2WCBA

S100a12 complex with zinc in the absence of calcium
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
STKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN S100-A12
publication title The Crystal Structures of Human S100A12 in Apo Form and in Complex with Zinc: New Insights Into S100A12 Oligomerisation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 36
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2wcbA00
4OR9B 1J7OA 3DF0A 4DS7A 4QJ4B 2FJUB 2JT3A 3BOWA 2BCAA 2EC6B 5J3XA 3CR5X 2KFFA 1F70A 1QV1A 1CLLA 2K8MB 4HSZA 3OX5A 1DT7B 1NP8A 4NDCA 1IQ3A 2CCMA 5ER4X 1IQ5A 1G8IA 2CT9A 1DTLA 1XFUO 4ICBA 1BU3A 2LVVA 3LK1A 1IG5A 4N1GA 4FQOA 1YUTA 3RM1A 4L9MA 5G08A 3VROA 4YGBB 2JNXA 4TNCA 2NCPA 1AP4A 1H8BA 2NZ0A 4CIDA 2SCPA 1RROA 2LVIA 2JULA 1D1OA 1BJFA 1KK7Y 1QX5B 4PDZA 2ZFDA 1K94A 3NXAA 4C0KA 1CKKA 2HETA 1BR1B 3NSIA 4NDBA 2MAZA 1DJIA 1S36A 1DJGA 4PALA 1IWQA 2EHBA 2IS9A 2O5GA 4XJKB 1LINA 2GV5A 2WOSA 2Y4QA 3BUMB 1QTXA 3JVTB 1SCMB 1XK4A 1FF1A 1TIZA 3NSKA 1G4YR 4JQ0D 1OMRA 1FI6A 1QV0A 1EG4A 1XFZO 1Y0VH 1DJXA 1S3PA 1TRFA 3SG3A 5AANA 1RECA 3GK2A 5GQQC 1BMOA 1DGVA 1U5IB 1OMVA 3TZ1A 2MHHA 1SYMA 2Q4UA 3GOFA 1EXRA 1YRTB 5AXIA 1Q80A 5HLVA 5TNCA 4YBHB 1R6PA 2KNEA 3JTDB 2LMTA 1DGUA 1CMGA 1KQVA 1KQMB 3TUYB 3SG6A 5I2OA 1MQ1A 3HCMA 5DKNA 1MWNA 1JF2A 1WDCC 2OTGB 1B8LA 1K9UA 2JQ6A 1C7WA 3PN7B 1NPQA 1CFDA 3KO0A 2LLSA 2K7DA 1W7JB 2M3WA 1NX0A 2I18A 2K7CA 2WC8A 5DKQA 2KAYA 4PCWA 1F54A 2JZIA 4NQGA 5FYXA 1J7PA 3EK7A 1CLMA 1QVIZ 3GK4X 3KF9A 1UHIA 5K89A 1LKJA 2KI6D 4I5NB 1FW4A 1UHKA 2WNDA 2E30A 1CTRA 2H61C 1YRUB 2JTZA 1JWDA 3VRRA 2ZNEA 5I8NA 3QRXA 3GK1A 2L50A 2Q91A 1S6IA 1CNPA 1BR4B 1QX2A 1BT6A 1XVJA 2MLEC 4E68A 4ZCVA 1SMGA 1LXFC 2ZN9A 3DF0B 1NCYA 4P2YB 1KFXL 1WRKA 3SG5A 3BOWB 1AK8A 4GPLB 2G2BA 3PALA 1C7VA 1ODBA 1B8RA 3EVUA 1SPYA 4I5LB 3HX4A 1JFJA 3OX6A 1SCVA 1B47A 4OVNF 1QXPA 1K96A 1OSAA 1TNPA 2JT8A 4PE7A 1CFPA 2I7AA 1S1EA 4QJ5B 1K95A 4GFTA 2M7NA 5KU1A 1Y1UA 1FI5A 1RTP1 3DD4A 4N1FA 4MZLA 4IL1A 1YTZC 2O60A 1DJWA 2PMYA 1UURA 1DJZA 5AERA 2L4IA 1YUSA 1A4PA 4CLNA 1WLMA 2BBNA 2R2IA 4WRIA 2F3ZA 1LA0A 3JVTC 1SCMC 2V53A 5HKZA 1OMDA 3AKAA 1BLQA 5BPJA 2OS8C 1JUOA 1N2DA 2E6WA 2F3YA 3SG7A 3TDUA 3MSEB 3I5FB 2KGRA 2MBXA 1ALVA 2KAVA 3M0WA 3PLFB 4XYNA 1KWOC 3CWGA 1KK7Z 3SIAA 1RJVA 3LK0A 2AUCA 4MBEA 5CSIA 3ICBA 5PALA 1CFFA 2JU0A 2P6BB 1M39A 1K90D 2JT0A 4OCIA 1AUIB 2L98A 2WCFA 3I5IB 5AEQA 1JC2A 4PHNA 4OV2A 1QASA 1WRZA 1ZOTB 1GJYA 1QX7A 3CTNA 1UUSA 1KQMC 1M45A 3FS7A 3TS5B 1CM4A 3TUYC 5CSJA 5AFPA 1YVLA 1J1EA 1NSHA 3I5HC 2HPSA 2OTGC 4GGFC 1B9AA 1N65A 3F45A 1A29A 1J1DA 1W7IB 1XFWO 1TNWA 2LC5A 3PN7C 2JXCA 4MZKA 4JWQA 1QIVA 1M46A 2LCPA 1MUXA 2LVKA 5HLOA 1ZFSA 1A2XA 1QLSA 2KGBC 2KQ6A 1B1GA 1R2UA 3LL8B 5KSZA 2HQ8A 4YGCB 1KFUL 2WORA 1XO5A 3BUOB 1TCFA 1SL7A 1J55A 2CTNA 2F33A 1MXEA 2Y1MA 1K9KA 2TN4A 2KI4C 3NSLA 1TTXA 2LP2A 2F2PA 3BUNB 2MLFC 1SRAA 3CZTX 1JSAA 2MJWB 4YGAA 1L7ZA 4DCKA 1GGWA 2WCBA 1E8AA 3VRNA 3IF7A 1BODA 2LLTA 4ZCUA 2MA2A 1IJ5A 3K21A 5CSNA 2FOTA 1WRLA 2ZNDA 1NCZA 4GNKB 1CDNA 5ER5A 4CPVA 5B8IB 2EGDA 2LUXA 1SL8A 2M1UA 2KAXA 3AAJA 4FTGA 1V1GA 2BCXA 4A4CA 1IGVA 2BE6A 5JOLA 3D0YA 2PASA 3FWBA 2M29A 2GGZA 2DOQA 1RFJA 3KHEA 1BG1A 2M49B 1HT9A 1YR5A 1RK9A 1JFKA 2BL0B 2JPTA 4AQJA 3DVJA 1MR8A 1DJYA 2LAPA 2K0JA 1K9PA 4MSPA 2JNFA 2Y1NA 1ZUZA 2K7OA 1MHOA 2Y5IA 1QJTA 2EC6C 1MF8B 4F0ZB 3DVMA 2LHLA 4MLWA 3PSRA 1EJ3A 2L5XB 1NIWA 4AOMA 3E3RA 2LV7A 1JBAA 1CDPA 3PATA 1QATA 4HRGA 3EK4A 1L2OB 4MVFA 3BXKA 2A4JA 3I5IC 1PVAA 4NDDA 3TDZA 2H2KA 3O78A 5DKRA 1CDMA 1TCOB 3IQQA 1SL9A 4MRYA 4OKHA 1CM1A 1JF0A 3BUXB 2KI6C 3LLEA 2M8UA 3DVEA 4MEWA 2QPTA 1EL4A 2L51A 1DJHA 1G33A 2JC2A 2OPOA 4GAOA 4ORBB 1J7QA 4PE1A 1OZSA 1OOJA 1SNLA 4YGDB 2AMIA 2CBLA 1PK0D 2KHNA 1ZACA 2LE9B 1AJ5A 2BECA 1X02A 3EK8A 4YGEB 1ALWA 1NWDA 1KFXS 4JPZB 1A75A 1FBVA 1J7RA 2PVBA 4BY5A 1PSRA 4HRHA 3SG2A 2D8NA 3OHMB 1S5GY 2M97A 2KOTA 2JXLA 2L4HA 2KBIA 2LUCA 1SK6D 2LHIA 5I2QA 1ZMZA 4M2QA 1SBJA 1NX1A 1QIWA 1UHJA 3BUWB 3DVKA 1KSOA 2HF5A 3WXAA 2ZRSA 5JJGA 2G9BA 3KEVA 4N5XA 4MRXA 1PULA 1K2HA 4YI8A 4GGNA 2GGMA 1EH2A 1KK8B 3AAKA 2JWWA 2LVJA 3LCPC 1A03A 3JTDC 1B7TY 1DF0A 1F8HA 3H4SE 4PE0A 4CFRA 1CDLA 3IQOA 2I94A 5KTYA 1S6CA 1SKTA 2KFHA 1NYAA 1DMOA 1YX8A 1AVSA 3VRPA 1SR6B 1IH0A 5CSFA 1KCYA 1WY9A 3OP0A 1QS7A 4PE4A 3SJSA 5IBWA 4A4BA 3PFVA 2BL0C 4CFQA 3KPXA 1NX3A 1Y6WA 1M31A 4C0LA 1CB1A 1F71A 2ZRTA 3PM8A 3O6BA 1B8CA 2BE4A 3FIAA 3D0YB 5I2LA 1GQMA 1M63B 2FCDA 2LLUA 2ZKMX 4DRWA 1B4CA 1XA5A 3C1VA 1IRJA 1CLBA 2FCEA 3FWCA 4HREE 1UHHA 3CR4X 1C07A 4DIRA 1F4OA 1TNQA 3WHUB 3EVVA 1CMFA 3TDIA 2CXJA 4I5JA 1NX2A 1PVBA 2LMUA 3EKHA 4WQ3A 1UWOA 2H61A 5D69A 1L2OC 1AHRA 4BY4A 2VRGA 3BQ3A 3EVRA 3I5GB 2WCEA 2M9GA 2I2RE 4M2PA 3SIBA 1IKUA 1KFUS 1PALA 2L0PA 2M1KB 4Q04A 1V1FA 2OS8B 3AKBA 4MN0A 1HQVA 2LM5A 1S26D 4AQIA 3WHTB 1F55A 1KWOB 5HYDA 1YX7A 2LP3A 2LNKA 4GBAA 3SG4A 2KQYA 4R1EA 1N0YA 2CNPA 2JRFA 1K93D 1XFYO 3EKJA 1SW8A 3CLNA 1K8UA 2AAOA 1LA3A 3OB1B 1LVCD 2KYCA 1CFCA 1TNXA 3VRQA 4I5KA 1KSMA 3ZNIA 5HKYA 1RWYA 3WNXB 2KFGA 3I5FC 2K2AA 2L2EA 4PHJA 1UP5A 2ZN8A 3I5HB 2QACA 4UPGA 3CR2A 4XJKA 2JTTA 5F6TA 4YRUA 1QLKA 4YI9A 1TN4A 3VGOA 1A75B 4USLA 1NUBA 3ZWHA 1AJ4A 2KBMA 1XK4C 2KDHA 4U8DA 1F4QA 1EG3A 4D1EA 2SASA 2COLB 4MZJA 2NLNA 2BCBA 4PHKA 2KYFA 1KK8C 3D10A 4M2OA 5D7FA 1BOCA 4ORAB 1S5GZ 5HKWA 1XFXO 2B1UA 1U5IA 2F2OA 3O4YA 2PRUA 1FPWA 2F8PA 2M7LA 3A4UB 1YVHA 1OQPA 2JOJA 3TS5C 2LMVA 1SR6C 2KI4B 2MRDA 2PSRA 1MXLC 2BBMA 4GUKA 1DF0B 3CGAA 2ISDA 4WQ2A 1SY9A 4GGFA 1PRWA 1XFVO 1B7TZ 2K61A 2RGIA 2HQWA 2M0RA 1VRKA 2PALA 1BF5A 1NCXA 4C0JA 1UHNA 2NCOA 1DVIA 1WLZA 1QVIY 2K7BA 1Y1AA 4QJ3B 1S6JA 1IJ6A 1OZOA 2BKHB 1XYDA 1OE9B 4PHMA 2KSPA 3A8RA 1GGZA 3NSOA 1TOPA 1WDCB 3BYAA 3CS1A 3OB2B 2BKIB 4ORCB 1YUUA 1PSBA 3O2PA 2LANA 1Y1XA 1H4BA 4ETOA 3RLZA 2K2FA 3I5GC 4DUQA 1YURA 4P5OE 5CPVA 2NXQA
chains in the Genus database with same CATH superfamily
4OR9B 1C3ZA 1J7OA 3DF0A 4DS7A 4QJ4B 2FJUB 2JT3A 3BOWA 2BCAA 2EC6B 5J3XA 3CR5X 2KFFA 1F70A 3OBVA 1QV1A 1CLLA 1XFRA 2K8MB 3FE8A 3CZ2A 3OX5A 3QMEA 4HSZA 1NP8A 4NDCA 3UO9A 5DICA 1DT7B 1IQ3A 2CCMA 5ER4X 1IQ5A 1G8IA 2CT9A 1DTLA 1XFUO 4ICBA 1BU3A 1LS8A 2LVVA 3LK1A 1IG5A 3BFHA 4N1GA 4FQOA 1YUTA 3RM1A 4L9MA 5G08A 2QEBA 3VROA 4YGBB 2JNXA 2BNXA 4TNCA 5I94A 2NCPA 3D77A 1OOGA 1IIOA 1AP4A 1H8BA 2NZ0A 4CIDA 2SCPA 1RROA 2LVIA 4IJ7A 2JULA 1D1OA 1BJFA 1KK7Y 1QX5B 3PJIA 4PDZA 2ZFDA 1K94A 3NXAA 4C0KA 1CKKA 2HETA 1BR1B 3NSIA 4NDBA 2MAZA 1DJIA 1S36A 1DJGA 4PALA 1IWQA 2EHBA 2IS9A 2O5GA 4XJKB 1LINA 2GV5A 2WOSA 2Y4QA 3BUMB 1QTXA 3JVTB 1SCMB 1XK4A 1FF1A 1TIZA 3NSKA 1G4YR 4JQ0D 1OMRA 1FI6A 1QV0A 2QEVA 1EG4A 1XFZO 1Y0VH 1DJXA 1S3PA 1TRFA 3SG3A 2BAPA 5AANA 1RECA 3GK2A 5GQQC 1BMOA 4F7FA 1DGVA 1U5IB 3S0DA 1OMVA 3TZ1A 4KYNA 2KPHA 2MHHA 1SYMA 2Q4UA 3GOFA 1EXRA 1YRTB 5AXIA 1Q80A 5HLVA 3O4XA 5TNCA 3S0AA 4YBHB 2WCMA 1R6PA 2KNEA 1DQEA 3JTDB 2LMTA 1DGUA 1CMGA 1KQVA 1KQMB 3TUYB 3SG6A 5I2OA 3DZTA 1MQ1A 3HCMA 5DKNA 1MWNA 1JF2A 1WDCC 2OTGB 1B8LA 1K9UA 2JQ6A 1C7WA 3PN7B 1NPQA 1CFDA 3KO0A 2LLSA 2K7DA 1W7JB 2M3WA 1NX0A 2I18A 2K7CA 2WC8A 5DKQA 2KAYA 4PCWA 1F54A 2JZIA 4NQGA 5FYXA 1J7PA 3EK7A 1CLMA 1QVIZ 2QDIA 3GK4X 3KF9A 1UHIA 5K89A 1LKJA 2KI6D 4I5NB 1FW4A 1UHKA 2WNDA 1SSEB 2E30A 1CTRA 2JPOA 2H61C 1YRUB 2JTZA 1JWDA 3VRRA 2ZNEA 5I8NA 3QRXA 2PQLA 3GK1A 2L50A 2Q91A 3L4LA 1S6IA 3Q8IA 1CNPA 1BR4B 1QX2A 1BT6A 1XVJA 2MLEC 4E68A 3D75A 3B86A 1SMGA 4ZCVA 1LXFC 2ZN9A 3DF0B 1NCYA 3NHTA 4P2YB 1KFXL 1WRKA 3SG5A 3BOWB 1AK8A 4GPLB 2G2BA 3PALA 1C7VA 1ODBA 1B8RA 3EVUA 1SPYA 4I5LB 3HX4A 1JFJA 3OX6A 3BFBA 1SCVA 1B47A 4OVNF 1QXPA 2QEOA 1K96A 1OSAA 1TNPA 2JT8A 3BJHA 4PE7A 2I7AA 1CFPA 3OGNA 1S1EA 4QJ5B 1K95A 4GFTA 2M7NA 5KU1A 1Y1UA 1FI5A 1RTP1 3DD4A 4N1FA 4MZLA 4IL1A 1YTZC 2O60A 1DJWA 2PMYA 1UURA 1DJZA 5AERA 2L4IA 1YUSA 1A4PA 4CLNA 1WLMA 2BBNA 2R2IA 4WRIA 1P28A 2F3ZA 1LA0A 3JVTC 1SCMC 2V53A 3BFAA 1OMDA 3AKAA 5HKZA 1BLQA 5BPJA 2OS8C 1JUOA 1N2DA 2E6WA 2F3YA 3CZ0A 3N7HA 3MSEB 3SG7A 3I5FB 3TDUA 2KGRA 2MBXA 1ALVA 2KAVA 3M0WA 3PLFB 4XYNA 3V2LA 1KWOC 3CWGA 1OOFA 1KK7Z 2KLDA 3SIAA 1RJVA 3LK0A 2AUCA 4MBEA 5CSIA 3ICBA 5PALA 1CFFA 3L4AA 2JU0A 2P6BB 1M39A 1K90D 2JT0A 4OCIA 1AUIB 2L98A 2WC5A 3NGVA 2WCFA 3I5IB 5AEQA 1JC2A 4PHNA 4OV2A 3EG5B 1QASA 3SS4A 1WRZA 1ZOTB 1GJYA 1QX7A 2P70A 1UUSA 1KQMC 1M45A 3CTNA 3FS7A 3SS3A 1CM4A 3TS5B 3TUYC 5CSJA 5AFPA 1YVLA 1J1EA 4FQTA 1NSHA 3I5HC 2HPSA 2OTGC 4GGFC 1B9AA 1N65A 3DYEA 3F45A 1A29A 1J1DA 1W7IB 1XFWO 1TNWA 2LC5A 3PN7C 2JXCA 4MZKA 4JWQA 1QIVA 1M46A 2LCPA 1MUXA 2LVKA 5HLOA 1ZFSA 1A2XA 1QLSA 2KGBC 2KQ6A 1B1GA 1R2UA 3LL8B 5KSZA 2HQ8A 4YGCB 1KFUL 2WORA 1XO5A 3BUOB 1TCFA 1SL7A 1J55A 2CTNA 3L47A 2F33A 1MXEA 2Y1MA 1K9KA 2TN4A 2KI4C 3NSLA 5FI7A 1TTXA 2LP2A 3RZSA 2F2PA 3BUNB 2MLFC 1SRAA 3CZTX 1JSAA 1TUJA 2MJWB 4YGAA 1L7ZA 2QEHA 4DCKA 1GGWA 2WCBA 1E8AA 3VRNA 3IF7A 1BODA 2LLTA 4ZCUA 2MA2A 1IJ5A 1OW4A 3K21A 2FOTA 5CSNA 1WRLA 2ZNDA 4INXA 1NCZA 4GNKB 1CDNA 5ER5A 4CPVA 5B8IB 2EGDA 2LUXA 1T14A 2WC6A 1SL8A 2M1UA 4PT1A 2KAXA 3AAJA 4FTGA 1V1GA 2BCXA 4A4CA 1IGVA 2BE6A 5JOLA 3D0YA 2PASA 3FWBA 2M29A 5FI6A 2GGZA 2DOQA 1RFJA 3KHEA 1BG1A 2M49B 1HT9A 1YR5A 1RK9A 1JFKA 2BL0B 2JPTA 2WCKA 4AQJA 3R72A 3DVJA 3R1VA 1MR8A 1DJYA 2LAPA 3NHIA 2K0JA 1K9PA 3R1PA 4MSPA 2JNFA 3D78A 2Y1NA 1ZUZA 2K7OA 1MHOA 2Y5IA 3VB1A 1QJTA 1Z4HA 1MF8B 2EC6C 2K60A 1C3YA 4F0ZB 3DVMA 2LHLA 4MLWA 3PSRA 1EJ3A 2L5XB 1NIWA 4AOMA 3E3RA 2LV7A 1JBAA 1CDPA 3PATA 1QATA 4HRGA 3EK4A 1L2OB 4MVFA 3BXKA 2A4JA 3I5IC 1PVAA 4NDDA 3TDZA 2H2KA 3O78A 2P71A 5DKRA 1CDMA 1TCOB 3CABA 3IQQA 1SL9A 4MRYA 2YGUA 1CM1A 4OKHA 1JF0A 3BUXB 2KI6C 3LLEA 2H8VA 2M8UA 3DVEA 2WCHA 4MEWA 2QPTA 1EL4A 2L51A 1DJHA 1G33A 2JC2A 2OPOA 4GAOA 4ORBB 1J7QA 3CDNA 4PE1A 1OZSA 1OOJA 1SNLA 4YGDB 2AMIA 2CBLA 1PK0D 2KHNA 1ZACA 2LE9B 2ERBA 1TUZA 1AJ5A 2BECA 1X02A 3EK8A 3DXLA 4YGEB 1ALWA 1NWDA 1KFXS 4JPZB 1A75A 1FBVA 1J7RA 2PVBA 3B88A 4BY5A 1PSRA 4HRHA 3PM2A 2D8NA 3DY9A 3OHMB 3SG2A 1S5GY 2M97A 2KOTA 2JXLA 2L4HA 2KBIA 2LUCA 1SK6D 2LHIA 5I2QA 1ZMZA 2WCLA 4M2QA 1SBJA 1NX1A 1QIWA 1UHJA 3BUWB 3DVKA 5D3OA 1KSOA 2HF5A 3WXAA 2ZRSA 5JJGA 2G9BA 1OOHA 3K1EA 3KEVA 4N5XA 4MRXA 1PULA 2L2CA 4YI8A 1K2HA 4GGNA 2GGMA 1EH2A 1KK8B 2KLEA 3AAKA 2JWWA 3CYZA 2LVJA 3LCPC 1A03A 3JTDC 1B7TY 1DF0A 1F8HA 3H4SE 4PE0A 4CFRA 1CDLA 3IQOA 2I94A 5KTYA 1S6CA 1SKTA 2KFHA 1NYAA 1DMOA 1YX8A 1AVSA 3S0EA 1SR6B 3VRPA 1IH0A 1ORGA 4JD9A 3B6XA 5CSFA 1KCYA 1WY9A 3OP0A 1QS7A 4PE4A 3SJSA 5IBWA 4A4BA 3PFVA 2BL0C 3D76A 4CFQA 3KPXA 1NX3A 1Y6WA 1M31A 3D73A 4C0LA 1CB1A 1F71A 2ZRTA 3PM8A 3O6BA 1B8CA 2BE4A 1QWVA 3D0YB 3FIAA 5I2LA 1GQMA 1M63B 2FCDA 2LLUA 2ZKMX 4DRWA 1B4CA 1XA5A 3B7AA 3FE9A 3C1VA 1IRJA 1CLBA 2FCEA 3FWCA 4HREE 1UHHA 3CR4X 1C07A 4OZDA 4DIRA 1F4OA 1TNQA 3WHUB 3EVVA 1CMFA 3TDIA 3S0BA 1TWOA 2CXJA 4I5JA 1NX2A 3SS5A 1PVBA 2LMUA 3EKHA 4WQ3A 1UWOA 2H61A 5D69A 1L2OC 1AHRA 4BY4A 2VRGA 3BQ3A 3EVRA 3I5GB 2WCEA 2M9GA 1DEKA 2I2RE 3R1OA 4M2PA 3SIBA 1IKUA 1KFUS 1PALA 2L0PA 2M1KB 4Q04A 1V1FA 2OS8B 3B87A 5EL2A 3S0GA 3AKBA 4MN0A 1HQVA 2LM5A 1S26D 4AQIA 3WHTB 5FI2A 1F55A 1KWOB 5HYDA 1YX7A 2LP3A 2LNKA 4GBAA 3SG4A 2KQYA 4R1EA 5HL1A 1N0YA 2CNPA 2JRFA 1K93D 1XFYO 3EKJA 1SW8A 4INWA 3CLNA 3D74A 1K8UA 2AAOA 1LA3A 3OB1B 1LVCD 2KYCA 1CFCA 1TNXA 3VRQA 4I5KA 1KSMA 3ZNIA 5HKYA 1DELA 1RWYA 3WNXB 2KFGA 3I5FC 2K2AA 2L2EA 4PHJA 1UP5A 2ZN8A 3I5HB 2QACA 4UPGA 3CR2A 2WCJA 4XJKA 2JTTA 2PYQA 5F6TA 4YRUA 1QLKA 4YI9A 1TN4A 3VGOA 1A75B 4USLA 1NUBA 3ZWHA 1AJ4A 2KBMA 1XK4C 2KDHA 4U8DA 1F4QA 1DC1A 1EG3A 4D1EA 2SASA 2COLB 4MZJA 2NLNA 2BCBA 4PHKA 2KYFA 1KK8C 3D10A 4M2OA 5D7FA 1BOCA 4ORAB 1S5GZ 5HKWA 1XFXO 2GTEA 2B1UA 1U5IA 2F2OA 3O4YA 2PRUA 3S0FA 1FPWA 2F8PA 2M7LA 3A4UB 1YVHA 1OQPA 2JOJA 3TS5C 4JKTA 2LMVA 1SR6C 2KI4B 2MRDA 2PSRA 1MXLC 2L5YA 2BBMA 4GUKA 4PHMA 1DF0B 3CGAA 1GM0A 2ISDA 4WQ2A 3UNWA 1SY9A 4GGFA 1PRWA 1XFVO 1B7TZ 2K61A 2RGIA 2HQWA 2M0RA 1VRKA 2PALA 1W9ZA 1BF5A 1NCXA 4C0JA 1UHNA 2NCOA 1DVIA 1WLZA 1QVIY 2K7BA 1Y1AA 4QJ3B 1S6JA 1IJ6A 1OZOA 2BKHB 1XYDA 1OE9B 1OOIX 2KSPA 3A8RA 1GGZA 3NSOA 1TOPA 1WDCB 1Z2CB 3BYAA 3CS1A 3FE6A 3CZ1A 3OB2B 2BKIB 4ORCB 2FJYA 1YUUA 1PSBA 3O2PA 2LANA 1Y1XA 1H4BA 4ETOA 3RLZA 2K2FA 3I5GC 3IVTA 4DUQA 1YURA 4P5OE 5CPVA 2NXQA
chains in the Genus database with same CATH topology
4OR9B 1J7OA 3DF0A 4DS7A 4QJ4B 2FJUB 2JT3A 3BOWA 2BCAA 2EC6B 5J3XA 3CR5X 2KFFA 1F70A 1QV1A 1CLLA 2K8MB 4HSZA 3OX5A 1DT7B 1NP8A 4NDCA 1IQ3A 2CCMA 5ER4X 1IQ5A 1G8IA 2CT9A 1DTLA 1XFUO 4ICBA 1BU3A 2LVVA 3LK1A 1IG5A 4N1GA 4FQOA 1YUTA 3RM1A 4L9MA 5G08A 3VROA 4YGBB 2JNXA 4TNCA 2NCPA 1AP4A 1H8BA 2NZ0A 4CIDA 2SCPA 1RROA 2LVIA 2JULA 1D1OA 1BJFA 1KK7Y 1QX5B 4PDZA 2ZFDA 1K94A 3NXAA 4C0KA 1CKKA 2HETA 1BR1B 3NSIA 4NDBA 2MAZA 1DJIA 1S36A 1DJGA 4PALA 1IWQA 2EHBA 2IS9A 2O5GA 4XJKB 1LINA 2GV5A 2WOSA 2Y4QA 3BUMB 1QTXA 3JVTB 1SCMB 1XK4A 1FF1A 1TIZA 3NSKA 1G4YR 4JQ0D 1OMRA 1FI6A 1QV0A 1EG4A 1XFZO 1Y0VH 1DJXA 1S3PA 1TRFA 3SG3A 5AANA 1RECA 3GK2A 5GQQC 1BMOA 1DGVA 1U5IB 1OMVA 3TZ1A 2MHHA 1SYMA 2Q4UA 3GOFA 1EXRA 1YRTB 5AXIA 1Q80A 5HLVA 5TNCA 4YBHB 1R6PA 2KNEA 3JTDB 2LMTA 1DGUA 1CMGA 1KQVA 1KQMB 3TUYB 3SG6A 5I2OA 1MQ1A 3HCMA 5DKNA 1MWNA 1JF2A 1WDCC 2OTGB 1B8LA 1K9UA 2JQ6A 1C7WA 3PN7B 1NPQA 1CFDA 3KO0A 2LLSA 2K7DA 1W7JB 2M3WA 1NX0A 2I18A 2K7CA 2WC8A 5DKQA 2KAYA 4PCWA 1F54A 2JZIA 4NQGA 5FYXA 1J7PA 3EK7A 1CLMA 1QVIZ 3GK4X 3KF9A 1UHIA 5K89A 1LKJA 2KI6D 4I5NB 1FW4A 1UHKA 2WNDA 2E30A 1CTRA 2H61C 1YRUB 2JTZA 1JWDA 3VRRA 2ZNEA 5I8NA 3QRXA 3GK1A 2L50A 2Q91A 1S6IA 1CNPA 1BR4B 1QX2A 1BT6A 1XVJA 2MLEC 4E68A 4ZCVA 1SMGA 1LXFC 2ZN9A 3DF0B 1NCYA 4P2YB 1KFXL 1WRKA 3SG5A 3BOWB 1AK8A 4GPLB 2G2BA 3PALA 1C7VA 1ODBA 1B8RA 3EVUA 1SPYA 4I5LB 3HX4A 1JFJA 3OX6A 1SCVA 1B47A 4OVNF 1QXPA 1K96A 1OSAA 1TNPA 2JT8A 4PE7A 1CFPA 2I7AA 1S1EA 4QJ5B 1K95A 4GFTA 2M7NA 5KU1A 1Y1UA 1FI5A 1RTP1 3DD4A 4N1FA 4MZLA 4IL1A 1YTZC 2O60A 1DJWA 2PMYA 1UURA 1DJZA 5AERA 2L4IA 1YUSA 1A4PA 4CLNA 1WLMA 2BBNA 2R2IA 4WRIA 2F3ZA 1LA0A 3JVTC 1SCMC 2V53A 5HKZA 1OMDA 3AKAA 1BLQA 5BPJA 2OS8C 1JUOA 1N2DA 2E6WA 2F3YA 3SG7A 3TDUA 3MSEB 3I5FB 2KGRA 2MBXA 1ALVA 2KAVA 3M0WA 3PLFB 4XYNA 1KWOC 3CWGA 1KK7Z 3SIAA 1RJVA 3LK0A 2AUCA 4MBEA 5CSIA 3ICBA 5PALA 1CFFA 2JU0A 2P6BB 1M39A 1K90D 2JT0A 4OCIA 1AUIB 2L98A 2WCFA 3I5IB 5AEQA 1JC2A 4PHNA 4OV2A 1QASA 1WRZA 1ZOTB 1GJYA 1QX7A 3CTNA 1UUSA 1KQMC 1M45A 3FS7A 3TS5B 1CM4A 3TUYC 5CSJA 5AFPA 1YVLA 1J1EA 1NSHA 3I5HC 2HPSA 2OTGC 4GGFC 1B9AA 1N65A 3F45A 1A29A 1J1DA 1W7IB 1XFWO 1TNWA 2LC5A 3PN7C 2JXCA 4MZKA 4JWQA 1QIVA 1M46A 2LCPA 1MUXA 2LVKA 5HLOA 1ZFSA 1A2XA 1QLSA 2KGBC 2KQ6A 1B1GA 1R2UA 3LL8B 5KSZA 2HQ8A 4YGCB 1KFUL 2WORA 1XO5A 3BUOB 1TCFA 1SL7A 1J55A 2CTNA 2F33A 1MXEA 2Y1MA 1K9KA 2TN4A 2KI4C 3NSLA 1TTXA 2LP2A 2F2PA 3BUNB 2MLFC 1SRAA 3CZTX 1JSAA 2MJWB 4YGAA 1L7ZA 4DCKA 1GGWA 2WCBA 1E8AA 3VRNA 3IF7A 1BODA 2LLTA 4ZCUA 2MA2A 1IJ5A 3K21A 5CSNA 2FOTA 1WRLA 2ZNDA 1NCZA 4GNKB 1CDNA 5ER5A 4CPVA 5B8IB 2EGDA 2LUXA 1SL8A 2M1UA 2KAXA 3AAJA 4FTGA 1V1GA 2BCXA 4A4CA 1IGVA 2BE6A 5JOLA 3D0YA 2PASA 3FWBA 2M29A 2GGZA 2DOQA 1RFJA 3KHEA 1BG1A 2M49B 1HT9A 1YR5A 1RK9A 1JFKA 2BL0B 2JPTA 4AQJA 3DVJA 1MR8A 1DJYA 2LAPA 2K0JA 1K9PA 4MSPA 2JNFA 2Y1NA 1ZUZA 2K7OA 1MHOA 2Y5IA 1QJTA 2EC6C 1MF8B 4F0ZB 3DVMA 2LHLA 4MLWA 3PSRA 1EJ3A 2L5XB 1NIWA 4AOMA 3E3RA 2LV7A 1JBAA 1CDPA 3PATA 1QATA 4HRGA 3EK4A 1L2OB 4MVFA 3BXKA 2A4JA 3I5IC 1PVAA 4NDDA 3TDZA 2H2KA 3O78A 5DKRA 1CDMA 1TCOB 3IQQA 1SL9A 4MRYA 4OKHA 1CM1A 1JF0A 3BUXB 2KI6C 3LLEA 2M8UA 3DVEA 4MEWA 2QPTA 1EL4A 2L51A 1DJHA 1G33A 2JC2A 2OPOA 4GAOA 4ORBB 1J7QA 4PE1A 1OZSA 1OOJA 1SNLA 4YGDB 2AMIA 2CBLA 1PK0D 2KHNA 1ZACA 2LE9B 1AJ5A 2BECA 1X02A 3EK8A 4YGEB 1ALWA 1NWDA 1KFXS 4JPZB 1A75A 1FBVA 1J7RA 2PVBA 4BY5A 1PSRA 4HRHA 3SG2A 2D8NA 3OHMB 1S5GY 2M97A 2KOTA 2JXLA 2L4HA 2KBIA 2LUCA 1SK6D 2LHIA 5I2QA 1ZMZA 4M2QA 1SBJA 1NX1A 1QIWA 1UHJA 3BUWB 3DVKA 1KSOA 2HF5A 3WXAA 2ZRSA 5JJGA 2G9BA 3KEVA 4N5XA 4MRXA 1PULA 1K2HA 4YI8A 4GGNA 2GGMA 1EH2A 1KK8B 3AAKA 2JWWA 2LVJA 3LCPC 1A03A 3JTDC 1B7TY 1DF0A 1F8HA 3H4SE 4PE0A 4CFRA 1CDLA 3IQOA 2I94A 5KTYA 1S6CA 1SKTA 2KFHA 1NYAA 1DMOA 1YX8A 1AVSA 3VRPA 1SR6B 1IH0A 5CSFA 1KCYA 1WY9A 3OP0A 1QS7A 4PE4A 3SJSA 5IBWA 4A4BA 3PFVA 2BL0C 4CFQA 3KPXA 1NX3A 1Y6WA 1M31A 4C0LA 1CB1A 1F71A 2ZRTA 3PM8A 3O6BA 1B8CA 2BE4A 3FIAA 3D0YB 5I2LA 1GQMA 1M63B 2FCDA 2LLUA 2ZKMX 4DRWA 1B4CA 1XA5A 3C1VA 1IRJA 1CLBA 2FCEA 3FWCA 4HREE 1UHHA 3CR4X 1C07A 4DIRA 1F4OA 1TNQA 3WHUB 3EVVA 1CMFA 3TDIA 2CXJA 4I5JA 1NX2A 1PVBA 2LMUA 3EKHA 4WQ3A 1UWOA 2H61A 5D69A 1L2OC 1AHRA 4BY4A 2VRGA 3BQ3A 3EVRA 3I5GB 2WCEA 2M9GA 2I2RE 4M2PA 3SIBA 1IKUA 1KFUS 1PALA 2L0PA 2M1KB 4Q04A 1V1FA 2OS8B 3AKBA 4MN0A 1HQVA 2LM5A 1S26D 4AQIA 3WHTB 1F55A 1KWOB 5HYDA 1YX7A 2LP3A 2LNKA 4GBAA 3SG4A 2KQYA 4R1EA 1N0YA 2CNPA 2JRFA 1K93D 1XFYO 3EKJA 1SW8A 3CLNA 1K8UA 2AAOA 1LA3A 3OB1B 1LVCD 2KYCA 1CFCA 1TNXA 3VRQA 4I5KA 1KSMA 3ZNIA 5HKYA 1RWYA 3WNXB 2KFGA 3I5FC 2K2AA 2L2EA 4PHJA 1UP5A 2ZN8A 3I5HB 2QACA 4UPGA 3CR2A 4XJKA 2JTTA 5F6TA 4YRUA 1QLKA 4YI9A 1TN4A 3VGOA 1A75B 4USLA 1NUBA 3ZWHA 1AJ4A 2KBMA 1XK4C 2KDHA 4U8DA 1F4QA 1EG3A 4D1EA 2SASA 2COLB 4MZJA 2NLNA 2BCBA 4PHKA 2KYFA 1KK8C 3D10A 4M2OA 5D7FA 1BOCA 4ORAB 1S5GZ 5HKWA 1XFXO 2B1UA 1U5IA 2F2OA 3O4YA 2PRUA 1FPWA 2F8PA 2M7LA 3A4UB 1YVHA 1OQPA 2JOJA 3TS5C 2LMVA 1SR6C 2KI4B 2MRDA 2PSRA 1MXLC 2BBMA 4GUKA 1DF0B 3CGAA 2ISDA 4WQ2A 1SY9A 4GGFA 1PRWA 1XFVO 1B7TZ 2K61A 2RGIA 2HQWA 2M0RA 1VRKA 2PALA 1BF5A 1NCXA 4C0JA 1UHNA 2NCOA 1DVIA 1WLZA 1QVIY 2K7BA 1Y1AA 4QJ3B 1S6JA 1IJ6A 1OZOA 2BKHB 1XYDA 1OE9B 4PHMA 2KSPA 3A8RA 1GGZA 3NSOA 1TOPA 1WDCB 3BYAA 3CS1A 3OB2B 2BKIB 4ORCB 1YUUA 1PSBA 3O2PA 2LANA 1Y1XA 1H4BA 4ETOA 3RLZA 2K2FA 3I5GC 4DUQA 1YURA 4P5OE 5CPVA 2NXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OR9 B;  1J7O A;  3DF0 A;  4DS7 A;  4QJ4 B;  2FJU B;  2JT3 A;  3BOW A;  2BCA A;  2EC6 B;  5J3X A;  3CR5 X;  2KFF A;  1F70 A;  1QV1 A;  1CLL A;  2K8M B;  4HSZ A;  3OX5 A;  1DT7 B;  1NP8 A;  4NDC A;  1IQ3 A;  2CCM A;  5ER4 X;  1IQ5 A;  1G8I A;  2CT9 A;  1DTL A;  1XFU O;  4ICB A;  1BU3 A;  2LVV A;  3LK1 A;  1IG5 A;  4N1G A;  4FQO A;  1YUT A;  3RM1 A;  4L9M A;  5G08 A;  3VRO A;  4YGB B;  2JNX A;  4TNC A;  2NCP A;  1AP4 A;  1H8B A;  2NZ0 A;  4CID A;  2SCP A;  1RRO A;  2LVI A;  2JUL A;  1D1O A;  1BJF A;  1KK7 Y;  1QX5 B;  4PDZ A;  2ZFD A;  1K94 A;  3NXA A;  4C0K A;  1CKK A;  2HET A;  1BR1 B;  3NSI A;  4NDB A;  2MAZ A;  1DJI A;  1S36 A;  1DJG A;  4PAL A;  1IWQ A;  2EHB A;  2IS9 A;  2O5G A;  4XJK B;  1LIN A;  2GV5 A;  2WOS A;  2Y4Q A;  3BUM B;  1QTX A;  3JVT B;  1SCM B;  1XK4 A;  1FF1 A;  1TIZ A;  3NSK A;  1G4Y R;  4JQ0 D;  1OMR A;  1FI6 A;  1QV0 A;  1EG4 A;  1XFZ O;  1Y0V H;  1DJX A;  1S3P A;  1TRF A;  3SG3 A;  5AAN A;  1REC A;  3GK2 A;  5GQQ C;  1BMO A;  1DGV A;  1U5I B;  1OMV A;  3TZ1 A;  2MHH A;  1SYM A;  2Q4U A;  3GOF A;  1EXR A;  1YRT B;  5AXI A;  1Q80 A;  5HLV A;  5TNC A;  4YBH B;  1R6P A;  2KNE A;  3JTD B;  2LMT A;  1DGU A;  1CMG A;  1KQV A;  1KQM B;  3TUY B;  3SG6 A;  5I2O A;  1MQ1 A;  3HCM A;  5DKN A;  1MWN A;  1JF2 A;  1WDC C;  2OTG B;  1B8L A;  1K9U A;  2JQ6 A;  1C7W A;  3PN7 B;  1NPQ A;  1CFD A;  3KO0 A;  2LLS A;  2K7D A;  1W7J B;  2M3W A;  1NX0 A;  2I18 A;  2K7C A;  2WC8 A;  5DKQ A;  2KAY A;  4PCW A;  1F54 A;  2JZI A;  4NQG A;  5FYX A;  1J7P A;  3EK7 A;  1CLM A;  1QVI Z;  3GK4 X;  3KF9 A;  1UHI A;  5K89 A;  1LKJ A;  2KI6 D;  4I5N B;  1FW4 A;  1UHK A;  2WND A;  2E30 A;  1CTR A;  2H61 C;  1YRU B;  2JTZ A;  1JWD A;  3VRR A;  2ZNE A;  5I8N A;  3QRX A;  3GK1 A;  2L50 A;  2Q91 A;  1S6I A;  1CNP A;  1BR4 B;  1QX2 A;  1BT6 A;  1XVJ A;  2MLE C;  4E68 A;  4ZCV A;  1SMG A;  1LXF C;  2ZN9 A;  3DF0 B;  1NCY A;  4P2Y B;  1KFX L;  1WRK A;  3SG5 A;  3BOW B;  1AK8 A;  4GPL B;  2G2B A;  3PAL A;  1C7V A;  1ODB A;  1B8R A;  3EVU A;  1SPY A;  4I5L B;  3HX4 A;  1JFJ A;  3OX6 A;  1SCV A;  1B47 A;  4OVN F;  1QXP A;  1K96 A;  1OSA A;  1TNP A;  2JT8 A;  4PE7 A;  1CFP A;  2I7A A;  1S1E A;  4QJ5 B;  1K95 A;  4GFT A;  2M7N A;  5KU1 A;  1Y1U A;  1FI5 A;  1RTP 1;  3DD4 A;  4N1F A;  4MZL A;  4IL1 A;  1YTZ C;  2O60 A;  1DJW A;  2PMY A;  1UUR A;  1DJZ A;  5AER A;  2L4I A;  1YUS A;  1A4P A;  4CLN A;  1WLM A;  2BBN A;  2R2I A;  4WRI A;  2F3Z A;  1LA0 A;  3JVT C;  1SCM C;  2V53 A;  5HKZ A;  1OMD A;  3AKA A;  1BLQ A;  5BPJ A;  2OS8 C;  1JUO A;  1N2D A;  2E6W A;  2F3Y A;  3SG7 A;  3TDU A;  3MSE B;  3I5F B;  2KGR A;  2MBX A;  1ALV A;  2KAV A;  3M0W A;  3PLF B;  4XYN A;  1KWO C;  3CWG A;  1KK7 Z;  3SIA A;  1RJV A;  3LK0 A;  2AUC A;  4MBE A;  5CSI A;  3ICB A;  5PAL A;  1CFF A;  2JU0 A;  2P6B B;  1M39 A;  1K90 D;  2JT0 A;  4OCI A;  1AUI B;  2L98 A;  2WCF A;  3I5I B;  5AEQ A;  1JC2 A;  4PHN A;  4OV2 A;  1QAS A;  1WRZ A;  1ZOT B;  1GJY A;  1QX7 A;  3CTN A;  1UUS A;  1KQM C;  1M45 A;  3FS7 A;  3TS5 B;  1CM4 A;  3TUY C;  5CSJ A;  5AFP A;  1YVL A;  1J1E A;  1NSH A;  3I5H C;  2HPS A;  2OTG C;  4GGF C;  1B9A A;  1N65 A;  3F45 A;  1A29 A;  1J1D A;  1W7I B;  1XFW O;  1TNW A;  2LC5 A;  3PN7 C;  2JXC A;  4MZK A;  4JWQ A;  1QIV A;  1M46 A;  2LCP A;  1MUX A;  2LVK A;  5HLO A;  1ZFS A;  1A2X A;  1QLS A;  2KGB C;  2KQ6 A;  1B1G A;  1R2U A;  3LL8 B;  5KSZ A;  2HQ8 A;  4YGC B;  1KFU L;  2WOR A;  1XO5 A;  3BUO B;  1TCF A;  1SL7 A;  1J55 A;  2CTN A;  2F33 A;  1MXE A;  2Y1M A;  1K9K A;  2TN4 A;  2KI4 C;  3NSL A;  1TTX A;  2LP2 A;  2F2P A;  3BUN B;  2MLF C;  1SRA A;  3CZT X;  1JSA A;  2MJW B;  4YGA A;  1L7Z A;  4DCK A;  1GGW A;  2WCB A;  1E8A A;  3VRN A;  3IF7 A;  1BOD A;  2LLT A;  4ZCU A;  2MA2 A;  1IJ5 A;  3K21 A;  5CSN A;  2FOT A;  1WRL A;  2ZND A;  1NCZ A;  4GNK B;  1CDN A;  5ER5 A;  4CPV A;  5B8I B;  2EGD A;  2LUX A;  1SL8 A;  2M1U A;  2KAX A;  3AAJ A;  4FTG A;  1V1G A;  2BCX A;  4A4C A;  1IGV A;  2BE6 A;  5JOL A;  3D0Y A;  2PAS A;  3FWB A;  2M29 A;  2GGZ A;  2DOQ A;  1RFJ A;  3KHE A;  1BG1 A;  2M49 B;  1HT9 A;  1YR5 A;  1RK9 A;  1JFK A;  2BL0 B;  2JPT A;  4AQJ A;  3DVJ A;  1MR8 A;  1DJY A;  2LAP A;  2K0J A;  1K9P A;  4MSP A;  2JNF A;  2Y1N A;  1ZUZ A;  2K7O A;  1MHO A;  2Y5I A;  1QJT A;  2EC6 C;  1MF8 B;  4F0Z B;  3DVM A;  2LHL A;  4MLW A;  3PSR A;  1EJ3 A;  2L5X B;  1NIW A;  4AOM A;  3E3R A;  2LV7 A;  1JBA A;  1CDP A;  3PAT A;  1QAT A;  4HRG A;  3EK4 A;  1L2O B;  4MVF A;  3BXK A;  2A4J A;  3I5I C;  1PVA A;  4NDD A;  3TDZ A;  2H2K A;  3O78 A;  5DKR A;  1CDM A;  1TCO B;  3IQQ A;  1SL9 A;  4MRY A;  4OKH A;  1CM1 A;  1JF0 A;  3BUX B;  2KI6 C;  3LLE A;  2M8U A;  3DVE A;  4MEW A;  2QPT A;  1EL4 A;  2L51 A;  1DJH A;  1G33 A;  2JC2 A;  2OPO A;  4GAO A;  4ORB B;  1J7Q A;  4PE1 A;  1OZS A;  1OOJ A;  1SNL A;  4YGD B;  2AMI A;  2CBL A;  1PK0 D;  2KHN A;  1ZAC A;  2LE9 B;  1AJ5 A;  2BEC A;  1X02 A;  3EK8 A;  4YGE B;  1ALW A;  1NWD A;  1KFX S;  4JPZ B;  1A75 A;  1FBV A;  1J7R A;  2PVB A;  4BY5 A;  1PSR A;  4HRH A;  3SG2 A;  2D8N A;  3OHM B;  1S5G Y;  2M97 A;  2KOT A;  2JXL A;  2L4H A;  2KBI A;  2LUC A;  1SK6 D;  2LHI A;  5I2Q A;  1ZMZ A;  4M2Q A;  1SBJ A;  1NX1 A;  1QIW A;  1UHJ A;  3BUW B;  3DVK A;  1KSO A;  2HF5 A;  3WXA A;  2ZRS A;  5JJG A;  2G9B A;  3KEV A;  4N5X A;  4MRX A;  1PUL A;  1K2H A;  4YI8 A;  4GGN A;  2GGM A;  1EH2 A;  1KK8 B;  3AAK A;  2JWW A;  2LVJ A;  3LCP C;  1A03 A;  3JTD C;  1B7T Y;  1DF0 A;  1F8H A;  3H4S E;  4PE0 A;  4CFR A;  1CDL A;  3IQO A;  2I94 A;  5KTY A;  1S6C A;  1SKT A;  2KFH A;  1NYA A;  1DMO A;  1YX8 A;  1AVS A;  3VRP A;  1SR6 B;  1IH0 A;  5CSF A;  1KCY A;  1WY9 A;  3OP0 A;  1QS7 A;  4PE4 A;  3SJS A;  5IBW A;  4A4B A;  3PFV A;  2BL0 C;  4CFQ A;  3KPX A;  1NX3 A;  1Y6W A;  1M31 A;  4C0L A;  1CB1 A;  1F71 A;  2ZRT A;  3PM8 A;  3O6B A;  1B8C A;  2BE4 A;  3FIA A;  3D0Y B;  5I2L A;  1GQM A;  1M63 B;  2FCD A;  2LLU A;  2ZKM X;  4DRW A;  1B4C A;  1XA5 A;  3C1V A;  1IRJ A;  1CLB A;  2FCE A;  3FWC A;  4HRE E;  1UHH A;  3CR4 X;  1C07 A;  4DIR A;  1F4O A;  1TNQ A;  3WHU B;  3EVV A;  1CMF A;  3TDI A;  2CXJ A;  4I5J A;  1NX2 A;  1PVB A;  2LMU A;  3EKH A;  4WQ3 A;  1UWO A;  2H61 A;  5D69 A;  1L2O C;  1AHR A;  4BY4 A;  2VRG A;  3BQ3 A;  3EVR A;  3I5G B;  2WCE A;  2M9G A;  2I2R E;  4M2P A;  3SIB A;  1IKU A;  1KFU S;  1PAL A;  2L0P A;  2M1K B;  4Q04 A;  1V1F A;  2OS8 B;  3AKB A;  4MN0 A;  1HQV A;  2LM5 A;  1S26 D;  4AQI A;  3WHT B;  1F55 A;  1KWO B;  5HYD A;  1YX7 A;  2LP3 A;  2LNK A;  4GBA A;  3SG4 A;  2KQY A;  4R1E A;  1N0Y A;  2CNP A;  2JRF A;  1K93 D;  1XFY O;  3EKJ A;  1SW8 A;  3CLN A;  1K8U A;  2AAO A;  1LA3 A;  3OB1 B;  1LVC D;  2KYC A;  1CFC A;  1TNX A;  3VRQ A;  4I5K A;  1KSM A;  3ZNI A;  5HKY A;  1RWY A;  3WNX B;  2KFG A;  3I5F C;  2K2A A;  2L2E A;  4PHJ A;  1UP5 A;  2ZN8 A;  3I5H B;  2QAC A;  4UPG A;  3CR2 A;  4XJK A;  2JTT A;  5F6T A;  4YRU A;  1QLK A;  4YI9 A;  1TN4 A;  3VGO A;  1A75 B;  4USL A;  1NUB A;  3ZWH A;  1AJ4 A;  2KBM A;  1XK4 C;  2KDH A;  4U8D A;  1F4Q A;  1EG3 A;  4D1E A;  2SAS A;  2COL B;  4MZJ A;  2NLN A;  2BCB A;  4PHK A;  2KYF A;  1KK8 C;  3D10 A;  4M2O A;  5D7F A;  1BOC A;  4ORA B;  1S5G Z;  5HKW A;  1XFX O;  2B1U A;  1U5I A;  2F2O A;  3O4Y A;  2PRU A;  1FPW A;  2F8P A;  2M7L A;  3A4U B;  1YVH A;  1OQP A;  2JOJ A;  3TS5 C;  2LMV A;  1SR6 C;  2KI4 B;  2MRD A;  2PSR A;  1MXL C;  2BBM A;  4GUK A;  1DF0 B;  3CGA A;  2ISD A;  4WQ2 A;  1SY9 A;  4GGF A;  1PRW A;  1XFV O;  1B7T Z;  2K61 A;  2RGI A;  2HQW A;  2M0R A;  1VRK A;  2PAL A;  1BF5 A;  1NCX A;  4C0J A;  1UHN A;  2NCO A;  1DVI A;  1WLZ A;  1QVI Y;  2K7B A;  1Y1A A;  4QJ3 B;  1S6J A;  1IJ6 A;  1OZO A;  2BKH B;  1XYD A;  1OE9 B;  4PHM A;  2KSP A;  3A8R A;  1GGZ A;  3NSO A;  1TOP A;  1WDC B;  3BYA A;  3CS1 A;  3OB2 B;  2BKI B;  4ORC B;  1YUU A;  1PSB A;  3O2P A;  2LAN A;  1Y1X A;  1H4B A;  4ETO A;  3RLZ A;  2K2F A;  3I5G C;  4DUQ A;  1YUR A;  4P5O E;  5CPV A;  2NXQ A; 
#chains in the Genus database with same CATH topology
 4OR9 B;  1C3Z A;  1J7O A;  3DF0 A;  4DS7 A;  4QJ4 B;  2FJU B;  2JT3 A;  3BOW A;  2BCA A;  2EC6 B;  5J3X A;  3CR5 X;  2KFF A;  1F70 A;  3OBV A;  1QV1 A;  1CLL A;  1XFR A;  2K8M B;  3FE8 A;  3CZ2 A;  3OX5 A;  3QME A;  4HSZ A;  1NP8 A;  4NDC A;  3UO9 A;  5DIC A;  1DT7 B;  1IQ3 A;  2CCM A;  5ER4 X;  1IQ5 A;  1G8I A;  2CT9 A;  1DTL A;  1XFU O;  4ICB A;  1BU3 A;  1LS8 A;  2LVV A;  3LK1 A;  1IG5 A;  3BFH A;  4N1G A;  4FQO A;  1YUT A;  3RM1 A;  4L9M A;  5G08 A;  2QEB A;  3VRO A;  4YGB B;  2JNX A;  2BNX A;  4TNC A;  5I94 A;  2NCP A;  3D77 A;  1OOG A;  1IIO A;  1AP4 A;  1H8B A;  2NZ0 A;  4CID A;  2SCP A;  1RRO A;  2LVI A;  4IJ7 A;  2JUL A;  1D1O A;  1BJF A;  1KK7 Y;  1QX5 B;  3PJI A;  4PDZ A;  2ZFD A;  1K94 A;  3NXA A;  4C0K A;  1CKK A;  2HET A;  1BR1 B;  3NSI A;  4NDB A;  2MAZ A;  1DJI A;  1S36 A;  1DJG A;  4PAL A;  1IWQ A;  2EHB A;  2IS9 A;  2O5G A;  4XJK B;  1LIN A;  2GV5 A;  2WOS A;  2Y4Q A;  3BUM B;  1QTX A;  3JVT B;  1SCM B;  1XK4 A;  1FF1 A;  1TIZ A;  3NSK A;  1G4Y R;  4JQ0 D;  1OMR A;  1FI6 A;  1QV0 A;  2QEV A;  1EG4 A;  1XFZ O;  1Y0V H;  1DJX A;  1S3P A;  1TRF A;  3SG3 A;  2BAP A;  5AAN A;  1REC A;  3GK2 A;  5GQQ C;  1BMO A;  4F7F A;  1DGV A;  1U5I B;  3S0D A;  1OMV A;  3TZ1 A;  4KYN A;  2KPH A;  2MHH A;  1SYM A;  2Q4U A;  3GOF A;  1EXR A;  1YRT B;  5AXI A;  1Q80 A;  5HLV A;  3O4X A;  5TNC A;  3S0A A;  4YBH B;  2WCM A;  1R6P A;  2KNE A;  1DQE A;  3JTD B;  2LMT A;  1DGU A;  1CMG A;  1KQV A;  1KQM B;  3TUY B;  3SG6 A;  5I2O A;  3DZT A;  1MQ1 A;  3HCM A;  5DKN A;  1MWN A;  1JF2 A;  1WDC C;  2OTG B;  1B8L A;  1K9U A;  2JQ6 A;  1C7W A;  3PN7 B;  1NPQ A;  1CFD A;  3KO0 A;  2LLS A;  2K7D A;  1W7J B;  2M3W A;  1NX0 A;  2I18 A;  2K7C A;  2WC8 A;  5DKQ A;  2KAY A;  4PCW A;  1F54 A;  2JZI A;  4NQG A;  5FYX A;  1J7P A;  3EK7 A;  1CLM A;  1QVI Z;  2QDI A;  3GK4 X;  3KF9 A;  1UHI A;  5K89 A;  1LKJ A;  2KI6 D;  4I5N B;  1FW4 A;  1UHK A;  2WND A;  1SSE B;  2E30 A;  1CTR A;  2JPO A;  2H61 C;  1YRU B;  2JTZ A;  1JWD A;  3VRR A;  2ZNE A;  5I8N A;  3QRX A;  2PQL A;  3GK1 A;  2L50 A;  2Q91 A;  3L4L A;  1S6I A;  3Q8I A;  1CNP A;  1BR4 B;  1QX2 A;  1BT6 A;  1XVJ A;  2MLE C;  4E68 A;  3D75 A;  3B86 A;  1SMG A;  4ZCV A;  1LXF C;  2ZN9 A;  3DF0 B;  1NCY A;  3NHT A;  4P2Y B;  1KFX L;  1WRK A;  3SG5 A;  3BOW B;  1AK8 A;  4GPL B;  2G2B A;  3PAL A;  1C7V A;  1ODB A;  1B8R A;  3EVU A;  1SPY A;  4I5L B;  3HX4 A;  1JFJ A;  3OX6 A;  3BFB A;  1SCV A;  1B47 A;  4OVN F;  1QXP A;  2QEO A;  1K96 A;  1OSA A;  1TNP A;  2JT8 A;  3BJH A;  4PE7 A;  2I7A A;  1CFP A;  3OGN A;  1S1E A;  4QJ5 B;  1K95 A;  4GFT A;  2M7N A;  5KU1 A;  1Y1U A;  1FI5 A;  1RTP 1;  3DD4 A;  4N1F A;  4MZL A;  4IL1 A;  1YTZ C;  2O60 A;  1DJW A;  2PMY A;  1UUR A;  1DJZ A;  5AER A;  2L4I A;  1YUS A;  1A4P A;  4CLN A;  1WLM A;  2BBN A;  2R2I A;  4WRI A;  1P28 A;  2F3Z A;  1LA0 A;  3JVT C;  1SCM C;  2V53 A;  3BFA A;  1OMD A;  3AKA A;  5HKZ A;  1BLQ A;  5BPJ A;  2OS8 C;  1JUO A;  1N2D A;  2E6W A;  2F3Y A;  3CZ0 A;  3N7H A;  3MSE B;  3SG7 A;  3I5F B;  3TDU A;  2KGR A;  2MBX A;  1ALV A;  2KAV A;  3M0W A;  3PLF B;  4XYN A;  3V2L A;  1KWO C;  3CWG A;  1OOF A;  1KK7 Z;  2KLD A;  3SIA A;  1RJV A;  3LK0 A;  2AUC A;  4MBE A;  5CSI A;  3ICB A;  5PAL A;  1CFF A;  3L4A A;  2JU0 A;  2P6B B;  1M39 A;  1K90 D;  2JT0 A;  4OCI A;  1AUI B;  2L98 A;  2WC5 A;  3NGV A;  2WCF A;  3I5I B;  5AEQ A;  1JC2 A;  4PHN A;  4OV2 A;  3EG5 B;  1QAS A;  3SS4 A;  1WRZ A;  1ZOT B;  1GJY A;  1QX7 A;  2P70 A;  1UUS A;  1KQM C;  1M45 A;  3CTN A;  3FS7 A;  3SS3 A;  1CM4 A;  3TS5 B;  3TUY C;  5CSJ A;  5AFP A;  1YVL A;  1J1E A;  4FQT A;  1NSH A;  3I5H C;  2HPS A;  2OTG C;  4GGF C;  1B9A A;  1N65 A;  3DYE A;  3F45 A;  1A29 A;  1J1D A;  1W7I B;  1XFW O;  1TNW A;  2LC5 A;  3PN7 C;  2JXC A;  4MZK A;  4JWQ A;  1QIV A;  1M46 A;  2LCP A;  1MUX A;  2LVK A;  5HLO A;  1ZFS A;  1A2X A;  1QLS A;  2KGB C;  2KQ6 A;  1B1G A;  1R2U A;  3LL8 B;  5KSZ A;  2HQ8 A;  4YGC B;  1KFU L;  2WOR A;  1XO5 A;  3BUO B;  1TCF A;  1SL7 A;  1J55 A;  2CTN A;  3L47 A;  2F33 A;  1MXE A;  2Y1M A;  1K9K A;  2TN4 A;  2KI4 C;  3NSL A;  5FI7 A;  1TTX A;  2LP2 A;  3RZS A;  2F2P A;  3BUN B;  2MLF C;  1SRA A;  3CZT X;  1JSA A;  1TUJ A;  2MJW B;  4YGA A;  1L7Z A;  2QEH A;  4DCK A;  1GGW A;  2WCB A;  1E8A A;  3VRN A;  3IF7 A;  1BOD A;  2LLT A;  4ZCU A;  2MA2 A;  1IJ5 A;  1OW4 A;  3K21 A;  2FOT A;  5CSN A;  1WRL A;  2ZND A;  4INX A;  1NCZ A;  4GNK B;  1CDN A;  5ER5 A;  4CPV A;  5B8I B;  2EGD A;  2LUX A;  1T14 A;  2WC6 A;  1SL8 A;  2M1U A;  4PT1 A;  2KAX A;  3AAJ A;  4FTG A;  1V1G A;  2BCX A;  4A4C A;  1IGV A;  2BE6 A;  5JOL A;  3D0Y A;  2PAS A;  3FWB A;  2M29 A;  5FI6 A;  2GGZ A;  2DOQ A;  1RFJ A;  3KHE A;  1BG1 A;  2M49 B;  1HT9 A;  1YR5 A;  1RK9 A;  1JFK A;  2BL0 B;  2JPT A;  2WCK A;  4AQJ A;  3R72 A;  3DVJ A;  3R1V A;  1MR8 A;  1DJY A;  2LAP A;  3NHI A;  2K0J A;  1K9P A;  3R1P A;  4MSP A;  2JNF A;  3D78 A;  2Y1N A;  1ZUZ A;  2K7O A;  1MHO A;  2Y5I A;  3VB1 A;  1QJT A;  1Z4H A;  1MF8 B;  2EC6 C;  2K60 A;  1C3Y A;  4F0Z B;  3DVM A;  2LHL A;  4MLW A;  3PSR A;  1EJ3 A;  2L5X B;  1NIW A;  4AOM A;  3E3R A;  2LV7 A;  1JBA A;  1CDP A;  3PAT A;  1QAT A;  4HRG A;  3EK4 A;  1L2O B;  4MVF A;  3BXK A;  2A4J A;  3I5I C;  1PVA A;  4NDD A;  3TDZ A;  2H2K A;  3O78 A;  2P71 A;  5DKR A;  1CDM A;  1TCO B;  3CAB A;  3IQQ A;  1SL9 A;  4MRY A;  2YGU A;  1CM1 A;  4OKH A;  1JF0 A;  3BUX B;  2KI6 C;  3LLE A;  2H8V A;  2M8U A;  3DVE A;  2WCH A;  4MEW A;  2QPT A;  1EL4 A;  2L51 A;  1DJH A;  1G33 A;  2JC2 A;  2OPO A;  4GAO A;  4ORB B;  1J7Q A;  3CDN A;  4PE1 A;  1OZS A;  1OOJ A;  1SNL A;  4YGD B;  2AMI A;  2CBL A;  1PK0 D;  2KHN A;  1ZAC A;  2LE9 B;  2ERB A;  1TUZ A;  1AJ5 A;  2BEC A;  1X02 A;  3EK8 A;  3DXL A;  4YGE B;  1ALW A;  1NWD A;  1KFX S;  4JPZ B;  1A75 A;  1FBV A;  1J7R A;  2PVB A;  3B88 A;  4BY5 A;  1PSR A;  4HRH A;  3PM2 A;  2D8N A;  3DY9 A;  3OHM B;  3SG2 A;  1S5G Y;  2M97 A;  2KOT A;  2JXL A;  2L4H A;  2KBI A;  2LUC A;  1SK6 D;  2LHI A;  5I2Q A;  1ZMZ A;  2WCL A;  4M2Q A;  1SBJ A;  1NX1 A;  1QIW A;  1UHJ A;  3BUW B;  3DVK A;  5D3O A;  1KSO A;  2HF5 A;  3WXA A;  2ZRS A;  5JJG A;  2G9B A;  1OOH A;  3K1E A;  3KEV A;  4N5X A;  4MRX A;  1PUL A;  2L2C A;  4YI8 A;  1K2H A;  4GGN A;  2GGM A;  1EH2 A;  1KK8 B;  2KLE A;  3AAK A;  2JWW A;  3CYZ A;  2LVJ A;  3LCP C;  1A03 A;  3JTD C;  1B7T Y;  1DF0 A;  1F8H A;  3H4S E;  4PE0 A;  4CFR A;  1CDL A;  3IQO A;  2I94 A;  5KTY A;  1S6C A;  1SKT A;  2KFH A;  1NYA A;  1DMO A;  1YX8 A;  1AVS A;  3S0E A;  1SR6 B;  3VRP A;  1IH0 A;  1ORG A;  4JD9 A;  3B6X A;  5CSF A;  1KCY A;  1WY9 A;  3OP0 A;  1QS7 A;  4PE4 A;  3SJS A;  5IBW A;  4A4B A;  3PFV A;  2BL0 C;  3D76 A;  4CFQ A;  3KPX A;  1NX3 A;  1Y6W A;  1M31 A;  3D73 A;  4C0L A;  1CB1 A;  1F71 A;  2ZRT A;  3PM8 A;  3O6B A;  1B8C A;  2BE4 A;  1QWV A;  3D0Y B;  3FIA A;  5I2L A;  1GQM A;  1M63 B;  2FCD A;  2LLU A;  2ZKM X;  4DRW A;  1B4C A;  1XA5 A;  3B7A A;  3FE9 A;  3C1V A;  1IRJ A;  1CLB A;  2FCE A;  3FWC A;  4HRE E;  1UHH A;  3CR4 X;  1C07 A;  4OZD A;  4DIR A;  1F4O A;  1TNQ A;  3WHU B;  3EVV A;  1CMF A;  3TDI A;  3S0B A;  1TWO A;  2CXJ A;  4I5J A;  1NX2 A;  3SS5 A;  1PVB A;  2LMU A;  3EKH A;  4WQ3 A;  1UWO A;  2H61 A;  5D69 A;  1L2O C;  1AHR A;  4BY4 A;  2VRG A;  3BQ3 A;  3EVR A;  3I5G B;  2WCE A;  2M9G A;  1DEK A;  2I2R E;  3R1O A;  4M2P A;  3SIB A;  1IKU A;  1KFU S;  1PAL A;  2L0P A;  2M1K B;  4Q04 A;  1V1F A;  2OS8 B;  3B87 A;  5EL2 A;  3S0G A;  3AKB A;  4MN0 A;  1HQV A;  2LM5 A;  1S26 D;  4AQI A;  3WHT B;  5FI2 A;  1F55 A;  1KWO B;  5HYD A;  1YX7 A;  2LP3 A;  2LNK A;  4GBA A;  3SG4 A;  2KQY A;  4R1E A;  5HL1 A;  1N0Y A;  2CNP A;  2JRF A;  1K93 D;  1XFY O;  3EKJ A;  1SW8 A;  4INW A;  3CLN A;  3D74 A;  1K8U A;  2AAO A;  1LA3 A;  3OB1 B;  1LVC D;  2KYC A;  1CFC A;  1TNX A;  3VRQ A;  4I5K A;  1KSM A;  3ZNI A;  5HKY A;  1DEL A;  1RWY A;  3WNX B;  2KFG A;  3I5F C;  2K2A A;  2L2E A;  4PHJ A;  1UP5 A;  2ZN8 A;  3I5H B;  2QAC A;  4UPG A;  3CR2 A;  2WCJ A;  4XJK A;  2JTT A;  2PYQ A;  5F6T A;  4YRU A;  1QLK A;  4YI9 A;  1TN4 A;  3VGO A;  1A75 B;  4USL A;  1NUB A;  3ZWH A;  1AJ4 A;  2KBM A;  1XK4 C;  2KDH A;  4U8D A;  1F4Q A;  1DC1 A;  1EG3 A;  4D1E A;  2SAS A;  2COL B;  4MZJ A;  2NLN A;  2BCB A;  4PHK A;  2KYF A;  1KK8 C;  3D10 A;  4M2O A;  5D7F A;  1BOC A;  4ORA B;  1S5G Z;  5HKW A;  1XFX O;  2GTE A;  2B1U A;  1U5I A;  2F2O A;  3O4Y A;  2PRU A;  3S0F A;  1FPW A;  2F8P A;  2M7L A;  3A4U B;  1YVH A;  1OQP A;  2JOJ A;  3TS5 C;  4JKT A;  2LMV A;  1SR6 C;  2KI4 B;  2MRD A;  2PSR A;  1MXL C;  2L5Y A;  2BBM A;  4GUK A;  4PHM A;  1DF0 B;  3CGA A;  1GM0 A;  2ISD A;  4WQ2 A;  3UNW A;  1SY9 A;  4GGF A;  1PRW A;  1XFV O;  1B7T Z;  2K61 A;  2RGI A;  2HQW A;  2M0R A;  1VRK A;  2PAL A;  1W9Z A;  1BF5 A;  1NCX A;  4C0J A;  1UHN A;  2NCO A;  1DVI A;  1WLZ A;  1QVI Y;  2K7B A;  1Y1A A;  4QJ3 B;  1S6J A;  1IJ6 A;  1OZO A;  2BKH B;  1XYD A;  1OE9 B;  1OOI X;  2KSP A;  3A8R A;  1GGZ A;  3NSO A;  1TOP A;  1WDC B;  1Z2C B;  3BYA A;  3CS1 A;  3FE6 A;  3CZ1 A;  3OB2 B;  2BKI B;  4ORC B;  2FJY A;  1YUU A;  1PSB A;  3O2P A;  2LAN A;  1Y1X A;  1H4B A;  4ETO A;  3RLZ A;  2K2F A;  3I5G C;  3IVT A;  4DUQ A;  1YUR A;  4P5O E;  5CPV A;  2NXQ A; 
#chains in the Genus database with same CATH homology
 4OR9 B;  1J7O A;  3DF0 A;  4DS7 A;  4QJ4 B;  2FJU B;  2JT3 A;  3BOW A;  2BCA A;  2EC6 B;  5J3X A;  3CR5 X;  2KFF A;  1F70 A;  1QV1 A;  1CLL A;  2K8M B;  4HSZ A;  3OX5 A;  1DT7 B;  1NP8 A;  4NDC A;  1IQ3 A;  2CCM A;  5ER4 X;  1IQ5 A;  1G8I A;  2CT9 A;  1DTL A;  1XFU O;  4ICB A;  1BU3 A;  2LVV A;  3LK1 A;  1IG5 A;  4N1G A;  4FQO A;  1YUT A;  3RM1 A;  4L9M A;  5G08 A;  3VRO A;  4YGB B;  2JNX A;  4TNC A;  2NCP A;  1AP4 A;  1H8B A;  2NZ0 A;  4CID A;  2SCP A;  1RRO A;  2LVI A;  2JUL A;  1D1O A;  1BJF A;  1KK7 Y;  1QX5 B;  4PDZ A;  2ZFD A;  1K94 A;  3NXA A;  4C0K A;  1CKK A;  2HET A;  1BR1 B;  3NSI A;  4NDB A;  2MAZ A;  1DJI A;  1S36 A;  1DJG A;  4PAL A;  1IWQ A;  2EHB A;  2IS9 A;  2O5G A;  4XJK B;  1LIN A;  2GV5 A;  2WOS A;  2Y4Q A;  3BUM B;  1QTX A;  3JVT B;  1SCM B;  1XK4 A;  1FF1 A;  1TIZ A;  3NSK A;  1G4Y R;  4JQ0 D;  1OMR A;  1FI6 A;  1QV0 A;  1EG4 A;  1XFZ O;  1Y0V H;  1DJX A;  1S3P A;  1TRF A;  3SG3 A;  5AAN A;  1REC A;  3GK2 A;  5GQQ C;  1BMO A;  1DGV A;  1U5I B;  1OMV A;  3TZ1 A;  2MHH A;  1SYM A;  2Q4U A;  3GOF A;  1EXR A;  1YRT B;  5AXI A;  1Q80 A;  5HLV A;  5TNC A;  4YBH B;  1R6P A;  2KNE A;  3JTD B;  2LMT A;  1DGU A;  1CMG A;  1KQV A;  1KQM B;  3TUY B;  3SG6 A;  5I2O A;  1MQ1 A;  3HCM A;  5DKN A;  1MWN A;  1JF2 A;  1WDC C;  2OTG B;  1B8L A;  1K9U A;  2JQ6 A;  1C7W A;  3PN7 B;  1NPQ A;  1CFD A;  3KO0 A;  2LLS A;  2K7D A;  1W7J B;  2M3W A;  1NX0 A;  2I18 A;  2K7C A;  2WC8 A;  5DKQ A;  2KAY A;  4PCW A;  1F54 A;  2JZI A;  4NQG A;  5FYX A;  1J7P A;  3EK7 A;  1CLM A;  1QVI Z;  3GK4 X;  3KF9 A;  1UHI A;  5K89 A;  1LKJ A;  2KI6 D;  4I5N B;  1FW4 A;  1UHK A;  2WND A;  2E30 A;  1CTR A;  2H61 C;  1YRU B;  2JTZ A;  1JWD A;  3VRR A;  2ZNE A;  5I8N A;  3QRX A;  3GK1 A;  2L50 A;  2Q91 A;  1S6I A;  1CNP A;  1BR4 B;  1QX2 A;  1BT6 A;  1XVJ A;  2MLE C;  4E68 A;  4ZCV A;  1SMG A;  1LXF C;  2ZN9 A;  3DF0 B;  1NCY A;  4P2Y B;  1KFX L;  1WRK A;  3SG5 A;  3BOW B;  1AK8 A;  4GPL B;  2G2B A;  3PAL A;  1C7V A;  1ODB A;  1B8R A;  3EVU A;  1SPY A;  4I5L B;  3HX4 A;  1JFJ A;  3OX6 A;  1SCV A;  1B47 A;  4OVN F;  1QXP A;  1K96 A;  1OSA A;  1TNP A;  2JT8 A;  4PE7 A;  1CFP A;  2I7A A;  1S1E A;  4QJ5 B;  1K95 A;  4GFT A;  2M7N A;  5KU1 A;  1Y1U A;  1FI5 A;  1RTP 1;  3DD4 A;  4N1F A;  4MZL A;  4IL1 A;  1YTZ C;  2O60 A;  1DJW A;  2PMY A;  1UUR A;  1DJZ A;  5AER A;  2L4I A;  1YUS A;  1A4P A;  4CLN A;  1WLM A;  2BBN A;  2R2I A;  4WRI A;  2F3Z A;  1LA0 A;  3JVT C;  1SCM C;  2V53 A;  5HKZ A;  1OMD A;  3AKA A;  1BLQ A;  5BPJ A;  2OS8 C;  1JUO A;  1N2D A;  2E6W A;  2F3Y A;  3SG7 A;  3TDU A;  3MSE B;  3I5F B;  2KGR A;  2MBX A;  1ALV A;  2KAV A;  3M0W A;  3PLF B;  4XYN A;  1KWO C;  3CWG A;  1KK7 Z;  3SIA A;  1RJV A;  3LK0 A;  2AUC A;  4MBE A;  5CSI A;  3ICB A;  5PAL A;  1CFF A;  2JU0 A;  2P6B B;  1M39 A;  1K90 D;  2JT0 A;  4OCI A;  1AUI B;  2L98 A;  2WCF A;  3I5I B;  5AEQ A;  1JC2 A;  4PHN A;  4OV2 A;  1QAS A;  1WRZ A;  1ZOT B;  1GJY A;  1QX7 A;  3CTN A;  1UUS A;  1KQM C;  1M45 A;  3FS7 A;  3TS5 B;  1CM4 A;  3TUY C;  5CSJ A;  5AFP A;  1YVL A;  1J1E A;  1NSH A;  3I5H C;  2HPS A;  2OTG C;  4GGF C;  1B9A A;  1N65 A;  3F45 A;  1A29 A;  1J1D A;  1W7I B;  1XFW O;  1TNW A;  2LC5 A;  3PN7 C;  2JXC A;  4MZK A;  4JWQ A;  1QIV A;  1M46 A;  2LCP A;  1MUX A;  2LVK A;  5HLO A;  1ZFS A;  1A2X A;  1QLS A;  2KGB C;  2KQ6 A;  1B1G A;  1R2U A;  3LL8 B;  5KSZ A;  2HQ8 A;  4YGC B;  1KFU L;  2WOR A;  1XO5 A;  3BUO B;  1TCF A;  1SL7 A;  1J55 A;  2CTN A;  2F33 A;  1MXE A;  2Y1M A;  1K9K A;  2TN4 A;  2KI4 C;  3NSL A;  1TTX A;  2LP2 A;  2F2P A;  3BUN B;  2MLF C;  1SRA A;  3CZT X;  1JSA A;  2MJW B;  4YGA A;  1L7Z A;  4DCK A;  1GGW A;  2WCB A;  1E8A A;  3VRN A;  3IF7 A;  1BOD A;  2LLT A;  4ZCU A;  2MA2 A;  1IJ5 A;  3K21 A;  5CSN A;  2FOT A;  1WRL A;  2ZND A;  1NCZ A;  4GNK B;  1CDN A;  5ER5 A;  4CPV A;  5B8I B;  2EGD A;  2LUX A;  1SL8 A;  2M1U A;  2KAX A;  3AAJ A;  4FTG A;  1V1G A;  2BCX A;  4A4C A;  1IGV A;  2BE6 A;  5JOL A;  3D0Y A;  2PAS A;  3FWB A;  2M29 A;  2GGZ A;  2DOQ A;  1RFJ A;  3KHE A;  1BG1 A;  2M49 B;  1HT9 A;  1YR5 A;  1RK9 A;  1JFK A;  2BL0 B;  2JPT A;  4AQJ A;  3DVJ A;  1MR8 A;  1DJY A;  2LAP A;  2K0J A;  1K9P A;  4MSP A;  2JNF A;  2Y1N A;  1ZUZ A;  2K7O A;  1MHO A;  2Y5I A;  1QJT A;  2EC6 C;  1MF8 B;  4F0Z B;  3DVM A;  2LHL A;  4MLW A;  3PSR A;  1EJ3 A;  2L5X B;  1NIW A;  4AOM A;  3E3R A;  2LV7 A;  1JBA A;  1CDP A;  3PAT A;  1QAT A;  4HRG A;  3EK4 A;  1L2O B;  4MVF A;  3BXK A;  2A4J A;  3I5I C;  1PVA A;  4NDD A;  3TDZ A;  2H2K A;  3O78 A;  5DKR A;  1CDM A;  1TCO B;  3IQQ A;  1SL9 A;  4MRY A;  4OKH A;  1CM1 A;  1JF0 A;  3BUX B;  2KI6 C;  3LLE A;  2M8U A;  3DVE A;  4MEW A;  2QPT A;  1EL4 A;  2L51 A;  1DJH A;  1G33 A;  2JC2 A;  2OPO A;  4GAO A;  4ORB B;  1J7Q A;  4PE1 A;  1OZS A;  1OOJ A;  1SNL A;  4YGD B;  2AMI A;  2CBL A;  1PK0 D;  2KHN A;  1ZAC A;  2LE9 B;  1AJ5 A;  2BEC A;  1X02 A;  3EK8 A;  4YGE B;  1ALW A;  1NWD A;  1KFX S;  4JPZ B;  1A75 A;  1FBV A;  1J7R A;  2PVB A;  4BY5 A;  1PSR A;  4HRH A;  3SG2 A;  2D8N A;  3OHM B;  1S5G Y;  2M97 A;  2KOT A;  2JXL A;  2L4H A;  2KBI A;  2LUC A;  1SK6 D;  2LHI A;  5I2Q A;  1ZMZ A;  4M2Q A;  1SBJ A;  1NX1 A;  1QIW A;  1UHJ A;  3BUW B;  3DVK A;  1KSO A;  2HF5 A;  3WXA A;  2ZRS A;  5JJG A;  2G9B A;  3KEV A;  4N5X A;  4MRX A;  1PUL A;  1K2H A;  4YI8 A;  4GGN A;  2GGM A;  1EH2 A;  1KK8 B;  3AAK A;  2JWW A;  2LVJ A;  3LCP C;  1A03 A;  3JTD C;  1B7T Y;  1DF0 A;  1F8H A;  3H4S E;  4PE0 A;  4CFR A;  1CDL A;  3IQO A;  2I94 A;  5KTY A;  1S6C A;  1SKT A;  2KFH A;  1NYA A;  1DMO A;  1YX8 A;  1AVS A;  3VRP A;  1SR6 B;  1IH0 A;  5CSF A;  1KCY A;  1WY9 A;  3OP0 A;  1QS7 A;  4PE4 A;  3SJS A;  5IBW A;  4A4B A;  3PFV A;  2BL0 C;  4CFQ A;  3KPX A;  1NX3 A;  1Y6W A;  1M31 A;  4C0L A;  1CB1 A;  1F71 A;  2ZRT A;  3PM8 A;  3O6B A;  1B8C A;  2BE4 A;  3FIA A;  3D0Y B;  5I2L A;  1GQM A;  1M63 B;  2FCD A;  2LLU A;  2ZKM X;  4DRW A;  1B4C A;  1XA5 A;  3C1V A;  1IRJ A;  1CLB A;  2FCE A;  3FWC A;  4HRE E;  1UHH A;  3CR4 X;  1C07 A;  4DIR A;  1F4O A;  1TNQ A;  3WHU B;  3EVV A;  1CMF A;  3TDI A;  2CXJ A;  4I5J A;  1NX2 A;  1PVB A;  2LMU A;  3EKH A;  4WQ3 A;  1UWO A;  2H61 A;  5D69 A;  1L2O C;  1AHR A;  4BY4 A;  2VRG A;  3BQ3 A;  3EVR A;  3I5G B;  2WCE A;  2M9G A;  2I2R E;  4M2P A;  3SIB A;  1IKU A;  1KFU S;  1PAL A;  2L0P A;  2M1K B;  4Q04 A;  1V1F A;  2OS8 B;  3AKB A;  4MN0 A;  1HQV A;  2LM5 A;  1S26 D;  4AQI A;  3WHT B;  1F55 A;  1KWO B;  5HYD A;  1YX7 A;  2LP3 A;  2LNK A;  4GBA A;  3SG4 A;  2KQY A;  4R1E A;  1N0Y A;  2CNP A;  2JRF A;  1K93 D;  1XFY O;  3EKJ A;  1SW8 A;  3CLN A;  1K8U A;  2AAO A;  1LA3 A;  3OB1 B;  1LVC D;  2KYC A;  1CFC A;  1TNX A;  3VRQ A;  4I5K A;  1KSM A;  3ZNI A;  5HKY A;  1RWY A;  3WNX B;  2KFG A;  3I5F C;  2K2A A;  2L2E A;  4PHJ A;  1UP5 A;  2ZN8 A;  3I5H B;  2QAC A;  4UPG A;  3CR2 A;  4XJK A;  2JTT A;  5F6T A;  4YRU A;  1QLK A;  4YI9 A;  1TN4 A;  3VGO A;  1A75 B;  4USL A;  1NUB A;  3ZWH A;  1AJ4 A;  2KBM A;  1XK4 C;  2KDH A;  4U8D A;  1F4Q A;  1EG3 A;  4D1E A;  2SAS A;  2COL B;  4MZJ A;  2NLN A;  2BCB A;  4PHK A;  2KYF A;  1KK8 C;  3D10 A;  4M2O A;  5D7F A;  1BOC A;  4ORA B;  1S5G Z;  5HKW A;  1XFX O;  2B1U A;  1U5I A;  2F2O A;  3O4Y A;  2PRU A;  1FPW A;  2F8P A;  2M7L A;  3A4U B;  1YVH A;  1OQP A;  2JOJ A;  3TS5 C;  2LMV A;  1SR6 C;  2KI4 B;  2MRD A;  2PSR A;  1MXL C;  2BBM A;  4GUK A;  1DF0 B;  3CGA A;  2ISD A;  4WQ2 A;  1SY9 A;  4GGF A;  1PRW A;  1XFV O;  1B7T Z;  2K61 A;  2RGI A;  2HQW A;  2M0R A;  1VRK A;  2PAL A;  1BF5 A;  1NCX A;  4C0J A;  1UHN A;  2NCO A;  1DVI A;  1WLZ A;  1QVI Y;  2K7B A;  1Y1A A;  4QJ3 B;  1S6J A;  1IJ6 A;  1OZO A;  2BKH B;  1XYD A;  1OE9 B;  4PHM A;  2KSP A;  3A8R A;  1GGZ A;  3NSO A;  1TOP A;  1WDC B;  3BYA A;  3CS1 A;  3OB2 B;  2BKI B;  4ORC B;  1YUU A;  1PSB A;  3O2P A;  2LAN A;  1Y1X A;  1H4B A;  4ETO A;  3RLZ A;  2K2F A;  3I5G C;  4DUQ A;  1YUR A;  4P5O E;  5CPV A;  2NXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...