1QTXA

The 1.65 angstrom structure of calmodulin rs20 peptide complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
148
structure length
148
Chain Sequence
ADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYEEFVQVMMAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CALMODULIN)
publication title High Resolution Structure of a Calmodulin Rs20 Peptide Complex
rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 52
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1999-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qtxA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qtxA02
1UHKA 3O78A 4HRHA 1NIWA 1TNPA 4ICBA 2SASA 5ER5A 1FI6A 2WNDA 1JUOA 1CDNA 2FCEA 1H4BA 2KI6D 1JFKA 1K90D 1QLSA 1B4CA 4QJ4B 4I5NB 1A29A 1GGZA 1XFWO 4N5XA 4MEWA 1G8IA 4C0LA 1XK4C 2L51A 3OP0A 1Y0VH 2GGZA 1CLLA 1NP8A 3FS7A 2M1KB 3PALA 3VRRA 2LP3A 4PE0A 4MVFA 1QX7A 3SG7A 2KDHA 2NXQA 2I7AA 1PVAA 2CBLA 3VRQA 1IGVA 4YGCB 3SIBA 1QIVA 5HLVA 3EK7A 1GJYA 1ZOTB 5DKQA 1DJZA 3SG5A 3BYAA 3TS5C 1SR6C 2KFHA 2Q91A 2LAPA 1QV1A 2Y4QA 1KFUL 3CR5X 1XVJA 2LNKA 2JT3A 1UWOA 4MZKA 4F0ZB 1KFXS 3D0YA 2EGDA 2HQWA 4MN0A 3DVJA 3H4SE 2AUCA 1ZMZA 4ZCUA 3IF7A 4MRYA 4AQJA 4PE1A 2F2PA 2MLEC 2L4HA 5KSZA 1CLBA 2LMUA 1SKTA 1RJVA 1S1EA 1KWOC 1DF0A 1MHOA 1TNWA 1DJYA 2CXJA 1OZOA 2F3YA 1S6JA 3DVEA 1BMOA 1KK8B 3DD4A 1K9KA 1MXEA 1OMVA 1OMRA 2HPSA 2K61A 2BE4A 5PALA 4CPVA 1YVLA 1TIZA 1NYAA 1X02A 1TTXA 5KTYA 1XFYO 2ZN8A 5CSNA 5DKNA 4BY5A 2KNEA 2JTTA 1SCVA 1OQPA 2A4JA 4XYNA 1MR8A 3KO0A 2LC5A 1CTRA 1YX8A 2JOJA 1WRLA 3E3RA 1AHRA 2BCAA 2FJUB 3PSRA 4WQ3A 2M9GA 1EXRA 2OS8C 3I5HC 1SRAA 4NQGA 4A4BA 5HKYA 2M49B 2AMIA 5I2OA 1SNLA 2PASA 1PSRA 1SCMC 2V53A 2BL0C 4USLA 4ETOA 1UHHA 3JTDC 1DJXA 2MHHA 3WHTB 4M2OA 2M97A 2EHBA 3PM8A 2KQYA 5F6TA 2H2KA 3K21A 1AK8A 1IJ5A 5HKWA 3EVRA 1PULA 3TDUA 1B9AA 4YI8A 1U5IA 2KGRA 2KFFA 1ZUZA 4GAOA 4PHKA 2LP2A 3D0YB 5CPVA 1M45A 1RK9A 2M7LA 1XA5A 1CFDA 2JXLA 3O2PA 1WDCB 2ZKMX 4R1EA 5JOLA 5I2LA 4XJKA 3RM1A 2OTGB 2EC6B 2WCEA 1BR4B 4ZCVA 4YGEB 1DF0B 1MWNA 2K7CA 1TCOB 1YX7A 3KEVA 1KFXL 4M2PA 3VRPA 3HCMA 1SL7A 2LHIA 1DGVA 1AUIB 2BKHB 3CLNA 4GGFA 2I2RE 1B8CA 2CNPA 4D1EA 2Q4UA 1H8BA 2H61A 4CLNA 1SBJA 1K96A 4AOMA 1DGUA 1TNXA 3C1VA 3IQOA 2LANA 2F2OA 1QIWA 3OB2B 4N1FA 3SJSA 1S6IA 2RGIA 3I5FB 2WOSA 2PALA 2PVBA 1CKKA 1EG3A 1WY9A 2BCBA 3O4YA 4Q04A 2LMTA 1NX2A 3PN7B 1ODBA 1NSHA 2O5GA 1YR5A 1NX1A 1SYMA 1LINA 1N65A 1BG1A 4PDZA 1MF8B 2K2AA 4GGNA 1DT7B 2JQ6A 1TNQA 1YTZC 1B47A 2BKIB 2KBMA 3EVUA 1KK8C 3WHUB 2ZFDA 2ZN9A 3AAKA 4PHMA 5GQQC 3WXAA 1DJGA 2MRDA 3BOWB 2KYCA 2ISDA 3TUYB 3I5IB 1NX3A 1IH0A 4NDBA 1K9PA 1QASA 2FCDA 1CDLA 4YI9A 2PMYA 1A03A 1U5IB 3CR4X 1XK4A 3I5GC 1CFPA 5HLOA 1JC2A 5TNCA 4QJ5B 1UUSA 1K95A 3QRXA 2JTZA 1XFXO 3BQ3A 1L2OB 3JVTB 3MSEB 2ZNEA 1K93D 4XJKB 1MQ1A 5CSIA 5KU1A 1AVSA 1YUSA 1A75A 2JXCA 2BCXA 3GOFA 4QJ3B 1JSAA 2LVJA 1E8AA 1RECA 4YBHB 2MJWB 5CSJA 5AEQA 2Y5IA 3SIAA 1C7WA 1NX0A 1V1FA 2BBMA 1G33A 4DS7A 4HREE 1BU3A 1A2XA 4OR9B 1CM1A 2LM5A 1ALWA 5AFPA 2JPTA 1HT9A 1RROA 4YRUA 1YRUB 3FIAA 1QV0A 2LHLA 1WDCC 2F8PA 3AKAA 2KBIA 3EVVA 1GGWA 2QPTA 1RFJA 2OTGC 2I18A 2EC6C 4GUKA 5BPJA 1V1GA 1CFCA 5G08A 2L0PA 4MRXA 2KFGA 1QLKA 4C0KA 1JWDA 1ZFSA 1BODA 2SCPA 2G2BA 1YURA 3NXAA 1L7ZA 1QX5B 4HSZA 2M7NA 5CSFA 1M63B 3TDIA 1QS7A 1PVBA 4PE4A 1Y1AA 2WC8A 1TN4A 2K7DA 1VRKA 3IQQA 3I5FC 3CR2A 1J1EA 2JT8A 3F45A 2WORA 3PATA 2HQ8A 3LCPC 1SW8A 2JWWA 1WLZA 1LA0A 4TNCA 1SY9A 1M39A 1F54A 3PN7C 3CGAA 2HETA 5I2QA 4YGBB 1Y6WA 2F3ZA 2PSRA 3NSKA 1D1OA 1HQVA 1N0YA 1TRFA 1DJIA 3NSOA 3GK1A 4IL1A 1OE9B 1A75B 3CWGA 1KQVA 4MZLA 3EK8A 1AJ4A 2K0JA 1BR1B 3SG4A 1RTP1 1K9UA 3BUMB 1F70A 1UHNA 2JC2A 2KYFA 1TCFA 1F4QA 3TUYC 5DKRA 1QX2A 1NCYA 3GK2A 1ZACA 1F4OA 1DJHA 1QXPA 1NCXA 2CTNA 1NUBA 3EKHA 4MZJA 2NLNA 3BUWB 1DMOA 4ORBB 1L2OC 3JVTC 4CFQA 2HF5A 1SK6D 4C0JA 2ZNDA 1TOPA 1CMGA 4N1GA 5FYXA 4FQOA 3LLEA 1AJ5A 1R6PA 1R2UA 2KHNA 4WRIA 1PK0D 3DVKA 1WLMA 2JNFA 3BUNB 1JFJA 1IQ5A 2LLUA 5AANA 3PLFB 4PHNA 2E6WA 2H61C 1M31A 1FPWA 4ORAB 1JF0A 2LLTA 3VGOA 1EG4A 1CDPA 1KSOA 2B1UA 3OB1B 3LK1A 2E30A 1N2DA 1YUTA 2GGMA 2OS8B 4GNKB 1G4YR 3I5HB 1PALA 1FF1A 5ER4X 3TDZA 2LE9B 1C07A 1KQMB 1CDMA 3KF9A 1BLQA 4AQIA 3CS1A 2L4IA 2Y1MA 3NSLA 2JT0A 2MA2A 4GBAA 1FI5A 1YVHA 3JTDB 2M29A 1Y1XA 2LV7A 1SMGA 1F55A 3EK4A 3CZTX 3O6BA 3SG6A 3D10A 1UURA 4CIDA 1EL4A 1SL8A 3A8RA 1M46A 4JPZB 4BY4A 1LKJA 4MBEA 1W7IB 1UHJA 5I8NA 1Q80A 3A4UB 1YUUA 1QVIY 1BJFA 2CT9A 1KK7Y 2PRUA 2ZRSA 1KCYA 3KPXA 1B7TY 2GV5A 1LA3A 1QATA 1SL9A 1MXLC 3OX6A 1XFUO 2WCBA 2O60A 2KAYA 5JJGA 1BF5A 1BOCA 1J7PA 3DF0A 4DCKA 4UPGA 1F8HA 2L98A 3TZ1A 4I5JA 3ZWHA 1J1DA 4NDCA 4U8DA 1OMDA 2KOTA 2KI4B 2L50A 1MUXA 4OVNF 1QVIZ 1RWYA 2BECA 1KK7Z 1OOJA 2L5XB 1B7TZ 1BT6A 3HX4A 1EH2A 2KAXA 2KAVA 1DJWA 2G9BA 4MSPA 1QJTA 1J7OA 3DVMA 2K8MB 2LLSA 1NCZA 4GPLB 4P5OE 1Y1UA 2D8NA 2NCOA 2M8UA 5D69A 2MAZA 2I94A 5HKZA 3EKJA 3FWCA 1B8RA 2L2EA 2TN4A 1FW4A 4I5LB 3CTNA 2LMVA 3VRNA 3WNXB 3LL8B 2FOTA 4MLWA 1XFVO 3M0WA 1B1GA 4OCIA 1IWQA 4WQ2A 5J3XA 2M1UA 1K2HA 2P6BB 2KI6C 1LXFC 1S6CA 2OPOA 5K89A 1ALVA 3I5GB 2BE6A 3SG3A 1CM4A 1PSBA 4CFRA 4GFTA 1UHIA 1S5GY 2R2IA 3FWBA 1SR6B 4JWQA 3TS5B 1KQMC 1C7VA 4L9MA 1A4PA 1EJ3A 5IBWA 1IRJA 2VRGA 1J7QA 2JNXA 2WCFA 2JZIA 1IJ6A 3DF0B 3I5IC 3AKBA 4YGDB 2JRFA 2JU0A 4DIRA 2MLFC 1QTXA 3BUOB 3BOWA 4ORCB 1WRKA 1JF2A 1JBAA 1DVIA 1CLMA 4FTGA 4PE7A 1KFUS 2KSPA 1KWOB 4PHJA 1CB1A 4JQ0D 2K7BA 4P2YB 1NWDA 5B8IB 4I5KA 5HYDA 2CCMA 2LCPA 1LVCD 1J7RA 2DOQA 5AXIA 3ZNIA 2ZRTA 1XFZO 3OHMB 1CNPA 1S3PA 1S5GZ 1S36A 3NSIA 1W7JB 1XO5A 2MBXA 1B8LA 1FBVA 3AAJA 1YRTB 4DUQA 1S26D 4GGFC 4OV2A 1PRWA 4M2QA 3VROA 3BUXB 1WRZA 3LK0A 1OZSA 2LVVA 2KQ6A 1CMFA 1IKUA 1J55A 2IS9A 2LUCA 4OKHA 1AP4A 1K8UA 2NCPA 2LUXA 2KI4C 3GK4X 2BBNA 2M0RA 1OSAA 2M3WA 3KHEA 4NDDA 1KSMA 1SPYA 5D7FA 3ICBA 1K94A 2NZ0A 4HRGA 2K2FA 3PFVA 1IQ3A 1F71A 3SG2A 1SCMB 4DRWA 4A4CA 4PCWA 2BL0B 5AERA 2QACA 1XYDA 4PALA 2F33A 1DTLA 2LVKA 3RLZA 1CFFA 1GQMA 3BXKA 3OX5A 2JULA 1NPQA 1IG5A 2LVIA 4E68A 2COLB 2Y1NA 2AAOA 1UP5A 2K7OA 4YGAA 2KGBC
chains in the Genus database with same CATH superfamily
1UHKA 3O78A 4HRHA 1NIWA 1TNPA 4ICBA 2SASA 5ER5A 1FI6A 2WNDA 1JUOA 1CDNA 2FCEA 1H4BA 2KI6D 3S0FA 1JFKA 1K90D 1QLSA 1B4CA 4QJ4B 4I5NB 1A29A 1GGZA 1XFWO 2KLEA 3L4AA 4MEWA 4N5XA 3SS3A 1G8IA 4C0LA 1XK4C 2L51A 3OP0A 1Y0VH 3CZ0A 2GGZA 1CLLA 1NP8A 3FS7A 2M1KB 3PALA 3VRRA 2LP3A 4PE0A 4MVFA 1QX7A 3SG7A 2KDHA 2NXQA 2WC6A 2I7AA 5FI7A 1PVAA 2CBLA 3VRQA 1IGVA 4YGCB 3SIBA 1QIVA 5HLVA 3EK7A 1GJYA 1ZOTB 5DKQA 1DJZA 3SG5A 5I94A 3BYAA 3TS5C 1SR6C 2KFHA 2Q91A 2LAPA 1QV1A 2Y4QA 1KFUL 1TWOA 1XVJA 2LNKA 2JT3A 3CR5X 1UWOA 4MZKA 4F0ZB 1KFXS 3D0YA 2EGDA 3D77A 2HQWA 4MN0A 3D76A 3DVJA 3H4SE 2AUCA 1ZMZA 4ZCUA 3IF7A 4MRYA 4AQJA 4PE1A 2F2PA 2MLEC 1DQEA 2L4HA 5KSZA 1CLBA 2LMUA 1SKTA 1RJVA 1S1EA 1KWOC 1DF0A 2BNXA 3SS4A 1MHOA 1TNWA 1DJYA 2CXJA 1OZOA 2F3YA 1S6JA 3DVEA 1BMOA 1KK8B 3DD4A 1K9KA 1MXEA 1OMVA 1OMRA 1T14A 2HPSA 2K61A 2BE4A 5PALA 4CPVA 1YVLA 1TIZA 1NYAA 2KLDA 1X02A 1TTXA 5KTYA 1XFYO 2ZN8A 5CSNA 5DKNA 4BY5A 2KNEA 2JTTA 1ORGA 2JPOA 1SCVA 1OQPA 2A4JA 4XYNA 1MR8A 3KO0A 2LC5A 1C3YA 1CTRA 1YX8A 2JOJA 1WRLA 3E3RA 1AHRA 2BCAA 2FJUB 3PSRA 4WQ3A 4F7FA 2M9GA 1EXRA 2OS8C 3I5HC 2BAPA 1SRAA 4NQGA 4A4BA 5HKYA 2M49B 2AMIA 5I2OA 1SNLA 2PASA 1PSRA 1SCMC 2V53A 2BL0C 2PYQA 4USLA 4ETOA 1UHHA 3JTDC 1DJXA 2ERBA 3L4LA 2MHHA 3WHTB 3N7HA 4M2OA 2M97A 2EHBA 3PM8A 2KQYA 5F6TA 2H2KA 3D74A 3K21A 1AK8A 1IJ5A 5HKWA 3VB1A 3EVRA 1PULA 3TDUA 1B9AA 4YI8A 1U5IA 2KGRA 2KFFA 1ZUZA 4GAOA 4PHKA 2LP2A 3D0YB 5CPVA 1M45A 1RK9A 2M7LA 3V2LA 3IVTA 3S0EA 1XA5A 3DXLA 1CFDA 2JXLA 3O2PA 1WDCB 2ZKMX 4R1EA 5JOLA 3NHTA 3D75A 5I2LA 4XJKA 1Z4HA 2OTGB 3RM1A 2EC6B 2WCEA 3R1PA 1BR4B 4ZCVA 4YGEB 4JKTA 1DF0B 1XFRA 1MWNA 2K7CA 1SSEB 1YX7A 1TCOB 1KFXL 3KEVA 4M2PA 3HCMA 1SL7A 3VRPA 2LHIA 1DGVA 1AUIB 2BKHB 3CLNA 4GGFA 2I2RE 1B8CA 2CNPA 5FI6A 4D1EA 2Q4UA 3PJIA 1H8BA 2H61A 4CLNA 1SBJA 1K96A 3BJHA 4AOMA 1DGUA 1TNXA 3B87A 3R72A 3C1VA 3IQOA 2LANA 2F2OA 1QIWA 3OB2B 4N1FA 4KYNA 3SJSA 1S6IA 2RGIA 3I5FB 2WOSA 2PALA 2PVBA 1TUZA 1EG3A 1WY9A 2BCBA 1CKKA 3D73A 3O4YA 4Q04A 3SS5A 2LMTA 4PT1A 1NX2A 3PN7B 1ODBA 3B88A 3UNWA 1NSHA 2O5GA 1YR5A 1NX1A 1SYMA 2FJYA 1LINA 1N65A 1BG1A 4PDZA 1MF8B 2K2AA 3S0BA 4GGNA 1DT7B 2JQ6A 1TNQA 1YTZC 1B47A 2BKIB 3DYEA 2KBMA 2WCHA 3EVUA 1KK8C 4OZDA 3NGVA 3WHUB 2ZFDA 2ZN9A 3AAKA 4PHMA 5GQQC 1OW4A 3WXAA 1DJGA 2MRDA 3BOWB 2KYCA 2ISDA 3TUYB 3I5IB 1NX3A 1IH0A 4NDBA 1K9PA 1QASA 2FCDA 1CDLA 4YI9A 2PMYA 3L47A 1A03A 1U5IB 3CR4X 3NHIA 1XK4A 3I5GC 1CFPA 5HLOA 1JC2A 5TNCA 1W9ZA 4QJ5B 1UUSA 1K95A 3QRXA 2JTZA 1XFXO 2P70A 3BQ3A 1L2OB 3JVTB 3MSEB 2ZNEA 1K93D 4XJKB 3DZTA 1MQ1A 5CSIA 5KU1A 2WCJA 1AVSA 1YUSA 3BFHA 1A75A 2QDIA 3RZSA 2JXCA 2BCXA 3GOFA 4QJ3B 1JSAA 2LVJA 1E8AA 1RECA 4YBHB 2MJWB 5CSJA 5AEQA 2Y5IA 3SIAA 1C7WA 1NX0A 1V1FA 2BBMA 1G33A 3DY9A 4DS7A 4HREE 5HL1A 1BU3A 1A2XA 4OR9B 1CM1A 2LM5A 1ALWA 5AFPA 2JPTA 1HT9A 1RROA 4YRUA 1YRUB 3FIAA 1QV0A 2LHLA 1WDCC 2F8PA 3AKAA 2KBIA 3S0GA 3EVVA 1GGWA 2QPTA 1RFJA 2OTGC 2I18A 2EC6C 4GUKA 5BPJA 3UO9A 1V1GA 1CFCA 5G08A 2L0PA 3FE6A 4MRXA 1OOFA 2KFGA 1QLKA 4C0KA 1JWDA 1ZFSA 1BODA 2SCPA 2G2BA 1YURA 3CZ2A 3NXAA 1L7ZA 1QX5B 4HSZA 2M7NA 3R1VA 5CSFA 1M63B 3TDIA 1QS7A 1PVBA 4PE4A 1Y1AA 2WC8A 1TN4A 2K7DA 1VRKA 3IQQA 3I5FC 3CR2A 1J1EA 2JT8A 3F45A 2WORA 3PATA 2HQ8A 3LCPC 2WCKA 1SW8A 2JWWA 3B6XA 1WLZA 1LA0A 4TNCA 1SY9A 1M39A 1F54A 1OOHA 3PN7C 3CGAA 2HETA 2WC5A 4YGBB 1Y6WA 2F3ZA 2PSRA 3NSKA 5I2QA 1D1OA 1HQVA 1N0YA 1TRFA 1IIOA 1DJIA 3NSOA 3GK1A 4FQTA 4IL1A 1OE9B 1A75B 2WCLA 3CWGA 1KQVA 4MZLA 3EK8A 1AJ4A 2K0JA 1BR1B 3SG4A 1RTP1 3BFAA 1K9UA 3BUMB 1F70A 1UHNA 2JC2A 2KYFA 3EG5B 1TCFA 1F4QA 3TUYC 5DKRA 1QX2A 1NCYA 3GK2A 1ZACA 1F4OA 1DJHA 1QXPA 3CABA 1NCXA 2CTNA 1NUBA 3EKHA 4MZJA 2NLNA 2L5YA 3BUWB 4ORBB 1DMOA 1LS8A 1L2OC 3JVTC 4CFQA 2HF5A 1SK6D 4C0JA 2ZNDA 1TOPA 1CMGA 4N1GA 5FYXA 4FQOA 3LLEA 1DELA 3QMEA 1AJ5A 1R6PA 1R2UA 2KHNA 4WRIA 2KPHA 2P71A 1PK0D 3DVKA 1WLMA 2JNFA 3BUNB 1JFJA 1IQ5A 2LLUA 5AANA 3CDNA 3PLFB 4PHNA 2E6WA 2H61C 1M31A 1FPWA 4ORAB 1JF0A 2LLTA 3VGOA 1EG4A 1CDPA 1KSOA 2B1UA 2GTEA 3D78A 3LK1A 3OB1B 2E30A 1N2DA 1YUTA 2GGMA 2OS8B 4GNKB 1G4YR 3I5HB 2PQLA 1PALA 1FF1A 5ER4X 3TDZA 2LE9B 3FE9A 1KQMB 1CDMA 1C07A 3KF9A 1BLQA 4AQIA 3CS1A 2L4IA 2Y1MA 3NSLA 1GM0A 2JT0A 2MA2A 4GBAA 1FI5A 1YVHA 3JTDB 2M29A 1Y1XA 2LV7A 1SMGA 3CZ1A 3EK4A 3CZTX 1F55A 3BFBA 3O6BA 1OOIX 3SG6A 3D10A 1UURA 4CIDA 1EL4A 1SL8A 3A8RA 1M46A 4JPZB 4BY4A 1LKJA 4MBEA 1W7IB 1UHJA 5I8NA 1Q80A 3A4UB 1YUUA 1QVIY 1TUJA 1BJFA 2CT9A 1KK7Y 2PRUA 2ZRSA 1KCYA 3KPXA 1B7TY 2GV5A 1LA3A 1QATA 1SL9A 1MXLC 5EL2A 3OX6A 1XFUO 2WCBA 2O60A 3R1OA 5FI2A 2KAYA 5JJGA 1BF5A 1BOCA 1J7PA 3DF0A 4DCKA 4UPGA 1F8HA 2L98A 3TZ1A 4I5JA 3ZWHA 1J1DA 4NDCA 4U8DA 1OMDA 2KOTA 1QWVA 2KI4B 2L50A 1P28A 1MUXA 4OVNF 5D3OA 1QVIZ 1RWYA 2BECA 1KK7Z 1OOGA 1OOJA 2L5XB 1B7TZ 1BT6A 3HX4A 1EH2A 2KAXA 2KAVA 1DJWA 2G9BA 4INWA 4MSPA 1QJTA 1J7OA 3DVMA 2K8MB 2LLSA 1NCZA 4GPLB 4P5OE 1Y1UA 2D8NA 2NCOA 3OBVA 2M8UA 5D69A 2MAZA 2I94A 4IJ7A 5HKZA 3EKJA 3FWCA 1B8RA 2L2EA 2TN4A 1FW4A 4I5LB 3CTNA 2LMVA 3VRNA 3WNXB 3LL8B 2FOTA 3B7AA 4MLWA 1XFVO 3M0WA 1B1GA 4OCIA 1IWQA 4WQ2A 5J3XA 2M1UA 1K2HA 2P6BB 2KI6C 1LXFC 1S6CA 2OPOA 5K89A 1ALVA 3I5GB 2BE6A 3PM2A 2YGUA 3SG3A 1CM4A 1PSBA 4CFRA 2QEVA 4GFTA 1UHIA 1S5GY 2R2IA 3FWBA 1SR6B 2QEBA 4JWQA 3TS5B 1KQMC 1C7VA 2L2CA 1A4PA 1EJ3A 3B86A 4L9MA 3S0DA 1IRJA 2VRGA 5IBWA 1J7QA 2JNXA 2WCFA 2JZIA 1IJ6A 3DF0B 3I5IC 3AKBA 3Q8IA 3S0AA 4YGDB 2JRFA 2JU0A 4DIRA 2MLFC 1QTXA 3BUOB 3BOWA 4ORCB 1WRKA 1JF2A 1JBAA 5DICA 1DVIA 1CLMA 4FTGA 4PE7A 1KFUS 2KSPA 1KWOB 4PHJA 1CB1A 4JQ0D 2K7BA 4P2YB 1NWDA 1DEKA 2QEHA 4INXA 5B8IB 4I5KA 5HYDA 2CCMA 2LCPA 1LVCD 1J7RA 2DOQA 2K60A 3CYZA 5AXIA 2ZRTA 3ZNIA 1XFZO 3OHMB 1CNPA 1S3PA 1S5GZ 1S36A 3NSIA 1W7JB 1XO5A 2MBXA 1B8LA 1FBVA 3AAJA 3OGNA 1YRTB 4JD9A 4DUQA 1S26D 4GGFC 3K1EA 4OV2A 1PRWA 4M2QA 3VROA 3BUXB 1WRZA 3LK0A 1OZSA 2LVVA 2KQ6A 1CMFA 1IKUA 1J55A 2IS9A 2LUCA 4OKHA 1DC1A 1AP4A 1K8UA 2NCPA 2LUXA 2KI4C 3GK4X 2BBNA 2M0RA 1OSAA 2M3WA 3KHEA 4NDDA 3O4XA 1KSMA 1SPYA 5D7FA 3ICBA 1K94A 2NZ0A 4HRGA 2K2FA 3PFVA 1IQ3A 1F71A 3SG2A 1SCMB 4DRWA 4A4CA 4PCWA 2BL0B 2QEOA 5AERA 2QACA 1XYDA 4PALA 2F33A 2H8VA 1DTLA 2WCMA 2LVKA 3RLZA 1CFFA 1GQMA 3BXKA 3OX5A 2JULA 1NPQA 1IG5A 2LVIA 1Z2CB 4E68A 2COLB 2Y1NA 3FE8A 2AAOA 1UP5A 2K7OA 4YGAA 2KGBC 1C3ZA
chains in the Genus database with same CATH topology
1UHKA 3O78A 4HRHA 1NIWA 1TNPA 4ICBA 2SASA 5ER5A 1FI6A 2WNDA 1JUOA 1CDNA 2FCEA 1H4BA 2KI6D 1JFKA 1K90D 1QLSA 1B4CA 4QJ4B 4I5NB 1A29A 1GGZA 1XFWO 4N5XA 4MEWA 1G8IA 4C0LA 1XK4C 2L51A 3OP0A 1Y0VH 2GGZA 1CLLA 1NP8A 3FS7A 2M1KB 3PALA 3VRRA 2LP3A 4PE0A 4MVFA 1QX7A 3SG7A 2KDHA 2NXQA 2I7AA 1PVAA 2CBLA 3VRQA 1IGVA 4YGCB 3SIBA 1QIVA 5HLVA 3EK7A 1GJYA 1ZOTB 5DKQA 1DJZA 3SG5A 3BYAA 3TS5C 1SR6C 2KFHA 2Q91A 2LAPA 1QV1A 2Y4QA 1KFUL 3CR5X 1XVJA 2LNKA 2JT3A 1UWOA 4MZKA 4F0ZB 1KFXS 3D0YA 2EGDA 2HQWA 4MN0A 3DVJA 3H4SE 2AUCA 1ZMZA 4ZCUA 3IF7A 4MRYA 4AQJA 4PE1A 2F2PA 2MLEC 2L4HA 5KSZA 1CLBA 2LMUA 1SKTA 1RJVA 1S1EA 1KWOC 1DF0A 1MHOA 1TNWA 1DJYA 2CXJA 1OZOA 2F3YA 1S6JA 3DVEA 1BMOA 1KK8B 3DD4A 1K9KA 1MXEA 1OMVA 1OMRA 2HPSA 2K61A 2BE4A 5PALA 4CPVA 1YVLA 1TIZA 1NYAA 1X02A 1TTXA 5KTYA 1XFYO 2ZN8A 5CSNA 5DKNA 4BY5A 2KNEA 2JTTA 1SCVA 1OQPA 2A4JA 4XYNA 1MR8A 3KO0A 2LC5A 1CTRA 1YX8A 2JOJA 1WRLA 3E3RA 1AHRA 2BCAA 2FJUB 3PSRA 4WQ3A 2M9GA 1EXRA 2OS8C 3I5HC 1SRAA 4NQGA 4A4BA 5HKYA 2M49B 2AMIA 5I2OA 1SNLA 2PASA 1PSRA 1SCMC 2V53A 2BL0C 4USLA 4ETOA 1UHHA 3JTDC 1DJXA 2MHHA 3WHTB 4M2OA 2M97A 2EHBA 3PM8A 2KQYA 5F6TA 2H2KA 3K21A 1AK8A 1IJ5A 5HKWA 3EVRA 1PULA 3TDUA 1B9AA 4YI8A 1U5IA 2KGRA 2KFFA 1ZUZA 4GAOA 4PHKA 2LP2A 3D0YB 5CPVA 1M45A 1RK9A 2M7LA 1XA5A 1CFDA 2JXLA 3O2PA 1WDCB 2ZKMX 4R1EA 5JOLA 5I2LA 4XJKA 3RM1A 2OTGB 2EC6B 2WCEA 1BR4B 4ZCVA 4YGEB 1DF0B 1MWNA 2K7CA 1TCOB 1YX7A 3KEVA 1KFXL 4M2PA 3VRPA 3HCMA 1SL7A 2LHIA 1DGVA 1AUIB 2BKHB 3CLNA 4GGFA 2I2RE 1B8CA 2CNPA 4D1EA 2Q4UA 1H8BA 2H61A 4CLNA 1SBJA 1K96A 4AOMA 1DGUA 1TNXA 3C1VA 3IQOA 2LANA 2F2OA 1QIWA 3OB2B 4N1FA 3SJSA 1S6IA 2RGIA 3I5FB 2WOSA 2PALA 2PVBA 1CKKA 1EG3A 1WY9A 2BCBA 3O4YA 4Q04A 2LMTA 1NX2A 3PN7B 1ODBA 1NSHA 2O5GA 1YR5A 1NX1A 1SYMA 1LINA 1N65A 1BG1A 4PDZA 1MF8B 2K2AA 4GGNA 1DT7B 2JQ6A 1TNQA 1YTZC 1B47A 2BKIB 2KBMA 3EVUA 1KK8C 3WHUB 2ZFDA 2ZN9A 3AAKA 4PHMA 5GQQC 3WXAA 1DJGA 2MRDA 3BOWB 2KYCA 2ISDA 3TUYB 3I5IB 1NX3A 1IH0A 4NDBA 1K9PA 1QASA 2FCDA 1CDLA 4YI9A 2PMYA 1A03A 1U5IB 3CR4X 1XK4A 3I5GC 1CFPA 5HLOA 1JC2A 5TNCA 4QJ5B 1UUSA 1K95A 3QRXA 2JTZA 1XFXO 3BQ3A 1L2OB 3JVTB 3MSEB 2ZNEA 1K93D 4XJKB 1MQ1A 5CSIA 5KU1A 1AVSA 1YUSA 1A75A 2JXCA 2BCXA 3GOFA 4QJ3B 1JSAA 2LVJA 1E8AA 1RECA 4YBHB 2MJWB 5CSJA 5AEQA 2Y5IA 3SIAA 1C7WA 1NX0A 1V1FA 2BBMA 1G33A 4DS7A 4HREE 1BU3A 1A2XA 4OR9B 1CM1A 2LM5A 1ALWA 5AFPA 2JPTA 1HT9A 1RROA 4YRUA 1YRUB 3FIAA 1QV0A 2LHLA 1WDCC 2F8PA 3AKAA 2KBIA 3EVVA 1GGWA 2QPTA 1RFJA 2OTGC 2I18A 2EC6C 4GUKA 5BPJA 1V1GA 1CFCA 5G08A 2L0PA 4MRXA 2KFGA 1QLKA 4C0KA 1JWDA 1ZFSA 1BODA 2SCPA 2G2BA 1YURA 3NXAA 1L7ZA 1QX5B 4HSZA 2M7NA 5CSFA 1M63B 3TDIA 1QS7A 1PVBA 4PE4A 1Y1AA 2WC8A 1TN4A 2K7DA 1VRKA 3IQQA 3I5FC 3CR2A 1J1EA 2JT8A 3F45A 2WORA 3PATA 2HQ8A 3LCPC 1SW8A 2JWWA 1WLZA 1LA0A 4TNCA 1SY9A 1M39A 1F54A 3PN7C 3CGAA 2HETA 5I2QA 4YGBB 1Y6WA 2F3ZA 2PSRA 3NSKA 1D1OA 1HQVA 1N0YA 1TRFA 1DJIA 3NSOA 3GK1A 4IL1A 1OE9B 1A75B 3CWGA 1KQVA 4MZLA 3EK8A 1AJ4A 2K0JA 1BR1B 3SG4A 1RTP1 1K9UA 3BUMB 1F70A 1UHNA 2JC2A 2KYFA 1TCFA 1F4QA 3TUYC 5DKRA 1QX2A 1NCYA 3GK2A 1ZACA 1F4OA 1DJHA 1QXPA 1NCXA 2CTNA 1NUBA 3EKHA 4MZJA 2NLNA 3BUWB 1DMOA 4ORBB 1L2OC 3JVTC 4CFQA 2HF5A 1SK6D 4C0JA 2ZNDA 1TOPA 1CMGA 4N1GA 5FYXA 4FQOA 3LLEA 1AJ5A 1R6PA 1R2UA 2KHNA 4WRIA 1PK0D 3DVKA 1WLMA 2JNFA 3BUNB 1JFJA 1IQ5A 2LLUA 5AANA 3PLFB 4PHNA 2E6WA 2H61C 1M31A 1FPWA 4ORAB 1JF0A 2LLTA 3VGOA 1EG4A 1CDPA 1KSOA 2B1UA 3OB1B 3LK1A 2E30A 1N2DA 1YUTA 2GGMA 2OS8B 4GNKB 1G4YR 3I5HB 1PALA 1FF1A 5ER4X 3TDZA 2LE9B 1C07A 1KQMB 1CDMA 3KF9A 1BLQA 4AQIA 3CS1A 2L4IA 2Y1MA 3NSLA 2JT0A 2MA2A 4GBAA 1FI5A 1YVHA 3JTDB 2M29A 1Y1XA 2LV7A 1SMGA 1F55A 3EK4A 3CZTX 3O6BA 3SG6A 3D10A 1UURA 4CIDA 1EL4A 1SL8A 3A8RA 1M46A 4JPZB 4BY4A 1LKJA 4MBEA 1W7IB 1UHJA 5I8NA 1Q80A 3A4UB 1YUUA 1QVIY 1BJFA 2CT9A 1KK7Y 2PRUA 2ZRSA 1KCYA 3KPXA 1B7TY 2GV5A 1LA3A 1QATA 1SL9A 1MXLC 3OX6A 1XFUO 2WCBA 2O60A 2KAYA 5JJGA 1BF5A 1BOCA 1J7PA 3DF0A 4DCKA 4UPGA 1F8HA 2L98A 3TZ1A 4I5JA 3ZWHA 1J1DA 4NDCA 4U8DA 1OMDA 2KOTA 2KI4B 2L50A 1MUXA 4OVNF 1QVIZ 1RWYA 2BECA 1KK7Z 1OOJA 2L5XB 1B7TZ 1BT6A 3HX4A 1EH2A 2KAXA 2KAVA 1DJWA 2G9BA 4MSPA 1QJTA 1J7OA 3DVMA 2K8MB 2LLSA 1NCZA 4GPLB 4P5OE 1Y1UA 2D8NA 2NCOA 2M8UA 5D69A 2MAZA 2I94A 5HKZA 3EKJA 3FWCA 1B8RA 2L2EA 2TN4A 1FW4A 4I5LB 3CTNA 2LMVA 3VRNA 3WNXB 3LL8B 2FOTA 4MLWA 1XFVO 3M0WA 1B1GA 4OCIA 1IWQA 4WQ2A 5J3XA 2M1UA 1K2HA 2P6BB 2KI6C 1LXFC 1S6CA 2OPOA 5K89A 1ALVA 3I5GB 2BE6A 3SG3A 1CM4A 1PSBA 4CFRA 4GFTA 1UHIA 1S5GY 2R2IA 3FWBA 1SR6B 4JWQA 3TS5B 1KQMC 1C7VA 4L9MA 1A4PA 1EJ3A 5IBWA 1IRJA 2VRGA 1J7QA 2JNXA 2WCFA 2JZIA 1IJ6A 3DF0B 3I5IC 3AKBA 4YGDB 2JRFA 2JU0A 4DIRA 2MLFC 1QTXA 3BUOB 3BOWA 4ORCB 1WRKA 1JF2A 1JBAA 1DVIA 1CLMA 4FTGA 4PE7A 1KFUS 2KSPA 1KWOB 4PHJA 1CB1A 4JQ0D 2K7BA 4P2YB 1NWDA 5B8IB 4I5KA 5HYDA 2CCMA 2LCPA 1LVCD 1J7RA 2DOQA 5AXIA 3ZNIA 2ZRTA 1XFZO 3OHMB 1CNPA 1S3PA 1S5GZ 1S36A 3NSIA 1W7JB 1XO5A 2MBXA 1B8LA 1FBVA 3AAJA 1YRTB 4DUQA 1S26D 4GGFC 4OV2A 1PRWA 4M2QA 3VROA 3BUXB 1WRZA 3LK0A 1OZSA 2LVVA 2KQ6A 1CMFA 1IKUA 1J55A 2IS9A 2LUCA 4OKHA 1AP4A 1K8UA 2NCPA 2LUXA 2KI4C 3GK4X 2BBNA 2M0RA 1OSAA 2M3WA 3KHEA 4NDDA 1KSMA 1SPYA 5D7FA 3ICBA 1K94A 2NZ0A 4HRGA 2K2FA 3PFVA 1IQ3A 1F71A 3SG2A 1SCMB 4DRWA 4A4CA 4PCWA 2BL0B 5AERA 2QACA 1XYDA 4PALA 2F33A 1DTLA 2LVKA 3RLZA 1CFFA 1GQMA 3BXKA 3OX5A 2JULA 1NPQA 1IG5A 2LVIA 4E68A 2COLB 2Y1NA 2AAOA 1UP5A 2K7OA 4YGAA 2KGBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHK A;  3O78 A;  4HRH A;  1NIW A;  1TNP A;  4ICB A;  2SAS A;  5ER5 A;  1FI6 A;  2WND A;  1JUO A;  1CDN A;  2FCE A;  1H4B A;  2KI6 D;  1JFK A;  1K90 D;  1QLS A;  1B4C A;  4QJ4 B;  4I5N B;  1A29 A;  1GGZ A;  1XFW O;  4N5X A;  4MEW A;  1G8I A;  4C0L A;  1XK4 C;  2L51 A;  3OP0 A;  1Y0V H;  2GGZ A;  1CLL A;  1NP8 A;  3FS7 A;  2M1K B;  3PAL A;  3VRR A;  2LP3 A;  4PE0 A;  4MVF A;  1QX7 A;  3SG7 A;  2KDH A;  2NXQ A;  2I7A A;  1PVA A;  2CBL A;  3VRQ A;  1IGV A;  4YGC B;  3SIB A;  1QIV A;  5HLV A;  3EK7 A;  1GJY A;  1ZOT B;  5DKQ A;  1DJZ A;  3SG5 A;  3BYA A;  3TS5 C;  1SR6 C;  2KFH A;  2Q91 A;  2LAP A;  1QV1 A;  2Y4Q A;  1KFU L;  3CR5 X;  1XVJ A;  2LNK A;  2JT3 A;  1UWO A;  4MZK A;  4F0Z B;  1KFX S;  3D0Y A;  2EGD A;  2HQW A;  4MN0 A;  3DVJ A;  3H4S E;  2AUC A;  1ZMZ A;  4ZCU A;  3IF7 A;  4MRY A;  4AQJ A;  4PE1 A;  2F2P A;  2MLE C;  2L4H A;  5KSZ A;  1CLB A;  2LMU A;  1SKT A;  1RJV A;  1S1E A;  1KWO C;  1DF0 A;  1MHO A;  1TNW A;  1DJY A;  2CXJ A;  1OZO A;  2F3Y A;  1S6J A;  3DVE A;  1BMO A;  1KK8 B;  3DD4 A;  1K9K A;  1MXE A;  1OMV A;  1OMR A;  2HPS A;  2K61 A;  2BE4 A;  5PAL A;  4CPV A;  1YVL A;  1TIZ A;  1NYA A;  1X02 A;  1TTX A;  5KTY A;  1XFY O;  2ZN8 A;  5CSN A;  5DKN A;  4BY5 A;  2KNE A;  2JTT A;  1SCV A;  1OQP A;  2A4J A;  4XYN A;  1MR8 A;  3KO0 A;  2LC5 A;  1CTR A;  1YX8 A;  2JOJ A;  1WRL A;  3E3R A;  1AHR A;  2BCA A;  2FJU B;  3PSR A;  4WQ3 A;  2M9G A;  1EXR A;  2OS8 C;  3I5H C;  1SRA A;  4NQG A;  4A4B A;  5HKY A;  2M49 B;  2AMI A;  5I2O A;  1SNL A;  2PAS A;  1PSR A;  1SCM C;  2V53 A;  2BL0 C;  4USL A;  4ETO A;  1UHH A;  3JTD C;  1DJX A;  2MHH A;  3WHT B;  4M2O A;  2M97 A;  2EHB A;  3PM8 A;  2KQY A;  5F6T A;  2H2K A;  3K21 A;  1AK8 A;  1IJ5 A;  5HKW A;  3EVR A;  1PUL A;  3TDU A;  1B9A A;  4YI8 A;  1U5I A;  2KGR A;  2KFF A;  1ZUZ A;  4GAO A;  4PHK A;  2LP2 A;  3D0Y B;  5CPV A;  1M45 A;  1RK9 A;  2M7L A;  1XA5 A;  1CFD A;  2JXL A;  3O2P A;  1WDC B;  2ZKM X;  4R1E A;  5JOL A;  5I2L A;  4XJK A;  3RM1 A;  2OTG B;  2EC6 B;  2WCE A;  1BR4 B;  4ZCV A;  4YGE B;  1DF0 B;  1MWN A;  2K7C A;  1TCO B;  1YX7 A;  3KEV A;  1KFX L;  4M2P A;  3VRP A;  3HCM A;  1SL7 A;  2LHI A;  1DGV A;  1AUI B;  2BKH B;  3CLN A;  4GGF A;  2I2R E;  1B8C A;  2CNP A;  4D1E A;  2Q4U A;  1H8B A;  2H61 A;  4CLN A;  1SBJ A;  1K96 A;  4AOM A;  1DGU A;  1TNX A;  3C1V A;  3IQO A;  2LAN A;  2F2O A;  1QIW A;  3OB2 B;  4N1F A;  3SJS A;  1S6I A;  2RGI A;  3I5F B;  2WOS A;  2PAL A;  2PVB A;  1CKK A;  1EG3 A;  1WY9 A;  2BCB A;  3O4Y A;  4Q04 A;  2LMT A;  1NX2 A;  3PN7 B;  1ODB A;  1NSH A;  2O5G A;  1YR5 A;  1NX1 A;  1SYM A;  1LIN A;  1N65 A;  1BG1 A;  4PDZ A;  1MF8 B;  2K2A A;  4GGN A;  1DT7 B;  2JQ6 A;  1TNQ A;  1YTZ C;  1B47 A;  2BKI B;  2KBM A;  3EVU A;  1KK8 C;  3WHU B;  2ZFD A;  2ZN9 A;  3AAK A;  4PHM A;  5GQQ C;  3WXA A;  1DJG A;  2MRD A;  3BOW B;  2KYC A;  2ISD A;  3TUY B;  3I5I B;  1NX3 A;  1IH0 A;  4NDB A;  1K9P A;  1QAS A;  2FCD A;  1CDL A;  4YI9 A;  2PMY A;  1A03 A;  1U5I B;  3CR4 X;  1XK4 A;  3I5G C;  1CFP A;  5HLO A;  1JC2 A;  5TNC A;  4QJ5 B;  1UUS A;  1K95 A;  3QRX A;  2JTZ A;  1XFX O;  3BQ3 A;  1L2O B;  3JVT B;  3MSE B;  2ZNE A;  1K93 D;  4XJK B;  1MQ1 A;  5CSI A;  5KU1 A;  1AVS A;  1YUS A;  1A75 A;  2JXC A;  2BCX A;  3GOF A;  4QJ3 B;  1JSA A;  2LVJ A;  1E8A A;  1REC A;  4YBH B;  2MJW B;  5CSJ A;  5AEQ A;  2Y5I A;  3SIA A;  1C7W A;  1NX0 A;  1V1F A;  2BBM A;  1G33 A;  4DS7 A;  4HRE E;  1BU3 A;  1A2X A;  4OR9 B;  1CM1 A;  2LM5 A;  1ALW A;  5AFP A;  2JPT A;  1HT9 A;  1RRO A;  4YRU A;  1YRU B;  3FIA A;  1QV0 A;  2LHL A;  1WDC C;  2F8P A;  3AKA A;  2KBI A;  3EVV A;  1GGW A;  2QPT A;  1RFJ A;  2OTG C;  2I18 A;  2EC6 C;  4GUK A;  5BPJ A;  1V1G A;  1CFC A;  5G08 A;  2L0P A;  4MRX A;  2KFG A;  1QLK A;  4C0K A;  1JWD A;  1ZFS A;  1BOD A;  2SCP A;  2G2B A;  1YUR A;  3NXA A;  1L7Z A;  1QX5 B;  4HSZ A;  2M7N A;  5CSF A;  1M63 B;  3TDI A;  1QS7 A;  1PVB A;  4PE4 A;  1Y1A A;  2WC8 A;  1TN4 A;  2K7D A;  1VRK A;  3IQQ A;  3I5F C;  3CR2 A;  1J1E A;  2JT8 A;  3F45 A;  2WOR A;  3PAT A;  2HQ8 A;  3LCP C;  1SW8 A;  2JWW A;  1WLZ A;  1LA0 A;  4TNC A;  1SY9 A;  1M39 A;  1F54 A;  3PN7 C;  3CGA A;  2HET A;  5I2Q A;  4YGB B;  1Y6W A;  2F3Z A;  2PSR A;  3NSK A;  1D1O A;  1HQV A;  1N0Y A;  1TRF A;  1DJI A;  3NSO A;  3GK1 A;  4IL1 A;  1OE9 B;  1A75 B;  3CWG A;  1KQV A;  4MZL A;  3EK8 A;  1AJ4 A;  2K0J A;  1BR1 B;  3SG4 A;  1RTP 1;  1K9U A;  3BUM B;  1F70 A;  1UHN A;  2JC2 A;  2KYF A;  1TCF A;  1F4Q A;  3TUY C;  5DKR A;  1QX2 A;  1NCY A;  3GK2 A;  1ZAC A;  1F4O A;  1DJH A;  1QXP A;  1NCX A;  2CTN A;  1NUB A;  3EKH A;  4MZJ A;  2NLN A;  3BUW B;  1DMO A;  4ORB B;  1L2O C;  3JVT C;  4CFQ A;  2HF5 A;  1SK6 D;  4C0J A;  2ZND A;  1TOP A;  1CMG A;  4N1G A;  5FYX A;  4FQO A;  3LLE A;  1AJ5 A;  1R6P A;  1R2U A;  2KHN A;  4WRI A;  1PK0 D;  3DVK A;  1WLM A;  2JNF A;  3BUN B;  1JFJ A;  1IQ5 A;  2LLU A;  5AAN A;  3PLF B;  4PHN A;  2E6W A;  2H61 C;  1M31 A;  1FPW A;  4ORA B;  1JF0 A;  2LLT A;  3VGO A;  1EG4 A;  1CDP A;  1KSO A;  2B1U A;  3OB1 B;  3LK1 A;  2E30 A;  1N2D A;  1YUT A;  2GGM A;  2OS8 B;  4GNK B;  1G4Y R;  3I5H B;  1PAL A;  1FF1 A;  5ER4 X;  3TDZ A;  2LE9 B;  1C07 A;  1KQM B;  1CDM A;  3KF9 A;  1BLQ A;  4AQI A;  3CS1 A;  2L4I A;  2Y1M A;  3NSL A;  2JT0 A;  2MA2 A;  4GBA A;  1FI5 A;  1YVH A;  3JTD B;  2M29 A;  1Y1X A;  2LV7 A;  1SMG A;  1F55 A;  3EK4 A;  3CZT X;  3O6B A;  3SG6 A;  3D10 A;  1UUR A;  4CID A;  1EL4 A;  1SL8 A;  3A8R A;  1M46 A;  4JPZ B;  4BY4 A;  1LKJ A;  4MBE A;  1W7I B;  1UHJ A;  5I8N A;  1Q80 A;  3A4U B;  1YUU A;  1QVI Y;  1BJF A;  2CT9 A;  1KK7 Y;  2PRU A;  2ZRS A;  1KCY A;  3KPX A;  1B7T Y;  2GV5 A;  1LA3 A;  1QAT A;  1SL9 A;  1MXL C;  3OX6 A;  1XFU O;  2WCB A;  2O60 A;  2KAY A;  5JJG A;  1BF5 A;  1BOC A;  1J7P A;  3DF0 A;  4DCK A;  4UPG A;  1F8H A;  2L98 A;  3TZ1 A;  4I5J A;  3ZWH A;  1J1D A;  4NDC A;  4U8D A;  1OMD A;  2KOT A;  2KI4 B;  2L50 A;  1MUX A;  4OVN F;  1QVI Z;  1RWY A;  2BEC A;  1KK7 Z;  1OOJ A;  2L5X B;  1B7T Z;  1BT6 A;  3HX4 A;  1EH2 A;  2KAX A;  2KAV A;  1DJW A;  2G9B A;  4MSP A;  1QJT A;  1J7O A;  3DVM A;  2K8M B;  2LLS A;  1NCZ A;  4GPL B;  4P5O E;  1Y1U A;  2D8N A;  2NCO A;  2M8U A;  5D69 A;  2MAZ A;  2I94 A;  5HKZ A;  3EKJ A;  3FWC A;  1B8R A;  2L2E A;  2TN4 A;  1FW4 A;  4I5L B;  3CTN A;  2LMV A;  3VRN A;  3WNX B;  3LL8 B;  2FOT A;  4MLW A;  1XFV O;  3M0W A;  1B1G A;  4OCI A;  1IWQ A;  4WQ2 A;  5J3X A;  2M1U A;  1K2H A;  2P6B B;  2KI6 C;  1LXF C;  1S6C A;  2OPO A;  5K89 A;  1ALV A;  3I5G B;  2BE6 A;  3SG3 A;  1CM4 A;  1PSB A;  4CFR A;  4GFT A;  1UHI A;  1S5G Y;  2R2I A;  3FWB A;  1SR6 B;  4JWQ A;  3TS5 B;  1KQM C;  1C7V A;  4L9M A;  1A4P A;  1EJ3 A;  5IBW A;  1IRJ A;  2VRG A;  1J7Q A;  2JNX A;  2WCF A;  2JZI A;  1IJ6 A;  3DF0 B;  3I5I C;  3AKB A;  4YGD B;  2JRF A;  2JU0 A;  4DIR A;  2MLF C;  1QTX A;  3BUO B;  3BOW A;  4ORC B;  1WRK A;  1JF2 A;  1JBA A;  1DVI A;  1CLM A;  4FTG A;  4PE7 A;  1KFU S;  2KSP A;  1KWO B;  4PHJ A;  1CB1 A;  4JQ0 D;  2K7B A;  4P2Y B;  1NWD A;  5B8I B;  4I5K A;  5HYD A;  2CCM A;  2LCP A;  1LVC D;  1J7R A;  2DOQ A;  5AXI A;  3ZNI A;  2ZRT A;  1XFZ O;  3OHM B;  1CNP A;  1S3P A;  1S5G Z;  1S36 A;  3NSI A;  1W7J B;  1XO5 A;  2MBX A;  1B8L A;  1FBV A;  3AAJ A;  1YRT B;  4DUQ A;  1S26 D;  4GGF C;  4OV2 A;  1PRW A;  4M2Q A;  3VRO A;  3BUX B;  1WRZ A;  3LK0 A;  1OZS A;  2LVV A;  2KQ6 A;  1CMF A;  1IKU A;  1J55 A;  2IS9 A;  2LUC A;  4OKH A;  1AP4 A;  1K8U A;  2NCP A;  2LUX A;  2KI4 C;  3GK4 X;  2BBN A;  2M0R A;  1OSA A;  2M3W A;  3KHE A;  4NDD A;  1KSM A;  1SPY A;  5D7F A;  3ICB A;  1K94 A;  2NZ0 A;  4HRG A;  2K2F A;  3PFV A;  1IQ3 A;  1F71 A;  3SG2 A;  1SCM B;  4DRW A;  4A4C A;  4PCW A;  2BL0 B;  5AER A;  2QAC A;  1XYD A;  4PAL A;  2F33 A;  1DTL A;  2LVK A;  3RLZ A;  1CFF A;  1GQM A;  3BXK A;  3OX5 A;  2JUL A;  1NPQ A;  1IG5 A;  2LVI A;  4E68 A;  2COL B;  2Y1N A;  2AAO A;  1UP5 A;  2K7O A;  4YGA A;  2KGB C; 
#chains in the Genus database with same CATH topology
 1UHK A;  3O78 A;  4HRH A;  1NIW A;  1TNP A;  4ICB A;  2SAS A;  5ER5 A;  1FI6 A;  2WND A;  1JUO A;  1CDN A;  2FCE A;  1H4B A;  2KI6 D;  3S0F A;  1JFK A;  1K90 D;  1QLS A;  1B4C A;  4QJ4 B;  4I5N B;  1A29 A;  1GGZ A;  1XFW O;  2KLE A;  3L4A A;  4MEW A;  4N5X A;  3SS3 A;  1G8I A;  4C0L A;  1XK4 C;  2L51 A;  3OP0 A;  1Y0V H;  3CZ0 A;  2GGZ A;  1CLL A;  1NP8 A;  3FS7 A;  2M1K B;  3PAL A;  3VRR A;  2LP3 A;  4PE0 A;  4MVF A;  1QX7 A;  3SG7 A;  2KDH A;  2NXQ A;  2WC6 A;  2I7A A;  5FI7 A;  1PVA A;  2CBL A;  3VRQ A;  1IGV A;  4YGC B;  3SIB A;  1QIV A;  5HLV A;  3EK7 A;  1GJY A;  1ZOT B;  5DKQ A;  1DJZ A;  3SG5 A;  5I94 A;  3BYA A;  3TS5 C;  1SR6 C;  2KFH A;  2Q91 A;  2LAP A;  1QV1 A;  2Y4Q A;  1KFU L;  1TWO A;  1XVJ A;  2LNK A;  2JT3 A;  3CR5 X;  1UWO A;  4MZK A;  4F0Z B;  1KFX S;  3D0Y A;  2EGD A;  3D77 A;  2HQW A;  4MN0 A;  3D76 A;  3DVJ A;  3H4S E;  2AUC A;  1ZMZ A;  4ZCU A;  3IF7 A;  4MRY A;  4AQJ A;  4PE1 A;  2F2P A;  2MLE C;  1DQE A;  2L4H A;  5KSZ A;  1CLB A;  2LMU A;  1SKT A;  1RJV A;  1S1E A;  1KWO C;  1DF0 A;  2BNX A;  3SS4 A;  1MHO A;  1TNW A;  1DJY A;  2CXJ A;  1OZO A;  2F3Y A;  1S6J A;  3DVE A;  1BMO A;  1KK8 B;  3DD4 A;  1K9K A;  1MXE A;  1OMV A;  1OMR A;  1T14 A;  2HPS A;  2K61 A;  2BE4 A;  5PAL A;  4CPV A;  1YVL A;  1TIZ A;  1NYA A;  2KLD A;  1X02 A;  1TTX A;  5KTY A;  1XFY O;  2ZN8 A;  5CSN A;  5DKN A;  4BY5 A;  2KNE A;  2JTT A;  1ORG A;  2JPO A;  1SCV A;  1OQP A;  2A4J A;  4XYN A;  1MR8 A;  3KO0 A;  2LC5 A;  1C3Y A;  1CTR A;  1YX8 A;  2JOJ A;  1WRL A;  3E3R A;  1AHR A;  2BCA A;  2FJU B;  3PSR A;  4WQ3 A;  4F7F A;  2M9G A;  1EXR A;  2OS8 C;  3I5H C;  2BAP A;  1SRA A;  4NQG A;  4A4B A;  5HKY A;  2M49 B;  2AMI A;  5I2O A;  1SNL A;  2PAS A;  1PSR A;  1SCM C;  2V53 A;  2BL0 C;  2PYQ A;  4USL A;  4ETO A;  1UHH A;  3JTD C;  1DJX A;  2ERB A;  3L4L A;  2MHH A;  3WHT B;  3N7H A;  4M2O A;  2M97 A;  2EHB A;  3PM8 A;  2KQY A;  5F6T A;  2H2K A;  3D74 A;  3K21 A;  1AK8 A;  1IJ5 A;  5HKW A;  3VB1 A;  3EVR A;  1PUL A;  3TDU A;  1B9A A;  4YI8 A;  1U5I A;  2KGR A;  2KFF A;  1ZUZ A;  4GAO A;  4PHK A;  2LP2 A;  3D0Y B;  5CPV A;  1M45 A;  1RK9 A;  2M7L A;  3V2L A;  3IVT A;  3S0E A;  1XA5 A;  3DXL A;  1CFD A;  2JXL A;  3O2P A;  1WDC B;  2ZKM X;  4R1E A;  5JOL A;  3NHT A;  3D75 A;  5I2L A;  4XJK A;  1Z4H A;  2OTG B;  3RM1 A;  2EC6 B;  2WCE A;  3R1P A;  1BR4 B;  4ZCV A;  4YGE B;  4JKT A;  1DF0 B;  1XFR A;  1MWN A;  2K7C A;  1SSE B;  1YX7 A;  1TCO B;  1KFX L;  3KEV A;  4M2P A;  3HCM A;  1SL7 A;  3VRP A;  2LHI A;  1DGV A;  1AUI B;  2BKH B;  3CLN A;  4GGF A;  2I2R E;  1B8C A;  2CNP A;  5FI6 A;  4D1E A;  2Q4U A;  3PJI A;  1H8B A;  2H61 A;  4CLN A;  1SBJ A;  1K96 A;  3BJH A;  4AOM A;  1DGU A;  1TNX A;  3B87 A;  3R72 A;  3C1V A;  3IQO A;  2LAN A;  2F2O A;  1QIW A;  3OB2 B;  4N1F A;  4KYN A;  3SJS A;  1S6I A;  2RGI A;  3I5F B;  2WOS A;  2PAL A;  2PVB A;  1TUZ A;  1EG3 A;  1WY9 A;  2BCB A;  1CKK A;  3D73 A;  3O4Y A;  4Q04 A;  3SS5 A;  2LMT A;  4PT1 A;  1NX2 A;  3PN7 B;  1ODB A;  3B88 A;  3UNW A;  1NSH A;  2O5G A;  1YR5 A;  1NX1 A;  1SYM A;  2FJY A;  1LIN A;  1N65 A;  1BG1 A;  4PDZ A;  1MF8 B;  2K2A A;  3S0B A;  4GGN A;  1DT7 B;  2JQ6 A;  1TNQ A;  1YTZ C;  1B47 A;  2BKI B;  3DYE A;  2KBM A;  2WCH A;  3EVU A;  1KK8 C;  4OZD A;  3NGV A;  3WHU B;  2ZFD A;  2ZN9 A;  3AAK A;  4PHM A;  5GQQ C;  1OW4 A;  3WXA A;  1DJG A;  2MRD A;  3BOW B;  2KYC A;  2ISD A;  3TUY B;  3I5I B;  1NX3 A;  1IH0 A;  4NDB A;  1K9P A;  1QAS A;  2FCD A;  1CDL A;  4YI9 A;  2PMY A;  3L47 A;  1A03 A;  1U5I B;  3CR4 X;  3NHI A;  1XK4 A;  3I5G C;  1CFP A;  5HLO A;  1JC2 A;  5TNC A;  1W9Z A;  4QJ5 B;  1UUS A;  1K95 A;  3QRX A;  2JTZ A;  1XFX O;  2P70 A;  3BQ3 A;  1L2O B;  3JVT B;  3MSE B;  2ZNE A;  1K93 D;  4XJK B;  3DZT A;  1MQ1 A;  5CSI A;  5KU1 A;  2WCJ A;  1AVS A;  1YUS A;  3BFH A;  1A75 A;  2QDI A;  3RZS A;  2JXC A;  2BCX A;  3GOF A;  4QJ3 B;  1JSA A;  2LVJ A;  1E8A A;  1REC A;  4YBH B;  2MJW B;  5CSJ A;  5AEQ A;  2Y5I A;  3SIA A;  1C7W A;  1NX0 A;  1V1F A;  2BBM A;  1G33 A;  3DY9 A;  4DS7 A;  4HRE E;  5HL1 A;  1BU3 A;  1A2X A;  4OR9 B;  1CM1 A;  2LM5 A;  1ALW A;  5AFP A;  2JPT A;  1HT9 A;  1RRO A;  4YRU A;  1YRU B;  3FIA A;  1QV0 A;  2LHL A;  1WDC C;  2F8P A;  3AKA A;  2KBI A;  3S0G A;  3EVV A;  1GGW A;  2QPT A;  1RFJ A;  2OTG C;  2I18 A;  2EC6 C;  4GUK A;  5BPJ A;  3UO9 A;  1V1G A;  1CFC A;  5G08 A;  2L0P A;  3FE6 A;  4MRX A;  1OOF A;  2KFG A;  1QLK A;  4C0K A;  1JWD A;  1ZFS A;  1BOD A;  2SCP A;  2G2B A;  1YUR A;  3CZ2 A;  3NXA A;  1L7Z A;  1QX5 B;  4HSZ A;  2M7N A;  3R1V A;  5CSF A;  1M63 B;  3TDI A;  1QS7 A;  1PVB A;  4PE4 A;  1Y1A A;  2WC8 A;  1TN4 A;  2K7D A;  1VRK A;  3IQQ A;  3I5F C;  3CR2 A;  1J1E A;  2JT8 A;  3F45 A;  2WOR A;  3PAT A;  2HQ8 A;  3LCP C;  2WCK A;  1SW8 A;  2JWW A;  3B6X A;  1WLZ A;  1LA0 A;  4TNC A;  1SY9 A;  1M39 A;  1F54 A;  1OOH A;  3PN7 C;  3CGA A;  2HET A;  2WC5 A;  4YGB B;  1Y6W A;  2F3Z A;  2PSR A;  3NSK A;  5I2Q A;  1D1O A;  1HQV A;  1N0Y A;  1TRF A;  1IIO A;  1DJI A;  3NSO A;  3GK1 A;  4FQT A;  4IL1 A;  1OE9 B;  1A75 B;  2WCL A;  3CWG A;  1KQV A;  4MZL A;  3EK8 A;  1AJ4 A;  2K0J A;  1BR1 B;  3SG4 A;  1RTP 1;  3BFA A;  1K9U A;  3BUM B;  1F70 A;  1UHN A;  2JC2 A;  2KYF A;  3EG5 B;  1TCF A;  1F4Q A;  3TUY C;  5DKR A;  1QX2 A;  1NCY A;  3GK2 A;  1ZAC A;  1F4O A;  1DJH A;  1QXP A;  3CAB A;  1NCX A;  2CTN A;  1NUB A;  3EKH A;  4MZJ A;  2NLN A;  2L5Y A;  3BUW B;  4ORB B;  1DMO A;  1LS8 A;  1L2O C;  3JVT C;  4CFQ A;  2HF5 A;  1SK6 D;  4C0J A;  2ZND A;  1TOP A;  1CMG A;  4N1G A;  5FYX A;  4FQO A;  3LLE A;  1DEL A;  3QME A;  1AJ5 A;  1R6P A;  1R2U A;  2KHN A;  4WRI A;  2KPH A;  2P71 A;  1PK0 D;  3DVK A;  1WLM A;  2JNF A;  3BUN B;  1JFJ A;  1IQ5 A;  2LLU A;  5AAN A;  3CDN A;  3PLF B;  4PHN A;  2E6W A;  2H61 C;  1M31 A;  1FPW A;  4ORA B;  1JF0 A;  2LLT A;  3VGO A;  1EG4 A;  1CDP A;  1KSO A;  2B1U A;  2GTE A;  3D78 A;  3LK1 A;  3OB1 B;  2E30 A;  1N2D A;  1YUT A;  2GGM A;  2OS8 B;  4GNK B;  1G4Y R;  3I5H B;  2PQL A;  1PAL A;  1FF1 A;  5ER4 X;  3TDZ A;  2LE9 B;  3FE9 A;  1KQM B;  1CDM A;  1C07 A;  3KF9 A;  1BLQ A;  4AQI A;  3CS1 A;  2L4I A;  2Y1M A;  3NSL A;  1GM0 A;  2JT0 A;  2MA2 A;  4GBA A;  1FI5 A;  1YVH A;  3JTD B;  2M29 A;  1Y1X A;  2LV7 A;  1SMG A;  3CZ1 A;  3EK4 A;  3CZT X;  1F55 A;  3BFB A;  3O6B A;  1OOI X;  3SG6 A;  3D10 A;  1UUR A;  4CID A;  1EL4 A;  1SL8 A;  3A8R A;  1M46 A;  4JPZ B;  4BY4 A;  1LKJ A;  4MBE A;  1W7I B;  1UHJ A;  5I8N A;  1Q80 A;  3A4U B;  1YUU A;  1QVI Y;  1TUJ A;  1BJF A;  2CT9 A;  1KK7 Y;  2PRU A;  2ZRS A;  1KCY A;  3KPX A;  1B7T Y;  2GV5 A;  1LA3 A;  1QAT A;  1SL9 A;  1MXL C;  5EL2 A;  3OX6 A;  1XFU O;  2WCB A;  2O60 A;  3R1O A;  5FI2 A;  2KAY A;  5JJG A;  1BF5 A;  1BOC A;  1J7P A;  3DF0 A;  4DCK A;  4UPG A;  1F8H A;  2L98 A;  3TZ1 A;  4I5J A;  3ZWH A;  1J1D A;  4NDC A;  4U8D A;  1OMD A;  2KOT A;  1QWV A;  2KI4 B;  2L50 A;  1P28 A;  1MUX A;  4OVN F;  5D3O A;  1QVI Z;  1RWY A;  2BEC A;  1KK7 Z;  1OOG A;  1OOJ A;  2L5X B;  1B7T Z;  1BT6 A;  3HX4 A;  1EH2 A;  2KAX A;  2KAV A;  1DJW A;  2G9B A;  4INW A;  4MSP A;  1QJT A;  1J7O A;  3DVM A;  2K8M B;  2LLS A;  1NCZ A;  4GPL B;  4P5O E;  1Y1U A;  2D8N A;  2NCO A;  3OBV A;  2M8U A;  5D69 A;  2MAZ A;  2I94 A;  4IJ7 A;  5HKZ A;  3EKJ A;  3FWC A;  1B8R A;  2L2E A;  2TN4 A;  1FW4 A;  4I5L B;  3CTN A;  2LMV A;  3VRN A;  3WNX B;  3LL8 B;  2FOT A;  3B7A A;  4MLW A;  1XFV O;  3M0W A;  1B1G A;  4OCI A;  1IWQ A;  4WQ2 A;  5J3X A;  2M1U A;  1K2H A;  2P6B B;  2KI6 C;  1LXF C;  1S6C A;  2OPO A;  5K89 A;  1ALV A;  3I5G B;  2BE6 A;  3PM2 A;  2YGU A;  3SG3 A;  1CM4 A;  1PSB A;  4CFR A;  2QEV A;  4GFT A;  1UHI A;  1S5G Y;  2R2I A;  3FWB A;  1SR6 B;  2QEB A;  4JWQ A;  3TS5 B;  1KQM C;  1C7V A;  2L2C A;  1A4P A;  1EJ3 A;  3B86 A;  4L9M A;  3S0D A;  1IRJ A;  2VRG A;  5IBW A;  1J7Q A;  2JNX A;  2WCF A;  2JZI A;  1IJ6 A;  3DF0 B;  3I5I C;  3AKB A;  3Q8I A;  3S0A A;  4YGD B;  2JRF A;  2JU0 A;  4DIR A;  2MLF C;  1QTX A;  3BUO B;  3BOW A;  4ORC B;  1WRK A;  1JF2 A;  1JBA A;  5DIC A;  1DVI A;  1CLM A;  4FTG A;  4PE7 A;  1KFU S;  2KSP A;  1KWO B;  4PHJ A;  1CB1 A;  4JQ0 D;  2K7B A;  4P2Y B;  1NWD A;  1DEK A;  2QEH A;  4INX A;  5B8I B;  4I5K A;  5HYD A;  2CCM A;  2LCP A;  1LVC D;  1J7R A;  2DOQ A;  2K60 A;  3CYZ A;  5AXI A;  2ZRT A;  3ZNI A;  1XFZ O;  3OHM B;  1CNP A;  1S3P A;  1S5G Z;  1S36 A;  3NSI A;  1W7J B;  1XO5 A;  2MBX A;  1B8L A;  1FBV A;  3AAJ A;  3OGN A;  1YRT B;  4JD9 A;  4DUQ A;  1S26 D;  4GGF C;  3K1E A;  4OV2 A;  1PRW A;  4M2Q A;  3VRO A;  3BUX B;  1WRZ A;  3LK0 A;  1OZS A;  2LVV A;  2KQ6 A;  1CMF A;  1IKU A;  1J55 A;  2IS9 A;  2LUC A;  4OKH A;  1DC1 A;  1AP4 A;  1K8U A;  2NCP A;  2LUX A;  2KI4 C;  3GK4 X;  2BBN A;  2M0R A;  1OSA A;  2M3W A;  3KHE A;  4NDD A;  3O4X A;  1KSM A;  1SPY A;  5D7F A;  3ICB A;  1K94 A;  2NZ0 A;  4HRG A;  2K2F A;  3PFV A;  1IQ3 A;  1F71 A;  3SG2 A;  1SCM B;  4DRW A;  4A4C A;  4PCW A;  2BL0 B;  2QEO A;  5AER A;  2QAC A;  1XYD A;  4PAL A;  2F33 A;  2H8V A;  1DTL A;  2WCM A;  2LVK A;  3RLZ A;  1CFF A;  1GQM A;  3BXK A;  3OX5 A;  2JUL A;  1NPQ A;  1IG5 A;  2LVI A;  1Z2C B;  4E68 A;  2COL B;  2Y1N A;  3FE8 A;  2AAO A;  1UP5 A;  2K7O A;  4YGA A;  2KGB C;  1C3Z A; 
#chains in the Genus database with same CATH homology
 1UHK A;  3O78 A;  4HRH A;  1NIW A;  1TNP A;  4ICB A;  2SAS A;  5ER5 A;  1FI6 A;  2WND A;  1JUO A;  1CDN A;  2FCE A;  1H4B A;  2KI6 D;  1JFK A;  1K90 D;  1QLS A;  1B4C A;  4QJ4 B;  4I5N B;  1A29 A;  1GGZ A;  1XFW O;  4N5X A;  4MEW A;  1G8I A;  4C0L A;  1XK4 C;  2L51 A;  3OP0 A;  1Y0V H;  2GGZ A;  1CLL A;  1NP8 A;  3FS7 A;  2M1K B;  3PAL A;  3VRR A;  2LP3 A;  4PE0 A;  4MVF A;  1QX7 A;  3SG7 A;  2KDH A;  2NXQ A;  2I7A A;  1PVA A;  2CBL A;  3VRQ A;  1IGV A;  4YGC B;  3SIB A;  1QIV A;  5HLV A;  3EK7 A;  1GJY A;  1ZOT B;  5DKQ A;  1DJZ A;  3SG5 A;  3BYA A;  3TS5 C;  1SR6 C;  2KFH A;  2Q91 A;  2LAP A;  1QV1 A;  2Y4Q A;  1KFU L;  3CR5 X;  1XVJ A;  2LNK A;  2JT3 A;  1UWO A;  4MZK A;  4F0Z B;  1KFX S;  3D0Y A;  2EGD A;  2HQW A;  4MN0 A;  3DVJ A;  3H4S E;  2AUC A;  1ZMZ A;  4ZCU A;  3IF7 A;  4MRY A;  4AQJ A;  4PE1 A;  2F2P A;  2MLE C;  2L4H A;  5KSZ A;  1CLB A;  2LMU A;  1SKT A;  1RJV A;  1S1E A;  1KWO C;  1DF0 A;  1MHO A;  1TNW A;  1DJY A;  2CXJ A;  1OZO A;  2F3Y A;  1S6J A;  3DVE A;  1BMO A;  1KK8 B;  3DD4 A;  1K9K A;  1MXE A;  1OMV A;  1OMR A;  2HPS A;  2K61 A;  2BE4 A;  5PAL A;  4CPV A;  1YVL A;  1TIZ A;  1NYA A;  1X02 A;  1TTX A;  5KTY A;  1XFY O;  2ZN8 A;  5CSN A;  5DKN A;  4BY5 A;  2KNE A;  2JTT A;  1SCV A;  1OQP A;  2A4J A;  4XYN A;  1MR8 A;  3KO0 A;  2LC5 A;  1CTR A;  1YX8 A;  2JOJ A;  1WRL A;  3E3R A;  1AHR A;  2BCA A;  2FJU B;  3PSR A;  4WQ3 A;  2M9G A;  1EXR A;  2OS8 C;  3I5H C;  1SRA A;  4NQG A;  4A4B A;  5HKY A;  2M49 B;  2AMI A;  5I2O A;  1SNL A;  2PAS A;  1PSR A;  1SCM C;  2V53 A;  2BL0 C;  4USL A;  4ETO A;  1UHH A;  3JTD C;  1DJX A;  2MHH A;  3WHT B;  4M2O A;  2M97 A;  2EHB A;  3PM8 A;  2KQY A;  5F6T A;  2H2K A;  3K21 A;  1AK8 A;  1IJ5 A;  5HKW A;  3EVR A;  1PUL A;  3TDU A;  1B9A A;  4YI8 A;  1U5I A;  2KGR A;  2KFF A;  1ZUZ A;  4GAO A;  4PHK A;  2LP2 A;  3D0Y B;  5CPV A;  1M45 A;  1RK9 A;  2M7L A;  1XA5 A;  1CFD A;  2JXL A;  3O2P A;  1WDC B;  2ZKM X;  4R1E A;  5JOL A;  5I2L A;  4XJK A;  3RM1 A;  2OTG B;  2EC6 B;  2WCE A;  1BR4 B;  4ZCV A;  4YGE B;  1DF0 B;  1MWN A;  2K7C A;  1TCO B;  1YX7 A;  3KEV A;  1KFX L;  4M2P A;  3VRP A;  3HCM A;  1SL7 A;  2LHI A;  1DGV A;  1AUI B;  2BKH B;  3CLN A;  4GGF A;  2I2R E;  1B8C A;  2CNP A;  4D1E A;  2Q4U A;  1H8B A;  2H61 A;  4CLN A;  1SBJ A;  1K96 A;  4AOM A;  1DGU A;  1TNX A;  3C1V A;  3IQO A;  2LAN A;  2F2O A;  1QIW A;  3OB2 B;  4N1F A;  3SJS A;  1S6I A;  2RGI A;  3I5F B;  2WOS A;  2PAL A;  2PVB A;  1CKK A;  1EG3 A;  1WY9 A;  2BCB A;  3O4Y A;  4Q04 A;  2LMT A;  1NX2 A;  3PN7 B;  1ODB A;  1NSH A;  2O5G A;  1YR5 A;  1NX1 A;  1SYM A;  1LIN A;  1N65 A;  1BG1 A;  4PDZ A;  1MF8 B;  2K2A A;  4GGN A;  1DT7 B;  2JQ6 A;  1TNQ A;  1YTZ C;  1B47 A;  2BKI B;  2KBM A;  3EVU A;  1KK8 C;  3WHU B;  2ZFD A;  2ZN9 A;  3AAK A;  4PHM A;  5GQQ C;  3WXA A;  1DJG A;  2MRD A;  3BOW B;  2KYC A;  2ISD A;  3TUY B;  3I5I B;  1NX3 A;  1IH0 A;  4NDB A;  1K9P A;  1QAS A;  2FCD A;  1CDL A;  4YI9 A;  2PMY A;  1A03 A;  1U5I B;  3CR4 X;  1XK4 A;  3I5G C;  1CFP A;  5HLO A;  1JC2 A;  5TNC A;  4QJ5 B;  1UUS A;  1K95 A;  3QRX A;  2JTZ A;  1XFX O;  3BQ3 A;  1L2O B;  3JVT B;  3MSE B;  2ZNE A;  1K93 D;  4XJK B;  1MQ1 A;  5CSI A;  5KU1 A;  1AVS A;  1YUS A;  1A75 A;  2JXC A;  2BCX A;  3GOF A;  4QJ3 B;  1JSA A;  2LVJ A;  1E8A A;  1REC A;  4YBH B;  2MJW B;  5CSJ A;  5AEQ A;  2Y5I A;  3SIA A;  1C7W A;  1NX0 A;  1V1F A;  2BBM A;  1G33 A;  4DS7 A;  4HRE E;  1BU3 A;  1A2X A;  4OR9 B;  1CM1 A;  2LM5 A;  1ALW A;  5AFP A;  2JPT A;  1HT9 A;  1RRO A;  4YRU A;  1YRU B;  3FIA A;  1QV0 A;  2LHL A;  1WDC C;  2F8P A;  3AKA A;  2KBI A;  3EVV A;  1GGW A;  2QPT A;  1RFJ A;  2OTG C;  2I18 A;  2EC6 C;  4GUK A;  5BPJ A;  1V1G A;  1CFC A;  5G08 A;  2L0P A;  4MRX A;  2KFG A;  1QLK A;  4C0K A;  1JWD A;  1ZFS A;  1BOD A;  2SCP A;  2G2B A;  1YUR A;  3NXA A;  1L7Z A;  1QX5 B;  4HSZ A;  2M7N A;  5CSF A;  1M63 B;  3TDI A;  1QS7 A;  1PVB A;  4PE4 A;  1Y1A A;  2WC8 A;  1TN4 A;  2K7D A;  1VRK A;  3IQQ A;  3I5F C;  3CR2 A;  1J1E A;  2JT8 A;  3F45 A;  2WOR A;  3PAT A;  2HQ8 A;  3LCP C;  1SW8 A;  2JWW A;  1WLZ A;  1LA0 A;  4TNC A;  1SY9 A;  1M39 A;  1F54 A;  3PN7 C;  3CGA A;  2HET A;  5I2Q A;  4YGB B;  1Y6W A;  2F3Z A;  2PSR A;  3NSK A;  1D1O A;  1HQV A;  1N0Y A;  1TRF A;  1DJI A;  3NSO A;  3GK1 A;  4IL1 A;  1OE9 B;  1A75 B;  3CWG A;  1KQV A;  4MZL A;  3EK8 A;  1AJ4 A;  2K0J A;  1BR1 B;  3SG4 A;  1RTP 1;  1K9U A;  3BUM B;  1F70 A;  1UHN A;  2JC2 A;  2KYF A;  1TCF A;  1F4Q A;  3TUY C;  5DKR A;  1QX2 A;  1NCY A;  3GK2 A;  1ZAC A;  1F4O A;  1DJH A;  1QXP A;  1NCX A;  2CTN A;  1NUB A;  3EKH A;  4MZJ A;  2NLN A;  3BUW B;  1DMO A;  4ORB B;  1L2O C;  3JVT C;  4CFQ A;  2HF5 A;  1SK6 D;  4C0J A;  2ZND A;  1TOP A;  1CMG A;  4N1G A;  5FYX A;  4FQO A;  3LLE A;  1AJ5 A;  1R6P A;  1R2U A;  2KHN A;  4WRI A;  1PK0 D;  3DVK A;  1WLM A;  2JNF A;  3BUN B;  1JFJ A;  1IQ5 A;  2LLU A;  5AAN A;  3PLF B;  4PHN A;  2E6W A;  2H61 C;  1M31 A;  1FPW A;  4ORA B;  1JF0 A;  2LLT A;  3VGO A;  1EG4 A;  1CDP A;  1KSO A;  2B1U A;  3OB1 B;  3LK1 A;  2E30 A;  1N2D A;  1YUT A;  2GGM A;  2OS8 B;  4GNK B;  1G4Y R;  3I5H B;  1PAL A;  1FF1 A;  5ER4 X;  3TDZ A;  2LE9 B;  1C07 A;  1KQM B;  1CDM A;  3KF9 A;  1BLQ A;  4AQI A;  3CS1 A;  2L4I A;  2Y1M A;  3NSL A;  2JT0 A;  2MA2 A;  4GBA A;  1FI5 A;  1YVH A;  3JTD B;  2M29 A;  1Y1X A;  2LV7 A;  1SMG A;  1F55 A;  3EK4 A;  3CZT X;  3O6B A;  3SG6 A;  3D10 A;  1UUR A;  4CID A;  1EL4 A;  1SL8 A;  3A8R A;  1M46 A;  4JPZ B;  4BY4 A;  1LKJ A;  4MBE A;  1W7I B;  1UHJ A;  5I8N A;  1Q80 A;  3A4U B;  1YUU A;  1QVI Y;  1BJF A;  2CT9 A;  1KK7 Y;  2PRU A;  2ZRS A;  1KCY A;  3KPX A;  1B7T Y;  2GV5 A;  1LA3 A;  1QAT A;  1SL9 A;  1MXL C;  3OX6 A;  1XFU O;  2WCB A;  2O60 A;  2KAY A;  5JJG A;  1BF5 A;  1BOC A;  1J7P A;  3DF0 A;  4DCK A;  4UPG A;  1F8H A;  2L98 A;  3TZ1 A;  4I5J A;  3ZWH A;  1J1D A;  4NDC A;  4U8D A;  1OMD A;  2KOT A;  2KI4 B;  2L50 A;  1MUX A;  4OVN F;  1QVI Z;  1RWY A;  2BEC A;  1KK7 Z;  1OOJ A;  2L5X B;  1B7T Z;  1BT6 A;  3HX4 A;  1EH2 A;  2KAX A;  2KAV A;  1DJW A;  2G9B A;  4MSP A;  1QJT A;  1J7O A;  3DVM A;  2K8M B;  2LLS A;  1NCZ A;  4GPL B;  4P5O E;  1Y1U A;  2D8N A;  2NCO A;  2M8U A;  5D69 A;  2MAZ A;  2I94 A;  5HKZ A;  3EKJ A;  3FWC A;  1B8R A;  2L2E A;  2TN4 A;  1FW4 A;  4I5L B;  3CTN A;  2LMV A;  3VRN A;  3WNX B;  3LL8 B;  2FOT A;  4MLW A;  1XFV O;  3M0W A;  1B1G A;  4OCI A;  1IWQ A;  4WQ2 A;  5J3X A;  2M1U A;  1K2H A;  2P6B B;  2KI6 C;  1LXF C;  1S6C A;  2OPO A;  5K89 A;  1ALV A;  3I5G B;  2BE6 A;  3SG3 A;  1CM4 A;  1PSB A;  4CFR A;  4GFT A;  1UHI A;  1S5G Y;  2R2I A;  3FWB A;  1SR6 B;  4JWQ A;  3TS5 B;  1KQM C;  1C7V A;  4L9M A;  1A4P A;  1EJ3 A;  5IBW A;  1IRJ A;  2VRG A;  1J7Q A;  2JNX A;  2WCF A;  2JZI A;  1IJ6 A;  3DF0 B;  3I5I C;  3AKB A;  4YGD B;  2JRF A;  2JU0 A;  4DIR A;  2MLF C;  1QTX A;  3BUO B;  3BOW A;  4ORC B;  1WRK A;  1JF2 A;  1JBA A;  1DVI A;  1CLM A;  4FTG A;  4PE7 A;  1KFU S;  2KSP A;  1KWO B;  4PHJ A;  1CB1 A;  4JQ0 D;  2K7B A;  4P2Y B;  1NWD A;  5B8I B;  4I5K A;  5HYD A;  2CCM A;  2LCP A;  1LVC D;  1J7R A;  2DOQ A;  5AXI A;  3ZNI A;  2ZRT A;  1XFZ O;  3OHM B;  1CNP A;  1S3P A;  1S5G Z;  1S36 A;  3NSI A;  1W7J B;  1XO5 A;  2MBX A;  1B8L A;  1FBV A;  3AAJ A;  1YRT B;  4DUQ A;  1S26 D;  4GGF C;  4OV2 A;  1PRW A;  4M2Q A;  3VRO A;  3BUX B;  1WRZ A;  3LK0 A;  1OZS A;  2LVV A;  2KQ6 A;  1CMF A;  1IKU A;  1J55 A;  2IS9 A;  2LUC A;  4OKH A;  1AP4 A;  1K8U A;  2NCP A;  2LUX A;  2KI4 C;  3GK4 X;  2BBN A;  2M0R A;  1OSA A;  2M3W A;  3KHE A;  4NDD A;  1KSM A;  1SPY A;  5D7F A;  3ICB A;  1K94 A;  2NZ0 A;  4HRG A;  2K2F A;  3PFV A;  1IQ3 A;  1F71 A;  3SG2 A;  1SCM B;  4DRW A;  4A4C A;  4PCW A;  2BL0 B;  5AER A;  2QAC A;  1XYD A;  4PAL A;  2F33 A;  1DTL A;  2LVK A;  3RLZ A;  1CFF A;  1GQM A;  3BXK A;  3OX5 A;  2JUL A;  1NPQ A;  1IG5 A;  2LVI A;  4E68 A;  2COL B;  2Y1N A;  2AAO A;  1UP5 A;  2K7O A;  4YGA A;  2KGB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...