1QTXA

The 1.65 angstrom structure of calmodulin rs20 peptide complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
148
structure length
148
Chain Sequence
ADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYEEFVQVMMAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structure of a Calmodulin Rs20 Peptide Complex
rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords PROTEIN (CALMODULIN)
total genus 52
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1999-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qtxA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qtxA02
3TUYB 1Y6WA 1CM4A 1DF0A 4NDDA 1BMOA 1B8RA 5HKYA 3FS7A 1F4QA 1KQMC 1NCZA 1SR6C 2L5XB 4ZCVA 1R6PA 1HT9A 2KFGA 5HYDA 4BY5A 4U8DA 4DS7A 1DJYA 1QATA 1TRFA 3TDZA 1QLSA 1FF1A 3VROA 4CPVA 2KNEA 4GAOA 3WHTB 4MZJA 1JFKA 1M31A 4MZLA 4YGCB 2Y1MA 1RK9A 3I5HC 2KI6D 1CTRA 1EL4A 2WCEA 4ZCUA 1NX1A 4USLA 2D8NA 1WLZA 1XFVO 2GGMA 1D1OA 5B8IB 2WCBA 1QVIZ 4NQGA 4XYNA 1OSAA 4AQJA 1SPYA 2Y4QA 1MF8B 1DGUA 4OR9B 3LL8B 5CSIA 3EKHA 1YR5A 2EGDA 1DJWA 2DOQA 3TZ1A 3MSEB 2O60A 1H8BA 5AERA 4ORAB 1KK7Z 1U5IA 1DT7B 2L0PA 3OX6A 2GV5A 1DGVA 1EG3A 2JULA 1JUOA 1XA5A 2BCBA 3FWBA 2JQ6A 4OCIA 2OPOA 2PSRA 2BKHB 4GFTA 2K7CA 5DKNA 1TNQA 2NCOA 2L98A 4MBEA 1BR1B 1WLMA 4OKHA 3VRQA 2EC6B 3PM8A 2L2EA 3AAKA 1UHKA 4CFRA 3TUYC 2JWWA 1AHRA 3DF0A 3O4YA 3PLFB 2KSPA 3PATA 2PASA 1EG4A 1EJ3A 2M49B 4MLWA 1A75A 1MQ1A 1UHHA 1Y0VH 2EHBA 2SCPA 2ZFDA 1FI6A 4DUQA 5D7FA 1NX2A 1W7IB 1K2HA 2PVBA 2QACA 4GGNA 4HRHA 5GQQC 1L2OB 1YURA 3H4SE 4GNKB 5J3XA 1BLQA 1J1EA 1MHOA 1CNPA 1NCXA 2AMIA 3EK4A 3K21A 4FQOA 4PCWA 1F8HA 2LCPA 2LUCA 1KK7Y 3BOWA 1SMGA 4A4CA 2TN4A 2BE6A 2LP3A 1CDPA 1IG5A 3CS1A 1K9KA 2K2AA 1XFUO 4D1EA 4R1EA 1QTXA 4L9MA 1BJFA 3BUWB 1JBAA 1DJHA 1AJ4A 5DKQA 3DVKA 1VRKA 2ZNEA 2LLUA 4A4BA 4PE7A 1A03A 4AQIA 1CDMA 1B4CA 1F55A 3EKJA 1ZFSA 2CT9A 3KF9A 5CSJA 1JF0A 1SCMC 1BF5A 1WY9A 3EK7A 1S6JA 1IH0A 2GGZA 2MBXA 4GGFA 4CLNA 1F4OA 3EVVA 1K94A 3AKBA 1HQVA 2JOJA 1BR4B 1DVIA 2K61A 1XO5A 1G8IA 3I5GC 2LP2A 2R2IA 4DIRA 1NYAA 1SKTA 4PE0A 1QLKA 4JQ0D 2MJWB 1YRUB 3RM1A 2K0JA 2LLTA 4NDCA 5CSFA 4M2PA 3IF7A 1M63B 1WRKA 3CLNA 1QX5B 2K7DA 3FWCA 1B7TZ 3I5FB 2BECA 3GK2A 1B47A 3IQOA 1JC2A 3DVJA 1J7QA 1NUBA 4DRWA 2JXCA 3LK1A 5JOLA 3GK4X 3TS5C 1KFUL 5F6TA 1LA3A 1YUTA 1DF0B 4ICBA 4HREE 5I2OA 1RROA 3CR2A 4PE1A 1LXFC 2L51A 3JTDB 5BPJA 2F8PA 4PE4A 3DVEA 3TS5B 2LHIA 2KI4C 4GGFC 1UHNA 2ZN9A 2LANA 5K89A 1J1DA 2LVVA 3VRPA 2JRFA 3EVRA 1SNLA 3WHUB 1YVHA 1GJYA 1A29A 4YGEB 1KCYA 1GQMA 4PHKA 1S6IA 1KK8B 2KFHA 1YTZC 2LNKA 5AANA 2JNXA 1PVAA 2NZ0A 5HLVA 2KBIA 5I2LA 3SIBA 2KYCA 1AK8A 2H2KA 4CIDA 1CB1A 5I2QA 2ZN8A 2OTGC 1IRJA 4UPGA 4N5XA 2PRUA 3NSKA 1CDNA 2OS8C 3CTNA 3I5HB 2I2RE 4PDZA 1E8AA 5D69A 5HLOA 3GK1A 2L4IA 1XFYO 4I5NB 2MA2A 3CZTX 2AAOA 2M8UA 1ZOTB 1ZUZA 3RLZA 3KPXA 1UUSA 1WDCC 5FYXA 2A4JA 2Y1NA 1IJ5A 2KGRA 2M1KB 4YRUA 1ODBA 2RGIA 2P6BB 1C7WA 2LAPA 2KAXA 3SJSA 2LM5A 2BE4A 1A4PA 1KK8C 2LV7A 4C0LA 1F54A 1YX7A 1J55A 2CXJA 1QX2A 1QIWA 1PVBA 1QV0A 4PHNA 2M1UA 1BG1A 3D10A 1QJTA 4ORBB 2ZNDA 1Y1UA 1BOCA 2PALA 1A75B 1M45A 3O2PA 4F0ZB 3I5IC 5IBWA 2BCAA 1F71A 3BUMB 2KAVA 1RTP1 2KGBC 4M2QA 2JC2A 2NLNA 1MXLC 1PRWA 3AAJA 2KAYA 2I18A 4HRGA 1MUXA 4PHMA 1V1FA 2ZRSA 1TCOB 2KDHA 3BOWB 1DJIA 3LK0A 5TNCA 1OZSA 1ZACA 1JF2A 2NXQA 4ORCB 1B8CA 1FW4A 2E30A 2O5GA 4I5KA 1IQ5A 3D0YB 1S3PA 4OVNF 2M29A 1F70A 2MHHA 2LUXA 2CCMA 1MR8A 3CWGA 2HPSA 1KSOA 2LMVA 2K7OA 2JXLA 2I7AA 2H61C 4JWQA 1TN4A 1TOPA 2BBNA 3SG3A 4DCKA 1MWNA 1CDLA 1RFJA 2JPTA 3IQQA 4JPZB 1H4BA 4QJ4B 2H61A 2HQ8A 3BUNB 2OS8B 3QRXA 2M7NA 2Q91A 1N2DA 1UHJA 2JTTA 2CBLA 2G9BA 2LC5A 1KFXS 2KQYA 1L2OC 4IL1A 5PALA 1W7JB 2LVJA 4GUKA 4HSZA 1PK0D 2JT0A 2ISDA 1WRLA 1K90D 4QJ5B 1AVSA 1RJVA 2WOSA 5HKWA 1K9PA 2I94A 2V53A 3HCMA 3OB1B 1DJZA 2HQWA 3EK8A 3GOFA 3OB2B 3KEVA 3NSIA 3CR4X 2KI4B 1QVIY 2BCXA 3TDUA 3E3RA 1JSAA 1K8UA 1YUSA 3BUOB 1SL7A 1SW8A 1N0YA 3NSLA 1YX8A 1CMGA 3JTDC 2M3WA 1JWDA 5KSZA 4ETOA 2WCFA 1K93D 3NSOA 3I5GB 1KWOC 2FJUB 5KU1A 1QV1A 2BBMA 2K2FA 1L7ZA 1M46A 1Q80A 5CPVA 2CTNA 1B7TY 3PSRA 4MRYA 3WNXB 3ZNIA 5I8NA 3NXAA 3BQ3A 3OHMB 1B9AA 5HKZA 1BODA 4OV2A 1UWOA 2BL0B 2KQ6A 4QJ3B 1ALWA 1C7VA 1NIWA 1J7RA 2QPTA 5KTYA 5AXIA 2KHNA 1CM1A 3CR5X 2JTZA 1PSRA 1TNWA 2Y5IA 4YGBB 2FCEA 3DD4A 4WRIA 5JJGA 1CFCA 4MN0A 1CLBA 1XFXO 2JZIA 4P5OE 2WC8A 5DKRA 1LVCD 1GGZA 2MRDA 4XJKA 2ZKMX 1NCYA 1BU3A 1XK4A 1OZOA 1OOJA 2BKIB 1RECA 3HX4A 1AJ5A 1KSMA 1YRTB 1TNPA 1J7OA 3ZWHA 1V1GA 1NX0A 1UP5A 3KHEA 5AEQA 1SK6D 1CFFA 1XFZO 1DMOA 2LLSA 1NWDA 4P2YB 3DF0B 1UHIA 1LA0A 1OE9B 1ZMZA 1OMRA 2F3ZA 1Y1AA 1K95A 1QASA 1IGVA 4YBHB 1NSHA 1KQMB 4GPLB 1FI5A 1J7PA 1OMVA 1FBVA 2JT8A 2JT3A 2KYFA 2MAZA 1RWYA 2L50A 3I5IB 1G4YR 5AFPA 1IJ6A 2COLB 1KQVA 1EXRA 4N1GA 1U5IB 1S5GZ 1S6CA 1XFWO 2PMYA 5ER5A 1K9UA 2L4HA 4Q04A 1ALVA 4GBAA 1NPQA 1B8LA 4M2OA 3SG7A 4CFQA 1S36A 4WQ3A 3WXAA 2KBMA 2HETA 1PULA 2EC6C 2NCPA 2WORA 1CFPA 1R2UA 4PALA 1TIZA 1S26D 3M0WA 2VRGA 2KI6C 1Y1XA 3A8RA 3OX5A 4YGDB 3TDIA 2M9GA 2JU0A 4MSPA 1XK4C 3BUXB 3BXKA 4AOMA 1SYMA 1KFXL 3I5FC 4NDBA 1C07A 4BY4A 4MZKA 1G33A 1KWOB 1MXEA 2F33A 3SIAA 1SBJA 3VRNA 2CNPA 1CMFA 3LCPC 1AUIB 3DVMA 2F2PA 5CSNA 2F2OA 2ZRTA 1DTLA 1SR6B 1X02A 2MLFC 2JNFA 4I5LB 1B1GA 2M97A 1QS7A 2IS9A 3BYAA 4MEWA 1S5GY 2LMUA 1KFUS 3KO0A 2LE9B 2LMTA 2FOTA 2G2BA 1PSBA 2KFFA 3F45A 4MVFA 1SL8A 1TTXA 2HF5A 3OP0A 2B1UA 1M39A 1XVJA 4YI8A 1A2XA 3D0YA 3EVUA 3PN7B 1CLLA 1NP8A 2OTGB 1QIVA 3FIAA 1YUUA 1DJXA 1SRAA 4YGAA 3VGOA 3C1VA 1TCFA 4I5JA 1WRZA 1IQ3A 4C0KA 2K8MB 1K96A 3O78A 1YVLA 3CGAA 5ER4X 2K7BA 1SY9A 4E68A 1PALA 1TNXA 1UURA 3VRRA 4MRXA 3A4UB 2M0RA 3JVTC 2KOTA 3PALA 3ICBA 1QXPA 4WQ2A 1GGWA 1S1EA 1OMDA 1SL9A 2M7LA 1CFDA 1JFJA 2F3YA 4N1FA 1LKJA 3SG4A 2LVIA 3PFVA 1BT6A 2Q4UA 2E6WA 1DJGA 4YI9A 2FCDA 2BL0C 1XYDA 2AUCA 2LHLA 3AKAA 1OQPA 2MLEC 1CKKA 1WDCB 1QX7A 1IWQA 2WNDA 1SCVA 3SG6A 1IKUA 4C0JA 3PN7C 1LINA 4TNCA 2SASA 3SG2A 1NX3A 4PHJA 3SG5A 2LVKA 1CLMA 1SCMB 4FTGA 4XJKB 3JVTB 1EH2A 3LLEA 1N65A 1AP4A 1FPWA 5G08A 3O6BA
chains in the Genus database with same CATH superfamily
3TUYB 1Y6WA 1CM4A 1DF0A 4NDDA 3B87A 1BMOA 1B8RA 5HKYA 4FQTA 3FS7A 1F4QA 4F7FA 3UO9A 1KQMC 1NCZA 1SR6C 2L5XB 4ZCVA 1R6PA 1HT9A 2KFGA 5HYDA 4BY5A 4U8DA 4DS7A 1DJYA 1QATA 1TRFA 3TDZA 1QLSA 1TUZA 3R72A 1FF1A 3VROA 4CPVA 2KNEA 4GAOA 3WHTB 4MZJA 1JFKA 1M31A 4MZLA 2FJYA 4YGCB 2Y1MA 1RK9A 3I5HC 2KI6D 1CTRA 1EL4A 2WCEA 4ZCUA 1NX1A 4USLA 2D8NA 1WLZA 3K1EA 1XFVO 2GGMA 1D1OA 5B8IB 2WCBA 1QVIZ 4NQGA 4XYNA 1OSAA 4AQJA 1SPYA 2Y4QA 1MF8B 1DGUA 4OR9B 1OOIX 3LL8B 5CSIA 3EKHA 1YR5A 2EGDA 1DJWA 2DOQA 3TZ1A 2KPHA 2O60A 3L47A 3MSEB 5AERA 1H8BA 4ORAB 1KK7Z 1U5IA 1DT7B 2L0PA 3OX6A 2GV5A 4PT1A 1DGVA 1EG3A 2JULA 2PYQA 1JUOA 1XA5A 2BCBA 3DXLA 2JQ6A 3FWBA 2OPOA 4OCIA 2PSRA 2BKHB 4GFTA 2K7CA 5DKNA 1TNQA 2NCOA 2L98A 4MBEA 1BR1B 1WLMA 1P28A 3CYZA 4OKHA 3VRQA 2EC6B 3PM8A 2L2EA 3AAKA 1UHKA 4CFRA 3TUYC 2JWWA 1AHRA 3DF0A 3O4YA 3PLFB 2KSPA 3PATA 2PASA 4IJ7A 1EG4A 1Z4HA 1EJ3A 2H8VA 2M49B 4MLWA 1A75A 1MQ1A 1UHHA 1Y0VH 2EHBA 2SCPA 2ZFDA 4JD9A 4DUQA 1FI6A 5D7FA 1NX2A 1W7IB 1K2HA 2PVBA 2QACA 4GGNA 4HRHA 5GQQC 1L2OB 1YURA 3H4SE 4GNKB 5J3XA 1BLQA 1J1EA 1MHOA 1CNPA 1NCXA 2AMIA 3EK4A 3K21A 3CZ0A 4FQOA 2WCHA 4PCWA 1F8HA 2LCPA 2LUCA 3S0DA 1KK7Y 2QEOA 3BOWA 1SMGA 1XFRA 3BJHA 4A4CA 2TN4A 2BE6A 3SS5A 2LP3A 1CDPA 1IG5A 3CS1A 1K9KA 2K2AA 3V2LA 1XFUO 4D1EA 3RZSA 3N7HA 4R1EA 1QTXA 3NHTA 4L9MA 1BJFA 3BUWB 1JBAA 1TWOA 3FE8A 1DJHA 1AJ4A 1IIOA 5DKQA 3DVKA 1VRKA 2ZNEA 2LLUA 4A4BA 4PE7A 1A03A 4AQIA 1CDMA 1B4CA 1F55A 3EKJA 1ZFSA 2CT9A 3KF9A 4KYNA 5CSJA 1JF0A 1SCMC 3QMEA 1WY9A 1BF5A 3EK7A 1S6JA 1IH0A 2GGZA 3DZTA 3B88A 2MBXA 4GGFA 4CLNA 1F4OA 3EVVA 1K94A 3AKBA 1HQVA 2JOJA 1BR4B 1DVIA 2K61A 1XO5A 1G8IA 3I5GC 2LP2A 2R2IA 4DIRA 1NYAA 1SKTA 4PE0A 1QLKA 4JQ0D 2L5YA 1YRUB 2MJWB 3RM1A 2K0JA 2LLTA 4NDCA 5CSFA 4M2PA 3IF7A 1M63B 2QDIA 1WRKA 3CLNA 1QX5B 2K7DA 4INXA 3FWCA 1B7TZ 3I5FB 2BECA 3GK2A 1B47A 3IQOA 1JC2A 3DVJA 1J7QA 1NUBA 4DRWA 2JXCA 3LK1A 5JOLA 3GK4X 3TS5C 1KFUL 5F6TA 1LA3A 1YUTA 1DF0B 3D77A 4ICBA 4HREE 5I2OA 1RROA 3CR2A 4PE1A 1LXFC 2L51A 3JTDB 5BPJA 2F8PA 5I94A 4PE4A 3DVEA 3TS5B 2LHIA 2KI4C 4GGFC 1Z2CB 1UHNA 3DYEA 2ZN9A 2LANA 3S0BA 5K89A 1J1DA 2LVVA 3VRPA 2JRFA 3EVRA 1SNLA 3WHUB 1GM0A 1YVHA 1C3YA 1GJYA 1A29A 4YGEB 1KCYA 1GQMA 4PHKA 1S6IA 1KK8B 2KFHA 1YTZC 2LNKA 5AANA 2JNXA 1PVAA 2NZ0A 3B7AA 5HLVA 2KBIA 5I2LA 3SIBA 5HL1A 2KYCA 2WC6A 3NHIA 1AK8A 2H2KA 4CIDA 3OGNA 1CB1A 3D75A 5I2QA 2ZN8A 2OTGC 3EG5B 1DEKA 1IRJA 4UPGA 4N5XA 2PRUA 3NSKA 1CDNA 2OS8C 3CTNA 3L4LA 3I5HB 2I2RE 3D78A 1E8AA 4PDZA 4OZDA 5D69A 5HLOA 3GK1A 2L4IA 1XFYO 4I5NB 2MA2A 3CZTX 2AAOA 2M8UA 1ZOTB 1ZUZA 3RLZA 3KPXA 1UUSA 1WDCC 5FYXA 2A4JA 2Y1NA 1T14A 1IJ5A 3Q8IA 2KGRA 2M1KB 4YRUA 1ODBA 2RGIA 2P6BB 1C7WA 2LAPA 2KAXA 3SJSA 2LM5A 2BE4A 1A4PA 1KK8C 2LV7A 1C3ZA 4C0LA 1F54A 1YX7A 1J55A 2CXJA 1QX2A 2BNXA 1QIWA 1PVBA 1QV0A 4PHNA 2M1UA 1BG1A 3D10A 3SS4A 1QJTA 4ORBB 2ZNDA 1Y1UA 1OW4A 1BOCA 2PALA 1A75B 1M45A 3O2PA 3DY9A 4F0ZB 3I5IC 5IBWA 2BCAA 1F71A 3BUMB 2KAVA 1RTP1 2KGBC 4M2QA 2JC2A 2NLNA 1MXLC 1PRWA 3AAJA 2KAYA 2I18A 4JKTA 4HRGA 1MUXA 4PHMA 1V1FA 2ZRSA 1TCOB 2GTEA 2KDHA 3BOWB 3BFBA 1DJIA 3CDNA 3LK0A 1OZSA 5TNCA 1ZACA 1JF2A 2NXQA 4ORCB 1B8CA 1FW4A 2E30A 2O5GA 4I5KA 1IQ5A 3D0YB 3UNWA 1S3PA 3S0AA 4OVNF 2M29A 1F70A 2MHHA 2LUXA 2CCMA 1MR8A 3CWGA 2WCLA 2HPSA 1KSOA 2LMVA 2K7OA 2JXLA 3CZ2A 2I7AA 2H61C 4JWQA 1TN4A 1TOPA 2BBNA 3SG3A 4DCKA 3S0GA 1MWNA 1CDLA 1RFJA 2JPTA 3IQQA 4JPZB 1H4BA 4QJ4B 3NGVA 2H61A 2HQ8A 3BUNB 2OS8B 3QRXA 2M7NA 2Q91A 1N2DA 1UHJA 2JTTA 2CBLA 2G9BA 3VB1A 2LC5A 1KFXS 2KQYA 1L2OC 4IL1A 5PALA 1W7JB 1OOGA 2LVJA 4GUKA 4HSZA 2ERBA 1OOHA 1PK0D 2JT0A 3D73A 2ISDA 1WRLA 1K90D 4QJ5B 1AVSA 1RJVA 2WOSA 5HKWA 1K9PA 2I94A 2V53A 3HCMA 3OB1B 1DJZA 2HQWA 3EK8A 3GOFA 3OB2B 3KEVA 3NSIA 3CR4X 2KI4B 1QVIY 2BCXA 3TDUA 3E3RA 1JSAA 1K8UA 1YUSA 3BUOB 1SL7A 1SW8A 1W9ZA 1N0YA 3NSLA 1YX8A 3R1OA 3JTDC 2M3WA 1CMGA 5FI7A 5KSZA 4ETOA 2WCFA 1JWDA 1K93D 3CABA 3I5GB 1KWOC 2FJUB 3NSOA 5KU1A 1QV1A 2BBMA 2K2FA 1L7ZA 5FI6A 1M46A 1Q80A 5CPVA 2CTNA 1B7TY 1DELA 3PSRA 3OBVA 4MRYA 3WNXB 3ZNIA 3NXAA 3BQ3A 3OHMB 1B9AA 5HKZA 1BODA 3S0EA 4OV2A 1UWOA 2BL0B 2KQ6A 3D74A 1ALWA 4QJ3B 1NIWA 1J7RA 2QPTA 1C7VA 5KTYA 5AXIA 2P70A 2KHNA 1CM1A 5FI2A 3CR5X 2JTZA 1PSRA 1TNWA 2Y5IA 4YGBB 2FCEA 3DD4A 4WRIA 5JJGA 1CFCA 2WCKA 4MN0A 1CLBA 1XFXO 2JZIA 4P5OE 2WC8A 2WCJA 5DKRA 1LVCD 1GGZA 2MRDA 4XJKA 1ORGA 1NCYA 2ZKMX 1BU3A 2YGUA 1XK4A 1OZOA 1OOJA 2BKIB 1RECA 2JPOA 3HX4A 3IVTA 1AJ5A 1KSMA 1YRTB 1TNPA 1J7OA 3ZWHA 1V1GA 1NX0A 1UP5A 3KHEA 5AEQA 1SK6D 2L2CA 1XFZO 1CFFA 1DMOA 2LLSA 1NWDA 4P2YB 3DF0B 1UHIA 1LA0A 2QEBA 1OE9B 1ZMZA 1OMRA 2F3ZA 2WCMA 1Y1AA 1K95A 1QASA 1IGVA 4YBHB 1NSHA 1KQMB 4GPLB 1FI5A 1J7PA 1OMVA 1FBVA 2JT8A 2JT3A 2KYFA 2MAZA 1RWYA 2L50A 3I5IB 1G4YR 5AFPA 1IJ6A 3FE9A 2P71A 2KLEA 2COLB 1KQVA 1EXRA 4N1GA 1SSEB 1U5IB 1S5GZ 1QWVA 1S6CA 1XFWO 2PMYA 5ER5A 1K9UA 2L4HA 4Q04A 1ALVA 4GBAA 1NPQA 1B8LA 3SS3A 4M2OA 3SG7A 4CFQA 1S36A 4WQ3A 3WXAA 2WC5A 2KBMA 2HETA 1PULA 2EC6C 2NCPA 2WORA 1CFPA 1R2UA 4PALA 1DC1A 1TIZA 1S26D 3M0WA 2VRGA 5DICA 2KI6C 1Y1XA 3A8RA 3OX5A 4YGDB 3TDIA 2M9GA 2JU0A 4MSPA 1XK4C 3BUXB 3BXKA 4AOMA 1SYMA 1KFXL 3I5FC 4NDBA 1C07A 4BY4A 4MZKA 1G33A 1KWOB 1MXEA 2F33A 3B86A 3SIAA 1SBJA 3VRNA 2CNPA 5D3OA 3BFHA 3LCPC 2KLDA 1AUIB 3B6XA 1CMFA 3DVMA 2F2PA 5CSNA 2F2OA 2ZRTA 1DTLA 1SR6B 1X02A 2MLFC 2JNFA 1LS8A 4I5LB 2M97A 1QS7A 2IS9A 1B1GA 3L4AA 2PQLA 3BYAA 1S5GY 2LMUA 4MEWA 1KFUS 3KO0A 2LE9B 2LMTA 2FOTA 2G2BA 1PSBA 2KFFA 2QEVA 3F45A 1SL8A 4MVFA 1TTXA 2HF5A 3OP0A 2B1UA 1M39A 1XVJA 3O4XA 1A2XA 4YI8A 3D0YA 3EVUA 3PN7B 1CLLA 1NP8A 2OTGB 2K60A 3BFAA 3D76A 3FE6A 1QIVA 3FIAA 1YUUA 1DJXA 1SRAA 4YGAA 3VGOA 3C1VA 1TCFA 3PJIA 4I5JA 2BAPA 1WRZA 1IQ3A 4C0KA 2K8MB 1K96A 3O78A 1YVLA 3CGAA 5EL2A 2K7BA 5ER4X 1SY9A 4E68A 1DQEA 1PALA 1TNXA 1UURA 3VRRA 4MRXA 3A4UB 4INWA 3PM2A 5I8NA 2M0RA 3JVTC 2KOTA 3R1VA 3PALA 3ICBA 1QXPA 4WQ2A 1GGWA 1S1EA 2QEHA 1OMDA 1SL9A 2M7LA 1CFDA 1JFJA 2F3YA 4N1FA 1LKJA 1OOFA 3SG4A 2LVIA 3PFVA 1BT6A 2Q4UA 2E6WA 1DJGA 4YI9A 2FCDA 2BL0C 1XYDA 2AUCA 2LHLA 3AKAA 1OQPA 2MLEC 1CKKA 1WDCB 1QX7A 1IWQA 2WNDA 1TUJA 1SCVA 3SG6A 1IKUA 4C0JA 3PN7C 1LINA 4TNCA 2SASA 3SG2A 1NX3A 3R1PA 3CZ1A 4PHJA 3SG5A 2LVKA 1CLMA 1SCMB 4FTGA 3S0FA 4XJKB 3JVTB 1EH2A 3LLEA 1N65A 1AP4A 1FPWA 5G08A 3O6BA
chains in the Genus database with same CATH topology
3TUYB 1Y6WA 1CM4A 1DF0A 4NDDA 1BMOA 1B8RA 5HKYA 3FS7A 1F4QA 1KQMC 1NCZA 1SR6C 2L5XB 4ZCVA 1R6PA 1HT9A 2KFGA 5HYDA 4BY5A 4U8DA 4DS7A 1DJYA 1QATA 1TRFA 3TDZA 1QLSA 1FF1A 3VROA 4CPVA 2KNEA 4GAOA 3WHTB 4MZJA 1JFKA 1M31A 4MZLA 4YGCB 2Y1MA 1RK9A 3I5HC 2KI6D 1CTRA 1EL4A 2WCEA 4ZCUA 1NX1A 4USLA 2D8NA 1WLZA 1XFVO 2GGMA 1D1OA 5B8IB 2WCBA 1QVIZ 4NQGA 4XYNA 1OSAA 4AQJA 1SPYA 2Y4QA 1MF8B 1DGUA 4OR9B 3LL8B 5CSIA 3EKHA 1YR5A 2EGDA 1DJWA 2DOQA 3TZ1A 3MSEB 2O60A 1H8BA 5AERA 4ORAB 1KK7Z 1U5IA 1DT7B 2L0PA 3OX6A 2GV5A 1DGVA 1EG3A 2JULA 1JUOA 1XA5A 2BCBA 3FWBA 2JQ6A 4OCIA 2OPOA 2PSRA 2BKHB 4GFTA 2K7CA 5DKNA 1TNQA 2NCOA 2L98A 4MBEA 1BR1B 1WLMA 4OKHA 3VRQA 2EC6B 3PM8A 2L2EA 3AAKA 1UHKA 4CFRA 3TUYC 2JWWA 1AHRA 3DF0A 3O4YA 3PLFB 2KSPA 3PATA 2PASA 1EG4A 1EJ3A 2M49B 4MLWA 1A75A 1MQ1A 1UHHA 1Y0VH 2EHBA 2SCPA 2ZFDA 1FI6A 4DUQA 5D7FA 1NX2A 1W7IB 1K2HA 2PVBA 2QACA 4GGNA 4HRHA 5GQQC 1L2OB 1YURA 3H4SE 4GNKB 5J3XA 1BLQA 1J1EA 1MHOA 1CNPA 1NCXA 2AMIA 3EK4A 3K21A 4FQOA 4PCWA 1F8HA 2LCPA 2LUCA 1KK7Y 3BOWA 1SMGA 4A4CA 2TN4A 2BE6A 2LP3A 1CDPA 1IG5A 3CS1A 1K9KA 2K2AA 1XFUO 4D1EA 4R1EA 1QTXA 4L9MA 1BJFA 3BUWB 1JBAA 1DJHA 1AJ4A 5DKQA 3DVKA 1VRKA 2ZNEA 2LLUA 4A4BA 4PE7A 1A03A 4AQIA 1CDMA 1B4CA 1F55A 3EKJA 1ZFSA 2CT9A 3KF9A 5CSJA 1JF0A 1SCMC 1BF5A 1WY9A 3EK7A 1S6JA 1IH0A 2GGZA 2MBXA 4GGFA 4CLNA 1F4OA 3EVVA 1K94A 3AKBA 1HQVA 2JOJA 1BR4B 1DVIA 2K61A 1XO5A 1G8IA 3I5GC 2LP2A 2R2IA 4DIRA 1NYAA 1SKTA 4PE0A 1QLKA 4JQ0D 2MJWB 1YRUB 3RM1A 2K0JA 2LLTA 4NDCA 5CSFA 4M2PA 3IF7A 1M63B 1WRKA 3CLNA 1QX5B 2K7DA 3FWCA 1B7TZ 3I5FB 2BECA 3GK2A 1B47A 3IQOA 1JC2A 3DVJA 1J7QA 1NUBA 4DRWA 2JXCA 3LK1A 5JOLA 3GK4X 3TS5C 1KFUL 5F6TA 1LA3A 1YUTA 1DF0B 4ICBA 4HREE 5I2OA 1RROA 3CR2A 4PE1A 1LXFC 2L51A 3JTDB 5BPJA 2F8PA 4PE4A 3DVEA 3TS5B 2LHIA 2KI4C 4GGFC 1UHNA 2ZN9A 2LANA 5K89A 1J1DA 2LVVA 3VRPA 2JRFA 3EVRA 1SNLA 3WHUB 1YVHA 1GJYA 1A29A 4YGEB 1KCYA 1GQMA 4PHKA 1S6IA 1KK8B 2KFHA 1YTZC 2LNKA 5AANA 2JNXA 1PVAA 2NZ0A 5HLVA 2KBIA 5I2LA 3SIBA 2KYCA 1AK8A 2H2KA 4CIDA 1CB1A 5I2QA 2ZN8A 2OTGC 1IRJA 4UPGA 4N5XA 2PRUA 3NSKA 1CDNA 2OS8C 3CTNA 3I5HB 2I2RE 4PDZA 1E8AA 5D69A 5HLOA 3GK1A 2L4IA 1XFYO 4I5NB 2MA2A 3CZTX 2AAOA 2M8UA 1ZOTB 1ZUZA 3RLZA 3KPXA 1UUSA 1WDCC 5FYXA 2A4JA 2Y1NA 1IJ5A 2KGRA 2M1KB 4YRUA 1ODBA 2RGIA 2P6BB 1C7WA 2LAPA 2KAXA 3SJSA 2LM5A 2BE4A 1A4PA 1KK8C 2LV7A 4C0LA 1F54A 1YX7A 1J55A 2CXJA 1QX2A 1QIWA 1PVBA 1QV0A 4PHNA 2M1UA 1BG1A 3D10A 1QJTA 4ORBB 2ZNDA 1Y1UA 1BOCA 2PALA 1A75B 1M45A 3O2PA 4F0ZB 3I5IC 5IBWA 2BCAA 1F71A 3BUMB 2KAVA 1RTP1 2KGBC 4M2QA 2JC2A 2NLNA 1MXLC 1PRWA 3AAJA 2KAYA 2I18A 4HRGA 1MUXA 4PHMA 1V1FA 2ZRSA 1TCOB 2KDHA 3BOWB 1DJIA 3LK0A 5TNCA 1OZSA 1ZACA 1JF2A 2NXQA 4ORCB 1B8CA 1FW4A 2E30A 2O5GA 4I5KA 1IQ5A 3D0YB 1S3PA 4OVNF 2M29A 1F70A 2MHHA 2LUXA 2CCMA 1MR8A 3CWGA 2HPSA 1KSOA 2LMVA 2K7OA 2JXLA 2I7AA 2H61C 4JWQA 1TN4A 1TOPA 2BBNA 3SG3A 4DCKA 1MWNA 1CDLA 1RFJA 2JPTA 3IQQA 4JPZB 1H4BA 4QJ4B 2H61A 2HQ8A 3BUNB 2OS8B 3QRXA 2M7NA 2Q91A 1N2DA 1UHJA 2JTTA 2CBLA 2G9BA 2LC5A 1KFXS 2KQYA 1L2OC 4IL1A 5PALA 1W7JB 2LVJA 4GUKA 4HSZA 1PK0D 2JT0A 2ISDA 1WRLA 1K90D 4QJ5B 1AVSA 1RJVA 2WOSA 5HKWA 1K9PA 2I94A 2V53A 3HCMA 3OB1B 1DJZA 2HQWA 3EK8A 3GOFA 3OB2B 3KEVA 3NSIA 3CR4X 2KI4B 1QVIY 2BCXA 3TDUA 3E3RA 1JSAA 1K8UA 1YUSA 3BUOB 1SL7A 1SW8A 1N0YA 3NSLA 1YX8A 1CMGA 3JTDC 2M3WA 1JWDA 5KSZA 4ETOA 2WCFA 1K93D 3NSOA 3I5GB 1KWOC 2FJUB 5KU1A 1QV1A 2BBMA 2K2FA 1L7ZA 1M46A 1Q80A 5CPVA 2CTNA 1B7TY 3PSRA 4MRYA 3WNXB 3ZNIA 5I8NA 3NXAA 3BQ3A 3OHMB 1B9AA 5HKZA 1BODA 4OV2A 1UWOA 2BL0B 2KQ6A 4QJ3B 1ALWA 1C7VA 1NIWA 1J7RA 2QPTA 5KTYA 5AXIA 2KHNA 1CM1A 3CR5X 2JTZA 1PSRA 1TNWA 2Y5IA 4YGBB 2FCEA 3DD4A 4WRIA 5JJGA 1CFCA 4MN0A 1CLBA 1XFXO 2JZIA 4P5OE 2WC8A 5DKRA 1LVCD 1GGZA 2MRDA 4XJKA 2ZKMX 1NCYA 1BU3A 1XK4A 1OZOA 1OOJA 2BKIB 1RECA 3HX4A 1AJ5A 1KSMA 1YRTB 1TNPA 1J7OA 3ZWHA 1V1GA 1NX0A 1UP5A 3KHEA 5AEQA 1SK6D 1CFFA 1XFZO 1DMOA 2LLSA 1NWDA 4P2YB 3DF0B 1UHIA 1LA0A 1OE9B 1ZMZA 1OMRA 2F3ZA 1Y1AA 1K95A 1QASA 1IGVA 4YBHB 1NSHA 1KQMB 4GPLB 1FI5A 1J7PA 1OMVA 1FBVA 2JT8A 2JT3A 2KYFA 2MAZA 1RWYA 2L50A 3I5IB 1G4YR 5AFPA 1IJ6A 2COLB 1KQVA 1EXRA 4N1GA 1U5IB 1S5GZ 1S6CA 1XFWO 2PMYA 5ER5A 1K9UA 2L4HA 4Q04A 1ALVA 4GBAA 1NPQA 1B8LA 4M2OA 3SG7A 4CFQA 1S36A 4WQ3A 3WXAA 2KBMA 2HETA 1PULA 2EC6C 2NCPA 2WORA 1CFPA 1R2UA 4PALA 1TIZA 1S26D 3M0WA 2VRGA 2KI6C 1Y1XA 3A8RA 3OX5A 4YGDB 3TDIA 2M9GA 2JU0A 4MSPA 1XK4C 3BUXB 3BXKA 4AOMA 1SYMA 1KFXL 3I5FC 4NDBA 1C07A 4BY4A 4MZKA 1G33A 1KWOB 1MXEA 2F33A 3SIAA 1SBJA 3VRNA 2CNPA 1CMFA 3LCPC 1AUIB 3DVMA 2F2PA 5CSNA 2F2OA 2ZRTA 1DTLA 1SR6B 1X02A 2MLFC 2JNFA 4I5LB 1B1GA 2M97A 1QS7A 2IS9A 3BYAA 4MEWA 1S5GY 2LMUA 1KFUS 3KO0A 2LE9B 2LMTA 2FOTA 2G2BA 1PSBA 2KFFA 3F45A 4MVFA 1SL8A 1TTXA 2HF5A 3OP0A 2B1UA 1M39A 1XVJA 4YI8A 1A2XA 3D0YA 3EVUA 3PN7B 1CLLA 1NP8A 2OTGB 1QIVA 3FIAA 1YUUA 1DJXA 1SRAA 4YGAA 3VGOA 3C1VA 1TCFA 4I5JA 1WRZA 1IQ3A 4C0KA 2K8MB 1K96A 3O78A 1YVLA 3CGAA 5ER4X 2K7BA 1SY9A 4E68A 1PALA 1TNXA 1UURA 3VRRA 4MRXA 3A4UB 2M0RA 3JVTC 2KOTA 3PALA 3ICBA 1QXPA 4WQ2A 1GGWA 1S1EA 1OMDA 1SL9A 2M7LA 1CFDA 1JFJA 2F3YA 4N1FA 1LKJA 3SG4A 2LVIA 3PFVA 1BT6A 2Q4UA 2E6WA 1DJGA 4YI9A 2FCDA 2BL0C 1XYDA 2AUCA 2LHLA 3AKAA 1OQPA 2MLEC 1CKKA 1WDCB 1QX7A 1IWQA 2WNDA 1SCVA 3SG6A 1IKUA 4C0JA 3PN7C 1LINA 4TNCA 2SASA 3SG2A 1NX3A 4PHJA 3SG5A 2LVKA 1CLMA 1SCMB 4FTGA 4XJKB 3JVTB 1EH2A 3LLEA 1N65A 1AP4A 1FPWA 5G08A 3O6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TUY B;  1Y6W A;  1CM4 A;  1DF0 A;  4NDD A;  1BMO A;  1B8R A;  5HKY A;  3FS7 A;  1F4Q A;  1KQM C;  1NCZ A;  1SR6 C;  2L5X B;  4ZCV A;  1R6P A;  1HT9 A;  2KFG A;  5HYD A;  4BY5 A;  4U8D A;  4DS7 A;  1DJY A;  1QAT A;  1TRF A;  3TDZ A;  1QLS A;  1FF1 A;  3VRO A;  4CPV A;  2KNE A;  4GAO A;  3WHT B;  4MZJ A;  1JFK A;  1M31 A;  4MZL A;  4YGC B;  2Y1M A;  1RK9 A;  3I5H C;  2KI6 D;  1CTR A;  1EL4 A;  2WCE A;  4ZCU A;  1NX1 A;  4USL A;  2D8N A;  1WLZ A;  1XFV O;  2GGM A;  1D1O A;  5B8I B;  2WCB A;  1QVI Z;  4NQG A;  4XYN A;  1OSA A;  4AQJ A;  1SPY A;  2Y4Q A;  1MF8 B;  1DGU A;  4OR9 B;  3LL8 B;  5CSI A;  3EKH A;  1YR5 A;  2EGD A;  1DJW A;  2DOQ A;  3TZ1 A;  3MSE B;  2O60 A;  1H8B A;  5AER A;  4ORA B;  1KK7 Z;  1U5I A;  1DT7 B;  2L0P A;  3OX6 A;  2GV5 A;  1DGV A;  1EG3 A;  2JUL A;  1JUO A;  1XA5 A;  2BCB A;  3FWB A;  2JQ6 A;  4OCI A;  2OPO A;  2PSR A;  2BKH B;  4GFT A;  2K7C A;  5DKN A;  1TNQ A;  2NCO A;  2L98 A;  4MBE A;  1BR1 B;  1WLM A;  4OKH A;  3VRQ A;  2EC6 B;  3PM8 A;  2L2E A;  3AAK A;  1UHK A;  4CFR A;  3TUY C;  2JWW A;  1AHR A;  3DF0 A;  3O4Y A;  3PLF B;  2KSP A;  3PAT A;  2PAS A;  1EG4 A;  1EJ3 A;  2M49 B;  4MLW A;  1A75 A;  1MQ1 A;  1UHH A;  1Y0V H;  2EHB A;  2SCP A;  2ZFD A;  1FI6 A;  4DUQ A;  5D7F A;  1NX2 A;  1W7I B;  1K2H A;  2PVB A;  2QAC A;  4GGN A;  4HRH A;  5GQQ C;  1L2O B;  1YUR A;  3H4S E;  4GNK B;  5J3X A;  1BLQ A;  1J1E A;  1MHO A;  1CNP A;  1NCX A;  2AMI A;  3EK4 A;  3K21 A;  4FQO A;  4PCW A;  1F8H A;  2LCP A;  2LUC A;  1KK7 Y;  3BOW A;  1SMG A;  4A4C A;  2TN4 A;  2BE6 A;  2LP3 A;  1CDP A;  1IG5 A;  3CS1 A;  1K9K A;  2K2A A;  1XFU O;  4D1E A;  4R1E A;  1QTX A;  4L9M A;  1BJF A;  3BUW B;  1JBA A;  1DJH A;  1AJ4 A;  5DKQ A;  3DVK A;  1VRK A;  2ZNE A;  2LLU A;  4A4B A;  4PE7 A;  1A03 A;  4AQI A;  1CDM A;  1B4C A;  1F55 A;  3EKJ A;  1ZFS A;  2CT9 A;  3KF9 A;  5CSJ A;  1JF0 A;  1SCM C;  1BF5 A;  1WY9 A;  3EK7 A;  1S6J A;  1IH0 A;  2GGZ A;  2MBX A;  4GGF A;  4CLN A;  1F4O A;  3EVV A;  1K94 A;  3AKB A;  1HQV A;  2JOJ A;  1BR4 B;  1DVI A;  2K61 A;  1XO5 A;  1G8I A;  3I5G C;  2LP2 A;  2R2I A;  4DIR A;  1NYA A;  1SKT A;  4PE0 A;  1QLK A;  4JQ0 D;  2MJW B;  1YRU B;  3RM1 A;  2K0J A;  2LLT A;  4NDC A;  5CSF A;  4M2P A;  3IF7 A;  1M63 B;  1WRK A;  3CLN A;  1QX5 B;  2K7D A;  3FWC A;  1B7T Z;  3I5F B;  2BEC A;  3GK2 A;  1B47 A;  3IQO A;  1JC2 A;  3DVJ A;  1J7Q A;  1NUB A;  4DRW A;  2JXC A;  3LK1 A;  5JOL A;  3GK4 X;  3TS5 C;  1KFU L;  5F6T A;  1LA3 A;  1YUT A;  1DF0 B;  4ICB A;  4HRE E;  5I2O A;  1RRO A;  3CR2 A;  4PE1 A;  1LXF C;  2L51 A;  3JTD B;  5BPJ A;  2F8P A;  4PE4 A;  3DVE A;  3TS5 B;  2LHI A;  2KI4 C;  4GGF C;  1UHN A;  2ZN9 A;  2LAN A;  5K89 A;  1J1D A;  2LVV A;  3VRP A;  2JRF A;  3EVR A;  1SNL A;  3WHU B;  1YVH A;  1GJY A;  1A29 A;  4YGE B;  1KCY A;  1GQM A;  4PHK A;  1S6I A;  1KK8 B;  2KFH A;  1YTZ C;  2LNK A;  5AAN A;  2JNX A;  1PVA A;  2NZ0 A;  5HLV A;  2KBI A;  5I2L A;  3SIB A;  2KYC A;  1AK8 A;  2H2K A;  4CID A;  1CB1 A;  5I2Q A;  2ZN8 A;  2OTG C;  1IRJ A;  4UPG A;  4N5X A;  2PRU A;  3NSK A;  1CDN A;  2OS8 C;  3CTN A;  3I5H B;  2I2R E;  4PDZ A;  1E8A A;  5D69 A;  5HLO A;  3GK1 A;  2L4I A;  1XFY O;  4I5N B;  2MA2 A;  3CZT X;  2AAO A;  2M8U A;  1ZOT B;  1ZUZ A;  3RLZ A;  3KPX A;  1UUS A;  1WDC C;  5FYX A;  2A4J A;  2Y1N A;  1IJ5 A;  2KGR A;  2M1K B;  4YRU A;  1ODB A;  2RGI A;  2P6B B;  1C7W A;  2LAP A;  2KAX A;  3SJS A;  2LM5 A;  2BE4 A;  1A4P A;  1KK8 C;  2LV7 A;  4C0L A;  1F54 A;  1YX7 A;  1J55 A;  2CXJ A;  1QX2 A;  1QIW A;  1PVB A;  1QV0 A;  4PHN A;  2M1U A;  1BG1 A;  3D10 A;  1QJT A;  4ORB B;  2ZND A;  1Y1U A;  1BOC A;  2PAL A;  1A75 B;  1M45 A;  3O2P A;  4F0Z B;  3I5I C;  5IBW A;  2BCA A;  1F71 A;  3BUM B;  2KAV A;  1RTP 1;  2KGB C;  4M2Q A;  2JC2 A;  2NLN A;  1MXL C;  1PRW A;  3AAJ A;  2KAY A;  2I18 A;  4HRG A;  1MUX A;  4PHM A;  1V1F A;  2ZRS A;  1TCO B;  2KDH A;  3BOW B;  1DJI A;  3LK0 A;  5TNC A;  1OZS A;  1ZAC A;  1JF2 A;  2NXQ A;  4ORC B;  1B8C A;  1FW4 A;  2E30 A;  2O5G A;  4I5K A;  1IQ5 A;  3D0Y B;  1S3P A;  4OVN F;  2M29 A;  1F70 A;  2MHH A;  2LUX A;  2CCM A;  1MR8 A;  3CWG A;  2HPS A;  1KSO A;  2LMV A;  2K7O A;  2JXL A;  2I7A A;  2H61 C;  4JWQ A;  1TN4 A;  1TOP A;  2BBN A;  3SG3 A;  4DCK A;  1MWN A;  1CDL A;  1RFJ A;  2JPT A;  3IQQ A;  4JPZ B;  1H4B A;  4QJ4 B;  2H61 A;  2HQ8 A;  3BUN B;  2OS8 B;  3QRX A;  2M7N A;  2Q91 A;  1N2D A;  1UHJ A;  2JTT A;  2CBL A;  2G9B A;  2LC5 A;  1KFX S;  2KQY A;  1L2O C;  4IL1 A;  5PAL A;  1W7J B;  2LVJ A;  4GUK A;  4HSZ A;  1PK0 D;  2JT0 A;  2ISD A;  1WRL A;  1K90 D;  4QJ5 B;  1AVS A;  1RJV A;  2WOS A;  5HKW A;  1K9P A;  2I94 A;  2V53 A;  3HCM A;  3OB1 B;  1DJZ A;  2HQW A;  3EK8 A;  3GOF A;  3OB2 B;  3KEV A;  3NSI A;  3CR4 X;  2KI4 B;  1QVI Y;  2BCX A;  3TDU A;  3E3R A;  1JSA A;  1K8U A;  1YUS A;  3BUO B;  1SL7 A;  1SW8 A;  1N0Y A;  3NSL A;  1YX8 A;  1CMG A;  3JTD C;  2M3W A;  1JWD A;  5KSZ A;  4ETO A;  2WCF A;  1K93 D;  3NSO A;  3I5G B;  1KWO C;  2FJU B;  5KU1 A;  1QV1 A;  2BBM A;  2K2F A;  1L7Z A;  1M46 A;  1Q80 A;  5CPV A;  2CTN A;  1B7T Y;  3PSR A;  4MRY A;  3WNX B;  3ZNI A;  5I8N A;  3NXA A;  3BQ3 A;  3OHM B;  1B9A A;  5HKZ A;  1BOD A;  4OV2 A;  1UWO A;  2BL0 B;  2KQ6 A;  4QJ3 B;  1ALW A;  1C7V A;  1NIW A;  1J7R A;  2QPT A;  5KTY A;  5AXI A;  2KHN A;  1CM1 A;  3CR5 X;  2JTZ A;  1PSR A;  1TNW A;  2Y5I A;  4YGB B;  2FCE A;  3DD4 A;  4WRI A;  5JJG A;  1CFC A;  4MN0 A;  1CLB A;  1XFX O;  2JZI A;  4P5O E;  2WC8 A;  5DKR A;  1LVC D;  1GGZ A;  2MRD A;  4XJK A;  2ZKM X;  1NCY A;  1BU3 A;  1XK4 A;  1OZO A;  1OOJ A;  2BKI B;  1REC A;  3HX4 A;  1AJ5 A;  1KSM A;  1YRT B;  1TNP A;  1J7O A;  3ZWH A;  1V1G A;  1NX0 A;  1UP5 A;  3KHE A;  5AEQ A;  1SK6 D;  1CFF A;  1XFZ O;  1DMO A;  2LLS A;  1NWD A;  4P2Y B;  3DF0 B;  1UHI A;  1LA0 A;  1OE9 B;  1ZMZ A;  1OMR A;  2F3Z A;  1Y1A A;  1K95 A;  1QAS A;  1IGV A;  4YBH B;  1NSH A;  1KQM B;  4GPL B;  1FI5 A;  1J7P A;  1OMV A;  1FBV A;  2JT8 A;  2JT3 A;  2KYF A;  2MAZ A;  1RWY A;  2L50 A;  3I5I B;  1G4Y R;  5AFP A;  1IJ6 A;  2COL B;  1KQV A;  1EXR A;  4N1G A;  1U5I B;  1S5G Z;  1S6C A;  1XFW O;  2PMY A;  5ER5 A;  1K9U A;  2L4H A;  4Q04 A;  1ALV A;  4GBA A;  1NPQ A;  1B8L A;  4M2O A;  3SG7 A;  4CFQ A;  1S36 A;  4WQ3 A;  3WXA A;  2KBM A;  2HET A;  1PUL A;  2EC6 C;  2NCP A;  2WOR A;  1CFP A;  1R2U A;  4PAL A;  1TIZ A;  1S26 D;  3M0W A;  2VRG A;  2KI6 C;  1Y1X A;  3A8R A;  3OX5 A;  4YGD B;  3TDI A;  2M9G A;  2JU0 A;  4MSP A;  1XK4 C;  3BUX B;  3BXK A;  4AOM A;  1SYM A;  1KFX L;  3I5F C;  4NDB A;  1C07 A;  4BY4 A;  4MZK A;  1G33 A;  1KWO B;  1MXE A;  2F33 A;  3SIA A;  1SBJ A;  3VRN A;  2CNP A;  1CMF A;  3LCP C;  1AUI B;  3DVM A;  2F2P A;  5CSN A;  2F2O A;  2ZRT A;  1DTL A;  1SR6 B;  1X02 A;  2MLF C;  2JNF A;  4I5L B;  1B1G A;  2M97 A;  1QS7 A;  2IS9 A;  3BYA A;  4MEW A;  1S5G Y;  2LMU A;  1KFU S;  3KO0 A;  2LE9 B;  2LMT A;  2FOT A;  2G2B A;  1PSB A;  2KFF A;  3F45 A;  4MVF A;  1SL8 A;  1TTX A;  2HF5 A;  3OP0 A;  2B1U A;  1M39 A;  1XVJ A;  4YI8 A;  1A2X A;  3D0Y A;  3EVU A;  3PN7 B;  1CLL A;  1NP8 A;  2OTG B;  1QIV A;  3FIA A;  1YUU A;  1DJX A;  1SRA A;  4YGA A;  3VGO A;  3C1V A;  1TCF A;  4I5J A;  1WRZ A;  1IQ3 A;  4C0K A;  2K8M B;  1K96 A;  3O78 A;  1YVL A;  3CGA A;  5ER4 X;  2K7B A;  1SY9 A;  4E68 A;  1PAL A;  1TNX A;  1UUR A;  3VRR A;  4MRX A;  3A4U B;  2M0R A;  3JVT C;  2KOT A;  3PAL A;  3ICB A;  1QXP A;  4WQ2 A;  1GGW A;  1S1E A;  1OMD A;  1SL9 A;  2M7L A;  1CFD A;  1JFJ A;  2F3Y A;  4N1F A;  1LKJ A;  3SG4 A;  2LVI A;  3PFV A;  1BT6 A;  2Q4U A;  2E6W A;  1DJG A;  4YI9 A;  2FCD A;  2BL0 C;  1XYD A;  2AUC A;  2LHL A;  3AKA A;  1OQP A;  2MLE C;  1CKK A;  1WDC B;  1QX7 A;  1IWQ A;  2WND A;  1SCV A;  3SG6 A;  1IKU A;  4C0J A;  3PN7 C;  1LIN A;  4TNC A;  2SAS A;  3SG2 A;  1NX3 A;  4PHJ A;  3SG5 A;  2LVK A;  1CLM A;  1SCM B;  4FTG A;  4XJK B;  3JVT B;  1EH2 A;  3LLE A;  1N65 A;  1AP4 A;  1FPW A;  5G08 A;  3O6B A; 
#chains in the Genus database with same CATH topology
 3TUY B;  1Y6W A;  1CM4 A;  1DF0 A;  4NDD A;  3B87 A;  1BMO A;  1B8R A;  5HKY A;  4FQT A;  3FS7 A;  1F4Q A;  4F7F A;  3UO9 A;  1KQM C;  1NCZ A;  1SR6 C;  2L5X B;  4ZCV A;  1R6P A;  1HT9 A;  2KFG A;  5HYD A;  4BY5 A;  4U8D A;  4DS7 A;  1DJY A;  1QAT A;  1TRF A;  3TDZ A;  1QLS A;  1TUZ A;  3R72 A;  1FF1 A;  3VRO A;  4CPV A;  2KNE A;  4GAO A;  3WHT B;  4MZJ A;  1JFK A;  1M31 A;  4MZL A;  2FJY A;  4YGC B;  2Y1M A;  1RK9 A;  3I5H C;  2KI6 D;  1CTR A;  1EL4 A;  2WCE A;  4ZCU A;  1NX1 A;  4USL A;  2D8N A;  1WLZ A;  3K1E A;  1XFV O;  2GGM A;  1D1O A;  5B8I B;  2WCB A;  1QVI Z;  4NQG A;  4XYN A;  1OSA A;  4AQJ A;  1SPY A;  2Y4Q A;  1MF8 B;  1DGU A;  4OR9 B;  1OOI X;  3LL8 B;  5CSI A;  3EKH A;  1YR5 A;  2EGD A;  1DJW A;  2DOQ A;  3TZ1 A;  2KPH A;  2O60 A;  3L47 A;  3MSE B;  5AER A;  1H8B A;  4ORA B;  1KK7 Z;  1U5I A;  1DT7 B;  2L0P A;  3OX6 A;  2GV5 A;  4PT1 A;  1DGV A;  1EG3 A;  2JUL A;  2PYQ A;  1JUO A;  1XA5 A;  2BCB A;  3DXL A;  2JQ6 A;  3FWB A;  2OPO A;  4OCI A;  2PSR A;  2BKH B;  4GFT A;  2K7C A;  5DKN A;  1TNQ A;  2NCO A;  2L98 A;  4MBE A;  1BR1 B;  1WLM A;  1P28 A;  3CYZ A;  4OKH A;  3VRQ A;  2EC6 B;  3PM8 A;  2L2E A;  3AAK A;  1UHK A;  4CFR A;  3TUY C;  2JWW A;  1AHR A;  3DF0 A;  3O4Y A;  3PLF B;  2KSP A;  3PAT A;  2PAS A;  4IJ7 A;  1EG4 A;  1Z4H A;  1EJ3 A;  2H8V A;  2M49 B;  4MLW A;  1A75 A;  1MQ1 A;  1UHH A;  1Y0V H;  2EHB A;  2SCP A;  2ZFD A;  4JD9 A;  4DUQ A;  1FI6 A;  5D7F A;  1NX2 A;  1W7I B;  1K2H A;  2PVB A;  2QAC A;  4GGN A;  4HRH A;  5GQQ C;  1L2O B;  1YUR A;  3H4S E;  4GNK B;  5J3X A;  1BLQ A;  1J1E A;  1MHO A;  1CNP A;  1NCX A;  2AMI A;  3EK4 A;  3K21 A;  3CZ0 A;  4FQO A;  2WCH A;  4PCW A;  1F8H A;  2LCP A;  2LUC A;  3S0D A;  1KK7 Y;  2QEO A;  3BOW A;  1SMG A;  1XFR A;  3BJH A;  4A4C A;  2TN4 A;  2BE6 A;  3SS5 A;  2LP3 A;  1CDP A;  1IG5 A;  3CS1 A;  1K9K A;  2K2A A;  3V2L A;  1XFU O;  4D1E A;  3RZS A;  3N7H A;  4R1E A;  1QTX A;  3NHT A;  4L9M A;  1BJF A;  3BUW B;  1JBA A;  1TWO A;  3FE8 A;  1DJH A;  1AJ4 A;  1IIO A;  5DKQ A;  3DVK A;  1VRK A;  2ZNE A;  2LLU A;  4A4B A;  4PE7 A;  1A03 A;  4AQI A;  1CDM A;  1B4C A;  1F55 A;  3EKJ A;  1ZFS A;  2CT9 A;  3KF9 A;  4KYN A;  5CSJ A;  1JF0 A;  1SCM C;  3QME A;  1WY9 A;  1BF5 A;  3EK7 A;  1S6J A;  1IH0 A;  2GGZ A;  3DZT A;  3B88 A;  2MBX A;  4GGF A;  4CLN A;  1F4O A;  3EVV A;  1K94 A;  3AKB A;  1HQV A;  2JOJ A;  1BR4 B;  1DVI A;  2K61 A;  1XO5 A;  1G8I A;  3I5G C;  2LP2 A;  2R2I A;  4DIR A;  1NYA A;  1SKT A;  4PE0 A;  1QLK A;  4JQ0 D;  2L5Y A;  1YRU B;  2MJW B;  3RM1 A;  2K0J A;  2LLT A;  4NDC A;  5CSF A;  4M2P A;  3IF7 A;  1M63 B;  2QDI A;  1WRK A;  3CLN A;  1QX5 B;  2K7D A;  4INX A;  3FWC A;  1B7T Z;  3I5F B;  2BEC A;  3GK2 A;  1B47 A;  3IQO A;  1JC2 A;  3DVJ A;  1J7Q A;  1NUB A;  4DRW A;  2JXC A;  3LK1 A;  5JOL A;  3GK4 X;  3TS5 C;  1KFU L;  5F6T A;  1LA3 A;  1YUT A;  1DF0 B;  3D77 A;  4ICB A;  4HRE E;  5I2O A;  1RRO A;  3CR2 A;  4PE1 A;  1LXF C;  2L51 A;  3JTD B;  5BPJ A;  2F8P A;  5I94 A;  4PE4 A;  3DVE A;  3TS5 B;  2LHI A;  2KI4 C;  4GGF C;  1Z2C B;  1UHN A;  3DYE A;  2ZN9 A;  2LAN A;  3S0B A;  5K89 A;  1J1D A;  2LVV A;  3VRP A;  2JRF A;  3EVR A;  1SNL A;  3WHU B;  1GM0 A;  1YVH A;  1C3Y A;  1GJY A;  1A29 A;  4YGE B;  1KCY A;  1GQM A;  4PHK A;  1S6I A;  1KK8 B;  2KFH A;  1YTZ C;  2LNK A;  5AAN A;  2JNX A;  1PVA A;  2NZ0 A;  3B7A A;  5HLV A;  2KBI A;  5I2L A;  3SIB A;  5HL1 A;  2KYC A;  2WC6 A;  3NHI A;  1AK8 A;  2H2K A;  4CID A;  3OGN A;  1CB1 A;  3D75 A;  5I2Q A;  2ZN8 A;  2OTG C;  3EG5 B;  1DEK A;  1IRJ A;  4UPG A;  4N5X A;  2PRU A;  3NSK A;  1CDN A;  2OS8 C;  3CTN A;  3L4L A;  3I5H B;  2I2R E;  3D78 A;  1E8A A;  4PDZ A;  4OZD A;  5D69 A;  5HLO A;  3GK1 A;  2L4I A;  1XFY O;  4I5N B;  2MA2 A;  3CZT X;  2AAO A;  2M8U A;  1ZOT B;  1ZUZ A;  3RLZ A;  3KPX A;  1UUS A;  1WDC C;  5FYX A;  2A4J A;  2Y1N A;  1T14 A;  1IJ5 A;  3Q8I A;  2KGR A;  2M1K B;  4YRU A;  1ODB A;  2RGI A;  2P6B B;  1C7W A;  2LAP A;  2KAX A;  3SJS A;  2LM5 A;  2BE4 A;  1A4P A;  1KK8 C;  2LV7 A;  1C3Z A;  4C0L A;  1F54 A;  1YX7 A;  1J55 A;  2CXJ A;  1QX2 A;  2BNX A;  1QIW A;  1PVB A;  1QV0 A;  4PHN A;  2M1U A;  1BG1 A;  3D10 A;  3SS4 A;  1QJT A;  4ORB B;  2ZND A;  1Y1U A;  1OW4 A;  1BOC A;  2PAL A;  1A75 B;  1M45 A;  3O2P A;  3DY9 A;  4F0Z B;  3I5I C;  5IBW A;  2BCA A;  1F71 A;  3BUM B;  2KAV A;  1RTP 1;  2KGB C;  4M2Q A;  2JC2 A;  2NLN A;  1MXL C;  1PRW A;  3AAJ A;  2KAY A;  2I18 A;  4JKT A;  4HRG A;  1MUX A;  4PHM A;  1V1F A;  2ZRS A;  1TCO B;  2GTE A;  2KDH A;  3BOW B;  3BFB A;  1DJI A;  3CDN A;  3LK0 A;  1OZS A;  5TNC A;  1ZAC A;  1JF2 A;  2NXQ A;  4ORC B;  1B8C A;  1FW4 A;  2E30 A;  2O5G A;  4I5K A;  1IQ5 A;  3D0Y B;  3UNW A;  1S3P A;  3S0A A;  4OVN F;  2M29 A;  1F70 A;  2MHH A;  2LUX A;  2CCM A;  1MR8 A;  3CWG A;  2WCL A;  2HPS A;  1KSO A;  2LMV A;  2K7O A;  2JXL A;  3CZ2 A;  2I7A A;  2H61 C;  4JWQ A;  1TN4 A;  1TOP A;  2BBN A;  3SG3 A;  4DCK A;  3S0G A;  1MWN A;  1CDL A;  1RFJ A;  2JPT A;  3IQQ A;  4JPZ B;  1H4B A;  4QJ4 B;  3NGV A;  2H61 A;  2HQ8 A;  3BUN B;  2OS8 B;  3QRX A;  2M7N A;  2Q91 A;  1N2D A;  1UHJ A;  2JTT A;  2CBL A;  2G9B A;  3VB1 A;  2LC5 A;  1KFX S;  2KQY A;  1L2O C;  4IL1 A;  5PAL A;  1W7J B;  1OOG A;  2LVJ A;  4GUK A;  4HSZ A;  2ERB A;  1OOH A;  1PK0 D;  2JT0 A;  3D73 A;  2ISD A;  1WRL A;  1K90 D;  4QJ5 B;  1AVS A;  1RJV A;  2WOS A;  5HKW A;  1K9P A;  2I94 A;  2V53 A;  3HCM A;  3OB1 B;  1DJZ A;  2HQW A;  3EK8 A;  3GOF A;  3OB2 B;  3KEV A;  3NSI A;  3CR4 X;  2KI4 B;  1QVI Y;  2BCX A;  3TDU A;  3E3R A;  1JSA A;  1K8U A;  1YUS A;  3BUO B;  1SL7 A;  1SW8 A;  1W9Z A;  1N0Y A;  3NSL A;  1YX8 A;  3R1O A;  3JTD C;  2M3W A;  1CMG A;  5FI7 A;  5KSZ A;  4ETO A;  2WCF A;  1JWD A;  1K93 D;  3CAB A;  3I5G B;  1KWO C;  2FJU B;  3NSO A;  5KU1 A;  1QV1 A;  2BBM A;  2K2F A;  1L7Z A;  5FI6 A;  1M46 A;  1Q80 A;  5CPV A;  2CTN A;  1B7T Y;  1DEL A;  3PSR A;  3OBV A;  4MRY A;  3WNX B;  3ZNI A;  3NXA A;  3BQ3 A;  3OHM B;  1B9A A;  5HKZ A;  1BOD A;  3S0E A;  4OV2 A;  1UWO A;  2BL0 B;  2KQ6 A;  3D74 A;  1ALW A;  4QJ3 B;  1NIW A;  1J7R A;  2QPT A;  1C7V A;  5KTY A;  5AXI A;  2P70 A;  2KHN A;  1CM1 A;  5FI2 A;  3CR5 X;  2JTZ A;  1PSR A;  1TNW A;  2Y5I A;  4YGB B;  2FCE A;  3DD4 A;  4WRI A;  5JJG A;  1CFC A;  2WCK A;  4MN0 A;  1CLB A;  1XFX O;  2JZI A;  4P5O E;  2WC8 A;  2WCJ A;  5DKR A;  1LVC D;  1GGZ A;  2MRD A;  4XJK A;  1ORG A;  1NCY A;  2ZKM X;  1BU3 A;  2YGU A;  1XK4 A;  1OZO A;  1OOJ A;  2BKI B;  1REC A;  2JPO A;  3HX4 A;  3IVT A;  1AJ5 A;  1KSM A;  1YRT B;  1TNP A;  1J7O A;  3ZWH A;  1V1G A;  1NX0 A;  1UP5 A;  3KHE A;  5AEQ A;  1SK6 D;  2L2C A;  1XFZ O;  1CFF A;  1DMO A;  2LLS A;  1NWD A;  4P2Y B;  3DF0 B;  1UHI A;  1LA0 A;  2QEB A;  1OE9 B;  1ZMZ A;  1OMR A;  2F3Z A;  2WCM A;  1Y1A A;  1K95 A;  1QAS A;  1IGV A;  4YBH B;  1NSH A;  1KQM B;  4GPL B;  1FI5 A;  1J7P A;  1OMV A;  1FBV A;  2JT8 A;  2JT3 A;  2KYF A;  2MAZ A;  1RWY A;  2L50 A;  3I5I B;  1G4Y R;  5AFP A;  1IJ6 A;  3FE9 A;  2P71 A;  2KLE A;  2COL B;  1KQV A;  1EXR A;  4N1G A;  1SSE B;  1U5I B;  1S5G Z;  1QWV A;  1S6C A;  1XFW O;  2PMY A;  5ER5 A;  1K9U A;  2L4H A;  4Q04 A;  1ALV A;  4GBA A;  1NPQ A;  1B8L A;  3SS3 A;  4M2O A;  3SG7 A;  4CFQ A;  1S36 A;  4WQ3 A;  3WXA A;  2WC5 A;  2KBM A;  2HET A;  1PUL A;  2EC6 C;  2NCP A;  2WOR A;  1CFP A;  1R2U A;  4PAL A;  1DC1 A;  1TIZ A;  1S26 D;  3M0W A;  2VRG A;  5DIC A;  2KI6 C;  1Y1X A;  3A8R A;  3OX5 A;  4YGD B;  3TDI A;  2M9G A;  2JU0 A;  4MSP A;  1XK4 C;  3BUX B;  3BXK A;  4AOM A;  1SYM A;  1KFX L;  3I5F C;  4NDB A;  1C07 A;  4BY4 A;  4MZK A;  1G33 A;  1KWO B;  1MXE A;  2F33 A;  3B86 A;  3SIA A;  1SBJ A;  3VRN A;  2CNP A;  5D3O A;  3BFH A;  3LCP C;  2KLD A;  1AUI B;  3B6X A;  1CMF A;  3DVM A;  2F2P A;  5CSN A;  2F2O A;  2ZRT A;  1DTL A;  1SR6 B;  1X02 A;  2MLF C;  2JNF A;  1LS8 A;  4I5L B;  2M97 A;  1QS7 A;  2IS9 A;  1B1G A;  3L4A A;  2PQL A;  3BYA A;  1S5G Y;  2LMU A;  4MEW A;  1KFU S;  3KO0 A;  2LE9 B;  2LMT A;  2FOT A;  2G2B A;  1PSB A;  2KFF A;  2QEV A;  3F45 A;  1SL8 A;  4MVF A;  1TTX A;  2HF5 A;  3OP0 A;  2B1U A;  1M39 A;  1XVJ A;  3O4X A;  1A2X A;  4YI8 A;  3D0Y A;  3EVU A;  3PN7 B;  1CLL A;  1NP8 A;  2OTG B;  2K60 A;  3BFA A;  3D76 A;  3FE6 A;  1QIV A;  3FIA A;  1YUU A;  1DJX A;  1SRA A;  4YGA A;  3VGO A;  3C1V A;  1TCF A;  3PJI A;  4I5J A;  2BAP A;  1WRZ A;  1IQ3 A;  4C0K A;  2K8M B;  1K96 A;  3O78 A;  1YVL A;  3CGA A;  5EL2 A;  2K7B A;  5ER4 X;  1SY9 A;  4E68 A;  1DQE A;  1PAL A;  1TNX A;  1UUR A;  3VRR A;  4MRX A;  3A4U B;  4INW A;  3PM2 A;  5I8N A;  2M0R A;  3JVT C;  2KOT A;  3R1V A;  3PAL A;  3ICB A;  1QXP A;  4WQ2 A;  1GGW A;  1S1E A;  2QEH A;  1OMD A;  1SL9 A;  2M7L A;  1CFD A;  1JFJ A;  2F3Y A;  4N1F A;  1LKJ A;  1OOF A;  3SG4 A;  2LVI A;  3PFV A;  1BT6 A;  2Q4U A;  2E6W A;  1DJG A;  4YI9 A;  2FCD A;  2BL0 C;  1XYD A;  2AUC A;  2LHL A;  3AKA A;  1OQP A;  2MLE C;  1CKK A;  1WDC B;  1QX7 A;  1IWQ A;  2WND A;  1TUJ A;  1SCV A;  3SG6 A;  1IKU A;  4C0J A;  3PN7 C;  1LIN A;  4TNC A;  2SAS A;  3SG2 A;  1NX3 A;  3R1P A;  3CZ1 A;  4PHJ A;  3SG5 A;  2LVK A;  1CLM A;  1SCM B;  4FTG A;  3S0F A;  4XJK B;  3JVT B;  1EH2 A;  3LLE A;  1N65 A;  1AP4 A;  1FPW A;  5G08 A;  3O6B A; 
#chains in the Genus database with same CATH homology
 3TUY B;  1Y6W A;  1CM4 A;  1DF0 A;  4NDD A;  1BMO A;  1B8R A;  5HKY A;  3FS7 A;  1F4Q A;  1KQM C;  1NCZ A;  1SR6 C;  2L5X B;  4ZCV A;  1R6P A;  1HT9 A;  2KFG A;  5HYD A;  4BY5 A;  4U8D A;  4DS7 A;  1DJY A;  1QAT A;  1TRF A;  3TDZ A;  1QLS A;  1FF1 A;  3VRO A;  4CPV A;  2KNE A;  4GAO A;  3WHT B;  4MZJ A;  1JFK A;  1M31 A;  4MZL A;  4YGC B;  2Y1M A;  1RK9 A;  3I5H C;  2KI6 D;  1CTR A;  1EL4 A;  2WCE A;  4ZCU A;  1NX1 A;  4USL A;  2D8N A;  1WLZ A;  1XFV O;  2GGM A;  1D1O A;  5B8I B;  2WCB A;  1QVI Z;  4NQG A;  4XYN A;  1OSA A;  4AQJ A;  1SPY A;  2Y4Q A;  1MF8 B;  1DGU A;  4OR9 B;  3LL8 B;  5CSI A;  3EKH A;  1YR5 A;  2EGD A;  1DJW A;  2DOQ A;  3TZ1 A;  3MSE B;  2O60 A;  1H8B A;  5AER A;  4ORA B;  1KK7 Z;  1U5I A;  1DT7 B;  2L0P A;  3OX6 A;  2GV5 A;  1DGV A;  1EG3 A;  2JUL A;  1JUO A;  1XA5 A;  2BCB A;  3FWB A;  2JQ6 A;  4OCI A;  2OPO A;  2PSR A;  2BKH B;  4GFT A;  2K7C A;  5DKN A;  1TNQ A;  2NCO A;  2L98 A;  4MBE A;  1BR1 B;  1WLM A;  4OKH A;  3VRQ A;  2EC6 B;  3PM8 A;  2L2E A;  3AAK A;  1UHK A;  4CFR A;  3TUY C;  2JWW A;  1AHR A;  3DF0 A;  3O4Y A;  3PLF B;  2KSP A;  3PAT A;  2PAS A;  1EG4 A;  1EJ3 A;  2M49 B;  4MLW A;  1A75 A;  1MQ1 A;  1UHH A;  1Y0V H;  2EHB A;  2SCP A;  2ZFD A;  1FI6 A;  4DUQ A;  5D7F A;  1NX2 A;  1W7I B;  1K2H A;  2PVB A;  2QAC A;  4GGN A;  4HRH A;  5GQQ C;  1L2O B;  1YUR A;  3H4S E;  4GNK B;  5J3X A;  1BLQ A;  1J1E A;  1MHO A;  1CNP A;  1NCX A;  2AMI A;  3EK4 A;  3K21 A;  4FQO A;  4PCW A;  1F8H A;  2LCP A;  2LUC A;  1KK7 Y;  3BOW A;  1SMG A;  4A4C A;  2TN4 A;  2BE6 A;  2LP3 A;  1CDP A;  1IG5 A;  3CS1 A;  1K9K A;  2K2A A;  1XFU O;  4D1E A;  4R1E A;  1QTX A;  4L9M A;  1BJF A;  3BUW B;  1JBA A;  1DJH A;  1AJ4 A;  5DKQ A;  3DVK A;  1VRK A;  2ZNE A;  2LLU A;  4A4B A;  4PE7 A;  1A03 A;  4AQI A;  1CDM A;  1B4C A;  1F55 A;  3EKJ A;  1ZFS A;  2CT9 A;  3KF9 A;  5CSJ A;  1JF0 A;  1SCM C;  1BF5 A;  1WY9 A;  3EK7 A;  1S6J A;  1IH0 A;  2GGZ A;  2MBX A;  4GGF A;  4CLN A;  1F4O A;  3EVV A;  1K94 A;  3AKB A;  1HQV A;  2JOJ A;  1BR4 B;  1DVI A;  2K61 A;  1XO5 A;  1G8I A;  3I5G C;  2LP2 A;  2R2I A;  4DIR A;  1NYA A;  1SKT A;  4PE0 A;  1QLK A;  4JQ0 D;  2MJW B;  1YRU B;  3RM1 A;  2K0J A;  2LLT A;  4NDC A;  5CSF A;  4M2P A;  3IF7 A;  1M63 B;  1WRK A;  3CLN A;  1QX5 B;  2K7D A;  3FWC A;  1B7T Z;  3I5F B;  2BEC A;  3GK2 A;  1B47 A;  3IQO A;  1JC2 A;  3DVJ A;  1J7Q A;  1NUB A;  4DRW A;  2JXC A;  3LK1 A;  5JOL A;  3GK4 X;  3TS5 C;  1KFU L;  5F6T A;  1LA3 A;  1YUT A;  1DF0 B;  4ICB A;  4HRE E;  5I2O A;  1RRO A;  3CR2 A;  4PE1 A;  1LXF C;  2L51 A;  3JTD B;  5BPJ A;  2F8P A;  4PE4 A;  3DVE A;  3TS5 B;  2LHI A;  2KI4 C;  4GGF C;  1UHN A;  2ZN9 A;  2LAN A;  5K89 A;  1J1D A;  2LVV A;  3VRP A;  2JRF A;  3EVR A;  1SNL A;  3WHU B;  1YVH A;  1GJY A;  1A29 A;  4YGE B;  1KCY A;  1GQM A;  4PHK A;  1S6I A;  1KK8 B;  2KFH A;  1YTZ C;  2LNK A;  5AAN A;  2JNX A;  1PVA A;  2NZ0 A;  5HLV A;  2KBI A;  5I2L A;  3SIB A;  2KYC A;  1AK8 A;  2H2K A;  4CID A;  1CB1 A;  5I2Q A;  2ZN8 A;  2OTG C;  1IRJ A;  4UPG A;  4N5X A;  2PRU A;  3NSK A;  1CDN A;  2OS8 C;  3CTN A;  3I5H B;  2I2R E;  4PDZ A;  1E8A A;  5D69 A;  5HLO A;  3GK1 A;  2L4I A;  1XFY O;  4I5N B;  2MA2 A;  3CZT X;  2AAO A;  2M8U A;  1ZOT B;  1ZUZ A;  3RLZ A;  3KPX A;  1UUS A;  1WDC C;  5FYX A;  2A4J A;  2Y1N A;  1IJ5 A;  2KGR A;  2M1K B;  4YRU A;  1ODB A;  2RGI A;  2P6B B;  1C7W A;  2LAP A;  2KAX A;  3SJS A;  2LM5 A;  2BE4 A;  1A4P A;  1KK8 C;  2LV7 A;  4C0L A;  1F54 A;  1YX7 A;  1J55 A;  2CXJ A;  1QX2 A;  1QIW A;  1PVB A;  1QV0 A;  4PHN A;  2M1U A;  1BG1 A;  3D10 A;  1QJT A;  4ORB B;  2ZND A;  1Y1U A;  1BOC A;  2PAL A;  1A75 B;  1M45 A;  3O2P A;  4F0Z B;  3I5I C;  5IBW A;  2BCA A;  1F71 A;  3BUM B;  2KAV A;  1RTP 1;  2KGB C;  4M2Q A;  2JC2 A;  2NLN A;  1MXL C;  1PRW A;  3AAJ A;  2KAY A;  2I18 A;  4HRG A;  1MUX A;  4PHM A;  1V1F A;  2ZRS A;  1TCO B;  2KDH A;  3BOW B;  1DJI A;  3LK0 A;  5TNC A;  1OZS A;  1ZAC A;  1JF2 A;  2NXQ A;  4ORC B;  1B8C A;  1FW4 A;  2E30 A;  2O5G A;  4I5K A;  1IQ5 A;  3D0Y B;  1S3P A;  4OVN F;  2M29 A;  1F70 A;  2MHH A;  2LUX A;  2CCM A;  1MR8 A;  3CWG A;  2HPS A;  1KSO A;  2LMV A;  2K7O A;  2JXL A;  2I7A A;  2H61 C;  4JWQ A;  1TN4 A;  1TOP A;  2BBN A;  3SG3 A;  4DCK A;  1MWN A;  1CDL A;  1RFJ A;  2JPT A;  3IQQ A;  4JPZ B;  1H4B A;  4QJ4 B;  2H61 A;  2HQ8 A;  3BUN B;  2OS8 B;  3QRX A;  2M7N A;  2Q91 A;  1N2D A;  1UHJ A;  2JTT A;  2CBL A;  2G9B A;  2LC5 A;  1KFX S;  2KQY A;  1L2O C;  4IL1 A;  5PAL A;  1W7J B;  2LVJ A;  4GUK A;  4HSZ A;  1PK0 D;  2JT0 A;  2ISD A;  1WRL A;  1K90 D;  4QJ5 B;  1AVS A;  1RJV A;  2WOS A;  5HKW A;  1K9P A;  2I94 A;  2V53 A;  3HCM A;  3OB1 B;  1DJZ A;  2HQW A;  3EK8 A;  3GOF A;  3OB2 B;  3KEV A;  3NSI A;  3CR4 X;  2KI4 B;  1QVI Y;  2BCX A;  3TDU A;  3E3R A;  1JSA A;  1K8U A;  1YUS A;  3BUO B;  1SL7 A;  1SW8 A;  1N0Y A;  3NSL A;  1YX8 A;  1CMG A;  3JTD C;  2M3W A;  1JWD A;  5KSZ A;  4ETO A;  2WCF A;  1K93 D;  3NSO A;  3I5G B;  1KWO C;  2FJU B;  5KU1 A;  1QV1 A;  2BBM A;  2K2F A;  1L7Z A;  1M46 A;  1Q80 A;  5CPV A;  2CTN A;  1B7T Y;  3PSR A;  4MRY A;  3WNX B;  3ZNI A;  5I8N A;  3NXA A;  3BQ3 A;  3OHM B;  1B9A A;  5HKZ A;  1BOD A;  4OV2 A;  1UWO A;  2BL0 B;  2KQ6 A;  4QJ3 B;  1ALW A;  1C7V A;  1NIW A;  1J7R A;  2QPT A;  5KTY A;  5AXI A;  2KHN A;  1CM1 A;  3CR5 X;  2JTZ A;  1PSR A;  1TNW A;  2Y5I A;  4YGB B;  2FCE A;  3DD4 A;  4WRI A;  5JJG A;  1CFC A;  4MN0 A;  1CLB A;  1XFX O;  2JZI A;  4P5O E;  2WC8 A;  5DKR A;  1LVC D;  1GGZ A;  2MRD A;  4XJK A;  2ZKM X;  1NCY A;  1BU3 A;  1XK4 A;  1OZO A;  1OOJ A;  2BKI B;  1REC A;  3HX4 A;  1AJ5 A;  1KSM A;  1YRT B;  1TNP A;  1J7O A;  3ZWH A;  1V1G A;  1NX0 A;  1UP5 A;  3KHE A;  5AEQ A;  1SK6 D;  1CFF A;  1XFZ O;  1DMO A;  2LLS A;  1NWD A;  4P2Y B;  3DF0 B;  1UHI A;  1LA0 A;  1OE9 B;  1ZMZ A;  1OMR A;  2F3Z A;  1Y1A A;  1K95 A;  1QAS A;  1IGV A;  4YBH B;  1NSH A;  1KQM B;  4GPL B;  1FI5 A;  1J7P A;  1OMV A;  1FBV A;  2JT8 A;  2JT3 A;  2KYF A;  2MAZ A;  1RWY A;  2L50 A;  3I5I B;  1G4Y R;  5AFP A;  1IJ6 A;  2COL B;  1KQV A;  1EXR A;  4N1G A;  1U5I B;  1S5G Z;  1S6C A;  1XFW O;  2PMY A;  5ER5 A;  1K9U A;  2L4H A;  4Q04 A;  1ALV A;  4GBA A;  1NPQ A;  1B8L A;  4M2O A;  3SG7 A;  4CFQ A;  1S36 A;  4WQ3 A;  3WXA A;  2KBM A;  2HET A;  1PUL A;  2EC6 C;  2NCP A;  2WOR A;  1CFP A;  1R2U A;  4PAL A;  1TIZ A;  1S26 D;  3M0W A;  2VRG A;  2KI6 C;  1Y1X A;  3A8R A;  3OX5 A;  4YGD B;  3TDI A;  2M9G A;  2JU0 A;  4MSP A;  1XK4 C;  3BUX B;  3BXK A;  4AOM A;  1SYM A;  1KFX L;  3I5F C;  4NDB A;  1C07 A;  4BY4 A;  4MZK A;  1G33 A;  1KWO B;  1MXE A;  2F33 A;  3SIA A;  1SBJ A;  3VRN A;  2CNP A;  1CMF A;  3LCP C;  1AUI B;  3DVM A;  2F2P A;  5CSN A;  2F2O A;  2ZRT A;  1DTL A;  1SR6 B;  1X02 A;  2MLF C;  2JNF A;  4I5L B;  1B1G A;  2M97 A;  1QS7 A;  2IS9 A;  3BYA A;  4MEW A;  1S5G Y;  2LMU A;  1KFU S;  3KO0 A;  2LE9 B;  2LMT A;  2FOT A;  2G2B A;  1PSB A;  2KFF A;  3F45 A;  4MVF A;  1SL8 A;  1TTX A;  2HF5 A;  3OP0 A;  2B1U A;  1M39 A;  1XVJ A;  4YI8 A;  1A2X A;  3D0Y A;  3EVU A;  3PN7 B;  1CLL A;  1NP8 A;  2OTG B;  1QIV A;  3FIA A;  1YUU A;  1DJX A;  1SRA A;  4YGA A;  3VGO A;  3C1V A;  1TCF A;  4I5J A;  1WRZ A;  1IQ3 A;  4C0K A;  2K8M B;  1K96 A;  3O78 A;  1YVL A;  3CGA A;  5ER4 X;  2K7B A;  1SY9 A;  4E68 A;  1PAL A;  1TNX A;  1UUR A;  3VRR A;  4MRX A;  3A4U B;  2M0R A;  3JVT C;  2KOT A;  3PAL A;  3ICB A;  1QXP A;  4WQ2 A;  1GGW A;  1S1E A;  1OMD A;  1SL9 A;  2M7L A;  1CFD A;  1JFJ A;  2F3Y A;  4N1F A;  1LKJ A;  3SG4 A;  2LVI A;  3PFV A;  1BT6 A;  2Q4U A;  2E6W A;  1DJG A;  4YI9 A;  2FCD A;  2BL0 C;  1XYD A;  2AUC A;  2LHL A;  3AKA A;  1OQP A;  2MLE C;  1CKK A;  1WDC B;  1QX7 A;  1IWQ A;  2WND A;  1SCV A;  3SG6 A;  1IKU A;  4C0J A;  3PN7 C;  1LIN A;  4TNC A;  2SAS A;  3SG2 A;  1NX3 A;  4PHJ A;  3SG5 A;  2LVK A;  1CLM A;  1SCM B;  4FTG A;  4XJK B;  3JVT B;  1EH2 A;  3LLE A;  1N65 A;  1AP4 A;  1FPW A;  5G08 A;  3O6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...