2WCBA

S100a12 complex with zinc in the absence of calcium
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
STKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Human S100A12 in Apo Form and in Complex with Zinc: New Insights Into S100A12 Oligomerisation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords PROTEIN S100-A12
total genus 36
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2wcbA00
1XO5A 3HX4A 1IJ6A 1SKTA 2HQWA 2M8UA 4JPZB 4C0JA 2HQ8A 1L2OC 1WLMA 3EVRA 4FTGA 3SG6A 2KBIA 4QJ4B 5BPJA 1F54A 2MAZA 4M2PA 2BECA 4JQ0D 1MQ1A 3DVMA 1XYDA 1SCVA 3TDZA 1ZMZA 3VRPA 1QLSA 1UHIA 2OTGC 3BOWA 4AQJA 1C7WA 3KO0A 1DMOA 5JJGA 1J1EA 1NIWA 1S5GY 2KFHA 1QX5B 1KWOB 4YGEB 4FQOA 2KI4B 2NCOA 2SCPA 1CLMA 2JNXA 2K7CA 1BOCA 1OSAA 3BXKA 1MXLC 1RFJA 4CFQA 4DUQA 2Y5IA 2SASA 1NCYA 1UHHA 1E8AA 4A4CA 2KAVA 2O5GA 5DKQA 1DJHA 2MHHA 3BUOB 3SG5A 1KFUL 3BOWB 2JC2A 1CMFA 2WOSA 2Q4UA 4D1EA 4ZCVA 1M39A 3EVVA 4MSPA 4AOMA 3FWCA 2LUXA 1LVCD 5HKYA 1CFDA 3C1VA 1YUTA 3H4SE 2ZNDA 2LE9B 2WC8A 2DOQA 4C0KA 2I94A 1YVLA 3FWBA 3KPXA 4TNCA 3IQQA 4YBHB 5CSNA 2M49B 1B8RA 1IRJA 1PRWA 2PRUA 2ZKMX 3D0YA 2KAYA 2BKIB 4MVFA 1TN4A 3PN7C 5TNCA 1G33A 1FI5A 2KBMA 1SRAA 2HETA 1ZACA 5I2OA 2G9BA 1KK8B 1BT6A 2QACA 5AXIA 4I5NB 4OKHA 4PE7A 1TNWA 4XJKA 1A4PA 3LL8B 5K89A 2WORA 1WRZA 1ZFSA 1CDMA 4Q04A 3PATA 4HRHA 1EJ3A 3DF0A 2JQ6A 4MLWA 2LVIA 2FCEA 2NZ0A 4PE4A 2OTGB 2KGRA 1IWQA 4NDDA 2EHBA 3LLEA 1QIVA 3A8RA 4WRIA 3D0YB 3CR4X 1J7RA 1SCMB 2CCMA 1GJYA 1NYAA 1KWOC 4WQ2A 1TTXA 1BODA 1RTP1 2GV5A 1QLKA 1BMOA 1DGVA 2H61C 4NDCA 3CLNA 3LK0A 1B1GA 2L2EA 2CBLA 1B7TZ 1U5IB 3EK7A 1XFYO 2GGZA 2BCBA 3CWGA 1B7TY 1J1DA 2M3WA 4CPVA 1LINA 1IQ5A 1Y1XA 2EC6B 4I5JA 1G8IA 2LVJA 4PHKA 1TNXA 3D10A 4GAOA 1NX2A 2KYCA 4YGAA 2JXCA 3LCPC 1QX2A 4QJ5B 4XYNA 1XFXO 4N5XA 3O6BA 3BUXB 1SK6D 1QXPA 1QV0A 1DGUA 1K94A 2LC5A 1LA3A 1Y6WA 1K2HA 1CM1A 1JBAA 2JT0A 2WCEA 1YX7A 1FW4A 1MF8B 1FBVA 1SW8A 1HT9A 3PN7B 2KI6D 2JPTA 4F0ZB 1JFKA 2M29A 2MLFC 2F2OA 3MSEB 4YI8A 5DKNA 4MRXA 2I2RE 3VRQA 1YRTB 3VGOA 1N65A 1YURA 1RK9A 3VRRA 1S6JA 4ORCB 2Y4QA 3JVTB 3BYAA 1XK4C 5AEQA 3IF7A 1OE9B 1EG4A 1RROA 1PSBA 1SCMC 2KAXA 2M0RA 1FPWA 1JFJA 2NLNA 1TNQA 1PVAA 2L4IA 1NCZA 3GK4X 1N0YA 3RM1A 4GBAA 1W7JB 4P2YB 1S36A 2ZRSA 1L7ZA 1TNPA 1WDCC 2AUCA 3PSRA 5AFPA 1OQPA 2ZNEA 5GQQC 1YUSA 1X02A 4N1GA 2BE4A 5PALA 2LUCA 4P5OE 1TCOB 2GGMA 2LMTA 2LHLA 5HKZA 1A03A 2JULA 1H8BA 1DJXA 1U5IA 2BL0C 4NDBA 4ZCUA 2PALA 2BE6A 4MRYA 1SMGA 4MZKA 4USLA 1GGWA 1B9AA 2JTZA 1BR4B 1CLBA 1UHNA 2F33A 1YR5A 2HF5A 5HLOA 4DIRA 1QATA 3WHUB 5IBWA 1KFUS 4OCIA 1DVIA 4DRWA 3NXAA 2LVVA 1A75A 4YI9A 1NUBA 5AERA 1J7OA 5D69A 3CGAA 1YUUA 3SIBA 4DS7A 2LLTA 3JTDC 1IJ5A 1KQMB 4PHNA 4BY5A 1GQMA 2AAOA 1A29A 1DF0A 2FOTA 3SIAA 1AHRA 4MEWA 2ZRTA 2Y1MA 3I5IC 4IL1A 1AUIB 4MN0A 4PDZA 1ALWA 1CKKA 2JZIA 3KEVA 1NX1A 1S1EA 2K7DA 2OS8B 2L0PA 3JVTC 1XFUO 2NCPA 1S3PA 2MBXA 1SR6C 4GNKB 2R2IA 1B4CA 2JT8A 4CIDA 3EKJA 1SY9A 1TOPA 3I5GC 4WQ3A 1W7IB 3SJSA 2LP3A 2M97A 1WY9A 2ZN8A 1KK8C 4C0LA 1Q80A 1WDCB 1S6IA 2I18A 1A2XA 4ORAB 1M63B 1QX7A 1MXEA 1JC2A 2K61A 1SPYA 4R1EA 4XJKB 5HYDA 3CR5X 3TS5B 1QS7A 4ETOA 2VRGA 2PASA 3BUNB 4I5LB 1OOJA 2LMVA 2LCPA 1SL8A 4PHJA 1KK7Y 3SG2A 3IQOA 4U8DA 5I2LA 1DJYA 1QJTA 1OMVA 4ICBA 3KHEA 3ICBA 3OHMB 1MR8A 3NSLA 3AKBA 1NX0A 2CTNA 2KYFA 1K9UA 2F3YA 3GK1A 2H61A 2P6BB 3O4YA 1K95A 2L51A 2LMUA 4HSZA 1H4BA 1YTZC 2KI6C 2OPOA 3WHTB 2EC6C 5HLVA 4NQGA 1WRLA 1JSAA 1LKJA 3LK1A 3TUYC 1AVSA 1YX8A 2JXLA 3I5FC 4M2OA 1DJIA 1J7QA 3ZWHA 1OMRA 2OS8C 5D7FA 2F2PA 4PALA 4QJ3B 3NSIA 2KDHA 1ODBA 1G4YR 3OB1B 1S6CA 4OR9B 3EK4A 3NSKA 1PALA 1TCFA 4A4BA 2ZFDA 3DF0B 3I5GB 4GGFC 4E68A 2MLEC 4GFTA 4CFRA 1EXRA 4MBEA 1BLQA 1B8CA 1B8LA 1KFXS 2BKHB 4JWQA 1LXFC 2I7AA 3DD4A 4PHMA 5KSZA 3OX6A 2IS9A 3AAKA 2JOJA 1VRKA 2JRFA 3EKHA 4YGBB 4PE0A 1NX3A 3TDUA 1DT7B 1QTXA 1A75B 1OMDA 1RWYA 1Y1UA 2K0JA 2D8NA 2LNKA 3TDIA 2RGIA 4PCWA 1CFFA 1IGVA 3PALA 2KHNA 4YRUA 3NSOA 1YRUB 2K2FA 1XFWO 1XA5A 3SG7A 1UWOA 2MRDA 3EK8A 1ZOTB 4YGDB 3WNXB 2QPTA 3CZTX 2LM5A 1J55A 1CMGA 1JF2A 2PVBA 5FYXA 1CM4A 2Y1NA 2LHIA 1CFCA 5KTYA 1XK4A 1BF5A 1SNLA 4GUKA 2M1UA 2BL0B 1EH2A 4PE1A 1JWDA 1PSRA 5JOLA 1S5GZ 1EL4A 4DCKA 3F45A 1L2OB 1AJ5A 3I5HB 2KQYA 5F6TA 1MWNA 1K90D 1LA0A 2KOTA 1F71A 2CXJA 1KSMA 1SL7A 3DVJA 4HRGA 4MZJA 2BCXA 2TN4A 3TZ1A 1OZSA 1F70A 1F4OA 2LANA 1Y0VH 1BJFA 1MHOA 2PSRA 3FS7A 1KQMC 3JTDB 3OX5A 2M1KB 5ER4X 1BU3A 4BY4A 4AQIA 1UHKA 1ALVA 3I5IB 2FCDA 2M9GA 3PLFB 4L9MA 3RLZA 2CT9A 1NP8A 5CPVA 1DTLA 3SG4A 3AAJA 1AK8A 1CFPA 1KQVA 3CS1A 2H2KA 4GGNA 4YGCB 1CLLA 1K9KA 5KU1A 1WRKA 1ZUZA 1S26D 3A4UB 1SR6B 1WLZA 4M2QA 5HKWA 3SG3A 3O2PA 1CDPA 2V53A 2JWWA 1FF1A 2JU0A 2K8MB 2KQ6A 3HCMA 4N1FA 3GOFA 3OB2B 2BBNA 1HQVA 1C07A 3VRNA 5B8IB 2G2BA 1V1FA 3EVUA 2K7BA 3PM8A 1K8UA 2L50A 3VROA 2LVKA 2K7OA 1N2DA 3PFVA 1UP5A 3TS5C 5I8NA 3ZNIA 1PVBA 1YVHA 1QV1A 3O78A 1R2UA 1QASA 4I5KA 3I5HC 2O60A 2WCFA 4OVNF 1V1GA 4OV2A 5CSJA 1JF0A 1K96A 1Y1AA 4MZLA 1AP4A 2BBMA 2L4HA 4GGFA 1MUXA 1F55A 2EGDA 2PMYA 3OP0A 1F8HA 3QRXA 1RJVA 1DJWA 1R6PA 2COLB 1FI6A 1JUOA 2K2AA 1XFZO 1PULA 1M31A 2MA2A 2ISDA 2LP2A 4ORBB 3TUYB 1CNPA 3I5FB 5J3XA 5DKRA 1D1OA 2A4JA 2JTTA 1NWDA 1TRFA 5ER5A 1IG5A 3KF9A 4CLNA 2L98A 2BCAA 1K9PA 2B1UA 2KSPA 1CB1A 1IKUA 1M45A 1DJGA 1SBJA 2AMIA 2LV7A 2Q91A 1NCXA 1BG1A 5CSFA 1KFXL 1KSOA 2LAPA 1UHJA 2KFGA 2WNDA 3FIAA 1SL9A 3CTNA 1EG3A 2ZN9A 3GK2A 5G08A 4HREE 1J7PA 2M7LA 1NPQA 3M0WA 2JNFA 5CSIA 1B47A 2E6WA 2KI4C 1UURA 1QIWA 2KFFA 1KK7Z 3BQ3A 1XVJA 2M7NA 2MJWB 1C7VA 2NXQA 3DVKA 1DJZA 1NSHA 2L5XB 3BUMB 5I2QA 3E3RA 2F8PA 1F4QA 1OZOA 1QVIY 2FJUB 2CNPA 1BR1B 1M46A 2JT3A 1TIZA 3AKAA 1RECA 1GGZA 2KGBC 1QVIZ 1IH0A 1DF0B 2LLUA 5AANA 1SYMA 1K93D 1AJ4A 1XFVO 3BUWB 1CDNA 1PK0D 2LLSA 1CDLA 2F3ZA 4GPLB 2KNEA 2WCBA 3CR2A 1IQ3A 1UUSA 2E30A 1CTRA 3DVEA 3K21A 4UPGA 3WXAA 2HPSA 1KCYA
chains in the Genus database with same CATH superfamily
3CYZA 1XO5A 2P71A 3HX4A 4FQTA 1IJ6A 1SKTA 2HQWA 2M8UA 4JPZB 4C0JA 2HQ8A 1L2OC 1WLMA 3EVRA 4FTGA 3SG6A 2ERBA 2KBIA 4QJ4B 5BPJA 1F54A 2MAZA 1OOHA 3DZTA 4M2PA 2BECA 4JQ0D 1MQ1A 3B7AA 3DVMA 1XYDA 1SCVA 3TDZA 1ZMZA 2QEHA 1QLSA 1UHIA 2OTGC 3BOWA 3VRPA 1DEKA 3D76A 4AQJA 1C7WA 3KO0A 1DMOA 5FI7A 5JJGA 1J1EA 1NIWA 1S5GY 2KFHA 3L4LA 1QX5B 3CZ0A 1KWOB 4YGEB 4FQOA 2KI4B 2NCOA 2SCPA 1CLMA 2JNXA 2K7CA 1BOCA 1OSAA 3BXKA 1MXLC 1RFJA 4CFQA 4DUQA 2Y5IA 2SASA 1NCYA 1UHHA 1E8AA 4A4CA 3OGNA 2KAVA 2O5GA 5DKQA 1DJHA 2MHHA 3BUOB 3SG5A 1XFRA 1KFUL 3BOWB 2JC2A 1OOIX 3R1VA 3NHIA 1CMFA 1DQEA 2WOSA 2Q4UA 3L47A 4D1EA 4ZCVA 1M39A 3EVVA 4MSPA 4AOMA 3FWCA 2LUXA 1LVCD 3UNWA 5HKYA 1CFDA 3C1VA 1YUTA 3H4SE 2ZNDA 2LE9B 2WC8A 2DOQA 4C0KA 2I94A 1YVLA 2L2CA 3FWBA 2WC6A 3KPXA 4TNCA 3IQQA 4YBHB 5CSNA 2M49B 1B8RA 1IRJA 1PRWA 2PRUA 2ZKMX 3D0YA 2KAYA 2BKIB 4MVFA 1TN4A 3PN7C 5TNCA 1G33A 1FI5A 2KBMA 1SRAA 2HETA 1ZACA 5I2OA 2G9BA 1KK8B 1BT6A 2QACA 5AXIA 4I5NB 4OKHA 4PE7A 1TNWA 4XJKA 1A4PA 1TUJA 3LL8B 5K89A 2WORA 1WRZA 1ZFSA 1CDMA 4Q04A 3PATA 4HRHA 2KLEA 3CZ2A 3PJIA 1EJ3A 3DF0A 2JQ6A 4MLWA 2LVIA 2FCEA 2NZ0A 4PE4A 2OTGB 2KGRA 1IWQA 4NDDA 2EHBA 3LLEA 1QIVA 3A8RA 4WRIA 3D0YB 1Z4HA 3CR4X 1J7RA 1SCMB 2CCMA 1GJYA 1NYAA 1KWOC 4WQ2A 1TTXA 1BODA 1RTP1 2GV5A 1QLKA 1BMOA 1DGVA 2H61C 4NDCA 3UO9A 3CLNA 2BAPA 3LK0A 1B1GA 2L2EA 2CBLA 1B7TZ 1U5IB 3EK7A 2QEOA 1XFYO 2GGZA 2BCBA 2YGUA 3CWGA 1ORGA 1B7TY 1J1DA 2M3WA 3D77A 1LINA 4CPVA 1IQ5A 1Y1XA 2EC6B 4I5JA 1G8IA 2LVJA 4PHKA 1TNXA 3D10A 4GAOA 1NX2A 2KYCA 4YGAA 2JXCA 3LCPC 1QX2A 4QJ5B 4XYNA 1XFXO 3R1PA 4N5XA 3O6BA 3BUXB 1SK6D 1QXPA 1QV0A 1DGUA 1K94A 2LC5A 1LA3A 1Y6WA 1K2HA 1CM1A 1JBAA 2JT0A 3PM2A 2WCEA 1YX7A 1FW4A 5FI2A 1MF8B 1FBVA 1SW8A 1HT9A 2KLDA 1W9ZA 3PN7B 2KI6D 2JPTA 4F0ZB 1JFKA 2M29A 2MLFC 2F2OA 3MSEB 4YI8A 3BFAA 4MRXA 2QEBA 5DKNA 2I2RE 3VRQA 1IIOA 1YRTB 3VGOA 1N65A 3IVTA 1YURA 1RK9A 3VRRA 1S6JA 4ORCB 2Y4QA 3JVTB 3BYAA 1XK4C 5AEQA 3IF7A 1OE9B 1EG4A 1RROA 1PSBA 1SCMC 2KAXA 2M0RA 1FPWA 3S0DA 1SSEB 2NLNA 1TNQA 3N7HA 1JFJA 1PVAA 2L4IA 1NCZA 3GK4X 1N0YA 3RM1A 1OW4A 4GBAA 1W7JB 4P2YB 1S36A 2ZRSA 1L7ZA 3EG5B 1TNPA 1WDCC 2AUCA 3PSRA 5AFPA 1OQPA 2ZNEA 5GQQC 4PT1A 1YUSA 1X02A 4N1GA 2BE4A 5PALA 2LUCA 4P5OE 3CZ1A 1TCOB 2GGMA 2LMTA 2LHLA 5HKZA 1A03A 2JULA 1H8BA 1DJXA 1U5IA 2BL0C 4NDBA 3DXLA 4ZCUA 1OOGA 2PALA 2BE6A 4MRYA 1SMGA 4MZKA 4USLA 1GGWA 1B9AA 2JTZA 1BR4B 1CLBA 1UHNA 2F33A 1YR5A 2HF5A 5HLOA 4DIRA 1QATA 3WHUB 3K1EA 5IBWA 1KFUS 2QDIA 4OCIA 1DVIA 4DRWA 3D74A 3NXAA 2LVVA 1A75A 4INWA 4YI9A 1NUBA 5AERA 1J7OA 4OZDA 5D69A 3CGAA 1YUUA 3SIBA 4DS7A 2LLTA 3D75A 3JTDC 1IJ5A 1KQMB 4PHNA 4BY5A 1GQMA 2AAOA 1A29A 1DF0A 2FOTA 3SIAA 1AHRA 4MEWA 3QMEA 2ZRTA 2Y1MA 3I5IC 4IL1A 1AUIB 4MN0A 4PDZA 1ALWA 1CKKA 2JZIA 3KEVA 1NX1A 1S1EA 2K7DA 2OS8B 2L0PA 3BFBA 3B86A 3JVTC 1XFUO 2NCPA 1S3PA 2MBXA 1SR6C 4GNKB 3FE6A 2R2IA 3BFHA 1B4CA 2JT8A 4CIDA 3EKJA 1SY9A 1TOPA 3I5GC 4WQ3A 1W7IB 3SJSA 2LP3A 2M97A 1WY9A 2ZN8A 2JPOA 1KK8C 4C0LA 1Q80A 3B88A 1WDCB 5FI6A 1S6IA 2I18A 1A2XA 4ORAB 1M63B 1QX7A 2WC5A 1MXEA 1JC2A 2K61A 1SPYA 4R1EA 4XJKB 5HYDA 1Z2CB 3CR5X 3S0GA 3TS5B 1QS7A 3RZSA 4ETOA 2VRGA 2PASA 3BUNB 4I5LB 4IJ7A 1OOJA 2LMVA 2LCPA 1SL8A 4PHJA 1KK7Y 3SG2A 3IQOA 4U8DA 5I2LA 3B87A 1DJYA 1QJTA 1OMVA 4ICBA 2PYQA 3KHEA 3ICBA 3OHMB 1MR8A 3NSLA 3AKBA 1NX0A 2CTNA 3R1OA 2KYFA 1K9UA 2F3YA 3GK1A 2H61A 2P6BB 1KQVA 3O4YA 1K95A 3S0BA 2L51A 2LMUA 4HSZA 1H4BA 1YTZC 2KI6C 2OPOA 3WHTB 2EC6C 5HLVA 4NQGA 1WRLA 1JSAA 1LKJA 3LK1A 3TUYC 1AVSA 1YX8A 4KYNA 2JXLA 3I5FC 4M2OA 2PQLA 1DJIA 1J7QA 1QWVA 3ZWHA 1OMRA 1C3YA 2OS8C 5D7FA 2F2PA 5EL2A 4PALA 4QJ3B 3NSIA 2KDHA 1ODBA 1G4YR 3OB1B 1S6CA 4OR9B 3EK4A 3NSKA 1PALA 2P70A 1TCFA 5I94A 4A4BA 2ZFDA 3DF0B 3I5GB 4GGFC 4E68A 2MLEC 4GFTA 4CFRA 1EXRA 4MBEA 1BLQA 1GM0A 1B8CA 1B8LA 1KFXS 2BKHB 4JWQA 1LXFC 3D73A 2I7AA 3DD4A 4PHMA 5KSZA 1TUZA 3OX6A 2IS9A 3AAKA 2JOJA 1VRKA 2JRFA 3EKHA 3R72A 4YGBB 4PE0A 1NX3A 3S0FA 3TDUA 1DT7B 1QTXA 1A75B 1OMDA 1RWYA 1Y1UA 2K0JA 2D8NA 2LNKA 3TDIA 2RGIA 4PCWA 1CFFA 1IGVA 3PALA 3S0EA 2KHNA 4YRUA 3NSOA 1YRUB 2K2FA 1XFWO 1XA5A 3SG7A 1UWOA 2MRDA 3EK8A 1ZOTB 4YGDB 3WNXB 2QPTA 3CZTX 2LM5A 1J55A 1CMGA 1JF2A 2FJYA 2PVBA 5FYXA 1CM4A 2Y1NA 1TWOA 2LHIA 1CFCA 5KTYA 1XK4A 1BF5A 1SNLA 4GUKA 2M1UA 2BL0B 1EH2A 4PE1A 1JWDA 1T14A 1PSRA 5JOLA 1S5GZ 1EL4A 4DCKA 3F45A 3VB1A 1L2OB 1AJ5A 3I5HB 2KQYA 5F6TA 1MWNA 1K90D 1LA0A 2KOTA 1F71A 2CXJA 1KSMA 1SL7A 3DVJA 4HRGA 4MZJA 2BCXA 2TN4A 3TZ1A 1OZSA 3NHTA 1F70A 1F4OA 2LANA 1P28A 1Y0VH 5HL1A 1BJFA 1MHOA 2PSRA 3FS7A 1KQMC 3JTDB 2WCLA 3OX5A 2M1KB 5ER4X 1BU3A 4BY4A 2WCHA 4AQIA 1UHKA 1ALVA 2BNXA 2FCDA 2M9GA 3I5IB 3PLFB 4L9MA 3RLZA 2CT9A 1NP8A 3D78A 1DTLA 5CPVA 3AAJA 3SG4A 1AK8A 3OBVA 3CS1A 1CFPA 2H2KA 4GGNA 1DC1A 3Q8IA 4YGCB 1CLLA 5D3OA 1K9KA 5KU1A 1WRKA 1ZUZA 1S26D 3A4UB 2WCKA 1SR6B 1WLZA 4M2QA 5HKWA 3SG3A 3O2PA 2WCMA 3DY9A 1CDPA 2V53A 2JWWA 1FF1A 2JU0A 2K8MB 2KQ6A 3HCMA 4N1FA 2H8VA 3GOFA 3OB2B 2BBNA 1HQVA 1C07A 3VRNA 5B8IB 2G2BA 1V1FA 3EVUA 2K7BA 3PM8A 3FE9A 1K8UA 2L50A 3VROA 2LVKA 2K7OA 1N2DA 3PFVA 3SS5A 1UP5A 3TS5C 5I8NA 3ZNIA 1PVBA 1YVHA 3DYEA 1QV1A 3O78A 2KPHA 1R2UA 1QASA 2K60A 4I5KA 4F7FA 3I5HC 2O60A 2WCFA 3SS3A 3V2LA 4OVNF 1V1GA 4OV2A 5CSJA 1JF0A 1C3ZA 1K96A 1Y1AA 4MZLA 1AP4A 2BBMA 2L4HA 4GGFA 1MUXA 1F55A 2EGDA 2PMYA 3OP0A 1F8HA 3QRXA 1RJVA 1DJWA 1R6PA 2COLB 3S0AA 1FI6A 1JUOA 2K2AA 1XFZO 1PULA 1M31A 2MA2A 2ISDA 2LP2A 2QEVA 4ORBB 3TUYB 1CNPA 3I5FB 5J3XA 5DKRA 1D1OA 2A4JA 2JTTA 1NWDA 1TRFA 5ER5A 1IG5A 2WCJA 3KF9A 4CLNA 2L98A 4INXA 3SS4A 2BCAA 1K9PA 3L4AA 2B1UA 2KSPA 1OOFA 1IKUA 1CB1A 1M45A 1DJGA 1SBJA 2AMIA 2LV7A 2Q91A 1NCXA 1BG1A 5CSFA 1KFXL 1KSOA 2LAPA 3CABA 1UHJA 2KFGA 2WNDA 3FIAA 1SL9A 3BJHA 3O4XA 3CTNA 1EG3A 2ZN9A 3GK2A 5G08A 4HREE 2L5YA 1J7PA 2M7LA 1NPQA 3M0WA 2JNFA 3NGVA 5CSIA 1B47A 2E6WA 2KI4C 1UURA 3FE8A 3B6XA 2GTEA 1QIWA 2KFFA 1KK7Z 3BQ3A 1XVJA 2M7NA 1DELA 2MJWB 4JKTA 1C7VA 2NXQA 3DVKA 1DJZA 1NSHA 2L5XB 3BUMB 5I2QA 3E3RA 2F8PA 1F4QA 1OZOA 1QVIY 2FJUB 2CNPA 1BR1B 1M46A 2JT3A 1TIZA 3AKAA 1RECA 1GGZA 2KGBC 1QVIZ 1IH0A 1DF0B 2LLUA 5AANA 1SYMA 1K93D 1AJ4A 1XFVO 3BUWB 1CDNA 1PK0D 2LLSA 1CDLA 2F3ZA 4GPLB 1LS8A 2KNEA 2WCBA 3CR2A 4JD9A 1IQ3A 1UUSA 2E30A 1CTRA 5DICA 3CDNA 3DVEA 3K21A 4UPGA 3WXAA 2HPSA 1KCYA
chains in the Genus database with same CATH topology
1XO5A 3HX4A 1IJ6A 1SKTA 2HQWA 2M8UA 4JPZB 4C0JA 2HQ8A 1L2OC 1WLMA 3EVRA 4FTGA 3SG6A 2KBIA 4QJ4B 5BPJA 1F54A 2MAZA 4M2PA 2BECA 4JQ0D 1MQ1A 3DVMA 1XYDA 1SCVA 3TDZA 1ZMZA 3VRPA 1QLSA 1UHIA 2OTGC 3BOWA 4AQJA 1C7WA 3KO0A 1DMOA 5JJGA 1J1EA 1NIWA 1S5GY 2KFHA 1QX5B 1KWOB 4YGEB 4FQOA 2KI4B 2NCOA 2SCPA 1CLMA 2JNXA 2K7CA 1BOCA 1OSAA 3BXKA 1MXLC 1RFJA 4CFQA 4DUQA 2Y5IA 2SASA 1NCYA 1UHHA 1E8AA 4A4CA 2KAVA 2O5GA 5DKQA 1DJHA 2MHHA 3BUOB 3SG5A 1KFUL 3BOWB 2JC2A 1CMFA 2WOSA 2Q4UA 4D1EA 4ZCVA 1M39A 3EVVA 4MSPA 4AOMA 3FWCA 2LUXA 1LVCD 5HKYA 1CFDA 3C1VA 1YUTA 3H4SE 2ZNDA 2LE9B 2WC8A 2DOQA 4C0KA 2I94A 1YVLA 3FWBA 3KPXA 4TNCA 3IQQA 4YBHB 5CSNA 2M49B 1B8RA 1IRJA 1PRWA 2PRUA 2ZKMX 3D0YA 2KAYA 2BKIB 4MVFA 1TN4A 3PN7C 5TNCA 1G33A 1FI5A 2KBMA 1SRAA 2HETA 1ZACA 5I2OA 2G9BA 1KK8B 1BT6A 2QACA 5AXIA 4I5NB 4OKHA 4PE7A 1TNWA 4XJKA 1A4PA 3LL8B 5K89A 2WORA 1WRZA 1ZFSA 1CDMA 4Q04A 3PATA 4HRHA 1EJ3A 3DF0A 2JQ6A 4MLWA 2LVIA 2FCEA 2NZ0A 4PE4A 2OTGB 2KGRA 1IWQA 4NDDA 2EHBA 3LLEA 1QIVA 3A8RA 4WRIA 3D0YB 3CR4X 1J7RA 1SCMB 2CCMA 1GJYA 1NYAA 1KWOC 4WQ2A 1TTXA 1BODA 1RTP1 2GV5A 1QLKA 1BMOA 1DGVA 2H61C 4NDCA 3CLNA 3LK0A 1B1GA 2L2EA 2CBLA 1B7TZ 1U5IB 3EK7A 1XFYO 2GGZA 2BCBA 3CWGA 1B7TY 1J1DA 2M3WA 4CPVA 1LINA 1IQ5A 1Y1XA 2EC6B 4I5JA 1G8IA 2LVJA 4PHKA 1TNXA 3D10A 4GAOA 1NX2A 2KYCA 4YGAA 2JXCA 3LCPC 1QX2A 4QJ5B 4XYNA 1XFXO 4N5XA 3O6BA 3BUXB 1SK6D 1QXPA 1QV0A 1DGUA 1K94A 2LC5A 1LA3A 1Y6WA 1K2HA 1CM1A 1JBAA 2JT0A 2WCEA 1YX7A 1FW4A 1MF8B 1FBVA 1SW8A 1HT9A 3PN7B 2KI6D 2JPTA 4F0ZB 1JFKA 2M29A 2MLFC 2F2OA 3MSEB 4YI8A 5DKNA 4MRXA 2I2RE 3VRQA 1YRTB 3VGOA 1N65A 1YURA 1RK9A 3VRRA 1S6JA 4ORCB 2Y4QA 3JVTB 3BYAA 1XK4C 5AEQA 3IF7A 1OE9B 1EG4A 1RROA 1PSBA 1SCMC 2KAXA 2M0RA 1FPWA 1JFJA 2NLNA 1TNQA 1PVAA 2L4IA 1NCZA 3GK4X 1N0YA 3RM1A 4GBAA 1W7JB 4P2YB 1S36A 2ZRSA 1L7ZA 1TNPA 1WDCC 2AUCA 3PSRA 5AFPA 1OQPA 2ZNEA 5GQQC 1YUSA 1X02A 4N1GA 2BE4A 5PALA 2LUCA 4P5OE 1TCOB 2GGMA 2LMTA 2LHLA 5HKZA 1A03A 2JULA 1H8BA 1DJXA 1U5IA 2BL0C 4NDBA 4ZCUA 2PALA 2BE6A 4MRYA 1SMGA 4MZKA 4USLA 1GGWA 1B9AA 2JTZA 1BR4B 1CLBA 1UHNA 2F33A 1YR5A 2HF5A 5HLOA 4DIRA 1QATA 3WHUB 5IBWA 1KFUS 4OCIA 1DVIA 4DRWA 3NXAA 2LVVA 1A75A 4YI9A 1NUBA 5AERA 1J7OA 5D69A 3CGAA 1YUUA 3SIBA 4DS7A 2LLTA 3JTDC 1IJ5A 1KQMB 4PHNA 4BY5A 1GQMA 2AAOA 1A29A 1DF0A 2FOTA 3SIAA 1AHRA 4MEWA 2ZRTA 2Y1MA 3I5IC 4IL1A 1AUIB 4MN0A 4PDZA 1ALWA 1CKKA 2JZIA 3KEVA 1NX1A 1S1EA 2K7DA 2OS8B 2L0PA 3JVTC 1XFUO 2NCPA 1S3PA 2MBXA 1SR6C 4GNKB 2R2IA 1B4CA 2JT8A 4CIDA 3EKJA 1SY9A 1TOPA 3I5GC 4WQ3A 1W7IB 3SJSA 2LP3A 2M97A 1WY9A 2ZN8A 1KK8C 4C0LA 1Q80A 1WDCB 1S6IA 2I18A 1A2XA 4ORAB 1M63B 1QX7A 1MXEA 1JC2A 2K61A 1SPYA 4R1EA 4XJKB 5HYDA 3CR5X 3TS5B 1QS7A 4ETOA 2VRGA 2PASA 3BUNB 4I5LB 1OOJA 2LMVA 2LCPA 1SL8A 4PHJA 1KK7Y 3SG2A 3IQOA 4U8DA 5I2LA 1DJYA 1QJTA 1OMVA 4ICBA 3KHEA 3ICBA 3OHMB 1MR8A 3NSLA 3AKBA 1NX0A 2CTNA 2KYFA 1K9UA 2F3YA 3GK1A 2H61A 2P6BB 3O4YA 1K95A 2L51A 2LMUA 4HSZA 1H4BA 1YTZC 2KI6C 2OPOA 3WHTB 2EC6C 5HLVA 4NQGA 1WRLA 1JSAA 1LKJA 3LK1A 3TUYC 1AVSA 1YX8A 2JXLA 3I5FC 4M2OA 1DJIA 1J7QA 3ZWHA 1OMRA 2OS8C 5D7FA 2F2PA 4PALA 4QJ3B 3NSIA 2KDHA 1ODBA 1G4YR 3OB1B 1S6CA 4OR9B 3EK4A 3NSKA 1PALA 1TCFA 4A4BA 2ZFDA 3DF0B 3I5GB 4GGFC 4E68A 2MLEC 4GFTA 4CFRA 1EXRA 4MBEA 1BLQA 1B8CA 1B8LA 1KFXS 2BKHB 4JWQA 1LXFC 2I7AA 3DD4A 4PHMA 5KSZA 3OX6A 2IS9A 3AAKA 2JOJA 1VRKA 2JRFA 3EKHA 4YGBB 4PE0A 1NX3A 3TDUA 1DT7B 1QTXA 1A75B 1OMDA 1RWYA 1Y1UA 2K0JA 2D8NA 2LNKA 3TDIA 2RGIA 4PCWA 1CFFA 1IGVA 3PALA 2KHNA 4YRUA 3NSOA 1YRUB 2K2FA 1XFWO 1XA5A 3SG7A 1UWOA 2MRDA 3EK8A 1ZOTB 4YGDB 3WNXB 2QPTA 3CZTX 2LM5A 1J55A 1CMGA 1JF2A 2PVBA 5FYXA 1CM4A 2Y1NA 2LHIA 1CFCA 5KTYA 1XK4A 1BF5A 1SNLA 4GUKA 2M1UA 2BL0B 1EH2A 4PE1A 1JWDA 1PSRA 5JOLA 1S5GZ 1EL4A 4DCKA 3F45A 1L2OB 1AJ5A 3I5HB 2KQYA 5F6TA 1MWNA 1K90D 1LA0A 2KOTA 1F71A 2CXJA 1KSMA 1SL7A 3DVJA 4HRGA 4MZJA 2BCXA 2TN4A 3TZ1A 1OZSA 1F70A 1F4OA 2LANA 1Y0VH 1BJFA 1MHOA 2PSRA 3FS7A 1KQMC 3JTDB 3OX5A 2M1KB 5ER4X 1BU3A 4BY4A 4AQIA 1UHKA 1ALVA 3I5IB 2FCDA 2M9GA 3PLFB 4L9MA 3RLZA 2CT9A 1NP8A 5CPVA 1DTLA 3SG4A 3AAJA 1AK8A 1CFPA 1KQVA 3CS1A 2H2KA 4GGNA 4YGCB 1CLLA 1K9KA 5KU1A 1WRKA 1ZUZA 1S26D 3A4UB 1SR6B 1WLZA 4M2QA 5HKWA 3SG3A 3O2PA 1CDPA 2V53A 2JWWA 1FF1A 2JU0A 2K8MB 2KQ6A 3HCMA 4N1FA 3GOFA 3OB2B 2BBNA 1HQVA 1C07A 3VRNA 5B8IB 2G2BA 1V1FA 3EVUA 2K7BA 3PM8A 1K8UA 2L50A 3VROA 2LVKA 2K7OA 1N2DA 3PFVA 1UP5A 3TS5C 5I8NA 3ZNIA 1PVBA 1YVHA 1QV1A 3O78A 1R2UA 1QASA 4I5KA 3I5HC 2O60A 2WCFA 4OVNF 1V1GA 4OV2A 5CSJA 1JF0A 1K96A 1Y1AA 4MZLA 1AP4A 2BBMA 2L4HA 4GGFA 1MUXA 1F55A 2EGDA 2PMYA 3OP0A 1F8HA 3QRXA 1RJVA 1DJWA 1R6PA 2COLB 1FI6A 1JUOA 2K2AA 1XFZO 1PULA 1M31A 2MA2A 2ISDA 2LP2A 4ORBB 3TUYB 1CNPA 3I5FB 5J3XA 5DKRA 1D1OA 2A4JA 2JTTA 1NWDA 1TRFA 5ER5A 1IG5A 3KF9A 4CLNA 2L98A 2BCAA 1K9PA 2B1UA 2KSPA 1CB1A 1IKUA 1M45A 1DJGA 1SBJA 2AMIA 2LV7A 2Q91A 1NCXA 1BG1A 5CSFA 1KFXL 1KSOA 2LAPA 1UHJA 2KFGA 2WNDA 3FIAA 1SL9A 3CTNA 1EG3A 2ZN9A 3GK2A 5G08A 4HREE 1J7PA 2M7LA 1NPQA 3M0WA 2JNFA 5CSIA 1B47A 2E6WA 2KI4C 1UURA 1QIWA 2KFFA 1KK7Z 3BQ3A 1XVJA 2M7NA 2MJWB 1C7VA 2NXQA 3DVKA 1DJZA 1NSHA 2L5XB 3BUMB 5I2QA 3E3RA 2F8PA 1F4QA 1OZOA 1QVIY 2FJUB 2CNPA 1BR1B 1M46A 2JT3A 1TIZA 3AKAA 1RECA 1GGZA 2KGBC 1QVIZ 1IH0A 1DF0B 2LLUA 5AANA 1SYMA 1K93D 1AJ4A 1XFVO 3BUWB 1CDNA 1PK0D 2LLSA 1CDLA 2F3ZA 4GPLB 2KNEA 2WCBA 3CR2A 1IQ3A 1UUSA 2E30A 1CTRA 3DVEA 3K21A 4UPGA 3WXAA 2HPSA 1KCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XO5 A;  3HX4 A;  1IJ6 A;  1SKT A;  2HQW A;  2M8U A;  4JPZ B;  4C0J A;  2HQ8 A;  1L2O C;  1WLM A;  3EVR A;  4FTG A;  3SG6 A;  2KBI A;  4QJ4 B;  5BPJ A;  1F54 A;  2MAZ A;  4M2P A;  2BEC A;  4JQ0 D;  1MQ1 A;  3DVM A;  1XYD A;  1SCV A;  3TDZ A;  1ZMZ A;  3VRP A;  1QLS A;  1UHI A;  2OTG C;  3BOW A;  4AQJ A;  1C7W A;  3KO0 A;  1DMO A;  5JJG A;  1J1E A;  1NIW A;  1S5G Y;  2KFH A;  1QX5 B;  1KWO B;  4YGE B;  4FQO A;  2KI4 B;  2NCO A;  2SCP A;  1CLM A;  2JNX A;  2K7C A;  1BOC A;  1OSA A;  3BXK A;  1MXL C;  1RFJ A;  4CFQ A;  4DUQ A;  2Y5I A;  2SAS A;  1NCY A;  1UHH A;  1E8A A;  4A4C A;  2KAV A;  2O5G A;  5DKQ A;  1DJH A;  2MHH A;  3BUO B;  3SG5 A;  1KFU L;  3BOW B;  2JC2 A;  1CMF A;  2WOS A;  2Q4U A;  4D1E A;  4ZCV A;  1M39 A;  3EVV A;  4MSP A;  4AOM A;  3FWC A;  2LUX A;  1LVC D;  5HKY A;  1CFD A;  3C1V A;  1YUT A;  3H4S E;  2ZND A;  2LE9 B;  2WC8 A;  2DOQ A;  4C0K A;  2I94 A;  1YVL A;  3FWB A;  3KPX A;  4TNC A;  3IQQ A;  4YBH B;  5CSN A;  2M49 B;  1B8R A;  1IRJ A;  1PRW A;  2PRU A;  2ZKM X;  3D0Y A;  2KAY A;  2BKI B;  4MVF A;  1TN4 A;  3PN7 C;  5TNC A;  1G33 A;  1FI5 A;  2KBM A;  1SRA A;  2HET A;  1ZAC A;  5I2O A;  2G9B A;  1KK8 B;  1BT6 A;  2QAC A;  5AXI A;  4I5N B;  4OKH A;  4PE7 A;  1TNW A;  4XJK A;  1A4P A;  3LL8 B;  5K89 A;  2WOR A;  1WRZ A;  1ZFS A;  1CDM A;  4Q04 A;  3PAT A;  4HRH A;  1EJ3 A;  3DF0 A;  2JQ6 A;  4MLW A;  2LVI A;  2FCE A;  2NZ0 A;  4PE4 A;  2OTG B;  2KGR A;  1IWQ A;  4NDD A;  2EHB A;  3LLE A;  1QIV A;  3A8R A;  4WRI A;  3D0Y B;  3CR4 X;  1J7R A;  1SCM B;  2CCM A;  1GJY A;  1NYA A;  1KWO C;  4WQ2 A;  1TTX A;  1BOD A;  1RTP 1;  2GV5 A;  1QLK A;  1BMO A;  1DGV A;  2H61 C;  4NDC A;  3CLN A;  3LK0 A;  1B1G A;  2L2E A;  2CBL A;  1B7T Z;  1U5I B;  3EK7 A;  1XFY O;  2GGZ A;  2BCB A;  3CWG A;  1B7T Y;  1J1D A;  2M3W A;  4CPV A;  1LIN A;  1IQ5 A;  1Y1X A;  2EC6 B;  4I5J A;  1G8I A;  2LVJ A;  4PHK A;  1TNX A;  3D10 A;  4GAO A;  1NX2 A;  2KYC A;  4YGA A;  2JXC A;  3LCP C;  1QX2 A;  4QJ5 B;  4XYN A;  1XFX O;  4N5X A;  3O6B A;  3BUX B;  1SK6 D;  1QXP A;  1QV0 A;  1DGU A;  1K94 A;  2LC5 A;  1LA3 A;  1Y6W A;  1K2H A;  1CM1 A;  1JBA A;  2JT0 A;  2WCE A;  1YX7 A;  1FW4 A;  1MF8 B;  1FBV A;  1SW8 A;  1HT9 A;  3PN7 B;  2KI6 D;  2JPT A;  4F0Z B;  1JFK A;  2M29 A;  2MLF C;  2F2O A;  3MSE B;  4YI8 A;  5DKN A;  4MRX A;  2I2R E;  3VRQ A;  1YRT B;  3VGO A;  1N65 A;  1YUR A;  1RK9 A;  3VRR A;  1S6J A;  4ORC B;  2Y4Q A;  3JVT B;  3BYA A;  1XK4 C;  5AEQ A;  3IF7 A;  1OE9 B;  1EG4 A;  1RRO A;  1PSB A;  1SCM C;  2KAX A;  2M0R A;  1FPW A;  1JFJ A;  2NLN A;  1TNQ A;  1PVA A;  2L4I A;  1NCZ A;  3GK4 X;  1N0Y A;  3RM1 A;  4GBA A;  1W7J B;  4P2Y B;  1S36 A;  2ZRS A;  1L7Z A;  1TNP A;  1WDC C;  2AUC A;  3PSR A;  5AFP A;  1OQP A;  2ZNE A;  5GQQ C;  1YUS A;  1X02 A;  4N1G A;  2BE4 A;  5PAL A;  2LUC A;  4P5O E;  1TCO B;  2GGM A;  2LMT A;  2LHL A;  5HKZ A;  1A03 A;  2JUL A;  1H8B A;  1DJX A;  1U5I A;  2BL0 C;  4NDB A;  4ZCU A;  2PAL A;  2BE6 A;  4MRY A;  1SMG A;  4MZK A;  4USL A;  1GGW A;  1B9A A;  2JTZ A;  1BR4 B;  1CLB A;  1UHN A;  2F33 A;  1YR5 A;  2HF5 A;  5HLO A;  4DIR A;  1QAT A;  3WHU B;  5IBW A;  1KFU S;  4OCI A;  1DVI A;  4DRW A;  3NXA A;  2LVV A;  1A75 A;  4YI9 A;  1NUB A;  5AER A;  1J7O A;  5D69 A;  3CGA A;  1YUU A;  3SIB A;  4DS7 A;  2LLT A;  3JTD C;  1IJ5 A;  1KQM B;  4PHN A;  4BY5 A;  1GQM A;  2AAO A;  1A29 A;  1DF0 A;  2FOT A;  3SIA A;  1AHR A;  4MEW A;  2ZRT A;  2Y1M A;  3I5I C;  4IL1 A;  1AUI B;  4MN0 A;  4PDZ A;  1ALW A;  1CKK A;  2JZI A;  3KEV A;  1NX1 A;  1S1E A;  2K7D A;  2OS8 B;  2L0P A;  3JVT C;  1XFU O;  2NCP A;  1S3P A;  2MBX A;  1SR6 C;  4GNK B;  2R2I A;  1B4C A;  2JT8 A;  4CID A;  3EKJ A;  1SY9 A;  1TOP A;  3I5G C;  4WQ3 A;  1W7I B;  3SJS A;  2LP3 A;  2M97 A;  1WY9 A;  2ZN8 A;  1KK8 C;  4C0L A;  1Q80 A;  1WDC B;  1S6I A;  2I18 A;  1A2X A;  4ORA B;  1M63 B;  1QX7 A;  1MXE A;  1JC2 A;  2K61 A;  1SPY A;  4R1E A;  4XJK B;  5HYD A;  3CR5 X;  3TS5 B;  1QS7 A;  4ETO A;  2VRG A;  2PAS A;  3BUN B;  4I5L B;  1OOJ A;  2LMV A;  2LCP A;  1SL8 A;  4PHJ A;  1KK7 Y;  3SG2 A;  3IQO A;  4U8D A;  5I2L A;  1DJY A;  1QJT A;  1OMV A;  4ICB A;  3KHE A;  3ICB A;  3OHM B;  1MR8 A;  3NSL A;  3AKB A;  1NX0 A;  2CTN A;  2KYF A;  1K9U A;  2F3Y A;  3GK1 A;  2H61 A;  2P6B B;  3O4Y A;  1K95 A;  2L51 A;  2LMU A;  4HSZ A;  1H4B A;  1YTZ C;  2KI6 C;  2OPO A;  3WHT B;  2EC6 C;  5HLV A;  4NQG A;  1WRL A;  1JSA A;  1LKJ A;  3LK1 A;  3TUY C;  1AVS A;  1YX8 A;  2JXL A;  3I5F C;  4M2O A;  1DJI A;  1J7Q A;  3ZWH A;  1OMR A;  2OS8 C;  5D7F A;  2F2P A;  4PAL A;  4QJ3 B;  3NSI A;  2KDH A;  1ODB A;  1G4Y R;  3OB1 B;  1S6C A;  4OR9 B;  3EK4 A;  3NSK A;  1PAL A;  1TCF A;  4A4B A;  2ZFD A;  3DF0 B;  3I5G B;  4GGF C;  4E68 A;  2MLE C;  4GFT A;  4CFR A;  1EXR A;  4MBE A;  1BLQ A;  1B8C A;  1B8L A;  1KFX S;  2BKH B;  4JWQ A;  1LXF C;  2I7A A;  3DD4 A;  4PHM A;  5KSZ A;  3OX6 A;  2IS9 A;  3AAK A;  2JOJ A;  1VRK A;  2JRF A;  3EKH A;  4YGB B;  4PE0 A;  1NX3 A;  3TDU A;  1DT7 B;  1QTX A;  1A75 B;  1OMD A;  1RWY A;  1Y1U A;  2K0J A;  2D8N A;  2LNK A;  3TDI A;  2RGI A;  4PCW A;  1CFF A;  1IGV A;  3PAL A;  2KHN A;  4YRU A;  3NSO A;  1YRU B;  2K2F A;  1XFW O;  1XA5 A;  3SG7 A;  1UWO A;  2MRD A;  3EK8 A;  1ZOT B;  4YGD B;  3WNX B;  2QPT A;  3CZT X;  2LM5 A;  1J55 A;  1CMG A;  1JF2 A;  2PVB A;  5FYX A;  1CM4 A;  2Y1N A;  2LHI A;  1CFC A;  5KTY A;  1XK4 A;  1BF5 A;  1SNL A;  4GUK A;  2M1U A;  2BL0 B;  1EH2 A;  4PE1 A;  1JWD A;  1PSR A;  5JOL A;  1S5G Z;  1EL4 A;  4DCK A;  3F45 A;  1L2O B;  1AJ5 A;  3I5H B;  2KQY A;  5F6T A;  1MWN A;  1K90 D;  1LA0 A;  2KOT A;  1F71 A;  2CXJ A;  1KSM A;  1SL7 A;  3DVJ A;  4HRG A;  4MZJ A;  2BCX A;  2TN4 A;  3TZ1 A;  1OZS A;  1F70 A;  1F4O A;  2LAN A;  1Y0V H;  1BJF A;  1MHO A;  2PSR A;  3FS7 A;  1KQM C;  3JTD B;  3OX5 A;  2M1K B;  5ER4 X;  1BU3 A;  4BY4 A;  4AQI A;  1UHK A;  1ALV A;  3I5I B;  2FCD A;  2M9G A;  3PLF B;  4L9M A;  3RLZ A;  2CT9 A;  1NP8 A;  5CPV A;  1DTL A;  3SG4 A;  3AAJ A;  1AK8 A;  1CFP A;  1KQV A;  3CS1 A;  2H2K A;  4GGN A;  4YGC B;  1CLL A;  1K9K A;  5KU1 A;  1WRK A;  1ZUZ A;  1S26 D;  3A4U B;  1SR6 B;  1WLZ A;  4M2Q A;  5HKW A;  3SG3 A;  3O2P A;  1CDP A;  2V53 A;  2JWW A;  1FF1 A;  2JU0 A;  2K8M B;  2KQ6 A;  3HCM A;  4N1F A;  3GOF A;  3OB2 B;  2BBN A;  1HQV A;  1C07 A;  3VRN A;  5B8I B;  2G2B A;  1V1F A;  3EVU A;  2K7B A;  3PM8 A;  1K8U A;  2L50 A;  3VRO A;  2LVK A;  2K7O A;  1N2D A;  3PFV A;  1UP5 A;  3TS5 C;  5I8N A;  3ZNI A;  1PVB A;  1YVH A;  1QV1 A;  3O78 A;  1R2U A;  1QAS A;  4I5K A;  3I5H C;  2O60 A;  2WCF A;  4OVN F;  1V1G A;  4OV2 A;  5CSJ A;  1JF0 A;  1K96 A;  1Y1A A;  4MZL A;  1AP4 A;  2BBM A;  2L4H A;  4GGF A;  1MUX A;  1F55 A;  2EGD A;  2PMY A;  3OP0 A;  1F8H A;  3QRX A;  1RJV A;  1DJW A;  1R6P A;  2COL B;  1FI6 A;  1JUO A;  2K2A A;  1XFZ O;  1PUL A;  1M31 A;  2MA2 A;  2ISD A;  2LP2 A;  4ORB B;  3TUY B;  1CNP A;  3I5F B;  5J3X A;  5DKR A;  1D1O A;  2A4J A;  2JTT A;  1NWD A;  1TRF A;  5ER5 A;  1IG5 A;  3KF9 A;  4CLN A;  2L98 A;  2BCA A;  1K9P A;  2B1U A;  2KSP A;  1CB1 A;  1IKU A;  1M45 A;  1DJG A;  1SBJ A;  2AMI A;  2LV7 A;  2Q91 A;  1NCX A;  1BG1 A;  5CSF A;  1KFX L;  1KSO A;  2LAP A;  1UHJ A;  2KFG A;  2WND A;  3FIA A;  1SL9 A;  3CTN A;  1EG3 A;  2ZN9 A;  3GK2 A;  5G08 A;  4HRE E;  1J7P A;  2M7L A;  1NPQ A;  3M0W A;  2JNF A;  5CSI A;  1B47 A;  2E6W A;  2KI4 C;  1UUR A;  1QIW A;  2KFF A;  1KK7 Z;  3BQ3 A;  1XVJ A;  2M7N A;  2MJW B;  1C7V A;  2NXQ A;  3DVK A;  1DJZ A;  1NSH A;  2L5X B;  3BUM B;  5I2Q A;  3E3R A;  2F8P A;  1F4Q A;  1OZO A;  1QVI Y;  2FJU B;  2CNP A;  1BR1 B;  1M46 A;  2JT3 A;  1TIZ A;  3AKA A;  1REC A;  1GGZ A;  2KGB C;  1QVI Z;  1IH0 A;  1DF0 B;  2LLU A;  5AAN A;  1SYM A;  1K93 D;  1AJ4 A;  1XFV O;  3BUW B;  1CDN A;  1PK0 D;  2LLS A;  1CDL A;  2F3Z A;  4GPL B;  2KNE A;  2WCB A;  3CR2 A;  1IQ3 A;  1UUS A;  2E30 A;  1CTR A;  3DVE A;  3K21 A;  4UPG A;  3WXA A;  2HPS A;  1KCY A; 
#chains in the Genus database with same CATH topology
 3CYZ A;  1XO5 A;  2P71 A;  3HX4 A;  4FQT A;  1IJ6 A;  1SKT A;  2HQW A;  2M8U A;  4JPZ B;  4C0J A;  2HQ8 A;  1L2O C;  1WLM A;  3EVR A;  4FTG A;  3SG6 A;  2ERB A;  2KBI A;  4QJ4 B;  5BPJ A;  1F54 A;  2MAZ A;  1OOH A;  3DZT A;  4M2P A;  2BEC A;  4JQ0 D;  1MQ1 A;  3B7A A;  3DVM A;  1XYD A;  1SCV A;  3TDZ A;  1ZMZ A;  2QEH A;  1QLS A;  1UHI A;  2OTG C;  3BOW A;  3VRP A;  1DEK A;  3D76 A;  4AQJ A;  1C7W A;  3KO0 A;  1DMO A;  5FI7 A;  5JJG A;  1J1E A;  1NIW A;  1S5G Y;  2KFH A;  3L4L A;  1QX5 B;  3CZ0 A;  1KWO B;  4YGE B;  4FQO A;  2KI4 B;  2NCO A;  2SCP A;  1CLM A;  2JNX A;  2K7C A;  1BOC A;  1OSA A;  3BXK A;  1MXL C;  1RFJ A;  4CFQ A;  4DUQ A;  2Y5I A;  2SAS A;  1NCY A;  1UHH A;  1E8A A;  4A4C A;  3OGN A;  2KAV A;  2O5G A;  5DKQ A;  1DJH A;  2MHH A;  3BUO B;  3SG5 A;  1XFR A;  1KFU L;  3BOW B;  2JC2 A;  1OOI X;  3R1V A;  3NHI A;  1CMF A;  1DQE A;  2WOS A;  2Q4U A;  3L47 A;  4D1E A;  4ZCV A;  1M39 A;  3EVV A;  4MSP A;  4AOM A;  3FWC A;  2LUX A;  1LVC D;  3UNW A;  5HKY A;  1CFD A;  3C1V A;  1YUT A;  3H4S E;  2ZND A;  2LE9 B;  2WC8 A;  2DOQ A;  4C0K A;  2I94 A;  1YVL A;  2L2C A;  3FWB A;  2WC6 A;  3KPX A;  4TNC A;  3IQQ A;  4YBH B;  5CSN A;  2M49 B;  1B8R A;  1IRJ A;  1PRW A;  2PRU A;  2ZKM X;  3D0Y A;  2KAY A;  2BKI B;  4MVF A;  1TN4 A;  3PN7 C;  5TNC A;  1G33 A;  1FI5 A;  2KBM A;  1SRA A;  2HET A;  1ZAC A;  5I2O A;  2G9B A;  1KK8 B;  1BT6 A;  2QAC A;  5AXI A;  4I5N B;  4OKH A;  4PE7 A;  1TNW A;  4XJK A;  1A4P A;  1TUJ A;  3LL8 B;  5K89 A;  2WOR A;  1WRZ A;  1ZFS A;  1CDM A;  4Q04 A;  3PAT A;  4HRH A;  2KLE A;  3CZ2 A;  3PJI A;  1EJ3 A;  3DF0 A;  2JQ6 A;  4MLW A;  2LVI A;  2FCE A;  2NZ0 A;  4PE4 A;  2OTG B;  2KGR A;  1IWQ A;  4NDD A;  2EHB A;  3LLE A;  1QIV A;  3A8R A;  4WRI A;  3D0Y B;  1Z4H A;  3CR4 X;  1J7R A;  1SCM B;  2CCM A;  1GJY A;  1NYA A;  1KWO C;  4WQ2 A;  1TTX A;  1BOD A;  1RTP 1;  2GV5 A;  1QLK A;  1BMO A;  1DGV A;  2H61 C;  4NDC A;  3UO9 A;  3CLN A;  2BAP A;  3LK0 A;  1B1G A;  2L2E A;  2CBL A;  1B7T Z;  1U5I B;  3EK7 A;  2QEO A;  1XFY O;  2GGZ A;  2BCB A;  2YGU A;  3CWG A;  1ORG A;  1B7T Y;  1J1D A;  2M3W A;  3D77 A;  1LIN A;  4CPV A;  1IQ5 A;  1Y1X A;  2EC6 B;  4I5J A;  1G8I A;  2LVJ A;  4PHK A;  1TNX A;  3D10 A;  4GAO A;  1NX2 A;  2KYC A;  4YGA A;  2JXC A;  3LCP C;  1QX2 A;  4QJ5 B;  4XYN A;  1XFX O;  3R1P A;  4N5X A;  3O6B A;  3BUX B;  1SK6 D;  1QXP A;  1QV0 A;  1DGU A;  1K94 A;  2LC5 A;  1LA3 A;  1Y6W A;  1K2H A;  1CM1 A;  1JBA A;  2JT0 A;  3PM2 A;  2WCE A;  1YX7 A;  1FW4 A;  5FI2 A;  1MF8 B;  1FBV A;  1SW8 A;  1HT9 A;  2KLD A;  1W9Z A;  3PN7 B;  2KI6 D;  2JPT A;  4F0Z B;  1JFK A;  2M29 A;  2MLF C;  2F2O A;  3MSE B;  4YI8 A;  3BFA A;  4MRX A;  2QEB A;  5DKN A;  2I2R E;  3VRQ A;  1IIO A;  1YRT B;  3VGO A;  1N65 A;  3IVT A;  1YUR A;  1RK9 A;  3VRR A;  1S6J A;  4ORC B;  2Y4Q A;  3JVT B;  3BYA A;  1XK4 C;  5AEQ A;  3IF7 A;  1OE9 B;  1EG4 A;  1RRO A;  1PSB A;  1SCM C;  2KAX A;  2M0R A;  1FPW A;  3S0D A;  1SSE B;  2NLN A;  1TNQ A;  3N7H A;  1JFJ A;  1PVA A;  2L4I A;  1NCZ A;  3GK4 X;  1N0Y A;  3RM1 A;  1OW4 A;  4GBA A;  1W7J B;  4P2Y B;  1S36 A;  2ZRS A;  1L7Z A;  3EG5 B;  1TNP A;  1WDC C;  2AUC A;  3PSR A;  5AFP A;  1OQP A;  2ZNE A;  5GQQ C;  4PT1 A;  1YUS A;  1X02 A;  4N1G A;  2BE4 A;  5PAL A;  2LUC A;  4P5O E;  3CZ1 A;  1TCO B;  2GGM A;  2LMT A;  2LHL A;  5HKZ A;  1A03 A;  2JUL A;  1H8B A;  1DJX A;  1U5I A;  2BL0 C;  4NDB A;  3DXL A;  4ZCU A;  1OOG A;  2PAL A;  2BE6 A;  4MRY A;  1SMG A;  4MZK A;  4USL A;  1GGW A;  1B9A A;  2JTZ A;  1BR4 B;  1CLB A;  1UHN A;  2F33 A;  1YR5 A;  2HF5 A;  5HLO A;  4DIR A;  1QAT A;  3WHU B;  3K1E A;  5IBW A;  1KFU S;  2QDI A;  4OCI A;  1DVI A;  4DRW A;  3D74 A;  3NXA A;  2LVV A;  1A75 A;  4INW A;  4YI9 A;  1NUB A;  5AER A;  1J7O A;  4OZD A;  5D69 A;  3CGA A;  1YUU A;  3SIB A;  4DS7 A;  2LLT A;  3D75 A;  3JTD C;  1IJ5 A;  1KQM B;  4PHN A;  4BY5 A;  1GQM A;  2AAO A;  1A29 A;  1DF0 A;  2FOT A;  3SIA A;  1AHR A;  4MEW A;  3QME A;  2ZRT A;  2Y1M A;  3I5I C;  4IL1 A;  1AUI B;  4MN0 A;  4PDZ A;  1ALW A;  1CKK A;  2JZI A;  3KEV A;  1NX1 A;  1S1E A;  2K7D A;  2OS8 B;  2L0P A;  3BFB A;  3B86 A;  3JVT C;  1XFU O;  2NCP A;  1S3P A;  2MBX A;  1SR6 C;  4GNK B;  3FE6 A;  2R2I A;  3BFH A;  1B4C A;  2JT8 A;  4CID A;  3EKJ A;  1SY9 A;  1TOP A;  3I5G C;  4WQ3 A;  1W7I B;  3SJS A;  2LP3 A;  2M97 A;  1WY9 A;  2ZN8 A;  2JPO A;  1KK8 C;  4C0L A;  1Q80 A;  3B88 A;  1WDC B;  5FI6 A;  1S6I A;  2I18 A;  1A2X A;  4ORA B;  1M63 B;  1QX7 A;  2WC5 A;  1MXE A;  1JC2 A;  2K61 A;  1SPY A;  4R1E A;  4XJK B;  5HYD A;  1Z2C B;  3CR5 X;  3S0G A;  3TS5 B;  1QS7 A;  3RZS A;  4ETO A;  2VRG A;  2PAS A;  3BUN B;  4I5L B;  4IJ7 A;  1OOJ A;  2LMV A;  2LCP A;  1SL8 A;  4PHJ A;  1KK7 Y;  3SG2 A;  3IQO A;  4U8D A;  5I2L A;  3B87 A;  1DJY A;  1QJT A;  1OMV A;  4ICB A;  2PYQ A;  3KHE A;  3ICB A;  3OHM B;  1MR8 A;  3NSL A;  3AKB A;  1NX0 A;  2CTN A;  3R1O A;  2KYF A;  1K9U A;  2F3Y A;  3GK1 A;  2H61 A;  2P6B B;  1KQV A;  3O4Y A;  1K95 A;  3S0B A;  2L51 A;  2LMU A;  4HSZ A;  1H4B A;  1YTZ C;  2KI6 C;  2OPO A;  3WHT B;  2EC6 C;  5HLV A;  4NQG A;  1WRL A;  1JSA A;  1LKJ A;  3LK1 A;  3TUY C;  1AVS A;  1YX8 A;  4KYN A;  2JXL A;  3I5F C;  4M2O A;  2PQL A;  1DJI A;  1J7Q A;  1QWV A;  3ZWH A;  1OMR A;  1C3Y A;  2OS8 C;  5D7F A;  2F2P A;  5EL2 A;  4PAL A;  4QJ3 B;  3NSI A;  2KDH A;  1ODB A;  1G4Y R;  3OB1 B;  1S6C A;  4OR9 B;  3EK4 A;  3NSK A;  1PAL A;  2P70 A;  1TCF A;  5I94 A;  4A4B A;  2ZFD A;  3DF0 B;  3I5G B;  4GGF C;  4E68 A;  2MLE C;  4GFT A;  4CFR A;  1EXR A;  4MBE A;  1BLQ A;  1GM0 A;  1B8C A;  1B8L A;  1KFX S;  2BKH B;  4JWQ A;  1LXF C;  3D73 A;  2I7A A;  3DD4 A;  4PHM A;  5KSZ A;  1TUZ A;  3OX6 A;  2IS9 A;  3AAK A;  2JOJ A;  1VRK A;  2JRF A;  3EKH A;  3R72 A;  4YGB B;  4PE0 A;  1NX3 A;  3S0F A;  3TDU A;  1DT7 B;  1QTX A;  1A75 B;  1OMD A;  1RWY A;  1Y1U A;  2K0J A;  2D8N A;  2LNK A;  3TDI A;  2RGI A;  4PCW A;  1CFF A;  1IGV A;  3PAL A;  3S0E A;  2KHN A;  4YRU A;  3NSO A;  1YRU B;  2K2F A;  1XFW O;  1XA5 A;  3SG7 A;  1UWO A;  2MRD A;  3EK8 A;  1ZOT B;  4YGD B;  3WNX B;  2QPT A;  3CZT X;  2LM5 A;  1J55 A;  1CMG A;  1JF2 A;  2FJY A;  2PVB A;  5FYX A;  1CM4 A;  2Y1N A;  1TWO A;  2LHI A;  1CFC A;  5KTY A;  1XK4 A;  1BF5 A;  1SNL A;  4GUK A;  2M1U A;  2BL0 B;  1EH2 A;  4PE1 A;  1JWD A;  1T14 A;  1PSR A;  5JOL A;  1S5G Z;  1EL4 A;  4DCK A;  3F45 A;  3VB1 A;  1L2O B;  1AJ5 A;  3I5H B;  2KQY A;  5F6T A;  1MWN A;  1K90 D;  1LA0 A;  2KOT A;  1F71 A;  2CXJ A;  1KSM A;  1SL7 A;  3DVJ A;  4HRG A;  4MZJ A;  2BCX A;  2TN4 A;  3TZ1 A;  1OZS A;  3NHT A;  1F70 A;  1F4O A;  2LAN A;  1P28 A;  1Y0V H;  5HL1 A;  1BJF A;  1MHO A;  2PSR A;  3FS7 A;  1KQM C;  3JTD B;  2WCL A;  3OX5 A;  2M1K B;  5ER4 X;  1BU3 A;  4BY4 A;  2WCH A;  4AQI A;  1UHK A;  1ALV A;  2BNX A;  2FCD A;  2M9G A;  3I5I B;  3PLF B;  4L9M A;  3RLZ A;  2CT9 A;  1NP8 A;  3D78 A;  1DTL A;  5CPV A;  3AAJ A;  3SG4 A;  1AK8 A;  3OBV A;  3CS1 A;  1CFP A;  2H2K A;  4GGN A;  1DC1 A;  3Q8I A;  4YGC B;  1CLL A;  5D3O A;  1K9K A;  5KU1 A;  1WRK A;  1ZUZ A;  1S26 D;  3A4U B;  2WCK A;  1SR6 B;  1WLZ A;  4M2Q A;  5HKW A;  3SG3 A;  3O2P A;  2WCM A;  3DY9 A;  1CDP A;  2V53 A;  2JWW A;  1FF1 A;  2JU0 A;  2K8M B;  2KQ6 A;  3HCM A;  4N1F A;  2H8V A;  3GOF A;  3OB2 B;  2BBN A;  1HQV A;  1C07 A;  3VRN A;  5B8I B;  2G2B A;  1V1F A;  3EVU A;  2K7B A;  3PM8 A;  3FE9 A;  1K8U A;  2L50 A;  3VRO A;  2LVK A;  2K7O A;  1N2D A;  3PFV A;  3SS5 A;  1UP5 A;  3TS5 C;  5I8N A;  3ZNI A;  1PVB A;  1YVH A;  3DYE A;  1QV1 A;  3O78 A;  2KPH A;  1R2U A;  1QAS A;  2K60 A;  4I5K A;  4F7F A;  3I5H C;  2O60 A;  2WCF A;  3SS3 A;  3V2L A;  4OVN F;  1V1G A;  4OV2 A;  5CSJ A;  1JF0 A;  1C3Z A;  1K96 A;  1Y1A A;  4MZL A;  1AP4 A;  2BBM A;  2L4H A;  4GGF A;  1MUX A;  1F55 A;  2EGD A;  2PMY A;  3OP0 A;  1F8H A;  3QRX A;  1RJV A;  1DJW A;  1R6P A;  2COL B;  3S0A A;  1FI6 A;  1JUO A;  2K2A A;  1XFZ O;  1PUL A;  1M31 A;  2MA2 A;  2ISD A;  2LP2 A;  2QEV A;  4ORB B;  3TUY B;  1CNP A;  3I5F B;  5J3X A;  5DKR A;  1D1O A;  2A4J A;  2JTT A;  1NWD A;  1TRF A;  5ER5 A;  1IG5 A;  2WCJ A;  3KF9 A;  4CLN A;  2L98 A;  4INX A;  3SS4 A;  2BCA A;  1K9P A;  3L4A A;  2B1U A;  2KSP A;  1OOF A;  1IKU A;  1CB1 A;  1M45 A;  1DJG A;  1SBJ A;  2AMI A;  2LV7 A;  2Q91 A;  1NCX A;  1BG1 A;  5CSF A;  1KFX L;  1KSO A;  2LAP A;  3CAB A;  1UHJ A;  2KFG A;  2WND A;  3FIA A;  1SL9 A;  3BJH A;  3O4X A;  3CTN A;  1EG3 A;  2ZN9 A;  3GK2 A;  5G08 A;  4HRE E;  2L5Y A;  1J7P A;  2M7L A;  1NPQ A;  3M0W A;  2JNF A;  3NGV A;  5CSI A;  1B47 A;  2E6W A;  2KI4 C;  1UUR A;  3FE8 A;  3B6X A;  2GTE A;  1QIW A;  2KFF A;  1KK7 Z;  3BQ3 A;  1XVJ A;  2M7N A;  1DEL A;  2MJW B;  4JKT A;  1C7V A;  2NXQ A;  3DVK A;  1DJZ A;  1NSH A;  2L5X B;  3BUM B;  5I2Q A;  3E3R A;  2F8P A;  1F4Q A;  1OZO A;  1QVI Y;  2FJU B;  2CNP A;  1BR1 B;  1M46 A;  2JT3 A;  1TIZ A;  3AKA A;  1REC A;  1GGZ A;  2KGB C;  1QVI Z;  1IH0 A;  1DF0 B;  2LLU A;  5AAN A;  1SYM A;  1K93 D;  1AJ4 A;  1XFV O;  3BUW B;  1CDN A;  1PK0 D;  2LLS A;  1CDL A;  2F3Z A;  4GPL B;  1LS8 A;  2KNE A;  2WCB A;  3CR2 A;  4JD9 A;  1IQ3 A;  1UUS A;  2E30 A;  1CTR A;  5DIC A;  3CDN A;  3DVE A;  3K21 A;  4UPG A;  3WXA A;  2HPS A;  1KCY A; 
#chains in the Genus database with same CATH homology
 1XO5 A;  3HX4 A;  1IJ6 A;  1SKT A;  2HQW A;  2M8U A;  4JPZ B;  4C0J A;  2HQ8 A;  1L2O C;  1WLM A;  3EVR A;  4FTG A;  3SG6 A;  2KBI A;  4QJ4 B;  5BPJ A;  1F54 A;  2MAZ A;  4M2P A;  2BEC A;  4JQ0 D;  1MQ1 A;  3DVM A;  1XYD A;  1SCV A;  3TDZ A;  1ZMZ A;  3VRP A;  1QLS A;  1UHI A;  2OTG C;  3BOW A;  4AQJ A;  1C7W A;  3KO0 A;  1DMO A;  5JJG A;  1J1E A;  1NIW A;  1S5G Y;  2KFH A;  1QX5 B;  1KWO B;  4YGE B;  4FQO A;  2KI4 B;  2NCO A;  2SCP A;  1CLM A;  2JNX A;  2K7C A;  1BOC A;  1OSA A;  3BXK A;  1MXL C;  1RFJ A;  4CFQ A;  4DUQ A;  2Y5I A;  2SAS A;  1NCY A;  1UHH A;  1E8A A;  4A4C A;  2KAV A;  2O5G A;  5DKQ A;  1DJH A;  2MHH A;  3BUO B;  3SG5 A;  1KFU L;  3BOW B;  2JC2 A;  1CMF A;  2WOS A;  2Q4U A;  4D1E A;  4ZCV A;  1M39 A;  3EVV A;  4MSP A;  4AOM A;  3FWC A;  2LUX A;  1LVC D;  5HKY A;  1CFD A;  3C1V A;  1YUT A;  3H4S E;  2ZND A;  2LE9 B;  2WC8 A;  2DOQ A;  4C0K A;  2I94 A;  1YVL A;  3FWB A;  3KPX A;  4TNC A;  3IQQ A;  4YBH B;  5CSN A;  2M49 B;  1B8R A;  1IRJ A;  1PRW A;  2PRU A;  2ZKM X;  3D0Y A;  2KAY A;  2BKI B;  4MVF A;  1TN4 A;  3PN7 C;  5TNC A;  1G33 A;  1FI5 A;  2KBM A;  1SRA A;  2HET A;  1ZAC A;  5I2O A;  2G9B A;  1KK8 B;  1BT6 A;  2QAC A;  5AXI A;  4I5N B;  4OKH A;  4PE7 A;  1TNW A;  4XJK A;  1A4P A;  3LL8 B;  5K89 A;  2WOR A;  1WRZ A;  1ZFS A;  1CDM A;  4Q04 A;  3PAT A;  4HRH A;  1EJ3 A;  3DF0 A;  2JQ6 A;  4MLW A;  2LVI A;  2FCE A;  2NZ0 A;  4PE4 A;  2OTG B;  2KGR A;  1IWQ A;  4NDD A;  2EHB A;  3LLE A;  1QIV A;  3A8R A;  4WRI A;  3D0Y B;  3CR4 X;  1J7R A;  1SCM B;  2CCM A;  1GJY A;  1NYA A;  1KWO C;  4WQ2 A;  1TTX A;  1BOD A;  1RTP 1;  2GV5 A;  1QLK A;  1BMO A;  1DGV A;  2H61 C;  4NDC A;  3CLN A;  3LK0 A;  1B1G A;  2L2E A;  2CBL A;  1B7T Z;  1U5I B;  3EK7 A;  1XFY O;  2GGZ A;  2BCB A;  3CWG A;  1B7T Y;  1J1D A;  2M3W A;  4CPV A;  1LIN A;  1IQ5 A;  1Y1X A;  2EC6 B;  4I5J A;  1G8I A;  2LVJ A;  4PHK A;  1TNX A;  3D10 A;  4GAO A;  1NX2 A;  2KYC A;  4YGA A;  2JXC A;  3LCP C;  1QX2 A;  4QJ5 B;  4XYN A;  1XFX O;  4N5X A;  3O6B A;  3BUX B;  1SK6 D;  1QXP A;  1QV0 A;  1DGU A;  1K94 A;  2LC5 A;  1LA3 A;  1Y6W A;  1K2H A;  1CM1 A;  1JBA A;  2JT0 A;  2WCE A;  1YX7 A;  1FW4 A;  1MF8 B;  1FBV A;  1SW8 A;  1HT9 A;  3PN7 B;  2KI6 D;  2JPT A;  4F0Z B;  1JFK A;  2M29 A;  2MLF C;  2F2O A;  3MSE B;  4YI8 A;  5DKN A;  4MRX A;  2I2R E;  3VRQ A;  1YRT B;  3VGO A;  1N65 A;  1YUR A;  1RK9 A;  3VRR A;  1S6J A;  4ORC B;  2Y4Q A;  3JVT B;  3BYA A;  1XK4 C;  5AEQ A;  3IF7 A;  1OE9 B;  1EG4 A;  1RRO A;  1PSB A;  1SCM C;  2KAX A;  2M0R A;  1FPW A;  1JFJ A;  2NLN A;  1TNQ A;  1PVA A;  2L4I A;  1NCZ A;  3GK4 X;  1N0Y A;  3RM1 A;  4GBA A;  1W7J B;  4P2Y B;  1S36 A;  2ZRS A;  1L7Z A;  1TNP A;  1WDC C;  2AUC A;  3PSR A;  5AFP A;  1OQP A;  2ZNE A;  5GQQ C;  1YUS A;  1X02 A;  4N1G A;  2BE4 A;  5PAL A;  2LUC A;  4P5O E;  1TCO B;  2GGM A;  2LMT A;  2LHL A;  5HKZ A;  1A03 A;  2JUL A;  1H8B A;  1DJX A;  1U5I A;  2BL0 C;  4NDB A;  4ZCU A;  2PAL A;  2BE6 A;  4MRY A;  1SMG A;  4MZK A;  4USL A;  1GGW A;  1B9A A;  2JTZ A;  1BR4 B;  1CLB A;  1UHN A;  2F33 A;  1YR5 A;  2HF5 A;  5HLO A;  4DIR A;  1QAT A;  3WHU B;  5IBW A;  1KFU S;  4OCI A;  1DVI A;  4DRW A;  3NXA A;  2LVV A;  1A75 A;  4YI9 A;  1NUB A;  5AER A;  1J7O A;  5D69 A;  3CGA A;  1YUU A;  3SIB A;  4DS7 A;  2LLT A;  3JTD C;  1IJ5 A;  1KQM B;  4PHN A;  4BY5 A;  1GQM A;  2AAO A;  1A29 A;  1DF0 A;  2FOT A;  3SIA A;  1AHR A;  4MEW A;  2ZRT A;  2Y1M A;  3I5I C;  4IL1 A;  1AUI B;  4MN0 A;  4PDZ A;  1ALW A;  1CKK A;  2JZI A;  3KEV A;  1NX1 A;  1S1E A;  2K7D A;  2OS8 B;  2L0P A;  3JVT C;  1XFU O;  2NCP A;  1S3P A;  2MBX A;  1SR6 C;  4GNK B;  2R2I A;  1B4C A;  2JT8 A;  4CID A;  3EKJ A;  1SY9 A;  1TOP A;  3I5G C;  4WQ3 A;  1W7I B;  3SJS A;  2LP3 A;  2M97 A;  1WY9 A;  2ZN8 A;  1KK8 C;  4C0L A;  1Q80 A;  1WDC B;  1S6I A;  2I18 A;  1A2X A;  4ORA B;  1M63 B;  1QX7 A;  1MXE A;  1JC2 A;  2K61 A;  1SPY A;  4R1E A;  4XJK B;  5HYD A;  3CR5 X;  3TS5 B;  1QS7 A;  4ETO A;  2VRG A;  2PAS A;  3BUN B;  4I5L B;  1OOJ A;  2LMV A;  2LCP A;  1SL8 A;  4PHJ A;  1KK7 Y;  3SG2 A;  3IQO A;  4U8D A;  5I2L A;  1DJY A;  1QJT A;  1OMV A;  4ICB A;  3KHE A;  3ICB A;  3OHM B;  1MR8 A;  3NSL A;  3AKB A;  1NX0 A;  2CTN A;  2KYF A;  1K9U A;  2F3Y A;  3GK1 A;  2H61 A;  2P6B B;  3O4Y A;  1K95 A;  2L51 A;  2LMU A;  4HSZ A;  1H4B A;  1YTZ C;  2KI6 C;  2OPO A;  3WHT B;  2EC6 C;  5HLV A;  4NQG A;  1WRL A;  1JSA A;  1LKJ A;  3LK1 A;  3TUY C;  1AVS A;  1YX8 A;  2JXL A;  3I5F C;  4M2O A;  1DJI A;  1J7Q A;  3ZWH A;  1OMR A;  2OS8 C;  5D7F A;  2F2P A;  4PAL A;  4QJ3 B;  3NSI A;  2KDH A;  1ODB A;  1G4Y R;  3OB1 B;  1S6C A;  4OR9 B;  3EK4 A;  3NSK A;  1PAL A;  1TCF A;  4A4B A;  2ZFD A;  3DF0 B;  3I5G B;  4GGF C;  4E68 A;  2MLE C;  4GFT A;  4CFR A;  1EXR A;  4MBE A;  1BLQ A;  1B8C A;  1B8L A;  1KFX S;  2BKH B;  4JWQ A;  1LXF C;  2I7A A;  3DD4 A;  4PHM A;  5KSZ A;  3OX6 A;  2IS9 A;  3AAK A;  2JOJ A;  1VRK A;  2JRF A;  3EKH A;  4YGB B;  4PE0 A;  1NX3 A;  3TDU A;  1DT7 B;  1QTX A;  1A75 B;  1OMD A;  1RWY A;  1Y1U A;  2K0J A;  2D8N A;  2LNK A;  3TDI A;  2RGI A;  4PCW A;  1CFF A;  1IGV A;  3PAL A;  2KHN A;  4YRU A;  3NSO A;  1YRU B;  2K2F A;  1XFW O;  1XA5 A;  3SG7 A;  1UWO A;  2MRD A;  3EK8 A;  1ZOT B;  4YGD B;  3WNX B;  2QPT A;  3CZT X;  2LM5 A;  1J55 A;  1CMG A;  1JF2 A;  2PVB A;  5FYX A;  1CM4 A;  2Y1N A;  2LHI A;  1CFC A;  5KTY A;  1XK4 A;  1BF5 A;  1SNL A;  4GUK A;  2M1U A;  2BL0 B;  1EH2 A;  4PE1 A;  1JWD A;  1PSR A;  5JOL A;  1S5G Z;  1EL4 A;  4DCK A;  3F45 A;  1L2O B;  1AJ5 A;  3I5H B;  2KQY A;  5F6T A;  1MWN A;  1K90 D;  1LA0 A;  2KOT A;  1F71 A;  2CXJ A;  1KSM A;  1SL7 A;  3DVJ A;  4HRG A;  4MZJ A;  2BCX A;  2TN4 A;  3TZ1 A;  1OZS A;  1F70 A;  1F4O A;  2LAN A;  1Y0V H;  1BJF A;  1MHO A;  2PSR A;  3FS7 A;  1KQM C;  3JTD B;  3OX5 A;  2M1K B;  5ER4 X;  1BU3 A;  4BY4 A;  4AQI A;  1UHK A;  1ALV A;  3I5I B;  2FCD A;  2M9G A;  3PLF B;  4L9M A;  3RLZ A;  2CT9 A;  1NP8 A;  5CPV A;  1DTL A;  3SG4 A;  3AAJ A;  1AK8 A;  1CFP A;  1KQV A;  3CS1 A;  2H2K A;  4GGN A;  4YGC B;  1CLL A;  1K9K A;  5KU1 A;  1WRK A;  1ZUZ A;  1S26 D;  3A4U B;  1SR6 B;  1WLZ A;  4M2Q A;  5HKW A;  3SG3 A;  3O2P A;  1CDP A;  2V53 A;  2JWW A;  1FF1 A;  2JU0 A;  2K8M B;  2KQ6 A;  3HCM A;  4N1F A;  3GOF A;  3OB2 B;  2BBN A;  1HQV A;  1C07 A;  3VRN A;  5B8I B;  2G2B A;  1V1F A;  3EVU A;  2K7B A;  3PM8 A;  1K8U A;  2L50 A;  3VRO A;  2LVK A;  2K7O A;  1N2D A;  3PFV A;  1UP5 A;  3TS5 C;  5I8N A;  3ZNI A;  1PVB A;  1YVH A;  1QV1 A;  3O78 A;  1R2U A;  1QAS A;  4I5K A;  3I5H C;  2O60 A;  2WCF A;  4OVN F;  1V1G A;  4OV2 A;  5CSJ A;  1JF0 A;  1K96 A;  1Y1A A;  4MZL A;  1AP4 A;  2BBM A;  2L4H A;  4GGF A;  1MUX A;  1F55 A;  2EGD A;  2PMY A;  3OP0 A;  1F8H A;  3QRX A;  1RJV A;  1DJW A;  1R6P A;  2COL B;  1FI6 A;  1JUO A;  2K2A A;  1XFZ O;  1PUL A;  1M31 A;  2MA2 A;  2ISD A;  2LP2 A;  4ORB B;  3TUY B;  1CNP A;  3I5F B;  5J3X A;  5DKR A;  1D1O A;  2A4J A;  2JTT A;  1NWD A;  1TRF A;  5ER5 A;  1IG5 A;  3KF9 A;  4CLN A;  2L98 A;  2BCA A;  1K9P A;  2B1U A;  2KSP A;  1CB1 A;  1IKU A;  1M45 A;  1DJG A;  1SBJ A;  2AMI A;  2LV7 A;  2Q91 A;  1NCX A;  1BG1 A;  5CSF A;  1KFX L;  1KSO A;  2LAP A;  1UHJ A;  2KFG A;  2WND A;  3FIA A;  1SL9 A;  3CTN A;  1EG3 A;  2ZN9 A;  3GK2 A;  5G08 A;  4HRE E;  1J7P A;  2M7L A;  1NPQ A;  3M0W A;  2JNF A;  5CSI A;  1B47 A;  2E6W A;  2KI4 C;  1UUR A;  1QIW A;  2KFF A;  1KK7 Z;  3BQ3 A;  1XVJ A;  2M7N A;  2MJW B;  1C7V A;  2NXQ A;  3DVK A;  1DJZ A;  1NSH A;  2L5X B;  3BUM B;  5I2Q A;  3E3R A;  2F8P A;  1F4Q A;  1OZO A;  1QVI Y;  2FJU B;  2CNP A;  1BR1 B;  1M46 A;  2JT3 A;  1TIZ A;  3AKA A;  1REC A;  1GGZ A;  2KGB C;  1QVI Z;  1IH0 A;  1DF0 B;  2LLU A;  5AAN A;  1SYM A;  1K93 D;  1AJ4 A;  1XFV O;  3BUW B;  1CDN A;  1PK0 D;  2LLS A;  1CDL A;  2F3Z A;  4GPL B;  2KNE A;  2WCB A;  3CR2 A;  1IQ3 A;  1UUS A;  2E30 A;  1CTR A;  3DVE A;  3K21 A;  4UPG A;  3WXA A;  2HPS A;  1KCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...