1QTXA

The 1.65 angstrom structure of calmodulin rs20 peptide complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
148
structure length
148
Chain Sequence
ADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYEEFVQVMMAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CALMODULIN)
publication title High Resolution Structure of a Calmodulin Rs20 Peptide Complex
rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 52
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1999-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qtxA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qtxA02
3WHTB 3KO0A 3BXKA 1QVIZ 1TNQA 1K9PA 2R2IA 4N1FA 1IJ6A 1IJ5A 4OV2A 4CFQA 1UHJA 2OTGC 2BE4A 2QPTA 1CDNA 1L2OC 1UHKA 3OHMB 2LE9B 1TNWA 2IS9A 5AANA 3VRQA 1B8RA 5I8NA 3EKHA 3WHUB 1BR1B 1BF5A 1FW4A 4JPZB 4C0KA 1SW8A 3DD4A 1U5IB 3D10A 3DVEA 2KAYA 4NQGA 4BY4A 1S6IA 1B7TZ 1K90D 3TUYB 2AAOA 1R2UA 1KK8C 2LV7A 1BLQA 2KFFA 1WRLA 1YVLA 4MRYA 5HKWA 4PHKA 1TRFA 1XVJA 4NDCA 2JT3A 1UP5A 1F71A 5G08A 4YI8A 1FI5A 2LLTA 2K2AA 4YRUA 2O60A 2M9GA 5HLVA 4AOMA 4PDZA 1XFWO 3NXAA 3SG6A 1SK6D 2BCXA 1OMRA 2LANA 2GGZA 2EHBA 1IWQA 1RWYA 4FQOA 1CDMA 2NZ0A 5PALA 2Q4UA 2MJWB 2LHIA 1X02A 4YGDB 5I2QA 2LNKA 4P2YB 1EH2A 3BUXB 1XYDA 2SCPA 5JJGA 4HRHA 1JUOA 1DJWA 1DF0A 1M31A 2LLSA 1SR6B 5KSZA 4HREE 1B4CA 2KHNA 5AFPA 2D8NA 3ICBA 4OVNF 3FWCA 2ISDA 1CMGA 1AJ4A 1DGVA 5CPVA 2BKIB 1WDCB 1NSHA 1KQMC 2DOQA 4R1EA 2OPOA 1XFZO 2LMTA 4U8DA 1CLBA 1HT9A 2L50A 1K9KA 2ZN9A 3IQQA 4PALA 2LVIA 4PE1A 5AEQA 4DCKA 1F55A 3JTDB 2OTGB 1DJHA 3FWBA 3WXAA 1Y0VH 4QJ4B 3D0YA 2LM5A 3O6BA 5IBWA 1QLKA 1TN4A 2LVKA 5D7FA 4HSZA 3EVVA 4YGBB 3LK0A 1GJYA 1LA0A 1FF1A 4ICBA 2I2RE 4N5XA 2JTTA 2NCPA 4CPVA 1AP4A 2HQWA 1XK4C 4PE4A 1RECA 2CBLA 1CM4A 1A4PA 4MZJA 2JT8A 2F2PA 2I18A 1KK8B 1AVSA 2M97A 2H2KA 2VRGA 3VRRA 1RTP1 1MF8B 3FIAA 1C07A 1YRTB 1E8AA 1QTXA 1QV0A 3TUYC 3SG2A 3LLEA 1XA5A 2KI6C 1TTXA 3EK4A 1HQVA 2NCOA 1MXEA 2G2BA 3DVMA 4MBEA 1SCMB 3PN7B 1OE9B 4PHMA 3CR5X 2AUCA 1OZSA 1N0YA 2M1KB 4OR9B 4QJ3B 4PCWA 2KBMA 3AAKA 2JULA 4ZCVA 2O5GA 2KNEA 3C1VA 1EG3A 3I5GC 1A2XA 2COLB 1EL4A 5HLOA 2PMYA 1IKUA 3D0YB 2LP2A 3CGAA 2KQ6A 2JXCA 1KWOB 1QS7A 2CCMA 3JVTB 4USLA 1TCFA 1UHHA 2CXJA 2F3ZA 1DJZA 1S5GY 1J7RA 2KDHA 2M7NA 3GK4X 4D1EA 4GGNA 1GQMA 4FTGA 1CDPA 3OX6A 2CT9A 4PHJA 4ORBB 4WQ2A 3TS5B 1CKKA 1WDCC 4TNCA 3KPXA 4GAOA 3CWGA 5HKYA 1AUIB 1XFYO 2LMVA 1G8IA 1UHNA 1S36A 4MN0A 5AERA 1QLSA 3JTDC 1IQ3A 1ZOTB 1SMGA 2E30A 4I5NB 1YURA 3OB2B 1QX5B 1OQPA 1K93D 2L51A 3H4SE 4GGFA 4N1GA 1CB1A 3RM1A 5ER5A 4F0ZB 1KQVA 2V53A 2ZNEA 1M39A 2K7OA 1D1OA 3VRPA 3BUMB 3EVRA 4WQ3A 5BPJA 4M2QA 1PSBA 1K95A 2ZNDA 1SY9A 1PVBA 4MLWA 3O2PA 2H61A 3TDIA 2LCPA 1F70A 1IRJA 1LA3A 2Y4QA 1J55A 1SL8A 1TNXA 2LLUA 1PVAA 2LMUA 2K8MB 1M46A 1MXLC 1F54A 4NDDA 1CFPA 2M3WA 1QVIY 1YX8A 4I5LB 2BCAA 2ZRTA 1OOJA 1SCMC 1Y1AA 2BE6A 2BL0C 3NSKA 3PN7C 2FCDA 3AKBA 2PSRA 2JNFA 3I5GB 1NYAA 1TOPA 1YUTA 4CFRA 1YVHA 1AK8A 1DT7B 4GUKA 2PVBA 4GNKB 1KFXL 1XFVO 2I7AA 3SG4A 4DIRA 5KTYA 1FI6A 3KF9A 1DVIA 1QX2A 1RK9A 2JZIA 3DVJA 2M8UA 1B7TY 1TNPA 3NSLA 1KWOC 3JVTC 1IH0A 2PALA 2L5XB 1CFCA 3EVUA 3SG7A 4QJ5B 1WY9A 1FBVA 1NX3A 3CR4X 4WRIA 3NSIA 5I2LA 1WLZA 2NLNA 3DVKA 1K8UA 1J1DA 1KK7Z 1G4YR 2L4HA 5GQQC 3TS5C 1IG5A 5D69A 2M1UA 1F4QA 1NCZA 2WCFA 4ETOA 1VRKA 2K2FA 3EK8A 1CFFA 5HKZA 2LVVA 3BYAA 4Q04A 3GK2A 1NIWA 1K9UA 2BCBA 1PK0D 3I5IB 1PSRA 1F8HA 1W7JB 2K7BA 2LHLA 2BKHB 5B8IB 1KFXS 1NCYA 4M2PA 2FCEA 1SNLA 3IF7A 1F4OA 4A4BA 1S26D 3BUWB 1CM1A 1DGUA 1KSMA 2M0RA 4YGAA 1QX7A 2M49B 5TNCA 2MRDA 4BY5A 2BBMA 2MLEC 1EG4A 1R6PA 1W7IB 1PULA 4PE0A 3M0WA 2JU0A 1DF0B 1B9AA 2HPSA 3BUNB 2BL0B 4PHNA 1NX2A 2K7DA 3E3RA 4GFTA 1G33A 2KQYA 2MHHA 1ODBA 2WCBA 1A75A 1NX1A 1QIVA 5CSFA 1BR4B 2L4IA 1PRWA 1OMDA 4OKHA 2Y5IA 1C7WA 1Y1UA 3BUOB 1JFKA 1SRAA 2LVJA 1OSAA 1RROA 1Y1XA 2MAZA 2Y1NA 2K7CA 2KI4B 1XO5A 2JTZA 1IGVA 4A4CA 3ZNIA 2JPTA 2LAPA 1S3PA 5DKQA 2KSPA 1B1GA 3WNXB 1M63B 2FJUB 3OB1B 1N65A 3CS1A 1H8BA 4GGFC 4MZLA 2EGDA 5KU1A 2I94A 1LINA 2KOTA 1WRZA 2CTNA 3TDZA 2HF5A 1S6CA 2PASA 1NP8A 4P5OE 5FYXA 1MQ1A 3A4UB 3EK7A 5CSNA 1B8LA 2H61C 1UURA 2BBNA 1JC2A 1QIWA 2SASA 3I5FB 1ZFSA 2GV5A 1AJ5A 1JBAA 1CDLA 3SIAA 1J7OA 1CTRA 3GOFA 3HX4A 5AXIA 2BECA 1B47A 1CLMA 1NUBA 2CNPA 2JOJA 4MZKA 1BOCA 2WNDA 1ALWA 3PSRA 1A75B 3I5IC 2ZN8A 5ER4X 1Y6WA 4DRWA 3O4YA 4YGEB 1IQ5A 3A8RA 1CNPA 2ZFDA 2KFGA 1KFUL 3CZTX 1CLLA 1MWNA 2RGIA 1WLMA 3I5HB 1NX0A 3LCPC 3NSOA 4OCIA 2FOTA 2KAXA 4GBAA 3DF0A 3BOWA 1SCVA 4YI9A 2WC8A 1JSAA 2HETA 2OS8C 3AKAA 3HCMA 2KFHA 2Q91A 5CSIA 1J7QA 2F2OA 2L2EA 1J7PA 1SBJA 2EC6B 4NDBA 1DJXA 1V1FA 1SL9A 1LKJA 2ZKMX 2KI6D 4CIDA 1A29A 3PFVA 1PALA 1J1EA 3PALA 3SG3A 4UPGA 2TN4A 1GGWA 3K21A 5F6TA 3IQOA 2F33A 2K61A 2KI4C 2B1UA 4AQJA 1EJ3A 2JC2A 1DMOA 1JFJA 1B8CA 1KFUS 1JF2A 1TIZA 2AMIA 2PRUA 2M7LA 2L98A 1BODA 1JWDA 4YBHB 4I5JA 1YTZC 1MHOA 2GGMA 2WORA 1BMOA 2LUXA 3MSEB 5J3XA 4XYNA 4L9MA 3VRNA 4MEWA 1L7ZA 1LVCD 1UWOA 4AQIA 1ALVA 2JWWA 3DF0B 1BJFA 1QV1A 2JNXA 3BOWB 1MUXA 1LXFC 1YUUA 2KYFA 1K96A 3I5FC 3KEVA 4C0JA 1M45A 1JF0A 2KYCA 4C0LA 4ORCB 2P6BB 4IL1A 3ZWHA 3RLZA 4HRGA 2Y1MA 2F3YA 5I2OA 2KBIA 1QASA 1OMVA 1YUSA 1N2DA 3FS7A 2WCEA 5HYDA 5DKRA 3VGOA 1C7VA 4MSPA 3F45A 1XFXO 5JOLA 1TCOB 5K89A 3CTNA 2K0JA 2MA2A 2JRFA 3SJSA 3KHEA 1L2OB 3VROA 3I5HC 3LK1A 1RJVA 3AAJA 2OS8B 4CLNA 1YR5A 1KK7Y 4PE7A 4ZCUA 5DKNA 1AHRA 2LP3A 4M2OA 3BQ3A 2JXLA 1NPQA 5CSJA 3PM8A 1QXPA 4XJKA 2KGRA 1DJIA 4JQ0D 2KGBC 1XFUO 3O78A 2EC6C 4JWQA 4E68A 2QACA 4MRXA 4MVFA 1UUSA 1S5GZ 1SL7A 1V1GA 1QJTA 1BG1A 3TZ1A 1OZOA 1FPWA 1RFJA 1SKTA 3QRXA 1BU3A 3CR2A 1ZUZA 2MLFC 1KSOA 1XK4A 1K2HA 1KCYA 2ZRSA 1A03A 1MR8A 2L0PA 4DS7A 3OX5A 1NWDA 2MBXA 1GGZA 1YRUB 2NXQA 1U5IA 1H4BA 1DJYA 1SPYA 2E6WA 3CLNA 4ORAB 2G9BA 4YGCB 2A4JA 3SG5A 1DTLA 1DJGA 2LUCA 1K94A 3SIBA 4I5KA 1EXRA 1CFDA 1NCXA 1BT6A 1YX7A 2WOSA 1QATA 1CMFA 4DUQA 1ZACA 1S1EA 1UHIA 2F8PA 4GPLB 2JQ6A 3TDUA 3PATA 2LC5A 1ZMZA 3LL8B 3OP0A 1WRKA 1Q80A 3EKJA 3PLFB 1SR6C 2KAVA 3GK1A 4XJKB 1KQMB 1S6JA 2M29A 2HQ8A 2JT0A 1SYMA
chains in the Genus database with same CATH superfamily
3WHTB 3KO0A 3BXKA 1QVIZ 1Z4HA 1TNQA 1K9PA 2R2IA 4N1FA 1IJ6A 1IJ5A 4OV2A 4CFQA 3S0FA 3R1PA 1UHJA 3CYZA 3B88A 2OTGC 2BE4A 2QPTA 2WCKA 1CDNA 1L2OC 1UHKA 3OHMB 2LE9B 1TNWA 2IS9A 5AANA 3VRQA 2BAPA 1B8RA 3S0EA 5I8NA 3EKHA 3WHUB 3B87A 1BR1B 2L5YA 1BF5A 1FW4A 4JPZB 4C0KA 3R1VA 1SW8A 3DD4A 1U5IB 2GTEA 1QWVA 3D10A 3DVEA 2KAYA 4NQGA 4BY4A 1S6IA 1B7TZ 1K90D 3TUYB 2AAOA 1R2UA 1KK8C 2LV7A 1BLQA 2KFFA 1OOFA 1WRLA 1YVLA 4MRYA 5HKWA 4PHKA 1TRFA 1XVJA 4NDCA 2JT3A 1UP5A 1F71A 1C3ZA 5G08A 4YI8A 1IIOA 1FI5A 2LLTA 2K2AA 4YRUA 2O60A 2M9GA 5HLVA 2ERBA 4AOMA 4PDZA 1XFWO 3NXAA 3QMEA 3SG6A 1SK6D 2BCXA 1OMRA 2LANA 2GGZA 2EHBA 1IWQA 3SS5A 1RWYA 4FQOA 1CDMA 2NZ0A 5PALA 2Q4UA 2MJWB 1ORGA 2LHIA 1X02A 4YGDB 5I2QA 2LNKA 1Z2CB 4P2YB 1EH2A 3BUXB 1XYDA 2SCPA 5JJGA 4HRHA 1JUOA 1DJWA 1DF0A 1M31A 2LLSA 1SR6B 5KSZA 4HREE 2PYQA 1B4CA 2KHNA 1T14A 5AFPA 2D8NA 3ICBA 4OVNF 3FWCA 2ISDA 1CMGA 1AJ4A 3DYEA 3S0DA 1DGVA 3V2LA 5CPVA 2BKIB 1WDCB 1NSHA 1KQMC 2DOQA 3OGNA 4R1EA 2OPOA 1XFZO 2LMTA 4U8DA 1CLBA 1HT9A 2L50A 1K9KA 2ZN9A 3IQQA 4PALA 2LVIA 4PE1A 5AEQA 4DCKA 1F55A 3JTDB 2OTGB 1DJHA 3FWBA 3WXAA 1Y0VH 4QJ4B 3D0YA 2LM5A 3O6BA 5IBWA 1QLKA 1TN4A 2LVKA 5D7FA 4HSZA 3EVVA 4YGBB 3LK0A 1GJYA 1LA0A 1FF1A 4ICBA 2I2RE 4N5XA 2JTTA 2NCPA 2WC6A 3IVTA 4CPVA 1AP4A 1GM0A 2HQWA 1XK4C 4PE4A 1RECA 2CBLA 1CM4A 1A4PA 4MZJA 2JPOA 2F2PA 2JT8A 5EL2A 2I18A 1KK8B 1AVSA 2M97A 2H2KA 2VRGA 3SS4A 3VRRA 1RTP1 1MF8B 3FIAA 1C07A 1YRTB 1E8AA 1QTXA 1QV0A 3TUYC 1DC1A 3SG2A 3LLEA 1XA5A 2QEOA 2KI6C 1TTXA 3EK4A 1HQVA 2NCOA 1OW4A 1MXEA 2G2BA 2PQLA 3DVMA 2K60A 3BFAA 4MBEA 1SCMB 3PN7B 1OE9B 4PHMA 3CR5X 1OZSA 2AUCA 1N0YA 2M1KB 5DICA 4OR9B 2L2CA 4QJ3B 4PCWA 2KBMA 3AAKA 2JULA 4ZCVA 4F7FA 2O5GA 2KNEA 3C1VA 1EG3A 3I5GC 1A2XA 2COLB 1EL4A 5HLOA 2PMYA 3FE9A 1IKUA 3D0YB 2LP2A 3CGAA 2KQ6A 2JXCA 1KWOB 1QS7A 2CCMA 3JVTB 4USLA 1TCFA 1UHHA 1W9ZA 2CXJA 2F3ZA 1DJZA 3DZTA 5D3OA 2QDIA 1S5GY 1J7RA 2KDHA 2M7NA 3GK4X 4D1EA 4GGNA 1GQMA 4FTGA 1CDPA 3S0GA 3D73A 3OX6A 4PT1A 2CT9A 4PHJA 4ORBB 4WQ2A 3TS5B 1OOIX 1CKKA 1WDCC 4TNCA 3KPXA 4GAOA 3CWGA 5HKYA 1AUIB 1XFYO 2LMVA 1G8IA 1UHNA 1S36A 3CZ1A 4MN0A 5AERA 1QLSA 3JTDC 1IQ3A 1ZOTB 1SMGA 2E30A 4I5NB 1YURA 3OB2B 1QX5B 1OQPA 1K93D 2BNXA 2L51A 3H4SE 4GGFA 4N1GA 1CB1A 3RM1A 4IJ7A 5ER5A 4F0ZB 1KQVA 2V53A 2ZNEA 1M39A 3S0AA 2K7OA 1D1OA 3VRPA 3BUMB 3EVRA 4WQ3A 5BPJA 4M2QA 1PSBA 1K95A 2ZNDA 1SY9A 1PVBA 4MLWA 3O2PA 3SS3A 2H61A 3TDIA 2LCPA 1F70A 1IRJA 1LA3A 2Y4QA 1J55A 1SL8A 1C3YA 1TNXA 2LLUA 1PVAA 2LMUA 2K8MB 1M46A 1MXLC 3UNWA 1F54A 4NDDA 1CFPA 2M3WA 1QVIY 1YX8A 1OOGA 3NHTA 4I5LB 2BCAA 2ZRTA 1OOJA 1SCMC 1Y1AA 2BE6A 2BL0C 3N7HA 3NSKA 3PN7C 2FCDA 3R72A 3AKBA 2PSRA 2JNFA 3I5GB 1NYAA 1TOPA 1YUTA 4CFRA 1YVHA 1AK8A 1DT7B 4GUKA 1TUJA 2PVBA 4GNKB 1KFXL 1XFVO 2I7AA 3SG4A 4DIRA 5KTYA 1FI6A 2P71A 1P28A 3KF9A 1DEKA 1DVIA 1QX2A 1RK9A 2JZIA 3DVJA 2M8UA 1B7TY 1TNPA 3NSLA 1KWOC 3JVTC 1IH0A 2PALA 2L5XB 1CFCA 3EVUA 3SG7A 4QJ5B 1WY9A 1FBVA 1NX3A 3CR4X 3L47A 4WRIA 1TUZA 3NSIA 5I2LA 1WLZA 2NLNA 3DVKA 1K8UA 1J1DA 1KK7Z 3DY9A 1G4YR 2L4HA 5GQQC 4KYNA 3TS5C 1IG5A 5D69A 2M1UA 1F4QA 1NCZA 2WCFA 4ETOA 1VRKA 2K2FA 3EK8A 1CFFA 3B7AA 5HKZA 2LVVA 2WCMA 3BYAA 4Q04A 4INXA 3GK2A 1NIWA 1K9UA 2BCBA 1PK0D 3I5IB 1PSRA 1F8HA 1W7JB 2K7BA 2LHLA 2BKHB 3BFBA 1KFXS 5B8IB 1NCYA 4M2PA 2FCEA 1SNLA 3IF7A 1F4OA 4A4BA 1S26D 3BUWB 3D77A 1CM1A 4INWA 1DGUA 1KSMA 2M0RA 4YGAA 1QX7A 2M49B 5TNCA 2MRDA 3OBVA 4BY5A 2BBMA 2MLEC 1EG4A 1R6PA 1W7IB 1PULA 4PE0A 3M0WA 2JU0A 1DF0B 1B9AA 2HPSA 3BUNB 2BL0B 4PHNA 1NX2A 2K7DA 3E3RA 4GFTA 1G33A 2KQYA 2MHHA 1ODBA 3CDNA 2WCBA 1A75A 1NX1A 1QIVA 5CSFA 1BR4B 2QEVA 2L4IA 1PRWA 1OMDA 3Q8IA 4FQTA 4OKHA 2Y5IA 1C7WA 1Y1UA 3BUOB 1JFKA 1SRAA 2LVJA 1OSAA 1RROA 1Y1XA 2MAZA 2YGUA 2Y1NA 2K7CA 2KI4B 1XO5A 2JTZA 1IGVA 4A4CA 3ZNIA 2JPTA 2FJYA 2LAPA 1S3PA 5DKQA 2KSPA 1B1GA 3WNXB 1M63B 2FJUB 3VB1A 3OB1B 1N65A 3CS1A 1H8BA 4GGFC 3NGVA 4MZLA 2EGDA 5KU1A 2I94A 1LINA 2KOTA 1WRZA 2CTNA 3TDZA 2HF5A 1S6CA 3DXLA 2PASA 1NP8A 4P5OE 5FYXA 1MQ1A 3A4UB 3EK7A 5CSNA 1B8LA 2H61C 1UURA 2BBNA 1JC2A 1QIWA 2SASA 3I5FB 1ZFSA 3L4LA 2GV5A 3D74A 1AJ5A 1JBAA 1CDLA 3FE8A 3SIAA 1J7OA 1CTRA 3GOFA 3HX4A 5AXIA 2BECA 1B47A 1CLMA 1NUBA 2CNPA 2JOJA 1TWOA 3D78A 2WNDA 1ALWA 4MZKA 5FI6A 3PSRA 3PJIA 1A75B 3I5IC 2ZN8A 5ER4X 1Y6WA 4DRWA 3O4YA 4YGEB 1IQ5A 3A8RA 1CNPA 2ZFDA 2KFGA 1KFUL 2P70A 3CZTX 1CLLA 3S0BA 1MWNA 2RGIA 1WLMA 3I5HB 1NX0A 3LCPC 3NHIA 3NSOA 2FOTA 2KAXA 4OCIA 4GBAA 3DF0A 3BOWA 1SCVA 4YI9A 2WC8A 1JSAA 2HETA 3BFHA 2OS8C 3AKAA 3CZ0A 3HCMA 2KFHA 2Q91A 5CSIA 1J7QA 2F2OA 2L2EA 2KLDA 1J7PA 1SBJA 2EC6B 4NDBA 1DJXA 3UO9A 1V1FA 1SL9A 1LKJA 2ZKMX 2KI6D 3O4XA 4CIDA 1A29A 3PFVA 1PALA 1J1EA 3PALA 3SG3A 4UPGA 2TN4A 1GGWA 3CZ2A 3K21A 3IQOA 5F6TA 2F33A 3B6XA 2K61A 3R1OA 2KI4C 2B1UA 4AQJA 1EJ3A 2JC2A 1DMOA 3B86A 1JFJA 1B8CA 1KFUS 3D75A 1JF2A 1XFRA 1TIZA 2AMIA 2PRUA 2M7LA 2L98A 1BODA 1JWDA 4YBHB 4I5JA 1YTZC 1MHOA 2GGMA 2WCJA 1BMOA 2LUXA 2WORA 3MSEB 5J3XA 4XYNA 4L9MA 3VRNA 4MEWA 3L4AA 1L7ZA 1LVCD 1UWOA 4AQIA 1ALVA 2H8VA 2JWWA 3DF0B 1BJFA 1QV1A 2JNXA 3BOWB 1MUXA 1LXFC 1YUUA 2KYFA 1K96A 3I5FC 3KEVA 4C0JA 1M45A 1JF0A 2KYCA 4C0LA 4ORCB 2P6BB 4IL1A 3ZWHA 2WC5A 3RLZA 1DQEA 1SSEB 4HRGA 2Y1MA 2F3YA 5I2OA 2QEBA 2KBIA 1QASA 1OMVA 1YUSA 1DELA 1N2DA 3FS7A 2WCEA 3BJHA 5HYDA 5DKRA 3VGOA 1C7VA 4MSPA 3F45A 2WCLA 1XFXO 2KPHA 1TCOB 4JKTA 5JOLA 5K89A 3FE6A 5HL1A 3CTNA 2K0JA 2MA2A 4JD9A 2JRFA 3SJSA 3KHEA 1L2OB 3VROA 3I5HC 3LK1A 1RJVA 3AAJA 5FI7A 2OS8B 4CLNA 1YR5A 1KK7Y 4PE7A 4ZCUA 3K1EA 5DKNA 1AHRA 2LP3A 4M2OA 3BQ3A 2JXLA 1NPQA 5CSJA 3PM8A 5I94A 1QXPA 4XJKA 2KGRA 1DJIA 4JQ0D 2KGBC 1XFUO 5FI2A 3O78A 2EC6C 4JWQA 1OOHA 4E68A 2QACA 4MRXA 3PM2A 4OZDA 4MVFA 1UUSA 1S5GZ 1SL7A 1V1GA 1QJTA 2QEHA 3TZ1A 1BG1A 1OZOA 1FPWA 3D76A 1RFJA 1SKTA 3QRXA 1BU3A 2WCHA 3CR2A 1ZUZA 2MLFC 1KSOA 1XK4A 1K2HA 1BOCA 1KCYA 2ZRSA 1A03A 1MR8A 2L0PA 4DS7A 3OX5A 1NWDA 2MBXA 1GGZA 1YRUB 2NXQA 1U5IA 1H4BA 1DJYA 1SPYA 2E6WA 3CLNA 4ORAB 2G9BA 4YGCB 2A4JA 3CABA 3SG5A 3RZSA 1DTLA 1DJGA 2LUCA 1K94A 3SIBA 4I5KA 1EXRA 2KLEA 1CFDA 1NCXA 1BT6A 1YX7A 2WOSA 1QATA 1CMFA 4DUQA 1ZACA 1S1EA 1UHIA 2F8PA 4GPLB 2JQ6A 3TDUA 3PATA 2LC5A 1ZMZA 3LL8B 3OP0A 1WRKA 1Q80A 3EKJA 3PLFB 1SR6C 2KAVA 3GK1A 4XJKB 1KQMB 1S6JA 2M29A 1LS8A 2HQ8A 2JT0A 1SYMA 3EG5B
chains in the Genus database with same CATH topology
3WHTB 3KO0A 3BXKA 1QVIZ 1TNQA 1K9PA 2R2IA 4N1FA 1IJ6A 1IJ5A 4OV2A 4CFQA 1UHJA 2OTGC 2BE4A 2QPTA 1CDNA 1L2OC 1UHKA 3OHMB 2LE9B 1TNWA 2IS9A 5AANA 3VRQA 1B8RA 5I8NA 3EKHA 3WHUB 1BR1B 1BF5A 1FW4A 4JPZB 4C0KA 1SW8A 3DD4A 1U5IB 3D10A 3DVEA 2KAYA 4NQGA 4BY4A 1S6IA 1B7TZ 1K90D 3TUYB 2AAOA 1R2UA 1KK8C 2LV7A 1BLQA 2KFFA 1WRLA 1YVLA 4MRYA 5HKWA 4PHKA 1TRFA 1XVJA 4NDCA 2JT3A 1UP5A 1F71A 5G08A 4YI8A 1FI5A 2LLTA 2K2AA 4YRUA 2O60A 2M9GA 5HLVA 4AOMA 4PDZA 1XFWO 3NXAA 3SG6A 1SK6D 2BCXA 1OMRA 2LANA 2GGZA 2EHBA 1IWQA 1RWYA 4FQOA 1CDMA 2NZ0A 5PALA 2Q4UA 2MJWB 2LHIA 1X02A 4YGDB 5I2QA 2LNKA 4P2YB 1EH2A 3BUXB 1XYDA 2SCPA 5JJGA 4HRHA 1JUOA 1DJWA 1DF0A 1M31A 2LLSA 1SR6B 5KSZA 4HREE 1B4CA 2KHNA 5AFPA 2D8NA 3ICBA 4OVNF 3FWCA 2ISDA 1CMGA 1AJ4A 1DGVA 5CPVA 2BKIB 1WDCB 1NSHA 1KQMC 2DOQA 4R1EA 2OPOA 1XFZO 2LMTA 4U8DA 1CLBA 1HT9A 2L50A 1K9KA 2ZN9A 3IQQA 4PALA 2LVIA 4PE1A 5AEQA 4DCKA 1F55A 3JTDB 2OTGB 1DJHA 3FWBA 3WXAA 1Y0VH 4QJ4B 3D0YA 2LM5A 3O6BA 5IBWA 1QLKA 1TN4A 2LVKA 5D7FA 4HSZA 3EVVA 4YGBB 3LK0A 1GJYA 1LA0A 1FF1A 4ICBA 2I2RE 4N5XA 2JTTA 2NCPA 4CPVA 1AP4A 2HQWA 1XK4C 4PE4A 1RECA 2CBLA 1CM4A 1A4PA 4MZJA 2JT8A 2F2PA 2I18A 1KK8B 1AVSA 2M97A 2H2KA 2VRGA 3VRRA 1RTP1 1MF8B 3FIAA 1C07A 1YRTB 1E8AA 1QTXA 1QV0A 3TUYC 3SG2A 3LLEA 1XA5A 2KI6C 1TTXA 3EK4A 1HQVA 2NCOA 1MXEA 2G2BA 3DVMA 4MBEA 1SCMB 3PN7B 1OE9B 4PHMA 3CR5X 2AUCA 1OZSA 1N0YA 2M1KB 4OR9B 4QJ3B 4PCWA 2KBMA 3AAKA 2JULA 4ZCVA 2O5GA 2KNEA 3C1VA 1EG3A 3I5GC 1A2XA 2COLB 1EL4A 5HLOA 2PMYA 1IKUA 3D0YB 2LP2A 3CGAA 2KQ6A 2JXCA 1KWOB 1QS7A 2CCMA 3JVTB 4USLA 1TCFA 1UHHA 2CXJA 2F3ZA 1DJZA 1S5GY 1J7RA 2KDHA 2M7NA 3GK4X 4D1EA 4GGNA 1GQMA 4FTGA 1CDPA 3OX6A 2CT9A 4PHJA 4ORBB 4WQ2A 3TS5B 1CKKA 1WDCC 4TNCA 3KPXA 4GAOA 3CWGA 5HKYA 1AUIB 1XFYO 2LMVA 1G8IA 1UHNA 1S36A 4MN0A 5AERA 1QLSA 3JTDC 1IQ3A 1ZOTB 1SMGA 2E30A 4I5NB 1YURA 3OB2B 1QX5B 1OQPA 1K93D 2L51A 3H4SE 4GGFA 4N1GA 1CB1A 3RM1A 5ER5A 4F0ZB 1KQVA 2V53A 2ZNEA 1M39A 2K7OA 1D1OA 3VRPA 3BUMB 3EVRA 4WQ3A 5BPJA 4M2QA 1PSBA 1K95A 2ZNDA 1SY9A 1PVBA 4MLWA 3O2PA 2H61A 3TDIA 2LCPA 1F70A 1IRJA 1LA3A 2Y4QA 1J55A 1SL8A 1TNXA 2LLUA 1PVAA 2LMUA 2K8MB 1M46A 1MXLC 1F54A 4NDDA 1CFPA 2M3WA 1QVIY 1YX8A 4I5LB 2BCAA 2ZRTA 1OOJA 1SCMC 1Y1AA 2BE6A 2BL0C 3NSKA 3PN7C 2FCDA 3AKBA 2PSRA 2JNFA 3I5GB 1NYAA 1TOPA 1YUTA 4CFRA 1YVHA 1AK8A 1DT7B 4GUKA 2PVBA 4GNKB 1KFXL 1XFVO 2I7AA 3SG4A 4DIRA 5KTYA 1FI6A 3KF9A 1DVIA 1QX2A 1RK9A 2JZIA 3DVJA 2M8UA 1B7TY 1TNPA 3NSLA 1KWOC 3JVTC 1IH0A 2PALA 2L5XB 1CFCA 3EVUA 3SG7A 4QJ5B 1WY9A 1FBVA 1NX3A 3CR4X 4WRIA 3NSIA 5I2LA 1WLZA 2NLNA 3DVKA 1K8UA 1J1DA 1KK7Z 1G4YR 2L4HA 5GQQC 3TS5C 1IG5A 5D69A 2M1UA 1F4QA 1NCZA 2WCFA 4ETOA 1VRKA 2K2FA 3EK8A 1CFFA 5HKZA 2LVVA 3BYAA 4Q04A 3GK2A 1NIWA 1K9UA 2BCBA 1PK0D 3I5IB 1PSRA 1F8HA 1W7JB 2K7BA 2LHLA 2BKHB 5B8IB 1KFXS 1NCYA 4M2PA 2FCEA 1SNLA 3IF7A 1F4OA 4A4BA 1S26D 3BUWB 1CM1A 1DGUA 1KSMA 2M0RA 4YGAA 1QX7A 2M49B 5TNCA 2MRDA 4BY5A 2BBMA 2MLEC 1EG4A 1R6PA 1W7IB 1PULA 4PE0A 3M0WA 2JU0A 1DF0B 1B9AA 2HPSA 3BUNB 2BL0B 4PHNA 1NX2A 2K7DA 3E3RA 4GFTA 1G33A 2KQYA 2MHHA 1ODBA 2WCBA 1A75A 1NX1A 1QIVA 5CSFA 1BR4B 2L4IA 1PRWA 1OMDA 4OKHA 2Y5IA 1C7WA 1Y1UA 3BUOB 1JFKA 1SRAA 2LVJA 1OSAA 1RROA 1Y1XA 2MAZA 2Y1NA 2K7CA 2KI4B 1XO5A 2JTZA 1IGVA 4A4CA 3ZNIA 2JPTA 2LAPA 1S3PA 5DKQA 2KSPA 1B1GA 3WNXB 1M63B 2FJUB 3OB1B 1N65A 3CS1A 1H8BA 4GGFC 4MZLA 2EGDA 5KU1A 2I94A 1LINA 2KOTA 1WRZA 2CTNA 3TDZA 2HF5A 1S6CA 2PASA 1NP8A 4P5OE 5FYXA 1MQ1A 3A4UB 3EK7A 5CSNA 1B8LA 2H61C 1UURA 2BBNA 1JC2A 1QIWA 2SASA 3I5FB 1ZFSA 2GV5A 1AJ5A 1JBAA 1CDLA 3SIAA 1J7OA 1CTRA 3GOFA 3HX4A 5AXIA 2BECA 1B47A 1CLMA 1NUBA 2CNPA 2JOJA 4MZKA 1BOCA 2WNDA 1ALWA 3PSRA 1A75B 3I5IC 2ZN8A 5ER4X 1Y6WA 4DRWA 3O4YA 4YGEB 1IQ5A 3A8RA 1CNPA 2ZFDA 2KFGA 1KFUL 3CZTX 1CLLA 1MWNA 2RGIA 1WLMA 3I5HB 1NX0A 3LCPC 3NSOA 4OCIA 2FOTA 2KAXA 4GBAA 3DF0A 3BOWA 1SCVA 4YI9A 2WC8A 1JSAA 2HETA 2OS8C 3AKAA 3HCMA 2KFHA 2Q91A 5CSIA 1J7QA 2F2OA 2L2EA 1J7PA 1SBJA 2EC6B 4NDBA 1DJXA 1V1FA 1SL9A 1LKJA 2ZKMX 2KI6D 4CIDA 1A29A 3PFVA 1PALA 1J1EA 3PALA 3SG3A 4UPGA 2TN4A 1GGWA 3K21A 5F6TA 3IQOA 2F33A 2K61A 2KI4C 2B1UA 4AQJA 1EJ3A 2JC2A 1DMOA 1JFJA 1B8CA 1KFUS 1JF2A 1TIZA 2AMIA 2PRUA 2M7LA 2L98A 1BODA 1JWDA 4YBHB 4I5JA 1YTZC 1MHOA 2GGMA 2WORA 1BMOA 2LUXA 3MSEB 5J3XA 4XYNA 4L9MA 3VRNA 4MEWA 1L7ZA 1LVCD 1UWOA 4AQIA 1ALVA 2JWWA 3DF0B 1BJFA 1QV1A 2JNXA 3BOWB 1MUXA 1LXFC 1YUUA 2KYFA 1K96A 3I5FC 3KEVA 4C0JA 1M45A 1JF0A 2KYCA 4C0LA 4ORCB 2P6BB 4IL1A 3ZWHA 3RLZA 4HRGA 2Y1MA 2F3YA 5I2OA 2KBIA 1QASA 1OMVA 1YUSA 1N2DA 3FS7A 2WCEA 5HYDA 5DKRA 3VGOA 1C7VA 4MSPA 3F45A 1XFXO 5JOLA 1TCOB 5K89A 3CTNA 2K0JA 2MA2A 2JRFA 3SJSA 3KHEA 1L2OB 3VROA 3I5HC 3LK1A 1RJVA 3AAJA 2OS8B 4CLNA 1YR5A 1KK7Y 4PE7A 4ZCUA 5DKNA 1AHRA 2LP3A 4M2OA 3BQ3A 2JXLA 1NPQA 5CSJA 3PM8A 1QXPA 4XJKA 2KGRA 1DJIA 4JQ0D 2KGBC 1XFUO 3O78A 2EC6C 4JWQA 4E68A 2QACA 4MRXA 4MVFA 1UUSA 1S5GZ 1SL7A 1V1GA 1QJTA 1BG1A 3TZ1A 1OZOA 1FPWA 1RFJA 1SKTA 3QRXA 1BU3A 3CR2A 1ZUZA 2MLFC 1KSOA 1XK4A 1K2HA 1KCYA 2ZRSA 1A03A 1MR8A 2L0PA 4DS7A 3OX5A 1NWDA 2MBXA 1GGZA 1YRUB 2NXQA 1U5IA 1H4BA 1DJYA 1SPYA 2E6WA 3CLNA 4ORAB 2G9BA 4YGCB 2A4JA 3SG5A 1DTLA 1DJGA 2LUCA 1K94A 3SIBA 4I5KA 1EXRA 1CFDA 1NCXA 1BT6A 1YX7A 2WOSA 1QATA 1CMFA 4DUQA 1ZACA 1S1EA 1UHIA 2F8PA 4GPLB 2JQ6A 3TDUA 3PATA 2LC5A 1ZMZA 3LL8B 3OP0A 1WRKA 1Q80A 3EKJA 3PLFB 1SR6C 2KAVA 3GK1A 4XJKB 1KQMB 1S6JA 2M29A 2HQ8A 2JT0A 1SYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WHT B;  3KO0 A;  3BXK A;  1QVI Z;  1TNQ A;  1K9P A;  2R2I A;  4N1F A;  1IJ6 A;  1IJ5 A;  4OV2 A;  4CFQ A;  1UHJ A;  2OTG C;  2BE4 A;  2QPT A;  1CDN A;  1L2O C;  1UHK A;  3OHM B;  2LE9 B;  1TNW A;  2IS9 A;  5AAN A;  3VRQ A;  1B8R A;  5I8N A;  3EKH A;  3WHU B;  1BR1 B;  1BF5 A;  1FW4 A;  4JPZ B;  4C0K A;  1SW8 A;  3DD4 A;  1U5I B;  3D10 A;  3DVE A;  2KAY A;  4NQG A;  4BY4 A;  1S6I A;  1B7T Z;  1K90 D;  3TUY B;  2AAO A;  1R2U A;  1KK8 C;  2LV7 A;  1BLQ A;  2KFF A;  1WRL A;  1YVL A;  4MRY A;  5HKW A;  4PHK A;  1TRF A;  1XVJ A;  4NDC A;  2JT3 A;  1UP5 A;  1F71 A;  5G08 A;  4YI8 A;  1FI5 A;  2LLT A;  2K2A A;  4YRU A;  2O60 A;  2M9G A;  5HLV A;  4AOM A;  4PDZ A;  1XFW O;  3NXA A;  3SG6 A;  1SK6 D;  2BCX A;  1OMR A;  2LAN A;  2GGZ A;  2EHB A;  1IWQ A;  1RWY A;  4FQO A;  1CDM A;  2NZ0 A;  5PAL A;  2Q4U A;  2MJW B;  2LHI A;  1X02 A;  4YGD B;  5I2Q A;  2LNK A;  4P2Y B;  1EH2 A;  3BUX B;  1XYD A;  2SCP A;  5JJG A;  4HRH A;  1JUO A;  1DJW A;  1DF0 A;  1M31 A;  2LLS A;  1SR6 B;  5KSZ A;  4HRE E;  1B4C A;  2KHN A;  5AFP A;  2D8N A;  3ICB A;  4OVN F;  3FWC A;  2ISD A;  1CMG A;  1AJ4 A;  1DGV A;  5CPV A;  2BKI B;  1WDC B;  1NSH A;  1KQM C;  2DOQ A;  4R1E A;  2OPO A;  1XFZ O;  2LMT A;  4U8D A;  1CLB A;  1HT9 A;  2L50 A;  1K9K A;  2ZN9 A;  3IQQ A;  4PAL A;  2LVI A;  4PE1 A;  5AEQ A;  4DCK A;  1F55 A;  3JTD B;  2OTG B;  1DJH A;  3FWB A;  3WXA A;  1Y0V H;  4QJ4 B;  3D0Y A;  2LM5 A;  3O6B A;  5IBW A;  1QLK A;  1TN4 A;  2LVK A;  5D7F A;  4HSZ A;  3EVV A;  4YGB B;  3LK0 A;  1GJY A;  1LA0 A;  1FF1 A;  4ICB A;  2I2R E;  4N5X A;  2JTT A;  2NCP A;  4CPV A;  1AP4 A;  2HQW A;  1XK4 C;  4PE4 A;  1REC A;  2CBL A;  1CM4 A;  1A4P A;  4MZJ A;  2JT8 A;  2F2P A;  2I18 A;  1KK8 B;  1AVS A;  2M97 A;  2H2K A;  2VRG A;  3VRR A;  1RTP 1;  1MF8 B;  3FIA A;  1C07 A;  1YRT B;  1E8A A;  1QTX A;  1QV0 A;  3TUY C;  3SG2 A;  3LLE A;  1XA5 A;  2KI6 C;  1TTX A;  3EK4 A;  1HQV A;  2NCO A;  1MXE A;  2G2B A;  3DVM A;  4MBE A;  1SCM B;  3PN7 B;  1OE9 B;  4PHM A;  3CR5 X;  2AUC A;  1OZS A;  1N0Y A;  2M1K B;  4OR9 B;  4QJ3 B;  4PCW A;  2KBM A;  3AAK A;  2JUL A;  4ZCV A;  2O5G A;  2KNE A;  3C1V A;  1EG3 A;  3I5G C;  1A2X A;  2COL B;  1EL4 A;  5HLO A;  2PMY A;  1IKU A;  3D0Y B;  2LP2 A;  3CGA A;  2KQ6 A;  2JXC A;  1KWO B;  1QS7 A;  2CCM A;  3JVT B;  4USL A;  1TCF A;  1UHH A;  2CXJ A;  2F3Z A;  1DJZ A;  1S5G Y;  1J7R A;  2KDH A;  2M7N A;  3GK4 X;  4D1E A;  4GGN A;  1GQM A;  4FTG A;  1CDP A;  3OX6 A;  2CT9 A;  4PHJ A;  4ORB B;  4WQ2 A;  3TS5 B;  1CKK A;  1WDC C;  4TNC A;  3KPX A;  4GAO A;  3CWG A;  5HKY A;  1AUI B;  1XFY O;  2LMV A;  1G8I A;  1UHN A;  1S36 A;  4MN0 A;  5AER A;  1QLS A;  3JTD C;  1IQ3 A;  1ZOT B;  1SMG A;  2E30 A;  4I5N B;  1YUR A;  3OB2 B;  1QX5 B;  1OQP A;  1K93 D;  2L51 A;  3H4S E;  4GGF A;  4N1G A;  1CB1 A;  3RM1 A;  5ER5 A;  4F0Z B;  1KQV A;  2V53 A;  2ZNE A;  1M39 A;  2K7O A;  1D1O A;  3VRP A;  3BUM B;  3EVR A;  4WQ3 A;  5BPJ A;  4M2Q A;  1PSB A;  1K95 A;  2ZND A;  1SY9 A;  1PVB A;  4MLW A;  3O2P A;  2H61 A;  3TDI A;  2LCP A;  1F70 A;  1IRJ A;  1LA3 A;  2Y4Q A;  1J55 A;  1SL8 A;  1TNX A;  2LLU A;  1PVA A;  2LMU A;  2K8M B;  1M46 A;  1MXL C;  1F54 A;  4NDD A;  1CFP A;  2M3W A;  1QVI Y;  1YX8 A;  4I5L B;  2BCA A;  2ZRT A;  1OOJ A;  1SCM C;  1Y1A A;  2BE6 A;  2BL0 C;  3NSK A;  3PN7 C;  2FCD A;  3AKB A;  2PSR A;  2JNF A;  3I5G B;  1NYA A;  1TOP A;  1YUT A;  4CFR A;  1YVH A;  1AK8 A;  1DT7 B;  4GUK A;  2PVB A;  4GNK B;  1KFX L;  1XFV O;  2I7A A;  3SG4 A;  4DIR A;  5KTY A;  1FI6 A;  3KF9 A;  1DVI A;  1QX2 A;  1RK9 A;  2JZI A;  3DVJ A;  2M8U A;  1B7T Y;  1TNP A;  3NSL A;  1KWO C;  3JVT C;  1IH0 A;  2PAL A;  2L5X B;  1CFC A;  3EVU A;  3SG7 A;  4QJ5 B;  1WY9 A;  1FBV A;  1NX3 A;  3CR4 X;  4WRI A;  3NSI A;  5I2L A;  1WLZ A;  2NLN A;  3DVK A;  1K8U A;  1J1D A;  1KK7 Z;  1G4Y R;  2L4H A;  5GQQ C;  3TS5 C;  1IG5 A;  5D69 A;  2M1U A;  1F4Q A;  1NCZ A;  2WCF A;  4ETO A;  1VRK A;  2K2F A;  3EK8 A;  1CFF A;  5HKZ A;  2LVV A;  3BYA A;  4Q04 A;  3GK2 A;  1NIW A;  1K9U A;  2BCB A;  1PK0 D;  3I5I B;  1PSR A;  1F8H A;  1W7J B;  2K7B A;  2LHL A;  2BKH B;  5B8I B;  1KFX S;  1NCY A;  4M2P A;  2FCE A;  1SNL A;  3IF7 A;  1F4O A;  4A4B A;  1S26 D;  3BUW B;  1CM1 A;  1DGU A;  1KSM A;  2M0R A;  4YGA A;  1QX7 A;  2M49 B;  5TNC A;  2MRD A;  4BY5 A;  2BBM A;  2MLE C;  1EG4 A;  1R6P A;  1W7I B;  1PUL A;  4PE0 A;  3M0W A;  2JU0 A;  1DF0 B;  1B9A A;  2HPS A;  3BUN B;  2BL0 B;  4PHN A;  1NX2 A;  2K7D A;  3E3R A;  4GFT A;  1G33 A;  2KQY A;  2MHH A;  1ODB A;  2WCB A;  1A75 A;  1NX1 A;  1QIV A;  5CSF A;  1BR4 B;  2L4I A;  1PRW A;  1OMD A;  4OKH A;  2Y5I A;  1C7W A;  1Y1U A;  3BUO B;  1JFK A;  1SRA A;  2LVJ A;  1OSA A;  1RRO A;  1Y1X A;  2MAZ A;  2Y1N A;  2K7C A;  2KI4 B;  1XO5 A;  2JTZ A;  1IGV A;  4A4C A;  3ZNI A;  2JPT A;  2LAP A;  1S3P A;  5DKQ A;  2KSP A;  1B1G A;  3WNX B;  1M63 B;  2FJU B;  3OB1 B;  1N65 A;  3CS1 A;  1H8B A;  4GGF C;  4MZL A;  2EGD A;  5KU1 A;  2I94 A;  1LIN A;  2KOT A;  1WRZ A;  2CTN A;  3TDZ A;  2HF5 A;  1S6C A;  2PAS A;  1NP8 A;  4P5O E;  5FYX A;  1MQ1 A;  3A4U B;  3EK7 A;  5CSN A;  1B8L A;  2H61 C;  1UUR A;  2BBN A;  1JC2 A;  1QIW A;  2SAS A;  3I5F B;  1ZFS A;  2GV5 A;  1AJ5 A;  1JBA A;  1CDL A;  3SIA A;  1J7O A;  1CTR A;  3GOF A;  3HX4 A;  5AXI A;  2BEC A;  1B47 A;  1CLM A;  1NUB A;  2CNP A;  2JOJ A;  4MZK A;  1BOC A;  2WND A;  1ALW A;  3PSR A;  1A75 B;  3I5I C;  2ZN8 A;  5ER4 X;  1Y6W A;  4DRW A;  3O4Y A;  4YGE B;  1IQ5 A;  3A8R A;  1CNP A;  2ZFD A;  2KFG A;  1KFU L;  3CZT X;  1CLL A;  1MWN A;  2RGI A;  1WLM A;  3I5H B;  1NX0 A;  3LCP C;  3NSO A;  4OCI A;  2FOT A;  2KAX A;  4GBA A;  3DF0 A;  3BOW A;  1SCV A;  4YI9 A;  2WC8 A;  1JSA A;  2HET A;  2OS8 C;  3AKA A;  3HCM A;  2KFH A;  2Q91 A;  5CSI A;  1J7Q A;  2F2O A;  2L2E A;  1J7P A;  1SBJ A;  2EC6 B;  4NDB A;  1DJX A;  1V1F A;  1SL9 A;  1LKJ A;  2ZKM X;  2KI6 D;  4CID A;  1A29 A;  3PFV A;  1PAL A;  1J1E A;  3PAL A;  3SG3 A;  4UPG A;  2TN4 A;  1GGW A;  3K21 A;  5F6T A;  3IQO A;  2F33 A;  2K61 A;  2KI4 C;  2B1U A;  4AQJ A;  1EJ3 A;  2JC2 A;  1DMO A;  1JFJ A;  1B8C A;  1KFU S;  1JF2 A;  1TIZ A;  2AMI A;  2PRU A;  2M7L A;  2L98 A;  1BOD A;  1JWD A;  4YBH B;  4I5J A;  1YTZ C;  1MHO A;  2GGM A;  2WOR A;  1BMO A;  2LUX A;  3MSE B;  5J3X A;  4XYN A;  4L9M A;  3VRN A;  4MEW A;  1L7Z A;  1LVC D;  1UWO A;  4AQI A;  1ALV A;  2JWW A;  3DF0 B;  1BJF A;  1QV1 A;  2JNX A;  3BOW B;  1MUX A;  1LXF C;  1YUU A;  2KYF A;  1K96 A;  3I5F C;  3KEV A;  4C0J A;  1M45 A;  1JF0 A;  2KYC A;  4C0L A;  4ORC B;  2P6B B;  4IL1 A;  3ZWH A;  3RLZ A;  4HRG A;  2Y1M A;  2F3Y A;  5I2O A;  2KBI A;  1QAS A;  1OMV A;  1YUS A;  1N2D A;  3FS7 A;  2WCE A;  5HYD A;  5DKR A;  3VGO A;  1C7V A;  4MSP A;  3F45 A;  1XFX O;  5JOL A;  1TCO B;  5K89 A;  3CTN A;  2K0J A;  2MA2 A;  2JRF A;  3SJS A;  3KHE A;  1L2O B;  3VRO A;  3I5H C;  3LK1 A;  1RJV A;  3AAJ A;  2OS8 B;  4CLN A;  1YR5 A;  1KK7 Y;  4PE7 A;  4ZCU A;  5DKN A;  1AHR A;  2LP3 A;  4M2O A;  3BQ3 A;  2JXL A;  1NPQ A;  5CSJ A;  3PM8 A;  1QXP A;  4XJK A;  2KGR A;  1DJI A;  4JQ0 D;  2KGB C;  1XFU O;  3O78 A;  2EC6 C;  4JWQ A;  4E68 A;  2QAC A;  4MRX A;  4MVF A;  1UUS A;  1S5G Z;  1SL7 A;  1V1G A;  1QJT A;  1BG1 A;  3TZ1 A;  1OZO A;  1FPW A;  1RFJ A;  1SKT A;  3QRX A;  1BU3 A;  3CR2 A;  1ZUZ A;  2MLF C;  1KSO A;  1XK4 A;  1K2H A;  1KCY A;  2ZRS A;  1A03 A;  1MR8 A;  2L0P A;  4DS7 A;  3OX5 A;  1NWD A;  2MBX A;  1GGZ A;  1YRU B;  2NXQ A;  1U5I A;  1H4B A;  1DJY A;  1SPY A;  2E6W A;  3CLN A;  4ORA B;  2G9B A;  4YGC B;  2A4J A;  3SG5 A;  1DTL A;  1DJG A;  2LUC A;  1K94 A;  3SIB A;  4I5K A;  1EXR A;  1CFD A;  1NCX A;  1BT6 A;  1YX7 A;  2WOS A;  1QAT A;  1CMF A;  4DUQ A;  1ZAC A;  1S1E A;  1UHI A;  2F8P A;  4GPL B;  2JQ6 A;  3TDU A;  3PAT A;  2LC5 A;  1ZMZ A;  3LL8 B;  3OP0 A;  1WRK A;  1Q80 A;  3EKJ A;  3PLF B;  1SR6 C;  2KAV A;  3GK1 A;  4XJK B;  1KQM B;  1S6J A;  2M29 A;  2HQ8 A;  2JT0 A;  1SYM A; 
#chains in the Genus database with same CATH topology
 3WHT B;  3KO0 A;  3BXK A;  1QVI Z;  1Z4H A;  1TNQ A;  1K9P A;  2R2I A;  4N1F A;  1IJ6 A;  1IJ5 A;  4OV2 A;  4CFQ A;  3S0F A;  3R1P A;  1UHJ A;  3CYZ A;  3B88 A;  2OTG C;  2BE4 A;  2QPT A;  2WCK A;  1CDN A;  1L2O C;  1UHK A;  3OHM B;  2LE9 B;  1TNW A;  2IS9 A;  5AAN A;  3VRQ A;  2BAP A;  1B8R A;  3S0E A;  5I8N A;  3EKH A;  3WHU B;  3B87 A;  1BR1 B;  2L5Y A;  1BF5 A;  1FW4 A;  4JPZ B;  4C0K A;  3R1V A;  1SW8 A;  3DD4 A;  1U5I B;  2GTE A;  1QWV A;  3D10 A;  3DVE A;  2KAY A;  4NQG A;  4BY4 A;  1S6I A;  1B7T Z;  1K90 D;  3TUY B;  2AAO A;  1R2U A;  1KK8 C;  2LV7 A;  1BLQ A;  2KFF A;  1OOF A;  1WRL A;  1YVL A;  4MRY A;  5HKW A;  4PHK A;  1TRF A;  1XVJ A;  4NDC A;  2JT3 A;  1UP5 A;  1F71 A;  1C3Z A;  5G08 A;  4YI8 A;  1IIO A;  1FI5 A;  2LLT A;  2K2A A;  4YRU A;  2O60 A;  2M9G A;  5HLV A;  2ERB A;  4AOM A;  4PDZ A;  1XFW O;  3NXA A;  3QME A;  3SG6 A;  1SK6 D;  2BCX A;  1OMR A;  2LAN A;  2GGZ A;  2EHB A;  1IWQ A;  3SS5 A;  1RWY A;  4FQO A;  1CDM A;  2NZ0 A;  5PAL A;  2Q4U A;  2MJW B;  1ORG A;  2LHI A;  1X02 A;  4YGD B;  5I2Q A;  2LNK A;  1Z2C B;  4P2Y B;  1EH2 A;  3BUX B;  1XYD A;  2SCP A;  5JJG A;  4HRH A;  1JUO A;  1DJW A;  1DF0 A;  1M31 A;  2LLS A;  1SR6 B;  5KSZ A;  4HRE E;  2PYQ A;  1B4C A;  2KHN A;  1T14 A;  5AFP A;  2D8N A;  3ICB A;  4OVN F;  3FWC A;  2ISD A;  1CMG A;  1AJ4 A;  3DYE A;  3S0D A;  1DGV A;  3V2L A;  5CPV A;  2BKI B;  1WDC B;  1NSH A;  1KQM C;  2DOQ A;  3OGN A;  4R1E A;  2OPO A;  1XFZ O;  2LMT A;  4U8D A;  1CLB A;  1HT9 A;  2L50 A;  1K9K A;  2ZN9 A;  3IQQ A;  4PAL A;  2LVI A;  4PE1 A;  5AEQ A;  4DCK A;  1F55 A;  3JTD B;  2OTG B;  1DJH A;  3FWB A;  3WXA A;  1Y0V H;  4QJ4 B;  3D0Y A;  2LM5 A;  3O6B A;  5IBW A;  1QLK A;  1TN4 A;  2LVK A;  5D7F A;  4HSZ A;  3EVV A;  4YGB B;  3LK0 A;  1GJY A;  1LA0 A;  1FF1 A;  4ICB A;  2I2R E;  4N5X A;  2JTT A;  2NCP A;  2WC6 A;  3IVT A;  4CPV A;  1AP4 A;  1GM0 A;  2HQW A;  1XK4 C;  4PE4 A;  1REC A;  2CBL A;  1CM4 A;  1A4P A;  4MZJ A;  2JPO A;  2F2P A;  2JT8 A;  5EL2 A;  2I18 A;  1KK8 B;  1AVS A;  2M97 A;  2H2K A;  2VRG A;  3SS4 A;  3VRR A;  1RTP 1;  1MF8 B;  3FIA A;  1C07 A;  1YRT B;  1E8A A;  1QTX A;  1QV0 A;  3TUY C;  1DC1 A;  3SG2 A;  3LLE A;  1XA5 A;  2QEO A;  2KI6 C;  1TTX A;  3EK4 A;  1HQV A;  2NCO A;  1OW4 A;  1MXE A;  2G2B A;  2PQL A;  3DVM A;  2K60 A;  3BFA A;  4MBE A;  1SCM B;  3PN7 B;  1OE9 B;  4PHM A;  3CR5 X;  1OZS A;  2AUC A;  1N0Y A;  2M1K B;  5DIC A;  4OR9 B;  2L2C A;  4QJ3 B;  4PCW A;  2KBM A;  3AAK A;  2JUL A;  4ZCV A;  4F7F A;  2O5G A;  2KNE A;  3C1V A;  1EG3 A;  3I5G C;  1A2X A;  2COL B;  1EL4 A;  5HLO A;  2PMY A;  3FE9 A;  1IKU A;  3D0Y B;  2LP2 A;  3CGA A;  2KQ6 A;  2JXC A;  1KWO B;  1QS7 A;  2CCM A;  3JVT B;  4USL A;  1TCF A;  1UHH A;  1W9Z A;  2CXJ A;  2F3Z A;  1DJZ A;  3DZT A;  5D3O A;  2QDI A;  1S5G Y;  1J7R A;  2KDH A;  2M7N A;  3GK4 X;  4D1E A;  4GGN A;  1GQM A;  4FTG A;  1CDP A;  3S0G A;  3D73 A;  3OX6 A;  4PT1 A;  2CT9 A;  4PHJ A;  4ORB B;  4WQ2 A;  3TS5 B;  1OOI X;  1CKK A;  1WDC C;  4TNC A;  3KPX A;  4GAO A;  3CWG A;  5HKY A;  1AUI B;  1XFY O;  2LMV A;  1G8I A;  1UHN A;  1S36 A;  3CZ1 A;  4MN0 A;  5AER A;  1QLS A;  3JTD C;  1IQ3 A;  1ZOT B;  1SMG A;  2E30 A;  4I5N B;  1YUR A;  3OB2 B;  1QX5 B;  1OQP A;  1K93 D;  2BNX A;  2L51 A;  3H4S E;  4GGF A;  4N1G A;  1CB1 A;  3RM1 A;  4IJ7 A;  5ER5 A;  4F0Z B;  1KQV A;  2V53 A;  2ZNE A;  1M39 A;  3S0A A;  2K7O A;  1D1O A;  3VRP A;  3BUM B;  3EVR A;  4WQ3 A;  5BPJ A;  4M2Q A;  1PSB A;  1K95 A;  2ZND A;  1SY9 A;  1PVB A;  4MLW A;  3O2P A;  3SS3 A;  2H61 A;  3TDI A;  2LCP A;  1F70 A;  1IRJ A;  1LA3 A;  2Y4Q A;  1J55 A;  1SL8 A;  1C3Y A;  1TNX A;  2LLU A;  1PVA A;  2LMU A;  2K8M B;  1M46 A;  1MXL C;  3UNW A;  1F54 A;  4NDD A;  1CFP A;  2M3W A;  1QVI Y;  1YX8 A;  1OOG A;  3NHT A;  4I5L B;  2BCA A;  2ZRT A;  1OOJ A;  1SCM C;  1Y1A A;  2BE6 A;  2BL0 C;  3N7H A;  3NSK A;  3PN7 C;  2FCD A;  3R72 A;  3AKB A;  2PSR A;  2JNF A;  3I5G B;  1NYA A;  1TOP A;  1YUT A;  4CFR A;  1YVH A;  1AK8 A;  1DT7 B;  4GUK A;  1TUJ A;  2PVB A;  4GNK B;  1KFX L;  1XFV O;  2I7A A;  3SG4 A;  4DIR A;  5KTY A;  1FI6 A;  2P71 A;  1P28 A;  3KF9 A;  1DEK A;  1DVI A;  1QX2 A;  1RK9 A;  2JZI A;  3DVJ A;  2M8U A;  1B7T Y;  1TNP A;  3NSL A;  1KWO C;  3JVT C;  1IH0 A;  2PAL A;  2L5X B;  1CFC A;  3EVU A;  3SG7 A;  4QJ5 B;  1WY9 A;  1FBV A;  1NX3 A;  3CR4 X;  3L47 A;  4WRI A;  1TUZ A;  3NSI A;  5I2L A;  1WLZ A;  2NLN A;  3DVK A;  1K8U A;  1J1D A;  1KK7 Z;  3DY9 A;  1G4Y R;  2L4H A;  5GQQ C;  4KYN A;  3TS5 C;  1IG5 A;  5D69 A;  2M1U A;  1F4Q A;  1NCZ A;  2WCF A;  4ETO A;  1VRK A;  2K2F A;  3EK8 A;  1CFF A;  3B7A A;  5HKZ A;  2LVV A;  2WCM A;  3BYA A;  4Q04 A;  4INX A;  3GK2 A;  1NIW A;  1K9U A;  2BCB A;  1PK0 D;  3I5I B;  1PSR A;  1F8H A;  1W7J B;  2K7B A;  2LHL A;  2BKH B;  3BFB A;  1KFX S;  5B8I B;  1NCY A;  4M2P A;  2FCE A;  1SNL A;  3IF7 A;  1F4O A;  4A4B A;  1S26 D;  3BUW B;  3D77 A;  1CM1 A;  4INW A;  1DGU A;  1KSM A;  2M0R A;  4YGA A;  1QX7 A;  2M49 B;  5TNC A;  2MRD A;  3OBV A;  4BY5 A;  2BBM A;  2MLE C;  1EG4 A;  1R6P A;  1W7I B;  1PUL A;  4PE0 A;  3M0W A;  2JU0 A;  1DF0 B;  1B9A A;  2HPS A;  3BUN B;  2BL0 B;  4PHN A;  1NX2 A;  2K7D A;  3E3R A;  4GFT A;  1G33 A;  2KQY A;  2MHH A;  1ODB A;  3CDN A;  2WCB A;  1A75 A;  1NX1 A;  1QIV A;  5CSF A;  1BR4 B;  2QEV A;  2L4I A;  1PRW A;  1OMD A;  3Q8I A;  4FQT A;  4OKH A;  2Y5I A;  1C7W A;  1Y1U A;  3BUO B;  1JFK A;  1SRA A;  2LVJ A;  1OSA A;  1RRO A;  1Y1X A;  2MAZ A;  2YGU A;  2Y1N A;  2K7C A;  2KI4 B;  1XO5 A;  2JTZ A;  1IGV A;  4A4C A;  3ZNI A;  2JPT A;  2FJY A;  2LAP A;  1S3P A;  5DKQ A;  2KSP A;  1B1G A;  3WNX B;  1M63 B;  2FJU B;  3VB1 A;  3OB1 B;  1N65 A;  3CS1 A;  1H8B A;  4GGF C;  3NGV A;  4MZL A;  2EGD A;  5KU1 A;  2I94 A;  1LIN A;  2KOT A;  1WRZ A;  2CTN A;  3TDZ A;  2HF5 A;  1S6C A;  3DXL A;  2PAS A;  1NP8 A;  4P5O E;  5FYX A;  1MQ1 A;  3A4U B;  3EK7 A;  5CSN A;  1B8L A;  2H61 C;  1UUR A;  2BBN A;  1JC2 A;  1QIW A;  2SAS A;  3I5F B;  1ZFS A;  3L4L A;  2GV5 A;  3D74 A;  1AJ5 A;  1JBA A;  1CDL A;  3FE8 A;  3SIA A;  1J7O A;  1CTR A;  3GOF A;  3HX4 A;  5AXI A;  2BEC A;  1B47 A;  1CLM A;  1NUB A;  2CNP A;  2JOJ A;  1TWO A;  3D78 A;  2WND A;  1ALW A;  4MZK A;  5FI6 A;  3PSR A;  3PJI A;  1A75 B;  3I5I C;  2ZN8 A;  5ER4 X;  1Y6W A;  4DRW A;  3O4Y A;  4YGE B;  1IQ5 A;  3A8R A;  1CNP A;  2ZFD A;  2KFG A;  1KFU L;  2P70 A;  3CZT X;  1CLL A;  3S0B A;  1MWN A;  2RGI A;  1WLM A;  3I5H B;  1NX0 A;  3LCP C;  3NHI A;  3NSO A;  2FOT A;  2KAX A;  4OCI A;  4GBA A;  3DF0 A;  3BOW A;  1SCV A;  4YI9 A;  2WC8 A;  1JSA A;  2HET A;  3BFH A;  2OS8 C;  3AKA A;  3CZ0 A;  3HCM A;  2KFH A;  2Q91 A;  5CSI A;  1J7Q A;  2F2O A;  2L2E A;  2KLD A;  1J7P A;  1SBJ A;  2EC6 B;  4NDB A;  1DJX A;  3UO9 A;  1V1F A;  1SL9 A;  1LKJ A;  2ZKM X;  2KI6 D;  3O4X A;  4CID A;  1A29 A;  3PFV A;  1PAL A;  1J1E A;  3PAL A;  3SG3 A;  4UPG A;  2TN4 A;  1GGW A;  3CZ2 A;  3K21 A;  3IQO A;  5F6T A;  2F33 A;  3B6X A;  2K61 A;  3R1O A;  2KI4 C;  2B1U A;  4AQJ A;  1EJ3 A;  2JC2 A;  1DMO A;  3B86 A;  1JFJ A;  1B8C A;  1KFU S;  3D75 A;  1JF2 A;  1XFR A;  1TIZ A;  2AMI A;  2PRU A;  2M7L A;  2L98 A;  1BOD A;  1JWD A;  4YBH B;  4I5J A;  1YTZ C;  1MHO A;  2GGM A;  2WCJ A;  1BMO A;  2LUX A;  2WOR A;  3MSE B;  5J3X A;  4XYN A;  4L9M A;  3VRN A;  4MEW A;  3L4A A;  1L7Z A;  1LVC D;  1UWO A;  4AQI A;  1ALV A;  2H8V A;  2JWW A;  3DF0 B;  1BJF A;  1QV1 A;  2JNX A;  3BOW B;  1MUX A;  1LXF C;  1YUU A;  2KYF A;  1K96 A;  3I5F C;  3KEV A;  4C0J A;  1M45 A;  1JF0 A;  2KYC A;  4C0L A;  4ORC B;  2P6B B;  4IL1 A;  3ZWH A;  2WC5 A;  3RLZ A;  1DQE A;  1SSE B;  4HRG A;  2Y1M A;  2F3Y A;  5I2O A;  2QEB A;  2KBI A;  1QAS A;  1OMV A;  1YUS A;  1DEL A;  1N2D A;  3FS7 A;  2WCE A;  3BJH A;  5HYD A;  5DKR A;  3VGO A;  1C7V A;  4MSP A;  3F45 A;  2WCL A;  1XFX O;  2KPH A;  1TCO B;  4JKT A;  5JOL A;  5K89 A;  3FE6 A;  5HL1 A;  3CTN A;  2K0J A;  2MA2 A;  4JD9 A;  2JRF A;  3SJS A;  3KHE A;  1L2O B;  3VRO A;  3I5H C;  3LK1 A;  1RJV A;  3AAJ A;  5FI7 A;  2OS8 B;  4CLN A;  1YR5 A;  1KK7 Y;  4PE7 A;  4ZCU A;  3K1E A;  5DKN A;  1AHR A;  2LP3 A;  4M2O A;  3BQ3 A;  2JXL A;  1NPQ A;  5CSJ A;  3PM8 A;  5I94 A;  1QXP A;  4XJK A;  2KGR A;  1DJI A;  4JQ0 D;  2KGB C;  1XFU O;  5FI2 A;  3O78 A;  2EC6 C;  4JWQ A;  1OOH A;  4E68 A;  2QAC A;  4MRX A;  3PM2 A;  4OZD A;  4MVF A;  1UUS A;  1S5G Z;  1SL7 A;  1V1G A;  1QJT A;  2QEH A;  3TZ1 A;  1BG1 A;  1OZO A;  1FPW A;  3D76 A;  1RFJ A;  1SKT A;  3QRX A;  1BU3 A;  2WCH A;  3CR2 A;  1ZUZ A;  2MLF C;  1KSO A;  1XK4 A;  1K2H A;  1BOC A;  1KCY A;  2ZRS A;  1A03 A;  1MR8 A;  2L0P A;  4DS7 A;  3OX5 A;  1NWD A;  2MBX A;  1GGZ A;  1YRU B;  2NXQ A;  1U5I A;  1H4B A;  1DJY A;  1SPY A;  2E6W A;  3CLN A;  4ORA B;  2G9B A;  4YGC B;  2A4J A;  3CAB A;  3SG5 A;  3RZS A;  1DTL A;  1DJG A;  2LUC A;  1K94 A;  3SIB A;  4I5K A;  1EXR A;  2KLE A;  1CFD A;  1NCX A;  1BT6 A;  1YX7 A;  2WOS A;  1QAT A;  1CMF A;  4DUQ A;  1ZAC A;  1S1E A;  1UHI A;  2F8P A;  4GPL B;  2JQ6 A;  3TDU A;  3PAT A;  2LC5 A;  1ZMZ A;  3LL8 B;  3OP0 A;  1WRK A;  1Q80 A;  3EKJ A;  3PLF B;  1SR6 C;  2KAV A;  3GK1 A;  4XJK B;  1KQM B;  1S6J A;  2M29 A;  1LS8 A;  2HQ8 A;  2JT0 A;  1SYM A;  3EG5 B; 
#chains in the Genus database with same CATH homology
 3WHT B;  3KO0 A;  3BXK A;  1QVI Z;  1TNQ A;  1K9P A;  2R2I A;  4N1F A;  1IJ6 A;  1IJ5 A;  4OV2 A;  4CFQ A;  1UHJ A;  2OTG C;  2BE4 A;  2QPT A;  1CDN A;  1L2O C;  1UHK A;  3OHM B;  2LE9 B;  1TNW A;  2IS9 A;  5AAN A;  3VRQ A;  1B8R A;  5I8N A;  3EKH A;  3WHU B;  1BR1 B;  1BF5 A;  1FW4 A;  4JPZ B;  4C0K A;  1SW8 A;  3DD4 A;  1U5I B;  3D10 A;  3DVE A;  2KAY A;  4NQG A;  4BY4 A;  1S6I A;  1B7T Z;  1K90 D;  3TUY B;  2AAO A;  1R2U A;  1KK8 C;  2LV7 A;  1BLQ A;  2KFF A;  1WRL A;  1YVL A;  4MRY A;  5HKW A;  4PHK A;  1TRF A;  1XVJ A;  4NDC A;  2JT3 A;  1UP5 A;  1F71 A;  5G08 A;  4YI8 A;  1FI5 A;  2LLT A;  2K2A A;  4YRU A;  2O60 A;  2M9G A;  5HLV A;  4AOM A;  4PDZ A;  1XFW O;  3NXA A;  3SG6 A;  1SK6 D;  2BCX A;  1OMR A;  2LAN A;  2GGZ A;  2EHB A;  1IWQ A;  1RWY A;  4FQO A;  1CDM A;  2NZ0 A;  5PAL A;  2Q4U A;  2MJW B;  2LHI A;  1X02 A;  4YGD B;  5I2Q A;  2LNK A;  4P2Y B;  1EH2 A;  3BUX B;  1XYD A;  2SCP A;  5JJG A;  4HRH A;  1JUO A;  1DJW A;  1DF0 A;  1M31 A;  2LLS A;  1SR6 B;  5KSZ A;  4HRE E;  1B4C A;  2KHN A;  5AFP A;  2D8N A;  3ICB A;  4OVN F;  3FWC A;  2ISD A;  1CMG A;  1AJ4 A;  1DGV A;  5CPV A;  2BKI B;  1WDC B;  1NSH A;  1KQM C;  2DOQ A;  4R1E A;  2OPO A;  1XFZ O;  2LMT A;  4U8D A;  1CLB A;  1HT9 A;  2L50 A;  1K9K A;  2ZN9 A;  3IQQ A;  4PAL A;  2LVI A;  4PE1 A;  5AEQ A;  4DCK A;  1F55 A;  3JTD B;  2OTG B;  1DJH A;  3FWB A;  3WXA A;  1Y0V H;  4QJ4 B;  3D0Y A;  2LM5 A;  3O6B A;  5IBW A;  1QLK A;  1TN4 A;  2LVK A;  5D7F A;  4HSZ A;  3EVV A;  4YGB B;  3LK0 A;  1GJY A;  1LA0 A;  1FF1 A;  4ICB A;  2I2R E;  4N5X A;  2JTT A;  2NCP A;  4CPV A;  1AP4 A;  2HQW A;  1XK4 C;  4PE4 A;  1REC A;  2CBL A;  1CM4 A;  1A4P A;  4MZJ A;  2JT8 A;  2F2P A;  2I18 A;  1KK8 B;  1AVS A;  2M97 A;  2H2K A;  2VRG A;  3VRR A;  1RTP 1;  1MF8 B;  3FIA A;  1C07 A;  1YRT B;  1E8A A;  1QTX A;  1QV0 A;  3TUY C;  3SG2 A;  3LLE A;  1XA5 A;  2KI6 C;  1TTX A;  3EK4 A;  1HQV A;  2NCO A;  1MXE A;  2G2B A;  3DVM A;  4MBE A;  1SCM B;  3PN7 B;  1OE9 B;  4PHM A;  3CR5 X;  2AUC A;  1OZS A;  1N0Y A;  2M1K B;  4OR9 B;  4QJ3 B;  4PCW A;  2KBM A;  3AAK A;  2JUL A;  4ZCV A;  2O5G A;  2KNE A;  3C1V A;  1EG3 A;  3I5G C;  1A2X A;  2COL B;  1EL4 A;  5HLO A;  2PMY A;  1IKU A;  3D0Y B;  2LP2 A;  3CGA A;  2KQ6 A;  2JXC A;  1KWO B;  1QS7 A;  2CCM A;  3JVT B;  4USL A;  1TCF A;  1UHH A;  2CXJ A;  2F3Z A;  1DJZ A;  1S5G Y;  1J7R A;  2KDH A;  2M7N A;  3GK4 X;  4D1E A;  4GGN A;  1GQM A;  4FTG A;  1CDP A;  3OX6 A;  2CT9 A;  4PHJ A;  4ORB B;  4WQ2 A;  3TS5 B;  1CKK A;  1WDC C;  4TNC A;  3KPX A;  4GAO A;  3CWG A;  5HKY A;  1AUI B;  1XFY O;  2LMV A;  1G8I A;  1UHN A;  1S36 A;  4MN0 A;  5AER A;  1QLS A;  3JTD C;  1IQ3 A;  1ZOT B;  1SMG A;  2E30 A;  4I5N B;  1YUR A;  3OB2 B;  1QX5 B;  1OQP A;  1K93 D;  2L51 A;  3H4S E;  4GGF A;  4N1G A;  1CB1 A;  3RM1 A;  5ER5 A;  4F0Z B;  1KQV A;  2V53 A;  2ZNE A;  1M39 A;  2K7O A;  1D1O A;  3VRP A;  3BUM B;  3EVR A;  4WQ3 A;  5BPJ A;  4M2Q A;  1PSB A;  1K95 A;  2ZND A;  1SY9 A;  1PVB A;  4MLW A;  3O2P A;  2H61 A;  3TDI A;  2LCP A;  1F70 A;  1IRJ A;  1LA3 A;  2Y4Q A;  1J55 A;  1SL8 A;  1TNX A;  2LLU A;  1PVA A;  2LMU A;  2K8M B;  1M46 A;  1MXL C;  1F54 A;  4NDD A;  1CFP A;  2M3W A;  1QVI Y;  1YX8 A;  4I5L B;  2BCA A;  2ZRT A;  1OOJ A;  1SCM C;  1Y1A A;  2BE6 A;  2BL0 C;  3NSK A;  3PN7 C;  2FCD A;  3AKB A;  2PSR A;  2JNF A;  3I5G B;  1NYA A;  1TOP A;  1YUT A;  4CFR A;  1YVH A;  1AK8 A;  1DT7 B;  4GUK A;  2PVB A;  4GNK B;  1KFX L;  1XFV O;  2I7A A;  3SG4 A;  4DIR A;  5KTY A;  1FI6 A;  3KF9 A;  1DVI A;  1QX2 A;  1RK9 A;  2JZI A;  3DVJ A;  2M8U A;  1B7T Y;  1TNP A;  3NSL A;  1KWO C;  3JVT C;  1IH0 A;  2PAL A;  2L5X B;  1CFC A;  3EVU A;  3SG7 A;  4QJ5 B;  1WY9 A;  1FBV A;  1NX3 A;  3CR4 X;  4WRI A;  3NSI A;  5I2L A;  1WLZ A;  2NLN A;  3DVK A;  1K8U A;  1J1D A;  1KK7 Z;  1G4Y R;  2L4H A;  5GQQ C;  3TS5 C;  1IG5 A;  5D69 A;  2M1U A;  1F4Q A;  1NCZ A;  2WCF A;  4ETO A;  1VRK A;  2K2F A;  3EK8 A;  1CFF A;  5HKZ A;  2LVV A;  3BYA A;  4Q04 A;  3GK2 A;  1NIW A;  1K9U A;  2BCB A;  1PK0 D;  3I5I B;  1PSR A;  1F8H A;  1W7J B;  2K7B A;  2LHL A;  2BKH B;  5B8I B;  1KFX S;  1NCY A;  4M2P A;  2FCE A;  1SNL A;  3IF7 A;  1F4O A;  4A4B A;  1S26 D;  3BUW B;  1CM1 A;  1DGU A;  1KSM A;  2M0R A;  4YGA A;  1QX7 A;  2M49 B;  5TNC A;  2MRD A;  4BY5 A;  2BBM A;  2MLE C;  1EG4 A;  1R6P A;  1W7I B;  1PUL A;  4PE0 A;  3M0W A;  2JU0 A;  1DF0 B;  1B9A A;  2HPS A;  3BUN B;  2BL0 B;  4PHN A;  1NX2 A;  2K7D A;  3E3R A;  4GFT A;  1G33 A;  2KQY A;  2MHH A;  1ODB A;  2WCB A;  1A75 A;  1NX1 A;  1QIV A;  5CSF A;  1BR4 B;  2L4I A;  1PRW A;  1OMD A;  4OKH A;  2Y5I A;  1C7W A;  1Y1U A;  3BUO B;  1JFK A;  1SRA A;  2LVJ A;  1OSA A;  1RRO A;  1Y1X A;  2MAZ A;  2Y1N A;  2K7C A;  2KI4 B;  1XO5 A;  2JTZ A;  1IGV A;  4A4C A;  3ZNI A;  2JPT A;  2LAP A;  1S3P A;  5DKQ A;  2KSP A;  1B1G A;  3WNX B;  1M63 B;  2FJU B;  3OB1 B;  1N65 A;  3CS1 A;  1H8B A;  4GGF C;  4MZL A;  2EGD A;  5KU1 A;  2I94 A;  1LIN A;  2KOT A;  1WRZ A;  2CTN A;  3TDZ A;  2HF5 A;  1S6C A;  2PAS A;  1NP8 A;  4P5O E;  5FYX A;  1MQ1 A;  3A4U B;  3EK7 A;  5CSN A;  1B8L A;  2H61 C;  1UUR A;  2BBN A;  1JC2 A;  1QIW A;  2SAS A;  3I5F B;  1ZFS A;  2GV5 A;  1AJ5 A;  1JBA A;  1CDL A;  3SIA A;  1J7O A;  1CTR A;  3GOF A;  3HX4 A;  5AXI A;  2BEC A;  1B47 A;  1CLM A;  1NUB A;  2CNP A;  2JOJ A;  4MZK A;  1BOC A;  2WND A;  1ALW A;  3PSR A;  1A75 B;  3I5I C;  2ZN8 A;  5ER4 X;  1Y6W A;  4DRW A;  3O4Y A;  4YGE B;  1IQ5 A;  3A8R A;  1CNP A;  2ZFD A;  2KFG A;  1KFU L;  3CZT X;  1CLL A;  1MWN A;  2RGI A;  1WLM A;  3I5H B;  1NX0 A;  3LCP C;  3NSO A;  4OCI A;  2FOT A;  2KAX A;  4GBA A;  3DF0 A;  3BOW A;  1SCV A;  4YI9 A;  2WC8 A;  1JSA A;  2HET A;  2OS8 C;  3AKA A;  3HCM A;  2KFH A;  2Q91 A;  5CSI A;  1J7Q A;  2F2O A;  2L2E A;  1J7P A;  1SBJ A;  2EC6 B;  4NDB A;  1DJX A;  1V1F A;  1SL9 A;  1LKJ A;  2ZKM X;  2KI6 D;  4CID A;  1A29 A;  3PFV A;  1PAL A;  1J1E A;  3PAL A;  3SG3 A;  4UPG A;  2TN4 A;  1GGW A;  3K21 A;  5F6T A;  3IQO A;  2F33 A;  2K61 A;  2KI4 C;  2B1U A;  4AQJ A;  1EJ3 A;  2JC2 A;  1DMO A;  1JFJ A;  1B8C A;  1KFU S;  1JF2 A;  1TIZ A;  2AMI A;  2PRU A;  2M7L A;  2L98 A;  1BOD A;  1JWD A;  4YBH B;  4I5J A;  1YTZ C;  1MHO A;  2GGM A;  2WOR A;  1BMO A;  2LUX A;  3MSE B;  5J3X A;  4XYN A;  4L9M A;  3VRN A;  4MEW A;  1L7Z A;  1LVC D;  1UWO A;  4AQI A;  1ALV A;  2JWW A;  3DF0 B;  1BJF A;  1QV1 A;  2JNX A;  3BOW B;  1MUX A;  1LXF C;  1YUU A;  2KYF A;  1K96 A;  3I5F C;  3KEV A;  4C0J A;  1M45 A;  1JF0 A;  2KYC A;  4C0L A;  4ORC B;  2P6B B;  4IL1 A;  3ZWH A;  3RLZ A;  4HRG A;  2Y1M A;  2F3Y A;  5I2O A;  2KBI A;  1QAS A;  1OMV A;  1YUS A;  1N2D A;  3FS7 A;  2WCE A;  5HYD A;  5DKR A;  3VGO A;  1C7V A;  4MSP A;  3F45 A;  1XFX O;  5JOL A;  1TCO B;  5K89 A;  3CTN A;  2K0J A;  2MA2 A;  2JRF A;  3SJS A;  3KHE A;  1L2O B;  3VRO A;  3I5H C;  3LK1 A;  1RJV A;  3AAJ A;  2OS8 B;  4CLN A;  1YR5 A;  1KK7 Y;  4PE7 A;  4ZCU A;  5DKN A;  1AHR A;  2LP3 A;  4M2O A;  3BQ3 A;  2JXL A;  1NPQ A;  5CSJ A;  3PM8 A;  1QXP A;  4XJK A;  2KGR A;  1DJI A;  4JQ0 D;  2KGB C;  1XFU O;  3O78 A;  2EC6 C;  4JWQ A;  4E68 A;  2QAC A;  4MRX A;  4MVF A;  1UUS A;  1S5G Z;  1SL7 A;  1V1G A;  1QJT A;  1BG1 A;  3TZ1 A;  1OZO A;  1FPW A;  1RFJ A;  1SKT A;  3QRX A;  1BU3 A;  3CR2 A;  1ZUZ A;  2MLF C;  1KSO A;  1XK4 A;  1K2H A;  1KCY A;  2ZRS A;  1A03 A;  1MR8 A;  2L0P A;  4DS7 A;  3OX5 A;  1NWD A;  2MBX A;  1GGZ A;  1YRU B;  2NXQ A;  1U5I A;  1H4B A;  1DJY A;  1SPY A;  2E6W A;  3CLN A;  4ORA B;  2G9B A;  4YGC B;  2A4J A;  3SG5 A;  1DTL A;  1DJG A;  2LUC A;  1K94 A;  3SIB A;  4I5K A;  1EXR A;  1CFD A;  1NCX A;  1BT6 A;  1YX7 A;  2WOS A;  1QAT A;  1CMF A;  4DUQ A;  1ZAC A;  1S1E A;  1UHI A;  2F8P A;  4GPL B;  2JQ6 A;  3TDU A;  3PAT A;  2LC5 A;  1ZMZ A;  3LL8 B;  3OP0 A;  1WRK A;  1Q80 A;  3EKJ A;  3PLF B;  1SR6 C;  2KAV A;  3GK1 A;  4XJK B;  1KQM B;  1S6J A;  2M29 A;  2HQ8 A;  2JT0 A;  1SYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...