1JUOA

Crystal structure of calcium-free human sorcin: a member of the penta-ef-hand protein family
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
172
structure length
172
Chain Sequence
FPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sorcin
publication title Crystal structure of calcium-free human sorcin: a member of the penta-EF-hand protein family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 55
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1juoA00
1N2DA 4TNCA 1S36A 2LMTA 4PE0A 3LL8B 3I5IC 2KQ6A 4OCIA 1OMDA 1A75A 3BYAA 2BBNA 1GGWA 1CMGA 1RWYA 1IG5A 1YURA 3LLEA 1KSOA 1ZMZA 1AUIB 3A8RA 4BY5A 3TUYC 3OHMB 1ODBA 1DT7B 2AMIA 1QXPA 2ZN8A 4YRUA 1DJHA 4AQJA 4ZCUA 2KGBC 4NDBA 2K7CA 1QASA 2QACA 2LP2A 4A4CA 1OSAA 2HPSA 1F70A 2R2IA 3O4YA 1LINA 4IL1A 3QRXA 1Y1XA 1RTP1 3BUMB 1NX2A 4L9MA 1B8LA 1RECA 3VRRA 2KNEA 1HT9A 2GGMA 2KHNA 3TDUA 3ZWHA 4YBHB 4PHKA 2JNXA 4F0ZB 1CFFA 1DF0B 2D8NA 2F33A 1K93D 3AAJA 4CIDA 1NWDA 1EG4A 1B1GA 2LUXA 2RGIA 1G8IA 2KBIA 1KK7Z 3NSIA 5DKQA 1OZOA 3CZTX 5I8NA 2MRDA 4I5KA 1QTXA 2K7BA 2LVIA 1RJVA 4PALA 5DKRA 1L2OB 1KQMB 1XO5A 2JULA 3TDZA 5BPJA 5HKWA 5ER5A 2JZIA 5HKZA 3NXAA 4PE4A 2L98A 1B8CA 2K61A 3MSEB 1LVCD 1UHNA 2BKHB 4CFRA 2F3YA 2M49B 1CFCA 3SIBA 1SL8A 1LKJA 3EKJA 1G33A 1ALVA 5HKYA 1DF0A 1J7QA 3CR4X 2KBMA 1MUXA 2KAVA 2MA2A 1WY9A 2OTGC 2Q91A 1CM1A 3OX5A 3WHTB 1K9KA 1NX1A 1OE9B 4ETOA 5I2LA 1TNQA 4DRWA 1TOPA 2L5XB 1TIZA 1BOCA 1QX7A 2MLFC 1DGUA 1GQMA 5I2OA 3VRNA 1ZACA 2KYCA 3CGAA 1IKUA 1UURA 2KFGA 4YGDB 3DD4A 2SCPA 1TCFA 2ISDA 1QX2A 1DJGA 2WCEA 1XFXO 2K7OA 1QATA 4WRIA 3BUOB 1B47A 1BMOA 1HQVA 3GK1A 1D1OA 1BG1A 2E30A 2MAZA 1YTZC 1IRJA 4PCWA 1XYDA 2JWWA 1CM4A 5D7FA 1SL7A 1MXEA 1UHHA 3ZNIA 1MHOA 5F6TA 4GUKA 1MXLC 4OR9B 1RK9A 4JPZB 1JF2A 1OQPA 2JT0A 3JTDB 4GNKB 2CTNA 3FWCA 1B8RA 1XFYO 1BU3A 4QJ5B 2M29A 4ORBB 1XFWO 5AXIA 1A03A 4YGBB 3KO0A 1NYAA 3VGOA 4HRGA 1UWOA 1NPQA 1CDLA 4N1FA 1IJ6A 1B7TY 1KFXL 4E68A 1IQ5A 3FWBA 2EC6B 2JU0A 1SCMB 4HREE 4MSPA 3AKAA 5AEQA 2NCOA 1UUSA 5CPVA 1F71A 4N5XA 1YRUB 2ZKMX 4FTGA 3SG7A 5TNCA 1IWQA 1G4YR 1QVIY 4AOMA 4GGNA 1WRLA 2M9GA 3PM8A 1BR4B 1NP8A 1K90D 5ER4X 1V1GA 3DVMA 1WLZA 2ZN9A 3GOFA 2KOTA 2QPTA 3EVUA 1F4QA 1AJ4A 3EK8A 1CNPA 2KFHA 2LC5A 1EL4A 1J55A 1PRWA 3AAKA 2DOQA 1MWNA 3TDIA 3EVVA 2K2FA 2M7LA 2LVKA 2IS9A 1NCXA 1TNPA 2KAYA 2ZNEA 1DGVA 1SCVA 2H61C 3EVRA 2LMVA 4GBAA 2KYFA 3I5FB 3H4SE 3SG6A 1A2XA 3EK4A 2I7AA 4MN0A 1MQ1A 5CSIA 1L2OC 1KQMC 2OS8B 3BUNB 3WNXB 4PDZA 4JWQA 1PULA 3IQOA 1SKTA 3KHEA 1CLBA 1R6PA 1ZFSA 1CTRA 1SY9A 3FIAA 1F54A 3I5HB 1SBJA 4MZLA 4C0JA 2GV5A 1FBVA 1QIWA 3CR5X 2K7DA 1EH2A 1FF1A 1EJ3A 1DJIA 2JOJA 3GK2A 4PE1A 5AANA 1DTLA 2L4HA 3VRQA 1S6JA 1SK6D 1AHRA 2TN4A 2G2BA 2WORA 1BT6A 2EHBA 5CSNA 1SNLA 4MVFA 2Y1MA 1Y0VH 2BCAA 1K96A 3CTNA 2WCBA 3HCMA 1YR5A 1CLLA 1B7TZ 1U5IB 1CMFA 4XJKB 4MLWA 3GK4X 1XK4A 1NUBA 3CWGA 2CXJA 2ZNDA 4NDCA 1UHJA 2PALA 1H8BA 2M8UA 5B8IB 2JXLA 1QV1A 1RFJA 1F8HA 4A4BA 1H4BA 2M7NA 5KU1A 1UHKA 4GFTA 1QVIZ 3VRPA 1X02A 2LAPA 1UP5A 3TZ1A 1B9AA 2LM5A 1M46A 3TS5B 3WHUB 4D1EA 2FJUB 1S3PA 3JTDC 2M3WA 1SL9A 3OB2B 1BJFA 1PK0D 2H61A 2BBMA 4DUQA 1LXFC 1PVAA 5HLOA 4GAOA 3SG4A 1C07A 1FPWA 1J7OA 2WOSA 2Q4UA 1U5IA 4PE7A 1M45A 2EC6C 1KQVA 1SRAA 1LA3A 1IGVA 1SCMC 1TCOB 3AKBA 4M2OA 1BLQA 1BF5A 1IQ3A 3DVJA 1PVBA 2BE4A 2BECA 4MZKA 5JJGA 1JFJA 2JQ6A 4FQOA 1XVJA 5D69A 2LP3A 1Y1UA 1NIWA 2ZRSA 4MEWA 4WQ3A 4P2YB 1YVHA 3CS1A 3PATA 1WDCB 1YX7A 3O6BA 1XFZO 5AFPA 1JWDA 1IJ5A 2B1UA 1C7VA 1KFUS 1FI6A 4OV2A 5AERA 1IH0A 1YX8A 1NSHA 1S1EA 3KPXA 1BR1B 4P5OE 5CSFA 1A4PA 4C0KA 3I5FC 5FYXA 2F3ZA 3DVEA 2FCEA 1FI5A 2FOTA 2KI4C 2OS8C 1M39A 1LA0A 4C0LA 1TNWA 2F2PA 2KAXA 5K89A 3HX4A 2JT3A 2NZ0A 3SIAA 2KFFA 1KK7Y 1XK4C 3IQQA 2O60A 2SASA 2OPOA 1JC2A 2P6BB 3I5HC 5HLVA 1S5GY 2LLUA 1J1EA 1J7RA 1YUSA 1Q80A 5KSZA 1GJYA 3D0YB 1AVSA 2KI6C 2WNDA 4Q04A 2L51A 3SG5A 1XA5A 2F8PA 3I5GB 5G08A 1JF0A 2LHIA 1CFPA 3KEVA 4U8DA 4HRHA 4I5LB 2AAOA 4OVNF 2CT9A 2JXCA 2LHLA 3SJSA 2JC2A 2V53A 1W7JB 4PHNA 2Y4QA 1E8AA 1YUUA 3SG3A 2LNKA 1K2HA 2LVVA 2NCPA 2H2KA 2KI4B 1QX5B 2Y1NA 3C1VA 2WC8A 1SW8A 1JUOA 3OB1B 1KK8B 1Y1AA 3BUXB 3RM1A 3D10A 1SPYA 1JSAA 2MJWB 2HQ8A 1EG3A 1EXRA 2JT8A 4NQGA 4GPLB 3PN7B 1K95A 3D0YA 2CCMA 4UPGA 1V1FA 2LV7A 1TTXA 1KSMA 2WCFA 1CLMA 1DJZA 2I18A 3JVTB 4I5NB 2HETA 3TS5C 2JTTA 5I2QA 2K0JA 2PMYA 2AUCA 1QS7A 1A29A 2EGDA 4MZJA 4YI9A 3OX6A 4YGCB 1CDPA 5DKNA 1J7PA 1QIVA 4HSZA 1SR6B 1B4CA 3BUWB 2PVBA 3DF0B 2JNFA 2BL0B 1KWOB 2CNPA 1UHIA 2PRUA 3LK0A 2BCXA 2KSPA 4YGAA 1DJWA 1QLSA 1N0YA 4DCKA 2LUCA 1NX0A 1SYMA 3I5IB 4CLNA 2VRGA 1K9PA 1CDMA 3K21A 4CFQA 2LLSA 2O5GA 2K2AA 5CSJA 1AJ5A 2MHHA 4PHMA 4AQIA 1W7IB 1WLMA 1BODA 2GGZA 2KGRA 2LANA 1TN4A 2MLEC 3SG2A 3BQ3A 1WRZA 3TUYB 4MBEA 1DMOA 2BKIB 3A4UB 3RLZA 1FW4A 1S5GZ 1DJYA 2NXQA 4GGFA 4QJ3B 4JQ0D 3NSOA 3WXAA 1QV0A 1WDCC 3ICBA 2I2RE 2NLNA 1K94A 1C7WA 3PALA 4DIRA 1ALWA 3DVKA 1MR8A 2BCBA 3E3RA 1SMGA 2A4JA 4CPVA 2M1UA 1KCYA 1AK8A 3DF0A 4BY4A 5GQQC 4N1GA 1M31A 2PSRA 3NSKA 4QJ4B 1YRTB 1S6IA 4PHJA 1CFDA 5J3XA 4ORAB 4OKHA 4XJKA 2HQWA 2ZRTA 1NX3A 4YGEB 1TRFA 4ORCB 1OMVA 3VROA 1OOJA 2LVJA 4YI8A 1RROA 1XFVO 1DVIA 5KTYA 4WQ2A 1YUTA 1OMRA 1S26D 1GGZA 1QLKA 2JPTA 2COLB 1JBAA 1PSRA 1Y6WA 3KF9A 1TNXA 1OZSA 2M1KB 4R1EA 2KQYA 2JTZA 2LLTA 3I5GC 3OP0A 3PSRA 1AP4A 1JFKA 1CDNA 1CKKA 2BE6A 1ZUZA 3BOWB 1NCZA 2M0RA 1S6CA 3IF7A 4ICBA 1KFUL 4ZCVA 2FCDA 5JOLA 2K8MB 3EKHA 5IBWA 1VRKA 3PFVA 1N65A 2MBXA 1L7ZA 2LMUA 2L0PA 3BXKA 3CR2A 2JRFA 2OTGB 1KK8C 1ZOTB 1DJXA 1F4OA 3PLFB 2CBLA 4MRYA 1XFUO 1A75B 3O78A 3EK7A 2LCPA 2E6WA 1KFXS 3PN7C 1J1DA 2HF5A 1K8UA 3NSLA 5HYDA 2I94A 3FS7A 4DS7A 2ZFDA 1PSBA 3LCPC 2KDHA 2L4IA 3JVTC 1R2UA 2Y5IA 3CLNA 4XYNA 4GGFC 2PASA 2LE9B 2M97A 4NDDA 4USLA 3LK1A 3BOWA 5PALA 1F55A 3F45A 1PALA 4I5JA 2KI6D 3O2PA 4MRXA 2L2EA 1SR6C 1YVLA 1WRKA 2F2OA 2L50A 4M2QA 4M2PA 1CB1A 1K9UA 1NCYA 2BL0C 1KWOC 2G9BA 3M0WA 1QJTA 1M63B 1MF8B
chains in the Genus database with same CATH superfamily
1N2DA 2KPHA 4TNCA 1S36A 2LMTA 4PE0A 3LL8B 3I5IC 2KQ6A 3B87A 2WCKA 1OMDA 3L47A 1A75A 4OCIA 3BYAA 2BBNA 1GGWA 1CMGA 1RWYA 3D78A 2P71A 1IG5A 1YURA 3LLEA 1KSOA 1ZMZA 1AUIB 3A8RA 4BY5A 3TUYC 3OHMB 1ODBA 1DT7B 2AMIA 1QXPA 2ZN8A 4YRUA 1DJHA 2P70A 4AQJA 4ZCUA 2KGBC 4NDBA 2K7CA 1QASA 2QACA 2LP2A 4A4CA 1OSAA 2HPSA 1F70A 2R2IA 3O4YA 1LINA 4IL1A 2L5YA 3QRXA 1Y1XA 1RTP1 3CDNA 3BUMB 1NX2A 4L9MA 1B8LA 1RECA 3VRRA 2KNEA 1HT9A 2GTEA 2GGMA 2KHNA 2KLEA 3TDUA 3ZWHA 4YBHB 4PHKA 2JNXA 4F0ZB 1CFFA 1DF0B 2D8NA 3FE6A 3O4XA 2F33A 1K93D 2L2CA 3AAJA 4CIDA 1NWDA 1EG4A 1B1GA 2LUXA 2RGIA 5I2QA 1G8IA 2KBIA 1KK7Z 3CABA 3NSIA 5DKQA 1OZOA 3CZTX 3VB1A 5I8NA 2MRDA 4I5KA 3B86A 1QTXA 2K7BA 2LVIA 5EL2A 1RJVA 4JD9A 1IIOA 4PALA 5DKRA 1L2OB 1KQMB 1XO5A 2JULA 3BFHA 3TDZA 5BPJA 5HKWA 5ER5A 2JZIA 5HKZA 3NXAA 2WCJA 4PE4A 2L98A 2BNXA 1B8CA 2K61A 3MSEB 1LVCD 1UHNA 3S0DA 2BKHB 4CFRA 2F3YA 2M49B 1CFCA 3SIBA 3NHIA 1SL8A 1LKJA 3EKJA 2QEOA 1G33A 5FI7A 1ALVA 5HKYA 1DF0A 1J7QA 3CR4X 2QDIA 2KBMA 1MUXA 2KAVA 2MA2A 1WY9A 2OTGC 2Q91A 1CM1A 3OX5A 3S0BA 3WHTB 1K9KA 1NX1A 1OE9B 4ETOA 5I2LA 1TNQA 4DRWA 1TOPA 1Z2CB 1TIZA 2L5XB 3QMEA 1SSEB 1QX7A 2MLFC 1DGUA 1BOCA 1GQMA 5I2OA 4KYNA 3VRNA 5HL1A 1ZACA 3SS4A 1DQEA 2KYCA 3CGAA 1IKUA 1UURA 2KFGA 2QEHA 4YGDB 3DD4A 2SCPA 1TCFA 2ISDA 1QX2A 1DJGA 2WCEA 1XFXO 2K7OA 3CYZA 3UO9A 4JKTA 1QATA 4WRIA 3BUOB 1B47A 1BMOA 1HQVA 3GK1A 1D1OA 1BG1A 2E30A 2MAZA 1YTZC 1IRJA 4PCWA 1XYDA 2JWWA 1CM4A 5D7FA 1SL7A 1MXEA 1UHHA 3ZNIA 1MHOA 5F6TA 1DEKA 4GUKA 1MXLC 4OR9B 1RK9A 4JPZB 1JF2A 1OQPA 1XFRA 2JT0A 3JTDB 4GNKB 2CTNA 3FWCA 1B8RA 1XFYO 1BU3A 3L4AA 2M29A 3Q8IA 4ORBB 1XFWO 5AXIA 3S0EA 4QJ5B 1A03A 4YGBB 3KO0A 1NYAA 3VGOA 4HRGA 1UWOA 3SS3A 1NPQA 1CDLA 4N1FA 1IJ6A 1B7TY 1KFXL 3NHTA 1IQ5A 4E68A 3FWBA 3R72A 2EC6B 2JU0A 1SCMB 4HREE 4MSPA 3AKAA 5AEQA 2NCOA 1UUSA 5CPVA 3BFBA 1F71A 4N5XA 1YRUB 2ZKMX 4FTGA 3SG7A 5TNCA 1IWQA 1G4YR 1QVIY 4AOMA 4GGNA 1WRLA 2M9GA 2WCLA 3PM8A 1BR4B 1NP8A 1K90D 5ER4X 1V1GA 3DVMA 1WLZA 2ZN9A 3GOFA 3R1PA 2KOTA 2QPTA 3EVUA 1F4QA 1AJ4A 3EK8A 1Z4HA 1CNPA 2KFHA 2LC5A 1EL4A 1J55A 1PRWA 3AAKA 2DOQA 1MWNA 3S0AA 3TDIA 3EVVA 2K2FA 2M7LA 2LVKA 2IS9A 1NCXA 1TNPA 2KAYA 2ZNEA 1DGVA 1SCVA 2H61C 3EVRA 2LMVA 4GBAA 2KYFA 3I5FB 3H4SE 1C3ZA 1A2XA 3EK4A 2I7AA 3SG6A 4MN0A 1MQ1A 5CSIA 1L2OC 1KQMC 2OS8B 3BUNB 3WNXB 4PDZA 4JWQA 1PULA 3IQOA 1SKTA 3KHEA 2BAPA 3D76A 1CLBA 1R6PA 1ZFSA 1CTRA 2YGUA 1SY9A 3FIAA 1F54A 3I5HB 1SBJA 4MZLA 4C0JA 4F7FA 2GV5A 1FBVA 1QIWA 1TWOA 3CR5X 2K7DA 1EH2A 3D75A 1FF1A 3CZ1A 1EJ3A 3S0FA 1DJIA 2JOJA 3GK2A 4PE1A 5AANA 1DTLA 2ERBA 2L4HA 3VRQA 1S6JA 1SK6D 1AHRA 2TN4A 2G2BA 2WORA 1BT6A 2EHBA 5CSNA 1SNLA 4MVFA 1W9ZA 2Y1MA 1Y0VH 3PJIA 2BCAA 1K96A 3CTNA 2WCBA 3HCMA 1YR5A 1CLLA 1B7TZ 3K1EA 1U5IB 1CMFA 4XJKB 4MLWA 3GK4X 1XK4A 2QEVA 1NUBA 3CWGA 2CXJA 2ZNDA 4NDCA 1UHJA 2PALA 1H8BA 2M8UA 5B8IB 2JXLA 1QV1A 1RFJA 1F8HA 4A4BA 1H4BA 2M7NA 5KU1A 1UHKA 4GFTA 1QVIZ 3VRPA 1X02A 2LAPA 1UP5A 3TZ1A 1B9AA 2LM5A 1M46A 3TS5B 3WHUB 4D1EA 2FJUB 1C3YA 1S3PA 3JTDC 2M3WA 1SL9A 3OB2B 1BJFA 1PK0D 2H61A 2BBMA 4DUQA 1LXFC 1PVAA 2WCHA 5HLOA 4GAOA 3SG4A 1C07A 3V2LA 1FPWA 1J7OA 2WOSA 2Q4UA 1U5IA 4PE7A 1M45A 2EC6C 1KQVA 1SRAA 1LA3A 1IGVA 1SCMC 1TCOB 3AKBA 4M2OA 1BLQA 1BF5A 1QWVA 1IQ3A 3DVJA 1GM0A 1PVBA 2BE4A 2BECA 4MZKA 5JJGA 1JFJA 3S0GA 2JQ6A 4FQOA 1XVJA 3BFAA 5D69A 2LP3A 1Y1UA 1NIWA 2ZRSA 4MEWA 4WQ3A 4P2YB 1YVHA 3CS1A 3PATA 3DY9A 1WDCB 1YX7A 3O6BA 1XFZO 5AFPA 1JWDA 1IJ5A 2B1UA 1C7VA 1KFUS 3RZSA 4OV2A 1FI6A 5AERA 1IH0A 1YX8A 1NSHA 1S1EA 3KPXA 1BR1B 4P5OE 5CSFA 1A4PA 4C0KA 3I5FC 1T14A 5FYXA 2F3ZA 3DVEA 2FCEA 1FI5A 2FOTA 2KI4C 2OS8C 3DXLA 1M39A 1LA0A 4C0LA 1TNWA 2F2PA 2KAXA 5K89A 1DC1A 3HX4A 2JT3A 4INWA 2NZ0A 3SIAA 2KFFA 1TUJA 1KK7Y 1XK4C 2KLDA 3IQQA 2O60A 2SASA 2OPOA 1JC2A 5DICA 2P6BB 3I5HC 5I94A 5HLVA 1S5GY 5D3OA 2LLUA 1J1EA 1J7RA 1YUSA 1Q80A 5KSZA 1LS8A 1GJYA 3D0YB 3N7HA 1AVSA 2KI6C 2WNDA 4OZDA 4Q04A 2L51A 3SG5A 1XA5A 2F8PA 3I5GB 5G08A 1JF0A 2LHIA 1CFPA 3KEVA 4U8DA 1OW4A 1TUZA 3EG5B 4HRHA 4I5LB 2AAOA 4OVNF 2CT9A 2JXCA 2LHLA 3SJSA 2JC2A 2V53A 1W7JB 4PHNA 2QEBA 2WC5A 3CZ0A 2Y4QA 1E8AA 1YUUA 5FI6A 3SG3A 2LNKA 1K2HA 2LVVA 2NCPA 2H2KA 2KI4B 1QX5B 2Y1NA 3C1VA 2WC8A 1SW8A 3B6XA 1JUOA 3OB1B 3NGVA 1KK8B 3D73A 1Y1AA 3BUXB 3D74A 3RM1A 3D10A 1SPYA 1JSAA 2MJWB 2HQ8A 1DELA 1EG3A 1EXRA 2JT8A 2PQLA 4NQGA 4GPLB 3PN7B 1K95A 3D0YA 2CCMA 4UPGA 1V1FA 2LV7A 1TTXA 3OGNA 1KSMA 2WCFA 1CLMA 1DJZA 2I18A 3JVTB 4I5NB 2HETA 3TS5C 2JTTA 3IVTA 2K0JA 2PMYA 2AUCA 4IJ7A 1QS7A 1A29A 2EGDA 1P28A 4MZJA 4YI9A 3OX6A 4PT1A 4YGCB 1CDPA 5DKNA 2FJYA 1J7PA 1QIVA 4HSZA 1SR6B 1B4CA 1ORGA 3BUWB 3SS5A 2PVBA 3DF0B 2JNFA 2BL0B 1KWOB 2CNPA 1UHIA 2PRUA 3LK0A 2BCXA 2WCMA 2KSPA 4YGAA 1DJWA 3D77A 1QLSA 1N0YA 2PYQA 4DCKA 2LUCA 1NX0A 1SYMA 3I5IB 3OBVA 4CLNA 1OOHA 2VRGA 1K9PA 1CDMA 3K21A 4CFQA 2LLSA 2O5GA 2K2AA 5CSJA 1AJ5A 2MHHA 4PHMA 4AQIA 1W7IB 1WLMA 1BODA 2GGZA 2KGRA 2LANA 1TN4A 2MLEC 3SG2A 3BQ3A 1WRZA 3TUYB 4MBEA 3R1OA 2JPOA 1DMOA 2BKIB 3A4UB 3RLZA 1FW4A 1S5GZ 1DJYA 2NXQA 4GGFA 4QJ3B 4JQ0D 3NSOA 3FE9A 1QV0A 1WDCC 3ICBA 2I2RE 2NLNA 1K94A 1C7WA 2H8VA 3PALA 1ALWA 3R1VA 3DVKA 1MR8A 2BCBA 3E3RA 1SMGA 2A4JA 4CPVA 2M1UA 3FE8A 1KCYA 1AK8A 3DF0A 4BY4A 5GQQC 4N1GA 1M31A 2PSRA 3NSKA 4QJ4B 1YRTB 1S6IA 4PHJA 1CFDA 5J3XA 4ORAB 4OKHA 4XJKA 2HQWA 2ZRTA 1NX3A 3BJHA 4YGEB 1TRFA 4ORCB 1OMVA 3VROA 1OOJA 2LVJA 4YI8A 1RROA 1XFVO 1DVIA 5KTYA 4WQ2A 1YUTA 1OMRA 4INXA 1S26D 1GGZA 1QLKA 2JPTA 2COLB 1JBAA 1PSRA 1OOGA 1Y6WA 3KF9A 1TNXA 1OZSA 2M1KB 4R1EA 2KQYA 2JTZA 1OOFA 2LLTA 3I5GC 3OP0A 3PSRA 5FI2A 1AP4A 1JFKA 1CDNA 1CKKA 3WXAA 4FQTA 2BE6A 1ZUZA 3BOWB 1NCZA 2M0RA 1S6CA 3CZ2A 3IF7A 4ICBA 1KFUL 4ZCVA 2FCDA 3B7AA 3DZTA 5JOLA 2K8MB 3EKHA 5IBWA 1VRKA 2K60A 3DYEA 3PFVA 1N65A 2MBXA 1L7ZA 2LMUA 2L0PA 3BXKA 3CR2A 2JRFA 2OTGB 1KK8C 1ZOTB 1DJXA 1F4OA 3B88A 3PLFB 3L4LA 2CBLA 4MRYA 1XFUO 1A75B 3O78A 3EK7A 2LCPA 2E6WA 1KFXS 3PN7C 1J1DA 2HF5A 1K8UA 3NSLA 3UNWA 5HYDA 2I94A 3FS7A 4DS7A 2ZFDA 1OOIX 1PSBA 3LCPC 2KDHA 2L4IA 3JVTC 1R2UA 2Y5IA 3CLNA 4XYNA 4DIRA 4GGFC 2PASA 2LE9B 2M97A 4NDDA 4USLA 3LK1A 3BOWA 5PALA 1F55A 3F45A 1PALA 4I5JA 2KI6D 3O2PA 4MRXA 2L2EA 3PM2A 1SR6C 1YVLA 1WRKA 2F2OA 2L50A 4M2QA 4M2PA 1CB1A 1K9UA 1NCYA 2BL0C 1KWOC 2G9BA 3M0WA 1QJTA 2WC6A 1M63B 1MF8B
chains in the Genus database with same CATH topology
1N2DA 4TNCA 1S36A 2LMTA 4PE0A 3LL8B 3I5IC 2KQ6A 4OCIA 1OMDA 1A75A 3BYAA 2BBNA 1GGWA 1CMGA 1RWYA 1IG5A 1YURA 3LLEA 1KSOA 1ZMZA 1AUIB 3A8RA 4BY5A 3TUYC 3OHMB 1ODBA 1DT7B 2AMIA 1QXPA 2ZN8A 4YRUA 1DJHA 4AQJA 4ZCUA 2KGBC 4NDBA 2K7CA 1QASA 2QACA 2LP2A 4A4CA 1OSAA 2HPSA 1F70A 2R2IA 3O4YA 1LINA 4IL1A 3QRXA 1Y1XA 1RTP1 3BUMB 1NX2A 4L9MA 1B8LA 1RECA 3VRRA 2KNEA 1HT9A 2GGMA 2KHNA 3TDUA 3ZWHA 4YBHB 4PHKA 2JNXA 4F0ZB 1CFFA 1DF0B 2D8NA 2F33A 1K93D 3AAJA 4CIDA 1NWDA 1EG4A 1B1GA 2LUXA 2RGIA 1G8IA 2KBIA 1KK7Z 3NSIA 5DKQA 1OZOA 3CZTX 5I8NA 2MRDA 4I5KA 1QTXA 2K7BA 2LVIA 1RJVA 4PALA 5DKRA 1L2OB 1KQMB 1XO5A 2JULA 3TDZA 5BPJA 5HKWA 5ER5A 2JZIA 5HKZA 3NXAA 4PE4A 2L98A 1B8CA 2K61A 3MSEB 1LVCD 1UHNA 2BKHB 4CFRA 2F3YA 2M49B 1CFCA 3SIBA 1SL8A 1LKJA 3EKJA 1G33A 1ALVA 5HKYA 1DF0A 1J7QA 3CR4X 2KBMA 1MUXA 2KAVA 2MA2A 1WY9A 2OTGC 2Q91A 1CM1A 3OX5A 3WHTB 1K9KA 1NX1A 1OE9B 4ETOA 5I2LA 1TNQA 4DRWA 1TOPA 2L5XB 1TIZA 1BOCA 1QX7A 2MLFC 1DGUA 1GQMA 5I2OA 3VRNA 1ZACA 2KYCA 3CGAA 1IKUA 1UURA 2KFGA 4YGDB 3DD4A 2SCPA 1TCFA 2ISDA 1QX2A 1DJGA 2WCEA 1XFXO 2K7OA 1QATA 4WRIA 3BUOB 1B47A 1BMOA 1HQVA 3GK1A 1D1OA 1BG1A 2E30A 2MAZA 1YTZC 1IRJA 4PCWA 1XYDA 2JWWA 1CM4A 5D7FA 1SL7A 1MXEA 1UHHA 3ZNIA 1MHOA 5F6TA 4GUKA 1MXLC 4OR9B 1RK9A 4JPZB 1JF2A 1OQPA 2JT0A 3JTDB 4GNKB 2CTNA 3FWCA 1B8RA 1XFYO 1BU3A 4QJ5B 2M29A 4ORBB 1XFWO 5AXIA 1A03A 4YGBB 3KO0A 1NYAA 3VGOA 4HRGA 1UWOA 1NPQA 1CDLA 4N1FA 1IJ6A 1B7TY 1KFXL 4E68A 1IQ5A 3FWBA 2EC6B 2JU0A 1SCMB 4HREE 4MSPA 3AKAA 5AEQA 2NCOA 1UUSA 5CPVA 1F71A 4N5XA 1YRUB 2ZKMX 4FTGA 3SG7A 5TNCA 1IWQA 1G4YR 1QVIY 4AOMA 4GGNA 1WRLA 2M9GA 3PM8A 1BR4B 1NP8A 1K90D 5ER4X 1V1GA 3DVMA 1WLZA 2ZN9A 3GOFA 2KOTA 2QPTA 3EVUA 1F4QA 1AJ4A 3EK8A 1CNPA 2KFHA 2LC5A 1EL4A 1J55A 1PRWA 3AAKA 2DOQA 1MWNA 3TDIA 3EVVA 2K2FA 2M7LA 2LVKA 2IS9A 1NCXA 1TNPA 2KAYA 2ZNEA 1DGVA 1SCVA 2H61C 3EVRA 2LMVA 4GBAA 2KYFA 3I5FB 3H4SE 3SG6A 1A2XA 3EK4A 2I7AA 4MN0A 1MQ1A 5CSIA 1L2OC 1KQMC 2OS8B 3BUNB 3WNXB 4PDZA 4JWQA 1PULA 3IQOA 1SKTA 3KHEA 1CLBA 1R6PA 1ZFSA 1CTRA 1SY9A 3FIAA 1F54A 3I5HB 1SBJA 4MZLA 4C0JA 2GV5A 1FBVA 1QIWA 3CR5X 2K7DA 1EH2A 1FF1A 1EJ3A 1DJIA 2JOJA 3GK2A 4PE1A 5AANA 1DTLA 2L4HA 3VRQA 1S6JA 1SK6D 1AHRA 2TN4A 2G2BA 2WORA 1BT6A 2EHBA 5CSNA 1SNLA 4MVFA 2Y1MA 1Y0VH 2BCAA 1K96A 3CTNA 2WCBA 3HCMA 1YR5A 1CLLA 1B7TZ 1U5IB 1CMFA 4XJKB 4MLWA 3GK4X 1XK4A 1NUBA 3CWGA 2CXJA 2ZNDA 4NDCA 1UHJA 2PALA 1H8BA 2M8UA 5B8IB 2JXLA 1QV1A 1RFJA 1F8HA 4A4BA 1H4BA 2M7NA 5KU1A 1UHKA 4GFTA 1QVIZ 3VRPA 1X02A 2LAPA 1UP5A 3TZ1A 1B9AA 2LM5A 1M46A 3TS5B 3WHUB 4D1EA 2FJUB 1S3PA 3JTDC 2M3WA 1SL9A 3OB2B 1BJFA 1PK0D 2H61A 2BBMA 4DUQA 1LXFC 1PVAA 5HLOA 4GAOA 3SG4A 1C07A 1FPWA 1J7OA 2WOSA 2Q4UA 1U5IA 4PE7A 1M45A 2EC6C 1KQVA 1SRAA 1LA3A 1IGVA 1SCMC 1TCOB 3AKBA 4M2OA 1BLQA 1BF5A 1IQ3A 3DVJA 1PVBA 2BE4A 2BECA 4MZKA 5JJGA 1JFJA 2JQ6A 4FQOA 1XVJA 5D69A 2LP3A 1Y1UA 1NIWA 2ZRSA 4MEWA 4WQ3A 4P2YB 1YVHA 3CS1A 3PATA 1WDCB 1YX7A 3O6BA 1XFZO 5AFPA 1JWDA 1IJ5A 2B1UA 1C7VA 1KFUS 1FI6A 4OV2A 5AERA 1IH0A 1YX8A 1NSHA 1S1EA 3KPXA 1BR1B 4P5OE 5CSFA 1A4PA 4C0KA 3I5FC 5FYXA 2F3ZA 3DVEA 2FCEA 1FI5A 2FOTA 2KI4C 2OS8C 1M39A 1LA0A 4C0LA 1TNWA 2F2PA 2KAXA 5K89A 3HX4A 2JT3A 2NZ0A 3SIAA 2KFFA 1KK7Y 1XK4C 3IQQA 2O60A 2SASA 2OPOA 1JC2A 2P6BB 3I5HC 5HLVA 1S5GY 2LLUA 1J1EA 1J7RA 1YUSA 1Q80A 5KSZA 1GJYA 3D0YB 1AVSA 2KI6C 2WNDA 4Q04A 2L51A 3SG5A 1XA5A 2F8PA 3I5GB 5G08A 1JF0A 2LHIA 1CFPA 3KEVA 4U8DA 4HRHA 4I5LB 2AAOA 4OVNF 2CT9A 2JXCA 2LHLA 3SJSA 2JC2A 2V53A 1W7JB 4PHNA 2Y4QA 1E8AA 1YUUA 3SG3A 2LNKA 1K2HA 2LVVA 2NCPA 2H2KA 2KI4B 1QX5B 2Y1NA 3C1VA 2WC8A 1SW8A 1JUOA 3OB1B 1KK8B 1Y1AA 3BUXB 3RM1A 3D10A 1SPYA 1JSAA 2MJWB 2HQ8A 1EG3A 1EXRA 2JT8A 4NQGA 4GPLB 3PN7B 1K95A 3D0YA 2CCMA 4UPGA 1V1FA 2LV7A 1TTXA 1KSMA 2WCFA 1CLMA 1DJZA 2I18A 3JVTB 4I5NB 2HETA 3TS5C 2JTTA 5I2QA 2K0JA 2PMYA 2AUCA 1QS7A 1A29A 2EGDA 4MZJA 4YI9A 3OX6A 4YGCB 1CDPA 5DKNA 1J7PA 1QIVA 4HSZA 1SR6B 1B4CA 3BUWB 2PVBA 3DF0B 2JNFA 2BL0B 1KWOB 2CNPA 1UHIA 2PRUA 3LK0A 2BCXA 2KSPA 4YGAA 1DJWA 1QLSA 1N0YA 4DCKA 2LUCA 1NX0A 1SYMA 3I5IB 4CLNA 2VRGA 1K9PA 1CDMA 3K21A 4CFQA 2LLSA 2O5GA 2K2AA 5CSJA 1AJ5A 2MHHA 4PHMA 4AQIA 1W7IB 1WLMA 1BODA 2GGZA 2KGRA 2LANA 1TN4A 2MLEC 3SG2A 3BQ3A 1WRZA 3TUYB 4MBEA 1DMOA 2BKIB 3A4UB 3RLZA 1FW4A 1S5GZ 1DJYA 2NXQA 4GGFA 4QJ3B 4JQ0D 3NSOA 3WXAA 1QV0A 1WDCC 3ICBA 2I2RE 2NLNA 1K94A 1C7WA 3PALA 4DIRA 1ALWA 3DVKA 1MR8A 2BCBA 3E3RA 1SMGA 2A4JA 4CPVA 2M1UA 1KCYA 1AK8A 3DF0A 4BY4A 5GQQC 4N1GA 1M31A 2PSRA 3NSKA 4QJ4B 1YRTB 1S6IA 4PHJA 1CFDA 5J3XA 4ORAB 4OKHA 4XJKA 2HQWA 2ZRTA 1NX3A 4YGEB 1TRFA 4ORCB 1OMVA 3VROA 1OOJA 2LVJA 4YI8A 1RROA 1XFVO 1DVIA 5KTYA 4WQ2A 1YUTA 1OMRA 1S26D 1GGZA 1QLKA 2JPTA 2COLB 1JBAA 1PSRA 1Y6WA 3KF9A 1TNXA 1OZSA 2M1KB 4R1EA 2KQYA 2JTZA 2LLTA 3I5GC 3OP0A 3PSRA 1AP4A 1JFKA 1CDNA 1CKKA 2BE6A 1ZUZA 3BOWB 1NCZA 2M0RA 1S6CA 3IF7A 4ICBA 1KFUL 4ZCVA 2FCDA 5JOLA 2K8MB 3EKHA 5IBWA 1VRKA 3PFVA 1N65A 2MBXA 1L7ZA 2LMUA 2L0PA 3BXKA 3CR2A 2JRFA 2OTGB 1KK8C 1ZOTB 1DJXA 1F4OA 3PLFB 2CBLA 4MRYA 1XFUO 1A75B 3O78A 3EK7A 2LCPA 2E6WA 1KFXS 3PN7C 1J1DA 2HF5A 1K8UA 3NSLA 5HYDA 2I94A 3FS7A 4DS7A 2ZFDA 1PSBA 3LCPC 2KDHA 2L4IA 3JVTC 1R2UA 2Y5IA 3CLNA 4XYNA 4GGFC 2PASA 2LE9B 2M97A 4NDDA 4USLA 3LK1A 3BOWA 5PALA 1F55A 3F45A 1PALA 4I5JA 2KI6D 3O2PA 4MRXA 2L2EA 1SR6C 1YVLA 1WRKA 2F2OA 2L50A 4M2QA 4M2PA 1CB1A 1K9UA 1NCYA 2BL0C 1KWOC 2G9BA 3M0WA 1QJTA 1M63B 1MF8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N2D A;  4TNC A;  1S36 A;  2LMT A;  4PE0 A;  3LL8 B;  3I5I C;  2KQ6 A;  4OCI A;  1OMD A;  1A75 A;  3BYA A;  2BBN A;  1GGW A;  1CMG A;  1RWY A;  1IG5 A;  1YUR A;  3LLE A;  1KSO A;  1ZMZ A;  1AUI B;  3A8R A;  4BY5 A;  3TUY C;  3OHM B;  1ODB A;  1DT7 B;  2AMI A;  1QXP A;  2ZN8 A;  4YRU A;  1DJH A;  4AQJ A;  4ZCU A;  2KGB C;  4NDB A;  2K7C A;  1QAS A;  2QAC A;  2LP2 A;  4A4C A;  1OSA A;  2HPS A;  1F70 A;  2R2I A;  3O4Y A;  1LIN A;  4IL1 A;  3QRX A;  1Y1X A;  1RTP 1;  3BUM B;  1NX2 A;  4L9M A;  1B8L A;  1REC A;  3VRR A;  2KNE A;  1HT9 A;  2GGM A;  2KHN A;  3TDU A;  3ZWH A;  4YBH B;  4PHK A;  2JNX A;  4F0Z B;  1CFF A;  1DF0 B;  2D8N A;  2F33 A;  1K93 D;  3AAJ A;  4CID A;  1NWD A;  1EG4 A;  1B1G A;  2LUX A;  2RGI A;  1G8I A;  2KBI A;  1KK7 Z;  3NSI A;  5DKQ A;  1OZO A;  3CZT X;  5I8N A;  2MRD A;  4I5K A;  1QTX A;  2K7B A;  2LVI A;  1RJV A;  4PAL A;  5DKR A;  1L2O B;  1KQM B;  1XO5 A;  2JUL A;  3TDZ A;  5BPJ A;  5HKW A;  5ER5 A;  2JZI A;  5HKZ A;  3NXA A;  4PE4 A;  2L98 A;  1B8C A;  2K61 A;  3MSE B;  1LVC D;  1UHN A;  2BKH B;  4CFR A;  2F3Y A;  2M49 B;  1CFC A;  3SIB A;  1SL8 A;  1LKJ A;  3EKJ A;  1G33 A;  1ALV A;  5HKY A;  1DF0 A;  1J7Q A;  3CR4 X;  2KBM A;  1MUX A;  2KAV A;  2MA2 A;  1WY9 A;  2OTG C;  2Q91 A;  1CM1 A;  3OX5 A;  3WHT B;  1K9K A;  1NX1 A;  1OE9 B;  4ETO A;  5I2L A;  1TNQ A;  4DRW A;  1TOP A;  2L5X B;  1TIZ A;  1BOC A;  1QX7 A;  2MLF C;  1DGU A;  1GQM A;  5I2O A;  3VRN A;  1ZAC A;  2KYC A;  3CGA A;  1IKU A;  1UUR A;  2KFG A;  4YGD B;  3DD4 A;  2SCP A;  1TCF A;  2ISD A;  1QX2 A;  1DJG A;  2WCE A;  1XFX O;  2K7O A;  1QAT A;  4WRI A;  3BUO B;  1B47 A;  1BMO A;  1HQV A;  3GK1 A;  1D1O A;  1BG1 A;  2E30 A;  2MAZ A;  1YTZ C;  1IRJ A;  4PCW A;  1XYD A;  2JWW A;  1CM4 A;  5D7F A;  1SL7 A;  1MXE A;  1UHH A;  3ZNI A;  1MHO A;  5F6T A;  4GUK A;  1MXL C;  4OR9 B;  1RK9 A;  4JPZ B;  1JF2 A;  1OQP A;  2JT0 A;  3JTD B;  4GNK B;  2CTN A;  3FWC A;  1B8R A;  1XFY O;  1BU3 A;  4QJ5 B;  2M29 A;  4ORB B;  1XFW O;  5AXI A;  1A03 A;  4YGB B;  3KO0 A;  1NYA A;  3VGO A;  4HRG A;  1UWO A;  1NPQ A;  1CDL A;  4N1F A;  1IJ6 A;  1B7T Y;  1KFX L;  4E68 A;  1IQ5 A;  3FWB A;  2EC6 B;  2JU0 A;  1SCM B;  4HRE E;  4MSP A;  3AKA A;  5AEQ A;  2NCO A;  1UUS A;  5CPV A;  1F71 A;  4N5X A;  1YRU B;  2ZKM X;  4FTG A;  3SG7 A;  5TNC A;  1IWQ A;  1G4Y R;  1QVI Y;  4AOM A;  4GGN A;  1WRL A;  2M9G A;  3PM8 A;  1BR4 B;  1NP8 A;  1K90 D;  5ER4 X;  1V1G A;  3DVM A;  1WLZ A;  2ZN9 A;  3GOF A;  2KOT A;  2QPT A;  3EVU A;  1F4Q A;  1AJ4 A;  3EK8 A;  1CNP A;  2KFH A;  2LC5 A;  1EL4 A;  1J55 A;  1PRW A;  3AAK A;  2DOQ A;  1MWN A;  3TDI A;  3EVV A;  2K2F A;  2M7L A;  2LVK A;  2IS9 A;  1NCX A;  1TNP A;  2KAY A;  2ZNE A;  1DGV A;  1SCV A;  2H61 C;  3EVR A;  2LMV A;  4GBA A;  2KYF A;  3I5F B;  3H4S E;  3SG6 A;  1A2X A;  3EK4 A;  2I7A A;  4MN0 A;  1MQ1 A;  5CSI A;  1L2O C;  1KQM C;  2OS8 B;  3BUN B;  3WNX B;  4PDZ A;  4JWQ A;  1PUL A;  3IQO A;  1SKT A;  3KHE A;  1CLB A;  1R6P A;  1ZFS A;  1CTR A;  1SY9 A;  3FIA A;  1F54 A;  3I5H B;  1SBJ A;  4MZL A;  4C0J A;  2GV5 A;  1FBV A;  1QIW A;  3CR5 X;  2K7D A;  1EH2 A;  1FF1 A;  1EJ3 A;  1DJI A;  2JOJ A;  3GK2 A;  4PE1 A;  5AAN A;  1DTL A;  2L4H A;  3VRQ A;  1S6J A;  1SK6 D;  1AHR A;  2TN4 A;  2G2B A;  2WOR A;  1BT6 A;  2EHB A;  5CSN A;  1SNL A;  4MVF A;  2Y1M A;  1Y0V H;  2BCA A;  1K96 A;  3CTN A;  2WCB A;  3HCM A;  1YR5 A;  1CLL A;  1B7T Z;  1U5I B;  1CMF A;  4XJK B;  4MLW A;  3GK4 X;  1XK4 A;  1NUB A;  3CWG A;  2CXJ A;  2ZND A;  4NDC A;  1UHJ A;  2PAL A;  1H8B A;  2M8U A;  5B8I B;  2JXL A;  1QV1 A;  1RFJ A;  1F8H A;  4A4B A;  1H4B A;  2M7N A;  5KU1 A;  1UHK A;  4GFT A;  1QVI Z;  3VRP A;  1X02 A;  2LAP A;  1UP5 A;  3TZ1 A;  1B9A A;  2LM5 A;  1M46 A;  3TS5 B;  3WHU B;  4D1E A;  2FJU B;  1S3P A;  3JTD C;  2M3W A;  1SL9 A;  3OB2 B;  1BJF A;  1PK0 D;  2H61 A;  2BBM A;  4DUQ A;  1LXF C;  1PVA A;  5HLO A;  4GAO A;  3SG4 A;  1C07 A;  1FPW A;  1J7O A;  2WOS A;  2Q4U A;  1U5I A;  4PE7 A;  1M45 A;  2EC6 C;  1KQV A;  1SRA A;  1LA3 A;  1IGV A;  1SCM C;  1TCO B;  3AKB A;  4M2O A;  1BLQ A;  1BF5 A;  1IQ3 A;  3DVJ A;  1PVB A;  2BE4 A;  2BEC A;  4MZK A;  5JJG A;  1JFJ A;  2JQ6 A;  4FQO A;  1XVJ A;  5D69 A;  2LP3 A;  1Y1U A;  1NIW A;  2ZRS A;  4MEW A;  4WQ3 A;  4P2Y B;  1YVH A;  3CS1 A;  3PAT A;  1WDC B;  1YX7 A;  3O6B A;  1XFZ O;  5AFP A;  1JWD A;  1IJ5 A;  2B1U A;  1C7V A;  1KFU S;  1FI6 A;  4OV2 A;  5AER A;  1IH0 A;  1YX8 A;  1NSH A;  1S1E A;  3KPX A;  1BR1 B;  4P5O E;  5CSF A;  1A4P A;  4C0K A;  3I5F C;  5FYX A;  2F3Z A;  3DVE A;  2FCE A;  1FI5 A;  2FOT A;  2KI4 C;  2OS8 C;  1M39 A;  1LA0 A;  4C0L A;  1TNW A;  2F2P A;  2KAX A;  5K89 A;  3HX4 A;  2JT3 A;  2NZ0 A;  3SIA A;  2KFF A;  1KK7 Y;  1XK4 C;  3IQQ A;  2O60 A;  2SAS A;  2OPO A;  1JC2 A;  2P6B B;  3I5H C;  5HLV A;  1S5G Y;  2LLU A;  1J1E A;  1J7R A;  1YUS A;  1Q80 A;  5KSZ A;  1GJY A;  3D0Y B;  1AVS A;  2KI6 C;  2WND A;  4Q04 A;  2L51 A;  3SG5 A;  1XA5 A;  2F8P A;  3I5G B;  5G08 A;  1JF0 A;  2LHI A;  1CFP A;  3KEV A;  4U8D A;  4HRH A;  4I5L B;  2AAO A;  4OVN F;  2CT9 A;  2JXC A;  2LHL A;  3SJS A;  2JC2 A;  2V53 A;  1W7J B;  4PHN A;  2Y4Q A;  1E8A A;  1YUU A;  3SG3 A;  2LNK A;  1K2H A;  2LVV A;  2NCP A;  2H2K A;  2KI4 B;  1QX5 B;  2Y1N A;  3C1V A;  2WC8 A;  1SW8 A;  1JUO A;  3OB1 B;  1KK8 B;  1Y1A A;  3BUX B;  3RM1 A;  3D10 A;  1SPY A;  1JSA A;  2MJW B;  2HQ8 A;  1EG3 A;  1EXR A;  2JT8 A;  4NQG A;  4GPL B;  3PN7 B;  1K95 A;  3D0Y A;  2CCM A;  4UPG A;  1V1F A;  2LV7 A;  1TTX A;  1KSM A;  2WCF A;  1CLM A;  1DJZ A;  2I18 A;  3JVT B;  4I5N B;  2HET A;  3TS5 C;  2JTT A;  5I2Q A;  2K0J A;  2PMY A;  2AUC A;  1QS7 A;  1A29 A;  2EGD A;  4MZJ A;  4YI9 A;  3OX6 A;  4YGC B;  1CDP A;  5DKN A;  1J7P A;  1QIV A;  4HSZ A;  1SR6 B;  1B4C A;  3BUW B;  2PVB A;  3DF0 B;  2JNF A;  2BL0 B;  1KWO B;  2CNP A;  1UHI A;  2PRU A;  3LK0 A;  2BCX A;  2KSP A;  4YGA A;  1DJW A;  1QLS A;  1N0Y A;  4DCK A;  2LUC A;  1NX0 A;  1SYM A;  3I5I B;  4CLN A;  2VRG A;  1K9P A;  1CDM A;  3K21 A;  4CFQ A;  2LLS A;  2O5G A;  2K2A A;  5CSJ A;  1AJ5 A;  2MHH A;  4PHM A;  4AQI A;  1W7I B;  1WLM A;  1BOD A;  2GGZ A;  2KGR A;  2LAN A;  1TN4 A;  2MLE C;  3SG2 A;  3BQ3 A;  1WRZ A;  3TUY B;  4MBE A;  1DMO A;  2BKI B;  3A4U B;  3RLZ A;  1FW4 A;  1S5G Z;  1DJY A;  2NXQ A;  4GGF A;  4QJ3 B;  4JQ0 D;  3NSO A;  3WXA A;  1QV0 A;  1WDC C;  3ICB A;  2I2R E;  2NLN A;  1K94 A;  1C7W A;  3PAL A;  4DIR A;  1ALW A;  3DVK A;  1MR8 A;  2BCB A;  3E3R A;  1SMG A;  2A4J A;  4CPV A;  2M1U A;  1KCY A;  1AK8 A;  3DF0 A;  4BY4 A;  5GQQ C;  4N1G A;  1M31 A;  2PSR A;  3NSK A;  4QJ4 B;  1YRT B;  1S6I A;  4PHJ A;  1CFD A;  5J3X A;  4ORA B;  4OKH A;  4XJK A;  2HQW A;  2ZRT A;  1NX3 A;  4YGE B;  1TRF A;  4ORC B;  1OMV A;  3VRO A;  1OOJ A;  2LVJ A;  4YI8 A;  1RRO A;  1XFV O;  1DVI A;  5KTY A;  4WQ2 A;  1YUT A;  1OMR A;  1S26 D;  1GGZ A;  1QLK A;  2JPT A;  2COL B;  1JBA A;  1PSR A;  1Y6W A;  3KF9 A;  1TNX A;  1OZS A;  2M1K B;  4R1E A;  2KQY A;  2JTZ A;  2LLT A;  3I5G C;  3OP0 A;  3PSR A;  1AP4 A;  1JFK A;  1CDN A;  1CKK A;  2BE6 A;  1ZUZ A;  3BOW B;  1NCZ A;  2M0R A;  1S6C A;  3IF7 A;  4ICB A;  1KFU L;  4ZCV A;  2FCD A;  5JOL A;  2K8M B;  3EKH A;  5IBW A;  1VRK A;  3PFV A;  1N65 A;  2MBX A;  1L7Z A;  2LMU A;  2L0P A;  3BXK A;  3CR2 A;  2JRF A;  2OTG B;  1KK8 C;  1ZOT B;  1DJX A;  1F4O A;  3PLF B;  2CBL A;  4MRY A;  1XFU O;  1A75 B;  3O78 A;  3EK7 A;  2LCP A;  2E6W A;  1KFX S;  3PN7 C;  1J1D A;  2HF5 A;  1K8U A;  3NSL A;  5HYD A;  2I94 A;  3FS7 A;  4DS7 A;  2ZFD A;  1PSB A;  3LCP C;  2KDH A;  2L4I A;  3JVT C;  1R2U A;  2Y5I A;  3CLN A;  4XYN A;  4GGF C;  2PAS A;  2LE9 B;  2M97 A;  4NDD A;  4USL A;  3LK1 A;  3BOW A;  5PAL A;  1F55 A;  3F45 A;  1PAL A;  4I5J A;  2KI6 D;  3O2P A;  4MRX A;  2L2E A;  1SR6 C;  1YVL A;  1WRK A;  2F2O A;  2L50 A;  4M2Q A;  4M2P A;  1CB1 A;  1K9U A;  1NCY A;  2BL0 C;  1KWO C;  2G9B A;  3M0W A;  1QJT A;  1M63 B;  1MF8 B; 
#chains in the Genus database with same CATH topology
 1N2D A;  2KPH A;  4TNC A;  1S36 A;  2LMT A;  4PE0 A;  3LL8 B;  3I5I C;  2KQ6 A;  3B87 A;  2WCK A;  1OMD A;  3L47 A;  1A75 A;  4OCI A;  3BYA A;  2BBN A;  1GGW A;  1CMG A;  1RWY A;  3D78 A;  2P71 A;  1IG5 A;  1YUR A;  3LLE A;  1KSO A;  1ZMZ A;  1AUI B;  3A8R A;  4BY5 A;  3TUY C;  3OHM B;  1ODB A;  1DT7 B;  2AMI A;  1QXP A;  2ZN8 A;  4YRU A;  1DJH A;  2P70 A;  4AQJ A;  4ZCU A;  2KGB C;  4NDB A;  2K7C A;  1QAS A;  2QAC A;  2LP2 A;  4A4C A;  1OSA A;  2HPS A;  1F70 A;  2R2I A;  3O4Y A;  1LIN A;  4IL1 A;  2L5Y A;  3QRX A;  1Y1X A;  1RTP 1;  3CDN A;  3BUM B;  1NX2 A;  4L9M A;  1B8L A;  1REC A;  3VRR A;  2KNE A;  1HT9 A;  2GTE A;  2GGM A;  2KHN A;  2KLE A;  3TDU A;  3ZWH A;  4YBH B;  4PHK A;  2JNX A;  4F0Z B;  1CFF A;  1DF0 B;  2D8N A;  3FE6 A;  3O4X A;  2F33 A;  1K93 D;  2L2C A;  3AAJ A;  4CID A;  1NWD A;  1EG4 A;  1B1G A;  2LUX A;  2RGI A;  5I2Q A;  1G8I A;  2KBI A;  1KK7 Z;  3CAB A;  3NSI A;  5DKQ A;  1OZO A;  3CZT X;  3VB1 A;  5I8N A;  2MRD A;  4I5K A;  3B86 A;  1QTX A;  2K7B A;  2LVI A;  5EL2 A;  1RJV A;  4JD9 A;  1IIO A;  4PAL A;  5DKR A;  1L2O B;  1KQM B;  1XO5 A;  2JUL A;  3BFH A;  3TDZ A;  5BPJ A;  5HKW A;  5ER5 A;  2JZI A;  5HKZ A;  3NXA A;  2WCJ A;  4PE4 A;  2L98 A;  2BNX A;  1B8C A;  2K61 A;  3MSE B;  1LVC D;  1UHN A;  3S0D A;  2BKH B;  4CFR A;  2F3Y A;  2M49 B;  1CFC A;  3SIB A;  3NHI A;  1SL8 A;  1LKJ A;  3EKJ A;  2QEO A;  1G33 A;  5FI7 A;  1ALV A;  5HKY A;  1DF0 A;  1J7Q A;  3CR4 X;  2QDI A;  2KBM A;  1MUX A;  2KAV A;  2MA2 A;  1WY9 A;  2OTG C;  2Q91 A;  1CM1 A;  3OX5 A;  3S0B A;  3WHT B;  1K9K A;  1NX1 A;  1OE9 B;  4ETO A;  5I2L A;  1TNQ A;  4DRW A;  1TOP A;  1Z2C B;  1TIZ A;  2L5X B;  3QME A;  1SSE B;  1QX7 A;  2MLF C;  1DGU A;  1BOC A;  1GQM A;  5I2O A;  4KYN A;  3VRN A;  5HL1 A;  1ZAC A;  3SS4 A;  1DQE A;  2KYC A;  3CGA A;  1IKU A;  1UUR A;  2KFG A;  2QEH A;  4YGD B;  3DD4 A;  2SCP A;  1TCF A;  2ISD A;  1QX2 A;  1DJG A;  2WCE A;  1XFX O;  2K7O A;  3CYZ A;  3UO9 A;  4JKT A;  1QAT A;  4WRI A;  3BUO B;  1B47 A;  1BMO A;  1HQV A;  3GK1 A;  1D1O A;  1BG1 A;  2E30 A;  2MAZ A;  1YTZ C;  1IRJ A;  4PCW A;  1XYD A;  2JWW A;  1CM4 A;  5D7F A;  1SL7 A;  1MXE A;  1UHH A;  3ZNI A;  1MHO A;  5F6T A;  1DEK A;  4GUK A;  1MXL C;  4OR9 B;  1RK9 A;  4JPZ B;  1JF2 A;  1OQP A;  1XFR A;  2JT0 A;  3JTD B;  4GNK B;  2CTN A;  3FWC A;  1B8R A;  1XFY O;  1BU3 A;  3L4A A;  2M29 A;  3Q8I A;  4ORB B;  1XFW O;  5AXI A;  3S0E A;  4QJ5 B;  1A03 A;  4YGB B;  3KO0 A;  1NYA A;  3VGO A;  4HRG A;  1UWO A;  3SS3 A;  1NPQ A;  1CDL A;  4N1F A;  1IJ6 A;  1B7T Y;  1KFX L;  3NHT A;  1IQ5 A;  4E68 A;  3FWB A;  3R72 A;  2EC6 B;  2JU0 A;  1SCM B;  4HRE E;  4MSP A;  3AKA A;  5AEQ A;  2NCO A;  1UUS A;  5CPV A;  3BFB A;  1F71 A;  4N5X A;  1YRU B;  2ZKM X;  4FTG A;  3SG7 A;  5TNC A;  1IWQ A;  1G4Y R;  1QVI Y;  4AOM A;  4GGN A;  1WRL A;  2M9G A;  2WCL A;  3PM8 A;  1BR4 B;  1NP8 A;  1K90 D;  5ER4 X;  1V1G A;  3DVM A;  1WLZ A;  2ZN9 A;  3GOF A;  3R1P A;  2KOT A;  2QPT A;  3EVU A;  1F4Q A;  1AJ4 A;  3EK8 A;  1Z4H A;  1CNP A;  2KFH A;  2LC5 A;  1EL4 A;  1J55 A;  1PRW A;  3AAK A;  2DOQ A;  1MWN A;  3S0A A;  3TDI A;  3EVV A;  2K2F A;  2M7L A;  2LVK A;  2IS9 A;  1NCX A;  1TNP A;  2KAY A;  2ZNE A;  1DGV A;  1SCV A;  2H61 C;  3EVR A;  2LMV A;  4GBA A;  2KYF A;  3I5F B;  3H4S E;  1C3Z A;  1A2X A;  3EK4 A;  2I7A A;  3SG6 A;  4MN0 A;  1MQ1 A;  5CSI A;  1L2O C;  1KQM C;  2OS8 B;  3BUN B;  3WNX B;  4PDZ A;  4JWQ A;  1PUL A;  3IQO A;  1SKT A;  3KHE A;  2BAP A;  3D76 A;  1CLB A;  1R6P A;  1ZFS A;  1CTR A;  2YGU A;  1SY9 A;  3FIA A;  1F54 A;  3I5H B;  1SBJ A;  4MZL A;  4C0J A;  4F7F A;  2GV5 A;  1FBV A;  1QIW A;  1TWO A;  3CR5 X;  2K7D A;  1EH2 A;  3D75 A;  1FF1 A;  3CZ1 A;  1EJ3 A;  3S0F A;  1DJI A;  2JOJ A;  3GK2 A;  4PE1 A;  5AAN A;  1DTL A;  2ERB A;  2L4H A;  3VRQ A;  1S6J A;  1SK6 D;  1AHR A;  2TN4 A;  2G2B A;  2WOR A;  1BT6 A;  2EHB A;  5CSN A;  1SNL A;  4MVF A;  1W9Z A;  2Y1M A;  1Y0V H;  3PJI A;  2BCA A;  1K96 A;  3CTN A;  2WCB A;  3HCM A;  1YR5 A;  1CLL A;  1B7T Z;  3K1E A;  1U5I B;  1CMF A;  4XJK B;  4MLW A;  3GK4 X;  1XK4 A;  2QEV A;  1NUB A;  3CWG A;  2CXJ A;  2ZND A;  4NDC A;  1UHJ A;  2PAL A;  1H8B A;  2M8U A;  5B8I B;  2JXL A;  1QV1 A;  1RFJ A;  1F8H A;  4A4B A;  1H4B A;  2M7N A;  5KU1 A;  1UHK A;  4GFT A;  1QVI Z;  3VRP A;  1X02 A;  2LAP A;  1UP5 A;  3TZ1 A;  1B9A A;  2LM5 A;  1M46 A;  3TS5 B;  3WHU B;  4D1E A;  2FJU B;  1C3Y A;  1S3P A;  3JTD C;  2M3W A;  1SL9 A;  3OB2 B;  1BJF A;  1PK0 D;  2H61 A;  2BBM A;  4DUQ A;  1LXF C;  1PVA A;  2WCH A;  5HLO A;  4GAO A;  3SG4 A;  1C07 A;  3V2L A;  1FPW A;  1J7O A;  2WOS A;  2Q4U A;  1U5I A;  4PE7 A;  1M45 A;  2EC6 C;  1KQV A;  1SRA A;  1LA3 A;  1IGV A;  1SCM C;  1TCO B;  3AKB A;  4M2O A;  1BLQ A;  1BF5 A;  1QWV A;  1IQ3 A;  3DVJ A;  1GM0 A;  1PVB A;  2BE4 A;  2BEC A;  4MZK A;  5JJG A;  1JFJ A;  3S0G A;  2JQ6 A;  4FQO A;  1XVJ A;  3BFA A;  5D69 A;  2LP3 A;  1Y1U A;  1NIW A;  2ZRS A;  4MEW A;  4WQ3 A;  4P2Y B;  1YVH A;  3CS1 A;  3PAT A;  3DY9 A;  1WDC B;  1YX7 A;  3O6B A;  1XFZ O;  5AFP A;  1JWD A;  1IJ5 A;  2B1U A;  1C7V A;  1KFU S;  3RZS A;  4OV2 A;  1FI6 A;  5AER A;  1IH0 A;  1YX8 A;  1NSH A;  1S1E A;  3KPX A;  1BR1 B;  4P5O E;  5CSF A;  1A4P A;  4C0K A;  3I5F C;  1T14 A;  5FYX A;  2F3Z A;  3DVE A;  2FCE A;  1FI5 A;  2FOT A;  2KI4 C;  2OS8 C;  3DXL A;  1M39 A;  1LA0 A;  4C0L A;  1TNW A;  2F2P A;  2KAX A;  5K89 A;  1DC1 A;  3HX4 A;  2JT3 A;  4INW A;  2NZ0 A;  3SIA A;  2KFF A;  1TUJ A;  1KK7 Y;  1XK4 C;  2KLD A;  3IQQ A;  2O60 A;  2SAS A;  2OPO A;  1JC2 A;  5DIC A;  2P6B B;  3I5H C;  5I94 A;  5HLV A;  1S5G Y;  5D3O A;  2LLU A;  1J1E A;  1J7R A;  1YUS A;  1Q80 A;  5KSZ A;  1LS8 A;  1GJY A;  3D0Y B;  3N7H A;  1AVS A;  2KI6 C;  2WND A;  4OZD A;  4Q04 A;  2L51 A;  3SG5 A;  1XA5 A;  2F8P A;  3I5G B;  5G08 A;  1JF0 A;  2LHI A;  1CFP A;  3KEV A;  4U8D A;  1OW4 A;  1TUZ A;  3EG5 B;  4HRH A;  4I5L B;  2AAO A;  4OVN F;  2CT9 A;  2JXC A;  2LHL A;  3SJS A;  2JC2 A;  2V53 A;  1W7J B;  4PHN A;  2QEB A;  2WC5 A;  3CZ0 A;  2Y4Q A;  1E8A A;  1YUU A;  5FI6 A;  3SG3 A;  2LNK A;  1K2H A;  2LVV A;  2NCP A;  2H2K A;  2KI4 B;  1QX5 B;  2Y1N A;  3C1V A;  2WC8 A;  1SW8 A;  3B6X A;  1JUO A;  3OB1 B;  3NGV A;  1KK8 B;  3D73 A;  1Y1A A;  3BUX B;  3D74 A;  3RM1 A;  3D10 A;  1SPY A;  1JSA A;  2MJW B;  2HQ8 A;  1DEL A;  1EG3 A;  1EXR A;  2JT8 A;  2PQL A;  4NQG A;  4GPL B;  3PN7 B;  1K95 A;  3D0Y A;  2CCM A;  4UPG A;  1V1F A;  2LV7 A;  1TTX A;  3OGN A;  1KSM A;  2WCF A;  1CLM A;  1DJZ A;  2I18 A;  3JVT B;  4I5N B;  2HET A;  3TS5 C;  2JTT A;  3IVT A;  2K0J A;  2PMY A;  2AUC A;  4IJ7 A;  1QS7 A;  1A29 A;  2EGD A;  1P28 A;  4MZJ A;  4YI9 A;  3OX6 A;  4PT1 A;  4YGC B;  1CDP A;  5DKN A;  2FJY A;  1J7P A;  1QIV A;  4HSZ A;  1SR6 B;  1B4C A;  1ORG A;  3BUW B;  3SS5 A;  2PVB A;  3DF0 B;  2JNF A;  2BL0 B;  1KWO B;  2CNP A;  1UHI A;  2PRU A;  3LK0 A;  2BCX A;  2WCM A;  2KSP A;  4YGA A;  1DJW A;  3D77 A;  1QLS A;  1N0Y A;  2PYQ A;  4DCK A;  2LUC A;  1NX0 A;  1SYM A;  3I5I B;  3OBV A;  4CLN A;  1OOH A;  2VRG A;  1K9P A;  1CDM A;  3K21 A;  4CFQ A;  2LLS A;  2O5G A;  2K2A A;  5CSJ A;  1AJ5 A;  2MHH A;  4PHM A;  4AQI A;  1W7I B;  1WLM A;  1BOD A;  2GGZ A;  2KGR A;  2LAN A;  1TN4 A;  2MLE C;  3SG2 A;  3BQ3 A;  1WRZ A;  3TUY B;  4MBE A;  3R1O A;  2JPO A;  1DMO A;  2BKI B;  3A4U B;  3RLZ A;  1FW4 A;  1S5G Z;  1DJY A;  2NXQ A;  4GGF A;  4QJ3 B;  4JQ0 D;  3NSO A;  3FE9 A;  1QV0 A;  1WDC C;  3ICB A;  2I2R E;  2NLN A;  1K94 A;  1C7W A;  2H8V A;  3PAL A;  1ALW A;  3R1V A;  3DVK A;  1MR8 A;  2BCB A;  3E3R A;  1SMG A;  2A4J A;  4CPV A;  2M1U A;  3FE8 A;  1KCY A;  1AK8 A;  3DF0 A;  4BY4 A;  5GQQ C;  4N1G A;  1M31 A;  2PSR A;  3NSK A;  4QJ4 B;  1YRT B;  1S6I A;  4PHJ A;  1CFD A;  5J3X A;  4ORA B;  4OKH A;  4XJK A;  2HQW A;  2ZRT A;  1NX3 A;  3BJH A;  4YGE B;  1TRF A;  4ORC B;  1OMV A;  3VRO A;  1OOJ A;  2LVJ A;  4YI8 A;  1RRO A;  1XFV O;  1DVI A;  5KTY A;  4WQ2 A;  1YUT A;  1OMR A;  4INX A;  1S26 D;  1GGZ A;  1QLK A;  2JPT A;  2COL B;  1JBA A;  1PSR A;  1OOG A;  1Y6W A;  3KF9 A;  1TNX A;  1OZS A;  2M1K B;  4R1E A;  2KQY A;  2JTZ A;  1OOF A;  2LLT A;  3I5G C;  3OP0 A;  3PSR A;  5FI2 A;  1AP4 A;  1JFK A;  1CDN A;  1CKK A;  3WXA A;  4FQT A;  2BE6 A;  1ZUZ A;  3BOW B;  1NCZ A;  2M0R A;  1S6C A;  3CZ2 A;  3IF7 A;  4ICB A;  1KFU L;  4ZCV A;  2FCD A;  3B7A A;  3DZT A;  5JOL A;  2K8M B;  3EKH A;  5IBW A;  1VRK A;  2K60 A;  3DYE A;  3PFV A;  1N65 A;  2MBX A;  1L7Z A;  2LMU A;  2L0P A;  3BXK A;  3CR2 A;  2JRF A;  2OTG B;  1KK8 C;  1ZOT B;  1DJX A;  1F4O A;  3B88 A;  3PLF B;  3L4L A;  2CBL A;  4MRY A;  1XFU O;  1A75 B;  3O78 A;  3EK7 A;  2LCP A;  2E6W A;  1KFX S;  3PN7 C;  1J1D A;  2HF5 A;  1K8U A;  3NSL A;  3UNW A;  5HYD A;  2I94 A;  3FS7 A;  4DS7 A;  2ZFD A;  1OOI X;  1PSB A;  3LCP C;  2KDH A;  2L4I A;  3JVT C;  1R2U A;  2Y5I A;  3CLN A;  4XYN A;  4DIR A;  4GGF C;  2PAS A;  2LE9 B;  2M97 A;  4NDD A;  4USL A;  3LK1 A;  3BOW A;  5PAL A;  1F55 A;  3F45 A;  1PAL A;  4I5J A;  2KI6 D;  3O2P A;  4MRX A;  2L2E A;  3PM2 A;  1SR6 C;  1YVL A;  1WRK A;  2F2O A;  2L50 A;  4M2Q A;  4M2P A;  1CB1 A;  1K9U A;  1NCY A;  2BL0 C;  1KWO C;  2G9B A;  3M0W A;  1QJT A;  2WC6 A;  1M63 B;  1MF8 B; 
#chains in the Genus database with same CATH homology
 1N2D A;  4TNC A;  1S36 A;  2LMT A;  4PE0 A;  3LL8 B;  3I5I C;  2KQ6 A;  4OCI A;  1OMD A;  1A75 A;  3BYA A;  2BBN A;  1GGW A;  1CMG A;  1RWY A;  1IG5 A;  1YUR A;  3LLE A;  1KSO A;  1ZMZ A;  1AUI B;  3A8R A;  4BY5 A;  3TUY C;  3OHM B;  1ODB A;  1DT7 B;  2AMI A;  1QXP A;  2ZN8 A;  4YRU A;  1DJH A;  4AQJ A;  4ZCU A;  2KGB C;  4NDB A;  2K7C A;  1QAS A;  2QAC A;  2LP2 A;  4A4C A;  1OSA A;  2HPS A;  1F70 A;  2R2I A;  3O4Y A;  1LIN A;  4IL1 A;  3QRX A;  1Y1X A;  1RTP 1;  3BUM B;  1NX2 A;  4L9M A;  1B8L A;  1REC A;  3VRR A;  2KNE A;  1HT9 A;  2GGM A;  2KHN A;  3TDU A;  3ZWH A;  4YBH B;  4PHK A;  2JNX A;  4F0Z B;  1CFF A;  1DF0 B;  2D8N A;  2F33 A;  1K93 D;  3AAJ A;  4CID A;  1NWD A;  1EG4 A;  1B1G A;  2LUX A;  2RGI A;  1G8I A;  2KBI A;  1KK7 Z;  3NSI A;  5DKQ A;  1OZO A;  3CZT X;  5I8N A;  2MRD A;  4I5K A;  1QTX A;  2K7B A;  2LVI A;  1RJV A;  4PAL A;  5DKR A;  1L2O B;  1KQM B;  1XO5 A;  2JUL A;  3TDZ A;  5BPJ A;  5HKW A;  5ER5 A;  2JZI A;  5HKZ A;  3NXA A;  4PE4 A;  2L98 A;  1B8C A;  2K61 A;  3MSE B;  1LVC D;  1UHN A;  2BKH B;  4CFR A;  2F3Y A;  2M49 B;  1CFC A;  3SIB A;  1SL8 A;  1LKJ A;  3EKJ A;  1G33 A;  1ALV A;  5HKY A;  1DF0 A;  1J7Q A;  3CR4 X;  2KBM A;  1MUX A;  2KAV A;  2MA2 A;  1WY9 A;  2OTG C;  2Q91 A;  1CM1 A;  3OX5 A;  3WHT B;  1K9K A;  1NX1 A;  1OE9 B;  4ETO A;  5I2L A;  1TNQ A;  4DRW A;  1TOP A;  2L5X B;  1TIZ A;  1BOC A;  1QX7 A;  2MLF C;  1DGU A;  1GQM A;  5I2O A;  3VRN A;  1ZAC A;  2KYC A;  3CGA A;  1IKU A;  1UUR A;  2KFG A;  4YGD B;  3DD4 A;  2SCP A;  1TCF A;  2ISD A;  1QX2 A;  1DJG A;  2WCE A;  1XFX O;  2K7O A;  1QAT A;  4WRI A;  3BUO B;  1B47 A;  1BMO A;  1HQV A;  3GK1 A;  1D1O A;  1BG1 A;  2E30 A;  2MAZ A;  1YTZ C;  1IRJ A;  4PCW A;  1XYD A;  2JWW A;  1CM4 A;  5D7F A;  1SL7 A;  1MXE A;  1UHH A;  3ZNI A;  1MHO A;  5F6T A;  4GUK A;  1MXL C;  4OR9 B;  1RK9 A;  4JPZ B;  1JF2 A;  1OQP A;  2JT0 A;  3JTD B;  4GNK B;  2CTN A;  3FWC A;  1B8R A;  1XFY O;  1BU3 A;  4QJ5 B;  2M29 A;  4ORB B;  1XFW O;  5AXI A;  1A03 A;  4YGB B;  3KO0 A;  1NYA A;  3VGO A;  4HRG A;  1UWO A;  1NPQ A;  1CDL A;  4N1F A;  1IJ6 A;  1B7T Y;  1KFX L;  4E68 A;  1IQ5 A;  3FWB A;  2EC6 B;  2JU0 A;  1SCM B;  4HRE E;  4MSP A;  3AKA A;  5AEQ A;  2NCO A;  1UUS A;  5CPV A;  1F71 A;  4N5X A;  1YRU B;  2ZKM X;  4FTG A;  3SG7 A;  5TNC A;  1IWQ A;  1G4Y R;  1QVI Y;  4AOM A;  4GGN A;  1WRL A;  2M9G A;  3PM8 A;  1BR4 B;  1NP8 A;  1K90 D;  5ER4 X;  1V1G A;  3DVM A;  1WLZ A;  2ZN9 A;  3GOF A;  2KOT A;  2QPT A;  3EVU A;  1F4Q A;  1AJ4 A;  3EK8 A;  1CNP A;  2KFH A;  2LC5 A;  1EL4 A;  1J55 A;  1PRW A;  3AAK A;  2DOQ A;  1MWN A;  3TDI A;  3EVV A;  2K2F A;  2M7L A;  2LVK A;  2IS9 A;  1NCX A;  1TNP A;  2KAY A;  2ZNE A;  1DGV A;  1SCV A;  2H61 C;  3EVR A;  2LMV A;  4GBA A;  2KYF A;  3I5F B;  3H4S E;  3SG6 A;  1A2X A;  3EK4 A;  2I7A A;  4MN0 A;  1MQ1 A;  5CSI A;  1L2O C;  1KQM C;  2OS8 B;  3BUN B;  3WNX B;  4PDZ A;  4JWQ A;  1PUL A;  3IQO A;  1SKT A;  3KHE A;  1CLB A;  1R6P A;  1ZFS A;  1CTR A;  1SY9 A;  3FIA A;  1F54 A;  3I5H B;  1SBJ A;  4MZL A;  4C0J A;  2GV5 A;  1FBV A;  1QIW A;  3CR5 X;  2K7D A;  1EH2 A;  1FF1 A;  1EJ3 A;  1DJI A;  2JOJ A;  3GK2 A;  4PE1 A;  5AAN A;  1DTL A;  2L4H A;  3VRQ A;  1S6J A;  1SK6 D;  1AHR A;  2TN4 A;  2G2B A;  2WOR A;  1BT6 A;  2EHB A;  5CSN A;  1SNL A;  4MVF A;  2Y1M A;  1Y0V H;  2BCA A;  1K96 A;  3CTN A;  2WCB A;  3HCM A;  1YR5 A;  1CLL A;  1B7T Z;  1U5I B;  1CMF A;  4XJK B;  4MLW A;  3GK4 X;  1XK4 A;  1NUB A;  3CWG A;  2CXJ A;  2ZND A;  4NDC A;  1UHJ A;  2PAL A;  1H8B A;  2M8U A;  5B8I B;  2JXL A;  1QV1 A;  1RFJ A;  1F8H A;  4A4B A;  1H4B A;  2M7N A;  5KU1 A;  1UHK A;  4GFT A;  1QVI Z;  3VRP A;  1X02 A;  2LAP A;  1UP5 A;  3TZ1 A;  1B9A A;  2LM5 A;  1M46 A;  3TS5 B;  3WHU B;  4D1E A;  2FJU B;  1S3P A;  3JTD C;  2M3W A;  1SL9 A;  3OB2 B;  1BJF A;  1PK0 D;  2H61 A;  2BBM A;  4DUQ A;  1LXF C;  1PVA A;  5HLO A;  4GAO A;  3SG4 A;  1C07 A;  1FPW A;  1J7O A;  2WOS A;  2Q4U A;  1U5I A;  4PE7 A;  1M45 A;  2EC6 C;  1KQV A;  1SRA A;  1LA3 A;  1IGV A;  1SCM C;  1TCO B;  3AKB A;  4M2O A;  1BLQ A;  1BF5 A;  1IQ3 A;  3DVJ A;  1PVB A;  2BE4 A;  2BEC A;  4MZK A;  5JJG A;  1JFJ A;  2JQ6 A;  4FQO A;  1XVJ A;  5D69 A;  2LP3 A;  1Y1U A;  1NIW A;  2ZRS A;  4MEW A;  4WQ3 A;  4P2Y B;  1YVH A;  3CS1 A;  3PAT A;  1WDC B;  1YX7 A;  3O6B A;  1XFZ O;  5AFP A;  1JWD A;  1IJ5 A;  2B1U A;  1C7V A;  1KFU S;  1FI6 A;  4OV2 A;  5AER A;  1IH0 A;  1YX8 A;  1NSH A;  1S1E A;  3KPX A;  1BR1 B;  4P5O E;  5CSF A;  1A4P A;  4C0K A;  3I5F C;  5FYX A;  2F3Z A;  3DVE A;  2FCE A;  1FI5 A;  2FOT A;  2KI4 C;  2OS8 C;  1M39 A;  1LA0 A;  4C0L A;  1TNW A;  2F2P A;  2KAX A;  5K89 A;  3HX4 A;  2JT3 A;  2NZ0 A;  3SIA A;  2KFF A;  1KK7 Y;  1XK4 C;  3IQQ A;  2O60 A;  2SAS A;  2OPO A;  1JC2 A;  2P6B B;  3I5H C;  5HLV A;  1S5G Y;  2LLU A;  1J1E A;  1J7R A;  1YUS A;  1Q80 A;  5KSZ A;  1GJY A;  3D0Y B;  1AVS A;  2KI6 C;  2WND A;  4Q04 A;  2L51 A;  3SG5 A;  1XA5 A;  2F8P A;  3I5G B;  5G08 A;  1JF0 A;  2LHI A;  1CFP A;  3KEV A;  4U8D A;  4HRH A;  4I5L B;  2AAO A;  4OVN F;  2CT9 A;  2JXC A;  2LHL A;  3SJS A;  2JC2 A;  2V53 A;  1W7J B;  4PHN A;  2Y4Q A;  1E8A A;  1YUU A;  3SG3 A;  2LNK A;  1K2H A;  2LVV A;  2NCP A;  2H2K A;  2KI4 B;  1QX5 B;  2Y1N A;  3C1V A;  2WC8 A;  1SW8 A;  1JUO A;  3OB1 B;  1KK8 B;  1Y1A A;  3BUX B;  3RM1 A;  3D10 A;  1SPY A;  1JSA A;  2MJW B;  2HQ8 A;  1EG3 A;  1EXR A;  2JT8 A;  4NQG A;  4GPL B;  3PN7 B;  1K95 A;  3D0Y A;  2CCM A;  4UPG A;  1V1F A;  2LV7 A;  1TTX A;  1KSM A;  2WCF A;  1CLM A;  1DJZ A;  2I18 A;  3JVT B;  4I5N B;  2HET A;  3TS5 C;  2JTT A;  5I2Q A;  2K0J A;  2PMY A;  2AUC A;  1QS7 A;  1A29 A;  2EGD A;  4MZJ A;  4YI9 A;  3OX6 A;  4YGC B;  1CDP A;  5DKN A;  1J7P A;  1QIV A;  4HSZ A;  1SR6 B;  1B4C A;  3BUW B;  2PVB A;  3DF0 B;  2JNF A;  2BL0 B;  1KWO B;  2CNP A;  1UHI A;  2PRU A;  3LK0 A;  2BCX A;  2KSP A;  4YGA A;  1DJW A;  1QLS A;  1N0Y A;  4DCK A;  2LUC A;  1NX0 A;  1SYM A;  3I5I B;  4CLN A;  2VRG A;  1K9P A;  1CDM A;  3K21 A;  4CFQ A;  2LLS A;  2O5G A;  2K2A A;  5CSJ A;  1AJ5 A;  2MHH A;  4PHM A;  4AQI A;  1W7I B;  1WLM A;  1BOD A;  2GGZ A;  2KGR A;  2LAN A;  1TN4 A;  2MLE C;  3SG2 A;  3BQ3 A;  1WRZ A;  3TUY B;  4MBE A;  1DMO A;  2BKI B;  3A4U B;  3RLZ A;  1FW4 A;  1S5G Z;  1DJY A;  2NXQ A;  4GGF A;  4QJ3 B;  4JQ0 D;  3NSO A;  3WXA A;  1QV0 A;  1WDC C;  3ICB A;  2I2R E;  2NLN A;  1K94 A;  1C7W A;  3PAL A;  4DIR A;  1ALW A;  3DVK A;  1MR8 A;  2BCB A;  3E3R A;  1SMG A;  2A4J A;  4CPV A;  2M1U A;  1KCY A;  1AK8 A;  3DF0 A;  4BY4 A;  5GQQ C;  4N1G A;  1M31 A;  2PSR A;  3NSK A;  4QJ4 B;  1YRT B;  1S6I A;  4PHJ A;  1CFD A;  5J3X A;  4ORA B;  4OKH A;  4XJK A;  2HQW A;  2ZRT A;  1NX3 A;  4YGE B;  1TRF A;  4ORC B;  1OMV A;  3VRO A;  1OOJ A;  2LVJ A;  4YI8 A;  1RRO A;  1XFV O;  1DVI A;  5KTY A;  4WQ2 A;  1YUT A;  1OMR A;  1S26 D;  1GGZ A;  1QLK A;  2JPT A;  2COL B;  1JBA A;  1PSR A;  1Y6W A;  3KF9 A;  1TNX A;  1OZS A;  2M1K B;  4R1E A;  2KQY A;  2JTZ A;  2LLT A;  3I5G C;  3OP0 A;  3PSR A;  1AP4 A;  1JFK A;  1CDN A;  1CKK A;  2BE6 A;  1ZUZ A;  3BOW B;  1NCZ A;  2M0R A;  1S6C A;  3IF7 A;  4ICB A;  1KFU L;  4ZCV A;  2FCD A;  5JOL A;  2K8M B;  3EKH A;  5IBW A;  1VRK A;  3PFV A;  1N65 A;  2MBX A;  1L7Z A;  2LMU A;  2L0P A;  3BXK A;  3CR2 A;  2JRF A;  2OTG B;  1KK8 C;  1ZOT B;  1DJX A;  1F4O A;  3PLF B;  2CBL A;  4MRY A;  1XFU O;  1A75 B;  3O78 A;  3EK7 A;  2LCP A;  2E6W A;  1KFX S;  3PN7 C;  1J1D A;  2HF5 A;  1K8U A;  3NSL A;  5HYD A;  2I94 A;  3FS7 A;  4DS7 A;  2ZFD A;  1PSB A;  3LCP C;  2KDH A;  2L4I A;  3JVT C;  1R2U A;  2Y5I A;  3CLN A;  4XYN A;  4GGF C;  2PAS A;  2LE9 B;  2M97 A;  4NDD A;  4USL A;  3LK1 A;  3BOW A;  5PAL A;  1F55 A;  3F45 A;  1PAL A;  4I5J A;  2KI6 D;  3O2P A;  4MRX A;  2L2E A;  1SR6 C;  1YVL A;  1WRK A;  2F2O A;  2L50 A;  4M2Q A;  4M2P A;  1CB1 A;  1K9U A;  1NCY A;  2BL0 C;  1KWO C;  2G9B A;  3M0W A;  1QJT A;  1M63 B;  1MF8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...