5G08A

Crystal structure of drosophila ncs-1 bound to chlorpromazine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
180
structure length
180
Chain Sequence
KNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRMVQALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords FREQUENIN 2
publication title Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 70
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2016-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5g08A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5g08A02
1NCZA 3TDZA 2K7BA 1Q80A 5AERA 1CDLA 1SR6C 2Y5IA 2PRUA 4GGFC 1C7WA 2COLB 4HRGA 1PULA 4PHMA 3BUWB 4MEWA 3VROA 1CDNA 3IQQA 1XFUO 2JC2A 2LVIA 3SG3A 4GPLB 2K61A 2KAYA 2KGBC 5HKWA 1QIWA 1KK7Y 2KOTA 2ZRTA 1AP4A 1XK4A 3EKJA 3TUYC 5CPVA 4USLA 4MSPA 5I8NA 3CR4X 1JSAA 2LUXA 2WCFA 1J7PA 1TN4A 1TTXA 2EC6B 3CS1A 3EVUA 1F4QA 1J7OA 1KFXS 2E30A 3PFVA 1CLBA 1EJ3A 1DJIA 5DKQA 1U5IA 2FJUB 3NSOA 1OE9B 1DF0B 1QASA 3D0YA 1TNWA 4MZJA 5KSZA 1QS7A 4PHKA 3MSEB 2LP2A 3WXAA 5B8IB 5IBWA 2I18A 3EK8A 2BECA 3ICBA 1QATA 3GK2A 5AFPA 3IF7A 1B1GA 3VRQA 4I5NB 3SG7A 5AANA 2K2FA 2L98A 2I2RE 2LCPA 2LV7A 2EGDA 3CLNA 3ZNIA 2P6BB 3AKBA 3SG6A 2JRFA 1SR6B 2B1UA 1LXFC 4C0KA 2RGIA 2JPTA 1NPQA 1OSAA 1J1DA 1QVIY 5J3XA 4OCIA 1H8BA 2M3WA 3I5FC 3TS5C 1DMOA 1C7VA 2JQ6A 1WRZA 1YVLA 4XJKB 4HRHA 2KNEA 3GOFA 2NLNA 1UP5A 1UWOA 1KFUS 1PALA 4YGCB 3DF0A 2WCBA 3DVJA 2CNPA 3LK0A 3KF9A 3NSIA 4HSZA 4ZCUA 1VRKA 4R1EA 1A29A 1BOCA 2LHIA 2PVBA 1V1GA 2L4HA 2M7LA 1N65A 1A03A 4D1EA 1XO5A 2V53A 4UPGA 1K93D 1MQ1A 1SKTA 2FCEA 1MR8A 4MLWA 1AJ4A 4DCKA 1MWNA 1IKUA 1QV0A 1IJ5A 1NX2A 4WQ2A 1K9UA 5HLVA 4GUKA 2CCMA 2OS8B 1BF5A 1XVJA 1M63B 1DJXA 1NX1A 1S3PA 1NX0A 1IG5A 3GK1A 2M0RA 4WRIA 4AQIA 3CZTX 2I94A 3BUXB 5ER4X 4ORCB 4U8DA 1BMOA 3D10A 4JQ0D 1EL4A 2ZNEA 3I5GC 3AKAA 2JNFA 2M7NA 1ALWA 1NCYA 1RWYA 2F8PA 2NCPA 2ISDA 1L2OC 1B7TZ 1G33A 4DS7A 2LVKA 1WDCC 3TS5B 2HQWA 1JWDA 2LMVA 2M1KB 3DVEA 1W7IB 1YRUB 1K2HA 1A4PA 4IL1A 1RK9A 1SYMA 4BY4A 5CSNA 4XYNA 3A4UB 2KDHA 2MRDA 5HLOA 1DJHA 1QJTA 1FPWA 2L4IA 1MXEA 1RROA 4YGBB 2NZ0A 4DRWA 1N0YA 1PSRA 1D1OA 1KQMB 4YI9A 2JOJA 2F33A 2CTNA 1HQVA 3DVKA 4CFQA 1Y6WA 2AMIA 1R6PA 1SCMB 1DTLA 2JZIA 3PN7B 3GK4X 3TDUA 1G8IA 1K96A 2L0PA 3E3RA 1KSOA 4P5OE 1OZSA 2JTTA 1QIVA 2LUCA 1BR1B 4AOMA 1PK0D 1SL7A 1XK4C 2TN4A 3CR5X 3OB1B 3RM1A 4MN0A 1J1EA 1KK8C 3RLZA 2QPTA 2MHHA 2JULA 2NCOA 1DJZA 3I5GB 4Q04A 1V1FA 1SK6D 2K2AA 3VRNA 1S6JA 3IQOA 2M49B 3KEVA 2CT9A 4MRXA 1SPYA 1UUSA 2PASA 3O6BA 2PMYA 1KQVA 3HX4A 1DF0A 2F2OA 4WQ3A 3VRRA 1K94A 1ZUZA 1XFXO 2GGMA 1F55A 1B8CA 5TNCA 1E8AA 1DJWA 2LVJA 2D8NA 2ZNDA 4PE4A 4HREE 1F70A 4YGDB 2ZFDA 2KHNA 2KGRA 2ZRSA 1CB1A 3LCPC 1EG3A 1JF0A 1EG4A 3C1VA 1CFCA 4DUQA 2BKHB 1QV1A 4OVNF 1M31A 1FBVA 2KBMA 4PHJA 4M2PA 2KYCA 2L5XB 2KBIA 3OP0A 4GGFA 4I5JA 3CWGA 3OX6A 1JFKA 3I5IB 4A4BA 1F71A 1NP8A 1SW8A 4E68A 3BQ3A 4MVFA 4AQJA 2H61C 1K90D 2LMUA 3EVRA 1YX7A 4XJKA 2JU0A 1XFWO 5JJGA 2JWWA 1NIWA 4QJ5B 5D69A 1YURA 1YVHA 1J55A 1Y1UA 3LLEA 1GQMA 1AJ5A 2KAVA 4YGEB 2LLSA 2KFHA 2BL0C 1RJVA 2WOSA 2K8MB 2QACA 3TUYB 5AXIA 4GFTA 2JT8A 5I2OA 2SCPA 4TNCA 5DKRA 3HCMA 1QX7A 3K21A 1FF1A 1IH0A 4ORBB 1SMGA 3NSKA 5AEQA 1KCYA 2G9BA 3BUNB 1F54A 2KFGA 1JC2A 2DOQA 1KWOC 1JFJA 1B47A 1TNXA 5FYXA 2K7CA 1ZMZA 2HF5A 3M0WA 2K7OA 2JXLA 1SL9A 1LVCD 4L9MA 4N1GA 2LE9B 1JBAA 2I7AA 3ZWHA 1IJ6A 2F3ZA 1KSMA 1FI5A 1F4OA 1JUOA 2OPOA 1N2DA 1WLMA 1QLSA 2KFFA 3DD4A 4C0LA 1B7TY 1SCVA 4ICBA 3BOWB 2Y1NA 1S1EA 5CSJA 2M97A 3OB2B 1K95A 3TDIA 2E6WA 5I2QA 2M9GA 1BLQA 1S5GZ 2O5GA 3I5FB 1SBJA 1NYAA 2FOTA 1IGVA 2KI4C 2NXQA 4FTGA 4PE0A 1DGVA 3BUOB 3H4SE 4I5LB 3SG4A 1S6CA 3KO0A 1UHKA 1YUTA 1RFJA 3JTDC 3KHEA 1SRAA 3CTNA 2Q4UA 2LHLA 2HPSA 2IS9A 1NWDA 2HETA 1DT7B 1UHIA 1UHJA 1GJYA 4MBEA 2MBXA 4MRYA 1AUIB 3FS7A 4FQOA 4GAOA 4N5XA 5GQQC 4MZLA 3CR2A 2JTZA 1ZFSA 2O60A 3O78A 1XA5A 1BU3A 1IRJA 1CM1A 2K0JA 3OHMB 1X02A 1IQ5A 1DJYA 2KYFA 1QXPA 1OZOA 3NSLA 4YGAA 4QJ4B 3VRPA 1TNPA 4P2YB 4DIRA 2F2PA 1OMDA 2PALA 1BR4B 1MHOA 2M8UA 1ZOTB 2LNKA 3EKHA 3QRXA 4CIDA 5HKYA 1L2OB 2LMTA 3JVTC 1WDCB 2JT0A 2L50A 1FW4A 1DGUA 1JF2A 2KI4B 2Y1MA 1CMFA 2ZKMX 4N1FA 4CFRA 2LVVA 2F3YA 2H2KA 1NUBA 1XFZO 2Y4QA 1OMVA 1CDMA 1YR5A 4PE7A 1YRTB 3JTDB 3WHUB 4CLNA 2ZN9A 3EK7A 1K9PA 1K9KA 1MUXA 1CM4A 1LKJA 3I5HC 1C07A 2R2IA 4A4CA 4YBHB 3SJSA 2BCBA 1PVBA 4OV2A 3PLFB 2MLFC 1NX3A 2LLUA 3DVMA 2KAXA 3OX5A 4PE1A 2BE4A 2AAOA 3EVVA 1ALVA 5F6TA 1G4YR 1EH2A 1CFDA 2LP3A 2KI6D 5KTYA 1S36A 1R2UA 3SG5A 1KK7Z 4NDDA 2L51A 1XYDA 1SL8A 2BBMA 1B8LA 1DJGA 2WCEA 3A8RA 5BPJA 2OTGC 2BBNA 2WNDA 1AK8A 2K7DA 1KK8B 2FCDA 3EK4A 1TRFA 3BUMB 1YX8A 2LC5A 1QLKA 2AUCA 1U5IB 3JVTB 4C0JA 1M46A 3LK1A 3D0YB 5D7FA 1CFFA 2OS8C 3VGOA 1J7QA 1TIZA 3FWBA 1B4CA 1CLLA 1A75A 1LINA 3TZ1A 5K89A 2LM5A 4GGNA 5CSIA 2CXJA 1GGZA 5DKNA 4NQGA 1KFXL 2KSPA 3I5HB 2GV5A 2CBLA 3O2PA 2SASA 1PVAA 4OKHA 1A75B 4ETOA 1CFPA 4CPVA 1GGWA 2BCXA 1Y1AA 2LANA 1ZACA 4NDCA 1XFVO 3WNXB 1MXLC 3BOWA 2H61A 2JNXA 3O4YA 4M2OA 4JPZB 4M2QA 5HKZA 1CTRA 1QVIZ 3AAJA 3WHTB 3KPXA 4GBAA 4JWQA 1S5GY 2KI6C 1CMGA 4QJ3B 1BG1A 2MLEC 1CDPA 3F45A 1SNLA 4MZKA 1UHNA 1Y0VH 1QTXA 1KQMC 1OMRA 1UHHA 3DF0B 1FI6A 2OTGB 1BT6A 5CSFA 1TCOB 3BYAA 1BODA 3BXKA 4PALA 1XFYO 2WORA 1L7ZA 1LA0A 1SCMC 3PN7C 2HQ8A 5G08A 2BKIB 1Y1XA 2VRGA 3LL8B 2BL0B 1WRKA 1OOJA 2JT3A 2A4JA 1IWQA 3CGAA 4YI8A 1RTP1 1DVIA 5JOLA 3SG2A 3NXAA 1SY9A 2ZN8A 2BE6A 1KFUL 1CNPA 1S26D 5KU1A 1YUUA 3SIAA 1NCXA 1LA3A 1A2XA 2JXCA 1HT9A 1M45A 5HYDA 1B8RA 1TCFA 1KWOB 1UURA 2Q91A 4NDBA 1WLZA 2KQYA 2MAZA 2M29A 3PSRA 1CLMA 2MA2A 1S6IA 1NSHA 2M1UA 1B9AA 1RECA 2G2BA 1AVSA 1OQPA 4PHNA 5PALA 4BY5A 1AHRA 2WC8A 1BJFA 1QX5B 1W7JB 3PALA 2LAPA 4OR9B 2EC6C 4PDZA 4YRUA 4ORAB 2KQ6A 1PRWA 4F0ZB 2L2EA 1J7RA 4PCWA 2GGZA 1WRLA 5ER5A 1ODBA 3PATA 1IQ3A 1MF8B 3PM8A 4I5KA 1K8UA 1YTZC 3AAKA 1M39A 4ZCVA 1PSBA 1TOPA 1EXRA 4GNKB 2BCAA 2EHBA 2PSRA 5I2LA 2LLTA 2MJWB 1QX2A 1CKKA 3I5IC 1YUSA 3FWCA 1TNQA 1WY9A 3FIAA 1F8HA 1H4BA 3SIBA
chains in the Genus database with same CATH superfamily
1NCZA 3TDZA 2K7BA 3S0AA 1Q80A 5AERA 1CDLA 1SR6C 3CYZA 2Y5IA 3QMEA 2PRUA 3CZ0A 1C7WA 2COLB 4GGFC 4HRGA 3CZ1A 1PULA 4PHMA 3BUWB 4MEWA 3CDNA 3VROA 1CDNA 3IQQA 1XFUO 2JC2A 2LVIA 3SG3A 4GPLB 2K61A 2QEVA 2KAYA 2KGBC 2L2CA 5HKWA 1QIWA 1KK7Y 2KOTA 2ZRTA 1AP4A 1XK4A 3EKJA 3R72A 5CPVA 3TUYC 4USLA 4MSPA 5I8NA 3CR4X 1JSAA 2LUXA 2WCFA 1J7PA 1TN4A 1TTXA 3DZTA 2EC6B 2P71A 3CS1A 3EVUA 1F4QA 3Q8IA 1KFXS 2E30A 3PFVA 1J7OA 1CLBA 1EJ3A 1DJIA 5DKQA 1U5IA 2FJUB 3NSOA 1OE9B 1DF0B 1QASA 3D0YA 1TNWA 4MZJA 5KSZA 1QS7A 4PHKA 3MSEB 2LP2A 3WXAA 5B8IB 5IBWA 3UNWA 2I18A 3EK8A 2BECA 3ICBA 1QATA 3GK2A 5AFPA 3IF7A 1B1GA 3VRQA 4I5NB 3SG7A 5AANA 2K2FA 2L98A 2I2RE 2LCPA 2LV7A 2EGDA 3CLNA 3ZNIA 2P6BB 3AKBA 1ORGA 1TUJA 3SG6A 2JRFA 1SR6B 2B1UA 1LXFC 4C0KA 2RGIA 2JPTA 1NPQA 1OSAA 1J1DA 1QVIY 5J3XA 4OCIA 1H8BA 2M3WA 3I5FC 3TS5C 1DMOA 1C7VA 2JQ6A 1WRZA 3D78A 1YVLA 4XJKB 4HRHA 2KNEA 3GOFA 2NLNA 1UP5A 1UWOA 1KFUS 1PALA 4YGCB 3DF0A 2WCBA 3DY9A 3R1PA 3DVJA 3VB1A 2CNPA 3LK0A 3KF9A 3NSIA 4HSZA 4ZCUA 1VRKA 4R1EA 1A29A 1BOCA 2LHIA 2PVBA 1V1GA 2L4HA 2M7LA 1N65A 1A03A 4D1EA 3D73A 1XO5A 2V53A 4UPGA 1K93D 1MQ1A 1SKTA 2FCEA 5FI7A 2FJYA 1MR8A 4MLWA 1AJ4A 4DCKA 1MWNA 5I94A 1IKUA 1QV0A 1IJ5A 1NX2A 4WQ2A 1K9UA 5HLVA 4GUKA 2CCMA 2OS8B 1BF5A 1XVJA 1M63B 1DJXA 1NX1A 1S3PA 3FE6A 1NX0A 1IG5A 3GK1A 2M0RA 4WRIA 4AQIA 3CZTX 2I94A 3BUXB 3L4LA 4ORCB 4U8DA 1BMOA 3D10A 4JQ0D 5ER4X 1EL4A 2YGUA 2ZNEA 3I5GC 3AKAA 2JNFA 2JPOA 1ALWA 2M7NA 1NCYA 1RWYA 2F8PA 2NCPA 2ISDA 1L2OC 1B7TZ 1G33A 4DS7A 2LVKA 1WDCC 3TS5B 2HQWA 5DICA 2LMVA 2M1KB 2WCMA 1W7IB 1YRUB 2L5YA 1A4PA 3DVEA 4IL1A 1RK9A 1K2HA 1SYMA 3RZSA 4BY4A 5CSNA 4XYNA 3A4UB 2KDHA 2MRDA 5HLOA 1DJHA 1QJTA 1FPWA 1P28A 2L4IA 5D3OA 1MXEA 3S0FA 1RROA 4YGBB 2NZ0A 4DRWA 1N0YA 3O4XA 1PSRA 1D1OA 2KLDA 1KQMB 4YI9A 2JOJA 2F33A 2CTNA 1HQVA 3DVKA 4CFQA 1Y6WA 2AMIA 1R6PA 1SCMB 1DTLA 2JZIA 2K60A 3PN7B 3GK4X 3TDUA 1G8IA 1K96A 2L0PA 2KLEA 1KSOA 3E3RA 4P5OE 1OZSA 2JTTA 1QIVA 2LUCA 1BR1B 4JD9A 4AOMA 1PK0D 1SL7A 1XK4C 2TN4A 3CR5X 3OB1B 3RM1A 4MN0A 1J1EA 1KK8C 3RLZA 2QPTA 2MHHA 2JULA 2NCOA 1DJZA 3I5GB 4Q04A 1IIOA 2WCKA 1V1FA 1SK6D 2K2AA 3NGVA 3VRNA 1S6JA 1LS8A 2M49B 3IQOA 3KEVA 2CT9A 4MRXA 1SPYA 1UUSA 2PASA 3O6BA 2PMYA 1KQVA 3HX4A 1DF0A 3BFAA 2F2OA 4WQ3A 3VRRA 1K94A 1ZUZA 1XFXO 2GGMA 1F55A 1B8CA 5TNCA 1E8AA 1DJWA 2LVJA 2D8NA 2ZNDA 4PE4A 4HREE 1F70A 3IVTA 4YGDB 2ZFDA 3V2LA 2KHNA 1TWOA 2KGRA 2ZRSA 3LCPC 1CB1A 1EG3A 1JF0A 1EG4A 2P70A 3C1VA 1CFCA 4DUQA 2BKHB 1QV1A 4OVNF 1M31A 1FBVA 2KBMA 4PHJA 4M2PA 2KYCA 2L5XB 2BAPA 2KBIA 3OP0A 4GGFA 4I5JA 3CWGA 3OX6A 1JFKA 3I5IB 4A4BA 1F71A 3D75A 1NP8A 1SW8A 4E68A 3BQ3A 4MVFA 3SG2A 4AQJA 2H61C 1K90D 2LMUA 3EVRA 1YX7A 4XJKA 3DXLA 2JU0A 1XFWO 3S0EA 5JJGA 2JWWA 1NIWA 5FI6A 5D69A 1YURA 5FI2A 1YVHA 4QJ5B 1J55A 2ERBA 1Y1UA 3LLEA 1GQMA 1AJ5A 2KAVA 4YGEB 2LLSA 2KFHA 2BL0C 1RJVA 2WOSA 4F7FA 2K8MB 2QACA 3TUYB 5AXIA 1JWDA 4GFTA 2JT8A 5I2OA 2SCPA 4TNCA 5DKRA 3HCMA 1QX7A 3K21A 1FF1A 1IH0A 4ORBB 1SMGA 3NSKA 5AEQA 1KCYA 2G9BA 3BUNB 1F54A 2KFGA 1JC2A 3DYEA 2DOQA 1KWOC 1JFJA 1B47A 1TNXA 2WC5A 5FYXA 2K7CA 1ZMZA 2HF5A 3M0WA 2K7OA 2JXLA 1SL9A 1LVCD 4L9MA 4N1GA 2LE9B 3SS4A 1JBAA 2I7AA 3ZWHA 3L47A 1IJ6A 2F3ZA 1KSMA 1OW4A 1FI5A 3D76A 3NHIA 1F4OA 1JUOA 2OPOA 1N2DA 1WLMA 1QLSA 2KFFA 3DD4A 4C0LA 3PJIA 1B7TY 3B87A 1SCVA 1XFRA 4ICBA 3BOWB 2Y1NA 1S1EA 5CSJA 4OZDA 2M97A 2PQLA 1QWVA 1K95A 3CABA 3OB2B 3R1OA 3TDIA 2E6WA 5I2QA 2M9GA 1BLQA 1S5GZ 2O5GA 3I5FB 1SBJA 1DQEA 1NYAA 2WCHA 2FOTA 1IGVA 2KI4C 2NXQA 1OOFA 4FTGA 4PE0A 1DGVA 3BUOB 3H4SE 4I5LB 3SG4A 3OBVA 1S6CA 3KO0A 1UHKA 1YUTA 1RFJA 3JTDC 3KHEA 1SRAA 3CTNA 2Q4UA 2LHLA 1DC1A 4KYNA 2HPSA 2IS9A 1NWDA 2HETA 1DT7B 1UHIA 1UHJA 1GJYA 4MBEA 2MBXA 4MRYA 1AUIB 3FS7A 4FQOA 2WC6A 4GAOA 2QDIA 4N5XA 5GQQC 4MZLA 3CR2A 2JTZA 1ZFSA 2O60A 3O78A 1XA5A 1BU3A 1IRJA 1CM1A 2K0JA 3OHMB 1X02A 1IQ5A 1OOHA 1DJYA 2KYFA 1QXPA 1OZOA 3NSLA 4YGAA 4QJ4B 3B88A 3VRPA 1OOIX 3PM2A 1TNPA 4P2YB 3B86A 2WCJA 4DIRA 2F2PA 1OMDA 2PALA 1BR4B 1MHOA 2M8UA 1ZOTB 2LNKA 3EG5B 3EKHA 3QRXA 4CIDA 1L2OB 2LMTA 3JVTC 1WDCB 2JT0A 2L50A 4FQTA 1DELA 1FW4A 1DGUA 1JF2A 2KI4B 2Y1MA 1CMFA 2ZKMX 4N1FA 4CFRA 2LVVA 2F3YA 2H2KA 4IJ7A 3B6XA 1NUBA 1XFZO 2Y4QA 1OMVA 1CDMA 1YR5A 4PE7A 1YRTB 3JTDB 3WHUB 4CLNA 1Z4HA 2ZN9A 3EK7A 1K9PA 1K9KA 1MUXA 1CM4A 1LKJA 3I5HC 1C07A 3UO9A 2R2IA 5HKYA 1DEKA 4YBHB 4A4CA 3SJSA 2BCBA 1PVBA 4OV2A 3PLFB 2MLFC 1NX3A 2LLUA 3DVMA 2KAXA 3OX5A 4PE1A 2BE4A 3K1EA 2AAOA 4INXA 3EVVA 1ALVA 5F6TA 3SS5A 1G4YR 1EH2A 1CFDA 2LP3A 2KI6D 5KTYA 1S36A 1GM0A 1R2UA 3SG5A 1KK7Z 3D74A 1W9ZA 2L51A 1XYDA 1SL8A 2BBMA 1OOGA 1B8LA 1DJGA 2WCEA 3A8RA 4NDDA 2OTGC 5BPJA 2BBNA 2WNDA 1AK8A 2K7DA 1KK8B 2FCDA 3EK4A 1TRFA 3BUMB 1YX8A 2LC5A 3CZ2A 1QLKA 2AUCA 1U5IB 3JVTB 4C0JA 1M46A 3LK1A 3D0YB 5D7FA 3NHTA 1CFFA 2OS8C 3VGOA 1J7QA 1TIZA 3FWBA 1B4CA 4PT1A 1CLLA 1A75A 1LINA 3S0BA 3TZ1A 5K89A 2LM5A 4GGNA 5CSIA 2CXJA 1GGZA 5DKNA 4NQGA 1KFXL 2KSPA 3I5HB 2GV5A 2CBLA 3O2PA 1C3YA 2SASA 2KPHA 1PVAA 4OKHA 1A75B 4ETOA 1CFPA 4CPVA 2GTEA 1GGWA 4INWA 2BCXA 1Y1AA 3FE9A 2LANA 1ZACA 3FE8A 1XFVO 3R1VA 4NDCA 1MXLC 3WNXB 3BOWA 2H61A 2JNXA 3O4YA 4M2OA 4JPZB 4M2QA 5HKZA 1CTRA 1QVIZ 3AAJA 3N7HA 3WHTB 3KPXA 4GBAA 2BNXA 4JWQA 1S5GY 1TUZA 2KI6C 1CMGA 4QJ3B 1BG1A 2MLEC 1C3ZA 1CDPA 3F45A 1SNLA 4MZKA 3BFBA 1UHNA 1Y0VH 1QTXA 1KQMC 1OMRA 1UHHA 3DF0B 5EL2A 1FI6A 2OTGB 1BT6A 5CSFA 1SSEB 1TCOB 3BYAA 1BODA 3BXKA 4PALA 1XFYO 2WORA 1L7ZA 1LA0A 1SCMC 3BFHA 3PN7C 4JKTA 2HQ8A 5G08A 2BKIB 1Y1XA 2VRGA 3LL8B 2BL0B 1WRKA 1OOJA 2JT3A 2A4JA 1IWQA 3CGAA 2QEOA 1RTP1 1DVIA 1T14A 4YI8A 3NXAA 1SY9A 2ZN8A 2BE6A 1KFUL 1CNPA 1S26D 2QEBA 2PYQA 5KU1A 1YUUA 3SIAA 1NCXA 1LA3A 1A2XA 2JXCA 1HT9A 1M45A 3S0GA 5HYDA 1B8RA 1TCFA 1KWOB 1UURA 2Q91A 4NDBA 1WLZA 2KQYA 2MAZA 2M29A 3PSRA 1CLMA 2MA2A 3L4AA 1S6IA 1NSHA 2WCLA 2M1UA 1B9AA 1RECA 2G2BA 1AVSA 1OQPA 3SS3A 4PHNA 5PALA 4BY5A 1AHRA 2WC8A 1BJFA 1QX5B 1W7JB 3PALA 2LAPA 4OR9B 2EC6C 4PDZA 4YRUA 4ORAB 2KQ6A 1PRWA 4F0ZB 2L2EA 1J7RA 3BJHA 4PCWA 2GGZA 1WRLA 3D77A 5ER5A 3S0DA 1ODBA 3PATA 1IQ3A 1MF8B 2QEHA 3PM8A 4I5KA 2H8VA 1K8UA 1YTZC 3AAKA 1M39A 4ZCVA 5HL1A 1PSBA 1TOPA 1EXRA 1Z2CB 4GNKB 3OGNA 2BCAA 2EHBA 2PSRA 5I2LA 2LLTA 2MJWB 1QX2A 1CKKA 3B7AA 1YUSA 3I5IC 3FWCA 1TNQA 5JOLA 1WY9A 3FIAA 1F8HA 1H4BA 3SIBA
chains in the Genus database with same CATH topology
1NCZA 3TDZA 2K7BA 1Q80A 5AERA 1CDLA 1SR6C 2Y5IA 2PRUA 4GGFC 1C7WA 2COLB 4HRGA 1PULA 4PHMA 3BUWB 4MEWA 3VROA 1CDNA 3IQQA 1XFUO 2JC2A 2LVIA 3SG3A 4GPLB 2K61A 2KAYA 2KGBC 5HKWA 1QIWA 1KK7Y 2KOTA 2ZRTA 1AP4A 1XK4A 3EKJA 3TUYC 5CPVA 4USLA 4MSPA 5I8NA 3CR4X 1JSAA 2LUXA 2WCFA 1J7PA 1TN4A 1TTXA 2EC6B 3CS1A 3EVUA 1F4QA 1J7OA 1KFXS 2E30A 3PFVA 1CLBA 1EJ3A 1DJIA 5DKQA 1U5IA 2FJUB 3NSOA 1OE9B 1DF0B 1QASA 3D0YA 1TNWA 4MZJA 5KSZA 1QS7A 4PHKA 3MSEB 2LP2A 3WXAA 5B8IB 5IBWA 2I18A 3EK8A 2BECA 3ICBA 1QATA 3GK2A 5AFPA 3IF7A 1B1GA 3VRQA 4I5NB 3SG7A 5AANA 2K2FA 2L98A 2I2RE 2LCPA 2LV7A 2EGDA 3CLNA 3ZNIA 2P6BB 3AKBA 3SG6A 2JRFA 1SR6B 2B1UA 1LXFC 4C0KA 2RGIA 2JPTA 1NPQA 1OSAA 1J1DA 1QVIY 5J3XA 4OCIA 1H8BA 2M3WA 3I5FC 3TS5C 1DMOA 1C7VA 2JQ6A 1WRZA 1YVLA 4XJKB 4HRHA 2KNEA 3GOFA 2NLNA 1UP5A 1UWOA 1KFUS 1PALA 4YGCB 3DF0A 2WCBA 3DVJA 2CNPA 3LK0A 3KF9A 3NSIA 4HSZA 4ZCUA 1VRKA 4R1EA 1A29A 1BOCA 2LHIA 2PVBA 1V1GA 2L4HA 2M7LA 1N65A 1A03A 4D1EA 1XO5A 2V53A 4UPGA 1K93D 1MQ1A 1SKTA 2FCEA 1MR8A 4MLWA 1AJ4A 4DCKA 1MWNA 1IKUA 1QV0A 1IJ5A 1NX2A 4WQ2A 1K9UA 5HLVA 4GUKA 2CCMA 2OS8B 1BF5A 1XVJA 1M63B 1DJXA 1NX1A 1S3PA 1NX0A 1IG5A 3GK1A 2M0RA 4WRIA 4AQIA 3CZTX 2I94A 3BUXB 5ER4X 4ORCB 4U8DA 1BMOA 3D10A 4JQ0D 1EL4A 2ZNEA 3I5GC 3AKAA 2JNFA 2M7NA 1ALWA 1NCYA 1RWYA 2F8PA 2NCPA 2ISDA 1L2OC 1B7TZ 1G33A 4DS7A 2LVKA 1WDCC 3TS5B 2HQWA 1JWDA 2LMVA 2M1KB 3DVEA 1W7IB 1YRUB 1K2HA 1A4PA 4IL1A 1RK9A 1SYMA 4BY4A 5CSNA 4XYNA 3A4UB 2KDHA 2MRDA 5HLOA 1DJHA 1QJTA 1FPWA 2L4IA 1MXEA 1RROA 4YGBB 2NZ0A 4DRWA 1N0YA 1PSRA 1D1OA 1KQMB 4YI9A 2JOJA 2F33A 2CTNA 1HQVA 3DVKA 4CFQA 1Y6WA 2AMIA 1R6PA 1SCMB 1DTLA 2JZIA 3PN7B 3GK4X 3TDUA 1G8IA 1K96A 2L0PA 3E3RA 1KSOA 4P5OE 1OZSA 2JTTA 1QIVA 2LUCA 1BR1B 4AOMA 1PK0D 1SL7A 1XK4C 2TN4A 3CR5X 3OB1B 3RM1A 4MN0A 1J1EA 1KK8C 3RLZA 2QPTA 2MHHA 2JULA 2NCOA 1DJZA 3I5GB 4Q04A 1V1FA 1SK6D 2K2AA 3VRNA 1S6JA 3IQOA 2M49B 3KEVA 2CT9A 4MRXA 1SPYA 1UUSA 2PASA 3O6BA 2PMYA 1KQVA 3HX4A 1DF0A 2F2OA 4WQ3A 3VRRA 1K94A 1ZUZA 1XFXO 2GGMA 1F55A 1B8CA 5TNCA 1E8AA 1DJWA 2LVJA 2D8NA 2ZNDA 4PE4A 4HREE 1F70A 4YGDB 2ZFDA 2KHNA 2KGRA 2ZRSA 1CB1A 3LCPC 1EG3A 1JF0A 1EG4A 3C1VA 1CFCA 4DUQA 2BKHB 1QV1A 4OVNF 1M31A 1FBVA 2KBMA 4PHJA 4M2PA 2KYCA 2L5XB 2KBIA 3OP0A 4GGFA 4I5JA 3CWGA 3OX6A 1JFKA 3I5IB 4A4BA 1F71A 1NP8A 1SW8A 4E68A 3BQ3A 4MVFA 4AQJA 2H61C 1K90D 2LMUA 3EVRA 1YX7A 4XJKA 2JU0A 1XFWO 5JJGA 2JWWA 1NIWA 4QJ5B 5D69A 1YURA 1YVHA 1J55A 1Y1UA 3LLEA 1GQMA 1AJ5A 2KAVA 4YGEB 2LLSA 2KFHA 2BL0C 1RJVA 2WOSA 2K8MB 2QACA 3TUYB 5AXIA 4GFTA 2JT8A 5I2OA 2SCPA 4TNCA 5DKRA 3HCMA 1QX7A 3K21A 1FF1A 1IH0A 4ORBB 1SMGA 3NSKA 5AEQA 1KCYA 2G9BA 3BUNB 1F54A 2KFGA 1JC2A 2DOQA 1KWOC 1JFJA 1B47A 1TNXA 5FYXA 2K7CA 1ZMZA 2HF5A 3M0WA 2K7OA 2JXLA 1SL9A 1LVCD 4L9MA 4N1GA 2LE9B 1JBAA 2I7AA 3ZWHA 1IJ6A 2F3ZA 1KSMA 1FI5A 1F4OA 1JUOA 2OPOA 1N2DA 1WLMA 1QLSA 2KFFA 3DD4A 4C0LA 1B7TY 1SCVA 4ICBA 3BOWB 2Y1NA 1S1EA 5CSJA 2M97A 3OB2B 1K95A 3TDIA 2E6WA 5I2QA 2M9GA 1BLQA 1S5GZ 2O5GA 3I5FB 1SBJA 1NYAA 2FOTA 1IGVA 2KI4C 2NXQA 4FTGA 4PE0A 1DGVA 3BUOB 3H4SE 4I5LB 3SG4A 1S6CA 3KO0A 1UHKA 1YUTA 1RFJA 3JTDC 3KHEA 1SRAA 3CTNA 2Q4UA 2LHLA 2HPSA 2IS9A 1NWDA 2HETA 1DT7B 1UHIA 1UHJA 1GJYA 4MBEA 2MBXA 4MRYA 1AUIB 3FS7A 4FQOA 4GAOA 4N5XA 5GQQC 4MZLA 3CR2A 2JTZA 1ZFSA 2O60A 3O78A 1XA5A 1BU3A 1IRJA 1CM1A 2K0JA 3OHMB 1X02A 1IQ5A 1DJYA 2KYFA 1QXPA 1OZOA 3NSLA 4YGAA 4QJ4B 3VRPA 1TNPA 4P2YB 4DIRA 2F2PA 1OMDA 2PALA 1BR4B 1MHOA 2M8UA 1ZOTB 2LNKA 3EKHA 3QRXA 4CIDA 5HKYA 1L2OB 2LMTA 3JVTC 1WDCB 2JT0A 2L50A 1FW4A 1DGUA 1JF2A 2KI4B 2Y1MA 1CMFA 2ZKMX 4N1FA 4CFRA 2LVVA 2F3YA 2H2KA 1NUBA 1XFZO 2Y4QA 1OMVA 1CDMA 1YR5A 4PE7A 1YRTB 3JTDB 3WHUB 4CLNA 2ZN9A 3EK7A 1K9PA 1K9KA 1MUXA 1CM4A 1LKJA 3I5HC 1C07A 2R2IA 4A4CA 4YBHB 3SJSA 2BCBA 1PVBA 4OV2A 3PLFB 2MLFC 1NX3A 2LLUA 3DVMA 2KAXA 3OX5A 4PE1A 2BE4A 2AAOA 3EVVA 1ALVA 5F6TA 1G4YR 1EH2A 1CFDA 2LP3A 2KI6D 5KTYA 1S36A 1R2UA 3SG5A 1KK7Z 4NDDA 2L51A 1XYDA 1SL8A 2BBMA 1B8LA 1DJGA 2WCEA 3A8RA 5BPJA 2OTGC 2BBNA 2WNDA 1AK8A 2K7DA 1KK8B 2FCDA 3EK4A 1TRFA 3BUMB 1YX8A 2LC5A 1QLKA 2AUCA 1U5IB 3JVTB 4C0JA 1M46A 3LK1A 3D0YB 5D7FA 1CFFA 2OS8C 3VGOA 1J7QA 1TIZA 3FWBA 1B4CA 1CLLA 1A75A 1LINA 3TZ1A 5K89A 2LM5A 4GGNA 5CSIA 2CXJA 1GGZA 5DKNA 4NQGA 1KFXL 2KSPA 3I5HB 2GV5A 2CBLA 3O2PA 2SASA 1PVAA 4OKHA 1A75B 4ETOA 1CFPA 4CPVA 1GGWA 2BCXA 1Y1AA 2LANA 1ZACA 4NDCA 1XFVO 3WNXB 1MXLC 3BOWA 2H61A 2JNXA 3O4YA 4M2OA 4JPZB 4M2QA 5HKZA 1CTRA 1QVIZ 3AAJA 3WHTB 3KPXA 4GBAA 4JWQA 1S5GY 2KI6C 1CMGA 4QJ3B 1BG1A 2MLEC 1CDPA 3F45A 1SNLA 4MZKA 1UHNA 1Y0VH 1QTXA 1KQMC 1OMRA 1UHHA 3DF0B 1FI6A 2OTGB 1BT6A 5CSFA 1TCOB 3BYAA 1BODA 3BXKA 4PALA 1XFYO 2WORA 1L7ZA 1LA0A 1SCMC 3PN7C 2HQ8A 5G08A 2BKIB 1Y1XA 2VRGA 3LL8B 2BL0B 1WRKA 1OOJA 2JT3A 2A4JA 1IWQA 3CGAA 4YI8A 1RTP1 1DVIA 5JOLA 3SG2A 3NXAA 1SY9A 2ZN8A 2BE6A 1KFUL 1CNPA 1S26D 5KU1A 1YUUA 3SIAA 1NCXA 1LA3A 1A2XA 2JXCA 1HT9A 1M45A 5HYDA 1B8RA 1TCFA 1KWOB 1UURA 2Q91A 4NDBA 1WLZA 2KQYA 2MAZA 2M29A 3PSRA 1CLMA 2MA2A 1S6IA 1NSHA 2M1UA 1B9AA 1RECA 2G2BA 1AVSA 1OQPA 4PHNA 5PALA 4BY5A 1AHRA 2WC8A 1BJFA 1QX5B 1W7JB 3PALA 2LAPA 4OR9B 2EC6C 4PDZA 4YRUA 4ORAB 2KQ6A 1PRWA 4F0ZB 2L2EA 1J7RA 4PCWA 2GGZA 1WRLA 5ER5A 1ODBA 3PATA 1IQ3A 1MF8B 3PM8A 4I5KA 1K8UA 1YTZC 3AAKA 1M39A 4ZCVA 1PSBA 1TOPA 1EXRA 4GNKB 2BCAA 2EHBA 2PSRA 5I2LA 2LLTA 2MJWB 1QX2A 1CKKA 3I5IC 1YUSA 3FWCA 1TNQA 1WY9A 3FIAA 1F8HA 1H4BA 3SIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NCZ A;  3TDZ A;  2K7B A;  1Q80 A;  5AER A;  1CDL A;  1SR6 C;  2Y5I A;  2PRU A;  4GGF C;  1C7W A;  2COL B;  4HRG A;  1PUL A;  4PHM A;  3BUW B;  4MEW A;  3VRO A;  1CDN A;  3IQQ A;  1XFU O;  2JC2 A;  2LVI A;  3SG3 A;  4GPL B;  2K61 A;  2KAY A;  2KGB C;  5HKW A;  1QIW A;  1KK7 Y;  2KOT A;  2ZRT A;  1AP4 A;  1XK4 A;  3EKJ A;  3TUY C;  5CPV A;  4USL A;  4MSP A;  5I8N A;  3CR4 X;  1JSA A;  2LUX A;  2WCF A;  1J7P A;  1TN4 A;  1TTX A;  2EC6 B;  3CS1 A;  3EVU A;  1F4Q A;  1J7O A;  1KFX S;  2E30 A;  3PFV A;  1CLB A;  1EJ3 A;  1DJI A;  5DKQ A;  1U5I A;  2FJU B;  3NSO A;  1OE9 B;  1DF0 B;  1QAS A;  3D0Y A;  1TNW A;  4MZJ A;  5KSZ A;  1QS7 A;  4PHK A;  3MSE B;  2LP2 A;  3WXA A;  5B8I B;  5IBW A;  2I18 A;  3EK8 A;  2BEC A;  3ICB A;  1QAT A;  3GK2 A;  5AFP A;  3IF7 A;  1B1G A;  3VRQ A;  4I5N B;  3SG7 A;  5AAN A;  2K2F A;  2L98 A;  2I2R E;  2LCP A;  2LV7 A;  2EGD A;  3CLN A;  3ZNI A;  2P6B B;  3AKB A;  3SG6 A;  2JRF A;  1SR6 B;  2B1U A;  1LXF C;  4C0K A;  2RGI A;  2JPT A;  1NPQ A;  1OSA A;  1J1D A;  1QVI Y;  5J3X A;  4OCI A;  1H8B A;  2M3W A;  3I5F C;  3TS5 C;  1DMO A;  1C7V A;  2JQ6 A;  1WRZ A;  1YVL A;  4XJK B;  4HRH A;  2KNE A;  3GOF A;  2NLN A;  1UP5 A;  1UWO A;  1KFU S;  1PAL A;  4YGC B;  3DF0 A;  2WCB A;  3DVJ A;  2CNP A;  3LK0 A;  3KF9 A;  3NSI A;  4HSZ A;  4ZCU A;  1VRK A;  4R1E A;  1A29 A;  1BOC A;  2LHI A;  2PVB A;  1V1G A;  2L4H A;  2M7L A;  1N65 A;  1A03 A;  4D1E A;  1XO5 A;  2V53 A;  4UPG A;  1K93 D;  1MQ1 A;  1SKT A;  2FCE A;  1MR8 A;  4MLW A;  1AJ4 A;  4DCK A;  1MWN A;  1IKU A;  1QV0 A;  1IJ5 A;  1NX2 A;  4WQ2 A;  1K9U A;  5HLV A;  4GUK A;  2CCM A;  2OS8 B;  1BF5 A;  1XVJ A;  1M63 B;  1DJX A;  1NX1 A;  1S3P A;  1NX0 A;  1IG5 A;  3GK1 A;  2M0R A;  4WRI A;  4AQI A;  3CZT X;  2I94 A;  3BUX B;  5ER4 X;  4ORC B;  4U8D A;  1BMO A;  3D10 A;  4JQ0 D;  1EL4 A;  2ZNE A;  3I5G C;  3AKA A;  2JNF A;  2M7N A;  1ALW A;  1NCY A;  1RWY A;  2F8P A;  2NCP A;  2ISD A;  1L2O C;  1B7T Z;  1G33 A;  4DS7 A;  2LVK A;  1WDC C;  3TS5 B;  2HQW A;  1JWD A;  2LMV A;  2M1K B;  3DVE A;  1W7I B;  1YRU B;  1K2H A;  1A4P A;  4IL1 A;  1RK9 A;  1SYM A;  4BY4 A;  5CSN A;  4XYN A;  3A4U B;  2KDH A;  2MRD A;  5HLO A;  1DJH A;  1QJT A;  1FPW A;  2L4I A;  1MXE A;  1RRO A;  4YGB B;  2NZ0 A;  4DRW A;  1N0Y A;  1PSR A;  1D1O A;  1KQM B;  4YI9 A;  2JOJ A;  2F33 A;  2CTN A;  1HQV A;  3DVK A;  4CFQ A;  1Y6W A;  2AMI A;  1R6P A;  1SCM B;  1DTL A;  2JZI A;  3PN7 B;  3GK4 X;  3TDU A;  1G8I A;  1K96 A;  2L0P A;  3E3R A;  1KSO A;  4P5O E;  1OZS A;  2JTT A;  1QIV A;  2LUC A;  1BR1 B;  4AOM A;  1PK0 D;  1SL7 A;  1XK4 C;  2TN4 A;  3CR5 X;  3OB1 B;  3RM1 A;  4MN0 A;  1J1E A;  1KK8 C;  3RLZ A;  2QPT A;  2MHH A;  2JUL A;  2NCO A;  1DJZ A;  3I5G B;  4Q04 A;  1V1F A;  1SK6 D;  2K2A A;  3VRN A;  1S6J A;  3IQO A;  2M49 B;  3KEV A;  2CT9 A;  4MRX A;  1SPY A;  1UUS A;  2PAS A;  3O6B A;  2PMY A;  1KQV A;  3HX4 A;  1DF0 A;  2F2O A;  4WQ3 A;  3VRR A;  1K94 A;  1ZUZ A;  1XFX O;  2GGM A;  1F55 A;  1B8C A;  5TNC A;  1E8A A;  1DJW A;  2LVJ A;  2D8N A;  2ZND A;  4PE4 A;  4HRE E;  1F70 A;  4YGD B;  2ZFD A;  2KHN A;  2KGR A;  2ZRS A;  1CB1 A;  3LCP C;  1EG3 A;  1JF0 A;  1EG4 A;  3C1V A;  1CFC A;  4DUQ A;  2BKH B;  1QV1 A;  4OVN F;  1M31 A;  1FBV A;  2KBM A;  4PHJ A;  4M2P A;  2KYC A;  2L5X B;  2KBI A;  3OP0 A;  4GGF A;  4I5J A;  3CWG A;  3OX6 A;  1JFK A;  3I5I B;  4A4B A;  1F71 A;  1NP8 A;  1SW8 A;  4E68 A;  3BQ3 A;  4MVF A;  4AQJ A;  2H61 C;  1K90 D;  2LMU A;  3EVR A;  1YX7 A;  4XJK A;  2JU0 A;  1XFW O;  5JJG A;  2JWW A;  1NIW A;  4QJ5 B;  5D69 A;  1YUR A;  1YVH A;  1J55 A;  1Y1U A;  3LLE A;  1GQM A;  1AJ5 A;  2KAV A;  4YGE B;  2LLS A;  2KFH A;  2BL0 C;  1RJV A;  2WOS A;  2K8M B;  2QAC A;  3TUY B;  5AXI A;  4GFT A;  2JT8 A;  5I2O A;  2SCP A;  4TNC A;  5DKR A;  3HCM A;  1QX7 A;  3K21 A;  1FF1 A;  1IH0 A;  4ORB B;  1SMG A;  3NSK A;  5AEQ A;  1KCY A;  2G9B A;  3BUN B;  1F54 A;  2KFG A;  1JC2 A;  2DOQ A;  1KWO C;  1JFJ A;  1B47 A;  1TNX A;  5FYX A;  2K7C A;  1ZMZ A;  2HF5 A;  3M0W A;  2K7O A;  2JXL A;  1SL9 A;  1LVC D;  4L9M A;  4N1G A;  2LE9 B;  1JBA A;  2I7A A;  3ZWH A;  1IJ6 A;  2F3Z A;  1KSM A;  1FI5 A;  1F4O A;  1JUO A;  2OPO A;  1N2D A;  1WLM A;  1QLS A;  2KFF A;  3DD4 A;  4C0L A;  1B7T Y;  1SCV A;  4ICB A;  3BOW B;  2Y1N A;  1S1E A;  5CSJ A;  2M97 A;  3OB2 B;  1K95 A;  3TDI A;  2E6W A;  5I2Q A;  2M9G A;  1BLQ A;  1S5G Z;  2O5G A;  3I5F B;  1SBJ A;  1NYA A;  2FOT A;  1IGV A;  2KI4 C;  2NXQ A;  4FTG A;  4PE0 A;  1DGV A;  3BUO B;  3H4S E;  4I5L B;  3SG4 A;  1S6C A;  3KO0 A;  1UHK A;  1YUT A;  1RFJ A;  3JTD C;  3KHE A;  1SRA A;  3CTN A;  2Q4U A;  2LHL A;  2HPS A;  2IS9 A;  1NWD A;  2HET A;  1DT7 B;  1UHI A;  1UHJ A;  1GJY A;  4MBE A;  2MBX A;  4MRY A;  1AUI B;  3FS7 A;  4FQO A;  4GAO A;  4N5X A;  5GQQ C;  4MZL A;  3CR2 A;  2JTZ A;  1ZFS A;  2O60 A;  3O78 A;  1XA5 A;  1BU3 A;  1IRJ A;  1CM1 A;  2K0J A;  3OHM B;  1X02 A;  1IQ5 A;  1DJY A;  2KYF A;  1QXP A;  1OZO A;  3NSL A;  4YGA A;  4QJ4 B;  3VRP A;  1TNP A;  4P2Y B;  4DIR A;  2F2P A;  1OMD A;  2PAL A;  1BR4 B;  1MHO A;  2M8U A;  1ZOT B;  2LNK A;  3EKH A;  3QRX A;  4CID A;  5HKY A;  1L2O B;  2LMT A;  3JVT C;  1WDC B;  2JT0 A;  2L50 A;  1FW4 A;  1DGU A;  1JF2 A;  2KI4 B;  2Y1M A;  1CMF A;  2ZKM X;  4N1F A;  4CFR A;  2LVV A;  2F3Y A;  2H2K A;  1NUB A;  1XFZ O;  2Y4Q A;  1OMV A;  1CDM A;  1YR5 A;  4PE7 A;  1YRT B;  3JTD B;  3WHU B;  4CLN A;  2ZN9 A;  3EK7 A;  1K9P A;  1K9K A;  1MUX A;  1CM4 A;  1LKJ A;  3I5H C;  1C07 A;  2R2I A;  4A4C A;  4YBH B;  3SJS A;  2BCB A;  1PVB A;  4OV2 A;  3PLF B;  2MLF C;  1NX3 A;  2LLU A;  3DVM A;  2KAX A;  3OX5 A;  4PE1 A;  2BE4 A;  2AAO A;  3EVV A;  1ALV A;  5F6T A;  1G4Y R;  1EH2 A;  1CFD A;  2LP3 A;  2KI6 D;  5KTY A;  1S36 A;  1R2U A;  3SG5 A;  1KK7 Z;  4NDD A;  2L51 A;  1XYD A;  1SL8 A;  2BBM A;  1B8L A;  1DJG A;  2WCE A;  3A8R A;  5BPJ A;  2OTG C;  2BBN A;  2WND A;  1AK8 A;  2K7D A;  1KK8 B;  2FCD A;  3EK4 A;  1TRF A;  3BUM B;  1YX8 A;  2LC5 A;  1QLK A;  2AUC A;  1U5I B;  3JVT B;  4C0J A;  1M46 A;  3LK1 A;  3D0Y B;  5D7F A;  1CFF A;  2OS8 C;  3VGO A;  1J7Q A;  1TIZ A;  3FWB A;  1B4C A;  1CLL A;  1A75 A;  1LIN A;  3TZ1 A;  5K89 A;  2LM5 A;  4GGN A;  5CSI A;  2CXJ A;  1GGZ A;  5DKN A;  4NQG A;  1KFX L;  2KSP A;  3I5H B;  2GV5 A;  2CBL A;  3O2P A;  2SAS A;  1PVA A;  4OKH A;  1A75 B;  4ETO A;  1CFP A;  4CPV A;  1GGW A;  2BCX A;  1Y1A A;  2LAN A;  1ZAC A;  4NDC A;  1XFV O;  3WNX B;  1MXL C;  3BOW A;  2H61 A;  2JNX A;  3O4Y A;  4M2O A;  4JPZ B;  4M2Q A;  5HKZ A;  1CTR A;  1QVI Z;  3AAJ A;  3WHT B;  3KPX A;  4GBA A;  4JWQ A;  1S5G Y;  2KI6 C;  1CMG A;  4QJ3 B;  1BG1 A;  2MLE C;  1CDP A;  3F45 A;  1SNL A;  4MZK A;  1UHN A;  1Y0V H;  1QTX A;  1KQM C;  1OMR A;  1UHH A;  3DF0 B;  1FI6 A;  2OTG B;  1BT6 A;  5CSF A;  1TCO B;  3BYA A;  1BOD A;  3BXK A;  4PAL A;  1XFY O;  2WOR A;  1L7Z A;  1LA0 A;  1SCM C;  3PN7 C;  2HQ8 A;  5G08 A;  2BKI B;  1Y1X A;  2VRG A;  3LL8 B;  2BL0 B;  1WRK A;  1OOJ A;  2JT3 A;  2A4J A;  1IWQ A;  3CGA A;  4YI8 A;  1RTP 1;  1DVI A;  5JOL A;  3SG2 A;  3NXA A;  1SY9 A;  2ZN8 A;  2BE6 A;  1KFU L;  1CNP A;  1S26 D;  5KU1 A;  1YUU A;  3SIA A;  1NCX A;  1LA3 A;  1A2X A;  2JXC A;  1HT9 A;  1M45 A;  5HYD A;  1B8R A;  1TCF A;  1KWO B;  1UUR A;  2Q91 A;  4NDB A;  1WLZ A;  2KQY A;  2MAZ A;  2M29 A;  3PSR A;  1CLM A;  2MA2 A;  1S6I A;  1NSH A;  2M1U A;  1B9A A;  1REC A;  2G2B A;  1AVS A;  1OQP A;  4PHN A;  5PAL A;  4BY5 A;  1AHR A;  2WC8 A;  1BJF A;  1QX5 B;  1W7J B;  3PAL A;  2LAP A;  4OR9 B;  2EC6 C;  4PDZ A;  4YRU A;  4ORA B;  2KQ6 A;  1PRW A;  4F0Z B;  2L2E A;  1J7R A;  4PCW A;  2GGZ A;  1WRL A;  5ER5 A;  1ODB A;  3PAT A;  1IQ3 A;  1MF8 B;  3PM8 A;  4I5K A;  1K8U A;  1YTZ C;  3AAK A;  1M39 A;  4ZCV A;  1PSB A;  1TOP A;  1EXR A;  4GNK B;  2BCA A;  2EHB A;  2PSR A;  5I2L A;  2LLT A;  2MJW B;  1QX2 A;  1CKK A;  3I5I C;  1YUS A;  3FWC A;  1TNQ A;  1WY9 A;  3FIA A;  1F8H A;  1H4B A;  3SIB A; 
#chains in the Genus database with same CATH topology
 1NCZ A;  3TDZ A;  2K7B A;  3S0A A;  1Q80 A;  5AER A;  1CDL A;  1SR6 C;  3CYZ A;  2Y5I A;  3QME A;  2PRU A;  3CZ0 A;  1C7W A;  2COL B;  4GGF C;  4HRG A;  3CZ1 A;  1PUL A;  4PHM A;  3BUW B;  4MEW A;  3CDN A;  3VRO A;  1CDN A;  3IQQ A;  1XFU O;  2JC2 A;  2LVI A;  3SG3 A;  4GPL B;  2K61 A;  2QEV A;  2KAY A;  2KGB C;  2L2C A;  5HKW A;  1QIW A;  1KK7 Y;  2KOT A;  2ZRT A;  1AP4 A;  1XK4 A;  3EKJ A;  3R72 A;  5CPV A;  3TUY C;  4USL A;  4MSP A;  5I8N A;  3CR4 X;  1JSA A;  2LUX A;  2WCF A;  1J7P A;  1TN4 A;  1TTX A;  3DZT A;  2EC6 B;  2P71 A;  3CS1 A;  3EVU A;  1F4Q A;  3Q8I A;  1KFX S;  2E30 A;  3PFV A;  1J7O A;  1CLB A;  1EJ3 A;  1DJI A;  5DKQ A;  1U5I A;  2FJU B;  3NSO A;  1OE9 B;  1DF0 B;  1QAS A;  3D0Y A;  1TNW A;  4MZJ A;  5KSZ A;  1QS7 A;  4PHK A;  3MSE B;  2LP2 A;  3WXA A;  5B8I B;  5IBW A;  3UNW A;  2I18 A;  3EK8 A;  2BEC A;  3ICB A;  1QAT A;  3GK2 A;  5AFP A;  3IF7 A;  1B1G A;  3VRQ A;  4I5N B;  3SG7 A;  5AAN A;  2K2F A;  2L98 A;  2I2R E;  2LCP A;  2LV7 A;  2EGD A;  3CLN A;  3ZNI A;  2P6B B;  3AKB A;  1ORG A;  1TUJ A;  3SG6 A;  2JRF A;  1SR6 B;  2B1U A;  1LXF C;  4C0K A;  2RGI A;  2JPT A;  1NPQ A;  1OSA A;  1J1D A;  1QVI Y;  5J3X A;  4OCI A;  1H8B A;  2M3W A;  3I5F C;  3TS5 C;  1DMO A;  1C7V A;  2JQ6 A;  1WRZ A;  3D78 A;  1YVL A;  4XJK B;  4HRH A;  2KNE A;  3GOF A;  2NLN A;  1UP5 A;  1UWO A;  1KFU S;  1PAL A;  4YGC B;  3DF0 A;  2WCB A;  3DY9 A;  3R1P A;  3DVJ A;  3VB1 A;  2CNP A;  3LK0 A;  3KF9 A;  3NSI A;  4HSZ A;  4ZCU A;  1VRK A;  4R1E A;  1A29 A;  1BOC A;  2LHI A;  2PVB A;  1V1G A;  2L4H A;  2M7L A;  1N65 A;  1A03 A;  4D1E A;  3D73 A;  1XO5 A;  2V53 A;  4UPG A;  1K93 D;  1MQ1 A;  1SKT A;  2FCE A;  5FI7 A;  2FJY A;  1MR8 A;  4MLW A;  1AJ4 A;  4DCK A;  1MWN A;  5I94 A;  1IKU A;  1QV0 A;  1IJ5 A;  1NX2 A;  4WQ2 A;  1K9U A;  5HLV A;  4GUK A;  2CCM A;  2OS8 B;  1BF5 A;  1XVJ A;  1M63 B;  1DJX A;  1NX1 A;  1S3P A;  3FE6 A;  1NX0 A;  1IG5 A;  3GK1 A;  2M0R A;  4WRI A;  4AQI A;  3CZT X;  2I94 A;  3BUX B;  3L4L A;  4ORC B;  4U8D A;  1BMO A;  3D10 A;  4JQ0 D;  5ER4 X;  1EL4 A;  2YGU A;  2ZNE A;  3I5G C;  3AKA A;  2JNF A;  2JPO A;  1ALW A;  2M7N A;  1NCY A;  1RWY A;  2F8P A;  2NCP A;  2ISD A;  1L2O C;  1B7T Z;  1G33 A;  4DS7 A;  2LVK A;  1WDC C;  3TS5 B;  2HQW A;  5DIC A;  2LMV A;  2M1K B;  2WCM A;  1W7I B;  1YRU B;  2L5Y A;  1A4P A;  3DVE A;  4IL1 A;  1RK9 A;  1K2H A;  1SYM A;  3RZS A;  4BY4 A;  5CSN A;  4XYN A;  3A4U B;  2KDH A;  2MRD A;  5HLO A;  1DJH A;  1QJT A;  1FPW A;  1P28 A;  2L4I A;  5D3O A;  1MXE A;  3S0F A;  1RRO A;  4YGB B;  2NZ0 A;  4DRW A;  1N0Y A;  3O4X A;  1PSR A;  1D1O A;  2KLD A;  1KQM B;  4YI9 A;  2JOJ A;  2F33 A;  2CTN A;  1HQV A;  3DVK A;  4CFQ A;  1Y6W A;  2AMI A;  1R6P A;  1SCM B;  1DTL A;  2JZI A;  2K60 A;  3PN7 B;  3GK4 X;  3TDU A;  1G8I A;  1K96 A;  2L0P A;  2KLE A;  1KSO A;  3E3R A;  4P5O E;  1OZS A;  2JTT A;  1QIV A;  2LUC A;  1BR1 B;  4JD9 A;  4AOM A;  1PK0 D;  1SL7 A;  1XK4 C;  2TN4 A;  3CR5 X;  3OB1 B;  3RM1 A;  4MN0 A;  1J1E A;  1KK8 C;  3RLZ A;  2QPT A;  2MHH A;  2JUL A;  2NCO A;  1DJZ A;  3I5G B;  4Q04 A;  1IIO A;  2WCK A;  1V1F A;  1SK6 D;  2K2A A;  3NGV A;  3VRN A;  1S6J A;  1LS8 A;  2M49 B;  3IQO A;  3KEV A;  2CT9 A;  4MRX A;  1SPY A;  1UUS A;  2PAS A;  3O6B A;  2PMY A;  1KQV A;  3HX4 A;  1DF0 A;  3BFA A;  2F2O A;  4WQ3 A;  3VRR A;  1K94 A;  1ZUZ A;  1XFX O;  2GGM A;  1F55 A;  1B8C A;  5TNC A;  1E8A A;  1DJW A;  2LVJ A;  2D8N A;  2ZND A;  4PE4 A;  4HRE E;  1F70 A;  3IVT A;  4YGD B;  2ZFD A;  3V2L A;  2KHN A;  1TWO A;  2KGR A;  2ZRS A;  3LCP C;  1CB1 A;  1EG3 A;  1JF0 A;  1EG4 A;  2P70 A;  3C1V A;  1CFC A;  4DUQ A;  2BKH B;  1QV1 A;  4OVN F;  1M31 A;  1FBV A;  2KBM A;  4PHJ A;  4M2P A;  2KYC A;  2L5X B;  2BAP A;  2KBI A;  3OP0 A;  4GGF A;  4I5J A;  3CWG A;  3OX6 A;  1JFK A;  3I5I B;  4A4B A;  1F71 A;  3D75 A;  1NP8 A;  1SW8 A;  4E68 A;  3BQ3 A;  4MVF A;  3SG2 A;  4AQJ A;  2H61 C;  1K90 D;  2LMU A;  3EVR A;  1YX7 A;  4XJK A;  3DXL A;  2JU0 A;  1XFW O;  3S0E A;  5JJG A;  2JWW A;  1NIW A;  5FI6 A;  5D69 A;  1YUR A;  5FI2 A;  1YVH A;  4QJ5 B;  1J55 A;  2ERB A;  1Y1U A;  3LLE A;  1GQM A;  1AJ5 A;  2KAV A;  4YGE B;  2LLS A;  2KFH A;  2BL0 C;  1RJV A;  2WOS A;  4F7F A;  2K8M B;  2QAC A;  3TUY B;  5AXI A;  1JWD A;  4GFT A;  2JT8 A;  5I2O A;  2SCP A;  4TNC A;  5DKR A;  3HCM A;  1QX7 A;  3K21 A;  1FF1 A;  1IH0 A;  4ORB B;  1SMG A;  3NSK A;  5AEQ A;  1KCY A;  2G9B A;  3BUN B;  1F54 A;  2KFG A;  1JC2 A;  3DYE A;  2DOQ A;  1KWO C;  1JFJ A;  1B47 A;  1TNX A;  2WC5 A;  5FYX A;  2K7C A;  1ZMZ A;  2HF5 A;  3M0W A;  2K7O A;  2JXL A;  1SL9 A;  1LVC D;  4L9M A;  4N1G A;  2LE9 B;  3SS4 A;  1JBA A;  2I7A A;  3ZWH A;  3L47 A;  1IJ6 A;  2F3Z A;  1KSM A;  1OW4 A;  1FI5 A;  3D76 A;  3NHI A;  1F4O A;  1JUO A;  2OPO A;  1N2D A;  1WLM A;  1QLS A;  2KFF A;  3DD4 A;  4C0L A;  3PJI A;  1B7T Y;  3B87 A;  1SCV A;  1XFR A;  4ICB A;  3BOW B;  2Y1N A;  1S1E A;  5CSJ A;  4OZD A;  2M97 A;  2PQL A;  1QWV A;  1K95 A;  3CAB A;  3OB2 B;  3R1O A;  3TDI A;  2E6W A;  5I2Q A;  2M9G A;  1BLQ A;  1S5G Z;  2O5G A;  3I5F B;  1SBJ A;  1DQE A;  1NYA A;  2WCH A;  2FOT A;  1IGV A;  2KI4 C;  2NXQ A;  1OOF A;  4FTG A;  4PE0 A;  1DGV A;  3BUO B;  3H4S E;  4I5L B;  3SG4 A;  3OBV A;  1S6C A;  3KO0 A;  1UHK A;  1YUT A;  1RFJ A;  3JTD C;  3KHE A;  1SRA A;  3CTN A;  2Q4U A;  2LHL A;  1DC1 A;  4KYN A;  2HPS A;  2IS9 A;  1NWD A;  2HET A;  1DT7 B;  1UHI A;  1UHJ A;  1GJY A;  4MBE A;  2MBX A;  4MRY A;  1AUI B;  3FS7 A;  4FQO A;  2WC6 A;  4GAO A;  2QDI A;  4N5X A;  5GQQ C;  4MZL A;  3CR2 A;  2JTZ A;  1ZFS A;  2O60 A;  3O78 A;  1XA5 A;  1BU3 A;  1IRJ A;  1CM1 A;  2K0J A;  3OHM B;  1X02 A;  1IQ5 A;  1OOH A;  1DJY A;  2KYF A;  1QXP A;  1OZO A;  3NSL A;  4YGA A;  4QJ4 B;  3B88 A;  3VRP A;  1OOI X;  3PM2 A;  1TNP A;  4P2Y B;  3B86 A;  2WCJ A;  4DIR A;  2F2P A;  1OMD A;  2PAL A;  1BR4 B;  1MHO A;  2M8U A;  1ZOT B;  2LNK A;  3EG5 B;  3EKH A;  3QRX A;  4CID A;  1L2O B;  2LMT A;  3JVT C;  1WDC B;  2JT0 A;  2L50 A;  4FQT A;  1DEL A;  1FW4 A;  1DGU A;  1JF2 A;  2KI4 B;  2Y1M A;  1CMF A;  2ZKM X;  4N1F A;  4CFR A;  2LVV A;  2F3Y A;  2H2K A;  4IJ7 A;  3B6X A;  1NUB A;  1XFZ O;  2Y4Q A;  1OMV A;  1CDM A;  1YR5 A;  4PE7 A;  1YRT B;  3JTD B;  3WHU B;  4CLN A;  1Z4H A;  2ZN9 A;  3EK7 A;  1K9P A;  1K9K A;  1MUX A;  1CM4 A;  1LKJ A;  3I5H C;  1C07 A;  3UO9 A;  2R2I A;  5HKY A;  1DEK A;  4YBH B;  4A4C A;  3SJS A;  2BCB A;  1PVB A;  4OV2 A;  3PLF B;  2MLF C;  1NX3 A;  2LLU A;  3DVM A;  2KAX A;  3OX5 A;  4PE1 A;  2BE4 A;  3K1E A;  2AAO A;  4INX A;  3EVV A;  1ALV A;  5F6T A;  3SS5 A;  1G4Y R;  1EH2 A;  1CFD A;  2LP3 A;  2KI6 D;  5KTY A;  1S36 A;  1GM0 A;  1R2U A;  3SG5 A;  1KK7 Z;  3D74 A;  1W9Z A;  2L51 A;  1XYD A;  1SL8 A;  2BBM A;  1OOG A;  1B8L A;  1DJG A;  2WCE A;  3A8R A;  4NDD A;  2OTG C;  5BPJ A;  2BBN A;  2WND A;  1AK8 A;  2K7D A;  1KK8 B;  2FCD A;  3EK4 A;  1TRF A;  3BUM B;  1YX8 A;  2LC5 A;  3CZ2 A;  1QLK A;  2AUC A;  1U5I B;  3JVT B;  4C0J A;  1M46 A;  3LK1 A;  3D0Y B;  5D7F A;  3NHT A;  1CFF A;  2OS8 C;  3VGO A;  1J7Q A;  1TIZ A;  3FWB A;  1B4C A;  4PT1 A;  1CLL A;  1A75 A;  1LIN A;  3S0B A;  3TZ1 A;  5K89 A;  2LM5 A;  4GGN A;  5CSI A;  2CXJ A;  1GGZ A;  5DKN A;  4NQG A;  1KFX L;  2KSP A;  3I5H B;  2GV5 A;  2CBL A;  3O2P A;  1C3Y A;  2SAS A;  2KPH A;  1PVA A;  4OKH A;  1A75 B;  4ETO A;  1CFP A;  4CPV A;  2GTE A;  1GGW A;  4INW A;  2BCX A;  1Y1A A;  3FE9 A;  2LAN A;  1ZAC A;  3FE8 A;  1XFV O;  3R1V A;  4NDC A;  1MXL C;  3WNX B;  3BOW A;  2H61 A;  2JNX A;  3O4Y A;  4M2O A;  4JPZ B;  4M2Q A;  5HKZ A;  1CTR A;  1QVI Z;  3AAJ A;  3N7H A;  3WHT B;  3KPX A;  4GBA A;  2BNX A;  4JWQ A;  1S5G Y;  1TUZ A;  2KI6 C;  1CMG A;  4QJ3 B;  1BG1 A;  2MLE C;  1C3Z A;  1CDP A;  3F45 A;  1SNL A;  4MZK A;  3BFB A;  1UHN A;  1Y0V H;  1QTX A;  1KQM C;  1OMR A;  1UHH A;  3DF0 B;  5EL2 A;  1FI6 A;  2OTG B;  1BT6 A;  5CSF A;  1SSE B;  1TCO B;  3BYA A;  1BOD A;  3BXK A;  4PAL A;  1XFY O;  2WOR A;  1L7Z A;  1LA0 A;  1SCM C;  3BFH A;  3PN7 C;  4JKT A;  2HQ8 A;  5G08 A;  2BKI B;  1Y1X A;  2VRG A;  3LL8 B;  2BL0 B;  1WRK A;  1OOJ A;  2JT3 A;  2A4J A;  1IWQ A;  3CGA A;  2QEO A;  1RTP 1;  1DVI A;  1T14 A;  4YI8 A;  3NXA A;  1SY9 A;  2ZN8 A;  2BE6 A;  1KFU L;  1CNP A;  1S26 D;  2QEB A;  2PYQ A;  5KU1 A;  1YUU A;  3SIA A;  1NCX A;  1LA3 A;  1A2X A;  2JXC A;  1HT9 A;  1M45 A;  3S0G A;  5HYD A;  1B8R A;  1TCF A;  1KWO B;  1UUR A;  2Q91 A;  4NDB A;  1WLZ A;  2KQY A;  2MAZ A;  2M29 A;  3PSR A;  1CLM A;  2MA2 A;  3L4A A;  1S6I A;  1NSH A;  2WCL A;  2M1U A;  1B9A A;  1REC A;  2G2B A;  1AVS A;  1OQP A;  3SS3 A;  4PHN A;  5PAL A;  4BY5 A;  1AHR A;  2WC8 A;  1BJF A;  1QX5 B;  1W7J B;  3PAL A;  2LAP A;  4OR9 B;  2EC6 C;  4PDZ A;  4YRU A;  4ORA B;  2KQ6 A;  1PRW A;  4F0Z B;  2L2E A;  1J7R A;  3BJH A;  4PCW A;  2GGZ A;  1WRL A;  3D77 A;  5ER5 A;  3S0D A;  1ODB A;  3PAT A;  1IQ3 A;  1MF8 B;  2QEH A;  3PM8 A;  4I5K A;  2H8V A;  1K8U A;  1YTZ C;  3AAK A;  1M39 A;  4ZCV A;  5HL1 A;  1PSB A;  1TOP A;  1EXR A;  1Z2C B;  4GNK B;  3OGN A;  2BCA A;  2EHB A;  2PSR A;  5I2L A;  2LLT A;  2MJW B;  1QX2 A;  1CKK A;  3B7A A;  1YUS A;  3I5I C;  3FWC A;  1TNQ A;  5JOL A;  1WY9 A;  3FIA A;  1F8H A;  1H4B A;  3SIB A; 
#chains in the Genus database with same CATH homology
 1NCZ A;  3TDZ A;  2K7B A;  1Q80 A;  5AER A;  1CDL A;  1SR6 C;  2Y5I A;  2PRU A;  4GGF C;  1C7W A;  2COL B;  4HRG A;  1PUL A;  4PHM A;  3BUW B;  4MEW A;  3VRO A;  1CDN A;  3IQQ A;  1XFU O;  2JC2 A;  2LVI A;  3SG3 A;  4GPL B;  2K61 A;  2KAY A;  2KGB C;  5HKW A;  1QIW A;  1KK7 Y;  2KOT A;  2ZRT A;  1AP4 A;  1XK4 A;  3EKJ A;  3TUY C;  5CPV A;  4USL A;  4MSP A;  5I8N A;  3CR4 X;  1JSA A;  2LUX A;  2WCF A;  1J7P A;  1TN4 A;  1TTX A;  2EC6 B;  3CS1 A;  3EVU A;  1F4Q A;  1J7O A;  1KFX S;  2E30 A;  3PFV A;  1CLB A;  1EJ3 A;  1DJI A;  5DKQ A;  1U5I A;  2FJU B;  3NSO A;  1OE9 B;  1DF0 B;  1QAS A;  3D0Y A;  1TNW A;  4MZJ A;  5KSZ A;  1QS7 A;  4PHK A;  3MSE B;  2LP2 A;  3WXA A;  5B8I B;  5IBW A;  2I18 A;  3EK8 A;  2BEC A;  3ICB A;  1QAT A;  3GK2 A;  5AFP A;  3IF7 A;  1B1G A;  3VRQ A;  4I5N B;  3SG7 A;  5AAN A;  2K2F A;  2L98 A;  2I2R E;  2LCP A;  2LV7 A;  2EGD A;  3CLN A;  3ZNI A;  2P6B B;  3AKB A;  3SG6 A;  2JRF A;  1SR6 B;  2B1U A;  1LXF C;  4C0K A;  2RGI A;  2JPT A;  1NPQ A;  1OSA A;  1J1D A;  1QVI Y;  5J3X A;  4OCI A;  1H8B A;  2M3W A;  3I5F C;  3TS5 C;  1DMO A;  1C7V A;  2JQ6 A;  1WRZ A;  1YVL A;  4XJK B;  4HRH A;  2KNE A;  3GOF A;  2NLN A;  1UP5 A;  1UWO A;  1KFU S;  1PAL A;  4YGC B;  3DF0 A;  2WCB A;  3DVJ A;  2CNP A;  3LK0 A;  3KF9 A;  3NSI A;  4HSZ A;  4ZCU A;  1VRK A;  4R1E A;  1A29 A;  1BOC A;  2LHI A;  2PVB A;  1V1G A;  2L4H A;  2M7L A;  1N65 A;  1A03 A;  4D1E A;  1XO5 A;  2V53 A;  4UPG A;  1K93 D;  1MQ1 A;  1SKT A;  2FCE A;  1MR8 A;  4MLW A;  1AJ4 A;  4DCK A;  1MWN A;  1IKU A;  1QV0 A;  1IJ5 A;  1NX2 A;  4WQ2 A;  1K9U A;  5HLV A;  4GUK A;  2CCM A;  2OS8 B;  1BF5 A;  1XVJ A;  1M63 B;  1DJX A;  1NX1 A;  1S3P A;  1NX0 A;  1IG5 A;  3GK1 A;  2M0R A;  4WRI A;  4AQI A;  3CZT X;  2I94 A;  3BUX B;  5ER4 X;  4ORC B;  4U8D A;  1BMO A;  3D10 A;  4JQ0 D;  1EL4 A;  2ZNE A;  3I5G C;  3AKA A;  2JNF A;  2M7N A;  1ALW A;  1NCY A;  1RWY A;  2F8P A;  2NCP A;  2ISD A;  1L2O C;  1B7T Z;  1G33 A;  4DS7 A;  2LVK A;  1WDC C;  3TS5 B;  2HQW A;  1JWD A;  2LMV A;  2M1K B;  3DVE A;  1W7I B;  1YRU B;  1K2H A;  1A4P A;  4IL1 A;  1RK9 A;  1SYM A;  4BY4 A;  5CSN A;  4XYN A;  3A4U B;  2KDH A;  2MRD A;  5HLO A;  1DJH A;  1QJT A;  1FPW A;  2L4I A;  1MXE A;  1RRO A;  4YGB B;  2NZ0 A;  4DRW A;  1N0Y A;  1PSR A;  1D1O A;  1KQM B;  4YI9 A;  2JOJ A;  2F33 A;  2CTN A;  1HQV A;  3DVK A;  4CFQ A;  1Y6W A;  2AMI A;  1R6P A;  1SCM B;  1DTL A;  2JZI A;  3PN7 B;  3GK4 X;  3TDU A;  1G8I A;  1K96 A;  2L0P A;  3E3R A;  1KSO A;  4P5O E;  1OZS A;  2JTT A;  1QIV A;  2LUC A;  1BR1 B;  4AOM A;  1PK0 D;  1SL7 A;  1XK4 C;  2TN4 A;  3CR5 X;  3OB1 B;  3RM1 A;  4MN0 A;  1J1E A;  1KK8 C;  3RLZ A;  2QPT A;  2MHH A;  2JUL A;  2NCO A;  1DJZ A;  3I5G B;  4Q04 A;  1V1F A;  1SK6 D;  2K2A A;  3VRN A;  1S6J A;  3IQO A;  2M49 B;  3KEV A;  2CT9 A;  4MRX A;  1SPY A;  1UUS A;  2PAS A;  3O6B A;  2PMY A;  1KQV A;  3HX4 A;  1DF0 A;  2F2O A;  4WQ3 A;  3VRR A;  1K94 A;  1ZUZ A;  1XFX O;  2GGM A;  1F55 A;  1B8C A;  5TNC A;  1E8A A;  1DJW A;  2LVJ A;  2D8N A;  2ZND A;  4PE4 A;  4HRE E;  1F70 A;  4YGD B;  2ZFD A;  2KHN A;  2KGR A;  2ZRS A;  1CB1 A;  3LCP C;  1EG3 A;  1JF0 A;  1EG4 A;  3C1V A;  1CFC A;  4DUQ A;  2BKH B;  1QV1 A;  4OVN F;  1M31 A;  1FBV A;  2KBM A;  4PHJ A;  4M2P A;  2KYC A;  2L5X B;  2KBI A;  3OP0 A;  4GGF A;  4I5J A;  3CWG A;  3OX6 A;  1JFK A;  3I5I B;  4A4B A;  1F71 A;  1NP8 A;  1SW8 A;  4E68 A;  3BQ3 A;  4MVF A;  4AQJ A;  2H61 C;  1K90 D;  2LMU A;  3EVR A;  1YX7 A;  4XJK A;  2JU0 A;  1XFW O;  5JJG A;  2JWW A;  1NIW A;  4QJ5 B;  5D69 A;  1YUR A;  1YVH A;  1J55 A;  1Y1U A;  3LLE A;  1GQM A;  1AJ5 A;  2KAV A;  4YGE B;  2LLS A;  2KFH A;  2BL0 C;  1RJV A;  2WOS A;  2K8M B;  2QAC A;  3TUY B;  5AXI A;  4GFT A;  2JT8 A;  5I2O A;  2SCP A;  4TNC A;  5DKR A;  3HCM A;  1QX7 A;  3K21 A;  1FF1 A;  1IH0 A;  4ORB B;  1SMG A;  3NSK A;  5AEQ A;  1KCY A;  2G9B A;  3BUN B;  1F54 A;  2KFG A;  1JC2 A;  2DOQ A;  1KWO C;  1JFJ A;  1B47 A;  1TNX A;  5FYX A;  2K7C A;  1ZMZ A;  2HF5 A;  3M0W A;  2K7O A;  2JXL A;  1SL9 A;  1LVC D;  4L9M A;  4N1G A;  2LE9 B;  1JBA A;  2I7A A;  3ZWH A;  1IJ6 A;  2F3Z A;  1KSM A;  1FI5 A;  1F4O A;  1JUO A;  2OPO A;  1N2D A;  1WLM A;  1QLS A;  2KFF A;  3DD4 A;  4C0L A;  1B7T Y;  1SCV A;  4ICB A;  3BOW B;  2Y1N A;  1S1E A;  5CSJ A;  2M97 A;  3OB2 B;  1K95 A;  3TDI A;  2E6W A;  5I2Q A;  2M9G A;  1BLQ A;  1S5G Z;  2O5G A;  3I5F B;  1SBJ A;  1NYA A;  2FOT A;  1IGV A;  2KI4 C;  2NXQ A;  4FTG A;  4PE0 A;  1DGV A;  3BUO B;  3H4S E;  4I5L B;  3SG4 A;  1S6C A;  3KO0 A;  1UHK A;  1YUT A;  1RFJ A;  3JTD C;  3KHE A;  1SRA A;  3CTN A;  2Q4U A;  2LHL A;  2HPS A;  2IS9 A;  1NWD A;  2HET A;  1DT7 B;  1UHI A;  1UHJ A;  1GJY A;  4MBE A;  2MBX A;  4MRY A;  1AUI B;  3FS7 A;  4FQO A;  4GAO A;  4N5X A;  5GQQ C;  4MZL A;  3CR2 A;  2JTZ A;  1ZFS A;  2O60 A;  3O78 A;  1XA5 A;  1BU3 A;  1IRJ A;  1CM1 A;  2K0J A;  3OHM B;  1X02 A;  1IQ5 A;  1DJY A;  2KYF A;  1QXP A;  1OZO A;  3NSL A;  4YGA A;  4QJ4 B;  3VRP A;  1TNP A;  4P2Y B;  4DIR A;  2F2P A;  1OMD A;  2PAL A;  1BR4 B;  1MHO A;  2M8U A;  1ZOT B;  2LNK A;  3EKH A;  3QRX A;  4CID A;  5HKY A;  1L2O B;  2LMT A;  3JVT C;  1WDC B;  2JT0 A;  2L50 A;  1FW4 A;  1DGU A;  1JF2 A;  2KI4 B;  2Y1M A;  1CMF A;  2ZKM X;  4N1F A;  4CFR A;  2LVV A;  2F3Y A;  2H2K A;  1NUB A;  1XFZ O;  2Y4Q A;  1OMV A;  1CDM A;  1YR5 A;  4PE7 A;  1YRT B;  3JTD B;  3WHU B;  4CLN A;  2ZN9 A;  3EK7 A;  1K9P A;  1K9K A;  1MUX A;  1CM4 A;  1LKJ A;  3I5H C;  1C07 A;  2R2I A;  4A4C A;  4YBH B;  3SJS A;  2BCB A;  1PVB A;  4OV2 A;  3PLF B;  2MLF C;  1NX3 A;  2LLU A;  3DVM A;  2KAX A;  3OX5 A;  4PE1 A;  2BE4 A;  2AAO A;  3EVV A;  1ALV A;  5F6T A;  1G4Y R;  1EH2 A;  1CFD A;  2LP3 A;  2KI6 D;  5KTY A;  1S36 A;  1R2U A;  3SG5 A;  1KK7 Z;  4NDD A;  2L51 A;  1XYD A;  1SL8 A;  2BBM A;  1B8L A;  1DJG A;  2WCE A;  3A8R A;  5BPJ A;  2OTG C;  2BBN A;  2WND A;  1AK8 A;  2K7D A;  1KK8 B;  2FCD A;  3EK4 A;  1TRF A;  3BUM B;  1YX8 A;  2LC5 A;  1QLK A;  2AUC A;  1U5I B;  3JVT B;  4C0J A;  1M46 A;  3LK1 A;  3D0Y B;  5D7F A;  1CFF A;  2OS8 C;  3VGO A;  1J7Q A;  1TIZ A;  3FWB A;  1B4C A;  1CLL A;  1A75 A;  1LIN A;  3TZ1 A;  5K89 A;  2LM5 A;  4GGN A;  5CSI A;  2CXJ A;  1GGZ A;  5DKN A;  4NQG A;  1KFX L;  2KSP A;  3I5H B;  2GV5 A;  2CBL A;  3O2P A;  2SAS A;  1PVA A;  4OKH A;  1A75 B;  4ETO A;  1CFP A;  4CPV A;  1GGW A;  2BCX A;  1Y1A A;  2LAN A;  1ZAC A;  4NDC A;  1XFV O;  3WNX B;  1MXL C;  3BOW A;  2H61 A;  2JNX A;  3O4Y A;  4M2O A;  4JPZ B;  4M2Q A;  5HKZ A;  1CTR A;  1QVI Z;  3AAJ A;  3WHT B;  3KPX A;  4GBA A;  4JWQ A;  1S5G Y;  2KI6 C;  1CMG A;  4QJ3 B;  1BG1 A;  2MLE C;  1CDP A;  3F45 A;  1SNL A;  4MZK A;  1UHN A;  1Y0V H;  1QTX A;  1KQM C;  1OMR A;  1UHH A;  3DF0 B;  1FI6 A;  2OTG B;  1BT6 A;  5CSF A;  1TCO B;  3BYA A;  1BOD A;  3BXK A;  4PAL A;  1XFY O;  2WOR A;  1L7Z A;  1LA0 A;  1SCM C;  3PN7 C;  2HQ8 A;  5G08 A;  2BKI B;  1Y1X A;  2VRG A;  3LL8 B;  2BL0 B;  1WRK A;  1OOJ A;  2JT3 A;  2A4J A;  1IWQ A;  3CGA A;  4YI8 A;  1RTP 1;  1DVI A;  5JOL A;  3SG2 A;  3NXA A;  1SY9 A;  2ZN8 A;  2BE6 A;  1KFU L;  1CNP A;  1S26 D;  5KU1 A;  1YUU A;  3SIA A;  1NCX A;  1LA3 A;  1A2X A;  2JXC A;  1HT9 A;  1M45 A;  5HYD A;  1B8R A;  1TCF A;  1KWO B;  1UUR A;  2Q91 A;  4NDB A;  1WLZ A;  2KQY A;  2MAZ A;  2M29 A;  3PSR A;  1CLM A;  2MA2 A;  1S6I A;  1NSH A;  2M1U A;  1B9A A;  1REC A;  2G2B A;  1AVS A;  1OQP A;  4PHN A;  5PAL A;  4BY5 A;  1AHR A;  2WC8 A;  1BJF A;  1QX5 B;  1W7J B;  3PAL A;  2LAP A;  4OR9 B;  2EC6 C;  4PDZ A;  4YRU A;  4ORA B;  2KQ6 A;  1PRW A;  4F0Z B;  2L2E A;  1J7R A;  4PCW A;  2GGZ A;  1WRL A;  5ER5 A;  1ODB A;  3PAT A;  1IQ3 A;  1MF8 B;  3PM8 A;  4I5K A;  1K8U A;  1YTZ C;  3AAK A;  1M39 A;  4ZCV A;  1PSB A;  1TOP A;  1EXR A;  4GNK B;  2BCA A;  2EHB A;  2PSR A;  5I2L A;  2LLT A;  2MJW B;  1QX2 A;  1CKK A;  3I5I C;  1YUS A;  3FWC A;  1TNQ A;  1WY9 A;  3FIA A;  1F8H A;  1H4B A;  3SIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...