 4CPVA 2K7BA 3I5IB 4GUKA 5B8IB 4CIDA 1KK8B 2LLTA 2B1UA 2F8PA 3JTDC 3TDIA 2JT0A 1PALA 4PALA 2MLFC 1J1EA 2KQYA 2M8UA 1KSOA 1NX1A 3I5IC 1QLSA 1KK8C 2BKIB 2M1KB 3D0YB 3TDZA 2BBMA 2JT8A 2LCPA 1PULA 5IBWA 1V1GA 2H2KA 2LP2A 2JNXA 1NCZA 1UURA 1S1EA 5KTYA 4GGFA 1YUUA 1UP5A 4FQOA 1BODA 3GK4X 3SIBA 3FWCA 1NX2A 2WOSA 1JSAA 3TUYB 1WLZA 1WRLA 4I5NB 3H4SE 2KFGA 1SL9A 1MQ1A 3NSIA 2M49B 2KNEA 2KI6D 3DF0B 3FIAA 3OHMB 5HLVA 3TUYC 1BG1A 4ORCB 1ZACA 1Y6WA 1K9UA 1B7TZ 2K2FA 1QVIZ 2P6BB 5DKQA 1TOPA 2PVBA 1SK6D 1YRTB 1QLKA 2NCPA 1YUSA 1B47A 5HKYA 1QX7A 2KI6C 4BY4A 4C0LA 1YX7A 1DJYA 2WCFA 2MA2A 2COLB 1S6JA 3CTNA 4DCKA 5D7FA 1D1OA 2MLEC 1S3PA 1K96A 1QJTA 1L7ZA 3OX5A 1WLMA 1CM4A 4C0KA 4DRWA 1XO5A 4OVNF 1IRJA 1BJFA 4I5JA 3CLNA 2JRFA 2KGRA 1K9KA 3KPXA 1CLBA 3CR4X 1KQMC 1KFUL 2BE4A 2VRGA 2WCEA 1CFPA 3MSEB 3ZWHA 1NSHA 4MLWA 4MVFA 1SCVA 1CDPA 1BLQA 1CDNA 4CLNA 4E68A 1IJ6A 3NSOA 2Y5IA 4CFRA 1B8RA 4N1GA 2LNKA 4DUQA 4NDCA 2M97A 3SG4A 2BKHB 2RGIA 1NIWA 1F54A 2KAYA 2Q4UA 1TCFA 2ISDA 1CDMA 2AAOA 1FW4A 1B7TY 2E30A 1QVIY 1NCXA 2MJWB 4PE0A 4ZCVA 3EKHA 2ZNDA 4NQGA 2I2RE 2KQ6A 2L0PA 1RROA 3KHEA 4F0ZB 1GJYA 2WORA 1RK9A 2BE6A 2HF5A 1DJZA 1BMOA 1L2OB 2JPTA 1CMGA 4ETOA 4PHJA 2KYCA 1YVHA 2BCXA 1L2OC 2LV7A 3O6BA 1F8HA 1OZOA 4PE1A 1RECA 2JXLA 3F45A 1MHOA 2SASA 3A8RA 1TIZA 2F2PA 2F3ZA 2L4HA 1J7RA 1GGZA 3BUOB 2V53A 3CGAA 4M2PA 4MN0A 5AFPA 1YURA 1IH0A 1DT7B 2GGMA 3SG6A 5CSNA 3FWBA 3SG2A 1WDCC 4ORAB 2LANA 2JTZA 4YI8A 3VROA 2HETA 3BQ3A 2F2OA 1MWNA 1Y0VH 1XK4A 2LMTA 3IF7A 1XA5A 4GFTA 3JVTB 4M2QA 3BUMB 1XVJA 4IL1A 1SCMB 3DF0A 2JQ6A 2EC6B 2M0RA 1QXPA 3EKJA 4USLA 2I7AA 3VRQA 1DJWA 2JOJA 3CWGA 1NPQA 3JVTC 4GNKB 1AP4A 2CT9A 1S26D 2PALA 1SCMC 2K8MB 3CZTX 3M0WA 1UHKA 2EC6C 5AXIA 1YVLA 2AMIA 3O4YA 1UHHA 1N65A 3BOWA 1G33A 1TTXA 5JJGA 1ALVA 1OQPA 4I5LB 1TNXA 4NDBA 1A29A 1OE9B 1LVCD 2Y4QA 1FI5A 2KGBC 1F71A 2GV5A 1VRKA 1YTZC 5I8NA 3DVKA 1M39A 5CPVA 2KAXA 1CKKA 1XFYO 2H61C 3FS7A 4MZLA 1R2UA 3PN7B 5ER4X 1IG5A 5CSIA 1AUIB 3BYAA 2R2IA 1MUXA 2Q91A 3IQOA 1LINA 1W7JB 2NCOA 1F4QA 1NWDA 3OP0A 3PN7C 1N2DA 2L4IA 1NYAA 4XJKA 1SBJA
chains in the Genus database with same CATH superfamily
1HQVA 5I2QA 1SKTA 3NHIA 3CR2A 3I5GB 2LHIA 3B7AA 4N1FA 5D3OA 4QJ4B 2PASA 3LK1A 4MSPA 3WHTB 4YGBB 4C0JA 1XFVO 1ALWA 2TN4A 1QV1A 2FOTA 4GBAA 4R1EA 2Y1MA 1CTRA 3I5GC 2FCDA 4ZCUA 3QRXA 2LLSA 1DGUA 2LVVA 3QMEA 2G9BA 3BOWB 3VRPA 2ZRSA 4F7FA 2LP3A 1M63B 1LA0A 4GGNA 1DJGA 2HPSA 2NZ0A 4OKHA 2QPTA 1M46A 1KFUS 1C7VA 1LKJA 1RJVA 2M29A 4JPZB 1MR8A 4GPLB 1LS8A 1J7PA 1RTP1 1C3YA 2LVJA 1XFUO 1DC1A 3NSKA 1A4PA 2SCPA 3CYZA 4A4BA 2BAPA 1H4BA 4N5XA 2LUXA 4AQJA 1C07A 2LM5A 5I2OA 5F6TA 1A75A 1X02A 1SSEB 2ZN8A 3VRRA 1SL7A 5HYDA 1K8UA 1CLMA 4HRHA 2FCEA 5D69A 1IQ5A 3A4UB 3D77A 1SPYA 4PCWA 3K21A 2LVIA 4XJKB 2I18A 4UPGA 3BFAA 3TDUA 4GGFC 4YGAA 3SS4A 1QX2A 3R72A 1J55A 1J7QA 4DS7A 1B9AA 3NHTA 2QEOA 5FI6A 2ERBA 2CBLA 3EK4A 3O2PA 1SR6B 1ZUZA 2LAPA 1CNPA 1JF0A 3HX4A 3PFVA 2KLDA 5HKWA 3DXLA 4ORBB 5DICA 1F55A 1KFXS 2G2BA 3DVJA 3DVMA 1EG3A 1N0YA 2KOTA 2PSRA 4PDZA 1A03A 2EHBA 4P2YB 1BF5A 5AEQA 1IQ3A 1FBVA 1JC2A 1K9PA 1FPWA 2DOQA 3CZ1A 1C3ZA 3VRNA 1KFXL 2JNFA 1JUOA 1TN4A 2F3YA 2JT3A 1CFCA 5JOLA 2BNXA 1S5GZ 5HLOA 3L4LA 4INXA 1SY9A 1PSBA 3BUNB 5CSFA 2OS8B 1TCOB 2D8NA 3KF9A 1OSAA 1QV0A 2JTTA 4YGEB 1A75B 3K1EA 1FF1A 4MZJA 1PRWA 1IWQA 2PRUA 2HQ8A 1CM1A 1DEKA 2OS8C 2JULA 3SJSA 2JWWA 1CFDA 1RWYA 1S6CA 2GGZA 3S0AA 4WRIA 2JU0A 4FTGA 1K94A 1F4OA 1AHRA 1ODBA 1F70A 1UHJA 1NCYA 2HQWA 2ZKMX 3HCMA 5CSJA 1EL4A 2MRDA 5FYXA 4GAOA 3BUXB 1J7OA 3S0GA 3B6XA 2LE9B 3CDNA 2L50A 2KPHA 2QACA 2L2CA 4QJ5B 1OMVA 2I94A 3S0EA 3SIAA 2BCBA 4ICBA 3WNXB 4XYNA 2KFFA 1OW4A 2M3WA 3CR5X 3SG5A 3O78A 2L51A 2LMUA 5K89A 3OB2B 3LCPC 4YRUA 1S5GY 3CZ0A 1M45A 1OZSA 1T14A 1E8AA 3PLFB 4L9MA 1OOJA 1QIWA 1R6PA 1K95A 1JFKA 4JQ0D 4MZKA 4YBHB 3EG5B 1SL8A 1BU3A 1PK0D 4PE4A 4HSZA 2ZNEA 1Y1AA 3OX6A 4U8DA 3AAKA 3SG3A 1KSMA 1WRZA 2L2EA 2OPOA 3I5FB 2MAZA 2CCMA 1NX0A 1B1GA 1RFJA 1HT9A 1SMGA 1YUTA 3OB1B 3I5FC 2ZFDA 1QWVA 1EXRA 3B87A 3D10A 4PE7A 4Q04A 1AVSA 5DKRA 1K2HA 3SS3A 1W9ZA 4I5KA 1TUZA 2Y1NA 1QX5B 1Y1UA 2KBIA 3SG7A 2F33A 4OV2A 1QS7A 3GK2A 3PSRA 1XK4C 3GOFA 2KBMA 1G4YR 3LK0A 3AKBA 3RM1A 3WHUB 2LLUA 1PVAA 3GK1A 1GQMA 2M1UA 4A4CA 2BCAA 2M7NA 1B4CA 3LL8B 3SS5A 2CTNA 1JWDA 2WCBA 2JC2A 2KLEA 4NDDA 1NP8A 1JBAA 1S36A 4AOMA 2LVKA 4DIRA 1KWOB 2AUCA 4YGCB 2WC6A 3PALA 1LXFC 4M2OA 1KWOC 5EL2A 2LHLA 5PALA 1PSRA 2QEHA 1XFRA 1DJIA 1LA3A 2L5XB 1EG4A 1K90D 2WCMA 4CFQA 3CABA 5HKZA 1Q80A 1U5IA 1UWOA 2CXJA 3RLZA 3CS1A 4WQ3A 1P28A 1B8CA 1QTXA 2WC8A 1ZOTB 1DVIA 2NLNA 3VGOA 4TNCA 1DGVA 2CNPA 2KHNA 5G08A 3BUWB 3TS5B 1Y1XA 2LC5A 2JZIA 5ER5A 4PHKA 2K7DA 1AJ4A 1OMDA 2K7OA 1KQMB 4MRXA 4OR9B 5I2LA 3TS5C 1ZFSA 1TRFA 4HRGA 3TZ1A 5AERA 5TNCA 1ORGA 1QIVA 1SYMA 4IJ7A 2MBXA 1MXLC 1SR6C 1IGVA 2IS9A 3IVTA 1GM0A 1SW8A 1IJ5A 1YX8A 1BOCA 1G8IA 2WCKA 5FI7A 2M9GA 3KO0A 5KSZA 4AQIA 1K93D 1XYDA 3EK8A 1YRUB 3IQQA 4HREE 1S6IA 2BBNA 5BPJA 4MBEA 2KDHA 1WRKA 2E6WA 3LLEA 3L4AA 2PQLA 1TNWA 1DELA 1CMFA 1M31A 1C7WA 1MXEA 3PATA 1OMRA 3NGVA 1TNPA 3DD4A 2BECA 1DJXA 4MRYA 1GGWA 1CLLA 1IKUA 1CB1A 1DTLA 2NXQA 1TNQA 1XFZO 1U5IB 1QASA 2LMVA 1NUBA 3AKAA 3KEVA 3C1VA 3AAJA 1SRAA 4MEWA 3DVEA 1XFWO 1MF8B 2O5GA 1PVBA 1EJ3A 1KK7Z 1V1FA 3O4XA 2JXCA 3PM8A 5DKNA 3PM2A 3ICBA 4YI9A 1DJHA 2KSPA 5HL1A 4JD9A 1BT6A 1H8BA 1UHNA 3S0BA 2ZRTA 5KU1A 1J1DA 2MHHA 2K7CA 1IIOA 1DF0A 1XFXO 1A2XA 4WQ2A 1SNLA 2ZN9A 1ZMZA 2PMYA 3B86A 1BR1B 3R1OA 4PHNA 1KCYA 1NX3A 4YGDB 3V2LA 2H61A 2O60A 2KFHA 2L5YA 5AANA 1WDCB 1CDLA 2L98A 2WC5A 4PHMA 1AK8A 2GTEA 3BXKA 4D1EA 2M7LA 3D75A 2BL0B 3D0YA 4QJ3B 3E3RA 1EH2A 3DYEA 1AJ5A 3EVRA 3FE6A 3ZNIA 2KI4B 1B8LA 1WY9A 2EGDA 1JF2A 4P5OE 5J3XA 1JFJA 2BL0C 1UUSA 4BY5A 1BR4B 2A4JA 3EK7A 1UHIA 4JWQA 2K0JA 2FJUB 1DMOA 2KI4C 2KAVA 2K2AA 2KYFA 3I5HB 4OZDA 1FI6A 3EVVA 2OTGB 1W7IB 1KK7Y 3EVUA 1YR5A 3DZTA 4OCIA 1KQVA 3NXAA 3WXAA 3I5HC 2OTGC 3NSLA 4PT1A 2K61A 2WNDA 1QATA 5GQQC 1CFFA 2LUCA 3JTDB 1DF0B 4CPVA 2K7BA 3I5IB 4GUKA 5B8IB 4CIDA 1KK8B 2LLTA 2B1UA 2F8PA 3JTDC 3TDIA 2JT0A 1PALA 4PALA 2MLFC 1J1EA 2KQYA 2M8UA 1KSOA 1NX1A 3I5IC 1QLSA 1KK8C 2BKIB 2M1KB 3BJHA 3D0YB 3TDZA 2BBMA 2H8VA 2JT8A 1PULA 2LCPA 5IBWA 1V1GA 2H2KA 2LP2A 2JNXA 1NCZA 2PYQA 1UURA 1S1EA 3OGNA 4GGFA 5KTYA 1YUUA 1UP5A 4FQOA 1BODA 3GK4X 3SIBA 3FWCA 1NX2A 2P71A 2WOSA 3CZ2A 1JSAA 3TUYB 1WLZA 1WRLA 4FQTA 4I5NB 3H4SE 2KFGA 1SL9A 1MQ1A 3NSIA 2M49B 3VB1A 2KNEA 2KI6D 3DF0B 3FIAA 3L47A 3OHMB 1DQEA 5HLVA 3Q8IA 3TUYC 1BG1A 4ORCB 1ZACA 1Y6WA 1K9UA 1B7TZ 2K2FA 1QVIZ 2P6BB 5DKQA 1TOPA 2PVBA 1SK6D 1YRTB 1QLKA 2NCPA 1YUSA 5I94A 1B47A 5HKYA 1QX7A 2KI6C 4BY4A 4C0LA 1YX7A 3FE8A 1DJYA 2WCFA 2WCLA 1Z4HA 2MA2A 2WCJA 2COLB 1S6JA 3CTNA 4DCKA 5D7FA 1D1OA 2MLEC 1S3PA 4INWA 1K96A 1QJTA 1L7ZA 3OX5A 1WLMA 1CM4A 4C0KA 4DRWA 3S0DA 2FJYA 1XO5A 3DY9A 4OVNF 1TUJA 1IRJA 1BJFA 4I5JA 3CLNA 2JRFA 2KGRA 1K9KA 3KPXA 1CLBA 3CR4X 5FI2A 1KQMC 3R1VA 1KFUL 2BE4A 2VRGA 2WCEA 1CFPA 3MSEB 3ZWHA 1NSHA 4MLWA 1TWOA 4MVFA 3S0FA 1SCVA 1CDPA 2WCHA 1BLQA 4CLNA 1CDNA 4E68A 1IJ6A 3NSOA 2Y5IA 4CFRA 1B8RA 4N1GA 2LNKA 4DUQA 4NDCA 2M97A 3SG4A 3BFHA 2BKHB 2RGIA 1NIWA 1F54A 2KAYA 2Q4UA 1TCFA 2ISDA 1CDMA 2AAOA 1FW4A 1B7TY 2E30A 1QVIY 1NCXA 2MJWB 4PE0A 4ZCVA 3EKHA 1OOHA 1OOFA 2ZNDA 2I2RE 4NQGA 2KQ6A 1OOIX 2L0PA 3UNWA 1RROA 3KHEA 4F0ZB 1GJYA 2WORA 1RK9A 2BE6A 2HF5A 1DJZA 1BMOA 1L2OB 2JPTA 3OBVA 4ETOA 4PHJA 1CMGA 2KYCA 3R1PA 3RZSA 1YVHA 2BCXA 1L2OC 2LV7A 3O6BA 1F8HA 1OZOA 3PJIA 4KYNA 4PE1A 1RECA 2JXLA 3F45A 1MHOA 2SASA 3A8RA 3N7HA 1Z2CB 1TIZA 2F2PA 2F3ZA 2L4HA 1J7RA 1GGZA 3BUOB 3D74A 2V53A 3CGAA 4M2PA 4MN0A 5AFPA 4JKTA 1YURA 1IH0A 1DT7B 2GGMA 3UO9A 3SG6A 5CSNA 3FWBA 3SG2A 1WDCC 4ORAB 2LANA 2JTZA 3BFBA 4YI8A 3VROA 3D73A 2HETA 3BQ3A 2F2OA 1MWNA 1Y0VH 1XK4A 2LMTA 3IF7A 1XA5A 4GFTA 3JVTB 4M2QA 3BUMB 1OOGA 1XVJA 4IL1A 1SCMB 3DF0A 2JQ6A 2EC6B 2M0RA 1QXPA 3EKJA 4USLA 2I7AA 3VRQA 1DJWA 2JOJA 3CWGA 1NPQA 3JVTC 4GNKB 1AP4A 2CT9A 1S26D 2PALA 1SCMC 2K8MB 3CZTX 3M0WA 1UHKA 2EC6C 3D76A 5AXIA 2JPOA 1YVLA 2AMIA 2QEBA 1UHHA 1N65A 3BOWA 3O4YA 1G33A 1TTXA 5JJGA 1ALVA 1OQPA 4I5LB 1TNXA 3B88A 2K60A 4NDBA 1A29A 1OE9B 1LVCD 2Y4QA 1FI5A 2KGBC 1F71A 2QDIA 2YGUA 2GV5A 1VRKA 1YTZC 5I8NA 3DVKA 1M39A 5CPVA 3FE9A 2KAXA 2P70A 1XFYO 2H61C 1CKKA 3FS7A 4MZLA 1R2UA 3PN7B 5ER4X 1IG5A 2QEVA 5CSIA 1AUIB 3BYAA 2R2IA 1MUXA 2Q91A 3IQOA 1LINA 1W7JB 2NCOA 1F4QA 1NWDA 3OP0A 3D78A 3PN7C 1N2DA 2L4IA 1NYAA 4XJKA 1SBJA
chains in the Genus database with same CATH topology
1HQVA 5I2QA 1SKTA 3CR2A 3I5GB 2LHIA 4N1FA 4QJ4B 2PASA 3LK1A 4MSPA 3WHTB 4YGBB 4C0JA 1XFVO 1ALWA 2TN4A 1QV1A 2FOTA 4GBAA 4R1EA 2Y1MA 1CTRA 3I5GC 2FCDA 4ZCUA 3QRXA 2LLSA 1DGUA 2LVVA 3VRPA 2G9BA 3BOWB 2ZRSA 2LP3A 1M63B 1LA0A 4GGNA 1DJGA 2HPSA 2NZ0A 4OKHA 2QPTA 1M46A 1KFUS 1C7VA 1LKJA 1RJVA 2M29A 4JPZB 1MR8A 4GPLB 1J7PA 1RTP1 2LVJA 1XFUO 3NSKA 1A4PA 2SCPA 4A4BA 1H4BA 4N5XA 2LUXA 4AQJA 1C07A 2LM5A 5I2OA 5F6TA 1A75A 1X02A 2ZN8A 3VRRA 1SL7A 5HYDA 1K8UA 1CLMA 4HRHA 2FCEA 5D69A 1IQ5A 3A4UB 4PCWA 1SPYA 3K21A 2LVIA 4XJKB 2I18A 4UPGA 3TDUA 4GGFC 4YGAA 1QX2A 1J55A 1J7QA 4DS7A 1B9AA 3O2PA 2CBLA 3EK4A 1CNPA 1SR6B 1ZUZA 2LAPA 1JF0A 3HX4A 3PFVA 5HKWA 4ORBB 1F55A 1KFXS 2G2BA 3DVJA 3DVMA 1EG3A 1N0YA 2KOTA 2PSRA 4PDZA 1A03A 2EHBA 4P2YB 1BF5A 5AEQA 1IQ3A 1FBVA 1JC2A 1K9PA 1FPWA 2DOQA 3VRNA 1KFXL 2JNFA 1JUOA 1TN4A 2F3YA 2JT3A 1CFCA 5JOLA 5HLOA 1S5GZ 1SY9A 1PSBA 3BUNB 5CSFA 2OS8B 1TCOB 2D8NA 3KF9A 1OSAA 1QV0A 2JTTA 4YGEB 1A75B 1FF1A 4MZJA 1PRWA 1IWQA 2PRUA 2HQ8A 1CM1A 2OS8C 2JULA 3SJSA 2JWWA 1CFDA 1RWYA 1S6CA 2GGZA 4WRIA 2JU0A 4FTGA 1K94A 1F4OA 1AHRA 1ODBA 1F70A 1UHJA 1NCYA 2HQWA 2ZKMX 3HCMA 5CSJA 1EL4A 2MRDA 5FYXA 4GAOA 3BUXB 1J7OA 2LE9B 2L50A 2QACA 4QJ5B 1OMVA 2I94A 3SIAA 2BCBA 4ICBA 3WNXB 4XYNA 2KFFA 3CR5X 2M3WA 3SG5A 5K89A 3O78A 2L51A 2LMUA 3OB2B 3LCPC 4YRUA 1S5GY 1M45A 1OZSA 1E8AA 3PLFB 4L9MA 1OOJA 1QIWA 1R6PA 1K95A 1JFKA 4JQ0D 4MZKA 4YBHB 1SL8A 1BU3A 1PK0D 4PE4A 4HSZA 2ZNEA 1Y1AA 3OX6A 4U8DA 3AAKA 3SG3A 1KSMA 1WRZA 2L2EA 2OPOA 3I5FB 2MAZA 2CCMA 1NX0A 1B1GA 1RFJA 1HT9A 1SMGA 1YUTA 3OB1B 3I5FC 2ZFDA 1K2HA 1EXRA 4PE7A 3D10A 4Q04A 1AVSA 5DKRA 4I5KA 2Y1NA 1QX5B 1Y1UA 2KBIA 3SG7A 2F33A 4OV2A 1QS7A 3GK2A 3PSRA 1XK4C 3GOFA 2KBMA 1G4YR 3LK0A 3AKBA 3RM1A 3WHUB 2LLUA 1PVAA 3GK1A 1GQMA 2M1UA 4A4CA 2BCAA 2M7NA 1B4CA 3LL8B 2CTNA 1JWDA 2WCBA 2JC2A 4NDDA 1NP8A 1JBAA 1S36A 4AOMA 2LVKA 4DIRA 1KWOB 2AUCA 4YGCB 3PALA 1LXFC 4M2OA 1KWOC 2LHLA 5PALA 1PSRA 2L5XB 1DJIA 1LA3A 1EG4A 1K90D 4CFQA 5HKZA 1Q80A 1U5IA 1UWOA 2CXJA 3RLZA 3CS1A 4WQ3A 1B8CA 1QTXA 2WC8A 1ZOTB 1DVIA 2NLNA 3VGOA 4TNCA 1DGVA 2CNPA 2KHNA 5G08A 3BUWB 3TS5B 1Y1XA 2LC5A 2JZIA 5ER5A 4PHKA 2K7DA 1AJ4A 1OMDA 2K7OA 1KQMB 4MRXA 4OR9B 5I2LA 3TS5C 1ZFSA 1TRFA 4HRGA 3TZ1A 5AERA 5TNCA 1QIVA 1SYMA 2MBXA 1MXLC 1SR6C 1IGVA 2IS9A 1SW8A 1IJ5A 1YX8A 1BOCA 1G8IA 5KSZA 2M9GA 3KO0A 4AQIA 1K93D 1XYDA 3EK8A 1YRUB 3IQQA 4HREE 1S6IA 2BBNA 5BPJA 4MBEA 2KDHA 1WRKA 2E6WA 3LLEA 1TNWA 1CMFA 1M31A 1C7WA 1MXEA 3PATA 1OMRA 1TNPA 3DD4A 2BECA 1DJXA 4MRYA 1GGWA 1CLLA 1IKUA 1CB1A 1DTLA 2NXQA 1TNQA 1XFZO 1U5IB 1QASA 2LMVA 1NUBA 3AKAA 3KEVA 3C1VA 3AAJA 1SRAA 4MEWA 3DVEA 1XFWO 1MF8B 2O5GA 1PVBA 1EJ3A 1KK7Z 1V1FA 3PM8A 2JXCA 5DKNA 3ICBA 4YI9A 1DJHA 2KSPA 1BT6A 1H8BA 1UHNA 2ZRTA 5KU1A 1J1DA 2MHHA 2K7CA 1DF0A 1XFXO 1A2XA 4WQ2A 1SNLA 2ZN9A 1ZMZA 2PMYA 1BR1B 4PHNA 1KCYA 1NX3A 4YGDB 2H61A 2O60A 2KFHA 5AANA 1WDCB 1CDLA 2L98A 4PHMA 1AK8A 3BXKA 4D1EA 2M7LA 2BL0B 3D0YA 4QJ3B 3E3RA 1EH2A 1AJ5A 3EVRA 3ZNIA 2KI4B 1B8LA 1WY9A 2EGDA 1JF2A 4P5OE 5J3XA 1JFJA 2BL0C 1UUSA 4BY5A 1BR4B 2A4JA 3EK7A 1UHIA 4JWQA 2K0JA 2FJUB 1DMOA 2KI4C 2KAVA 2K2AA 2KYFA 3I5HB 1FI6A 3EVVA 2OTGB 1W7IB 1KK7Y 3EVUA 1YR5A 4OCIA 1KQVA 3NXAA 3WXAA 3I5HC 2OTGC 3NSLA 2K61A 2WNDA 1QATA 5GQQC 1CFFA 2LUCA 3JTDB 1DF0B 4CPVA 2K7BA 3I5IB 4GUKA 5B8IB 4CIDA 1KK8B 2LLTA 2B1UA 2F8PA 3JTDC 3TDIA 2JT0A 1PALA 4PALA 2MLFC 1J1EA 2KQYA 2M8UA 1KSOA 1NX1A 3I5IC 1QLSA 1KK8C 2BKIB 2M1KB 3D0YB 3TDZA 2BBMA 2JT8A 2LCPA 1PULA 5IBWA 1V1GA 2H2KA 2LP2A 2JNXA 1NCZA 1UURA 1S1EA 5KTYA 4GGFA 1YUUA 1UP5A 4FQOA 1BODA 3GK4X 3SIBA 3FWCA 1NX2A 2WOSA 1JSAA 3TUYB 1WLZA 1WRLA 4I5NB 3H4SE 2KFGA 1SL9A 1MQ1A 3NSIA 2M49B 2KNEA 2KI6D 3DF0B 3FIAA 3OHMB 5HLVA 3TUYC 1BG1A 4ORCB 1ZACA 1Y6WA 1K9UA 1B7TZ 2K2FA 1QVIZ 2P6BB 5DKQA 1TOPA 2PVBA 1SK6D 1YRTB 1QLKA 2NCPA 1YUSA 1B47A 5HKYA 1QX7A 2KI6C 4BY4A 4C0LA 1YX7A 1DJYA 2WCFA 2MA2A 2COLB 1S6JA 3CTNA 4DCKA 5D7FA 1D1OA 2MLEC 1S3PA 1K96A 1QJTA 1L7ZA 3OX5A 1WLMA 1CM4A 4C0KA 4DRWA 1XO5A 4OVNF 1IRJA 1BJFA 4I5JA 3CLNA 2JRFA 2KGRA 1K9KA 3KPXA 1CLBA 3CR4X 1KQMC 1KFUL 2BE4A 2VRGA 2WCEA 1CFPA 3MSEB 3ZWHA 1NSHA 4MLWA 4MVFA 1SCVA 1CDPA 1BLQA 1CDNA 4CLNA 4E68A 1IJ6A 3NSOA 2Y5IA 4CFRA 1B8RA 4N1GA 2LNKA 4DUQA 4NDCA 2M97A 3SG4A 2BKHB 2RGIA 1NIWA 1F54A 2KAYA 2Q4UA 1TCFA 2ISDA 1CDMA 2AAOA 1FW4A 1B7TY 2E30A 1QVIY 1NCXA 2MJWB 4PE0A 4ZCVA 3EKHA 2ZNDA 4NQGA 2I2RE 2KQ6A 2L0PA 1RROA 3KHEA 4F0ZB 1GJYA 2WORA 1RK9A 2BE6A 2HF5A 1DJZA 1BMOA 1L2OB 2JPTA 1CMGA 4ETOA 4PHJA 2KYCA 1YVHA 2BCXA 1L2OC 2LV7A 3O6BA 1F8HA 1OZOA 4PE1A 1RECA 2JXLA 3F45A 1MHOA 2SASA 3A8RA 1TIZA 2F2PA 2F3ZA 2L4HA 1J7RA 1GGZA 3BUOB 2V53A 3CGAA 4M2PA 4MN0A 5AFPA 1YURA 1IH0A 1DT7B 2GGMA 3SG6A 5CSNA 3FWBA 3SG2A 1WDCC 4ORAB 2LANA 2JTZA 4YI8A 3VROA 2HETA 3BQ3A 2F2OA 1MWNA 1Y0VH 1XK4A 2LMTA 3IF7A 1XA5A 4GFTA 3JVTB 4M2QA 3BUMB 1XVJA 4IL1A 1SCMB 3DF0A 2JQ6A 2EC6B 2M0RA 1QXPA 3EKJA 4USLA 2I7AA 3VRQA 1DJWA 2JOJA 3CWGA 1NPQA 3JVTC 4GNKB 1AP4A 2CT9A 1S26D 2PALA 1SCMC 2K8MB 3CZTX 3M0WA 1UHKA 2EC6C 5AXIA 1YVLA 2AMIA 3O4YA 1UHHA 1N65A 3BOWA 1G33A 1TTXA 5JJGA 1ALVA 1OQPA 4I5LB 1TNXA 4NDBA 1A29A 1OE9B 1LVCD 2Y4QA 1FI5A 2KGBC 1F71A 2GV5A 1VRKA 1YTZC 5I8NA 3DVKA 1M39A 5CPVA 2KAXA 1CKKA 1XFYO 2H61C 3FS7A 4MZLA 1R2UA 3PN7B 5ER4X 1IG5A 5CSIA 1AUIB 3BYAA 2R2IA 1MUXA 2Q91A 3IQOA 1LINA 1W7JB 2NCOA 1F4QA 1NWDA 3OP0A 3PN7C 1N2DA 2L4IA 1NYAA 4XJKA 1SBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQV A;  5I2Q A;  1SKT A;  3CR2 A;  3I5G B;  2LHI A;  4N1F A;  4QJ4 B;  2PAS A;  3LK1 A;  4MSP A;  3WHT B;  4YGB B;  4C0J A;  1XFV O;  1ALW A;  2TN4 A;  1QV1 A;  2FOT A;  4GBA A;  4R1E A;  2Y1M A;  1CTR A;  3I5G C;  2FCD A;  4ZCU A;  3QRX A;  2LLS A;  1DGU A;  2LVV A;  3VRP A;  2G9B A;  3BOW B;  2ZRS A;  2LP3 A;  1M63 B;  1LA0 A;  4GGN A;  1DJG A;  2HPS A;  2NZ0 A;  4OKH A;  2QPT A;  1M46 A;  1KFU S;  1C7V A;  1LKJ A;  1RJV A;  2M29 A;  4JPZ B;  1MR8 A;  4GPL B;  1J7P A;  1RTP 1;  2LVJ A;  1XFU O;  3NSK A;  1A4P A;  2SCP A;  4A4B A;  1H4B A;  4N5X A;  2LUX A;  4AQJ A;  1C07 A;  2LM5 A;  5I2O A;  5F6T A;  1A75 A;  1X02 A;  2ZN8 A;  3VRR A;  1SL7 A;  5HYD A;  1K8U A;  1CLM A;  4HRH A;  2FCE A;  5D69 A;  1IQ5 A;  3A4U B;  4PCW A;  1SPY A;  3K21 A;  2LVI A;  4XJK B;  2I18 A;  4UPG A;  3TDU A;  4GGF C;  4YGA A;  1QX2 A;  1J55 A;  1J7Q A;  4DS7 A;  1B9A A;  3O2P A;  2CBL A;  3EK4 A;  1CNP A;  1SR6 B;  1ZUZ A;  2LAP A;  1JF0 A;  3HX4 A;  3PFV A;  5HKW A;  4ORB B;  1F55 A;  1KFX S;  2G2B A;  3DVJ A;  3DVM A;  1EG3 A;  1N0Y A;  2KOT A;  2PSR A;  4PDZ A;  1A03 A;  2EHB A;  4P2Y B;  1BF5 A;  5AEQ A;  1IQ3 A;  1FBV A;  1JC2 A;  1K9P A;  1FPW A;  2DOQ A;  3VRN A;  1KFX L;  2JNF A;  1JUO A;  1TN4 A;  2F3Y A;  2JT3 A;  1CFC A;  5JOL A;  5HLO A;  1S5G Z;  1SY9 A;  1PSB A;  3BUN B;  5CSF A;  2OS8 B;  1TCO B;  2D8N A;  3KF9 A;  1OSA A;  1QV0 A;  2JTT A;  4YGE B;  1A75 B;  1FF1 A;  4MZJ A;  1PRW A;  1IWQ A;  2PRU A;  2HQ8 A;  1CM1 A;  2OS8 C;  2JUL A;  3SJS A;  2JWW A;  1CFD A;  1RWY A;  1S6C A;  2GGZ A;  4WRI A;  2JU0 A;  4FTG A;  1K94 A;  1F4O A;  1AHR A;  1ODB A;  1F70 A;  1UHJ A;  1NCY A;  2HQW A;  2ZKM X;  3HCM A;  5CSJ A;  1EL4 A;  2MRD A;  5FYX A;  4GAO A;  3BUX B;  1J7O A;  2LE9 B;  2L50 A;  2QAC A;  4QJ5 B;  1OMV A;  2I94 A;  3SIA A;  2BCB A;  4ICB A;  3WNX B;  4XYN A;  2KFF A;  3CR5 X;  2M3W A;  3SG5 A;  5K89 A;  3O78 A;  2L51 A;  2LMU A;  3OB2 B;  3LCP C;  4YRU A;  1S5G Y;  1M45 A;  1OZS A;  1E8A A;  3PLF B;  4L9M A;  1OOJ A;  1QIW A;  1R6P A;  1K95 A;  1JFK A;  4JQ0 D;  4MZK A;  4YBH B;  1SL8 A;  1BU3 A;  1PK0 D;  4PE4 A;  4HSZ A;  2ZNE A;  1Y1A A;  3OX6 A;  4U8D A;  3AAK A;  3SG3 A;  1KSM A;  1WRZ A;  2L2E A;  2OPO A;  3I5F B;  2MAZ A;  2CCM A;  1NX0 A;  1B1G A;  1RFJ A;  1HT9 A;  1SMG A;  1YUT A;  3OB1 B;  3I5F C;  2ZFD A;  1K2H A;  1EXR A;  4PE7 A;  3D10 A;  4Q04 A;  1AVS A;  5DKR A;  4I5K A;  2Y1N A;  1QX5 B;  1Y1U A;  2KBI A;  3SG7 A;  2F33 A;  4OV2 A;  1QS7 A;  3GK2 A;  3PSR A;  1XK4 C;  3GOF A;  2KBM A;  1G4Y R;  3LK0 A;  3AKB A;  3RM1 A;  3WHU B;  2LLU A;  1PVA A;  3GK1 A;  1GQM A;  2M1U A;  4A4C A;  2BCA A;  2M7N A;  1B4C A;  3LL8 B;  2CTN A;  1JWD A;  2WCB A;  2JC2 A;  4NDD A;  1NP8 A;  1JBA A;  1S36 A;  4AOM A;  2LVK A;  4DIR A;  1KWO B;  2AUC A;  4YGC B;  3PAL A;  1LXF C;  4M2O A;  1KWO C;  2LHL A;  5PAL A;  1PSR A;  2L5X B;  1DJI A;  1LA3 A;  1EG4 A;  1K90 D;  4CFQ A;  5HKZ A;  1Q80 A;  1U5I A;  1UWO A;  2CXJ A;  3RLZ A;  3CS1 A;  4WQ3 A;  1B8C A;  1QTX A;  2WC8 A;  1ZOT B;  1DVI A;  2NLN A;  3VGO A;  4TNC A;  1DGV A;  2CNP A;  2KHN A;  5G08 A;  3BUW B;  3TS5 B;  1Y1X A;  2LC5 A;  2JZI A;  5ER5 A;  4PHK A;  2K7D A;  1AJ4 A;  1OMD A;  2K7O A;  1KQM B;  4MRX A;  4OR9 B;  5I2L A;  3TS5 C;  1ZFS A;  1TRF A;  4HRG A;  3TZ1 A;  5AER A;  5TNC A;  1QIV A;  1SYM A;  2MBX A;  1MXL C;  1SR6 C;  1IGV A;  2IS9 A;  1SW8 A;  1IJ5 A;  1YX8 A;  1BOC A;  1G8I A;  5KSZ A;  2M9G A;  3KO0 A;  4AQI A;  1K93 D;  1XYD A;  3EK8 A;  1YRU B;  3IQQ A;  4HRE E;  1S6I A;  2BBN A;  5BPJ A;  4MBE A;  2KDH A;  1WRK A;  2E6W A;  3LLE A;  1TNW A;  1CMF A;  1M31 A;  1C7W A;  1MXE A;  3PAT A;  1OMR A;  1TNP A;  3DD4 A;  2BEC A;  1DJX A;  4MRY A;  1GGW A;  1CLL A;  1IKU A;  1CB1 A;  1DTL A;  2NXQ A;  1TNQ A;  1XFZ O;  1U5I B;  1QAS A;  2LMV A;  1NUB A;  3AKA A;  3KEV A;  3C1V A;  3AAJ A;  1SRA A;  4MEW A;  3DVE A;  1XFW O;  1MF8 B;  2O5G A;  1PVB A;  1EJ3 A;  1KK7 Z;  1V1F A;  3PM8 A;  2JXC A;  5DKN A;  3ICB A;  4YI9 A;  1DJH A;  2KSP A;  1BT6 A;  1H8B A;  1UHN A;  2ZRT A;  5KU1 A;  1J1D A;  2MHH A;  2K7C A;  1DF0 A;  1XFX O;  1A2X A;  4WQ2 A;  1SNL A;  2ZN9 A;  1ZMZ A;  2PMY A;  1BR1 B;  4PHN A;  1KCY A;  1NX3 A;  4YGD B;  2H61 A;  2O60 A;  2KFH A;  5AAN A;  1WDC B;  1CDL A;  2L98 A;  4PHM A;  1AK8 A;  3BXK A;  4D1E A;  2M7L A;  2BL0 B;  3D0Y A;  4QJ3 B;  3E3R A;  1EH2 A;  1AJ5 A;  3EVR A;  3ZNI A;  2KI4 B;  1B8L A;  1WY9 A;  2EGD A;  1JF2 A;  4P5O E;  5J3X A;  1JFJ A;  2BL0 C;  1UUS A;  4BY5 A;  1BR4 B;  2A4J A;  3EK7 A;  1UHI A;  4JWQ A;  2K0J A;  2FJU B;  1DMO A;  2KI4 C;  2KAV A;  2K2A A;  2KYF A;  3I5H B;  1FI6 A;  3EVV A;  2OTG B;  1W7I B;  1KK7 Y;  3EVU A;  1YR5 A;  4OCI A;  1KQV A;  3NXA A;  3WXA A;  3I5H C;  2OTG C;  3NSL A;  2K61 A;  2WND A;  1QAT A;  5GQQ C;  1CFF A;  2LUC A;  3JTD B;  1DF0 B;  4CPV A;  2K7B A;  3I5I B;  4GUK A;  5B8I B;  4CID A;  1KK8 B;  2LLT A;  2B1U A;  2F8P A;  3JTD C;  3TDI A;  2JT0 A;  1PAL A;  4PAL A;  2MLF C;  1J1E A;  2KQY A;  2M8U A;  1KSO A;  1NX1 A;  3I5I C;  1QLS A;  1KK8 C;  2BKI B;  2M1K B;  3D0Y B;  3TDZ A;  2BBM A;  2JT8 A;  2LCP A;  1PUL A;  5IBW A;  1V1G A;  2H2K A;  2LP2 A;  2JNX A;  1NCZ A;  1UUR A;  1S1E A;  5KTY A;  4GGF A;  1YUU A;  1UP5 A;  4FQO A;  1BOD A;  3GK4 X;  3SIB A;  3FWC A;  1NX2 A;  2WOS A;  1JSA A;  3TUY B;  1WLZ A;  1WRL A;  4I5N B;  3H4S E;  2KFG A;  1SL9 A;  1MQ1 A;  3NSI A;  2M49 B;  2KNE A;  2KI6 D;  3DF0 B;  3FIA A;  3OHM B;  5HLV A;  3TUY C;  1BG1 A;  4ORC B;  1ZAC A;  1Y6W A;  1K9U A;  1B7T Z;  2K2F A;  1QVI Z;  2P6B B;  5DKQ A;  1TOP A;  2PVB A;  1SK6 D;  1YRT B;  1QLK A;  2NCP A;  1YUS A;  1B47 A;  5HKY A;  1QX7 A;  2KI6 C;  4BY4 A;  4C0L A;  1YX7 A;  1DJY A;  2WCF A;  2MA2 A;  2COL B;  1S6J A;  3CTN A;  4DCK A;  5D7F A;  1D1O A;  2MLE C;  1S3P A;  1K96 A;  1QJT A;  1L7Z A;  3OX5 A;  1WLM A;  1CM4 A;  4C0K A;  4DRW A;  1XO5 A;  4OVN F;  1IRJ A;  1BJF A;  4I5J A;  3CLN A;  2JRF A;  2KGR A;  1K9K A;  3KPX A;  1CLB A;  3CR4 X;  1KQM C;  1KFU L;  2BE4 A;  2VRG A;  2WCE A;  1CFP A;  3MSE B;  3ZWH A;  1NSH A;  4MLW A;  4MVF A;  1SCV A;  1CDP A;  1BLQ A;  1CDN A;  4CLN A;  4E68 A;  1IJ6 A;  3NSO A;  2Y5I A;  4CFR A;  1B8R A;  4N1G A;  2LNK A;  4DUQ A;  4NDC A;  2M97 A;  3SG4 A;  2BKH B;  2RGI A;  1NIW A;  1F54 A;  2KAY A;  2Q4U A;  1TCF A;  2ISD A;  1CDM A;  2AAO A;  1FW4 A;  1B7T Y;  2E30 A;  1QVI Y;  1NCX A;  2MJW B;  4PE0 A;  4ZCV A;  3EKH A;  2ZND A;  4NQG A;  2I2R E;  2KQ6 A;  2L0P A;  1RRO A;  3KHE A;  4F0Z B;  1GJY A;  2WOR A;  1RK9 A;  2BE6 A;  2HF5 A;  1DJZ A;  1BMO A;  1L2O B;  2JPT A;  1CMG A;  4ETO A;  4PHJ A;  2KYC A;  1YVH A;  2BCX A;  1L2O C;  2LV7 A;  3O6B A;  1F8H A;  1OZO A;  4PE1 A;  1REC A;  2JXL A;  3F45 A;  1MHO A;  2SAS A;  3A8R A;  1TIZ A;  2F2P A;  2F3Z A;  2L4H A;  1J7R A;  1GGZ A;  3BUO B;  2V53 A;  3CGA A;  4M2P A;  4MN0 A;  5AFP A;  1YUR A;  1IH0 A;  1DT7 B;  2GGM A;  3SG6 A;  5CSN A;  3FWB A;  3SG2 A;  1WDC C;  4ORA B;  2LAN A;  2JTZ A;  4YI8 A;  3VRO A;  2HET A;  3BQ3 A;  2F2O A;  1MWN A;  1Y0V H;  1XK4 A;  2LMT A;  3IF7 A;  1XA5 A;  4GFT A;  3JVT B;  4M2Q A;  3BUM B;  1XVJ A;  4IL1 A;  1SCM B;  3DF0 A;  2JQ6 A;  2EC6 B;  2M0R A;  1QXP A;  3EKJ A;  4USL A;  2I7A A;  3VRQ A;  1DJW A;  2JOJ A;  3CWG A;  1NPQ A;  3JVT C;  4GNK B;  1AP4 A;  2CT9 A;  1S26 D;  2PAL A;  1SCM C;  2K8M B;  3CZT X;  3M0W A;  1UHK A;  2EC6 C;  5AXI A;  1YVL A;  2AMI A;  3O4Y A;  1UHH A;  1N65 A;  3BOW A;  1G33 A;  1TTX A;  5JJG A;  1ALV A;  1OQP A;  4I5L B;  1TNX A;  4NDB A;  1A29 A;  1OE9 B;  1LVC D;  2Y4Q A;  1FI5 A;  2KGB C;  1F71 A;  2GV5 A;  1VRK A;  1YTZ C;  5I8N A;  3DVK A;  1M39 A;  5CPV A;  2KAX A;  1CKK A;  1XFY O;  2H61 C;  3FS7 A;  4MZL A;  1R2U A;  3PN7 B;  5ER4 X;  1IG5 A;  5CSI A;  1AUI B;  3BYA A;  2R2I A;  1MUX A;  2Q91 A;  3IQO A;  1LIN A;  1W7J B;  2NCO A;  1F4Q A;  1NWD A;  3OP0 A;  3PN7 C;  1N2D A;  2L4I A;  1NYA A;  4XJK A;  1SBJ A; 
#chains in the Genus database with same CATH topology
 1HQV A;  5I2Q A;  1SKT A;  3NHI A;  3CR2 A;  3I5G B;  2LHI A;  3B7A A;  4N1F A;  5D3O A;  4QJ4 B;  2PAS A;  3LK1 A;  4MSP A;  3WHT B;  4YGB B;  4C0J A;  1XFV O;  1ALW A;  2TN4 A;  1QV1 A;  2FOT A;  4GBA A;  4R1E A;  2Y1M A;  1CTR A;  3I5G C;  2FCD A;  4ZCU A;  3QRX A;  2LLS A;  1DGU A;  2LVV A;  3QME A;  2G9B A;  3BOW B;  3VRP A;  2ZRS A;  4F7F A;  2LP3 A;  1M63 B;  1LA0 A;  4GGN A;  1DJG A;  2HPS A;  2NZ0 A;  4OKH A;  2QPT A;  1M46 A;  1KFU S;  1C7V A;  1LKJ A;  1RJV A;  2M29 A;  4JPZ B;  1MR8 A;  4GPL B;  1LS8 A;  1J7P A;  1RTP 1;  1C3Y A;  2LVJ A;  1XFU O;  1DC1 A;  3NSK A;  1A4P A;  2SCP A;  3CYZ A;  4A4B A;  2BAP A;  1H4B A;  4N5X A;  2LUX A;  4AQJ A;  1C07 A;  2LM5 A;  5I2O A;  5F6T A;  1A75 A;  1X02 A;  1SSE B;  2ZN8 A;  3VRR A;  1SL7 A;  5HYD A;  1K8U A;  1CLM A;  4HRH A;  2FCE A;  5D69 A;  1IQ5 A;  3A4U B;  3D77 A;  1SPY A;  4PCW A;  3K21 A;  2LVI A;  4XJK B;  2I18 A;  4UPG A;  3BFA A;  3TDU A;  4GGF C;  4YGA A;  3SS4 A;  1QX2 A;  3R72 A;  1J55 A;  1J7Q A;  4DS7 A;  1B9A A;  3NHT A;  2QEO A;  5FI6 A;  2ERB A;  2CBL A;  3EK4 A;  3O2P A;  1SR6 B;  1ZUZ A;  2LAP A;  1CNP A;  1JF0 A;  3HX4 A;  3PFV A;  2KLD A;  5HKW A;  3DXL A;  4ORB B;  5DIC A;  1F55 A;  1KFX S;  2G2B A;  3DVJ A;  3DVM A;  1EG3 A;  1N0Y A;  2KOT A;  2PSR A;  4PDZ A;  1A03 A;  2EHB A;  4P2Y B;  1BF5 A;  5AEQ A;  1IQ3 A;  1FBV A;  1JC2 A;  1K9P A;  1FPW A;  2DOQ A;  3CZ1 A;  1C3Z A;  3VRN A;  1KFX L;  2JNF A;  1JUO A;  1TN4 A;  2F3Y A;  2JT3 A;  1CFC A;  5JOL A;  2BNX A;  1S5G Z;  5HLO A;  3L4L A;  4INX A;  1SY9 A;  1PSB A;  3BUN B;  5CSF A;  2OS8 B;  1TCO B;  2D8N A;  3KF9 A;  1OSA A;  1QV0 A;  2JTT A;  4YGE B;  1A75 B;  3K1E A;  1FF1 A;  4MZJ A;  1PRW A;  1IWQ A;  2PRU A;  2HQ8 A;  1CM1 A;  1DEK A;  2OS8 C;  2JUL A;  3SJS A;  2JWW A;  1CFD A;  1RWY A;  1S6C A;  2GGZ A;  3S0A A;  4WRI A;  2JU0 A;  4FTG A;  1K94 A;  1F4O A;  1AHR A;  1ODB A;  1F70 A;  1UHJ A;  1NCY A;  2HQW A;  2ZKM X;  3HCM A;  5CSJ A;  1EL4 A;  2MRD A;  5FYX A;  4GAO A;  3BUX B;  1J7O A;  3S0G A;  3B6X A;  2LE9 B;  3CDN A;  2L50 A;  2KPH A;  2QAC A;  2L2C A;  4QJ5 B;  1OMV A;  2I94 A;  3S0E A;  3SIA A;  2BCB A;  4ICB A;  3WNX B;  4XYN A;  2KFF A;  1OW4 A;  2M3W A;  3CR5 X;  3SG5 A;  3O78 A;  2L51 A;  2LMU A;  5K89 A;  3OB2 B;  3LCP C;  4YRU A;  1S5G Y;  3CZ0 A;  1M45 A;  1OZS A;  1T14 A;  1E8A A;  3PLF B;  4L9M A;  1OOJ A;  1QIW A;  1R6P A;  1K95 A;  1JFK A;  4JQ0 D;  4MZK A;  4YBH B;  3EG5 B;  1SL8 A;  1BU3 A;  1PK0 D;  4PE4 A;  4HSZ A;  2ZNE A;  1Y1A A;  3OX6 A;  4U8D A;  3AAK A;  3SG3 A;  1KSM A;  1WRZ A;  2L2E A;  2OPO A;  3I5F B;  2MAZ A;  2CCM A;  1NX0 A;  1B1G A;  1RFJ A;  1HT9 A;  1SMG A;  1YUT A;  3OB1 B;  3I5F C;  2ZFD A;  1QWV A;  1EXR A;  3B87 A;  3D10 A;  4PE7 A;  4Q04 A;  1AVS A;  5DKR A;  1K2H A;  3SS3 A;  1W9Z A;  4I5K A;  1TUZ A;  2Y1N A;  1QX5 B;  1Y1U A;  2KBI A;  3SG7 A;  2F33 A;  4OV2 A;  1QS7 A;  3GK2 A;  3PSR A;  1XK4 C;  3GOF A;  2KBM A;  1G4Y R;  3LK0 A;  3AKB A;  3RM1 A;  3WHU B;  2LLU A;  1PVA A;  3GK1 A;  1GQM A;  2M1U A;  4A4C A;  2BCA A;  2M7N A;  1B4C A;  3LL8 B;  3SS5 A;  2CTN A;  1JWD A;  2WCB A;  2JC2 A;  2KLE A;  4NDD A;  1NP8 A;  1JBA A;  1S36 A;  4AOM A;  2LVK A;  4DIR A;  1KWO B;  2AUC A;  4YGC B;  2WC6 A;  3PAL A;  1LXF C;  4M2O A;  1KWO C;  5EL2 A;  2LHL A;  5PAL A;  1PSR A;  2QEH A;  1XFR A;  1DJI A;  1LA3 A;  2L5X B;  1EG4 A;  1K90 D;  2WCM A;  4CFQ A;  3CAB A;  5HKZ A;  1Q80 A;  1U5I A;  1UWO A;  2CXJ A;  3RLZ A;  3CS1 A;  4WQ3 A;  1P28 A;  1B8C A;  1QTX A;  2WC8 A;  1ZOT B;  1DVI A;  2NLN A;  3VGO A;  4TNC A;  1DGV A;  2CNP A;  2KHN A;  5G08 A;  3BUW B;  3TS5 B;  1Y1X A;  2LC5 A;  2JZI A;  5ER5 A;  4PHK A;  2K7D A;  1AJ4 A;  1OMD A;  2K7O A;  1KQM B;  4MRX A;  4OR9 B;  5I2L A;  3TS5 C;  1ZFS A;  1TRF A;  4HRG A;  3TZ1 A;  5AER A;  5TNC A;  1ORG A;  1QIV A;  1SYM A;  4IJ7 A;  2MBX A;  1MXL C;  1SR6 C;  1IGV A;  2IS9 A;  3IVT A;  1GM0 A;  1SW8 A;  1IJ5 A;  1YX8 A;  1BOC A;  1G8I A;  2WCK A;  5FI7 A;  2M9G A;  3KO0 A;  5KSZ A;  4AQI A;  1K93 D;  1XYD A;  3EK8 A;  1YRU B;  3IQQ A;  4HRE E;  1S6I A;  2BBN A;  5BPJ A;  4MBE A;  2KDH A;  1WRK A;  2E6W A;  3LLE A;  3L4A A;  2PQL A;  1TNW A;  1DEL A;  1CMF A;  1M31 A;  1C7W A;  1MXE A;  3PAT A;  1OMR A;  3NGV A;  1TNP A;  3DD4 A;  2BEC A;  1DJX A;  4MRY A;  1GGW A;  1CLL A;  1IKU A;  1CB1 A;  1DTL A;  2NXQ A;  1TNQ A;  1XFZ O;  1U5I B;  1QAS A;  2LMV A;  1NUB A;  3AKA A;  3KEV A;  3C1V A;  3AAJ A;  1SRA A;  4MEW A;  3DVE A;  1XFW O;  1MF8 B;  2O5G A;  1PVB A;  1EJ3 A;  1KK7 Z;  1V1F A;  3O4X A;  2JXC A;  3PM8 A;  5DKN A;  3PM2 A;  3ICB A;  4YI9 A;  1DJH A;  2KSP A;  5HL1 A;  4JD9 A;  1BT6 A;  1H8B A;  1UHN A;  3S0B A;  2ZRT A;  5KU1 A;  1J1D A;  2MHH A;  2K7C A;  1IIO A;  1DF0 A;  1XFX O;  1A2X A;  4WQ2 A;  1SNL A;  2ZN9 A;  1ZMZ A;  2PMY A;  3B86 A;  1BR1 B;  3R1O A;  4PHN A;  1KCY A;  1NX3 A;  4YGD B;  3V2L A;  2H61 A;  2O60 A;  2KFH A;  2L5Y A;  5AAN A;  1WDC B;  1CDL A;  2L98 A;  2WC5 A;  4PHM A;  1AK8 A;  2GTE A;  3BXK A;  4D1E A;  2M7L A;  3D75 A;  2BL0 B;  3D0Y A;  4QJ3 B;  3E3R A;  1EH2 A;  3DYE A;  1AJ5 A;  3EVR A;  3FE6 A;  3ZNI A;  2KI4 B;  1B8L A;  1WY9 A;  2EGD A;  1JF2 A;  4P5O E;  5J3X A;  1JFJ A;  2BL0 C;  1UUS A;  4BY5 A;  1BR4 B;  2A4J A;  3EK7 A;  1UHI A;  4JWQ A;  2K0J A;  2FJU B;  1DMO A;  2KI4 C;  2KAV A;  2K2A A;  2KYF A;  3I5H B;  4OZD A;  1FI6 A;  3EVV A;  2OTG B;  1W7I B;  1KK7 Y;  3EVU A;  1YR5 A;  3DZT A;  4OCI A;  1KQV A;  3NXA A;  3WXA A;  3I5H C;  2OTG C;  3NSL A;  4PT1 A;  2K61 A;  2WND A;  1QAT A;  5GQQ C;  1CFF A;  2LUC A;  3JTD B;  1DF0 B;  4CPV A;  2K7B A;  3I5I B;  4GUK A;  5B8I B;  4CID A;  1KK8 B;  2LLT A;  2B1U A;  2F8P A;  3JTD C;  3TDI A;  2JT0 A;  1PAL A;  4PAL A;  2MLF C;  1J1E A;  2KQY A;  2M8U A;  1KSO A;  1NX1 A;  3I5I C;  1QLS A;  1KK8 C;  2BKI B;  2M1K B;  3BJH A;  3D0Y B;  3TDZ A;  2BBM A;  2H8V A;  2JT8 A;  1PUL A;  2LCP A;  5IBW A;  1V1G A;  2H2K A;  2LP2 A;  2JNX A;  1NCZ A;  2PYQ A;  1UUR A;  1S1E A;  3OGN A;  4GGF A;  5KTY A;  1YUU A;  1UP5 A;  4FQO A;  1BOD A;  3GK4 X;  3SIB A;  3FWC A;  1NX2 A;  2P71 A;  2WOS A;  3CZ2 A;  1JSA A;  3TUY B;  1WLZ A;  1WRL A;  4FQT A;  4I5N B;  3H4S E;  2KFG A;  1SL9 A;  1MQ1 A;  3NSI A;  2M49 B;  3VB1 A;  2KNE A;  2KI6 D;  3DF0 B;  3FIA A;  3L47 A;  3OHM B;  1DQE A;  5HLV A;  3Q8I A;  3TUY C;  1BG1 A;  4ORC B;  1ZAC A;  1Y6W A;  1K9U A;  1B7T Z;  2K2F A;  1QVI Z;  2P6B B;  5DKQ A;  1TOP A;  2PVB A;  1SK6 D;  1YRT B;  1QLK A;  2NCP A;  1YUS A;  5I94 A;  1B47 A;  5HKY A;  1QX7 A;  2KI6 C;  4BY4 A;  4C0L A;  1YX7 A;  3FE8 A;  1DJY A;  2WCF A;  2WCL A;  1Z4H A;  2MA2 A;  2WCJ A;  2COL B;  1S6J A;  3CTN A;  4DCK A;  5D7F A;  1D1O A;  2MLE C;  1S3P A;  4INW A;  1K96 A;  1QJT A;  1L7Z A;  3OX5 A;  1WLM A;  1CM4 A;  4C0K A;  4DRW A;  3S0D A;  2FJY A;  1XO5 A;  3DY9 A;  4OVN F;  1TUJ A;  1IRJ A;  1BJF A;  4I5J A;  3CLN A;  2JRF A;  2KGR A;  1K9K A;  3KPX A;  1CLB A;  3CR4 X;  5FI2 A;  1KQM C;  3R1V A;  1KFU L;  2BE4 A;  2VRG A;  2WCE A;  1CFP A;  3MSE B;  3ZWH A;  1NSH A;  4MLW A;  1TWO A;  4MVF A;  3S0F A;  1SCV A;  1CDP A;  2WCH A;  1BLQ A;  4CLN A;  1CDN A;  4E68 A;  1IJ6 A;  3NSO A;  2Y5I A;  4CFR A;  1B8R A;  4N1G A;  2LNK A;  4DUQ A;  4NDC A;  2M97 A;  3SG4 A;  3BFH A;  2BKH B;  2RGI A;  1NIW A;  1F54 A;  2KAY A;  2Q4U A;  1TCF A;  2ISD A;  1CDM A;  2AAO A;  1FW4 A;  1B7T Y;  2E30 A;  1QVI Y;  1NCX A;  2MJW B;  4PE0 A;  4ZCV A;  3EKH A;  1OOH A;  1OOF A;  2ZND A;  2I2R E;  4NQG A;  2KQ6 A;  1OOI X;  2L0P A;  3UNW A;  1RRO A;  3KHE A;  4F0Z B;  1GJY A;  2WOR A;  1RK9 A;  2BE6 A;  2HF5 A;  1DJZ A;  1BMO A;  1L2O B;  2JPT A;  3OBV A;  4ETO A;  4PHJ A;  1CMG A;  2KYC A;  3R1P A;  3RZS A;  1YVH A;  2BCX A;  1L2O C;  2LV7 A;  3O6B A;  1F8H A;  1OZO A;  3PJI A;  4KYN A;  4PE1 A;  1REC A;  2JXL A;  3F45 A;  1MHO A;  2SAS A;  3A8R A;  3N7H A;  1Z2C B;  1TIZ A;  2F2P A;  2F3Z A;  2L4H A;  1J7R A;  1GGZ A;  3BUO B;  3D74 A;  2V53 A;  3CGA A;  4M2P A;  4MN0 A;  5AFP A;  4JKT A;  1YUR A;  1IH0 A;  1DT7 B;  2GGM A;  3UO9 A;  3SG6 A;  5CSN A;  3FWB A;  3SG2 A;  1WDC C;  4ORA B;  2LAN A;  2JTZ A;  3BFB A;  4YI8 A;  3VRO A;  3D73 A;  2HET A;  3BQ3 A;  2F2O A;  1MWN A;  1Y0V H;  1XK4 A;  2LMT A;  3IF7 A;  1XA5 A;  4GFT A;  3JVT B;  4M2Q A;  3BUM B;  1OOG A;  1XVJ A;  4IL1 A;  1SCM B;  3DF0 A;  2JQ6 A;  2EC6 B;  2M0R A;  1QXP A;  3EKJ A;  4USL A;  2I7A A;  3VRQ A;  1DJW A;  2JOJ A;  3CWG A;  1NPQ A;  3JVT C;  4GNK B;  1AP4 A;  2CT9 A;  1S26 D;  2PAL A;  1SCM C;  2K8M B;  3CZT X;  3M0W A;  1UHK A;  2EC6 C;  3D76 A;  5AXI A;  2JPO A;  1YVL A;  2AMI A;  2QEB A;  1UHH A;  1N65 A;  3BOW A;  3O4Y A;  1G33 A;  1TTX A;  5JJG A;  1ALV A;  1OQP A;  4I5L B;  1TNX A;  3B88 A;  2K60 A;  4NDB A;  1A29 A;  1OE9 B;  1LVC D;  2Y4Q A;  1FI5 A;  2KGB C;  1F71 A;  2QDI A;  2YGU A;  2GV5 A;  1VRK A;  1YTZ C;  5I8N A;  3DVK A;  1M39 A;  5CPV A;  3FE9 A;  2KAX A;  2P70 A;  1XFY O;  2H61 C;  1CKK A;  3FS7 A;  4MZL A;  1R2U A;  3PN7 B;  5ER4 X;  1IG5 A;  2QEV A;  5CSI A;  1AUI B;  3BYA A;  2R2I A;  1MUX A;  2Q91 A;  3IQO A;  1LIN A;  1W7J B;  2NCO A;  1F4Q A;  1NWD A;  3OP0 A;  3D78 A;  3PN7 C;  1N2D A;  2L4I A;  1NYA A;  4XJK A;  1SBJ A; 
#chains in the Genus database with same CATH homology
 1HQV A;  5I2Q A;  1SKT A;  3CR2 A;  3I5G B;  2LHI A;  4N1F A;  4QJ4 B;  2PAS A;  3LK1 A;  4MSP A;  3WHT B;  4YGB B;  4C0J A;  1XFV O;  1ALW A;  2TN4 A;  1QV1 A;  2FOT A;  4GBA A;  4R1E A;  2Y1M A;  1CTR A;  3I5G C;  2FCD A;  4ZCU A;  3QRX A;  2LLS A;  1DGU A;  2LVV A;  3VRP A;  2G9B A;  3BOW B;  2ZRS A;  2LP3 A;  1M63 B;  1LA0 A;  4GGN A;  1DJG A;  2HPS A;  2NZ0 A;  4OKH A;  2QPT A;  1M46 A;  1KFU S;  1C7V A;  1LKJ A;  1RJV A;  2M29 A;  4JPZ B;  1MR8 A;  4GPL B;  1J7P A;  1RTP 1;  2LVJ A;  1XFU O;  3NSK A;  1A4P A;  2SCP A;  4A4B A;  1H4B A;  4N5X A;  2LUX A;  4AQJ A;  1C07 A;  2LM5 A;  5I2O A;  5F6T A;  1A75 A;  1X02 A;  2ZN8 A;  3VRR A;  1SL7 A;  5HYD A;  1K8U A;  1CLM A;  4HRH A;  2FCE A;  5D69 A;  1IQ5 A;  3A4U B;  4PCW A;  1SPY A;  3K21 A;  2LVI A;  4XJK B;  2I18 A;  4UPG A;  3TDU A;  4GGF C;  4YGA A;  1QX2 A;  1J55 A;  1J7Q A;  4DS7 A;  1B9A A;  3O2P A;  2CBL A;  3EK4 A;  1CNP A;  1SR6 B;  1ZUZ A;  2LAP A;  1JF0 A;  3HX4 A;  3PFV A;  5HKW A;  4ORB B;  1F55 A;  1KFX S;  2G2B A;  3DVJ A;  3DVM A;  1EG3 A;  1N0Y A;  2KOT A;  2PSR A;  4PDZ A;  1A03 A;  2EHB A;  4P2Y B;  1BF5 A;  5AEQ A;  1IQ3 A;  1FBV A;  1JC2 A;  1K9P A;  1FPW A;  2DOQ A;  3VRN A;  1KFX L;  2JNF A;  1JUO A;  1TN4 A;  2F3Y A;  2JT3 A;  1CFC A;  5JOL A;  5HLO A;  1S5G Z;  1SY9 A;  1PSB A;  3BUN B;  5CSF A;  2OS8 B;  1TCO B;  2D8N A;  3KF9 A;  1OSA A;  1QV0 A;  2JTT A;  4YGE B;  1A75 B;  1FF1 A;  4MZJ A;  1PRW A;  1IWQ A;  2PRU A;  2HQ8 A;  1CM1 A;  2OS8 C;  2JUL A;  3SJS A;  2JWW A;  1CFD A;  1RWY A;  1S6C A;  2GGZ A;  4WRI A;  2JU0 A;  4FTG A;  1K94 A;  1F4O A;  1AHR A;  1ODB A;  1F70 A;  1UHJ A;  1NCY A;  2HQW A;  2ZKM X;  3HCM A;  5CSJ A;  1EL4 A;  2MRD A;  5FYX A;  4GAO A;  3BUX B;  1J7O A;  2LE9 B;  2L50 A;  2QAC A;  4QJ5 B;  1OMV A;  2I94 A;  3SIA A;  2BCB A;  4ICB A;  3WNX B;  4XYN A;  2KFF A;  3CR5 X;  2M3W A;  3SG5 A;  5K89 A;  3O78 A;  2L51 A;  2LMU A;  3OB2 B;  3LCP C;  4YRU A;  1S5G Y;  1M45 A;  1OZS A;  1E8A A;  3PLF B;  4L9M A;  1OOJ A;  1QIW A;  1R6P A;  1K95 A;  1JFK A;  4JQ0 D;  4MZK A;  4YBH B;  1SL8 A;  1BU3 A;  1PK0 D;  4PE4 A;  4HSZ A;  2ZNE A;  1Y1A A;  3OX6 A;  4U8D A;  3AAK A;  3SG3 A;  1KSM A;  1WRZ A;  2L2E A;  2OPO A;  3I5F B;  2MAZ A;  2CCM A;  1NX0 A;  1B1G A;  1RFJ A;  1HT9 A;  1SMG A;  1YUT A;  3OB1 B;  3I5F C;  2ZFD A;  1K2H A;  1EXR A;  4PE7 A;  3D10 A;  4Q04 A;  1AVS A;  5DKR A;  4I5K A;  2Y1N A;  1QX5 B;  1Y1U A;  2KBI A;  3SG7 A;  2F33 A;  4OV2 A;  1QS7 A;  3GK2 A;  3PSR A;  1XK4 C;  3GOF A;  2KBM A;  1G4Y R;  3LK0 A;  3AKB A;  3RM1 A;  3WHU B;  2LLU A;  1PVA A;  3GK1 A;  1GQM A;  2M1U A;  4A4C A;  2BCA A;  2M7N A;  1B4C A;  3LL8 B;  2CTN A;  1JWD A;  2WCB A;  2JC2 A;  4NDD A;  1NP8 A;  1JBA A;  1S36 A;  4AOM A;  2LVK A;  4DIR A;  1KWO B;  2AUC A;  4YGC B;  3PAL A;  1LXF C;  4M2O A;  1KWO C;  2LHL A;  5PAL A;  1PSR A;  2L5X B;  1DJI A;  1LA3 A;  1EG4 A;  1K90 D;  4CFQ A;  5HKZ A;  1Q80 A;  1U5I A;  1UWO A;  2CXJ A;  3RLZ A;  3CS1 A;  4WQ3 A;  1B8C A;  1QTX A;  2WC8 A;  1ZOT B;  1DVI A;  2NLN A;  3VGO A;  4TNC A;  1DGV A;  2CNP A;  2KHN A;  5G08 A;  3BUW B;  3TS5 B;  1Y1X A;  2LC5 A;  2JZI A;  5ER5 A;  4PHK A;  2K7D A;  1AJ4 A;  1OMD A;  2K7O A;  1KQM B;  4MRX A;  4OR9 B;  5I2L A;  3TS5 C;  1ZFS A;  1TRF A;  4HRG A;  3TZ1 A;  5AER A;  5TNC A;  1QIV A;  1SYM A;  2MBX A;  1MXL C;  1SR6 C;  1IGV A;  2IS9 A;  1SW8 A;  1IJ5 A;  1YX8 A;  1BOC A;  1G8I A;  5KSZ A;  2M9G A;  3KO0 A;  4AQI A;  1K93 D;  1XYD A;  3EK8 A;  1YRU B;  3IQQ A;  4HRE E;  1S6I A;  2BBN A;  5BPJ A;  4MBE A;  2KDH A;  1WRK A;  2E6W A;  3LLE A;  1TNW A;  1CMF A;  1M31 A;  1C7W A;  1MXE A;  3PAT A;  1OMR A;  1TNP A;  3DD4 A;  2BEC A;  1DJX A;  4MRY A;  1GGW A;  1CLL A;  1IKU A;  1CB1 A;  1DTL A;  2NXQ A;  1TNQ A;  1XFZ O;  1U5I B;  1QAS A;  2LMV A;  1NUB A;  3AKA A;  3KEV A;  3C1V A;  3AAJ A;  1SRA A;  4MEW A;  3DVE A;  1XFW O;  1MF8 B;  2O5G A;  1PVB A;  1EJ3 A;  1KK7 Z;  1V1F A;  3PM8 A;  2JXC A;  5DKN A;  3ICB A;  4YI9 A;  1DJH A;  2KSP A;  1BT6 A;  1H8B A;  1UHN A;  2ZRT A;  5KU1 A;  1J1D A;  2MHH A;  2K7C A;  1DF0 A;  1XFX O;  1A2X A;  4WQ2 A;  1SNL A;  2ZN9 A;  1ZMZ A;  2PMY A;  1BR1 B;  4PHN A;  1KCY A;  1NX3 A;  4YGD B;  2H61 A;  2O60 A;  2KFH A;  5AAN A;  1WDC B;  1CDL A;  2L98 A;  4PHM A;  1AK8 A;  3BXK A;  4D1E A;  2M7L A;  2BL0 B;  3D0Y A;  4QJ3 B;  3E3R A;  1EH2 A;  1AJ5 A;  3EVR A;  3ZNI A;  2KI4 B;  1B8L A;  1WY9 A;  2EGD A;  1JF2 A;  4P5O E;  5J3X A;  1JFJ A;  2BL0 C;  1UUS A;  4BY5 A;  1BR4 B;  2A4J A;  3EK7 A;  1UHI A;  4JWQ A;  2K0J A;  2FJU B;  1DMO A;  2KI4 C;  2KAV A;  2K2A A;  2KYF A;  3I5H B;  1FI6 A;  3EVV A;  2OTG B;  1W7I B;  1KK7 Y;  3EVU A;  1YR5 A;  4OCI A;  1KQV A;  3NXA A;  3WXA A;  3I5H C;  2OTG C;  3NSL A;  2K61 A;  2WND A;  1QAT A;  5GQQ C;  1CFF A;  2LUC A;  3JTD B;  1DF0 B;  4CPV A;  2K7B A;  3I5I B;  4GUK A;  5B8I B;  4CID A;  1KK8 B;  2LLT A;  2B1U A;  2F8P A;  3JTD C;  3TDI A;  2JT0 A;  1PAL A;  4PAL A;  2MLF C;  1J1E A;  2KQY A;  2M8U A;  1KSO A;  1NX1 A;  3I5I C;  1QLS A;  1KK8 C;  2BKI B;  2M1K B;  3D0Y B;  3TDZ A;  2BBM A;  2JT8 A;  2LCP A;  1PUL A;  5IBW A;  1V1G A;  2H2K A;  2LP2 A;  2JNX A;  1NCZ A;  1UUR A;  1S1E A;  5KTY A;  4GGF A;  1YUU A;  1UP5 A;  4FQO A;  1BOD A;  3GK4 X;  3SIB A;  3FWC A;  1NX2 A;  2WOS A;  1JSA A;  3TUY B;  1WLZ A;  1WRL A;  4I5N B;  3H4S E;  2KFG A;  1SL9 A;  1MQ1 A;  3NSI A;  2M49 B;  2KNE A;  2KI6 D;  3DF0 B;  3FIA A;  3OHM B;  5HLV A;  3TUY C;  1BG1 A;  4ORC B;  1ZAC A;  1Y6W A;  1K9U A;  1B7T Z;  2K2F A;  1QVI Z;  2P6B B;  5DKQ A;  1TOP A;  2PVB A;  1SK6 D;  1YRT B;  1QLK A;  2NCP A;  1YUS A;  1B47 A;  5HKY A;  1QX7 A;  2KI6 C;  4BY4 A;  4C0L A;  1YX7 A;  1DJY A;  2WCF A;  2MA2 A;  2COL B;  1S6J A;  3CTN A;  4DCK A;  5D7F A;  1D1O A;  2MLE C;  1S3P A;  1K96 A;  1QJT A;  1L7Z A;  3OX5 A;  1WLM A;  1CM4 A;  4C0K A;  4DRW A;  1XO5 A;  4OVN F;  1IRJ A;  1BJF A;  4I5J A;  3CLN A;  2JRF A;  2KGR A;  1K9K A;  3KPX A;  1CLB A;  3CR4 X;  1KQM C;  1KFU L;  2BE4 A;  2VRG A;  2WCE A;  1CFP A;  3MSE B;  3ZWH A;  1NSH A;  4MLW A;  4MVF A;  1SCV A;  1CDP A;  1BLQ A;  1CDN A;  4CLN A;  4E68 A;  1IJ6 A;  3NSO A;  2Y5I A;  4CFR A;  1B8R A;  4N1G A;  2LNK A;  4DUQ A;  4NDC A;  2M97 A;  3SG4 A;  2BKH B;  2RGI A;  1NIW A;  1F54 A;  2KAY A;  2Q4U A;  1TCF A;  2ISD A;  1CDM A;  2AAO A;  1FW4 A;  1B7T Y;  2E30 A;  1QVI Y;  1NCX A;  2MJW B;  4PE0 A;  4ZCV A;  3EKH A;  2ZND A;  4NQG A;  2I2R E;  2KQ6 A;  2L0P A;  1RRO A;  3KHE A;  4F0Z B;  1GJY A;  2WOR A;  1RK9 A;  2BE6 A;  2HF5 A;  1DJZ A;  1BMO A;  1L2O B;  2JPT A;  1CMG A;  4ETO A;  4PHJ A;  2KYC A;  1YVH A;  2BCX A;  1L2O C;  2LV7 A;  3O6B A;  1F8H A;  1OZO A;  4PE1 A;  1REC A;  2JXL A;  3F45 A;  1MHO A;  2SAS A;  3A8R A;  1TIZ A;  2F2P A;  2F3Z A;  2L4H A;  1J7R A;  1GGZ A;  3BUO B;  2V53 A;  3CGA A;  4M2P A;  4MN0 A;  5AFP A;  1YUR A;  1IH0 A;  1DT7 B;  2GGM A;  3SG6 A;  5CSN A;  3FWB A;  3SG2 A;  1WDC C;  4ORA B;  2LAN A;  2JTZ A;  4YI8 A;  3VRO A;  2HET A;  3BQ3 A;  2F2O A;  1MWN A;  1Y0V H;  1XK4 A;  2LMT A;  3IF7 A;  1XA5 A;  4GFT A;  3JVT B;  4M2Q A;  3BUM B;  1XVJ A;  4IL1 A;  1SCM B;  3DF0 A;  2JQ6 A;  2EC6 B;  2M0R A;  1QXP A;  3EKJ A;  4USL A;  2I7A A;  3VRQ A;  1DJW A;  2JOJ A;  3CWG A;  1NPQ A;  3JVT C;  4GNK B;  1AP4 A;  2CT9 A;  1S26 D;  2PAL A;  1SCM C;  2K8M B;  3CZT X;  3M0W A;  1UHK A;  2EC6 C;  5AXI A;  1YVL A;  2AMI A;  3O4Y A;  1UHH A;  1N65 A;  3BOW A;  1G33 A;  1TTX A;  5JJG A;  1ALV A;  1OQP A;  4I5L B;  1TNX A;  4NDB A;  1A29 A;  1OE9 B;  1LVC D;  2Y4Q A;  1FI5 A;  2KGB C;  1F71 A;  2GV5 A;  1VRK A;  1YTZ C;  5I8N A;  3DVK A;  1M39 A;  5CPV A;  2KAX A;  1CKK A;  1XFY O;  2H61 C;  3FS7 A;  4MZL A;  1R2U A;  3PN7 B;  5ER4 X;  1IG5 A;  5CSI A;  1AUI B;  3BYA A;  2R2I A;  1MUX A;  2Q91 A;  3IQO A;  1LIN A;  1W7J B;  2NCO A;  1F4Q A;  1NWD A;  3OP0 A;  3PN7 C;  1N2D A;  2L4I A;  1NYA A;  4XJK A;  1SBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...