3RLZA

2.0 angstrom x-ray structure of bovine ca(2+)-s100b d63n
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSNGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title The effects of CapZ peptide (TRTK12) on the protein dynamics of S100B and S100B D63N
rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 31
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3rlzA00
2LANA 1DT7B 2P6BB 1MQ1A 1CDNA 1Y1AA 2BBMA 3LLEA 1ZUZA 2MJWB 1DVIA 3D0YA 1NPQA 4JQ0D 1XK4A 4PALA 1JF0A 4MVFA 2I94A 2LLUA 2SCPA 4CIDA 2NXQA 1EJ3A 1A4PA 1M45A 1M31A 2BECA 2PRUA 4DRWA 1SCMB 4C0JA 2HQWA 2WCEA 1IWQA 4GAOA 2KNEA 1CFFA 5HKYA 1KQMB 2KHNA 4UPGA 4GUKA 2JRFA 4N1FA 1Q80A 1GQMA 1J7QA 2JTZA 2F8PA 4I5KA 2M29A 4NDBA 1J55A 1QTXA 2LM5A 1NCXA 4CPVA 1NIWA 1KK8B 1VRKA 2KFFA 2M7NA 3PLFB 4CLNA 1FPWA 2KI6C 2WOSA 1L2OB 1AK8A 1J1EA 1OMVA 4GNKB 1K96A 1TNQA 1TCFA 4NDCA 1B8RA 1TCOB 1A29A 3D10A 1OOJA 3GOFA 5JJGA 3PN7B 2ZFDA 2CNPA 3NXAA 2WORA 2L2EA 4NDDA 1UUSA 4FQOA 1BU3A 4MRYA 3TZ1A 1SK6D 4M2OA 2WCFA 5HKZA 1KFUL 3JTDC 2JXCA 3OX6A 1AUIB 1NX1A 4OV2A 2M3WA 5CSNA 1G8IA 1OMDA 2KBMA 2OS8B 1TTXA 1YX7A 2F3YA 4ZCVA 4HRGA 4YRUA 3CS1A 1YX8A 3BUXB 1NX3A 3OB1B 1HT9A 1PVAA 1MHOA 1EXRA 2B1UA 1W7IB 2K7CA 2Y1NA 1QIWA 4I5LB 4E68A 1S6CA 2BL0C 2KFGA 3EK7A 3SG6A 1AJ5A 2MLFC 4D1EA 4YGCB 3I5IC 1IG5A 4M2QA 4ORCB 5AFPA 3O2PA 2LVKA 2F33A 2JWWA 3JVTB 1UHHA 2KDHA 1QLKA 1JSAA 3VRQA 2JT8A 1ALVA 2FOTA 1YUSA 3SG3A 2BCXA 1PVBA 3VROA 4MBEA 3A4UB 1CDLA 5I2LA 2LVIA 5AXIA 3DD4A 3EVUA 2CCMA 1DGUA 3EK4A 1JC2A 5KSZA 1K8UA 3DF0A 3H4SE 4ORAB 1LXFC 2PSRA 1SY9A 2EC6B 2MA2A 1UHKA 1WRZA 2HPSA 1WY9A 1CLLA 2ZRTA 4XJKA 4MN0A 3WXAA 1CKKA 1E8AA 5JOLA 1OZOA 3AKAA 3KF9A 1SW8A 1NX0A 2NLNA 2HQ8A 4GGFC 2OTGC 1LINA 4XJKB 3VRPA 1NCYA 3SG7A 1IH0A 3BYAA 1QASA 1JBAA 1K2HA 1UHJA 1RROA 3TDZA 1DTLA 1IQ3A 1Y0VH 1Y1UA 1DF0A 1X02A 2BCAA 2QPTA 3HX4A 4ETOA 1B7TZ 1SBJA 3AKBA 1BT6A 1CFDA 1A75A 1SPYA 5DKNA 1BR4B 2AUCA 2LVJA 2ZNDA 4ORBB 1SR6C 3I5GC 3TUYC 2ZNEA 5ER4X 3MSEB 2JOJA 1EL4A 1R2UA 2M1KB 1B4CA 1M39A 4XYNA 1KWOC 4I5NB 3IF7A 1H8BA 4IL1A 4MLWA 2M0RA 4GGNA 3AAKA 1R6PA 1KK7Z 4MEWA 3M0WA 5CPVA 1MWNA 3SG4A 3AAJA 4QJ3B 2MLEC 2KQ6A 2LLTA 4M2PA 4AOMA 2LC5A 1OZSA 3BUMB 3CLNA 5PALA 3C1VA 3TS5C 1CLBA 1U5IA 3O78A 2M7LA 4GGFA 4NQGA 2KBIA 2K7OA 3FIAA 2PMYA 1KFXS 2CXJA 1XFVO 3D0YB 1M46A 1ODBA 1KCYA 2KI6D 2D8NA 2KQYA 1QATA 2JT0A 1K90D 1YVHA 2NCPA 3ZWHA 1AP4A 1CMGA 1KSOA 1S6JA 1CB1A 5GQQC 4R1EA 1QIVA 1M63B 1BF5A 1S5GZ 1TNXA 1BLQA 2PASA 4GPLB 3DVKA 1B9AA 3KO0A 4Q04A 1IRJA 1F71A 4GBAA 2CTNA 1QV1A 4QJ4B 1HQVA 2L51A 1YRTB 1UHIA 1UHNA 3ZNIA 4HSZA 2KI4C 1BMOA 4AQIA 5F6TA 3OB2B 1V1GA 2JXLA 4N5XA 1FW4A 2I7AA 1BR1B 2V53A 4OKHA 1MXLC 1J7RA 3BOWA 3OX5A 1ZFSA 1CFPA 1S6IA 1KWOB 2ZKMX 5HLVA 1YR5A 2JQ6A 1WDCC 1NUBA 1J7OA 2LMTA 1YVLA 2LV7A 5D7FA 1IGVA 3EKJA 2R2IA 1AVSA 2K2FA 2K8MB 1PRWA 2JC2A 1DJGA 4PE4A 3SG5A 3TS5B 5I2OA 2LCPA 4OVNF 2KGBC 1V1FA 2LAPA 3I5HC 1DGVA 1B8CA 1YUTA 2PVBA 1MR8A 4P2YB 2Y5IA 3O4YA 3F45A 2KYFA 1BG1A 1RECA 4PE7A 1ZMZA 3SG2A 2BCBA 3I5FC 1F70A 3PATA 2EGDA 1YUUA 1DJZA 4MZLA 1SL9A 2NZ0A 2KAYA 5DKRA 3BXKA 3NSOA 2LHIA 3GK4X 1S1EA 1UWOA 2KAXA 1GGZA 1N2DA 2AAOA 1B7TY 2E6WA 1DJWA 1SCVA 1YRUB 2LP2A 1QX5B 2WNDA 2L50A 3CWGA 4YGAA 5AANA 1B47A 3EK8A 1ALWA 3O6BA 3WNXB 1C07A 2PALA 3FWCA 4L9MA 3JTDB 1PSBA 1UP5A 2KOTA 2Q91A 3DF0B 2Q4UA 3LK0A 1ZOTB 2ZRSA 1LA3A 1OSAA 1WDCB 1XFWO 4ICBA 5CSFA 1SL7A 2JULA 1K9KA 4PE1A 3GK2A 2DOQA 2O60A 3NSKA 5J3XA 4I5JA 2ISDA 2EHBA 1RWYA 2F3ZA 3DVMA 3KEVA 1DJIA 1FI6A 2COLB 1QLSA 2F2OA 2BL0B 2GV5A 1RJVA 1W7JB 1OE9B 2JT3A 1KQMC 3BQ3A 1XVJA 3I5IB 2FCEA 2K7BA 2LMUA 1WRKA 5BPJA 1FI5A 1J1DA 1FF1A 3SJSA 3VRRA 3HCMA 1CTRA 1KFUS 2L5XB 4YGDB 4TNCA 5HKWA 4BY5A 1RK9A 1KK8C 2WC8A 1DF0B 1XFUO 1F8HA 1L2OC 1N0YA 2L4IA 1A75B 1S5GY 2MAZA 5G08A 1BODA 3LL8B 4DCKA 1G4YR 2MHHA 2LE9B 3IQOA 2BE4A 1NCZA 3PN7C 1TIZA 1XA5A 1QVIZ 2JNXA 4ZCUA 2FJUB 4DIRA 5D69A 1A03A 4MZKA 3CR4X 3EVRA 2K7DA 4DS7A 2BKHB 4JWQA 4QJ5B 5K89A 3BUWB 2KFHA 2GGZA 1DMOA 1L7ZA 2OS8C 4U8DA 1SL8A 1U5IB 4YGBB 1QXPA 3FS7A 2HETA 1CLMA 2HF5A 2LVVA 1S36A 2OTGB 5I2QA 5KU1A 3SIBA 1K9PA 2SASA 3BUNB 1F4QA 1JF2A 4MZJA 3WHUB 4BY4A 4OR9B 3CZTX 1TOPA 4F0ZB 1D1OA 1JWDA 1B8LA 1B1GA 1DJHA 1FBVA 2LLSA 1AJ4A 1SMGA 4YI8A 1TN4A 1H4BA 3PFVA 3K21A 4CFRA 1JFJA 3JVTC 4MSPA 1SR6B 3I5GB 3TUYB 1QX7A 2JPTA 4N1GA 4MRXA 1QS7A 1OMRA 1PSRA 2E30A 1NYAA 4AQJA 1CNPA 2Y4QA 2L0PA 1IQ5A 2ZN8A 3RM1A 2AMIA 2I18A 3CGAA 4HRHA 1BOCA 1XO5A 2JZIA 3DVEA 2NCOA 4PCWA 4JPZB 1RFJA 1QV0A 4USLA 3NSIA 3BOWB 1C7WA 1EG4A 5DKQA 1MUXA 4WQ3A 1F55A 5ER5A 4C0KA 1LVCD 1CFCA 2L4HA 3FWBA 1KQVA 2LUXA 2Y1MA 1YURA 2EC6C 3PSRA 2MRDA 2M97A 1EG3A 2KYCA 3TDUA 5AERA 2CT9A 1IJ6A 2K0JA 2F2PA 2JNFA 2KSPA 1WLZA 3IQQA 3KPXA 5FYXA 4CFQA 2VRGA 2KAVA 2GGMA 5AEQA 3PALA 2K61A 1TNPA 2K2AA 4PDZA 4C0LA 1S26D 1NWDA 1A2XA 1K95A 2H61C 2I2RE 2G9BA 1TRFA 2BE6A 2LNKA 1QX2A 2QACA 2LUCA 1JUOA 3PM8A 5CSJA 1KFXL 3CR2A 3OHMB 4PHNA 2KI4B 2LHLA 3QRXA 1TNWA 1IJ5A 1NX2A 1S3PA 1N65A 2G2BA 1KSMA 1PK0D 1XFXO 4PHJA 1DJXA 3DVJA 1EH2A 4WRIA 1XFYO 2WCBA 1RTP1 3ICBA 3LCPC 1JFKA 1UURA 3A8RA 2BKIB 2BBNA 2JTTA 1WLMA 3BUOB 2M49B 4YGEB 5KTYA 1KK7Y 1AHRA 2IS9A 3KHEA 3RLZA 4WQ2A 1QVIY 2JU0A 2LMVA 1IKUA 3EKHA 2CBLA 1CMFA 1F4OA 1SCMC 4P5OE 2L98A 1MF8B 4HREE 1LA0A 3I5HB 5IBWA 1XYDA 4YI9A 3E3RA 1G33A 2FCDA 3EVVA 1CM1A 2ZN9A 2LP3A 1BJFA 2A4JA 2M8UA 1XK4C 1PALA 1CM4A 2RGIA 4DUQA 2H61A 4PHMA 1Y6WA 4A4BA 1K94A 1MXEA 5CSIA 3I5FB 3WHTB 1K9UA 2TN4A 2M9GA 1J7PA 3TDIA 1Y1XA 4GFTA 2H2KA 4OCIA 5HYDA 1CDPA 2O5GA 1ZACA 3NSLA 5TNCA 1CDMA 1NSHA 4PHKA 5I8NA 5HLOA 1K93D 1SYMA 2KGRA 2MBXA 1YTZC 1GGWA 4YBHB 1F54A 2OPOA 1SRAA 1NP8A 4PE0A 2M1UA 3VRNA 4FTGA 1PULA 1SNLA 4A4CA 1XFZO 1SKTA 1QJTA 3CR5X 1C7VA 3GK1A 1GJYA 3SIAA 5B8IB 1OQPA 1WRLA 1DJYA 3CTNA 3OP0A 3LK1A 3VGOA 1LKJA
chains in the Genus database with same CATH superfamily
2LANA 1DT7B 2P6BB 1MQ1A 1CDNA 1Y1AA 2BBMA 3LLEA 1ZUZA 2MJWB 1DVIA 3D0YA 1NPQA 4JQ0D 1XK4A 4PALA 1JF0A 4MVFA 2I94A 2LLUA 2SCPA 4CIDA 2NXQA 1EJ3A 1A4PA 1M45A 1M31A 2BECA 2PRUA 1Z4HA 1SCMB 4C0JA 4DRWA 2HQWA 2WCEA 1IWQA 4GAOA 2KNEA 1CFFA 5HKYA 1KQMB 2KHNA 4UPGA 4GUKA 2JRFA 4N1FA 1Q80A 1GQMA 1J7QA 2JTZA 2F8PA 4I5KA 2M29A 4NDBA 1J55A 3WXAA 2KLDA 1QTXA 2LM5A 4JKTA 1NCXA 4CPVA 1NIWA 1KK8B 1VRKA 2KFFA 2M7NA 3PLFB 4CLNA 1FPWA 2KI6C 2WCMA 1L2OB 2WOSA 3S0FA 1AK8A 1J1EA 1OMVA 4GNKB 1K96A 1TNQA 1TCFA 4NDCA 1B8RA 1TCOB 1A29A 3D10A 1OOJA 3GOFA 5JJGA 4IJ7A 3PN7B 2ZFDA 2CNPA 3NXAA 2WORA 2L2EA 4NDDA 1UUSA 4FQOA 3B86A 1BU3A 4MRYA 3TZ1A 1SK6D 4M2OA 2WCFA 3O4XA 5HKZA 5FI6A 3VB1A 1KFUL 3JTDC 2JXCA 3OX6A 1AUIB 1NX1A 4OV2A 2M3WA 5CSNA 1G8IA 1OMDA 2KBMA 2OS8B 1TTXA 1YX7A 2F3YA 4ZCVA 4HRGA 4YRUA 3CS1A 1YX8A 3BUXB 1NX3A 3S0DA 3OB1B 1HT9A 1PVAA 1MHOA 1EXRA 2B1UA 1W7IB 2K7CA 2Y1NA 2BAPA 1QIWA 4I5LB 4E68A 1S6CA 2BL0C 2KFGA 3EK7A 4PT1A 3SG6A 1AJ5A 2MLFC 4D1EA 4YGCB 3I5IC 1IG5A 4M2QA 3R1PA 4ORCB 5AFPA 3O2PA 2LVKA 2F33A 2JWWA 3JVTB 1UHHA 2KDHA 1QLKA 1JSAA 3VRQA 2JT8A 1ALVA 2FOTA 1YUSA 3SG3A 3UO9A 2BCXA 1PVBA 3VROA 4MBEA 3A4UB 3BFAA 1CDLA 5I2LA 2LVIA 5AXIA 3DD4A 3EVUA 2CCMA 1DGUA 3EK4A 1JC2A 5KSZA 2YGUA 1K8UA 3DF0A 3R72A 3H4SE 2WCJA 4ORAB 1LXFC 5DICA 2PSRA 1SY9A 2EC6B 2MA2A 1UHKA 1WRZA 2HPSA 1WY9A 1CLLA 2ZRTA 4XJKA 2WC5A 4MN0A 1CKKA 1E8AA 5JOLA 1OZOA 3AKAA 3KF9A 1SW8A 1NX0A 2NLNA 1OOIX 1OOFA 2HQ8A 4GGFC 2OTGC 1LINA 4XJKB 3VRPA 1NCYA 3SG7A 1IH0A 3BYAA 1QASA 1JBAA 1K2HA 1UHJA 1RROA 3TDZA 1DTLA 2WCHA 3FE9A 1IQ3A 1Y0VH 1Y1UA 1DF0A 1X02A 2BCAA 2QPTA 3HX4A 4ETOA 1B7TZ 1SBJA 3AKBA 3V2LA 1BT6A 1CFDA 1A75A 1SPYA 2P70A 5DKNA 1BR4B 2AUCA 2LVJA 2ZNDA 4ORBB 1LS8A 1SR6C 3I5GC 2ZNEA 3TUYC 1OW4A 5ER4X 3MSEB 2JOJA 1EL4A 1R2UA 2M1KB 1B4CA 1M39A 4XYNA 1KWOC 4I5NB 2KPHA 3IF7A 4INXA 4IL1A 3B7AA 1T14A 4MLWA 1H8BA 1OOGA 2M0RA 3EG5B 5FI7A 4GGNA 3AAKA 1R6PA 1KK7Z 4MEWA 3M0WA 5CPVA 1ORGA 1MWNA 3S0EA 3SG4A 3AAJA 4QJ3B 2MLEC 2KQ6A 2LLTA 4M2PA 4AOMA 2LC5A 1OZSA 3BUMB 3CLNA 5PALA 3C1VA 3TS5C 2QEOA 1CLBA 1U5IA 3O78A 2M7LA 4GGFA 4NQGA 2KBIA 2K7OA 3FIAA 2PMYA 1KFXS 2CXJA 1XFVO 3CZ1A 3NGVA 3D0YB 1M46A 1ODBA 3OBVA 1KCYA 2KI6D 2D8NA 2KQYA 1QATA 2JT0A 1K90D 4FQTA 1YVHA 2NCPA 3ZWHA 1AP4A 1CMGA 3D78A 1KSOA 1S6JA 1CB1A 5FI2A 4R1EA 5GQQC 1QIVA 1M63B 1BF5A 1S5GZ 1TNXA 2ERBA 2PASA 4GPLB 1BLQA 3DVKA 1B9AA 3KO0A 4Q04A 1IRJA 1F71A 4GBAA 2CTNA 1QV1A 4QJ4B 1HQVA 2L51A 1DC1A 3D76A 1YRTB 1UHIA 1IIOA 3FE8A 1UHNA 3ZNIA 4HSZA 2KI4C 1BMOA 4AQIA 5F6TA 3OB2B 1V1GA 2JXLA 4N5XA 5HL1A 1FW4A 2I7AA 1BR1B 2V53A 4OKHA 1MXLC 1J7RA 2WCKA 3BOWA 3OX5A 1ZFSA 1CFPA 1S6IA 1KWOB 2ZKMX 5HLVA 1YR5A 3B87A 2JQ6A 3CZ2A 2FJYA 1WDCC 3SS5A 1NUBA 1J7OA 2LMTA 1YVLA 2LV7A 5D7FA 1IGVA 3EKJA 2R2IA 1AVSA 2K2FA 2K8MB 3CZ0A 1C3YA 1PRWA 2JC2A 1DJGA 4PE4A 3SG5A 3UNWA 1TWOA 3TS5B 3BFHA 5I2OA 2LCPA 4OVNF 2KGBC 1V1FA 2LAPA 3I5HC 1DGVA 1B8CA 1YUTA 2PVBA 1MR8A 2QEHA 4P2YB 2Y5IA 3O4YA 3F45A 2KYFA 4INWA 1BG1A 1RECA 4PE7A 4OZDA 1ZMZA 3SG2A 1DELA 2BCBA 3I5FC 1F70A 3PATA 2EGDA 1YUUA 1DJZA 4MZLA 1SL9A 2NZ0A 5I94A 2KAYA 5DKRA 2KLEA 3BXKA 3NSOA 3OGNA 2LHIA 3GK4X 3D77A 2L5YA 1S1EA 1UWOA 2KAXA 1GGZA 1N2DA 2AAOA 1B7TY 2E6WA 1DJWA 1SCVA 1YRUB 2LP2A 1QX5B 2WNDA 2L50A 3CWGA 4YGAA 3CYZA 5AANA 1B47A 3EK8A 1ALWA 3O6BA 3Q8IA 3WNXB 2PALA 3FWCA 4L9MA 3JTDB 1C07A 2PYQA 1PSBA 1UP5A 3BJHA 2KOTA 2Q91A 3DF0B 2Q4UA 3LK0A 1ZOTB 2ZRSA 3L4AA 1LA3A 1OSAA 1WDCB 1XFWO 1Z2CB 4ICBA 3PM2A 3D73A 1SL7A 2JULA 1K9KA 5CSFA 4PE1A 3GK2A 2DOQA 2O60A 3NSKA 5J3XA 4I5JA 2ISDA 2EHBA 1RWYA 2F3ZA 3DVMA 3KEVA 1DJIA 1FI6A 1TUZA 2COLB 1OOHA 1QLSA 2F2OA 2BL0B 2GV5A 1RJVA 1W7JB 3L4LA 1OE9B 2JT3A 1KQMC 3BQ3A 1XVJA 3I5IB 2FCEA 2K7BA 2QEVA 2LMUA 1WRKA 5BPJA 1FI5A 2WCLA 1J1DA 1FF1A 3SJSA 3VRRA 3HCMA 1CTRA 1KFUS 2L5XB 3DXLA 4YGDB 4TNCA 5HKWA 4BY5A 1RK9A 1KK8C 2PQLA 1DF0B 1XFUO 2WC8A 3DY9A 1F8HA 1L2OC 2H8VA 3B6XA 3B88A 1N0YA 2L4IA 1A75B 1S5GY 2MAZA 2K60A 5G08A 1BODA 3LL8B 4DCKA 2P71A 1G4YR 2MHHA 2LE9B 3IQOA 2BE4A 1NCZA 3PN7C 1TIZA 1XA5A 1QVIZ 2JNXA 4ZCUA 1XFRA 2FJUB 5D69A 4DIRA 1A03A 4MZKA 3K1EA 4JD9A 3CR4X 2BNXA 3EVRA 2K7DA 3NHIA 3N7HA 4DS7A 2BKHB 4JWQA 4QJ5B 5K89A 3BUWB 2KFHA 2GGZA 1DMOA 1L7ZA 2OS8C 4U8DA 1SL8A 1U5IB 3DZTA 1QXPA 4YGBB 3FS7A 2HETA 1CLMA 2HF5A 2LVVA 1S36A 2OTGB 5I2QA 2QDIA 5KU1A 3SIBA 1K9PA 2SASA 1QWVA 3BUNB 1F4QA 1JF2A 3DYEA 4MZJA 3WHUB 4BY4A 4OR9B 3CZTX 1TOPA 4F0ZB 1D1OA 1JWDA 1SSEB 5D3OA 1B8LA 1B1GA 1DJHA 1FBVA 2LLSA 1AJ4A 1SMGA 4YI8A 4F7FA 1GM0A 1TN4A 1H4BA 3PFVA 3K21A 4CFRA 1JFJA 3JVTC 4MSPA 1SR6B 3I5GB 3TUYB 1QX7A 2JPTA 4N1GA 4MRXA 1QS7A 1OMRA 1PSRA 2E30A 1NYAA 4AQJA 1CNPA 2Y4QA 2L0PA 1IQ5A 2ZN8A 3L47A 3RM1A 2AMIA 2I18A 3CGAA 4HRHA 1BOCA 1XO5A 2JZIA 3DVEA 2NCOA 4PCWA 4JPZB 1RFJA 3S0BA 1QV0A 4USLA 2QEBA 3NSIA 3BOWB 1C7WA 1EG4A 5DKQA 1MUXA 4KYNA 4WQ3A 5ER5A 4C0KA 1LVCD 1CFCA 1F55A 2L4HA 3FWBA 1KQVA 2LUXA 2Y1MA 1YURA 2EC6C 3PSRA 2MRDA 2M97A 1EG3A 2KYCA 3TDUA 5AERA 2CT9A 1IJ6A 2L2CA 2K0JA 2F2PA 2JNFA 2KSPA 1WLZA 3IQQA 3KPXA 5FYXA 3R1OA 2VRGA 2KAVA 4CFQA 2GGMA 3R1VA 5AEQA 3PALA 2K61A 3PJIA 3BFBA 3NHTA 1TNPA 3S0GA 2K2AA 4PDZA 4C0LA 1S26D 1NWDA 1A2XA 1K95A 3SS4A 2H61C 2I2RE 2WC6A 2G9BA 1TRFA 2BE6A 2LNKA 1QX2A 2QACA 2LUCA 1JUOA 3PM8A 5CSJA 1KFXL 3CR2A 3OHMB 4PHNA 2KI4B 2LHLA 3QRXA 1TNWA 1IJ5A 1NX2A 1S3PA 1N65A 2G2BA 3RZSA 1KSMA 1PK0D 1XFXO 4PHJA 3FE6A 1DJXA 3DVJA 1EH2A 4WRIA 1XFYO 2WCBA 1RTP1 3ICBA 3LCPC 1JFKA 1UURA 3A8RA 3CABA 2BKIB 2BBNA 2JTTA 1WLMA 3BUOB 3D74A 2M49B 5EL2A 3S0AA 4YGEB 5KTYA 1DQEA 1KK7Y 1AHRA 2IS9A 3KHEA 3RLZA 4WQ2A 1QVIY 2JU0A 2LMVA 1IKUA 3EKHA 2CBLA 1CMFA 1F4OA 1SCMC 4P5OE 1C3ZA 2L98A 1MF8B 3D75A 1LA0A 3I5HB 4HREE 5IBWA 1XYDA 1W9ZA 3E3RA 1G33A 4YI9A 2FCDA 2JPOA 3EVVA 1CM1A 2ZN9A 2LP3A 1BJFA 2A4JA 2M8UA 1XK4C 1PALA 1CM4A 2RGIA 4DUQA 2H61A 4PHMA 1Y6WA 4A4BA 1K94A 1MXEA 1P28A 3I5FB 5CSIA 1K9UA 3WHTB 2TN4A 2M9GA 1J7PA 3SS3A 3TDIA 1Y1XA 4GFTA 2GTEA 2H2KA 4OCIA 5HYDA 1CDPA 2O5GA 1ZACA 1TUJA 3NSLA 5TNCA 1CDMA 1NSHA 4PHKA 5I8NA 5HLOA 1K93D 1SYMA 2KGRA 2MBXA 1YTZC 1GGWA 4YBHB 1F54A 2OPOA 1SRAA 1NP8A 4PE0A 2M1UA 3IVTA 3VRNA 4FTGA 1PULA 1SNLA 4A4CA 1XFZO 1SKTA 1QJTA 3CR5X 1C7VA 3GK1A 1GJYA 3SIAA 5B8IB 1OQPA 1WRLA 3CDNA 1DJYA 3CTNA 3OP0A 3LK1A 3VGOA 1DEKA 1LKJA 3QMEA
chains in the Genus database with same CATH topology
2LANA 1DT7B 2P6BB 1MQ1A 1CDNA 1Y1AA 2BBMA 3LLEA 1ZUZA 2MJWB 1DVIA 3D0YA 1NPQA 4JQ0D 1XK4A 4PALA 1JF0A 4MVFA 2I94A 2LLUA 2SCPA 4CIDA 2NXQA 1EJ3A 1A4PA 1M45A 1M31A 2BECA 2PRUA 4DRWA 1SCMB 4C0JA 2HQWA 2WCEA 1IWQA 4GAOA 2KNEA 1CFFA 5HKYA 1KQMB 2KHNA 4UPGA 4GUKA 2JRFA 4N1FA 1Q80A 1GQMA 1J7QA 2JTZA 2F8PA 4I5KA 2M29A 4NDBA 1J55A 1QTXA 2LM5A 1NCXA 4CPVA 1NIWA 1KK8B 1VRKA 2KFFA 2M7NA 3PLFB 4CLNA 1FPWA 2KI6C 2WOSA 1L2OB 1AK8A 1J1EA 1OMVA 4GNKB 1K96A 1TNQA 1TCFA 4NDCA 1B8RA 1TCOB 1A29A 3D10A 1OOJA 3GOFA 5JJGA 3PN7B 2ZFDA 2CNPA 3NXAA 2WORA 2L2EA 4NDDA 1UUSA 4FQOA 1BU3A 4MRYA 3TZ1A 1SK6D 4M2OA 2WCFA 5HKZA 1KFUL 3JTDC 2JXCA 3OX6A 1AUIB 1NX1A 4OV2A 2M3WA 5CSNA 1G8IA 1OMDA 2KBMA 2OS8B 1TTXA 1YX7A 2F3YA 4ZCVA 4HRGA 4YRUA 3CS1A 1YX8A 3BUXB 1NX3A 3OB1B 1HT9A 1PVAA 1MHOA 1EXRA 2B1UA 1W7IB 2K7CA 2Y1NA 1QIWA 4I5LB 4E68A 1S6CA 2BL0C 2KFGA 3EK7A 3SG6A 1AJ5A 2MLFC 4D1EA 4YGCB 3I5IC 1IG5A 4M2QA 4ORCB 5AFPA 3O2PA 2LVKA 2F33A 2JWWA 3JVTB 1UHHA 2KDHA 1QLKA 1JSAA 3VRQA 2JT8A 1ALVA 2FOTA 1YUSA 3SG3A 2BCXA 1PVBA 3VROA 4MBEA 3A4UB 1CDLA 5I2LA 2LVIA 5AXIA 3DD4A 3EVUA 2CCMA 1DGUA 3EK4A 1JC2A 5KSZA 1K8UA 3DF0A 3H4SE 4ORAB 1LXFC 2PSRA 1SY9A 2EC6B 2MA2A 1UHKA 1WRZA 2HPSA 1WY9A 1CLLA 2ZRTA 4XJKA 4MN0A 3WXAA 1CKKA 1E8AA 5JOLA 1OZOA 3AKAA 3KF9A 1SW8A 1NX0A 2NLNA 2HQ8A 4GGFC 2OTGC 1LINA 4XJKB 3VRPA 1NCYA 3SG7A 1IH0A 3BYAA 1QASA 1JBAA 1K2HA 1UHJA 1RROA 3TDZA 1DTLA 1IQ3A 1Y0VH 1Y1UA 1DF0A 1X02A 2BCAA 2QPTA 3HX4A 4ETOA 1B7TZ 1SBJA 3AKBA 1BT6A 1CFDA 1A75A 1SPYA 5DKNA 1BR4B 2AUCA 2LVJA 2ZNDA 4ORBB 1SR6C 3I5GC 3TUYC 2ZNEA 5ER4X 3MSEB 2JOJA 1EL4A 1R2UA 2M1KB 1B4CA 1M39A 4XYNA 1KWOC 4I5NB 3IF7A 1H8BA 4IL1A 4MLWA 2M0RA 4GGNA 3AAKA 1R6PA 1KK7Z 4MEWA 3M0WA 5CPVA 1MWNA 3SG4A 3AAJA 4QJ3B 2MLEC 2KQ6A 2LLTA 4M2PA 4AOMA 2LC5A 1OZSA 3BUMB 3CLNA 5PALA 3C1VA 3TS5C 1CLBA 1U5IA 3O78A 2M7LA 4GGFA 4NQGA 2KBIA 2K7OA 3FIAA 2PMYA 1KFXS 2CXJA 1XFVO 3D0YB 1M46A 1ODBA 1KCYA 2KI6D 2D8NA 2KQYA 1QATA 2JT0A 1K90D 1YVHA 2NCPA 3ZWHA 1AP4A 1CMGA 1KSOA 1S6JA 1CB1A 5GQQC 4R1EA 1QIVA 1M63B 1BF5A 1S5GZ 1TNXA 1BLQA 2PASA 4GPLB 3DVKA 1B9AA 3KO0A 4Q04A 1IRJA 1F71A 4GBAA 2CTNA 1QV1A 4QJ4B 1HQVA 2L51A 1YRTB 1UHIA 1UHNA 3ZNIA 4HSZA 2KI4C 1BMOA 4AQIA 5F6TA 3OB2B 1V1GA 2JXLA 4N5XA 1FW4A 2I7AA 1BR1B 2V53A 4OKHA 1MXLC 1J7RA 3BOWA 3OX5A 1ZFSA 1CFPA 1S6IA 1KWOB 2ZKMX 5HLVA 1YR5A 2JQ6A 1WDCC 1NUBA 1J7OA 2LMTA 1YVLA 2LV7A 5D7FA 1IGVA 3EKJA 2R2IA 1AVSA 2K2FA 2K8MB 1PRWA 2JC2A 1DJGA 4PE4A 3SG5A 3TS5B 5I2OA 2LCPA 4OVNF 2KGBC 1V1FA 2LAPA 3I5HC 1DGVA 1B8CA 1YUTA 2PVBA 1MR8A 4P2YB 2Y5IA 3O4YA 3F45A 2KYFA 1BG1A 1RECA 4PE7A 1ZMZA 3SG2A 2BCBA 3I5FC 1F70A 3PATA 2EGDA 1YUUA 1DJZA 4MZLA 1SL9A 2NZ0A 2KAYA 5DKRA 3BXKA 3NSOA 2LHIA 3GK4X 1S1EA 1UWOA 2KAXA 1GGZA 1N2DA 2AAOA 1B7TY 2E6WA 1DJWA 1SCVA 1YRUB 2LP2A 1QX5B 2WNDA 2L50A 3CWGA 4YGAA 5AANA 1B47A 3EK8A 1ALWA 3O6BA 3WNXB 1C07A 2PALA 3FWCA 4L9MA 3JTDB 1PSBA 1UP5A 2KOTA 2Q91A 3DF0B 2Q4UA 3LK0A 1ZOTB 2ZRSA 1LA3A 1OSAA 1WDCB 1XFWO 4ICBA 5CSFA 1SL7A 2JULA 1K9KA 4PE1A 3GK2A 2DOQA 2O60A 3NSKA 5J3XA 4I5JA 2ISDA 2EHBA 1RWYA 2F3ZA 3DVMA 3KEVA 1DJIA 1FI6A 2COLB 1QLSA 2F2OA 2BL0B 2GV5A 1RJVA 1W7JB 1OE9B 2JT3A 1KQMC 3BQ3A 1XVJA 3I5IB 2FCEA 2K7BA 2LMUA 1WRKA 5BPJA 1FI5A 1J1DA 1FF1A 3SJSA 3VRRA 3HCMA 1CTRA 1KFUS 2L5XB 4YGDB 4TNCA 5HKWA 4BY5A 1RK9A 1KK8C 2WC8A 1DF0B 1XFUO 1F8HA 1L2OC 1N0YA 2L4IA 1A75B 1S5GY 2MAZA 5G08A 1BODA 3LL8B 4DCKA 1G4YR 2MHHA 2LE9B 3IQOA 2BE4A 1NCZA 3PN7C 1TIZA 1XA5A 1QVIZ 2JNXA 4ZCUA 2FJUB 4DIRA 5D69A 1A03A 4MZKA 3CR4X 3EVRA 2K7DA 4DS7A 2BKHB 4JWQA 4QJ5B 5K89A 3BUWB 2KFHA 2GGZA 1DMOA 1L7ZA 2OS8C 4U8DA 1SL8A 1U5IB 4YGBB 1QXPA 3FS7A 2HETA 1CLMA 2HF5A 2LVVA 1S36A 2OTGB 5I2QA 5KU1A 3SIBA 1K9PA 2SASA 3BUNB 1F4QA 1JF2A 4MZJA 3WHUB 4BY4A 4OR9B 3CZTX 1TOPA 4F0ZB 1D1OA 1JWDA 1B8LA 1B1GA 1DJHA 1FBVA 2LLSA 1AJ4A 1SMGA 4YI8A 1TN4A 1H4BA 3PFVA 3K21A 4CFRA 1JFJA 3JVTC 4MSPA 1SR6B 3I5GB 3TUYB 1QX7A 2JPTA 4N1GA 4MRXA 1QS7A 1OMRA 1PSRA 2E30A 1NYAA 4AQJA 1CNPA 2Y4QA 2L0PA 1IQ5A 2ZN8A 3RM1A 2AMIA 2I18A 3CGAA 4HRHA 1BOCA 1XO5A 2JZIA 3DVEA 2NCOA 4PCWA 4JPZB 1RFJA 1QV0A 4USLA 3NSIA 3BOWB 1C7WA 1EG4A 5DKQA 1MUXA 4WQ3A 1F55A 5ER5A 4C0KA 1LVCD 1CFCA 2L4HA 3FWBA 1KQVA 2LUXA 2Y1MA 1YURA 2EC6C 3PSRA 2MRDA 2M97A 1EG3A 2KYCA 3TDUA 5AERA 2CT9A 1IJ6A 2K0JA 2F2PA 2JNFA 2KSPA 1WLZA 3IQQA 3KPXA 5FYXA 4CFQA 2VRGA 2KAVA 2GGMA 5AEQA 3PALA 2K61A 1TNPA 2K2AA 4PDZA 4C0LA 1S26D 1NWDA 1A2XA 1K95A 2H61C 2I2RE 2G9BA 1TRFA 2BE6A 2LNKA 1QX2A 2QACA 2LUCA 1JUOA 3PM8A 5CSJA 1KFXL 3CR2A 3OHMB 4PHNA 2KI4B 2LHLA 3QRXA 1TNWA 1IJ5A 1NX2A 1S3PA 1N65A 2G2BA 1KSMA 1PK0D 1XFXO 4PHJA 1DJXA 3DVJA 1EH2A 4WRIA 1XFYO 2WCBA 1RTP1 3ICBA 3LCPC 1JFKA 1UURA 3A8RA 2BKIB 2BBNA 2JTTA 1WLMA 3BUOB 2M49B 4YGEB 5KTYA 1KK7Y 1AHRA 2IS9A 3KHEA 3RLZA 4WQ2A 1QVIY 2JU0A 2LMVA 1IKUA 3EKHA 2CBLA 1CMFA 1F4OA 1SCMC 4P5OE 2L98A 1MF8B 4HREE 1LA0A 3I5HB 5IBWA 1XYDA 4YI9A 3E3RA 1G33A 2FCDA 3EVVA 1CM1A 2ZN9A 2LP3A 1BJFA 2A4JA 2M8UA 1XK4C 1PALA 1CM4A 2RGIA 4DUQA 2H61A 4PHMA 1Y6WA 4A4BA 1K94A 1MXEA 5CSIA 3I5FB 3WHTB 1K9UA 2TN4A 2M9GA 1J7PA 3TDIA 1Y1XA 4GFTA 2H2KA 4OCIA 5HYDA 1CDPA 2O5GA 1ZACA 3NSLA 5TNCA 1CDMA 1NSHA 4PHKA 5I8NA 5HLOA 1K93D 1SYMA 2KGRA 2MBXA 1YTZC 1GGWA 4YBHB 1F54A 2OPOA 1SRAA 1NP8A 4PE0A 2M1UA 3VRNA 4FTGA 1PULA 1SNLA 4A4CA 1XFZO 1SKTA 1QJTA 3CR5X 1C7VA 3GK1A 1GJYA 3SIAA 5B8IB 1OQPA 1WRLA 1DJYA 3CTNA 3OP0A 3LK1A 3VGOA 1LKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAN A;  1DT7 B;  2P6B B;  1MQ1 A;  1CDN A;  1Y1A A;  2BBM A;  3LLE A;  1ZUZ A;  2MJW B;  1DVI A;  3D0Y A;  1NPQ A;  4JQ0 D;  1XK4 A;  4PAL A;  1JF0 A;  4MVF A;  2I94 A;  2LLU A;  2SCP A;  4CID A;  2NXQ A;  1EJ3 A;  1A4P A;  1M45 A;  1M31 A;  2BEC A;  2PRU A;  4DRW A;  1SCM B;  4C0J A;  2HQW A;  2WCE A;  1IWQ A;  4GAO A;  2KNE A;  1CFF A;  5HKY A;  1KQM B;  2KHN A;  4UPG A;  4GUK A;  2JRF A;  4N1F A;  1Q80 A;  1GQM A;  1J7Q A;  2JTZ A;  2F8P A;  4I5K A;  2M29 A;  4NDB A;  1J55 A;  1QTX A;  2LM5 A;  1NCX A;  4CPV A;  1NIW A;  1KK8 B;  1VRK A;  2KFF A;  2M7N A;  3PLF B;  4CLN A;  1FPW A;  2KI6 C;  2WOS A;  1L2O B;  1AK8 A;  1J1E A;  1OMV A;  4GNK B;  1K96 A;  1TNQ A;  1TCF A;  4NDC A;  1B8R A;  1TCO B;  1A29 A;  3D10 A;  1OOJ A;  3GOF A;  5JJG A;  3PN7 B;  2ZFD A;  2CNP A;  3NXA A;  2WOR A;  2L2E A;  4NDD A;  1UUS A;  4FQO A;  1BU3 A;  4MRY A;  3TZ1 A;  1SK6 D;  4M2O A;  2WCF A;  5HKZ A;  1KFU L;  3JTD C;  2JXC A;  3OX6 A;  1AUI B;  1NX1 A;  4OV2 A;  2M3W A;  5CSN A;  1G8I A;  1OMD A;  2KBM A;  2OS8 B;  1TTX A;  1YX7 A;  2F3Y A;  4ZCV A;  4HRG A;  4YRU A;  3CS1 A;  1YX8 A;  3BUX B;  1NX3 A;  3OB1 B;  1HT9 A;  1PVA A;  1MHO A;  1EXR A;  2B1U A;  1W7I B;  2K7C A;  2Y1N A;  1QIW A;  4I5L B;  4E68 A;  1S6C A;  2BL0 C;  2KFG A;  3EK7 A;  3SG6 A;  1AJ5 A;  2MLF C;  4D1E A;  4YGC B;  3I5I C;  1IG5 A;  4M2Q A;  4ORC B;  5AFP A;  3O2P A;  2LVK A;  2F33 A;  2JWW A;  3JVT B;  1UHH A;  2KDH A;  1QLK A;  1JSA A;  3VRQ A;  2JT8 A;  1ALV A;  2FOT A;  1YUS A;  3SG3 A;  2BCX A;  1PVB A;  3VRO A;  4MBE A;  3A4U B;  1CDL A;  5I2L A;  2LVI A;  5AXI A;  3DD4 A;  3EVU A;  2CCM A;  1DGU A;  3EK4 A;  1JC2 A;  5KSZ A;  1K8U A;  3DF0 A;  3H4S E;  4ORA B;  1LXF C;  2PSR A;  1SY9 A;  2EC6 B;  2MA2 A;  1UHK A;  1WRZ A;  2HPS A;  1WY9 A;  1CLL A;  2ZRT A;  4XJK A;  4MN0 A;  3WXA A;  1CKK A;  1E8A A;  5JOL A;  1OZO A;  3AKA A;  3KF9 A;  1SW8 A;  1NX0 A;  2NLN A;  2HQ8 A;  4GGF C;  2OTG C;  1LIN A;  4XJK B;  3VRP A;  1NCY A;  3SG7 A;  1IH0 A;  3BYA A;  1QAS A;  1JBA A;  1K2H A;  1UHJ A;  1RRO A;  3TDZ A;  1DTL A;  1IQ3 A;  1Y0V H;  1Y1U A;  1DF0 A;  1X02 A;  2BCA A;  2QPT A;  3HX4 A;  4ETO A;  1B7T Z;  1SBJ A;  3AKB A;  1BT6 A;  1CFD A;  1A75 A;  1SPY A;  5DKN A;  1BR4 B;  2AUC A;  2LVJ A;  2ZND A;  4ORB B;  1SR6 C;  3I5G C;  3TUY C;  2ZNE A;  5ER4 X;  3MSE B;  2JOJ A;  1EL4 A;  1R2U A;  2M1K B;  1B4C A;  1M39 A;  4XYN A;  1KWO C;  4I5N B;  3IF7 A;  1H8B A;  4IL1 A;  4MLW A;  2M0R A;  4GGN A;  3AAK A;  1R6P A;  1KK7 Z;  4MEW A;  3M0W A;  5CPV A;  1MWN A;  3SG4 A;  3AAJ A;  4QJ3 B;  2MLE C;  2KQ6 A;  2LLT A;  4M2P A;  4AOM A;  2LC5 A;  1OZS A;  3BUM B;  3CLN A;  5PAL A;  3C1V A;  3TS5 C;  1CLB A;  1U5I A;  3O78 A;  2M7L A;  4GGF A;  4NQG A;  2KBI A;  2K7O A;  3FIA A;  2PMY A;  1KFX S;  2CXJ A;  1XFV O;  3D0Y B;  1M46 A;  1ODB A;  1KCY A;  2KI6 D;  2D8N A;  2KQY A;  1QAT A;  2JT0 A;  1K90 D;  1YVH A;  2NCP A;  3ZWH A;  1AP4 A;  1CMG A;  1KSO A;  1S6J A;  1CB1 A;  5GQQ C;  4R1E A;  1QIV A;  1M63 B;  1BF5 A;  1S5G Z;  1TNX A;  1BLQ A;  2PAS A;  4GPL B;  3DVK A;  1B9A A;  3KO0 A;  4Q04 A;  1IRJ A;  1F71 A;  4GBA A;  2CTN A;  1QV1 A;  4QJ4 B;  1HQV A;  2L51 A;  1YRT B;  1UHI A;  1UHN A;  3ZNI A;  4HSZ A;  2KI4 C;  1BMO A;  4AQI A;  5F6T A;  3OB2 B;  1V1G A;  2JXL A;  4N5X A;  1FW4 A;  2I7A A;  1BR1 B;  2V53 A;  4OKH A;  1MXL C;  1J7R A;  3BOW A;  3OX5 A;  1ZFS A;  1CFP A;  1S6I A;  1KWO B;  2ZKM X;  5HLV A;  1YR5 A;  2JQ6 A;  1WDC C;  1NUB A;  1J7O A;  2LMT A;  1YVL A;  2LV7 A;  5D7F A;  1IGV A;  3EKJ A;  2R2I A;  1AVS A;  2K2F A;  2K8M B;  1PRW A;  2JC2 A;  1DJG A;  4PE4 A;  3SG5 A;  3TS5 B;  5I2O A;  2LCP A;  4OVN F;  2KGB C;  1V1F A;  2LAP A;  3I5H C;  1DGV A;  1B8C A;  1YUT A;  2PVB A;  1MR8 A;  4P2Y B;  2Y5I A;  3O4Y A;  3F45 A;  2KYF A;  1BG1 A;  1REC A;  4PE7 A;  1ZMZ A;  3SG2 A;  2BCB A;  3I5F C;  1F70 A;  3PAT A;  2EGD A;  1YUU A;  1DJZ A;  4MZL A;  1SL9 A;  2NZ0 A;  2KAY A;  5DKR A;  3BXK A;  3NSO A;  2LHI A;  3GK4 X;  1S1E A;  1UWO A;  2KAX A;  1GGZ A;  1N2D A;  2AAO A;  1B7T Y;  2E6W A;  1DJW A;  1SCV A;  1YRU B;  2LP2 A;  1QX5 B;  2WND A;  2L50 A;  3CWG A;  4YGA A;  5AAN A;  1B47 A;  3EK8 A;  1ALW A;  3O6B A;  3WNX B;  1C07 A;  2PAL A;  3FWC A;  4L9M A;  3JTD B;  1PSB A;  1UP5 A;  2KOT A;  2Q91 A;  3DF0 B;  2Q4U A;  3LK0 A;  1ZOT B;  2ZRS A;  1LA3 A;  1OSA A;  1WDC B;  1XFW O;  4ICB A;  5CSF A;  1SL7 A;  2JUL A;  1K9K A;  4PE1 A;  3GK2 A;  2DOQ A;  2O60 A;  3NSK A;  5J3X A;  4I5J A;  2ISD A;  2EHB A;  1RWY A;  2F3Z A;  3DVM A;  3KEV A;  1DJI A;  1FI6 A;  2COL B;  1QLS A;  2F2O A;  2BL0 B;  2GV5 A;  1RJV A;  1W7J B;  1OE9 B;  2JT3 A;  1KQM C;  3BQ3 A;  1XVJ A;  3I5I B;  2FCE A;  2K7B A;  2LMU A;  1WRK A;  5BPJ A;  1FI5 A;  1J1D A;  1FF1 A;  3SJS A;  3VRR A;  3HCM A;  1CTR A;  1KFU S;  2L5X B;  4YGD B;  4TNC A;  5HKW A;  4BY5 A;  1RK9 A;  1KK8 C;  2WC8 A;  1DF0 B;  1XFU O;  1F8H A;  1L2O C;  1N0Y A;  2L4I A;  1A75 B;  1S5G Y;  2MAZ A;  5G08 A;  1BOD A;  3LL8 B;  4DCK A;  1G4Y R;  2MHH A;  2LE9 B;  3IQO A;  2BE4 A;  1NCZ A;  3PN7 C;  1TIZ A;  1XA5 A;  1QVI Z;  2JNX A;  4ZCU A;  2FJU B;  4DIR A;  5D69 A;  1A03 A;  4MZK A;  3CR4 X;  3EVR A;  2K7D A;  4DS7 A;  2BKH B;  4JWQ A;  4QJ5 B;  5K89 A;  3BUW B;  2KFH A;  2GGZ A;  1DMO A;  1L7Z A;  2OS8 C;  4U8D A;  1SL8 A;  1U5I B;  4YGB B;  1QXP A;  3FS7 A;  2HET A;  1CLM A;  2HF5 A;  2LVV A;  1S36 A;  2OTG B;  5I2Q A;  5KU1 A;  3SIB A;  1K9P A;  2SAS A;  3BUN B;  1F4Q A;  1JF2 A;  4MZJ A;  3WHU B;  4BY4 A;  4OR9 B;  3CZT X;  1TOP A;  4F0Z B;  1D1O A;  1JWD A;  1B8L A;  1B1G A;  1DJH A;  1FBV A;  2LLS A;  1AJ4 A;  1SMG A;  4YI8 A;  1TN4 A;  1H4B A;  3PFV A;  3K21 A;  4CFR A;  1JFJ A;  3JVT C;  4MSP A;  1SR6 B;  3I5G B;  3TUY B;  1QX7 A;  2JPT A;  4N1G A;  4MRX A;  1QS7 A;  1OMR A;  1PSR A;  2E30 A;  1NYA A;  4AQJ A;  1CNP A;  2Y4Q A;  2L0P A;  1IQ5 A;  2ZN8 A;  3RM1 A;  2AMI A;  2I18 A;  3CGA A;  4HRH A;  1BOC A;  1XO5 A;  2JZI A;  3DVE A;  2NCO A;  4PCW A;  4JPZ B;  1RFJ A;  1QV0 A;  4USL A;  3NSI A;  3BOW B;  1C7W A;  1EG4 A;  5DKQ A;  1MUX A;  4WQ3 A;  1F55 A;  5ER5 A;  4C0K A;  1LVC D;  1CFC A;  2L4H A;  3FWB A;  1KQV A;  2LUX A;  2Y1M A;  1YUR A;  2EC6 C;  3PSR A;  2MRD A;  2M97 A;  1EG3 A;  2KYC A;  3TDU A;  5AER A;  2CT9 A;  1IJ6 A;  2K0J A;  2F2P A;  2JNF A;  2KSP A;  1WLZ A;  3IQQ A;  3KPX A;  5FYX A;  4CFQ A;  2VRG A;  2KAV A;  2GGM A;  5AEQ A;  3PAL A;  2K61 A;  1TNP A;  2K2A A;  4PDZ A;  4C0L A;  1S26 D;  1NWD A;  1A2X A;  1K95 A;  2H61 C;  2I2R E;  2G9B A;  1TRF A;  2BE6 A;  2LNK A;  1QX2 A;  2QAC A;  2LUC A;  1JUO A;  3PM8 A;  5CSJ A;  1KFX L;  3CR2 A;  3OHM B;  4PHN A;  2KI4 B;  2LHL A;  3QRX A;  1TNW A;  1IJ5 A;  1NX2 A;  1S3P A;  1N65 A;  2G2B A;  1KSM A;  1PK0 D;  1XFX O;  4PHJ A;  1DJX A;  3DVJ A;  1EH2 A;  4WRI A;  1XFY O;  2WCB A;  1RTP 1;  3ICB A;  3LCP C;  1JFK A;  1UUR A;  3A8R A;  2BKI B;  2BBN A;  2JTT A;  1WLM A;  3BUO B;  2M49 B;  4YGE B;  5KTY A;  1KK7 Y;  1AHR A;  2IS9 A;  3KHE A;  3RLZ A;  4WQ2 A;  1QVI Y;  2JU0 A;  2LMV A;  1IKU A;  3EKH A;  2CBL A;  1CMF A;  1F4O A;  1SCM C;  4P5O E;  2L98 A;  1MF8 B;  4HRE E;  1LA0 A;  3I5H B;  5IBW A;  1XYD A;  4YI9 A;  3E3R A;  1G33 A;  2FCD A;  3EVV A;  1CM1 A;  2ZN9 A;  2LP3 A;  1BJF A;  2A4J A;  2M8U A;  1XK4 C;  1PAL A;  1CM4 A;  2RGI A;  4DUQ A;  2H61 A;  4PHM A;  1Y6W A;  4A4B A;  1K94 A;  1MXE A;  5CSI A;  3I5F B;  3WHT B;  1K9U A;  2TN4 A;  2M9G A;  1J7P A;  3TDI A;  1Y1X A;  4GFT A;  2H2K A;  4OCI A;  5HYD A;  1CDP A;  2O5G A;  1ZAC A;  3NSL A;  5TNC A;  1CDM A;  1NSH A;  4PHK A;  5I8N A;  5HLO A;  1K93 D;  1SYM A;  2KGR A;  2MBX A;  1YTZ C;  1GGW A;  4YBH B;  1F54 A;  2OPO A;  1SRA A;  1NP8 A;  4PE0 A;  2M1U A;  3VRN A;  4FTG A;  1PUL A;  1SNL A;  4A4C A;  1XFZ O;  1SKT A;  1QJT A;  3CR5 X;  1C7V A;  3GK1 A;  1GJY A;  3SIA A;  5B8I B;  1OQP A;  1WRL A;  1DJY A;  3CTN A;  3OP0 A;  3LK1 A;  3VGO A;  1LKJ A; 
#chains in the Genus database with same CATH topology
 2LAN A;  1DT7 B;  2P6B B;  1MQ1 A;  1CDN A;  1Y1A A;  2BBM A;  3LLE A;  1ZUZ A;  2MJW B;  1DVI A;  3D0Y A;  1NPQ A;  4JQ0 D;  1XK4 A;  4PAL A;  1JF0 A;  4MVF A;  2I94 A;  2LLU A;  2SCP A;  4CID A;  2NXQ A;  1EJ3 A;  1A4P A;  1M45 A;  1M31 A;  2BEC A;  2PRU A;  1Z4H A;  1SCM B;  4C0J A;  4DRW A;  2HQW A;  2WCE A;  1IWQ A;  4GAO A;  2KNE A;  1CFF A;  5HKY A;  1KQM B;  2KHN A;  4UPG A;  4GUK A;  2JRF A;  4N1F A;  1Q80 A;  1GQM A;  1J7Q A;  2JTZ A;  2F8P A;  4I5K A;  2M29 A;  4NDB A;  1J55 A;  3WXA A;  2KLD A;  1QTX A;  2LM5 A;  4JKT A;  1NCX A;  4CPV A;  1NIW A;  1KK8 B;  1VRK A;  2KFF A;  2M7N A;  3PLF B;  4CLN A;  1FPW A;  2KI6 C;  2WCM A;  1L2O B;  2WOS A;  3S0F A;  1AK8 A;  1J1E A;  1OMV A;  4GNK B;  1K96 A;  1TNQ A;  1TCF A;  4NDC A;  1B8R A;  1TCO B;  1A29 A;  3D10 A;  1OOJ A;  3GOF A;  5JJG A;  4IJ7 A;  3PN7 B;  2ZFD A;  2CNP A;  3NXA A;  2WOR A;  2L2E A;  4NDD A;  1UUS A;  4FQO A;  3B86 A;  1BU3 A;  4MRY A;  3TZ1 A;  1SK6 D;  4M2O A;  2WCF A;  3O4X A;  5HKZ A;  5FI6 A;  3VB1 A;  1KFU L;  3JTD C;  2JXC A;  3OX6 A;  1AUI B;  1NX1 A;  4OV2 A;  2M3W A;  5CSN A;  1G8I A;  1OMD A;  2KBM A;  2OS8 B;  1TTX A;  1YX7 A;  2F3Y A;  4ZCV A;  4HRG A;  4YRU A;  3CS1 A;  1YX8 A;  3BUX B;  1NX3 A;  3S0D A;  3OB1 B;  1HT9 A;  1PVA A;  1MHO A;  1EXR A;  2B1U A;  1W7I B;  2K7C A;  2Y1N A;  2BAP A;  1QIW A;  4I5L B;  4E68 A;  1S6C A;  2BL0 C;  2KFG A;  3EK7 A;  4PT1 A;  3SG6 A;  1AJ5 A;  2MLF C;  4D1E A;  4YGC B;  3I5I C;  1IG5 A;  4M2Q A;  3R1P A;  4ORC B;  5AFP A;  3O2P A;  2LVK A;  2F33 A;  2JWW A;  3JVT B;  1UHH A;  2KDH A;  1QLK A;  1JSA A;  3VRQ A;  2JT8 A;  1ALV A;  2FOT A;  1YUS A;  3SG3 A;  3UO9 A;  2BCX A;  1PVB A;  3VRO A;  4MBE A;  3A4U B;  3BFA A;  1CDL A;  5I2L A;  2LVI A;  5AXI A;  3DD4 A;  3EVU A;  2CCM A;  1DGU A;  3EK4 A;  1JC2 A;  5KSZ A;  2YGU A;  1K8U A;  3DF0 A;  3R72 A;  3H4S E;  2WCJ A;  4ORA B;  1LXF C;  5DIC A;  2PSR A;  1SY9 A;  2EC6 B;  2MA2 A;  1UHK A;  1WRZ A;  2HPS A;  1WY9 A;  1CLL A;  2ZRT A;  4XJK A;  2WC5 A;  4MN0 A;  1CKK A;  1E8A A;  5JOL A;  1OZO A;  3AKA A;  3KF9 A;  1SW8 A;  1NX0 A;  2NLN A;  1OOI X;  1OOF A;  2HQ8 A;  4GGF C;  2OTG C;  1LIN A;  4XJK B;  3VRP A;  1NCY A;  3SG7 A;  1IH0 A;  3BYA A;  1QAS A;  1JBA A;  1K2H A;  1UHJ A;  1RRO A;  3TDZ A;  1DTL A;  2WCH A;  3FE9 A;  1IQ3 A;  1Y0V H;  1Y1U A;  1DF0 A;  1X02 A;  2BCA A;  2QPT A;  3HX4 A;  4ETO A;  1B7T Z;  1SBJ A;  3AKB A;  3V2L A;  1BT6 A;  1CFD A;  1A75 A;  1SPY A;  2P70 A;  5DKN A;  1BR4 B;  2AUC A;  2LVJ A;  2ZND A;  4ORB B;  1LS8 A;  1SR6 C;  3I5G C;  2ZNE A;  3TUY C;  1OW4 A;  5ER4 X;  3MSE B;  2JOJ A;  1EL4 A;  1R2U A;  2M1K B;  1B4C A;  1M39 A;  4XYN A;  1KWO C;  4I5N B;  2KPH A;  3IF7 A;  4INX A;  4IL1 A;  3B7A A;  1T14 A;  4MLW A;  1H8B A;  1OOG A;  2M0R A;  3EG5 B;  5FI7 A;  4GGN A;  3AAK A;  1R6P A;  1KK7 Z;  4MEW A;  3M0W A;  5CPV A;  1ORG A;  1MWN A;  3S0E A;  3SG4 A;  3AAJ A;  4QJ3 B;  2MLE C;  2KQ6 A;  2LLT A;  4M2P A;  4AOM A;  2LC5 A;  1OZS A;  3BUM B;  3CLN A;  5PAL A;  3C1V A;  3TS5 C;  2QEO A;  1CLB A;  1U5I A;  3O78 A;  2M7L A;  4GGF A;  4NQG A;  2KBI A;  2K7O A;  3FIA A;  2PMY A;  1KFX S;  2CXJ A;  1XFV O;  3CZ1 A;  3NGV A;  3D0Y B;  1M46 A;  1ODB A;  3OBV A;  1KCY A;  2KI6 D;  2D8N A;  2KQY A;  1QAT A;  2JT0 A;  1K90 D;  4FQT A;  1YVH A;  2NCP A;  3ZWH A;  1AP4 A;  1CMG A;  3D78 A;  1KSO A;  1S6J A;  1CB1 A;  5FI2 A;  4R1E A;  5GQQ C;  1QIV A;  1M63 B;  1BF5 A;  1S5G Z;  1TNX A;  2ERB A;  2PAS A;  4GPL B;  1BLQ A;  3DVK A;  1B9A A;  3KO0 A;  4Q04 A;  1IRJ A;  1F71 A;  4GBA A;  2CTN A;  1QV1 A;  4QJ4 B;  1HQV A;  2L51 A;  1DC1 A;  3D76 A;  1YRT B;  1UHI A;  1IIO A;  3FE8 A;  1UHN A;  3ZNI A;  4HSZ A;  2KI4 C;  1BMO A;  4AQI A;  5F6T A;  3OB2 B;  1V1G A;  2JXL A;  4N5X A;  5HL1 A;  1FW4 A;  2I7A A;  1BR1 B;  2V53 A;  4OKH A;  1MXL C;  1J7R A;  2WCK A;  3BOW A;  3OX5 A;  1ZFS A;  1CFP A;  1S6I A;  1KWO B;  2ZKM X;  5HLV A;  1YR5 A;  3B87 A;  2JQ6 A;  3CZ2 A;  2FJY A;  1WDC C;  3SS5 A;  1NUB A;  1J7O A;  2LMT A;  1YVL A;  2LV7 A;  5D7F A;  1IGV A;  3EKJ A;  2R2I A;  1AVS A;  2K2F A;  2K8M B;  3CZ0 A;  1C3Y A;  1PRW A;  2JC2 A;  1DJG A;  4PE4 A;  3SG5 A;  3UNW A;  1TWO A;  3TS5 B;  3BFH A;  5I2O A;  2LCP A;  4OVN F;  2KGB C;  1V1F A;  2LAP A;  3I5H C;  1DGV A;  1B8C A;  1YUT A;  2PVB A;  1MR8 A;  2QEH A;  4P2Y B;  2Y5I A;  3O4Y A;  3F45 A;  2KYF A;  4INW A;  1BG1 A;  1REC A;  4PE7 A;  4OZD A;  1ZMZ A;  3SG2 A;  1DEL A;  2BCB A;  3I5F C;  1F70 A;  3PAT A;  2EGD A;  1YUU A;  1DJZ A;  4MZL A;  1SL9 A;  2NZ0 A;  5I94 A;  2KAY A;  5DKR A;  2KLE A;  3BXK A;  3NSO A;  3OGN A;  2LHI A;  3GK4 X;  3D77 A;  2L5Y A;  1S1E A;  1UWO A;  2KAX A;  1GGZ A;  1N2D A;  2AAO A;  1B7T Y;  2E6W A;  1DJW A;  1SCV A;  1YRU B;  2LP2 A;  1QX5 B;  2WND A;  2L50 A;  3CWG A;  4YGA A;  3CYZ A;  5AAN A;  1B47 A;  3EK8 A;  1ALW A;  3O6B A;  3Q8I A;  3WNX B;  2PAL A;  3FWC A;  4L9M A;  3JTD B;  1C07 A;  2PYQ A;  1PSB A;  1UP5 A;  3BJH A;  2KOT A;  2Q91 A;  3DF0 B;  2Q4U A;  3LK0 A;  1ZOT B;  2ZRS A;  3L4A A;  1LA3 A;  1OSA A;  1WDC B;  1XFW O;  1Z2C B;  4ICB A;  3PM2 A;  3D73 A;  1SL7 A;  2JUL A;  1K9K A;  5CSF A;  4PE1 A;  3GK2 A;  2DOQ A;  2O60 A;  3NSK A;  5J3X A;  4I5J A;  2ISD A;  2EHB A;  1RWY A;  2F3Z A;  3DVM A;  3KEV A;  1DJI A;  1FI6 A;  1TUZ A;  2COL B;  1OOH A;  1QLS A;  2F2O A;  2BL0 B;  2GV5 A;  1RJV A;  1W7J B;  3L4L A;  1OE9 B;  2JT3 A;  1KQM C;  3BQ3 A;  1XVJ A;  3I5I B;  2FCE A;  2K7B A;  2QEV A;  2LMU A;  1WRK A;  5BPJ A;  1FI5 A;  2WCL A;  1J1D A;  1FF1 A;  3SJS A;  3VRR A;  3HCM A;  1CTR A;  1KFU S;  2L5X B;  3DXL A;  4YGD B;  4TNC A;  5HKW A;  4BY5 A;  1RK9 A;  1KK8 C;  2PQL A;  1DF0 B;  1XFU O;  2WC8 A;  3DY9 A;  1F8H A;  1L2O C;  2H8V A;  3B6X A;  3B88 A;  1N0Y A;  2L4I A;  1A75 B;  1S5G Y;  2MAZ A;  2K60 A;  5G08 A;  1BOD A;  3LL8 B;  4DCK A;  2P71 A;  1G4Y R;  2MHH A;  2LE9 B;  3IQO A;  2BE4 A;  1NCZ A;  3PN7 C;  1TIZ A;  1XA5 A;  1QVI Z;  2JNX A;  4ZCU A;  1XFR A;  2FJU B;  5D69 A;  4DIR A;  1A03 A;  4MZK A;  3K1E A;  4JD9 A;  3CR4 X;  2BNX A;  3EVR A;  2K7D A;  3NHI A;  3N7H A;  4DS7 A;  2BKH B;  4JWQ A;  4QJ5 B;  5K89 A;  3BUW B;  2KFH A;  2GGZ A;  1DMO A;  1L7Z A;  2OS8 C;  4U8D A;  1SL8 A;  1U5I B;  3DZT A;  1QXP A;  4YGB B;  3FS7 A;  2HET A;  1CLM A;  2HF5 A;  2LVV A;  1S36 A;  2OTG B;  5I2Q A;  2QDI A;  5KU1 A;  3SIB A;  1K9P A;  2SAS A;  1QWV A;  3BUN B;  1F4Q A;  1JF2 A;  3DYE A;  4MZJ A;  3WHU B;  4BY4 A;  4OR9 B;  3CZT X;  1TOP A;  4F0Z B;  1D1O A;  1JWD A;  1SSE B;  5D3O A;  1B8L A;  1B1G A;  1DJH A;  1FBV A;  2LLS A;  1AJ4 A;  1SMG A;  4YI8 A;  4F7F A;  1GM0 A;  1TN4 A;  1H4B A;  3PFV A;  3K21 A;  4CFR A;  1JFJ A;  3JVT C;  4MSP A;  1SR6 B;  3I5G B;  3TUY B;  1QX7 A;  2JPT A;  4N1G A;  4MRX A;  1QS7 A;  1OMR A;  1PSR A;  2E30 A;  1NYA A;  4AQJ A;  1CNP A;  2Y4Q A;  2L0P A;  1IQ5 A;  2ZN8 A;  3L47 A;  3RM1 A;  2AMI A;  2I18 A;  3CGA A;  4HRH A;  1BOC A;  1XO5 A;  2JZI A;  3DVE A;  2NCO A;  4PCW A;  4JPZ B;  1RFJ A;  3S0B A;  1QV0 A;  4USL A;  2QEB A;  3NSI A;  3BOW B;  1C7W A;  1EG4 A;  5DKQ A;  1MUX A;  4KYN A;  4WQ3 A;  5ER5 A;  4C0K A;  1LVC D;  1CFC A;  1F55 A;  2L4H A;  3FWB A;  1KQV A;  2LUX A;  2Y1M A;  1YUR A;  2EC6 C;  3PSR A;  2MRD A;  2M97 A;  1EG3 A;  2KYC A;  3TDU A;  5AER A;  2CT9 A;  1IJ6 A;  2L2C A;  2K0J A;  2F2P A;  2JNF A;  2KSP A;  1WLZ A;  3IQQ A;  3KPX A;  5FYX A;  3R1O A;  2VRG A;  2KAV A;  4CFQ A;  2GGM A;  3R1V A;  5AEQ A;  3PAL A;  2K61 A;  3PJI A;  3BFB A;  3NHT A;  1TNP A;  3S0G A;  2K2A A;  4PDZ A;  4C0L A;  1S26 D;  1NWD A;  1A2X A;  1K95 A;  3SS4 A;  2H61 C;  2I2R E;  2WC6 A;  2G9B A;  1TRF A;  2BE6 A;  2LNK A;  1QX2 A;  2QAC A;  2LUC A;  1JUO A;  3PM8 A;  5CSJ A;  1KFX L;  3CR2 A;  3OHM B;  4PHN A;  2KI4 B;  2LHL A;  3QRX A;  1TNW A;  1IJ5 A;  1NX2 A;  1S3P A;  1N65 A;  2G2B A;  3RZS A;  1KSM A;  1PK0 D;  1XFX O;  4PHJ A;  3FE6 A;  1DJX A;  3DVJ A;  1EH2 A;  4WRI A;  1XFY O;  2WCB A;  1RTP 1;  3ICB A;  3LCP C;  1JFK A;  1UUR A;  3A8R A;  3CAB A;  2BKI B;  2BBN A;  2JTT A;  1WLM A;  3BUO B;  3D74 A;  2M49 B;  5EL2 A;  3S0A A;  4YGE B;  5KTY A;  1DQE A;  1KK7 Y;  1AHR A;  2IS9 A;  3KHE A;  3RLZ A;  4WQ2 A;  1QVI Y;  2JU0 A;  2LMV A;  1IKU A;  3EKH A;  2CBL A;  1CMF A;  1F4O A;  1SCM C;  4P5O E;  1C3Z A;  2L98 A;  1MF8 B;  3D75 A;  1LA0 A;  3I5H B;  4HRE E;  5IBW A;  1XYD A;  1W9Z A;  3E3R A;  1G33 A;  4YI9 A;  2FCD A;  2JPO A;  3EVV A;  1CM1 A;  2ZN9 A;  2LP3 A;  1BJF A;  2A4J A;  2M8U A;  1XK4 C;  1PAL A;  1CM4 A;  2RGI A;  4DUQ A;  2H61 A;  4PHM A;  1Y6W A;  4A4B A;  1K94 A;  1MXE A;  1P28 A;  3I5F B;  5CSI A;  1K9U A;  3WHT B;  2TN4 A;  2M9G A;  1J7P A;  3SS3 A;  3TDI A;  1Y1X A;  4GFT A;  2GTE A;  2H2K A;  4OCI A;  5HYD A;  1CDP A;  2O5G A;  1ZAC A;  1TUJ A;  3NSL A;  5TNC A;  1CDM A;  1NSH A;  4PHK A;  5I8N A;  5HLO A;  1K93 D;  1SYM A;  2KGR A;  2MBX A;  1YTZ C;  1GGW A;  4YBH B;  1F54 A;  2OPO A;  1SRA A;  1NP8 A;  4PE0 A;  2M1U A;  3IVT A;  3VRN A;  4FTG A;  1PUL A;  1SNL A;  4A4C A;  1XFZ O;  1SKT A;  1QJT A;  3CR5 X;  1C7V A;  3GK1 A;  1GJY A;  3SIA A;  5B8I B;  1OQP A;  1WRL A;  3CDN A;  1DJY A;  3CTN A;  3OP0 A;  3LK1 A;  3VGO A;  1DEK A;  1LKJ A;  3QME A; 
#chains in the Genus database with same CATH homology
 2LAN A;  1DT7 B;  2P6B B;  1MQ1 A;  1CDN A;  1Y1A A;  2BBM A;  3LLE A;  1ZUZ A;  2MJW B;  1DVI A;  3D0Y A;  1NPQ A;  4JQ0 D;  1XK4 A;  4PAL A;  1JF0 A;  4MVF A;  2I94 A;  2LLU A;  2SCP A;  4CID A;  2NXQ A;  1EJ3 A;  1A4P A;  1M45 A;  1M31 A;  2BEC A;  2PRU A;  4DRW A;  1SCM B;  4C0J A;  2HQW A;  2WCE A;  1IWQ A;  4GAO A;  2KNE A;  1CFF A;  5HKY A;  1KQM B;  2KHN A;  4UPG A;  4GUK A;  2JRF A;  4N1F A;  1Q80 A;  1GQM A;  1J7Q A;  2JTZ A;  2F8P A;  4I5K A;  2M29 A;  4NDB A;  1J55 A;  1QTX A;  2LM5 A;  1NCX A;  4CPV A;  1NIW A;  1KK8 B;  1VRK A;  2KFF A;  2M7N A;  3PLF B;  4CLN A;  1FPW A;  2KI6 C;  2WOS A;  1L2O B;  1AK8 A;  1J1E A;  1OMV A;  4GNK B;  1K96 A;  1TNQ A;  1TCF A;  4NDC A;  1B8R A;  1TCO B;  1A29 A;  3D10 A;  1OOJ A;  3GOF A;  5JJG A;  3PN7 B;  2ZFD A;  2CNP A;  3NXA A;  2WOR A;  2L2E A;  4NDD A;  1UUS A;  4FQO A;  1BU3 A;  4MRY A;  3TZ1 A;  1SK6 D;  4M2O A;  2WCF A;  5HKZ A;  1KFU L;  3JTD C;  2JXC A;  3OX6 A;  1AUI B;  1NX1 A;  4OV2 A;  2M3W A;  5CSN A;  1G8I A;  1OMD A;  2KBM A;  2OS8 B;  1TTX A;  1YX7 A;  2F3Y A;  4ZCV A;  4HRG A;  4YRU A;  3CS1 A;  1YX8 A;  3BUX B;  1NX3 A;  3OB1 B;  1HT9 A;  1PVA A;  1MHO A;  1EXR A;  2B1U A;  1W7I B;  2K7C A;  2Y1N A;  1QIW A;  4I5L B;  4E68 A;  1S6C A;  2BL0 C;  2KFG A;  3EK7 A;  3SG6 A;  1AJ5 A;  2MLF C;  4D1E A;  4YGC B;  3I5I C;  1IG5 A;  4M2Q A;  4ORC B;  5AFP A;  3O2P A;  2LVK A;  2F33 A;  2JWW A;  3JVT B;  1UHH A;  2KDH A;  1QLK A;  1JSA A;  3VRQ A;  2JT8 A;  1ALV A;  2FOT A;  1YUS A;  3SG3 A;  2BCX A;  1PVB A;  3VRO A;  4MBE A;  3A4U B;  1CDL A;  5I2L A;  2LVI A;  5AXI A;  3DD4 A;  3EVU A;  2CCM A;  1DGU A;  3EK4 A;  1JC2 A;  5KSZ A;  1K8U A;  3DF0 A;  3H4S E;  4ORA B;  1LXF C;  2PSR A;  1SY9 A;  2EC6 B;  2MA2 A;  1UHK A;  1WRZ A;  2HPS A;  1WY9 A;  1CLL A;  2ZRT A;  4XJK A;  4MN0 A;  3WXA A;  1CKK A;  1E8A A;  5JOL A;  1OZO A;  3AKA A;  3KF9 A;  1SW8 A;  1NX0 A;  2NLN A;  2HQ8 A;  4GGF C;  2OTG C;  1LIN A;  4XJK B;  3VRP A;  1NCY A;  3SG7 A;  1IH0 A;  3BYA A;  1QAS A;  1JBA A;  1K2H A;  1UHJ A;  1RRO A;  3TDZ A;  1DTL A;  1IQ3 A;  1Y0V H;  1Y1U A;  1DF0 A;  1X02 A;  2BCA A;  2QPT A;  3HX4 A;  4ETO A;  1B7T Z;  1SBJ A;  3AKB A;  1BT6 A;  1CFD A;  1A75 A;  1SPY A;  5DKN A;  1BR4 B;  2AUC A;  2LVJ A;  2ZND A;  4ORB B;  1SR6 C;  3I5G C;  3TUY C;  2ZNE A;  5ER4 X;  3MSE B;  2JOJ A;  1EL4 A;  1R2U A;  2M1K B;  1B4C A;  1M39 A;  4XYN A;  1KWO C;  4I5N B;  3IF7 A;  1H8B A;  4IL1 A;  4MLW A;  2M0R A;  4GGN A;  3AAK A;  1R6P A;  1KK7 Z;  4MEW A;  3M0W A;  5CPV A;  1MWN A;  3SG4 A;  3AAJ A;  4QJ3 B;  2MLE C;  2KQ6 A;  2LLT A;  4M2P A;  4AOM A;  2LC5 A;  1OZS A;  3BUM B;  3CLN A;  5PAL A;  3C1V A;  3TS5 C;  1CLB A;  1U5I A;  3O78 A;  2M7L A;  4GGF A;  4NQG A;  2KBI A;  2K7O A;  3FIA A;  2PMY A;  1KFX S;  2CXJ A;  1XFV O;  3D0Y B;  1M46 A;  1ODB A;  1KCY A;  2KI6 D;  2D8N A;  2KQY A;  1QAT A;  2JT0 A;  1K90 D;  1YVH A;  2NCP A;  3ZWH A;  1AP4 A;  1CMG A;  1KSO A;  1S6J A;  1CB1 A;  5GQQ C;  4R1E A;  1QIV A;  1M63 B;  1BF5 A;  1S5G Z;  1TNX A;  1BLQ A;  2PAS A;  4GPL B;  3DVK A;  1B9A A;  3KO0 A;  4Q04 A;  1IRJ A;  1F71 A;  4GBA A;  2CTN A;  1QV1 A;  4QJ4 B;  1HQV A;  2L51 A;  1YRT B;  1UHI A;  1UHN A;  3ZNI A;  4HSZ A;  2KI4 C;  1BMO A;  4AQI A;  5F6T A;  3OB2 B;  1V1G A;  2JXL A;  4N5X A;  1FW4 A;  2I7A A;  1BR1 B;  2V53 A;  4OKH A;  1MXL C;  1J7R A;  3BOW A;  3OX5 A;  1ZFS A;  1CFP A;  1S6I A;  1KWO B;  2ZKM X;  5HLV A;  1YR5 A;  2JQ6 A;  1WDC C;  1NUB A;  1J7O A;  2LMT A;  1YVL A;  2LV7 A;  5D7F A;  1IGV A;  3EKJ A;  2R2I A;  1AVS A;  2K2F A;  2K8M B;  1PRW A;  2JC2 A;  1DJG A;  4PE4 A;  3SG5 A;  3TS5 B;  5I2O A;  2LCP A;  4OVN F;  2KGB C;  1V1F A;  2LAP A;  3I5H C;  1DGV A;  1B8C A;  1YUT A;  2PVB A;  1MR8 A;  4P2Y B;  2Y5I A;  3O4Y A;  3F45 A;  2KYF A;  1BG1 A;  1REC A;  4PE7 A;  1ZMZ A;  3SG2 A;  2BCB A;  3I5F C;  1F70 A;  3PAT A;  2EGD A;  1YUU A;  1DJZ A;  4MZL A;  1SL9 A;  2NZ0 A;  2KAY A;  5DKR A;  3BXK A;  3NSO A;  2LHI A;  3GK4 X;  1S1E A;  1UWO A;  2KAX A;  1GGZ A;  1N2D A;  2AAO A;  1B7T Y;  2E6W A;  1DJW A;  1SCV A;  1YRU B;  2LP2 A;  1QX5 B;  2WND A;  2L50 A;  3CWG A;  4YGA A;  5AAN A;  1B47 A;  3EK8 A;  1ALW A;  3O6B A;  3WNX B;  1C07 A;  2PAL A;  3FWC A;  4L9M A;  3JTD B;  1PSB A;  1UP5 A;  2KOT A;  2Q91 A;  3DF0 B;  2Q4U A;  3LK0 A;  1ZOT B;  2ZRS A;  1LA3 A;  1OSA A;  1WDC B;  1XFW O;  4ICB A;  5CSF A;  1SL7 A;  2JUL A;  1K9K A;  4PE1 A;  3GK2 A;  2DOQ A;  2O60 A;  3NSK A;  5J3X A;  4I5J A;  2ISD A;  2EHB A;  1RWY A;  2F3Z A;  3DVM A;  3KEV A;  1DJI A;  1FI6 A;  2COL B;  1QLS A;  2F2O A;  2BL0 B;  2GV5 A;  1RJV A;  1W7J B;  1OE9 B;  2JT3 A;  1KQM C;  3BQ3 A;  1XVJ A;  3I5I B;  2FCE A;  2K7B A;  2LMU A;  1WRK A;  5BPJ A;  1FI5 A;  1J1D A;  1FF1 A;  3SJS A;  3VRR A;  3HCM A;  1CTR A;  1KFU S;  2L5X B;  4YGD B;  4TNC A;  5HKW A;  4BY5 A;  1RK9 A;  1KK8 C;  2WC8 A;  1DF0 B;  1XFU O;  1F8H A;  1L2O C;  1N0Y A;  2L4I A;  1A75 B;  1S5G Y;  2MAZ A;  5G08 A;  1BOD A;  3LL8 B;  4DCK A;  1G4Y R;  2MHH A;  2LE9 B;  3IQO A;  2BE4 A;  1NCZ A;  3PN7 C;  1TIZ A;  1XA5 A;  1QVI Z;  2JNX A;  4ZCU A;  2FJU B;  4DIR A;  5D69 A;  1A03 A;  4MZK A;  3CR4 X;  3EVR A;  2K7D A;  4DS7 A;  2BKH B;  4JWQ A;  4QJ5 B;  5K89 A;  3BUW B;  2KFH A;  2GGZ A;  1DMO A;  1L7Z A;  2OS8 C;  4U8D A;  1SL8 A;  1U5I B;  4YGB B;  1QXP A;  3FS7 A;  2HET A;  1CLM A;  2HF5 A;  2LVV A;  1S36 A;  2OTG B;  5I2Q A;  5KU1 A;  3SIB A;  1K9P A;  2SAS A;  3BUN B;  1F4Q A;  1JF2 A;  4MZJ A;  3WHU B;  4BY4 A;  4OR9 B;  3CZT X;  1TOP A;  4F0Z B;  1D1O A;  1JWD A;  1B8L A;  1B1G A;  1DJH A;  1FBV A;  2LLS A;  1AJ4 A;  1SMG A;  4YI8 A;  1TN4 A;  1H4B A;  3PFV A;  3K21 A;  4CFR A;  1JFJ A;  3JVT C;  4MSP A;  1SR6 B;  3I5G B;  3TUY B;  1QX7 A;  2JPT A;  4N1G A;  4MRX A;  1QS7 A;  1OMR A;  1PSR A;  2E30 A;  1NYA A;  4AQJ A;  1CNP A;  2Y4Q A;  2L0P A;  1IQ5 A;  2ZN8 A;  3RM1 A;  2AMI A;  2I18 A;  3CGA A;  4HRH A;  1BOC A;  1XO5 A;  2JZI A;  3DVE A;  2NCO A;  4PCW A;  4JPZ B;  1RFJ A;  1QV0 A;  4USL A;  3NSI A;  3BOW B;  1C7W A;  1EG4 A;  5DKQ A;  1MUX A;  4WQ3 A;  1F55 A;  5ER5 A;  4C0K A;  1LVC D;  1CFC A;  2L4H A;  3FWB A;  1KQV A;  2LUX A;  2Y1M A;  1YUR A;  2EC6 C;  3PSR A;  2MRD A;  2M97 A;  1EG3 A;  2KYC A;  3TDU A;  5AER A;  2CT9 A;  1IJ6 A;  2K0J A;  2F2P A;  2JNF A;  2KSP A;  1WLZ A;  3IQQ A;  3KPX A;  5FYX A;  4CFQ A;  2VRG A;  2KAV A;  2GGM A;  5AEQ A;  3PAL A;  2K61 A;  1TNP A;  2K2A A;  4PDZ A;  4C0L A;  1S26 D;  1NWD A;  1A2X A;  1K95 A;  2H61 C;  2I2R E;  2G9B A;  1TRF A;  2BE6 A;  2LNK A;  1QX2 A;  2QAC A;  2LUC A;  1JUO A;  3PM8 A;  5CSJ A;  1KFX L;  3CR2 A;  3OHM B;  4PHN A;  2KI4 B;  2LHL A;  3QRX A;  1TNW A;  1IJ5 A;  1NX2 A;  1S3P A;  1N65 A;  2G2B A;  1KSM A;  1PK0 D;  1XFX O;  4PHJ A;  1DJX A;  3DVJ A;  1EH2 A;  4WRI A;  1XFY O;  2WCB A;  1RTP 1;  3ICB A;  3LCP C;  1JFK A;  1UUR A;  3A8R A;  2BKI B;  2BBN A;  2JTT A;  1WLM A;  3BUO B;  2M49 B;  4YGE B;  5KTY A;  1KK7 Y;  1AHR A;  2IS9 A;  3KHE A;  3RLZ A;  4WQ2 A;  1QVI Y;  2JU0 A;  2LMV A;  1IKU A;  3EKH A;  2CBL A;  1CMF A;  1F4O A;  1SCM C;  4P5O E;  2L98 A;  1MF8 B;  4HRE E;  1LA0 A;  3I5H B;  5IBW A;  1XYD A;  4YI9 A;  3E3R A;  1G33 A;  2FCD A;  3EVV A;  1CM1 A;  2ZN9 A;  2LP3 A;  1BJF A;  2A4J A;  2M8U A;  1XK4 C;  1PAL A;  1CM4 A;  2RGI A;  4DUQ A;  2H61 A;  4PHM A;  1Y6W A;  4A4B A;  1K94 A;  1MXE A;  5CSI A;  3I5F B;  3WHT B;  1K9U A;  2TN4 A;  2M9G A;  1J7P A;  3TDI A;  1Y1X A;  4GFT A;  2H2K A;  4OCI A;  5HYD A;  1CDP A;  2O5G A;  1ZAC A;  3NSL A;  5TNC A;  1CDM A;  1NSH A;  4PHK A;  5I8N A;  5HLO A;  1K93 D;  1SYM A;  2KGR A;  2MBX A;  1YTZ C;  1GGW A;  4YBH B;  1F54 A;  2OPO A;  1SRA A;  1NP8 A;  4PE0 A;  2M1U A;  3VRN A;  4FTG A;  1PUL A;  1SNL A;  4A4C A;  1XFZ O;  1SKT A;  1QJT A;  3CR5 X;  1C7V A;  3GK1 A;  1GJY A;  3SIA A;  5B8I B;  1OQP A;  1WRL A;  1DJY A;  3CTN A;  3OP0 A;  3LK1 A;  3VGO A;  1LKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...