5G08A

Crystal structure of drosophila ncs-1 bound to chlorpromazine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
180
structure length
180
Chain Sequence
KNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRMVQALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FREQUENIN 2
publication title Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 70
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2016-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5g08A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5g08A02
1RTP1 4MZLA 2KYFA 1J1DA 1DMOA 1W7IB 5DKRA 1PRWA 1JF2A 3BOWB 1BT6A 4CLNA 2M1UA 1B1GA 1G8IA 1SW8A 2RGIA 3AKAA 4P2YB 2KGBC 2WCEA 1K96A 3BUMB 4JPZB 5JOLA 1CDMA 2WNDA 1F71A 2MRDA 1UUSA 4NQGA 1SBJA 1TNWA 1A75B 1OOJA 2HQ8A 3NSLA 3BUNB 3RLZA 4CIDA 4YI9A 4YRUA 1K9UA 4MZJA 4QJ4B 4WRIA 1NPQA 1M45A 4OCIA 1SCVA 3ZWHA 1NX3A 2MA2A 2LUXA 1OZSA 5F6TA 1C7VA 4A4BA 2SASA 1CLMA 4PE0A 3LL8B 4YGAA 1MF8B 1YX8A 2JWWA 1F54A 1PSRA 1B9AA 1V1GA 1YVLA 1ZFSA 4MN0A 3CTNA 2KI4C 3LCPC 1WLMA 1XVJA 4MRYA 5BPJA 3JVTB 1WY9A 3CWGA 3I5IC 1CLLA 1QVIZ 1M39A 2LHIA 3H4SE 5AANA 1WDCC 3EKJA 1C7WA 1PULA 3SG4A 2MLEC 1R2UA 2L4HA 1S5GY 3KPXA 1A4PA 1XK4C 2ZNEA 1BG1A 1XFZO 1DJHA 4AOMA 2ZFDA 1IQ3A 2FOTA 4F0ZB 3CR2A 4JQ0D 2L2EA 4AQIA 2G2BA 1B8RA 3VRPA 5AXIA 3NSKA 1NCXA 2LM5A 3I5FB 1CLBA 1AVSA 2F2OA 1B7TY 1B8LA 1MXLC 3BOWA 2JULA 2BBMA 4CPVA 1K94A 3SG7A 2M49B 1N65A 2MLFC 2AMIA 2LLSA 1L7ZA 2K7BA 2ZN9A 3DVKA 5DKNA 4USLA 1XFYO 1H4BA 2OS8B 1KQMB 1A75A 2BECA 3OP0A 4MZKA 3TUYC 3EK8A 4C0LA 1GQMA 5CSFA 1RWYA 1DGVA 4PHKA 2KI6D 1WLZA 1AHRA 2NCPA 4QJ5B 1KK7Y 5KSZA 4C0JA 3FWBA 2Y1NA 4N1FA 1RROA 1IJ5A 1TNQA 2M1KB 1CFPA 3I5HB 3BUOB 5FYXA 2MAZA 1EG3A 1K8UA 1RJVA 2CBLA 2BKHB 3OX5A 1QX2A 3FWCA 2PMYA 2GGZA 5HKYA 3GK1A 3I5GB 4DRWA 4OVNF 1K9KA 3TDZA 1NCZA 5CSIA 4PHNA 3I5IB 1KCYA 2Y4QA 1ODBA 4YBHB 5AERA 2KAYA 1OMVA 2PRUA 1QLSA 2K61A 1BR4B 1TOPA 1N2DA 2ZRTA 2BL0C 5I2LA 1CDLA 1KQVA 1JWDA 2VRGA 2LMVA 2KHNA 4ORAB 2LNKA 1AK8A 1MHOA 2KOTA 4PE1A 5K89A 1ZOTB 2LP2A 4C0KA 2CNPA 1NSHA 2LV7A 4YGDB 2M7LA 2JT8A 1KK8C 2Y1MA 2I94A 2WORA 1SNLA 3AAJA 1L2OC 1UWOA 2LHLA 2OTGB 1OMDA 2DOQA 2KBMA 1MQ1A 2K7CA 1CTRA 5DKQA 4MVFA 3WHTB 4DUQA 2O5GA 3LLEA 1LA3A 2HF5A 3PM8A 4HRGA 1QIVA 2EC6B 1QIWA 3GK4X 3BUWB 4YGEB 5HKZA 2F33A 1EH2A 4YI8A 2FCDA 2JNFA 4R1EA 3O2PA 2LLTA 3OX6A 1MXEA 3FS7A 1BF5A 2I2RE 2CT9A 1XFUO 4ORBB 1Y1AA 4MBEA 4DCKA 1IG5A 1G33A 1XYDA 2JU0A 3PATA 2K8MB 3DF0A 4YGBB 4ZCUA 4PHJA 1YUSA 1QV0A 3PFVA 2KYCA 3GOFA 2F2PA 1NYAA 2MBXA 4GGFC 1NWDA 1CMFA 1M31A 3A4UB 4N1GA 2NLNA 3RM1A 3GK2A 1Y0VH 1AP4A 1NCYA 1NP8A 1EJ3A 5KU1A 4M2PA 4DS7A 1XFWO 1XA5A 1DJGA 2BKIB 1OE9B 2M0RA 2LLUA 3JTDC 4BY5A 1BLQA 1Y1UA 1H8BA 4OR9B 3VRQA 3KO0A 1SL8A 3BQ3A 2MHHA 3EVRA 3PLFB 1ALWA 1Q80A 1HT9A 1UHHA 4UPGA 3CR4X 1IJ6A 1KWOC 1AJ5A 1UHIA 1XO5A 2CXJA 2EGDA 2JXCA 2L98A 4L9MA 2L5XB 5AEQA 1DVIA 2CTNA 2A4JA 2GV5A 1TCFA 1CM1A 1TIZA 2H61A 3OB2B 1E8AA 1UP5A 3CZTX 1WRLA 3PALA 1J55A 1YR5A 2O60A 5HLOA 4BY4A 3LK0A 1JF0A 3TS5C 2LMUA 3QRXA 1ALVA 2NCOA 1IGVA 1QASA 1U5IB 4JWQA 3C1VA 1NX1A 1DJIA 1YRUB 1EG4A 1FI6A 3AAKA 1LXFC 4U8DA 1QLKA 2PVBA 2V53A 4GPLB 4PE4A 3D10A 2IS9A 4E68A 4M2OA 3PN7C 3D0YB 2E30A 4GBAA 4PE7A 1CNPA 2LP3A 1A2XA 3VRNA 1B4CA 2KSPA 5ER4X 1BODA 2KGRA 3DD4A 1B47A 3O78A 4PALA 2ISDA 4IL1A 1SCMC 1SR6C 1AUIB 2JRFA 2TN4A 5KTYA 1W7JB 4TNCA 4N5XA 1DTLA 3DF0B 2NZ0A 1ZUZA 4AQJA 3CGAA 2MJWB 1YUUA 2KI4B 1TTXA 2Q4UA 1GGWA 1UURA 3IF7A 2FCEA 1S5GZ 1Y6WA 1NUBA 1WDCB 4GUKA 4I5JA 3KHEA 1YRTB 2I7AA 1IRJA 1SKTA 3ZNIA 2BE4A 1OQPA 4HSZA 2F8PA 3IQOA 2M97A 2LE9B 2K0JA 4NDCA 1RFJA 1B7TZ 1QS7A 1PK0D 2BCAA 5CSNA 1CFCA 1UHKA 3HCMA 1QX7A 3M0WA 1JC2A 1TCOB 2M7NA 1WRKA 2HPSA 3SJSA 3EVVA 1U5IA 2Y5IA 5D69A 1QX5B 2JNXA 1DJYA 1QTXA 1NX0A 2M8UA 3JVTC 2HETA 1LA0A 3SIBA 2D8NA 1DJZA 2OPOA 1KK7Z 3BXKA 3D0YA 3MSEB 1D1OA 1YTZC 2KDHA 3BUXB 3O6BA 2KNEA 3TUYB 2WOSA 3DVJA 5AFPA 3WHUB 5ER5A 1PVAA 1K2HA 1QVIY 1TRFA 1S3PA 3VRRA 3O4YA 4PHMA 3PSRA 5J3XA 1FF1A 1JFKA 1QXPA 2JOJA 1WRZA 4FQOA 3TDIA 1VRKA 3EK7A 4MLWA 2K7OA 2K7DA 1RK9A 2ZNDA 1SR6B 4GFTA 2M29A 3OHMB 3HX4A 4Q04A 1ZMZA 5PALA 2WCFA 2WCBA 3I5FC 1JSAA 1CB1A 1JUOA 2KFFA 3NSOA 3VROA 2JQ6A 2P6BB 3F45A 1PVBA 2BE6A 4GAOA 3EVUA 1BU3A 3SG2A 2JTTA 2I18A 2KFGA 5CSJA 2ZN8A 3ICBA 5G08A 1CFFA 4D1EA 2OS8C 1KQMC 1J7PA 2JTZA 3EK4A 2BL0B 1FI5A 1XK4A 3CLNA 3E3RA 2PALA 1K90D 3OB1B 1CDPA 1K95A 2WC8A 2B1UA 4P5OE 2ZKMX 4ORCB 1S26D 1G4YR 1F4QA 2BBNA 1S6JA 4WQ3A 1GGZA 1A03A 3I5HC 2KQYA 1SY9A 4XYNA 1PSBA 1IKUA 4CFRA 1FBVA 4NDDA 4QJ3B 2GGMA 2L50A 4OKHA 1UHNA 1KK8B 2JT0A 2M3WA 1K9PA 2KAVA 1CMGA 1L2OB 4OV2A 2M9GA 2L51A 1BJFA 3DVEA 3I5GC 3LK1A 4MEWA 1CDNA 1OZOA 1QJTA 3SG5A 3CS1A 2JPTA 1DF0B 2AUCA 2JXLA 3VGOA 1UHJA 3NSIA 1DJXA 1SRAA 2E6WA 1CM4A 1EL4A 3AKBA 1S6IA 4XJKB 4ZCVA 1F70A 2LCPA 3BYAA 1OMRA 3SIAA 1K93D 1CFDA 1KFXS 1DT7B 4PCWA 5HLVA 3KF9A 4MRXA 2FJUB 1SMGA 4PDZA 3SG3A 1MWNA 1IWQA 3IQQA 1AJ4A 1RECA 1KSOA 2LAPA 2JZIA 2KFHA 5D7FA 1IQ5A 2CCMA 5HKWA 1KFXL 1TNXA 2LVVA 4GGNA 1TN4A 1BMOA 4DIRA 2HQWA 2H2KA 1CKKA 1DJWA 3K21A 4I5LB 2H61C 5GQQC 2OTGC 1F8HA 1V1FA 2QACA 2K2FA 2QPTA 1OSAA 2AAOA 4NDBA 3SG6A 1J7OA 4HRHA 1Y1XA 2KQ6A 4ICBA 4ETOA 1NX2A 2EC6C 1YUTA 1FPWA 2KAXA 1S1EA 1F4OA 4FTGA 2BCBA 3WXAA 5I2OA 3WNXB 1SL9A 1YX7A 3JTDB 2Q91A 1M63B 4WQ2A 1MUXA 4HREE 5HYDA 1KFUS 2LMTA 1GJYA 1MR8A 1YURA 2EHBA 3NXAA 2JT3A 2L4IA 5JJGA 1SYMA 2LANA 2PSRA 1KWOB 1S36A 2PASA 1BOCA 2LUCA 1JBAA 2SCPA 2LVJA 1PALA 1EXRA 4YGCB 2G9BA 2L0PA 1SL7A 1YVHA 2LVIA 3KEVA 3CR5X 1KFUL 4GNKB 1B8CA 1DF0A 1F55A 1HQVA 1SK6D 1J1EA 3FIAA 1LVCD 4XJKA 2F3YA 2NXQA 1X02A 3TS5B 1IH0A 1N0YA 4CFQA 2JC2A 3TZ1A 1ZACA 2BCXA 2KI6C 4M2QA 5TNCA 2R2IA 5CPVA 2ZRSA 1BR1B 1XFVO 2K2AA 2COLB 1QV1A 4I5KA 5IBWA 1A29A 1S6CA 2F3ZA 5I2QA 4MSPA 3PN7B 1J7RA 1SPYA 4A4CA 2LC5A 1R6PA 1M46A 1KSMA 3A8RA 4I5NB 1LKJA 1LINA 1JFJA 1FW4A 1DGUA 1NIWA 5B8IB 1TNPA 3TDUA 4GGFA 3EKHA 3DVMA 1J7QA 1SCMB 5I8NA 1QATA 2LVKA 1XFXO 2KBIA 1C07A
chains in the Genus database with same CATH superfamily
1RTP1 4MZLA 2KYFA 1J1DA 1DMOA 1W7IB 5DKRA 1PRWA 1JF2A 2P71A 3BOWB 1BT6A 4CLNA 2M1UA 1B1GA 1G8IA 3N7HA 1SW8A 2RGIA 3AKAA 4P2YB 2KGBC 2WCEA 1K96A 3BUMB 4JPZB 5JOLA 1CDMA 3CYZA 2WNDA 4IJ7A 2MRDA 1UUSA 1F71A 4NQGA 1SBJA 1TNWA 1A75B 1OOJA 2HQ8A 3NSLA 3BUNB 3RLZA 4CIDA 4YI9A 4YRUA 1TUZA 1K9UA 4MZJA 4QJ4B 4WRIA 1NPQA 1M45A 4OCIA 3D75A 1SCVA 3ZWHA 2WCJA 1NX3A 2MA2A 2LUXA 1OZSA 5F6TA 1C7VA 4A4BA 2SASA 1CLMA 4PE0A 3SS4A 3LL8B 4YGAA 1MF8B 1YX8A 2JWWA 2BNXA 1PSRA 1F54A 1B9AA 1V1GA 1YVLA 1ZFSA 3NHTA 3CTNA 4MN0A 1OOGA 2QDIA 2YGUA 2KI4C 3LCPC 1WLMA 1XVJA 3CDNA 4MRYA 5BPJA 3JVTB 1WY9A 3CWGA 3I5IC 1CLLA 1QVIZ 1M39A 2LHIA 3H4SE 5AANA 1WDCC 3EKJA 3NGVA 1C7WA 1PULA 3SG4A 2MLEC 1R2UA 2L4HA 3BFBA 1S5GY 3KPXA 1A4PA 1XK4C 2ZNEA 1BG1A 1XFZO 1DJHA 4AOMA 2ZFDA 5I94A 2FOTA 4F0ZB 2FJYA 1IQ3A 3CR2A 4JQ0D 2L2EA 4AQIA 2G2BA 1B8RA 3CZ0A 3VRPA 5AXIA 3NSKA 1NCXA 2LM5A 3I5FB 1CLBA 1AVSA 2F2OA 1B7TY 1B8LA 1MXLC 3BOWA 2JULA 3FE8A 2BBMA 4CPVA 1K94A 3SG7A 3UO9A 2M49B 1N65A 2MLFC 3R1PA 2AMIA 2LLSA 1L7ZA 2K7BA 2ZN9A 3DVKA 5DKNA 4USLA 1XFYO 3B6XA 2OS8B 1H4BA 1KQMB 1A75A 2BECA 3OP0A 4MZKA 3TUYC 3EK8A 4C0LA 1GM0A 1GQMA 5CSFA 1RWYA 1DGVA 4PHKA 2KI6D 1WLZA 1AHRA 2NCPA 4QJ5B 1KK7Y 4FQTA 5KSZA 4C0JA 3FWBA 2Y1NA 4N1FA 1RROA 1IJ5A 1TNQA 2M1KB 1CFPA 3I5HB 3BUOB 5FYXA 2MAZA 1EG3A 1K8UA 1RJVA 2CBLA 1P28A 2BKHB 3OX5A 1QX2A 3FWCA 3QMEA 2PMYA 3CZ2A 2GGZA 5HKYA 3GK1A 3I5GB 4DRWA 4OVNF 1K9KA 3EG5B 1NCZA 5CSIA 3TDZA 4PHNA 3I5IB 1KCYA 2QEHA 2Y4QA 1ODBA 4YBHB 5AERA 2KAYA 1OMVA 2PRUA 1QLSA 2K61A 1BR4B 1TOPA 1N2DA 1DC1A 2ZRTA 2BL0C 5I2LA 1CDLA 1LS8A 1KQVA 1JWDA 2VRGA 2LMVA 2KHNA 4ORAB 2LNKA 1AK8A 1MHOA 2KOTA 4PE1A 5K89A 1ZOTB 1SSEB 2LP2A 4C0KA 2CNPA 1NSHA 2LV7A 4YGDB 2M7LA 2JT8A 1KK8C 2Y1MA 2I94A 2WORA 1SNLA 2BAPA 3AAJA 1L2OC 1UWOA 2JPOA 2LHLA 2OTGB 1OMDA 2DOQA 2KBMA 1MQ1A 3D73A 3BFHA 2K7CA 1CTRA 5DKQA 4MVFA 3WHTB 4DUQA 2O5GA 3LLEA 1LA3A 2HF5A 3PM8A 4HRGA 1QIVA 2EC6B 1QIWA 3GK4X 3BUWB 4YGEB 5HKZA 2F33A 4F7FA 1EH2A 4YI8A 2FCDA 2JNFA 4R1EA 4JKTA 3O2PA 2LLTA 3OX6A 1MXEA 3FS7A 1BF5A 2I2RE 2CT9A 1XFUO 2PYQA 2QEBA 4ORBB 1Y1AA 4MBEA 4DCKA 1IG5A 1TWOA 3S0GA 1G33A 1XYDA 2JU0A 3PATA 1TUJA 2K8MB 3DF0A 4YGBB 4ZCUA 3UNWA 4PHJA 1YUSA 3SS5A 1QV0A 3PFVA 2KYCA 3GOFA 2F2PA 1NYAA 5FI7A 2MBXA 5HL1A 4GGFC 1NWDA 1CMFA 1M31A 3A4UB 4N1GA 2NLNA 3RM1A 3GK2A 1Y0VH 1AP4A 1NCYA 1NP8A 2P70A 1EJ3A 5KU1A 1OOHA 4M2PA 4DS7A 1XFWO 3O4XA 4INWA 1XA5A 2ERBA 1OOFA 1DJGA 2BKIB 2H8VA 1OE9B 2M0RA 2LLUA 3JTDC 4BY5A 1BLQA 3CZ1A 1Y1UA 1H8BA 4OR9B 5EL2A 3DZTA 3VRQA 3KO0A 1SL8A 3BQ3A 2MHHA 3EVRA 3PLFB 3Q8IA 1ALWA 1Q80A 1HT9A 1UHHA 4UPGA 3DYEA 3CR4X 1IJ6A 1KWOC 1AJ5A 1UHIA 1XO5A 2CXJA 2EGDA 2JXCA 3B86A 2L98A 5FI6A 3PJIA 4L9MA 2L5XB 5AEQA 4INXA 1DVIA 2CTNA 2A4JA 2GV5A 1TCFA 1CM1A 1TIZA 2H61A 3OB2B 3K1EA 1E8AA 1UP5A 3CZTX 3SG3A 1IIOA 1WRLA 3S0EA 3PALA 1J55A 1YR5A 2O60A 5HLOA 4BY4A 3LK0A 3D77A 1JF0A 3TS5C 2LMUA 3QRXA 1ALVA 2NCOA 1IGVA 1QASA 2QEVA 1U5IB 4JWQA 3C1VA 1NX1A 1DJIA 1YRUB 1EG4A 1FI6A 3AAKA 1LXFC 4U8DA 1QLKA 2PVBA 2V53A 4GPLB 3VB1A 4PE4A 3D10A 2IS9A 3S0BA 4E68A 2L5YA 4M2OA 3PN7C 3D0YB 2E30A 4GBAA 4PE7A 1CNPA 2LP3A 1A2XA 3VRNA 1B4CA 2KSPA 5ER4X 1BODA 2KGRA 3DD4A 1B47A 3O78A 4PALA 2QEOA 2ISDA 4IL1A 3R72A 1SCMC 1SR6C 1AUIB 2JRFA 2TN4A 5KTYA 1W7JB 4TNCA 4N5XA 1DTLA 2WCHA 3DF0B 3L47A 2NZ0A 1C3YA 1ZUZA 4AQJA 3CGAA 1QWVA 1YUUA 2KI4B 2MJWB 1TTXA 2Q4UA 1GGWA 1UURA 3IF7A 1Z4HA 2FCEA 1S5GZ 1Y6WA 1NUBA 1WDCB 3OGNA 4GUKA 4I5JA 3KHEA 1YRTB 2I7AA 1IRJA 3L4LA 1SKTA 3V2LA 3ZNIA 2BE4A 1OQPA 4HSZA 2F8PA 3IQOA 2M97A 2LE9B 2K0JA 2KPHA 4KYNA 4NDCA 1RFJA 1B7TZ 1QS7A 1PK0D 2BCAA 5CSNA 1CFCA 1UHKA 3HCMA 1QX7A 3M0WA 1JC2A 1TCOB 2M7NA 1WRKA 2HPSA 3SJSA 1OOIX 3EVVA 1U5IA 2Y5IA 5D69A 1QX5B 2JNXA 3RZSA 1DJYA 1QTXA 1NX0A 2M8UA 3JVTC 2HETA 1LA0A 3SIBA 2D8NA 1DJZA 2OPOA 1KK7Z 3BXKA 3D0YA 3MSEB 1D1OA 1YTZC 2KDHA 3BUXB 3O6BA 4OZDA 2KNEA 3TUYB 2WOSA 3DVJA 3DXLA 5AFPA 3WHUB 5ER5A 1PVAA 1K2HA 1QVIY 1TRFA 1S3PA 3VRRA 3O4YA 4PHMA 3PSRA 5J3XA 1FF1A 1JFKA 1QXPA 2JOJA 1WRZA 2WCMA 4FQOA 3TDIA 1VRKA 3EK7A 4MLWA 2K7OA 2K7DA 1RK9A 2ZNDA 1SR6B 4GFTA 2WC6A 2M29A 3OHMB 3HX4A 4Q04A 1ZMZA 5PALA 2WCFA 2WCBA 2K60A 3I5FC 1JSAA 1CB1A 1JUOA 2KFFA 3NSOA 3VROA 2JQ6A 2WCKA 2P6BB 3F45A 1PVBA 2BE6A 4GAOA 1DQEA 3EVUA 1BU3A 3SG2A 2JTTA 1ORGA 2I18A 2KFGA 5CSJA 2ZN8A 3ICBA 5G08A 1CFFA 4D1EA 2OS8C 1KQMC 1DELA 3PM2A 1J7PA 2JTZA 3EK4A 2BL0B 1FI5A 1XK4A 3CLNA 3E3RA 4JD9A 2PALA 1K90D 3OB1B 3BFAA 1CDPA 1K95A 2WC8A 2B1UA 4P5OE 2ZKMX 4ORCB 1S26D 1G4YR 1F4QA 1S6JA 2BBNA 4WQ3A 1GGZA 1A03A 3I5HC 2KQYA 1SY9A 4XYNA 1PSBA 1IKUA 4CFRA 3NHIA 1FBVA 4NDDA 4QJ3B 2GGMA 2L50A 2L2CA 4OKHA 1UHNA 1KK8B 2JT0A 2M3WA 1K9PA 2KAVA 1CMGA 1L2OB 4OV2A 2M9GA 2L51A 1BJFA 3DVEA 3FE9A 3I5GC 3LK1A 4MEWA 1OZOA 1CDNA 1QJTA 3SG5A 3CS1A 2JPTA 1DF0B 2AUCA 2JXLA 3VGOA 1UHJA 3NSIA 1DJXA 1SRAA 2E6WA 1CM4A 1EL4A 3AKBA 1S6IA 1OW4A 3L4AA 4XJKB 4ZCVA 1F70A 2LCPA 3BYAA 1OMRA 3SIAA 1K93D 3IVTA 1CFDA 1KFXS 1DT7B 4PCWA 5HLVA 3KF9A 4MRXA 2FJUB 1SMGA 3D76A 4PDZA 1MWNA 1IWQA 3IQQA 1AJ4A 1RECA 3OBVA 1KSOA 2LAPA 2JZIA 2KFHA 5D7FA 1IQ5A 2CCMA 3CABA 2PQLA 5HKWA 3BJHA 1KFXL 1TNXA 2LVVA 3FE6A 4GGNA 1TN4A 1BMOA 5D3OA 2HQWA 2H2KA 1Z2CB 3R1VA 4DIRA 1CKKA 1DJWA 3S0AA 2WC5A 3K21A 4I5LB 2H61C 5GQQC 2OTGC 1F8HA 1V1FA 2QACA 2K2FA 2QPTA 1OSAA 2AAOA 4NDBA 3SG6A 1J7OA 4HRHA 1Y1XA 2KQ6A 4PT1A 4ICBA 4ETOA 1NX2A 3S0DA 2EC6C 1YUTA 3S0FA 1FPWA 2KAXA 1S1EA 1F4OA 4FTGA 2BCBA 1T14A 3WXAA 5I2OA 3WNXB 1SL9A 1YX7A 3JTDB 3SS3A 3B7AA 2Q91A 1M63B 4WQ2A 1MUXA 4HREE 5HYDA 1KFUS 2LMTA 1GJYA 5DICA 1MR8A 1YURA 2EHBA 3NXAA 2JT3A 2L4IA 5JJGA 1SYMA 1DEKA 2LANA 2PSRA 1KWOB 1S36A 2PASA 1BOCA 2LUCA 1JBAA 2SCPA 2LVJA 1PALA 1EXRA 4YGCB 2G9BA 2L0PA 1SL7A 1YVHA 2LVIA 3KEVA 3CR5X 1KFUL 4GNKB 1B8CA 1DF0A 1F55A 1HQVA 1SK6D 2KLDA 1J1EA 3FIAA 1LVCD 2WCLA 4XJKA 2F3YA 2NXQA 3R1OA 1X02A 2GTEA 3DY9A 3TS5B 1IH0A 1N0YA 2KLEA 4CFQA 2JC2A 3D74A 3TZ1A 5FI2A 1ZACA 2BCXA 1C3ZA 2KI6C 4M2QA 5TNCA 2R2IA 5CPVA 2ZRSA 1BR1B 1XFVO 2K2AA 3D78A 2COLB 1QV1A 4I5KA 5IBWA 1A29A 1S6CA 2F3ZA 5I2QA 4MSPA 3PN7B 1J7RA 1SPYA 4A4CA 2LC5A 1R6PA 1M46A 1KSMA 3A8RA 4I5NB 1LKJA 1LINA 1JFJA 1FW4A 1DGUA 3B87A 1NIWA 1XFRA 5B8IB 1TNPA 3TDUA 4GGFA 3EKHA 3DVMA 3B88A 1J7QA 1SCMB 5I8NA 1QATA 1W9ZA 2LVKA 1XFXO 2KBIA 1C07A
chains in the Genus database with same CATH topology
1RTP1 4MZLA 2KYFA 1J1DA 1DMOA 1W7IB 5DKRA 1PRWA 1JF2A 3BOWB 1BT6A 4CLNA 2M1UA 1B1GA 1G8IA 1SW8A 2RGIA 3AKAA 4P2YB 2KGBC 2WCEA 1K96A 3BUMB 4JPZB 5JOLA 1CDMA 2WNDA 1F71A 2MRDA 1UUSA 4NQGA 1SBJA 1TNWA 1A75B 1OOJA 2HQ8A 3NSLA 3BUNB 3RLZA 4CIDA 4YI9A 4YRUA 1K9UA 4MZJA 4QJ4B 4WRIA 1NPQA 1M45A 4OCIA 1SCVA 3ZWHA 1NX3A 2MA2A 2LUXA 1OZSA 5F6TA 1C7VA 4A4BA 2SASA 1CLMA 4PE0A 3LL8B 4YGAA 1MF8B 1YX8A 2JWWA 1F54A 1PSRA 1B9AA 1V1GA 1YVLA 1ZFSA 4MN0A 3CTNA 2KI4C 3LCPC 1WLMA 1XVJA 4MRYA 5BPJA 3JVTB 1WY9A 3CWGA 3I5IC 1CLLA 1QVIZ 1M39A 2LHIA 3H4SE 5AANA 1WDCC 3EKJA 1C7WA 1PULA 3SG4A 2MLEC 1R2UA 2L4HA 1S5GY 3KPXA 1A4PA 1XK4C 2ZNEA 1BG1A 1XFZO 1DJHA 4AOMA 2ZFDA 1IQ3A 2FOTA 4F0ZB 3CR2A 4JQ0D 2L2EA 4AQIA 2G2BA 1B8RA 3VRPA 5AXIA 3NSKA 1NCXA 2LM5A 3I5FB 1CLBA 1AVSA 2F2OA 1B7TY 1B8LA 1MXLC 3BOWA 2JULA 2BBMA 4CPVA 1K94A 3SG7A 2M49B 1N65A 2MLFC 2AMIA 2LLSA 1L7ZA 2K7BA 2ZN9A 3DVKA 5DKNA 4USLA 1XFYO 1H4BA 2OS8B 1KQMB 1A75A 2BECA 3OP0A 4MZKA 3TUYC 3EK8A 4C0LA 1GQMA 5CSFA 1RWYA 1DGVA 4PHKA 2KI6D 1WLZA 1AHRA 2NCPA 4QJ5B 1KK7Y 5KSZA 4C0JA 3FWBA 2Y1NA 4N1FA 1RROA 1IJ5A 1TNQA 2M1KB 1CFPA 3I5HB 3BUOB 5FYXA 2MAZA 1EG3A 1K8UA 1RJVA 2CBLA 2BKHB 3OX5A 1QX2A 3FWCA 2PMYA 2GGZA 5HKYA 3GK1A 3I5GB 4DRWA 4OVNF 1K9KA 3TDZA 1NCZA 5CSIA 4PHNA 3I5IB 1KCYA 2Y4QA 1ODBA 4YBHB 5AERA 2KAYA 1OMVA 2PRUA 1QLSA 2K61A 1BR4B 1TOPA 1N2DA 2ZRTA 2BL0C 5I2LA 1CDLA 1KQVA 1JWDA 2VRGA 2LMVA 2KHNA 4ORAB 2LNKA 1AK8A 1MHOA 2KOTA 4PE1A 5K89A 1ZOTB 2LP2A 4C0KA 2CNPA 1NSHA 2LV7A 4YGDB 2M7LA 2JT8A 1KK8C 2Y1MA 2I94A 2WORA 1SNLA 3AAJA 1L2OC 1UWOA 2LHLA 2OTGB 1OMDA 2DOQA 2KBMA 1MQ1A 2K7CA 1CTRA 5DKQA 4MVFA 3WHTB 4DUQA 2O5GA 3LLEA 1LA3A 2HF5A 3PM8A 4HRGA 1QIVA 2EC6B 1QIWA 3GK4X 3BUWB 4YGEB 5HKZA 2F33A 1EH2A 4YI8A 2FCDA 2JNFA 4R1EA 3O2PA 2LLTA 3OX6A 1MXEA 3FS7A 1BF5A 2I2RE 2CT9A 1XFUO 4ORBB 1Y1AA 4MBEA 4DCKA 1IG5A 1G33A 1XYDA 2JU0A 3PATA 2K8MB 3DF0A 4YGBB 4ZCUA 4PHJA 1YUSA 1QV0A 3PFVA 2KYCA 3GOFA 2F2PA 1NYAA 2MBXA 4GGFC 1NWDA 1CMFA 1M31A 3A4UB 4N1GA 2NLNA 3RM1A 3GK2A 1Y0VH 1AP4A 1NCYA 1NP8A 1EJ3A 5KU1A 4M2PA 4DS7A 1XFWO 1XA5A 1DJGA 2BKIB 1OE9B 2M0RA 2LLUA 3JTDC 4BY5A 1BLQA 1Y1UA 1H8BA 4OR9B 3VRQA 3KO0A 1SL8A 3BQ3A 2MHHA 3EVRA 3PLFB 1ALWA 1Q80A 1HT9A 1UHHA 4UPGA 3CR4X 1IJ6A 1KWOC 1AJ5A 1UHIA 1XO5A 2CXJA 2EGDA 2JXCA 2L98A 4L9MA 2L5XB 5AEQA 1DVIA 2CTNA 2A4JA 2GV5A 1TCFA 1CM1A 1TIZA 2H61A 3OB2B 1E8AA 1UP5A 3CZTX 1WRLA 3PALA 1J55A 1YR5A 2O60A 5HLOA 4BY4A 3LK0A 1JF0A 3TS5C 2LMUA 3QRXA 1ALVA 2NCOA 1IGVA 1QASA 1U5IB 4JWQA 3C1VA 1NX1A 1DJIA 1YRUB 1EG4A 1FI6A 3AAKA 1LXFC 4U8DA 1QLKA 2PVBA 2V53A 4GPLB 4PE4A 3D10A 2IS9A 4E68A 4M2OA 3PN7C 3D0YB 2E30A 4GBAA 4PE7A 1CNPA 2LP3A 1A2XA 3VRNA 1B4CA 2KSPA 5ER4X 1BODA 2KGRA 3DD4A 1B47A 3O78A 4PALA 2ISDA 4IL1A 1SCMC 1SR6C 1AUIB 2JRFA 2TN4A 5KTYA 1W7JB 4TNCA 4N5XA 1DTLA 3DF0B 2NZ0A 1ZUZA 4AQJA 3CGAA 2MJWB 1YUUA 2KI4B 1TTXA 2Q4UA 1GGWA 1UURA 3IF7A 2FCEA 1S5GZ 1Y6WA 1NUBA 1WDCB 4GUKA 4I5JA 3KHEA 1YRTB 2I7AA 1IRJA 1SKTA 3ZNIA 2BE4A 1OQPA 4HSZA 2F8PA 3IQOA 2M97A 2LE9B 2K0JA 4NDCA 1RFJA 1B7TZ 1QS7A 1PK0D 2BCAA 5CSNA 1CFCA 1UHKA 3HCMA 1QX7A 3M0WA 1JC2A 1TCOB 2M7NA 1WRKA 2HPSA 3SJSA 3EVVA 1U5IA 2Y5IA 5D69A 1QX5B 2JNXA 1DJYA 1QTXA 1NX0A 2M8UA 3JVTC 2HETA 1LA0A 3SIBA 2D8NA 1DJZA 2OPOA 1KK7Z 3BXKA 3D0YA 3MSEB 1D1OA 1YTZC 2KDHA 3BUXB 3O6BA 2KNEA 3TUYB 2WOSA 3DVJA 5AFPA 3WHUB 5ER5A 1PVAA 1K2HA 1QVIY 1TRFA 1S3PA 3VRRA 3O4YA 4PHMA 3PSRA 5J3XA 1FF1A 1JFKA 1QXPA 2JOJA 1WRZA 4FQOA 3TDIA 1VRKA 3EK7A 4MLWA 2K7OA 2K7DA 1RK9A 2ZNDA 1SR6B 4GFTA 2M29A 3OHMB 3HX4A 4Q04A 1ZMZA 5PALA 2WCFA 2WCBA 3I5FC 1JSAA 1CB1A 1JUOA 2KFFA 3NSOA 3VROA 2JQ6A 2P6BB 3F45A 1PVBA 2BE6A 4GAOA 3EVUA 1BU3A 3SG2A 2JTTA 2I18A 2KFGA 5CSJA 2ZN8A 3ICBA 5G08A 1CFFA 4D1EA 2OS8C 1KQMC 1J7PA 2JTZA 3EK4A 2BL0B 1FI5A 1XK4A 3CLNA 3E3RA 2PALA 1K90D 3OB1B 1CDPA 1K95A 2WC8A 2B1UA 4P5OE 2ZKMX 4ORCB 1S26D 1G4YR 1F4QA 2BBNA 1S6JA 4WQ3A 1GGZA 1A03A 3I5HC 2KQYA 1SY9A 4XYNA 1PSBA 1IKUA 4CFRA 1FBVA 4NDDA 4QJ3B 2GGMA 2L50A 4OKHA 1UHNA 1KK8B 2JT0A 2M3WA 1K9PA 2KAVA 1CMGA 1L2OB 4OV2A 2M9GA 2L51A 1BJFA 3DVEA 3I5GC 3LK1A 4MEWA 1CDNA 1OZOA 1QJTA 3SG5A 3CS1A 2JPTA 1DF0B 2AUCA 2JXLA 3VGOA 1UHJA 3NSIA 1DJXA 1SRAA 2E6WA 1CM4A 1EL4A 3AKBA 1S6IA 4XJKB 4ZCVA 1F70A 2LCPA 3BYAA 1OMRA 3SIAA 1K93D 1CFDA 1KFXS 1DT7B 4PCWA 5HLVA 3KF9A 4MRXA 2FJUB 1SMGA 4PDZA 3SG3A 1MWNA 1IWQA 3IQQA 1AJ4A 1RECA 1KSOA 2LAPA 2JZIA 2KFHA 5D7FA 1IQ5A 2CCMA 5HKWA 1KFXL 1TNXA 2LVVA 4GGNA 1TN4A 1BMOA 4DIRA 2HQWA 2H2KA 1CKKA 1DJWA 3K21A 4I5LB 2H61C 5GQQC 2OTGC 1F8HA 1V1FA 2QACA 2K2FA 2QPTA 1OSAA 2AAOA 4NDBA 3SG6A 1J7OA 4HRHA 1Y1XA 2KQ6A 4ICBA 4ETOA 1NX2A 2EC6C 1YUTA 1FPWA 2KAXA 1S1EA 1F4OA 4FTGA 2BCBA 3WXAA 5I2OA 3WNXB 1SL9A 1YX7A 3JTDB 2Q91A 1M63B 4WQ2A 1MUXA 4HREE 5HYDA 1KFUS 2LMTA 1GJYA 1MR8A 1YURA 2EHBA 3NXAA 2JT3A 2L4IA 5JJGA 1SYMA 2LANA 2PSRA 1KWOB 1S36A 2PASA 1BOCA 2LUCA 1JBAA 2SCPA 2LVJA 1PALA 1EXRA 4YGCB 2G9BA 2L0PA 1SL7A 1YVHA 2LVIA 3KEVA 3CR5X 1KFUL 4GNKB 1B8CA 1DF0A 1F55A 1HQVA 1SK6D 1J1EA 3FIAA 1LVCD 4XJKA 2F3YA 2NXQA 1X02A 3TS5B 1IH0A 1N0YA 4CFQA 2JC2A 3TZ1A 1ZACA 2BCXA 2KI6C 4M2QA 5TNCA 2R2IA 5CPVA 2ZRSA 1BR1B 1XFVO 2K2AA 2COLB 1QV1A 4I5KA 5IBWA 1A29A 1S6CA 2F3ZA 5I2QA 4MSPA 3PN7B 1J7RA 1SPYA 4A4CA 2LC5A 1R6PA 1M46A 1KSMA 3A8RA 4I5NB 1LKJA 1LINA 1JFJA 1FW4A 1DGUA 1NIWA 5B8IB 1TNPA 3TDUA 4GGFA 3EKHA 3DVMA 1J7QA 1SCMB 5I8NA 1QATA 2LVKA 1XFXO 2KBIA 1C07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RTP 1;  4MZL A;  2KYF A;  1J1D A;  1DMO A;  1W7I B;  5DKR A;  1PRW A;  1JF2 A;  3BOW B;  1BT6 A;  4CLN A;  2M1U A;  1B1G A;  1G8I A;  1SW8 A;  2RGI A;  3AKA A;  4P2Y B;  2KGB C;  2WCE A;  1K96 A;  3BUM B;  4JPZ B;  5JOL A;  1CDM A;  2WND A;  1F71 A;  2MRD A;  1UUS A;  4NQG A;  1SBJ A;  1TNW A;  1A75 B;  1OOJ A;  2HQ8 A;  3NSL A;  3BUN B;  3RLZ A;  4CID A;  4YI9 A;  4YRU A;  1K9U A;  4MZJ A;  4QJ4 B;  4WRI A;  1NPQ A;  1M45 A;  4OCI A;  1SCV A;  3ZWH A;  1NX3 A;  2MA2 A;  2LUX A;  1OZS A;  5F6T A;  1C7V A;  4A4B A;  2SAS A;  1CLM A;  4PE0 A;  3LL8 B;  4YGA A;  1MF8 B;  1YX8 A;  2JWW A;  1F54 A;  1PSR A;  1B9A A;  1V1G A;  1YVL A;  1ZFS A;  4MN0 A;  3CTN A;  2KI4 C;  3LCP C;  1WLM A;  1XVJ A;  4MRY A;  5BPJ A;  3JVT B;  1WY9 A;  3CWG A;  3I5I C;  1CLL A;  1QVI Z;  1M39 A;  2LHI A;  3H4S E;  5AAN A;  1WDC C;  3EKJ A;  1C7W A;  1PUL A;  3SG4 A;  2MLE C;  1R2U A;  2L4H A;  1S5G Y;  3KPX A;  1A4P A;  1XK4 C;  2ZNE A;  1BG1 A;  1XFZ O;  1DJH A;  4AOM A;  2ZFD A;  1IQ3 A;  2FOT A;  4F0Z B;  3CR2 A;  4JQ0 D;  2L2E A;  4AQI A;  2G2B A;  1B8R A;  3VRP A;  5AXI A;  3NSK A;  1NCX A;  2LM5 A;  3I5F B;  1CLB A;  1AVS A;  2F2O A;  1B7T Y;  1B8L A;  1MXL C;  3BOW A;  2JUL A;  2BBM A;  4CPV A;  1K94 A;  3SG7 A;  2M49 B;  1N65 A;  2MLF C;  2AMI A;  2LLS A;  1L7Z A;  2K7B A;  2ZN9 A;  3DVK A;  5DKN A;  4USL A;  1XFY O;  1H4B A;  2OS8 B;  1KQM B;  1A75 A;  2BEC A;  3OP0 A;  4MZK A;  3TUY C;  3EK8 A;  4C0L A;  1GQM A;  5CSF A;  1RWY A;  1DGV A;  4PHK A;  2KI6 D;  1WLZ A;  1AHR A;  2NCP A;  4QJ5 B;  1KK7 Y;  5KSZ A;  4C0J A;  3FWB A;  2Y1N A;  4N1F A;  1RRO A;  1IJ5 A;  1TNQ A;  2M1K B;  1CFP A;  3I5H B;  3BUO B;  5FYX A;  2MAZ A;  1EG3 A;  1K8U A;  1RJV A;  2CBL A;  2BKH B;  3OX5 A;  1QX2 A;  3FWC A;  2PMY A;  2GGZ A;  5HKY A;  3GK1 A;  3I5G B;  4DRW A;  4OVN F;  1K9K A;  3TDZ A;  1NCZ A;  5CSI A;  4PHN A;  3I5I B;  1KCY A;  2Y4Q A;  1ODB A;  4YBH B;  5AER A;  2KAY A;  1OMV A;  2PRU A;  1QLS A;  2K61 A;  1BR4 B;  1TOP A;  1N2D A;  2ZRT A;  2BL0 C;  5I2L A;  1CDL A;  1KQV A;  1JWD A;  2VRG A;  2LMV A;  2KHN A;  4ORA B;  2LNK A;  1AK8 A;  1MHO A;  2KOT A;  4PE1 A;  5K89 A;  1ZOT B;  2LP2 A;  4C0K A;  2CNP A;  1NSH A;  2LV7 A;  4YGD B;  2M7L A;  2JT8 A;  1KK8 C;  2Y1M A;  2I94 A;  2WOR A;  1SNL A;  3AAJ A;  1L2O C;  1UWO A;  2LHL A;  2OTG B;  1OMD A;  2DOQ A;  2KBM A;  1MQ1 A;  2K7C A;  1CTR A;  5DKQ A;  4MVF A;  3WHT B;  4DUQ A;  2O5G A;  3LLE A;  1LA3 A;  2HF5 A;  3PM8 A;  4HRG A;  1QIV A;  2EC6 B;  1QIW A;  3GK4 X;  3BUW B;  4YGE B;  5HKZ A;  2F33 A;  1EH2 A;  4YI8 A;  2FCD A;  2JNF A;  4R1E A;  3O2P A;  2LLT A;  3OX6 A;  1MXE A;  3FS7 A;  1BF5 A;  2I2R E;  2CT9 A;  1XFU O;  4ORB B;  1Y1A A;  4MBE A;  4DCK A;  1IG5 A;  1G33 A;  1XYD A;  2JU0 A;  3PAT A;  2K8M B;  3DF0 A;  4YGB B;  4ZCU A;  4PHJ A;  1YUS A;  1QV0 A;  3PFV A;  2KYC A;  3GOF A;  2F2P A;  1NYA A;  2MBX A;  4GGF C;  1NWD A;  1CMF A;  1M31 A;  3A4U B;  4N1G A;  2NLN A;  3RM1 A;  3GK2 A;  1Y0V H;  1AP4 A;  1NCY A;  1NP8 A;  1EJ3 A;  5KU1 A;  4M2P A;  4DS7 A;  1XFW O;  1XA5 A;  1DJG A;  2BKI B;  1OE9 B;  2M0R A;  2LLU A;  3JTD C;  4BY5 A;  1BLQ A;  1Y1U A;  1H8B A;  4OR9 B;  3VRQ A;  3KO0 A;  1SL8 A;  3BQ3 A;  2MHH A;  3EVR A;  3PLF B;  1ALW A;  1Q80 A;  1HT9 A;  1UHH A;  4UPG A;  3CR4 X;  1IJ6 A;  1KWO C;  1AJ5 A;  1UHI A;  1XO5 A;  2CXJ A;  2EGD A;  2JXC A;  2L98 A;  4L9M A;  2L5X B;  5AEQ A;  1DVI A;  2CTN A;  2A4J A;  2GV5 A;  1TCF A;  1CM1 A;  1TIZ A;  2H61 A;  3OB2 B;  1E8A A;  1UP5 A;  3CZT X;  1WRL A;  3PAL A;  1J55 A;  1YR5 A;  2O60 A;  5HLO A;  4BY4 A;  3LK0 A;  1JF0 A;  3TS5 C;  2LMU A;  3QRX A;  1ALV A;  2NCO A;  1IGV A;  1QAS A;  1U5I B;  4JWQ A;  3C1V A;  1NX1 A;  1DJI A;  1YRU B;  1EG4 A;  1FI6 A;  3AAK A;  1LXF C;  4U8D A;  1QLK A;  2PVB A;  2V53 A;  4GPL B;  4PE4 A;  3D10 A;  2IS9 A;  4E68 A;  4M2O A;  3PN7 C;  3D0Y B;  2E30 A;  4GBA A;  4PE7 A;  1CNP A;  2LP3 A;  1A2X A;  3VRN A;  1B4C A;  2KSP A;  5ER4 X;  1BOD A;  2KGR A;  3DD4 A;  1B47 A;  3O78 A;  4PAL A;  2ISD A;  4IL1 A;  1SCM C;  1SR6 C;  1AUI B;  2JRF A;  2TN4 A;  5KTY A;  1W7J B;  4TNC A;  4N5X A;  1DTL A;  3DF0 B;  2NZ0 A;  1ZUZ A;  4AQJ A;  3CGA A;  2MJW B;  1YUU A;  2KI4 B;  1TTX A;  2Q4U A;  1GGW A;  1UUR A;  3IF7 A;  2FCE A;  1S5G Z;  1Y6W A;  1NUB A;  1WDC B;  4GUK A;  4I5J A;  3KHE A;  1YRT B;  2I7A A;  1IRJ A;  1SKT A;  3ZNI A;  2BE4 A;  1OQP A;  4HSZ A;  2F8P A;  3IQO A;  2M97 A;  2LE9 B;  2K0J A;  4NDC A;  1RFJ A;  1B7T Z;  1QS7 A;  1PK0 D;  2BCA A;  5CSN A;  1CFC A;  1UHK A;  3HCM A;  1QX7 A;  3M0W A;  1JC2 A;  1TCO B;  2M7N A;  1WRK A;  2HPS A;  3SJS A;  3EVV A;  1U5I A;  2Y5I A;  5D69 A;  1QX5 B;  2JNX A;  1DJY A;  1QTX A;  1NX0 A;  2M8U A;  3JVT C;  2HET A;  1LA0 A;  3SIB A;  2D8N A;  1DJZ A;  2OPO A;  1KK7 Z;  3BXK A;  3D0Y A;  3MSE B;  1D1O A;  1YTZ C;  2KDH A;  3BUX B;  3O6B A;  2KNE A;  3TUY B;  2WOS A;  3DVJ A;  5AFP A;  3WHU B;  5ER5 A;  1PVA A;  1K2H A;  1QVI Y;  1TRF A;  1S3P A;  3VRR A;  3O4Y A;  4PHM A;  3PSR A;  5J3X A;  1FF1 A;  1JFK A;  1QXP A;  2JOJ A;  1WRZ A;  4FQO A;  3TDI A;  1VRK A;  3EK7 A;  4MLW A;  2K7O A;  2K7D A;  1RK9 A;  2ZND A;  1SR6 B;  4GFT A;  2M29 A;  3OHM B;  3HX4 A;  4Q04 A;  1ZMZ A;  5PAL A;  2WCF A;  2WCB A;  3I5F C;  1JSA A;  1CB1 A;  1JUO A;  2KFF A;  3NSO A;  3VRO A;  2JQ6 A;  2P6B B;  3F45 A;  1PVB A;  2BE6 A;  4GAO A;  3EVU A;  1BU3 A;  3SG2 A;  2JTT A;  2I18 A;  2KFG A;  5CSJ A;  2ZN8 A;  3ICB A;  5G08 A;  1CFF A;  4D1E A;  2OS8 C;  1KQM C;  1J7P A;  2JTZ A;  3EK4 A;  2BL0 B;  1FI5 A;  1XK4 A;  3CLN A;  3E3R A;  2PAL A;  1K90 D;  3OB1 B;  1CDP A;  1K95 A;  2WC8 A;  2B1U A;  4P5O E;  2ZKM X;  4ORC B;  1S26 D;  1G4Y R;  1F4Q A;  2BBN A;  1S6J A;  4WQ3 A;  1GGZ A;  1A03 A;  3I5H C;  2KQY A;  1SY9 A;  4XYN A;  1PSB A;  1IKU A;  4CFR A;  1FBV A;  4NDD A;  4QJ3 B;  2GGM A;  2L50 A;  4OKH A;  1UHN A;  1KK8 B;  2JT0 A;  2M3W A;  1K9P A;  2KAV A;  1CMG A;  1L2O B;  4OV2 A;  2M9G A;  2L51 A;  1BJF A;  3DVE A;  3I5G C;  3LK1 A;  4MEW A;  1CDN A;  1OZO A;  1QJT A;  3SG5 A;  3CS1 A;  2JPT A;  1DF0 B;  2AUC A;  2JXL A;  3VGO A;  1UHJ A;  3NSI A;  1DJX A;  1SRA A;  2E6W A;  1CM4 A;  1EL4 A;  3AKB A;  1S6I A;  4XJK B;  4ZCV A;  1F70 A;  2LCP A;  3BYA A;  1OMR A;  3SIA A;  1K93 D;  1CFD A;  1KFX S;  1DT7 B;  4PCW A;  5HLV A;  3KF9 A;  4MRX A;  2FJU B;  1SMG A;  4PDZ A;  3SG3 A;  1MWN A;  1IWQ A;  3IQQ A;  1AJ4 A;  1REC A;  1KSO A;  2LAP A;  2JZI A;  2KFH A;  5D7F A;  1IQ5 A;  2CCM A;  5HKW A;  1KFX L;  1TNX A;  2LVV A;  4GGN A;  1TN4 A;  1BMO A;  4DIR A;  2HQW A;  2H2K A;  1CKK A;  1DJW A;  3K21 A;  4I5L B;  2H61 C;  5GQQ C;  2OTG C;  1F8H A;  1V1F A;  2QAC A;  2K2F A;  2QPT A;  1OSA A;  2AAO A;  4NDB A;  3SG6 A;  1J7O A;  4HRH A;  1Y1X A;  2KQ6 A;  4ICB A;  4ETO A;  1NX2 A;  2EC6 C;  1YUT A;  1FPW A;  2KAX A;  1S1E A;  1F4O A;  4FTG A;  2BCB A;  3WXA A;  5I2O A;  3WNX B;  1SL9 A;  1YX7 A;  3JTD B;  2Q91 A;  1M63 B;  4WQ2 A;  1MUX A;  4HRE E;  5HYD A;  1KFU S;  2LMT A;  1GJY A;  1MR8 A;  1YUR A;  2EHB A;  3NXA A;  2JT3 A;  2L4I A;  5JJG A;  1SYM A;  2LAN A;  2PSR A;  1KWO B;  1S36 A;  2PAS A;  1BOC A;  2LUC A;  1JBA A;  2SCP A;  2LVJ A;  1PAL A;  1EXR A;  4YGC B;  2G9B A;  2L0P A;  1SL7 A;  1YVH A;  2LVI A;  3KEV A;  3CR5 X;  1KFU L;  4GNK B;  1B8C A;  1DF0 A;  1F55 A;  1HQV A;  1SK6 D;  1J1E A;  3FIA A;  1LVC D;  4XJK A;  2F3Y A;  2NXQ A;  1X02 A;  3TS5 B;  1IH0 A;  1N0Y A;  4CFQ A;  2JC2 A;  3TZ1 A;  1ZAC A;  2BCX A;  2KI6 C;  4M2Q A;  5TNC A;  2R2I A;  5CPV A;  2ZRS A;  1BR1 B;  1XFV O;  2K2A A;  2COL B;  1QV1 A;  4I5K A;  5IBW A;  1A29 A;  1S6C A;  2F3Z A;  5I2Q A;  4MSP A;  3PN7 B;  1J7R A;  1SPY A;  4A4C A;  2LC5 A;  1R6P A;  1M46 A;  1KSM A;  3A8R A;  4I5N B;  1LKJ A;  1LIN A;  1JFJ A;  1FW4 A;  1DGU A;  1NIW A;  5B8I B;  1TNP A;  3TDU A;  4GGF A;  3EKH A;  3DVM A;  1J7Q A;  1SCM B;  5I8N A;  1QAT A;  2LVK A;  1XFX O;  2KBI A;  1C07 A; 
#chains in the Genus database with same CATH topology
 1RTP 1;  4MZL A;  2KYF A;  1J1D A;  1DMO A;  1W7I B;  5DKR A;  1PRW A;  1JF2 A;  2P71 A;  3BOW B;  1BT6 A;  4CLN A;  2M1U A;  1B1G A;  1G8I A;  3N7H A;  1SW8 A;  2RGI A;  3AKA A;  4P2Y B;  2KGB C;  2WCE A;  1K96 A;  3BUM B;  4JPZ B;  5JOL A;  1CDM A;  3CYZ A;  2WND A;  4IJ7 A;  2MRD A;  1UUS A;  1F71 A;  4NQG A;  1SBJ A;  1TNW A;  1A75 B;  1OOJ A;  2HQ8 A;  3NSL A;  3BUN B;  3RLZ A;  4CID A;  4YI9 A;  4YRU A;  1TUZ A;  1K9U A;  4MZJ A;  4QJ4 B;  4WRI A;  1NPQ A;  1M45 A;  4OCI A;  3D75 A;  1SCV A;  3ZWH A;  2WCJ A;  1NX3 A;  2MA2 A;  2LUX A;  1OZS A;  5F6T A;  1C7V A;  4A4B A;  2SAS A;  1CLM A;  4PE0 A;  3SS4 A;  3LL8 B;  4YGA A;  1MF8 B;  1YX8 A;  2JWW A;  2BNX A;  1PSR A;  1F54 A;  1B9A A;  1V1G A;  1YVL A;  1ZFS A;  3NHT A;  3CTN A;  4MN0 A;  1OOG A;  2QDI A;  2YGU A;  2KI4 C;  3LCP C;  1WLM A;  1XVJ A;  3CDN A;  4MRY A;  5BPJ A;  3JVT B;  1WY9 A;  3CWG A;  3I5I C;  1CLL A;  1QVI Z;  1M39 A;  2LHI A;  3H4S E;  5AAN A;  1WDC C;  3EKJ A;  3NGV A;  1C7W A;  1PUL A;  3SG4 A;  2MLE C;  1R2U A;  2L4H A;  3BFB A;  1S5G Y;  3KPX A;  1A4P A;  1XK4 C;  2ZNE A;  1BG1 A;  1XFZ O;  1DJH A;  4AOM A;  2ZFD A;  5I94 A;  2FOT A;  4F0Z B;  2FJY A;  1IQ3 A;  3CR2 A;  4JQ0 D;  2L2E A;  4AQI A;  2G2B A;  1B8R A;  3CZ0 A;  3VRP A;  5AXI A;  3NSK A;  1NCX A;  2LM5 A;  3I5F B;  1CLB A;  1AVS A;  2F2O A;  1B7T Y;  1B8L A;  1MXL C;  3BOW A;  2JUL A;  3FE8 A;  2BBM A;  4CPV A;  1K94 A;  3SG7 A;  3UO9 A;  2M49 B;  1N65 A;  2MLF C;  3R1P A;  2AMI A;  2LLS A;  1L7Z A;  2K7B A;  2ZN9 A;  3DVK A;  5DKN A;  4USL A;  1XFY O;  3B6X A;  2OS8 B;  1H4B A;  1KQM B;  1A75 A;  2BEC A;  3OP0 A;  4MZK A;  3TUY C;  3EK8 A;  4C0L A;  1GM0 A;  1GQM A;  5CSF A;  1RWY A;  1DGV A;  4PHK A;  2KI6 D;  1WLZ A;  1AHR A;  2NCP A;  4QJ5 B;  1KK7 Y;  4FQT A;  5KSZ A;  4C0J A;  3FWB A;  2Y1N A;  4N1F A;  1RRO A;  1IJ5 A;  1TNQ A;  2M1K B;  1CFP A;  3I5H B;  3BUO B;  5FYX A;  2MAZ A;  1EG3 A;  1K8U A;  1RJV A;  2CBL A;  1P28 A;  2BKH B;  3OX5 A;  1QX2 A;  3FWC A;  3QME A;  2PMY A;  3CZ2 A;  2GGZ A;  5HKY A;  3GK1 A;  3I5G B;  4DRW A;  4OVN F;  1K9K A;  3EG5 B;  1NCZ A;  5CSI A;  3TDZ A;  4PHN A;  3I5I B;  1KCY A;  2QEH A;  2Y4Q A;  1ODB A;  4YBH B;  5AER A;  2KAY A;  1OMV A;  2PRU A;  1QLS A;  2K61 A;  1BR4 B;  1TOP A;  1N2D A;  1DC1 A;  2ZRT A;  2BL0 C;  5I2L A;  1CDL A;  1LS8 A;  1KQV A;  1JWD A;  2VRG A;  2LMV A;  2KHN A;  4ORA B;  2LNK A;  1AK8 A;  1MHO A;  2KOT A;  4PE1 A;  5K89 A;  1ZOT B;  1SSE B;  2LP2 A;  4C0K A;  2CNP A;  1NSH A;  2LV7 A;  4YGD B;  2M7L A;  2JT8 A;  1KK8 C;  2Y1M A;  2I94 A;  2WOR A;  1SNL A;  2BAP A;  3AAJ A;  1L2O C;  1UWO A;  2JPO A;  2LHL A;  2OTG B;  1OMD A;  2DOQ A;  2KBM A;  1MQ1 A;  3D73 A;  3BFH A;  2K7C A;  1CTR A;  5DKQ A;  4MVF A;  3WHT B;  4DUQ A;  2O5G A;  3LLE A;  1LA3 A;  2HF5 A;  3PM8 A;  4HRG A;  1QIV A;  2EC6 B;  1QIW A;  3GK4 X;  3BUW B;  4YGE B;  5HKZ A;  2F33 A;  4F7F A;  1EH2 A;  4YI8 A;  2FCD A;  2JNF A;  4R1E A;  4JKT A;  3O2P A;  2LLT A;  3OX6 A;  1MXE A;  3FS7 A;  1BF5 A;  2I2R E;  2CT9 A;  1XFU O;  2PYQ A;  2QEB A;  4ORB B;  1Y1A A;  4MBE A;  4DCK A;  1IG5 A;  1TWO A;  3S0G A;  1G33 A;  1XYD A;  2JU0 A;  3PAT A;  1TUJ A;  2K8M B;  3DF0 A;  4YGB B;  4ZCU A;  3UNW A;  4PHJ A;  1YUS A;  3SS5 A;  1QV0 A;  3PFV A;  2KYC A;  3GOF A;  2F2P A;  1NYA A;  5FI7 A;  2MBX A;  5HL1 A;  4GGF C;  1NWD A;  1CMF A;  1M31 A;  3A4U B;  4N1G A;  2NLN A;  3RM1 A;  3GK2 A;  1Y0V H;  1AP4 A;  1NCY A;  1NP8 A;  2P70 A;  1EJ3 A;  5KU1 A;  1OOH A;  4M2P A;  4DS7 A;  1XFW O;  3O4X A;  4INW A;  1XA5 A;  2ERB A;  1OOF A;  1DJG A;  2BKI B;  2H8V A;  1OE9 B;  2M0R A;  2LLU A;  3JTD C;  4BY5 A;  1BLQ A;  3CZ1 A;  1Y1U A;  1H8B A;  4OR9 B;  5EL2 A;  3DZT A;  3VRQ A;  3KO0 A;  1SL8 A;  3BQ3 A;  2MHH A;  3EVR A;  3PLF B;  3Q8I A;  1ALW A;  1Q80 A;  1HT9 A;  1UHH A;  4UPG A;  3DYE A;  3CR4 X;  1IJ6 A;  1KWO C;  1AJ5 A;  1UHI A;  1XO5 A;  2CXJ A;  2EGD A;  2JXC A;  3B86 A;  2L98 A;  5FI6 A;  3PJI A;  4L9M A;  2L5X B;  5AEQ A;  4INX A;  1DVI A;  2CTN A;  2A4J A;  2GV5 A;  1TCF A;  1CM1 A;  1TIZ A;  2H61 A;  3OB2 B;  3K1E A;  1E8A A;  1UP5 A;  3CZT X;  3SG3 A;  1IIO A;  1WRL A;  3S0E A;  3PAL A;  1J55 A;  1YR5 A;  2O60 A;  5HLO A;  4BY4 A;  3LK0 A;  3D77 A;  1JF0 A;  3TS5 C;  2LMU A;  3QRX A;  1ALV A;  2NCO A;  1IGV A;  1QAS A;  2QEV A;  1U5I B;  4JWQ A;  3C1V A;  1NX1 A;  1DJI A;  1YRU B;  1EG4 A;  1FI6 A;  3AAK A;  1LXF C;  4U8D A;  1QLK A;  2PVB A;  2V53 A;  4GPL B;  3VB1 A;  4PE4 A;  3D10 A;  2IS9 A;  3S0B A;  4E68 A;  2L5Y A;  4M2O A;  3PN7 C;  3D0Y B;  2E30 A;  4GBA A;  4PE7 A;  1CNP A;  2LP3 A;  1A2X A;  3VRN A;  1B4C A;  2KSP A;  5ER4 X;  1BOD A;  2KGR A;  3DD4 A;  1B47 A;  3O78 A;  4PAL A;  2QEO A;  2ISD A;  4IL1 A;  3R72 A;  1SCM C;  1SR6 C;  1AUI B;  2JRF A;  2TN4 A;  5KTY A;  1W7J B;  4TNC A;  4N5X A;  1DTL A;  2WCH A;  3DF0 B;  3L47 A;  2NZ0 A;  1C3Y A;  1ZUZ A;  4AQJ A;  3CGA A;  1QWV A;  1YUU A;  2KI4 B;  2MJW B;  1TTX A;  2Q4U A;  1GGW A;  1UUR A;  3IF7 A;  1Z4H A;  2FCE A;  1S5G Z;  1Y6W A;  1NUB A;  1WDC B;  3OGN A;  4GUK A;  4I5J A;  3KHE A;  1YRT B;  2I7A A;  1IRJ A;  3L4L A;  1SKT A;  3V2L A;  3ZNI A;  2BE4 A;  1OQP A;  4HSZ A;  2F8P A;  3IQO A;  2M97 A;  2LE9 B;  2K0J A;  2KPH A;  4KYN A;  4NDC A;  1RFJ A;  1B7T Z;  1QS7 A;  1PK0 D;  2BCA A;  5CSN A;  1CFC A;  1UHK A;  3HCM A;  1QX7 A;  3M0W A;  1JC2 A;  1TCO B;  2M7N A;  1WRK A;  2HPS A;  3SJS A;  1OOI X;  3EVV A;  1U5I A;  2Y5I A;  5D69 A;  1QX5 B;  2JNX A;  3RZS A;  1DJY A;  1QTX A;  1NX0 A;  2M8U A;  3JVT C;  2HET A;  1LA0 A;  3SIB A;  2D8N A;  1DJZ A;  2OPO A;  1KK7 Z;  3BXK A;  3D0Y A;  3MSE B;  1D1O A;  1YTZ C;  2KDH A;  3BUX B;  3O6B A;  4OZD A;  2KNE A;  3TUY B;  2WOS A;  3DVJ A;  3DXL A;  5AFP A;  3WHU B;  5ER5 A;  1PVA A;  1K2H A;  1QVI Y;  1TRF A;  1S3P A;  3VRR A;  3O4Y A;  4PHM A;  3PSR A;  5J3X A;  1FF1 A;  1JFK A;  1QXP A;  2JOJ A;  1WRZ A;  2WCM A;  4FQO A;  3TDI A;  1VRK A;  3EK7 A;  4MLW A;  2K7O A;  2K7D A;  1RK9 A;  2ZND A;  1SR6 B;  4GFT A;  2WC6 A;  2M29 A;  3OHM B;  3HX4 A;  4Q04 A;  1ZMZ A;  5PAL A;  2WCF A;  2WCB A;  2K60 A;  3I5F C;  1JSA A;  1CB1 A;  1JUO A;  2KFF A;  3NSO A;  3VRO A;  2JQ6 A;  2WCK A;  2P6B B;  3F45 A;  1PVB A;  2BE6 A;  4GAO A;  1DQE A;  3EVU A;  1BU3 A;  3SG2 A;  2JTT A;  1ORG A;  2I18 A;  2KFG A;  5CSJ A;  2ZN8 A;  3ICB A;  5G08 A;  1CFF A;  4D1E A;  2OS8 C;  1KQM C;  1DEL A;  3PM2 A;  1J7P A;  2JTZ A;  3EK4 A;  2BL0 B;  1FI5 A;  1XK4 A;  3CLN A;  3E3R A;  4JD9 A;  2PAL A;  1K90 D;  3OB1 B;  3BFA A;  1CDP A;  1K95 A;  2WC8 A;  2B1U A;  4P5O E;  2ZKM X;  4ORC B;  1S26 D;  1G4Y R;  1F4Q A;  1S6J A;  2BBN A;  4WQ3 A;  1GGZ A;  1A03 A;  3I5H C;  2KQY A;  1SY9 A;  4XYN A;  1PSB A;  1IKU A;  4CFR A;  3NHI A;  1FBV A;  4NDD A;  4QJ3 B;  2GGM A;  2L50 A;  2L2C A;  4OKH A;  1UHN A;  1KK8 B;  2JT0 A;  2M3W A;  1K9P A;  2KAV A;  1CMG A;  1L2O B;  4OV2 A;  2M9G A;  2L51 A;  1BJF A;  3DVE A;  3FE9 A;  3I5G C;  3LK1 A;  4MEW A;  1OZO A;  1CDN A;  1QJT A;  3SG5 A;  3CS1 A;  2JPT A;  1DF0 B;  2AUC A;  2JXL A;  3VGO A;  1UHJ A;  3NSI A;  1DJX A;  1SRA A;  2E6W A;  1CM4 A;  1EL4 A;  3AKB A;  1S6I A;  1OW4 A;  3L4A A;  4XJK B;  4ZCV A;  1F70 A;  2LCP A;  3BYA A;  1OMR A;  3SIA A;  1K93 D;  3IVT A;  1CFD A;  1KFX S;  1DT7 B;  4PCW A;  5HLV A;  3KF9 A;  4MRX A;  2FJU B;  1SMG A;  3D76 A;  4PDZ A;  1MWN A;  1IWQ A;  3IQQ A;  1AJ4 A;  1REC A;  3OBV A;  1KSO A;  2LAP A;  2JZI A;  2KFH A;  5D7F A;  1IQ5 A;  2CCM A;  3CAB A;  2PQL A;  5HKW A;  3BJH A;  1KFX L;  1TNX A;  2LVV A;  3FE6 A;  4GGN A;  1TN4 A;  1BMO A;  5D3O A;  2HQW A;  2H2K A;  1Z2C B;  3R1V A;  4DIR A;  1CKK A;  1DJW A;  3S0A A;  2WC5 A;  3K21 A;  4I5L B;  2H61 C;  5GQQ C;  2OTG C;  1F8H A;  1V1F A;  2QAC A;  2K2F A;  2QPT A;  1OSA A;  2AAO A;  4NDB A;  3SG6 A;  1J7O A;  4HRH A;  1Y1X A;  2KQ6 A;  4PT1 A;  4ICB A;  4ETO A;  1NX2 A;  3S0D A;  2EC6 C;  1YUT A;  3S0F A;  1FPW A;  2KAX A;  1S1E A;  1F4O A;  4FTG A;  2BCB A;  1T14 A;  3WXA A;  5I2O A;  3WNX B;  1SL9 A;  1YX7 A;  3JTD B;  3SS3 A;  3B7A A;  2Q91 A;  1M63 B;  4WQ2 A;  1MUX A;  4HRE E;  5HYD A;  1KFU S;  2LMT A;  1GJY A;  5DIC A;  1MR8 A;  1YUR A;  2EHB A;  3NXA A;  2JT3 A;  2L4I A;  5JJG A;  1SYM A;  1DEK A;  2LAN A;  2PSR A;  1KWO B;  1S36 A;  2PAS A;  1BOC A;  2LUC A;  1JBA A;  2SCP A;  2LVJ A;  1PAL A;  1EXR A;  4YGC B;  2G9B A;  2L0P A;  1SL7 A;  1YVH A;  2LVI A;  3KEV A;  3CR5 X;  1KFU L;  4GNK B;  1B8C A;  1DF0 A;  1F55 A;  1HQV A;  1SK6 D;  2KLD A;  1J1E A;  3FIA A;  1LVC D;  2WCL A;  4XJK A;  2F3Y A;  2NXQ A;  3R1O A;  1X02 A;  2GTE A;  3DY9 A;  3TS5 B;  1IH0 A;  1N0Y A;  2KLE A;  4CFQ A;  2JC2 A;  3D74 A;  3TZ1 A;  5FI2 A;  1ZAC A;  2BCX A;  1C3Z A;  2KI6 C;  4M2Q A;  5TNC A;  2R2I A;  5CPV A;  2ZRS A;  1BR1 B;  1XFV O;  2K2A A;  3D78 A;  2COL B;  1QV1 A;  4I5K A;  5IBW A;  1A29 A;  1S6C A;  2F3Z A;  5I2Q A;  4MSP A;  3PN7 B;  1J7R A;  1SPY A;  4A4C A;  2LC5 A;  1R6P A;  1M46 A;  1KSM A;  3A8R A;  4I5N B;  1LKJ A;  1LIN A;  1JFJ A;  1FW4 A;  1DGU A;  3B87 A;  1NIW A;  1XFR A;  5B8I B;  1TNP A;  3TDU A;  4GGF A;  3EKH A;  3DVM A;  3B88 A;  1J7Q A;  1SCM B;  5I8N A;  1QAT A;  1W9Z A;  2LVK A;  1XFX O;  2KBI A;  1C07 A; 
#chains in the Genus database with same CATH homology
 1RTP 1;  4MZL A;  2KYF A;  1J1D A;  1DMO A;  1W7I B;  5DKR A;  1PRW A;  1JF2 A;  3BOW B;  1BT6 A;  4CLN A;  2M1U A;  1B1G A;  1G8I A;  1SW8 A;  2RGI A;  3AKA A;  4P2Y B;  2KGB C;  2WCE A;  1K96 A;  3BUM B;  4JPZ B;  5JOL A;  1CDM A;  2WND A;  1F71 A;  2MRD A;  1UUS A;  4NQG A;  1SBJ A;  1TNW A;  1A75 B;  1OOJ A;  2HQ8 A;  3NSL A;  3BUN B;  3RLZ A;  4CID A;  4YI9 A;  4YRU A;  1K9U A;  4MZJ A;  4QJ4 B;  4WRI A;  1NPQ A;  1M45 A;  4OCI A;  1SCV A;  3ZWH A;  1NX3 A;  2MA2 A;  2LUX A;  1OZS A;  5F6T A;  1C7V A;  4A4B A;  2SAS A;  1CLM A;  4PE0 A;  3LL8 B;  4YGA A;  1MF8 B;  1YX8 A;  2JWW A;  1F54 A;  1PSR A;  1B9A A;  1V1G A;  1YVL A;  1ZFS A;  4MN0 A;  3CTN A;  2KI4 C;  3LCP C;  1WLM A;  1XVJ A;  4MRY A;  5BPJ A;  3JVT B;  1WY9 A;  3CWG A;  3I5I C;  1CLL A;  1QVI Z;  1M39 A;  2LHI A;  3H4S E;  5AAN A;  1WDC C;  3EKJ A;  1C7W A;  1PUL A;  3SG4 A;  2MLE C;  1R2U A;  2L4H A;  1S5G Y;  3KPX A;  1A4P A;  1XK4 C;  2ZNE A;  1BG1 A;  1XFZ O;  1DJH A;  4AOM A;  2ZFD A;  1IQ3 A;  2FOT A;  4F0Z B;  3CR2 A;  4JQ0 D;  2L2E A;  4AQI A;  2G2B A;  1B8R A;  3VRP A;  5AXI A;  3NSK A;  1NCX A;  2LM5 A;  3I5F B;  1CLB A;  1AVS A;  2F2O A;  1B7T Y;  1B8L A;  1MXL C;  3BOW A;  2JUL A;  2BBM A;  4CPV A;  1K94 A;  3SG7 A;  2M49 B;  1N65 A;  2MLF C;  2AMI A;  2LLS A;  1L7Z A;  2K7B A;  2ZN9 A;  3DVK A;  5DKN A;  4USL A;  1XFY O;  1H4B A;  2OS8 B;  1KQM B;  1A75 A;  2BEC A;  3OP0 A;  4MZK A;  3TUY C;  3EK8 A;  4C0L A;  1GQM A;  5CSF A;  1RWY A;  1DGV A;  4PHK A;  2KI6 D;  1WLZ A;  1AHR A;  2NCP A;  4QJ5 B;  1KK7 Y;  5KSZ A;  4C0J A;  3FWB A;  2Y1N A;  4N1F A;  1RRO A;  1IJ5 A;  1TNQ A;  2M1K B;  1CFP A;  3I5H B;  3BUO B;  5FYX A;  2MAZ A;  1EG3 A;  1K8U A;  1RJV A;  2CBL A;  2BKH B;  3OX5 A;  1QX2 A;  3FWC A;  2PMY A;  2GGZ A;  5HKY A;  3GK1 A;  3I5G B;  4DRW A;  4OVN F;  1K9K A;  3TDZ A;  1NCZ A;  5CSI A;  4PHN A;  3I5I B;  1KCY A;  2Y4Q A;  1ODB A;  4YBH B;  5AER A;  2KAY A;  1OMV A;  2PRU A;  1QLS A;  2K61 A;  1BR4 B;  1TOP A;  1N2D A;  2ZRT A;  2BL0 C;  5I2L A;  1CDL A;  1KQV A;  1JWD A;  2VRG A;  2LMV A;  2KHN A;  4ORA B;  2LNK A;  1AK8 A;  1MHO A;  2KOT A;  4PE1 A;  5K89 A;  1ZOT B;  2LP2 A;  4C0K A;  2CNP A;  1NSH A;  2LV7 A;  4YGD B;  2M7L A;  2JT8 A;  1KK8 C;  2Y1M A;  2I94 A;  2WOR A;  1SNL A;  3AAJ A;  1L2O C;  1UWO A;  2LHL A;  2OTG B;  1OMD A;  2DOQ A;  2KBM A;  1MQ1 A;  2K7C A;  1CTR A;  5DKQ A;  4MVF A;  3WHT B;  4DUQ A;  2O5G A;  3LLE A;  1LA3 A;  2HF5 A;  3PM8 A;  4HRG A;  1QIV A;  2EC6 B;  1QIW A;  3GK4 X;  3BUW B;  4YGE B;  5HKZ A;  2F33 A;  1EH2 A;  4YI8 A;  2FCD A;  2JNF A;  4R1E A;  3O2P A;  2LLT A;  3OX6 A;  1MXE A;  3FS7 A;  1BF5 A;  2I2R E;  2CT9 A;  1XFU O;  4ORB B;  1Y1A A;  4MBE A;  4DCK A;  1IG5 A;  1G33 A;  1XYD A;  2JU0 A;  3PAT A;  2K8M B;  3DF0 A;  4YGB B;  4ZCU A;  4PHJ A;  1YUS A;  1QV0 A;  3PFV A;  2KYC A;  3GOF A;  2F2P A;  1NYA A;  2MBX A;  4GGF C;  1NWD A;  1CMF A;  1M31 A;  3A4U B;  4N1G A;  2NLN A;  3RM1 A;  3GK2 A;  1Y0V H;  1AP4 A;  1NCY A;  1NP8 A;  1EJ3 A;  5KU1 A;  4M2P A;  4DS7 A;  1XFW O;  1XA5 A;  1DJG A;  2BKI B;  1OE9 B;  2M0R A;  2LLU A;  3JTD C;  4BY5 A;  1BLQ A;  1Y1U A;  1H8B A;  4OR9 B;  3VRQ A;  3KO0 A;  1SL8 A;  3BQ3 A;  2MHH A;  3EVR A;  3PLF B;  1ALW A;  1Q80 A;  1HT9 A;  1UHH A;  4UPG A;  3CR4 X;  1IJ6 A;  1KWO C;  1AJ5 A;  1UHI A;  1XO5 A;  2CXJ A;  2EGD A;  2JXC A;  2L98 A;  4L9M A;  2L5X B;  5AEQ A;  1DVI A;  2CTN A;  2A4J A;  2GV5 A;  1TCF A;  1CM1 A;  1TIZ A;  2H61 A;  3OB2 B;  1E8A A;  1UP5 A;  3CZT X;  1WRL A;  3PAL A;  1J55 A;  1YR5 A;  2O60 A;  5HLO A;  4BY4 A;  3LK0 A;  1JF0 A;  3TS5 C;  2LMU A;  3QRX A;  1ALV A;  2NCO A;  1IGV A;  1QAS A;  1U5I B;  4JWQ A;  3C1V A;  1NX1 A;  1DJI A;  1YRU B;  1EG4 A;  1FI6 A;  3AAK A;  1LXF C;  4U8D A;  1QLK A;  2PVB A;  2V53 A;  4GPL B;  4PE4 A;  3D10 A;  2IS9 A;  4E68 A;  4M2O A;  3PN7 C;  3D0Y B;  2E30 A;  4GBA A;  4PE7 A;  1CNP A;  2LP3 A;  1A2X A;  3VRN A;  1B4C A;  2KSP A;  5ER4 X;  1BOD A;  2KGR A;  3DD4 A;  1B47 A;  3O78 A;  4PAL A;  2ISD A;  4IL1 A;  1SCM C;  1SR6 C;  1AUI B;  2JRF A;  2TN4 A;  5KTY A;  1W7J B;  4TNC A;  4N5X A;  1DTL A;  3DF0 B;  2NZ0 A;  1ZUZ A;  4AQJ A;  3CGA A;  2MJW B;  1YUU A;  2KI4 B;  1TTX A;  2Q4U A;  1GGW A;  1UUR A;  3IF7 A;  2FCE A;  1S5G Z;  1Y6W A;  1NUB A;  1WDC B;  4GUK A;  4I5J A;  3KHE A;  1YRT B;  2I7A A;  1IRJ A;  1SKT A;  3ZNI A;  2BE4 A;  1OQP A;  4HSZ A;  2F8P A;  3IQO A;  2M97 A;  2LE9 B;  2K0J A;  4NDC A;  1RFJ A;  1B7T Z;  1QS7 A;  1PK0 D;  2BCA A;  5CSN A;  1CFC A;  1UHK A;  3HCM A;  1QX7 A;  3M0W A;  1JC2 A;  1TCO B;  2M7N A;  1WRK A;  2HPS A;  3SJS A;  3EVV A;  1U5I A;  2Y5I A;  5D69 A;  1QX5 B;  2JNX A;  1DJY A;  1QTX A;  1NX0 A;  2M8U A;  3JVT C;  2HET A;  1LA0 A;  3SIB A;  2D8N A;  1DJZ A;  2OPO A;  1KK7 Z;  3BXK A;  3D0Y A;  3MSE B;  1D1O A;  1YTZ C;  2KDH A;  3BUX B;  3O6B A;  2KNE A;  3TUY B;  2WOS A;  3DVJ A;  5AFP A;  3WHU B;  5ER5 A;  1PVA A;  1K2H A;  1QVI Y;  1TRF A;  1S3P A;  3VRR A;  3O4Y A;  4PHM A;  3PSR A;  5J3X A;  1FF1 A;  1JFK A;  1QXP A;  2JOJ A;  1WRZ A;  4FQO A;  3TDI A;  1VRK A;  3EK7 A;  4MLW A;  2K7O A;  2K7D A;  1RK9 A;  2ZND A;  1SR6 B;  4GFT A;  2M29 A;  3OHM B;  3HX4 A;  4Q04 A;  1ZMZ A;  5PAL A;  2WCF A;  2WCB A;  3I5F C;  1JSA A;  1CB1 A;  1JUO A;  2KFF A;  3NSO A;  3VRO A;  2JQ6 A;  2P6B B;  3F45 A;  1PVB A;  2BE6 A;  4GAO A;  3EVU A;  1BU3 A;  3SG2 A;  2JTT A;  2I18 A;  2KFG A;  5CSJ A;  2ZN8 A;  3ICB A;  5G08 A;  1CFF A;  4D1E A;  2OS8 C;  1KQM C;  1J7P A;  2JTZ A;  3EK4 A;  2BL0 B;  1FI5 A;  1XK4 A;  3CLN A;  3E3R A;  2PAL A;  1K90 D;  3OB1 B;  1CDP A;  1K95 A;  2WC8 A;  2B1U A;  4P5O E;  2ZKM X;  4ORC B;  1S26 D;  1G4Y R;  1F4Q A;  2BBN A;  1S6J A;  4WQ3 A;  1GGZ A;  1A03 A;  3I5H C;  2KQY A;  1SY9 A;  4XYN A;  1PSB A;  1IKU A;  4CFR A;  1FBV A;  4NDD A;  4QJ3 B;  2GGM A;  2L50 A;  4OKH A;  1UHN A;  1KK8 B;  2JT0 A;  2M3W A;  1K9P A;  2KAV A;  1CMG A;  1L2O B;  4OV2 A;  2M9G A;  2L51 A;  1BJF A;  3DVE A;  3I5G C;  3LK1 A;  4MEW A;  1CDN A;  1OZO A;  1QJT A;  3SG5 A;  3CS1 A;  2JPT A;  1DF0 B;  2AUC A;  2JXL A;  3VGO A;  1UHJ A;  3NSI A;  1DJX A;  1SRA A;  2E6W A;  1CM4 A;  1EL4 A;  3AKB A;  1S6I A;  4XJK B;  4ZCV A;  1F70 A;  2LCP A;  3BYA A;  1OMR A;  3SIA A;  1K93 D;  1CFD A;  1KFX S;  1DT7 B;  4PCW A;  5HLV A;  3KF9 A;  4MRX A;  2FJU B;  1SMG A;  4PDZ A;  3SG3 A;  1MWN A;  1IWQ A;  3IQQ A;  1AJ4 A;  1REC A;  1KSO A;  2LAP A;  2JZI A;  2KFH A;  5D7F A;  1IQ5 A;  2CCM A;  5HKW A;  1KFX L;  1TNX A;  2LVV A;  4GGN A;  1TN4 A;  1BMO A;  4DIR A;  2HQW A;  2H2K A;  1CKK A;  1DJW A;  3K21 A;  4I5L B;  2H61 C;  5GQQ C;  2OTG C;  1F8H A;  1V1F A;  2QAC A;  2K2F A;  2QPT A;  1OSA A;  2AAO A;  4NDB A;  3SG6 A;  1J7O A;  4HRH A;  1Y1X A;  2KQ6 A;  4ICB A;  4ETO A;  1NX2 A;  2EC6 C;  1YUT A;  1FPW A;  2KAX A;  1S1E A;  1F4O A;  4FTG A;  2BCB A;  3WXA A;  5I2O A;  3WNX B;  1SL9 A;  1YX7 A;  3JTD B;  2Q91 A;  1M63 B;  4WQ2 A;  1MUX A;  4HRE E;  5HYD A;  1KFU S;  2LMT A;  1GJY A;  1MR8 A;  1YUR A;  2EHB A;  3NXA A;  2JT3 A;  2L4I A;  5JJG A;  1SYM A;  2LAN A;  2PSR A;  1KWO B;  1S36 A;  2PAS A;  1BOC A;  2LUC A;  1JBA A;  2SCP A;  2LVJ A;  1PAL A;  1EXR A;  4YGC B;  2G9B A;  2L0P A;  1SL7 A;  1YVH A;  2LVI A;  3KEV A;  3CR5 X;  1KFU L;  4GNK B;  1B8C A;  1DF0 A;  1F55 A;  1HQV A;  1SK6 D;  1J1E A;  3FIA A;  1LVC D;  4XJK A;  2F3Y A;  2NXQ A;  1X02 A;  3TS5 B;  1IH0 A;  1N0Y A;  4CFQ A;  2JC2 A;  3TZ1 A;  1ZAC A;  2BCX A;  2KI6 C;  4M2Q A;  5TNC A;  2R2I A;  5CPV A;  2ZRS A;  1BR1 B;  1XFV O;  2K2A A;  2COL B;  1QV1 A;  4I5K A;  5IBW A;  1A29 A;  1S6C A;  2F3Z A;  5I2Q A;  4MSP A;  3PN7 B;  1J7R A;  1SPY A;  4A4C A;  2LC5 A;  1R6P A;  1M46 A;  1KSM A;  3A8R A;  4I5N B;  1LKJ A;  1LIN A;  1JFJ A;  1FW4 A;  1DGU A;  1NIW A;  5B8I B;  1TNP A;  3TDU A;  4GGF A;  3EKH A;  3DVM A;  1J7Q A;  1SCM B;  5I8N A;  1QAT A;  2LVK A;  1XFX O;  2KBI A;  1C07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...