3RLZA

2.0 angstrom x-ray structure of bovine ca(2+)-s100b d63n
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSNGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title The effects of CapZ peptide (TRTK12) on the protein dynamics of S100B and S100B D63N
rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 31
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3rlzA00
1CM4A 2H61C 3BUNB 3CWGA 3OHMB 1YUTA 2H61A 1F70A 1BG1A 3SG2A 1B9AA 2M7LA 1WRLA 3H4SE 1JF2A 2MAZA 1C07A 3GK2A 1MUXA 1FI6A 1ODBA 2L4HA 4PHKA 1K93D 1R2UA 1SR6C 5BPJA 3ZWHA 1RWYA 1ZUZA 1NCYA 2ZFDA 1J7PA 3ICBA 1DGVA 4MEWA 1J7QA 3JTDC 1JC2A 1NYAA 2WC8A 5ER5A 1YRTB 4C0JA 3JVTB 4MLWA 2K2AA 1KCYA 4F0ZB 1YR5A 1B4CA 2OS8B 4MZJA 1GJYA 1JF0A 3PALA 3FWCA 1A03A 1QV1A 3SJSA 4AQJA 2SASA 1FF1A 3PN7B 1PVBA 1TCFA 1B8LA 2HF5A 2LMUA 2JT0A 3DD4A 1VRKA 2CNPA 3VRNA 1UHIA 1DT7B 2KI4B 1V1FA 2M3WA 3TS5B 1CLBA 2Y1NA 2LCPA 2ZRTA 3TDIA 1CDMA 1UHJA 2COLB 2LVVA 2OTGC 4YBHB 2JWWA 5IBWA 2BL0B 2JOJA 2BCXA 2LMTA 4QJ5B 3D0YB 2CXJA 5AFPA 1YVHA 1CLLA 1CMFA 2Q4UA 3AKBA 3SG3A 1QVIZ 1K9KA 1QLKA 1XA5A 2LM5A 1GQMA 1XVJA 2M7NA 1OQPA 2GGMA 2I2RE 3I5FB 2BKHB 5I2OA 1KK7Z 2L5XB 3LK0A 2F8PA 2PALA 3BOWA 5DKNA 1XK4C 5B8IB 1XK4A 2MA2A 2QACA 3C1VA 1BOCA 1RFJA 2L2EA 1DJGA 2LVJA 2M8UA 2PRUA 2JNFA 2L51A 1MXEA 1LVCD 1S6IA 2Y4QA 4HSZA 4CFRA 1F54A 1KWOC 3O2PA 1EG3A 1OE9B 1SMGA 2GGZA 1B1GA 3LK1A 4PHMA 1YRUB 2Y1MA 4AOMA 1RK9A 1BF5A 1CM1A 4YRUA 5F6TA 1L2OC 1KSOA 4PE0A 1F55A 1TNXA 2KQYA 1K9PA 2LNKA 4JPZB 1OMDA 1IKUA 1IQ3A 3BUXB 2M9GA 3EKJA 4PE7A 1AJ4A 3QRXA 2WCEA 4OCIA 4M2PA 4MRXA 4BY4A 1A4PA 1H4BA 1S1EA 3O78A 3PSRA 1JWDA 1OMRA 3SG7A 3E3RA 1KFXL 2I7AA 1DJZA 1HQVA 1JSAA 3VRRA 3I5IC 3IQOA 3I5GB 1K90D 1B8RA 2GV5A 1NCZA 5CSJA 4CFQA 1BJFA 3VRQA 4MZKA 1AK8A 2PSRA 1QX2A 2FOTA 2KAVA 2LLSA 2MRDA 1QV0A 2WCFA 5HLVA 1PALA 1LA0A 2NCPA 3FIAA 1YUUA 4QJ3B 2JZIA 4GPLB 1NPQA 3EK4A 2LAPA 2AMIA 4A4CA 1QXPA 3NSIA 1SR6B 1QS7A 4YGBB 2I94A 3LL8B 1NP8A 2NZ0A 1OOJA 1CTRA 2ZNEA 3JTDB 3SG6A 1J7OA 4MBEA 3A4UB 1EG4A 2F3YA 4PALA 2WOSA 1DJWA 1IG5A 2HQWA 3TDUA 1WDCB 1S6CA 1Y6WA 3A8RA 4MZLA 4PE1A 2F3ZA 2M29A 1SKTA 1XO5A 1PSRA 5HKWA 3VROA 1SPYA 1DF0B 1LA3A 1GGWA 2BKIB 2LANA 1W7IB 1MQ1A 4GGNA 1LXFC 5AANA 3AKAA 2V53A 1MWNA 1QTXA 1Y1AA 3EKHA 1DJXA 1N0YA 2FCEA 3GOFA 5KTYA 2OTGB 4YI8A 5I8NA 1AVSA 1WLZA 5I2LA 1M39A 1CFPA 1BMOA 3NSKA 1W7JB 4GAOA 1CB1A 5JJGA 2EGDA 1NCXA 3OB1B 2P6BB 2IS9A 4GFTA 1J55A 2ZKMX 1XFWO 1ZMZA 3OX6A 4PE4A 4HRGA 4YGEB 4GNKB 1S5GY 1DF0A 1OZSA 3D10A 4PHNA 2JC2A 2G9BA 1KFUS 3M0WA 2K8MB 1YTZC 3BOWB 1YURA 4USLA 2MLFC 4HREE 1OZOA 2G2BA 3AAKA 1F71A 5G08A 4I5LB 5JOLA 3WHUB 2KBMA 1QIWA 1TNWA 4N1GA 1CKKA 1J1DA 2NCOA 1BR1B 1KWOB 2LUXA 3IF7A 3HX4A 2LVKA 5TNCA 1SL7A 1B47A 1ZFSA 4P2YB 1S26D 2L4IA 2JULA 2M1UA 1KQMC 1Y1UA 2ZN8A 3OB2B 5D69A 2K7CA 3KPXA 4ICBA 3PFVA 1L2OB 2KBIA 2KGBC 2L98A 2E30A 2PMYA 3FWBA 4MN0A 3SG4A 4QJ4B 1YUSA 3CLNA 1BR4B 3LCPC 2LHIA 5AEQA 1RROA 4DRWA 1JFJA 1H8BA 2KI6D 1AP4A 1EXRA 4DCKA 2M97A 2RGIA 3F45A 2KFHA 2JQ6A 4YGCB 1CMGA 2BCBA 2DOQA 1Y0VH 2CBLA 1K95A 1WRZA 3EVVA 3PATA 2BECA 2JU0A 2Y5IA 1KFXS 4ZCVA 2BE4A 2JTTA 1F4QA 2M49B 1DGUA 3I5IB 3CR4X 1NUBA 1S6JA 3KF9A 2K0JA 4XJKA 4PDZA 5FYXA 3EVRA 1SNLA 4JQ0D 1QVIY 2R2IA 1RECA 1BLQA 5HKYA 2JPTA 4GBAA 2KGRA 5CSFA 1KK7Y 1TRFA 1TTXA 3TDZA 1Y1XA 1X02A 2KFGA 4WQ3A 2KI6C 1DTLA 1PRWA 1B7TZ 4PHJA 2KOTA 4MRYA 3SIAA 3NXAA 3TZ1A 2LLUA 1QIVA 1CNPA 1SCMC 1DMOA 1M46A 2Q91A 1GGZA 1SCVA 1QX5B 3CTNA 3GK1A 3DVMA 1LINA 3BUMB 3EK8A 1YX8A 2OPOA 1F4OA 1UHHA 1U5IA 1FI5A 1NWDA 4OR9B 4IL1A 2H2KA 2JTZA 1JBAA 3KHEA 2KHNA 4YGDB 1BODA 4NDCA 1XFXO 1E8AA 2FCDA 4Q04A 4GUKA 1EH2A 1CDLA 1NSHA 3CGAA 1IGVA 1IJ5A 1DJIA 1B8CA 2WORA 4U8DA 4L9MA 2EC6C 1OSAA 1UHNA 2AAOA 2KDHA 4BY5A 2MLEC 4N5XA 5AERA 3O6BA 1IRJA 1K9UA 1WY9A 4FQOA 1CFCA 1Q80A 2CTNA 2LUCA 3GK4X 3EVUA 1UWOA 4WQ2A 4OKHA 3RM1A 1DJHA 2PASA 3CR5X 3VGOA 4A4BA 2L0PA 1FW4A 4M2QA 1SBJA 3RLZA 2KAXA 1CFDA 1MXLC 3BXKA 3O4YA 1BT6A 2HPSA 4JWQA 1TN4A 2KNEA 5DKRA 2JNXA 3CS1A 1IJ6A 1YX7A 1SW8A 3HCMA 3KO0A 4MVFA 5DKQA 4HRHA 1JFKA 3BYAA 1QATA 4ORAB 3I5HC 3EK7A 4ORCB 3CZTX 2NLNA 1PVAA 2F33A 4E68A 2CCMA 3ZNIA 1KK8C 2M0RA 1AUIB 1S3PA 1NX0A 1A75A 3AAJA 4TNCA 1UUSA 4PCWA 3TUYC 3FS7A 2LMVA 4NQGA 1PK0D 2BE6A 3PM8A 4ORBB 2F2OA 1KQMB 1SYMA 4M2OA 1PSBA 1RJVA 1AHRA 4ZCUA 2NXQA 5HLOA 2JT8A 2KAYA 3BUWB 1QLSA 3K21A 1M45A 1ALWA 1IWQA 2A4JA 4CLNA 1WDCC 2KYCA 4C0KA 1JUOA 5PALA 1A2XA 1SK6D 3DF0A 2PVBA 1DVIA 1UURA 1V1GA 1IQ5A 1NIWA 1TIZA 2QPTA 4AQIA 4OV2A 1XYDA 4YGAA 1IH0A 4I5KA 4D1EA 1MR8A 1S36A 2LP2A 1K2HA 5K89A 2B1UA 4XJKB 3KEVA 2BBMA 5CPVA 1CLMA 1D1OA 2JRFA 4C0LA 1J1EA 3JVTC 4P5OE 2LLTA 1C7VA 2OS8C 1L7ZA 1XFYO 2LE9B 2TN4A 1QX7A 2VRGA 2ZNDA 2FJUB 3PN7C 2MJWB 2F2PA 1N2DA 3SIBA 1WLMA 1SY9A 2KFFA 5ER4X 5HYDA 2BBNA 1A29A 1EL4A 5I2QA 1SCMB 2MBXA 2HETA 2K2FA 2I18A 1G4YR 2KI4C 1KFUL 1BU3A 3TS5C 1U5IB 1CFFA 1WRKA 4N1FA 1M31A 2LC5A 4I5JA 2LP3A 2LV7A 2BL0C 2WCBA 1G8IA 3D0YA 4NDDA 5CSNA 1TCOB 3OP0A 1F8HA 4DIRA 5AXIA 1FBVA 1QJTA 2K61A 3BUOB 2JXLA 2EC6B 1NX3A 3VRPA 1MHOA 3I5FC 3NSOA 3DVJA 4ETOA 5CSIA 1NX2A 1QASA 2LVIA 2KYFA 4GGFC 1DJYA 5GQQC 4GGFA 4UPGA 1MF8B 2E6WA 2BCAA 1TNQA 1FPWA 1ZOTB 4WRIA 4OVNF 1RTP1 1KQVA 3LLEA 1K96A 2JXCA 1UP5A 2HQ8A 1TOPA 5J3XA 1TNPA 3CR2A 2AUCA 2KSPA 2O60A 1CDPA 4FTGA 5KU1A 1XFVO 1K8UA 2ISDA 3WHTB 1K94A 1ZACA 5HKZA 5D7FA 1SRAA 4DS7A 2KQ6A 2WNDA 1NX1A 1M63B 1B7TY 1SL8A 1YVLA 4I5NB 4YI9A 1OMVA 5KSZA 1AJ5A 2D8NA 1SL9A 3I5HB 4XYNA 2K7DA 1C7WA 1G33A 1PULA 3WXAA 1CDNA 3PLFB 3WNXB 3MSEB 2K7BA 2CT9A 1KSMA 1XFUO 2ZRSA 1KK8B 1UHKA 3NSLA 1A75B 3DVKA 3OX5A 3DVEA 2K7OA 2LHLA 2MHHA 1N65A 2EHBA 4CPVA 3TUYB 2JT3A 1HT9A 2M1KB 1ALVA 2L50A 2O5GA 1XFZO 3I5GC 1R6PA 4NDBA 2SCPA 2ZN9A 3SG5A 3BQ3A 4MSPA 1LKJA 3IQQA 1EJ3A 4CIDA 1S5GZ 4DUQA 4R1EA 1J7RA 3DF0B
chains in the Genus database with same CATH superfamily
1CM4A 2H61C 3BUNB 3CWGA 3OHMB 1YUTA 2H61A 1F70A 1BG1A 3SG2A 1B9AA 2KPHA 1WRLA 2M7LA 3H4SE 1JF2A 2MAZA 1C07A 3GK2A 1MUXA 3QMEA 1FI6A 1ODBA 2L4HA 4PHKA 1K93D 1R2UA 1SR6C 5BPJA 3ZWHA 1RWYA 1ZUZA 1NCYA 2ZFDA 1J7PA 3ICBA 1DGVA 4MEWA 1J7QA 3JTDC 1JC2A 1NYAA 2WC8A 5I94A 5ER5A 1YRTB 4C0JA 3JVTB 4MLWA 2K2AA 1KCYA 4F0ZB 1YR5A 1B4CA 2OS8B 4MZJA 3B7AA 1GJYA 1JF0A 3PALA 3FWCA 1A03A 1QV1A 3SJSA 4AQJA 2SASA 1FF1A 3B6XA 3PN7B 1PVBA 1TCFA 1B8LA 2HF5A 2LMUA 2JT0A 3DD4A 1VRKA 2CNPA 3VRNA 2KLDA 1UHIA 1DT7B 2KI4B 1V1FA 2KLEA 2M3WA 3TS5B 1CLBA 1TUJA 2Y1NA 2LCPA 2ZRTA 3TDIA 5DICA 1CDMA 1UHJA 2COLB 2LVVA 2OTGC 4YBHB 3CZ2A 2JWWA 3DXLA 5IBWA 1OOHA 2BL0B 2BCXA 2JOJA 2LMTA 4QJ5B 3D0YB 3CYZA 3FE9A 2CXJA 5AFPA 1YVHA 1CLLA 1CMFA 2Q4UA 3AKBA 3SG3A 1QVIZ 1K9KA 1QLKA 1XA5A 2LM5A 1GQMA 1XVJA 2M7NA 3Q8IA 1OQPA 2GGMA 3K1EA 2I2RE 3I5FB 2BKHB 3OGNA 5I2OA 1KK7Z 2L5XB 3LK0A 2F8PA 2PALA 3BOWA 2JPOA 5DKNA 1XK4C 3L47A 5B8IB 1XK4A 2MA2A 3S0AA 2QACA 3C1VA 1BOCA 3CDNA 1RFJA 2L2EA 1DJGA 2LVJA 2M8UA 2PRUA 2JNFA 2L51A 3S0FA 1MXEA 1LVCD 1S6IA 2Y4QA 4HSZA 4CFRA 1F54A 1KWOC 3O2PA 1EG3A 1OE9B 1SMGA 2GGZA 4IJ7A 1B1GA 3LK1A 4PHMA 1YRUB 3BJHA 2Y1MA 4AOMA 1RK9A 1BF5A 1CM1A 4YRUA 5F6TA 1L2OC 1KSOA 4PE0A 1F55A 1TNXA 2KQYA 1K9PA 2LNKA 3NHTA 4JPZB 1OMDA 1IKUA 1IQ3A 3BUXB 2M9GA 3EKJA 3D77A 1AJ4A 4PE7A 3L4AA 3QRXA 2WCEA 3S0EA 4OCIA 4M2PA 4MRXA 4BY4A 1A4PA 5FI2A 1H4BA 1S1EA 3O78A 3PSRA 1JWDA 1OMRA 3SG7A 3E3RA 1KFXL 2I7AA 1DJZA 1HQVA 1JSAA 3VRRA 3I5IC 3IQOA 1P28A 3I5GB 1K90D 1B8RA 2PYQA 2GV5A 1NCZA 5CSJA 4CFQA 1BJFA 2QEBA 3VRQA 4MZKA 1AK8A 2PSRA 1QX2A 2FOTA 2KAVA 2LLSA 1ORGA 1QV0A 2MRDA 2WCFA 1PALA 5HLVA 1LA0A 2NCPA 3FIAA 1YUUA 4QJ3B 2JZIA 4GPLB 1NPQA 3EK4A 4INWA 2LAPA 2AMIA 4A4CA 1IIOA 1QXPA 3NSIA 1SR6B 2WC6A 1QS7A 4YGBB 2I94A 3LL8B 5FI7A 1NP8A 2NZ0A 1OOJA 1CTRA 2PQLA 2ZNEA 3JTDB 3SG6A 1J7OA 4MBEA 3A4UB 1EG4A 2F3YA 4PALA 2P70A 2WOSA 1DJWA 1IG5A 2HQWA 3TDUA 1WDCB 1S6CA 1Y6WA 3A8RA 4MZLA 4PE1A 2F3ZA 2M29A 1SKTA 1XO5A 1PSRA 5HKWA 4INXA 3VROA 1SPYA 1DF0B 1LA3A 2BNXA 1GGWA 2BKIB 2LANA 1W7IB 2WCMA 1MQ1A 3FE8A 4GGNA 1LXFC 3BFAA 3AKAA 5AANA 2V53A 1MWNA 1QTXA 1Y1AA 3EKHA 1DJXA 1N0YA 2FCEA 3GOFA 5KTYA 2OTGB 4YI8A 2WCLA 5I8NA 1AVSA 1WLZA 5D3OA 5I2LA 1M39A 1CFPA 1BMOA 3NSKA 1W7JB 1T14A 4GAOA 1CB1A 5JJGA 2EGDA 1NCXA 3OB1B 1DEKA 2P6BB 2IS9A 1SSEB 4GFTA 1J55A 3DYEA 2ZKMX 1XFWO 1ZMZA 3B88A 3OX6A 4HRGA 4PE4A 4YGEB 4GNKB 1S5GY 1DF0A 1OZSA 3D10A 1OW4A 1DC1A 4PHNA 2JC2A 2G9BA 1KFUS 3M0WA 2K8MB 1YTZC 3BOWB 1YURA 4USLA 5FI6A 2MLFC 4HREE 1OZOA 2G2BA 3AAKA 1F71A 5G08A 4I5LB 5JOLA 3WHUB 2KBMA 1QIWA 1TNWA 4N1GA 3CZ1A 1CKKA 1J1DA 2NCOA 1BR1B 1KWOB 2LUXA 3IF7A 3HX4A 2LVKA 5TNCA 1C3YA 1SL7A 1B47A 1ZFSA 4P2YB 1S26D 2L4IA 2JULA 2M1UA 1KQMC 3BFBA 1Y1UA 2ZN8A 3OB2B 5D69A 4F7FA 2K7CA 2L5YA 3KPXA 4ICBA 3PFVA 1L2OB 2KBIA 2KGBC 2L98A 2E30A 2PMYA 3FWBA 4MN0A 3SG4A 4QJ4B 1YUSA 3CLNA 1BR4B 3LCPC 2LHIA 5AEQA 1RROA 4DRWA 1JFJA 1H8BA 2KI6D 1AP4A 1EXRA 4DCKA 2M97A 2RGIA 3F45A 2KFHA 2JQ6A 4YGCB 1CMGA 2BCBA 2DOQA 1Y0VH 2CBLA 1K95A 1WRZA 3EVVA 3PATA 2BECA 2JU0A 2Y5IA 1KFXS 3S0DA 2WCKA 4ZCVA 2BE4A 2JTTA 1F4QA 2M49B 1DGUA 3I5IB 3CR4X 1NUBA 1S6JA 3KF9A 2K0JA 4XJKA 4PDZA 5FYXA 3EVRA 1SNLA 4JQ0D 1QVIY 2R2IA 1RECA 1BLQA 5HKYA 2JPTA 4GBAA 2KGRA 5CSFA 1KK7Y 1TRFA 1Z2CB 1TTXA 3TDZA 3BFHA 1Y1XA 1X02A 2KFGA 4WQ3A 2KI6C 1DTLA 1PRWA 1B7TZ 4PHJA 2KOTA 4MRYA 3SIAA 3NXAA 3TZ1A 2LLUA 1QIVA 4OZDA 1CNPA 1SCMC 1DMOA 1M46A 2Q91A 1GGZA 1SCVA 1QX5B 3CTNA 3GK1A 3DVMA 1LINA 3BUMB 2QDIA 2QEOA 3EK8A 1YX8A 2OPOA 1F4OA 1UHHA 1U5IA 1FI5A 1NWDA 4OR9B 4IL1A 2H2KA 2JTZA 1JBAA 3KHEA 2KHNA 4YGDB 3D75A 1BODA 4NDCA 1XFXO 4PT1A 1E8AA 2FCDA 4Q04A 4GUKA 1EH2A 1CDLA 1NSHA 3CGAA 3PM2A 1IGVA 1IJ5A 1DJIA 1B8CA 2WORA 4U8DA 4L9MA 2EC6C 1OSAA 1UHNA 2AAOA 2KDHA 4BY5A 2MLEC 4N5XA 5AERA 3O6BA 1IRJA 1K9UA 1WY9A 4FQOA 1CFCA 1Q80A 2CTNA 2LUCA 3GK4X 3EVUA 3O4XA 1UWOA 4WQ2A 4OKHA 1Z4HA 3RM1A 3IVTA 1DJHA 3UO9A 2PASA 3CR5X 1OOIX 3VGOA 4A4BA 2L0PA 1FW4A 4M2QA 1SBJA 3RLZA 2KAXA 1CFDA 1MXLC 3BXKA 3O4YA 1BT6A 2HPSA 4JWQA 1TN4A 2KNEA 5DKRA 2JNXA 3CS1A 1IJ6A 1YX7A 1SW8A 3HCMA 3KO0A 4MVFA 5DKQA 3SS4A 3CABA 4HRHA 1JFKA 3BYAA 1LS8A 1QATA 4ORAB 3I5HC 2WC5A 3EK7A 4ORCB 3CZTX 2NLNA 1PVAA 2F33A 4E68A 2CCMA 3ZNIA 1KK8C 2M0RA 1AUIB 1S3PA 1NX0A 1A75A 4KYNA 3AAJA 4TNCA 1UUSA 4PCWA 3TUYC 3FS7A 2LMVA 4NQGA 1PK0D 2BE6A 3PM8A 4ORBB 2F2OA 1KQMB 3FE6A 1SYMA 3D76A 4M2OA 1PSBA 1RJVA 3DY9A 1AHRA 4ZCUA 2NXQA 5HLOA 2JT8A 2KAYA 2BAPA 3BUWB 1QLSA 3SS3A 3K21A 3L4LA 1M45A 1ALWA 3D73A 1IWQA 2A4JA 4CLNA 1WDCC 2KYCA 4C0KA 1JUOA 5PALA 1A2XA 1SK6D 3DF0A 2PVBA 1DVIA 1UURA 1TWOA 1QWVA 1W9ZA 1V1GA 1IQ5A 1C3ZA 1NIWA 1TIZA 2QEVA 2QPTA 4AQIA 4OV2A 1XYDA 4YGAA 1IH0A 4I5KA 4D1EA 1MR8A 1S36A 2LP2A 1K2HA 1OOGA 5K89A 4FQTA 2B1UA 4XJKB 3R72A 3KEVA 2BBMA 5CPVA 1CLMA 1D1OA 2JRFA 4C0LA 1J1EA 3JVTC 4JD9A 4P5OE 2LLTA 1C7VA 3RZSA 2OS8C 1L7ZA 1XFYO 2LE9B 2TN4A 2YGUA 3S0GA 1QX7A 2VRGA 2ZNDA 3DZTA 2FJUB 3PN7C 2MJWB 2F2PA 1N2DA 3R1OA 3SIBA 1WLMA 1SY9A 2KFFA 5ER4X 5HYDA 2BBNA 1A29A 1EL4A 5I2QA 1SCMB 3V2LA 2MBXA 3N7HA 3UNWA 2HETA 2K2FA 2I18A 3R1PA 3CZ0A 1G4YR 2KI4C 1KFUL 1BU3A 3TS5C 1GM0A 3OBVA 1U5IB 1CFFA 2K60A 1WRKA 4N1FA 1M31A 2LC5A 4I5JA 2LP3A 2LV7A 2BL0C 5EL2A 3R1VA 2WCBA 1G8IA 3D0YA 4NDDA 5CSNA 1TCOB 3OP0A 1F8HA 4DIRA 5AXIA 1FBVA 1QJTA 2K61A 3BUOB 2JXLA 2EC6B 1NX3A 3VB1A 2FJYA 2P71A 3VRPA 1MHOA 3I5FC 3NSOA 3DVJA 4ETOA 5CSIA 1NX2A 1QASA 3B87A 2LVIA 2KYFA 4GGFC 1DJYA 5GQQC 4GGFA 4UPGA 3S0BA 1MF8B 2E6WA 3EG5B 2BCAA 1TNQA 1FPWA 1ZOTB 4WRIA 4OVNF 3NGVA 1RTP1 1OOFA 1KQVA 2L2CA 3LLEA 1K96A 2JXCA 1XFRA 1UP5A 2HQ8A 1TOPA 5J3XA 1TNPA 5HL1A 3CR2A 2AUCA 2KSPA 2O60A 1CDPA 4FTGA 5KU1A 1DQEA 1XFVO 1K8UA 2ISDA 4JKTA 1K94A 3WHTB 1ZACA 3PJIA 5HKZA 5D7FA 1SRAA 4DS7A 2WCHA 1DELA 2KQ6A 1NX1A 1M63B 2QEHA 2WNDA 1B7TY 1SL8A 1YVLA 4I5NB 4YI9A 1OMVA 5KSZA 1AJ5A 2D8NA 1SL9A 3I5HB 4XYNA 2K7DA 1C7WA 1G33A 3D74A 1PULA 3WXAA 1CDNA 3PLFB 3WNXB 2WCJA 3MSEB 2K7BA 2CT9A 1KSMA 1XFUO 2ZRSA 1KK8B 1UHKA 3NSLA 1A75B 2ERBA 3DVKA 3OX5A 3DVEA 2K7OA 1TUZA 2LHLA 2MHHA 1N65A 2EHBA 4CPVA 3TUYB 2JT3A 1HT9A 3B86A 3SS5A 2M1KB 1ALVA 2GTEA 2L50A 2O5GA 1XFZO 3I5GC 1R6PA 4NDBA 2SCPA 2ZN9A 3D78A 3SG5A 3BQ3A 3NHIA 4MSPA 1LKJA 3IQQA 2H8VA 1EJ3A 4CIDA 1S5GZ 4DUQA 4R1EA 1J7RA 3DF0B
chains in the Genus database with same CATH topology
1CM4A 2H61C 3BUNB 3CWGA 3OHMB 1YUTA 2H61A 1F70A 1BG1A 3SG2A 1B9AA 2M7LA 1WRLA 3H4SE 1JF2A 2MAZA 1C07A 3GK2A 1MUXA 1FI6A 1ODBA 2L4HA 4PHKA 1K93D 1R2UA 1SR6C 5BPJA 3ZWHA 1RWYA 1ZUZA 1NCYA 2ZFDA 1J7PA 3ICBA 1DGVA 4MEWA 1J7QA 3JTDC 1JC2A 1NYAA 2WC8A 5ER5A 1YRTB 4C0JA 3JVTB 4MLWA 2K2AA 1KCYA 4F0ZB 1YR5A 1B4CA 2OS8B 4MZJA 1GJYA 1JF0A 3PALA 3FWCA 1A03A 1QV1A 3SJSA 4AQJA 2SASA 1FF1A 3PN7B 1PVBA 1TCFA 1B8LA 2HF5A 2LMUA 2JT0A 3DD4A 1VRKA 2CNPA 3VRNA 1UHIA 1DT7B 2KI4B 1V1FA 2M3WA 3TS5B 1CLBA 2Y1NA 2LCPA 2ZRTA 3TDIA 1CDMA 1UHJA 2COLB 2LVVA 2OTGC 4YBHB 2JWWA 5IBWA 2BL0B 2JOJA 2BCXA 2LMTA 4QJ5B 3D0YB 2CXJA 5AFPA 1YVHA 1CLLA 1CMFA 2Q4UA 3AKBA 3SG3A 1QVIZ 1K9KA 1QLKA 1XA5A 2LM5A 1GQMA 1XVJA 2M7NA 1OQPA 2GGMA 2I2RE 3I5FB 2BKHB 5I2OA 1KK7Z 2L5XB 3LK0A 2F8PA 2PALA 3BOWA 5DKNA 1XK4C 5B8IB 1XK4A 2MA2A 2QACA 3C1VA 1BOCA 1RFJA 2L2EA 1DJGA 2LVJA 2M8UA 2PRUA 2JNFA 2L51A 1MXEA 1LVCD 1S6IA 2Y4QA 4HSZA 4CFRA 1F54A 1KWOC 3O2PA 1EG3A 1OE9B 1SMGA 2GGZA 1B1GA 3LK1A 4PHMA 1YRUB 2Y1MA 4AOMA 1RK9A 1BF5A 1CM1A 4YRUA 5F6TA 1L2OC 1KSOA 4PE0A 1F55A 1TNXA 2KQYA 1K9PA 2LNKA 4JPZB 1OMDA 1IKUA 1IQ3A 3BUXB 2M9GA 3EKJA 4PE7A 1AJ4A 3QRXA 2WCEA 4OCIA 4M2PA 4MRXA 4BY4A 1A4PA 1H4BA 1S1EA 3O78A 3PSRA 1JWDA 1OMRA 3SG7A 3E3RA 1KFXL 2I7AA 1DJZA 1HQVA 1JSAA 3VRRA 3I5IC 3IQOA 3I5GB 1K90D 1B8RA 2GV5A 1NCZA 5CSJA 4CFQA 1BJFA 3VRQA 4MZKA 1AK8A 2PSRA 1QX2A 2FOTA 2KAVA 2LLSA 2MRDA 1QV0A 2WCFA 5HLVA 1PALA 1LA0A 2NCPA 3FIAA 1YUUA 4QJ3B 2JZIA 4GPLB 1NPQA 3EK4A 2LAPA 2AMIA 4A4CA 1QXPA 3NSIA 1SR6B 1QS7A 4YGBB 2I94A 3LL8B 1NP8A 2NZ0A 1OOJA 1CTRA 2ZNEA 3JTDB 3SG6A 1J7OA 4MBEA 3A4UB 1EG4A 2F3YA 4PALA 2WOSA 1DJWA 1IG5A 2HQWA 3TDUA 1WDCB 1S6CA 1Y6WA 3A8RA 4MZLA 4PE1A 2F3ZA 2M29A 1SKTA 1XO5A 1PSRA 5HKWA 3VROA 1SPYA 1DF0B 1LA3A 1GGWA 2BKIB 2LANA 1W7IB 1MQ1A 4GGNA 1LXFC 5AANA 3AKAA 2V53A 1MWNA 1QTXA 1Y1AA 3EKHA 1DJXA 1N0YA 2FCEA 3GOFA 5KTYA 2OTGB 4YI8A 5I8NA 1AVSA 1WLZA 5I2LA 1M39A 1CFPA 1BMOA 3NSKA 1W7JB 4GAOA 1CB1A 5JJGA 2EGDA 1NCXA 3OB1B 2P6BB 2IS9A 4GFTA 1J55A 2ZKMX 1XFWO 1ZMZA 3OX6A 4PE4A 4HRGA 4YGEB 4GNKB 1S5GY 1DF0A 1OZSA 3D10A 4PHNA 2JC2A 2G9BA 1KFUS 3M0WA 2K8MB 1YTZC 3BOWB 1YURA 4USLA 2MLFC 4HREE 1OZOA 2G2BA 3AAKA 1F71A 5G08A 4I5LB 5JOLA 3WHUB 2KBMA 1QIWA 1TNWA 4N1GA 1CKKA 1J1DA 2NCOA 1BR1B 1KWOB 2LUXA 3IF7A 3HX4A 2LVKA 5TNCA 1SL7A 1B47A 1ZFSA 4P2YB 1S26D 2L4IA 2JULA 2M1UA 1KQMC 1Y1UA 2ZN8A 3OB2B 5D69A 2K7CA 3KPXA 4ICBA 3PFVA 1L2OB 2KBIA 2KGBC 2L98A 2E30A 2PMYA 3FWBA 4MN0A 3SG4A 4QJ4B 1YUSA 3CLNA 1BR4B 3LCPC 2LHIA 5AEQA 1RROA 4DRWA 1JFJA 1H8BA 2KI6D 1AP4A 1EXRA 4DCKA 2M97A 2RGIA 3F45A 2KFHA 2JQ6A 4YGCB 1CMGA 2BCBA 2DOQA 1Y0VH 2CBLA 1K95A 1WRZA 3EVVA 3PATA 2BECA 2JU0A 2Y5IA 1KFXS 4ZCVA 2BE4A 2JTTA 1F4QA 2M49B 1DGUA 3I5IB 3CR4X 1NUBA 1S6JA 3KF9A 2K0JA 4XJKA 4PDZA 5FYXA 3EVRA 1SNLA 4JQ0D 1QVIY 2R2IA 1RECA 1BLQA 5HKYA 2JPTA 4GBAA 2KGRA 5CSFA 1KK7Y 1TRFA 1TTXA 3TDZA 1Y1XA 1X02A 2KFGA 4WQ3A 2KI6C 1DTLA 1PRWA 1B7TZ 4PHJA 2KOTA 4MRYA 3SIAA 3NXAA 3TZ1A 2LLUA 1QIVA 1CNPA 1SCMC 1DMOA 1M46A 2Q91A 1GGZA 1SCVA 1QX5B 3CTNA 3GK1A 3DVMA 1LINA 3BUMB 3EK8A 1YX8A 2OPOA 1F4OA 1UHHA 1U5IA 1FI5A 1NWDA 4OR9B 4IL1A 2H2KA 2JTZA 1JBAA 3KHEA 2KHNA 4YGDB 1BODA 4NDCA 1XFXO 1E8AA 2FCDA 4Q04A 4GUKA 1EH2A 1CDLA 1NSHA 3CGAA 1IGVA 1IJ5A 1DJIA 1B8CA 2WORA 4U8DA 4L9MA 2EC6C 1OSAA 1UHNA 2AAOA 2KDHA 4BY5A 2MLEC 4N5XA 5AERA 3O6BA 1IRJA 1K9UA 1WY9A 4FQOA 1CFCA 1Q80A 2CTNA 2LUCA 3GK4X 3EVUA 1UWOA 4WQ2A 4OKHA 3RM1A 1DJHA 2PASA 3CR5X 3VGOA 4A4BA 2L0PA 1FW4A 4M2QA 1SBJA 3RLZA 2KAXA 1CFDA 1MXLC 3BXKA 3O4YA 1BT6A 2HPSA 4JWQA 1TN4A 2KNEA 5DKRA 2JNXA 3CS1A 1IJ6A 1YX7A 1SW8A 3HCMA 3KO0A 4MVFA 5DKQA 4HRHA 1JFKA 3BYAA 1QATA 4ORAB 3I5HC 3EK7A 4ORCB 3CZTX 2NLNA 1PVAA 2F33A 4E68A 2CCMA 3ZNIA 1KK8C 2M0RA 1AUIB 1S3PA 1NX0A 1A75A 3AAJA 4TNCA 1UUSA 4PCWA 3TUYC 3FS7A 2LMVA 4NQGA 1PK0D 2BE6A 3PM8A 4ORBB 2F2OA 1KQMB 1SYMA 4M2OA 1PSBA 1RJVA 1AHRA 4ZCUA 2NXQA 5HLOA 2JT8A 2KAYA 3BUWB 1QLSA 3K21A 1M45A 1ALWA 1IWQA 2A4JA 4CLNA 1WDCC 2KYCA 4C0KA 1JUOA 5PALA 1A2XA 1SK6D 3DF0A 2PVBA 1DVIA 1UURA 1V1GA 1IQ5A 1NIWA 1TIZA 2QPTA 4AQIA 4OV2A 1XYDA 4YGAA 1IH0A 4I5KA 4D1EA 1MR8A 1S36A 2LP2A 1K2HA 5K89A 2B1UA 4XJKB 3KEVA 2BBMA 5CPVA 1CLMA 1D1OA 2JRFA 4C0LA 1J1EA 3JVTC 4P5OE 2LLTA 1C7VA 2OS8C 1L7ZA 1XFYO 2LE9B 2TN4A 1QX7A 2VRGA 2ZNDA 2FJUB 3PN7C 2MJWB 2F2PA 1N2DA 3SIBA 1WLMA 1SY9A 2KFFA 5ER4X 5HYDA 2BBNA 1A29A 1EL4A 5I2QA 1SCMB 2MBXA 2HETA 2K2FA 2I18A 1G4YR 2KI4C 1KFUL 1BU3A 3TS5C 1U5IB 1CFFA 1WRKA 4N1FA 1M31A 2LC5A 4I5JA 2LP3A 2LV7A 2BL0C 2WCBA 1G8IA 3D0YA 4NDDA 5CSNA 1TCOB 3OP0A 1F8HA 4DIRA 5AXIA 1FBVA 1QJTA 2K61A 3BUOB 2JXLA 2EC6B 1NX3A 3VRPA 1MHOA 3I5FC 3NSOA 3DVJA 4ETOA 5CSIA 1NX2A 1QASA 2LVIA 2KYFA 4GGFC 1DJYA 5GQQC 4GGFA 4UPGA 1MF8B 2E6WA 2BCAA 1TNQA 1FPWA 1ZOTB 4WRIA 4OVNF 1RTP1 1KQVA 3LLEA 1K96A 2JXCA 1UP5A 2HQ8A 1TOPA 5J3XA 1TNPA 3CR2A 2AUCA 2KSPA 2O60A 1CDPA 4FTGA 5KU1A 1XFVO 1K8UA 2ISDA 3WHTB 1K94A 1ZACA 5HKZA 5D7FA 1SRAA 4DS7A 2KQ6A 2WNDA 1NX1A 1M63B 1B7TY 1SL8A 1YVLA 4I5NB 4YI9A 1OMVA 5KSZA 1AJ5A 2D8NA 1SL9A 3I5HB 4XYNA 2K7DA 1C7WA 1G33A 1PULA 3WXAA 1CDNA 3PLFB 3WNXB 3MSEB 2K7BA 2CT9A 1KSMA 1XFUO 2ZRSA 1KK8B 1UHKA 3NSLA 1A75B 3DVKA 3OX5A 3DVEA 2K7OA 2LHLA 2MHHA 1N65A 2EHBA 4CPVA 3TUYB 2JT3A 1HT9A 2M1KB 1ALVA 2L50A 2O5GA 1XFZO 3I5GC 1R6PA 4NDBA 2SCPA 2ZN9A 3SG5A 3BQ3A 4MSPA 1LKJA 3IQQA 1EJ3A 4CIDA 1S5GZ 4DUQA 4R1EA 1J7RA 3DF0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CM4 A;  2H61 C;  3BUN B;  3CWG A;  3OHM B;  1YUT A;  2H61 A;  1F70 A;  1BG1 A;  3SG2 A;  1B9A A;  2M7L A;  1WRL A;  3H4S E;  1JF2 A;  2MAZ A;  1C07 A;  3GK2 A;  1MUX A;  1FI6 A;  1ODB A;  2L4H A;  4PHK A;  1K93 D;  1R2U A;  1SR6 C;  5BPJ A;  3ZWH A;  1RWY A;  1ZUZ A;  1NCY A;  2ZFD A;  1J7P A;  3ICB A;  1DGV A;  4MEW A;  1J7Q A;  3JTD C;  1JC2 A;  1NYA A;  2WC8 A;  5ER5 A;  1YRT B;  4C0J A;  3JVT B;  4MLW A;  2K2A A;  1KCY A;  4F0Z B;  1YR5 A;  1B4C A;  2OS8 B;  4MZJ A;  1GJY A;  1JF0 A;  3PAL A;  3FWC A;  1A03 A;  1QV1 A;  3SJS A;  4AQJ A;  2SAS A;  1FF1 A;  3PN7 B;  1PVB A;  1TCF A;  1B8L A;  2HF5 A;  2LMU A;  2JT0 A;  3DD4 A;  1VRK A;  2CNP A;  3VRN A;  1UHI A;  1DT7 B;  2KI4 B;  1V1F A;  2M3W A;  3TS5 B;  1CLB A;  2Y1N A;  2LCP A;  2ZRT A;  3TDI A;  1CDM A;  1UHJ A;  2COL B;  2LVV A;  2OTG C;  4YBH B;  2JWW A;  5IBW A;  2BL0 B;  2JOJ A;  2BCX A;  2LMT A;  4QJ5 B;  3D0Y B;  2CXJ A;  5AFP A;  1YVH A;  1CLL A;  1CMF A;  2Q4U A;  3AKB A;  3SG3 A;  1QVI Z;  1K9K A;  1QLK A;  1XA5 A;  2LM5 A;  1GQM A;  1XVJ A;  2M7N A;  1OQP A;  2GGM A;  2I2R E;  3I5F B;  2BKH B;  5I2O A;  1KK7 Z;  2L5X B;  3LK0 A;  2F8P A;  2PAL A;  3BOW A;  5DKN A;  1XK4 C;  5B8I B;  1XK4 A;  2MA2 A;  2QAC A;  3C1V A;  1BOC A;  1RFJ A;  2L2E A;  1DJG A;  2LVJ A;  2M8U A;  2PRU A;  2JNF A;  2L51 A;  1MXE A;  1LVC D;  1S6I A;  2Y4Q A;  4HSZ A;  4CFR A;  1F54 A;  1KWO C;  3O2P A;  1EG3 A;  1OE9 B;  1SMG A;  2GGZ A;  1B1G A;  3LK1 A;  4PHM A;  1YRU B;  2Y1M A;  4AOM A;  1RK9 A;  1BF5 A;  1CM1 A;  4YRU A;  5F6T A;  1L2O C;  1KSO A;  4PE0 A;  1F55 A;  1TNX A;  2KQY A;  1K9P A;  2LNK A;  4JPZ B;  1OMD A;  1IKU A;  1IQ3 A;  3BUX B;  2M9G A;  3EKJ A;  4PE7 A;  1AJ4 A;  3QRX A;  2WCE A;  4OCI A;  4M2P A;  4MRX A;  4BY4 A;  1A4P A;  1H4B A;  1S1E A;  3O78 A;  3PSR A;  1JWD A;  1OMR A;  3SG7 A;  3E3R A;  1KFX L;  2I7A A;  1DJZ A;  1HQV A;  1JSA A;  3VRR A;  3I5I C;  3IQO A;  3I5G B;  1K90 D;  1B8R A;  2GV5 A;  1NCZ A;  5CSJ A;  4CFQ A;  1BJF A;  3VRQ A;  4MZK A;  1AK8 A;  2PSR A;  1QX2 A;  2FOT A;  2KAV A;  2LLS A;  2MRD A;  1QV0 A;  2WCF A;  5HLV A;  1PAL A;  1LA0 A;  2NCP A;  3FIA A;  1YUU A;  4QJ3 B;  2JZI A;  4GPL B;  1NPQ A;  3EK4 A;  2LAP A;  2AMI A;  4A4C A;  1QXP A;  3NSI A;  1SR6 B;  1QS7 A;  4YGB B;  2I94 A;  3LL8 B;  1NP8 A;  2NZ0 A;  1OOJ A;  1CTR A;  2ZNE A;  3JTD B;  3SG6 A;  1J7O A;  4MBE A;  3A4U B;  1EG4 A;  2F3Y A;  4PAL A;  2WOS A;  1DJW A;  1IG5 A;  2HQW A;  3TDU A;  1WDC B;  1S6C A;  1Y6W A;  3A8R A;  4MZL A;  4PE1 A;  2F3Z A;  2M29 A;  1SKT A;  1XO5 A;  1PSR A;  5HKW A;  3VRO A;  1SPY A;  1DF0 B;  1LA3 A;  1GGW A;  2BKI B;  2LAN A;  1W7I B;  1MQ1 A;  4GGN A;  1LXF C;  5AAN A;  3AKA A;  2V53 A;  1MWN A;  1QTX A;  1Y1A A;  3EKH A;  1DJX A;  1N0Y A;  2FCE A;  3GOF A;  5KTY A;  2OTG B;  4YI8 A;  5I8N A;  1AVS A;  1WLZ A;  5I2L A;  1M39 A;  1CFP A;  1BMO A;  3NSK A;  1W7J B;  4GAO A;  1CB1 A;  5JJG A;  2EGD A;  1NCX A;  3OB1 B;  2P6B B;  2IS9 A;  4GFT A;  1J55 A;  2ZKM X;  1XFW O;  1ZMZ A;  3OX6 A;  4PE4 A;  4HRG A;  4YGE B;  4GNK B;  1S5G Y;  1DF0 A;  1OZS A;  3D10 A;  4PHN A;  2JC2 A;  2G9B A;  1KFU S;  3M0W A;  2K8M B;  1YTZ C;  3BOW B;  1YUR A;  4USL A;  2MLF C;  4HRE E;  1OZO A;  2G2B A;  3AAK A;  1F71 A;  5G08 A;  4I5L B;  5JOL A;  3WHU B;  2KBM A;  1QIW A;  1TNW A;  4N1G A;  1CKK A;  1J1D A;  2NCO A;  1BR1 B;  1KWO B;  2LUX A;  3IF7 A;  3HX4 A;  2LVK A;  5TNC A;  1SL7 A;  1B47 A;  1ZFS A;  4P2Y B;  1S26 D;  2L4I A;  2JUL A;  2M1U A;  1KQM C;  1Y1U A;  2ZN8 A;  3OB2 B;  5D69 A;  2K7C A;  3KPX A;  4ICB A;  3PFV A;  1L2O B;  2KBI A;  2KGB C;  2L98 A;  2E30 A;  2PMY A;  3FWB A;  4MN0 A;  3SG4 A;  4QJ4 B;  1YUS A;  3CLN A;  1BR4 B;  3LCP C;  2LHI A;  5AEQ A;  1RRO A;  4DRW A;  1JFJ A;  1H8B A;  2KI6 D;  1AP4 A;  1EXR A;  4DCK A;  2M97 A;  2RGI A;  3F45 A;  2KFH A;  2JQ6 A;  4YGC B;  1CMG A;  2BCB A;  2DOQ A;  1Y0V H;  2CBL A;  1K95 A;  1WRZ A;  3EVV A;  3PAT A;  2BEC A;  2JU0 A;  2Y5I A;  1KFX S;  4ZCV A;  2BE4 A;  2JTT A;  1F4Q A;  2M49 B;  1DGU A;  3I5I B;  3CR4 X;  1NUB A;  1S6J A;  3KF9 A;  2K0J A;  4XJK A;  4PDZ A;  5FYX A;  3EVR A;  1SNL A;  4JQ0 D;  1QVI Y;  2R2I A;  1REC A;  1BLQ A;  5HKY A;  2JPT A;  4GBA A;  2KGR A;  5CSF A;  1KK7 Y;  1TRF A;  1TTX A;  3TDZ A;  1Y1X A;  1X02 A;  2KFG A;  4WQ3 A;  2KI6 C;  1DTL A;  1PRW A;  1B7T Z;  4PHJ A;  2KOT A;  4MRY A;  3SIA A;  3NXA A;  3TZ1 A;  2LLU A;  1QIV A;  1CNP A;  1SCM C;  1DMO A;  1M46 A;  2Q91 A;  1GGZ A;  1SCV A;  1QX5 B;  3CTN A;  3GK1 A;  3DVM A;  1LIN A;  3BUM B;  3EK8 A;  1YX8 A;  2OPO A;  1F4O A;  1UHH A;  1U5I A;  1FI5 A;  1NWD A;  4OR9 B;  4IL1 A;  2H2K A;  2JTZ A;  1JBA A;  3KHE A;  2KHN A;  4YGD B;  1BOD A;  4NDC A;  1XFX O;  1E8A A;  2FCD A;  4Q04 A;  4GUK A;  1EH2 A;  1CDL A;  1NSH A;  3CGA A;  1IGV A;  1IJ5 A;  1DJI A;  1B8C A;  2WOR A;  4U8D A;  4L9M A;  2EC6 C;  1OSA A;  1UHN A;  2AAO A;  2KDH A;  4BY5 A;  2MLE C;  4N5X A;  5AER A;  3O6B A;  1IRJ A;  1K9U A;  1WY9 A;  4FQO A;  1CFC A;  1Q80 A;  2CTN A;  2LUC A;  3GK4 X;  3EVU A;  1UWO A;  4WQ2 A;  4OKH A;  3RM1 A;  1DJH A;  2PAS A;  3CR5 X;  3VGO A;  4A4B A;  2L0P A;  1FW4 A;  4M2Q A;  1SBJ A;  3RLZ A;  2KAX A;  1CFD A;  1MXL C;  3BXK A;  3O4Y A;  1BT6 A;  2HPS A;  4JWQ A;  1TN4 A;  2KNE A;  5DKR A;  2JNX A;  3CS1 A;  1IJ6 A;  1YX7 A;  1SW8 A;  3HCM A;  3KO0 A;  4MVF A;  5DKQ A;  4HRH A;  1JFK A;  3BYA A;  1QAT A;  4ORA B;  3I5H C;  3EK7 A;  4ORC B;  3CZT X;  2NLN A;  1PVA A;  2F33 A;  4E68 A;  2CCM A;  3ZNI A;  1KK8 C;  2M0R A;  1AUI B;  1S3P A;  1NX0 A;  1A75 A;  3AAJ A;  4TNC A;  1UUS A;  4PCW A;  3TUY C;  3FS7 A;  2LMV A;  4NQG A;  1PK0 D;  2BE6 A;  3PM8 A;  4ORB B;  2F2O A;  1KQM B;  1SYM A;  4M2O A;  1PSB A;  1RJV A;  1AHR A;  4ZCU A;  2NXQ A;  5HLO A;  2JT8 A;  2KAY A;  3BUW B;  1QLS A;  3K21 A;  1M45 A;  1ALW A;  1IWQ A;  2A4J A;  4CLN A;  1WDC C;  2KYC A;  4C0K A;  1JUO A;  5PAL A;  1A2X A;  1SK6 D;  3DF0 A;  2PVB A;  1DVI A;  1UUR A;  1V1G A;  1IQ5 A;  1NIW A;  1TIZ A;  2QPT A;  4AQI A;  4OV2 A;  1XYD A;  4YGA A;  1IH0 A;  4I5K A;  4D1E A;  1MR8 A;  1S36 A;  2LP2 A;  1K2H A;  5K89 A;  2B1U A;  4XJK B;  3KEV A;  2BBM A;  5CPV A;  1CLM A;  1D1O A;  2JRF A;  4C0L A;  1J1E A;  3JVT C;  4P5O E;  2LLT A;  1C7V A;  2OS8 C;  1L7Z A;  1XFY O;  2LE9 B;  2TN4 A;  1QX7 A;  2VRG A;  2ZND A;  2FJU B;  3PN7 C;  2MJW B;  2F2P A;  1N2D A;  3SIB A;  1WLM A;  1SY9 A;  2KFF A;  5ER4 X;  5HYD A;  2BBN A;  1A29 A;  1EL4 A;  5I2Q A;  1SCM B;  2MBX A;  2HET A;  2K2F A;  2I18 A;  1G4Y R;  2KI4 C;  1KFU L;  1BU3 A;  3TS5 C;  1U5I B;  1CFF A;  1WRK A;  4N1F A;  1M31 A;  2LC5 A;  4I5J A;  2LP3 A;  2LV7 A;  2BL0 C;  2WCB A;  1G8I A;  3D0Y A;  4NDD A;  5CSN A;  1TCO B;  3OP0 A;  1F8H A;  4DIR A;  5AXI A;  1FBV A;  1QJT A;  2K61 A;  3BUO B;  2JXL A;  2EC6 B;  1NX3 A;  3VRP A;  1MHO A;  3I5F C;  3NSO A;  3DVJ A;  4ETO A;  5CSI A;  1NX2 A;  1QAS A;  2LVI A;  2KYF A;  4GGF C;  1DJY A;  5GQQ C;  4GGF A;  4UPG A;  1MF8 B;  2E6W A;  2BCA A;  1TNQ A;  1FPW A;  1ZOT B;  4WRI A;  4OVN F;  1RTP 1;  1KQV A;  3LLE A;  1K96 A;  2JXC A;  1UP5 A;  2HQ8 A;  1TOP A;  5J3X A;  1TNP A;  3CR2 A;  2AUC A;  2KSP A;  2O60 A;  1CDP A;  4FTG A;  5KU1 A;  1XFV O;  1K8U A;  2ISD A;  3WHT B;  1K94 A;  1ZAC A;  5HKZ A;  5D7F A;  1SRA A;  4DS7 A;  2KQ6 A;  2WND A;  1NX1 A;  1M63 B;  1B7T Y;  1SL8 A;  1YVL A;  4I5N B;  4YI9 A;  1OMV A;  5KSZ A;  1AJ5 A;  2D8N A;  1SL9 A;  3I5H B;  4XYN A;  2K7D A;  1C7W A;  1G33 A;  1PUL A;  3WXA A;  1CDN A;  3PLF B;  3WNX B;  3MSE B;  2K7B A;  2CT9 A;  1KSM A;  1XFU O;  2ZRS A;  1KK8 B;  1UHK A;  3NSL A;  1A75 B;  3DVK A;  3OX5 A;  3DVE A;  2K7O A;  2LHL A;  2MHH A;  1N65 A;  2EHB A;  4CPV A;  3TUY B;  2JT3 A;  1HT9 A;  2M1K B;  1ALV A;  2L50 A;  2O5G A;  1XFZ O;  3I5G C;  1R6P A;  4NDB A;  2SCP A;  2ZN9 A;  3SG5 A;  3BQ3 A;  4MSP A;  1LKJ A;  3IQQ A;  1EJ3 A;  4CID A;  1S5G Z;  4DUQ A;  4R1E A;  1J7R A;  3DF0 B; 
#chains in the Genus database with same CATH topology
 1CM4 A;  2H61 C;  3BUN B;  3CWG A;  3OHM B;  1YUT A;  2H61 A;  1F70 A;  1BG1 A;  3SG2 A;  1B9A A;  2KPH A;  1WRL A;  2M7L A;  3H4S E;  1JF2 A;  2MAZ A;  1C07 A;  3GK2 A;  1MUX A;  3QME A;  1FI6 A;  1ODB A;  2L4H A;  4PHK A;  1K93 D;  1R2U A;  1SR6 C;  5BPJ A;  3ZWH A;  1RWY A;  1ZUZ A;  1NCY A;  2ZFD A;  1J7P A;  3ICB A;  1DGV A;  4MEW A;  1J7Q A;  3JTD C;  1JC2 A;  1NYA A;  2WC8 A;  5I94 A;  5ER5 A;  1YRT B;  4C0J A;  3JVT B;  4MLW A;  2K2A A;  1KCY A;  4F0Z B;  1YR5 A;  1B4C A;  2OS8 B;  4MZJ A;  3B7A A;  1GJY A;  1JF0 A;  3PAL A;  3FWC A;  1A03 A;  1QV1 A;  3SJS A;  4AQJ A;  2SAS A;  1FF1 A;  3B6X A;  3PN7 B;  1PVB A;  1TCF A;  1B8L A;  2HF5 A;  2LMU A;  2JT0 A;  3DD4 A;  1VRK A;  2CNP A;  3VRN A;  2KLD A;  1UHI A;  1DT7 B;  2KI4 B;  1V1F A;  2KLE A;  2M3W A;  3TS5 B;  1CLB A;  1TUJ A;  2Y1N A;  2LCP A;  2ZRT A;  3TDI A;  5DIC A;  1CDM A;  1UHJ A;  2COL B;  2LVV A;  2OTG C;  4YBH B;  3CZ2 A;  2JWW A;  3DXL A;  5IBW A;  1OOH A;  2BL0 B;  2BCX A;  2JOJ A;  2LMT A;  4QJ5 B;  3D0Y B;  3CYZ A;  3FE9 A;  2CXJ A;  5AFP A;  1YVH A;  1CLL A;  1CMF A;  2Q4U A;  3AKB A;  3SG3 A;  1QVI Z;  1K9K A;  1QLK A;  1XA5 A;  2LM5 A;  1GQM A;  1XVJ A;  2M7N A;  3Q8I A;  1OQP A;  2GGM A;  3K1E A;  2I2R E;  3I5F B;  2BKH B;  3OGN A;  5I2O A;  1KK7 Z;  2L5X B;  3LK0 A;  2F8P A;  2PAL A;  3BOW A;  2JPO A;  5DKN A;  1XK4 C;  3L47 A;  5B8I B;  1XK4 A;  2MA2 A;  3S0A A;  2QAC A;  3C1V A;  1BOC A;  3CDN A;  1RFJ A;  2L2E A;  1DJG A;  2LVJ A;  2M8U A;  2PRU A;  2JNF A;  2L51 A;  3S0F A;  1MXE A;  1LVC D;  1S6I A;  2Y4Q A;  4HSZ A;  4CFR A;  1F54 A;  1KWO C;  3O2P A;  1EG3 A;  1OE9 B;  1SMG A;  2GGZ A;  4IJ7 A;  1B1G A;  3LK1 A;  4PHM A;  1YRU B;  3BJH A;  2Y1M A;  4AOM A;  1RK9 A;  1BF5 A;  1CM1 A;  4YRU A;  5F6T A;  1L2O C;  1KSO A;  4PE0 A;  1F55 A;  1TNX A;  2KQY A;  1K9P A;  2LNK A;  3NHT A;  4JPZ B;  1OMD A;  1IKU A;  1IQ3 A;  3BUX B;  2M9G A;  3EKJ A;  3D77 A;  1AJ4 A;  4PE7 A;  3L4A A;  3QRX A;  2WCE A;  3S0E A;  4OCI A;  4M2P A;  4MRX A;  4BY4 A;  1A4P A;  5FI2 A;  1H4B A;  1S1E A;  3O78 A;  3PSR A;  1JWD A;  1OMR A;  3SG7 A;  3E3R A;  1KFX L;  2I7A A;  1DJZ A;  1HQV A;  1JSA A;  3VRR A;  3I5I C;  3IQO A;  1P28 A;  3I5G B;  1K90 D;  1B8R A;  2PYQ A;  2GV5 A;  1NCZ A;  5CSJ A;  4CFQ A;  1BJF A;  2QEB A;  3VRQ A;  4MZK A;  1AK8 A;  2PSR A;  1QX2 A;  2FOT A;  2KAV A;  2LLS A;  1ORG A;  1QV0 A;  2MRD A;  2WCF A;  1PAL A;  5HLV A;  1LA0 A;  2NCP A;  3FIA A;  1YUU A;  4QJ3 B;  2JZI A;  4GPL B;  1NPQ A;  3EK4 A;  4INW A;  2LAP A;  2AMI A;  4A4C A;  1IIO A;  1QXP A;  3NSI A;  1SR6 B;  2WC6 A;  1QS7 A;  4YGB B;  2I94 A;  3LL8 B;  5FI7 A;  1NP8 A;  2NZ0 A;  1OOJ A;  1CTR A;  2PQL A;  2ZNE A;  3JTD B;  3SG6 A;  1J7O A;  4MBE A;  3A4U B;  1EG4 A;  2F3Y A;  4PAL A;  2P70 A;  2WOS A;  1DJW A;  1IG5 A;  2HQW A;  3TDU A;  1WDC B;  1S6C A;  1Y6W A;  3A8R A;  4MZL A;  4PE1 A;  2F3Z A;  2M29 A;  1SKT A;  1XO5 A;  1PSR A;  5HKW A;  4INX A;  3VRO A;  1SPY A;  1DF0 B;  1LA3 A;  2BNX A;  1GGW A;  2BKI B;  2LAN A;  1W7I B;  2WCM A;  1MQ1 A;  3FE8 A;  4GGN A;  1LXF C;  3BFA A;  3AKA A;  5AAN A;  2V53 A;  1MWN A;  1QTX A;  1Y1A A;  3EKH A;  1DJX A;  1N0Y A;  2FCE A;  3GOF A;  5KTY A;  2OTG B;  4YI8 A;  2WCL A;  5I8N A;  1AVS A;  1WLZ A;  5D3O A;  5I2L A;  1M39 A;  1CFP A;  1BMO A;  3NSK A;  1W7J B;  1T14 A;  4GAO A;  1CB1 A;  5JJG A;  2EGD A;  1NCX A;  3OB1 B;  1DEK A;  2P6B B;  2IS9 A;  1SSE B;  4GFT A;  1J55 A;  3DYE A;  2ZKM X;  1XFW O;  1ZMZ A;  3B88 A;  3OX6 A;  4HRG A;  4PE4 A;  4YGE B;  4GNK B;  1S5G Y;  1DF0 A;  1OZS A;  3D10 A;  1OW4 A;  1DC1 A;  4PHN A;  2JC2 A;  2G9B A;  1KFU S;  3M0W A;  2K8M B;  1YTZ C;  3BOW B;  1YUR A;  4USL A;  5FI6 A;  2MLF C;  4HRE E;  1OZO A;  2G2B A;  3AAK A;  1F71 A;  5G08 A;  4I5L B;  5JOL A;  3WHU B;  2KBM A;  1QIW A;  1TNW A;  4N1G A;  3CZ1 A;  1CKK A;  1J1D A;  2NCO A;  1BR1 B;  1KWO B;  2LUX A;  3IF7 A;  3HX4 A;  2LVK A;  5TNC A;  1C3Y A;  1SL7 A;  1B47 A;  1ZFS A;  4P2Y B;  1S26 D;  2L4I A;  2JUL A;  2M1U A;  1KQM C;  3BFB A;  1Y1U A;  2ZN8 A;  3OB2 B;  5D69 A;  4F7F A;  2K7C A;  2L5Y A;  3KPX A;  4ICB A;  3PFV A;  1L2O B;  2KBI A;  2KGB C;  2L98 A;  2E30 A;  2PMY A;  3FWB A;  4MN0 A;  3SG4 A;  4QJ4 B;  1YUS A;  3CLN A;  1BR4 B;  3LCP C;  2LHI A;  5AEQ A;  1RRO A;  4DRW A;  1JFJ A;  1H8B A;  2KI6 D;  1AP4 A;  1EXR A;  4DCK A;  2M97 A;  2RGI A;  3F45 A;  2KFH A;  2JQ6 A;  4YGC B;  1CMG A;  2BCB A;  2DOQ A;  1Y0V H;  2CBL A;  1K95 A;  1WRZ A;  3EVV A;  3PAT A;  2BEC A;  2JU0 A;  2Y5I A;  1KFX S;  3S0D A;  2WCK A;  4ZCV A;  2BE4 A;  2JTT A;  1F4Q A;  2M49 B;  1DGU A;  3I5I B;  3CR4 X;  1NUB A;  1S6J A;  3KF9 A;  2K0J A;  4XJK A;  4PDZ A;  5FYX A;  3EVR A;  1SNL A;  4JQ0 D;  1QVI Y;  2R2I A;  1REC A;  1BLQ A;  5HKY A;  2JPT A;  4GBA A;  2KGR A;  5CSF A;  1KK7 Y;  1TRF A;  1Z2C B;  1TTX A;  3TDZ A;  3BFH A;  1Y1X A;  1X02 A;  2KFG A;  4WQ3 A;  2KI6 C;  1DTL A;  1PRW A;  1B7T Z;  4PHJ A;  2KOT A;  4MRY A;  3SIA A;  3NXA A;  3TZ1 A;  2LLU A;  1QIV A;  4OZD A;  1CNP A;  1SCM C;  1DMO A;  1M46 A;  2Q91 A;  1GGZ A;  1SCV A;  1QX5 B;  3CTN A;  3GK1 A;  3DVM A;  1LIN A;  3BUM B;  2QDI A;  2QEO A;  3EK8 A;  1YX8 A;  2OPO A;  1F4O A;  1UHH A;  1U5I A;  1FI5 A;  1NWD A;  4OR9 B;  4IL1 A;  2H2K A;  2JTZ A;  1JBA A;  3KHE A;  2KHN A;  4YGD B;  3D75 A;  1BOD A;  4NDC A;  1XFX O;  4PT1 A;  1E8A A;  2FCD A;  4Q04 A;  4GUK A;  1EH2 A;  1CDL A;  1NSH A;  3CGA A;  3PM2 A;  1IGV A;  1IJ5 A;  1DJI A;  1B8C A;  2WOR A;  4U8D A;  4L9M A;  2EC6 C;  1OSA A;  1UHN A;  2AAO A;  2KDH A;  4BY5 A;  2MLE C;  4N5X A;  5AER A;  3O6B A;  1IRJ A;  1K9U A;  1WY9 A;  4FQO A;  1CFC A;  1Q80 A;  2CTN A;  2LUC A;  3GK4 X;  3EVU A;  3O4X A;  1UWO A;  4WQ2 A;  4OKH A;  1Z4H A;  3RM1 A;  3IVT A;  1DJH A;  3UO9 A;  2PAS A;  3CR5 X;  1OOI X;  3VGO A;  4A4B A;  2L0P A;  1FW4 A;  4M2Q A;  1SBJ A;  3RLZ A;  2KAX A;  1CFD A;  1MXL C;  3BXK A;  3O4Y A;  1BT6 A;  2HPS A;  4JWQ A;  1TN4 A;  2KNE A;  5DKR A;  2JNX A;  3CS1 A;  1IJ6 A;  1YX7 A;  1SW8 A;  3HCM A;  3KO0 A;  4MVF A;  5DKQ A;  3SS4 A;  3CAB A;  4HRH A;  1JFK A;  3BYA A;  1LS8 A;  1QAT A;  4ORA B;  3I5H C;  2WC5 A;  3EK7 A;  4ORC B;  3CZT X;  2NLN A;  1PVA A;  2F33 A;  4E68 A;  2CCM A;  3ZNI A;  1KK8 C;  2M0R A;  1AUI B;  1S3P A;  1NX0 A;  1A75 A;  4KYN A;  3AAJ A;  4TNC A;  1UUS A;  4PCW A;  3TUY C;  3FS7 A;  2LMV A;  4NQG A;  1PK0 D;  2BE6 A;  3PM8 A;  4ORB B;  2F2O A;  1KQM B;  3FE6 A;  1SYM A;  3D76 A;  4M2O A;  1PSB A;  1RJV A;  3DY9 A;  1AHR A;  4ZCU A;  2NXQ A;  5HLO A;  2JT8 A;  2KAY A;  2BAP A;  3BUW B;  1QLS A;  3SS3 A;  3K21 A;  3L4L A;  1M45 A;  1ALW A;  3D73 A;  1IWQ A;  2A4J A;  4CLN A;  1WDC C;  2KYC A;  4C0K A;  1JUO A;  5PAL A;  1A2X A;  1SK6 D;  3DF0 A;  2PVB A;  1DVI A;  1UUR A;  1TWO A;  1QWV A;  1W9Z A;  1V1G A;  1IQ5 A;  1C3Z A;  1NIW A;  1TIZ A;  2QEV A;  2QPT A;  4AQI A;  4OV2 A;  1XYD A;  4YGA A;  1IH0 A;  4I5K A;  4D1E A;  1MR8 A;  1S36 A;  2LP2 A;  1K2H A;  1OOG A;  5K89 A;  4FQT A;  2B1U A;  4XJK B;  3R72 A;  3KEV A;  2BBM A;  5CPV A;  1CLM A;  1D1O A;  2JRF A;  4C0L A;  1J1E A;  3JVT C;  4JD9 A;  4P5O E;  2LLT A;  1C7V A;  3RZS A;  2OS8 C;  1L7Z A;  1XFY O;  2LE9 B;  2TN4 A;  2YGU A;  3S0G A;  1QX7 A;  2VRG A;  2ZND A;  3DZT A;  2FJU B;  3PN7 C;  2MJW B;  2F2P A;  1N2D A;  3R1O A;  3SIB A;  1WLM A;  1SY9 A;  2KFF A;  5ER4 X;  5HYD A;  2BBN A;  1A29 A;  1EL4 A;  5I2Q A;  1SCM B;  3V2L A;  2MBX A;  3N7H A;  3UNW A;  2HET A;  2K2F A;  2I18 A;  3R1P A;  3CZ0 A;  1G4Y R;  2KI4 C;  1KFU L;  1BU3 A;  3TS5 C;  1GM0 A;  3OBV A;  1U5I B;  1CFF A;  2K60 A;  1WRK A;  4N1F A;  1M31 A;  2LC5 A;  4I5J A;  2LP3 A;  2LV7 A;  2BL0 C;  5EL2 A;  3R1V A;  2WCB A;  1G8I A;  3D0Y A;  4NDD A;  5CSN A;  1TCO B;  3OP0 A;  1F8H A;  4DIR A;  5AXI A;  1FBV A;  1QJT A;  2K61 A;  3BUO B;  2JXL A;  2EC6 B;  1NX3 A;  3VB1 A;  2FJY A;  2P71 A;  3VRP A;  1MHO A;  3I5F C;  3NSO A;  3DVJ A;  4ETO A;  5CSI A;  1NX2 A;  1QAS A;  3B87 A;  2LVI A;  2KYF A;  4GGF C;  1DJY A;  5GQQ C;  4GGF A;  4UPG A;  3S0B A;  1MF8 B;  2E6W A;  3EG5 B;  2BCA A;  1TNQ A;  1FPW A;  1ZOT B;  4WRI A;  4OVN F;  3NGV A;  1RTP 1;  1OOF A;  1KQV A;  2L2C A;  3LLE A;  1K96 A;  2JXC A;  1XFR A;  1UP5 A;  2HQ8 A;  1TOP A;  5J3X A;  1TNP A;  5HL1 A;  3CR2 A;  2AUC A;  2KSP A;  2O60 A;  1CDP A;  4FTG A;  5KU1 A;  1DQE A;  1XFV O;  1K8U A;  2ISD A;  4JKT A;  1K94 A;  3WHT B;  1ZAC A;  3PJI A;  5HKZ A;  5D7F A;  1SRA A;  4DS7 A;  2WCH A;  1DEL A;  2KQ6 A;  1NX1 A;  1M63 B;  2QEH A;  2WND A;  1B7T Y;  1SL8 A;  1YVL A;  4I5N B;  4YI9 A;  1OMV A;  5KSZ A;  1AJ5 A;  2D8N A;  1SL9 A;  3I5H B;  4XYN A;  2K7D A;  1C7W A;  1G33 A;  3D74 A;  1PUL A;  3WXA A;  1CDN A;  3PLF B;  3WNX B;  2WCJ A;  3MSE B;  2K7B A;  2CT9 A;  1KSM A;  1XFU O;  2ZRS A;  1KK8 B;  1UHK A;  3NSL A;  1A75 B;  2ERB A;  3DVK A;  3OX5 A;  3DVE A;  2K7O A;  1TUZ A;  2LHL A;  2MHH A;  1N65 A;  2EHB A;  4CPV A;  3TUY B;  2JT3 A;  1HT9 A;  3B86 A;  3SS5 A;  2M1K B;  1ALV A;  2GTE A;  2L50 A;  2O5G A;  1XFZ O;  3I5G C;  1R6P A;  4NDB A;  2SCP A;  2ZN9 A;  3D78 A;  3SG5 A;  3BQ3 A;  3NHI A;  4MSP A;  1LKJ A;  3IQQ A;  2H8V A;  1EJ3 A;  4CID A;  1S5G Z;  4DUQ A;  4R1E A;  1J7R A;  3DF0 B; 
#chains in the Genus database with same CATH homology
 1CM4 A;  2H61 C;  3BUN B;  3CWG A;  3OHM B;  1YUT A;  2H61 A;  1F70 A;  1BG1 A;  3SG2 A;  1B9A A;  2M7L A;  1WRL A;  3H4S E;  1JF2 A;  2MAZ A;  1C07 A;  3GK2 A;  1MUX A;  1FI6 A;  1ODB A;  2L4H A;  4PHK A;  1K93 D;  1R2U A;  1SR6 C;  5BPJ A;  3ZWH A;  1RWY A;  1ZUZ A;  1NCY A;  2ZFD A;  1J7P A;  3ICB A;  1DGV A;  4MEW A;  1J7Q A;  3JTD C;  1JC2 A;  1NYA A;  2WC8 A;  5ER5 A;  1YRT B;  4C0J A;  3JVT B;  4MLW A;  2K2A A;  1KCY A;  4F0Z B;  1YR5 A;  1B4C A;  2OS8 B;  4MZJ A;  1GJY A;  1JF0 A;  3PAL A;  3FWC A;  1A03 A;  1QV1 A;  3SJS A;  4AQJ A;  2SAS A;  1FF1 A;  3PN7 B;  1PVB A;  1TCF A;  1B8L A;  2HF5 A;  2LMU A;  2JT0 A;  3DD4 A;  1VRK A;  2CNP A;  3VRN A;  1UHI A;  1DT7 B;  2KI4 B;  1V1F A;  2M3W A;  3TS5 B;  1CLB A;  2Y1N A;  2LCP A;  2ZRT A;  3TDI A;  1CDM A;  1UHJ A;  2COL B;  2LVV A;  2OTG C;  4YBH B;  2JWW A;  5IBW A;  2BL0 B;  2JOJ A;  2BCX A;  2LMT A;  4QJ5 B;  3D0Y B;  2CXJ A;  5AFP A;  1YVH A;  1CLL A;  1CMF A;  2Q4U A;  3AKB A;  3SG3 A;  1QVI Z;  1K9K A;  1QLK A;  1XA5 A;  2LM5 A;  1GQM A;  1XVJ A;  2M7N A;  1OQP A;  2GGM A;  2I2R E;  3I5F B;  2BKH B;  5I2O A;  1KK7 Z;  2L5X B;  3LK0 A;  2F8P A;  2PAL A;  3BOW A;  5DKN A;  1XK4 C;  5B8I B;  1XK4 A;  2MA2 A;  2QAC A;  3C1V A;  1BOC A;  1RFJ A;  2L2E A;  1DJG A;  2LVJ A;  2M8U A;  2PRU A;  2JNF A;  2L51 A;  1MXE A;  1LVC D;  1S6I A;  2Y4Q A;  4HSZ A;  4CFR A;  1F54 A;  1KWO C;  3O2P A;  1EG3 A;  1OE9 B;  1SMG A;  2GGZ A;  1B1G A;  3LK1 A;  4PHM A;  1YRU B;  2Y1M A;  4AOM A;  1RK9 A;  1BF5 A;  1CM1 A;  4YRU A;  5F6T A;  1L2O C;  1KSO A;  4PE0 A;  1F55 A;  1TNX A;  2KQY A;  1K9P A;  2LNK A;  4JPZ B;  1OMD A;  1IKU A;  1IQ3 A;  3BUX B;  2M9G A;  3EKJ A;  4PE7 A;  1AJ4 A;  3QRX A;  2WCE A;  4OCI A;  4M2P A;  4MRX A;  4BY4 A;  1A4P A;  1H4B A;  1S1E A;  3O78 A;  3PSR A;  1JWD A;  1OMR A;  3SG7 A;  3E3R A;  1KFX L;  2I7A A;  1DJZ A;  1HQV A;  1JSA A;  3VRR A;  3I5I C;  3IQO A;  3I5G B;  1K90 D;  1B8R A;  2GV5 A;  1NCZ A;  5CSJ A;  4CFQ A;  1BJF A;  3VRQ A;  4MZK A;  1AK8 A;  2PSR A;  1QX2 A;  2FOT A;  2KAV A;  2LLS A;  2MRD A;  1QV0 A;  2WCF A;  5HLV A;  1PAL A;  1LA0 A;  2NCP A;  3FIA A;  1YUU A;  4QJ3 B;  2JZI A;  4GPL B;  1NPQ A;  3EK4 A;  2LAP A;  2AMI A;  4A4C A;  1QXP A;  3NSI A;  1SR6 B;  1QS7 A;  4YGB B;  2I94 A;  3LL8 B;  1NP8 A;  2NZ0 A;  1OOJ A;  1CTR A;  2ZNE A;  3JTD B;  3SG6 A;  1J7O A;  4MBE A;  3A4U B;  1EG4 A;  2F3Y A;  4PAL A;  2WOS A;  1DJW A;  1IG5 A;  2HQW A;  3TDU A;  1WDC B;  1S6C A;  1Y6W A;  3A8R A;  4MZL A;  4PE1 A;  2F3Z A;  2M29 A;  1SKT A;  1XO5 A;  1PSR A;  5HKW A;  3VRO A;  1SPY A;  1DF0 B;  1LA3 A;  1GGW A;  2BKI B;  2LAN A;  1W7I B;  1MQ1 A;  4GGN A;  1LXF C;  5AAN A;  3AKA A;  2V53 A;  1MWN A;  1QTX A;  1Y1A A;  3EKH A;  1DJX A;  1N0Y A;  2FCE A;  3GOF A;  5KTY A;  2OTG B;  4YI8 A;  5I8N A;  1AVS A;  1WLZ A;  5I2L A;  1M39 A;  1CFP A;  1BMO A;  3NSK A;  1W7J B;  4GAO A;  1CB1 A;  5JJG A;  2EGD A;  1NCX A;  3OB1 B;  2P6B B;  2IS9 A;  4GFT A;  1J55 A;  2ZKM X;  1XFW O;  1ZMZ A;  3OX6 A;  4PE4 A;  4HRG A;  4YGE B;  4GNK B;  1S5G Y;  1DF0 A;  1OZS A;  3D10 A;  4PHN A;  2JC2 A;  2G9B A;  1KFU S;  3M0W A;  2K8M B;  1YTZ C;  3BOW B;  1YUR A;  4USL A;  2MLF C;  4HRE E;  1OZO A;  2G2B A;  3AAK A;  1F71 A;  5G08 A;  4I5L B;  5JOL A;  3WHU B;  2KBM A;  1QIW A;  1TNW A;  4N1G A;  1CKK A;  1J1D A;  2NCO A;  1BR1 B;  1KWO B;  2LUX A;  3IF7 A;  3HX4 A;  2LVK A;  5TNC A;  1SL7 A;  1B47 A;  1ZFS A;  4P2Y B;  1S26 D;  2L4I A;  2JUL A;  2M1U A;  1KQM C;  1Y1U A;  2ZN8 A;  3OB2 B;  5D69 A;  2K7C A;  3KPX A;  4ICB A;  3PFV A;  1L2O B;  2KBI A;  2KGB C;  2L98 A;  2E30 A;  2PMY A;  3FWB A;  4MN0 A;  3SG4 A;  4QJ4 B;  1YUS A;  3CLN A;  1BR4 B;  3LCP C;  2LHI A;  5AEQ A;  1RRO A;  4DRW A;  1JFJ A;  1H8B A;  2KI6 D;  1AP4 A;  1EXR A;  4DCK A;  2M97 A;  2RGI A;  3F45 A;  2KFH A;  2JQ6 A;  4YGC B;  1CMG A;  2BCB A;  2DOQ A;  1Y0V H;  2CBL A;  1K95 A;  1WRZ A;  3EVV A;  3PAT A;  2BEC A;  2JU0 A;  2Y5I A;  1KFX S;  4ZCV A;  2BE4 A;  2JTT A;  1F4Q A;  2M49 B;  1DGU A;  3I5I B;  3CR4 X;  1NUB A;  1S6J A;  3KF9 A;  2K0J A;  4XJK A;  4PDZ A;  5FYX A;  3EVR A;  1SNL A;  4JQ0 D;  1QVI Y;  2R2I A;  1REC A;  1BLQ A;  5HKY A;  2JPT A;  4GBA A;  2KGR A;  5CSF A;  1KK7 Y;  1TRF A;  1TTX A;  3TDZ A;  1Y1X A;  1X02 A;  2KFG A;  4WQ3 A;  2KI6 C;  1DTL A;  1PRW A;  1B7T Z;  4PHJ A;  2KOT A;  4MRY A;  3SIA A;  3NXA A;  3TZ1 A;  2LLU A;  1QIV A;  1CNP A;  1SCM C;  1DMO A;  1M46 A;  2Q91 A;  1GGZ A;  1SCV A;  1QX5 B;  3CTN A;  3GK1 A;  3DVM A;  1LIN A;  3BUM B;  3EK8 A;  1YX8 A;  2OPO A;  1F4O A;  1UHH A;  1U5I A;  1FI5 A;  1NWD A;  4OR9 B;  4IL1 A;  2H2K A;  2JTZ A;  1JBA A;  3KHE A;  2KHN A;  4YGD B;  1BOD A;  4NDC A;  1XFX O;  1E8A A;  2FCD A;  4Q04 A;  4GUK A;  1EH2 A;  1CDL A;  1NSH A;  3CGA A;  1IGV A;  1IJ5 A;  1DJI A;  1B8C A;  2WOR A;  4U8D A;  4L9M A;  2EC6 C;  1OSA A;  1UHN A;  2AAO A;  2KDH A;  4BY5 A;  2MLE C;  4N5X A;  5AER A;  3O6B A;  1IRJ A;  1K9U A;  1WY9 A;  4FQO A;  1CFC A;  1Q80 A;  2CTN A;  2LUC A;  3GK4 X;  3EVU A;  1UWO A;  4WQ2 A;  4OKH A;  3RM1 A;  1DJH A;  2PAS A;  3CR5 X;  3VGO A;  4A4B A;  2L0P A;  1FW4 A;  4M2Q A;  1SBJ A;  3RLZ A;  2KAX A;  1CFD A;  1MXL C;  3BXK A;  3O4Y A;  1BT6 A;  2HPS A;  4JWQ A;  1TN4 A;  2KNE A;  5DKR A;  2JNX A;  3CS1 A;  1IJ6 A;  1YX7 A;  1SW8 A;  3HCM A;  3KO0 A;  4MVF A;  5DKQ A;  4HRH A;  1JFK A;  3BYA A;  1QAT A;  4ORA B;  3I5H C;  3EK7 A;  4ORC B;  3CZT X;  2NLN A;  1PVA A;  2F33 A;  4E68 A;  2CCM A;  3ZNI A;  1KK8 C;  2M0R A;  1AUI B;  1S3P A;  1NX0 A;  1A75 A;  3AAJ A;  4TNC A;  1UUS A;  4PCW A;  3TUY C;  3FS7 A;  2LMV A;  4NQG A;  1PK0 D;  2BE6 A;  3PM8 A;  4ORB B;  2F2O A;  1KQM B;  1SYM A;  4M2O A;  1PSB A;  1RJV A;  1AHR A;  4ZCU A;  2NXQ A;  5HLO A;  2JT8 A;  2KAY A;  3BUW B;  1QLS A;  3K21 A;  1M45 A;  1ALW A;  1IWQ A;  2A4J A;  4CLN A;  1WDC C;  2KYC A;  4C0K A;  1JUO A;  5PAL A;  1A2X A;  1SK6 D;  3DF0 A;  2PVB A;  1DVI A;  1UUR A;  1V1G A;  1IQ5 A;  1NIW A;  1TIZ A;  2QPT A;  4AQI A;  4OV2 A;  1XYD A;  4YGA A;  1IH0 A;  4I5K A;  4D1E A;  1MR8 A;  1S36 A;  2LP2 A;  1K2H A;  5K89 A;  2B1U A;  4XJK B;  3KEV A;  2BBM A;  5CPV A;  1CLM A;  1D1O A;  2JRF A;  4C0L A;  1J1E A;  3JVT C;  4P5O E;  2LLT A;  1C7V A;  2OS8 C;  1L7Z A;  1XFY O;  2LE9 B;  2TN4 A;  1QX7 A;  2VRG A;  2ZND A;  2FJU B;  3PN7 C;  2MJW B;  2F2P A;  1N2D A;  3SIB A;  1WLM A;  1SY9 A;  2KFF A;  5ER4 X;  5HYD A;  2BBN A;  1A29 A;  1EL4 A;  5I2Q A;  1SCM B;  2MBX A;  2HET A;  2K2F A;  2I18 A;  1G4Y R;  2KI4 C;  1KFU L;  1BU3 A;  3TS5 C;  1U5I B;  1CFF A;  1WRK A;  4N1F A;  1M31 A;  2LC5 A;  4I5J A;  2LP3 A;  2LV7 A;  2BL0 C;  2WCB A;  1G8I A;  3D0Y A;  4NDD A;  5CSN A;  1TCO B;  3OP0 A;  1F8H A;  4DIR A;  5AXI A;  1FBV A;  1QJT A;  2K61 A;  3BUO B;  2JXL A;  2EC6 B;  1NX3 A;  3VRP A;  1MHO A;  3I5F C;  3NSO A;  3DVJ A;  4ETO A;  5CSI A;  1NX2 A;  1QAS A;  2LVI A;  2KYF A;  4GGF C;  1DJY A;  5GQQ C;  4GGF A;  4UPG A;  1MF8 B;  2E6W A;  2BCA A;  1TNQ A;  1FPW A;  1ZOT B;  4WRI A;  4OVN F;  1RTP 1;  1KQV A;  3LLE A;  1K96 A;  2JXC A;  1UP5 A;  2HQ8 A;  1TOP A;  5J3X A;  1TNP A;  3CR2 A;  2AUC A;  2KSP A;  2O60 A;  1CDP A;  4FTG A;  5KU1 A;  1XFV O;  1K8U A;  2ISD A;  3WHT B;  1K94 A;  1ZAC A;  5HKZ A;  5D7F A;  1SRA A;  4DS7 A;  2KQ6 A;  2WND A;  1NX1 A;  1M63 B;  1B7T Y;  1SL8 A;  1YVL A;  4I5N B;  4YI9 A;  1OMV A;  5KSZ A;  1AJ5 A;  2D8N A;  1SL9 A;  3I5H B;  4XYN A;  2K7D A;  1C7W A;  1G33 A;  1PUL A;  3WXA A;  1CDN A;  3PLF B;  3WNX B;  3MSE B;  2K7B A;  2CT9 A;  1KSM A;  1XFU O;  2ZRS A;  1KK8 B;  1UHK A;  3NSL A;  1A75 B;  3DVK A;  3OX5 A;  3DVE A;  2K7O A;  2LHL A;  2MHH A;  1N65 A;  2EHB A;  4CPV A;  3TUY B;  2JT3 A;  1HT9 A;  2M1K B;  1ALV A;  2L50 A;  2O5G A;  1XFZ O;  3I5G C;  1R6P A;  4NDB A;  2SCP A;  2ZN9 A;  3SG5 A;  3BQ3 A;  4MSP A;  1LKJ A;  3IQQ A;  1EJ3 A;  4CID A;  1S5G Z;  4DUQ A;  4R1E A;  1J7R A;  3DF0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...