1QTXA

The 1.65 angstrom structure of calmodulin rs20 peptide complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
148
structure length
148
Chain Sequence
ADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYEEFVQVMMAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PROTEIN (CALMODULIN)
publication title High Resolution Structure of a Calmodulin Rs20 Peptide Complex
rcsb
source organism Escherichia coli
total genus 52
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1999-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qtxA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qtxA02
1CFDA 2KI4C 1N2DA 2BL0C 3KPXA 3WHUB 1YURA 5K89A 2QPTA 4PALA 1BG1A 5I2OA 1GGWA 1S1EA 1ZACA 1B9AA 4MLWA 1KQVA 1E8AA 3I5GB 1SK6D 1QX7A 2LNKA 1K93D 1OMVA 1XFWO 2JT0A 4Q04A 3FWBA 2BCBA 5IBWA 2LAPA 2KNEA 3GOFA 1PULA 2F33A 1XFUO 1OMRA 4GGNA 3SG5A 4M2OA 1RWYA 2FJUB 4ZCUA 2ZNEA 5KSZA 1NSHA 1WY9A 1XYDA 2M1KB 3BOWB 2GGMA 2MJWB 4N5XA 5PALA 1RK9A 2JRFA 2L4HA 2PALA 5GQQC 4DCKA 1DVIA 1SW8A 3CTNA 1WLZA 1WDCC 4YGCB 2BE6A 1YUUA 3I5FB 4QJ3B 1SBJA 1S5GZ 1TCOB 1NYAA 5CSFA 3F45A 3NSLA 1A03A 3AAJA 3ZWHA 2WOSA 1A29A 4IL1A 3HCMA 3ICBA 1CDNA 1BOCA 1QASA 1YVLA 3EK7A 1SCMB 1VRKA 1MUXA 2JWWA 3LK0A 4YGDB 1XFVO 3SG4A 1DJIA 3O78A 1YR5A 5G08A 2ISDA 2CT9A 1F70A 4GAOA 2QACA 2ZRTA 2Q4UA 1TNXA 2LV7A 1WLMA 4PE1A 4YI8A 5HLOA 1DGUA 2LLSA 2WCEA 1AP4A 4AQJA 4HRGA 1C7VA 1M39A 2NLNA 2WCBA 4P2YB 2LVKA 2ZKMX 4A4CA 1EJ3A 1SNLA 5BPJA 2KI6D 2EC6B 2L98A 4C0JA 3EKJA 1XO5A 4PHNA 4BY4A 1TTXA 2JC2A 3BQ3A 1L2OC 2COLB 2OTGC 3CLNA 2KOTA 1QV0A 3C1VA 2LMVA 2WCFA 2I94A 1HT9A 2LC5A 3LK1A 1XFXO 5AFPA 3QRXA 2HF5A 1W7IB 1IQ5A 1D1OA 1CLMA 1SYMA 3JVTC 4MZKA 1SL9A 2MRDA 2WC8A 1SR6B 1V1FA 1TOPA 1JWDA 2VRGA 2IS9A 2MBXA 3VROA 1PRWA 3DF0A 4DS7A 2M0RA 2KBIA 2KBMA 2JTZA 2O5GA 1UUSA 2PASA 2Q91A 2ZNDA 1IRJA 2BKIB 2Y1MA 1PVAA 2SCPA 1S26D 1QVIZ 2CNPA 1K9PA 3EKHA 3TDIA 3D0YA 4MEWA 1A75B 2OS8C 3TS5B 1YX7A 1A4PA 1CDMA 4PE7A 4E68A 1SKTA 3O2PA 2KI4B 1DTLA 2H2KA 5B8IB 4AQIA 2L50A 4I5JA 1MXEA 4CLNA 1DJWA 1DF0A 3IQOA 4F0ZB 1QX5B 1X02A 3PN7C 3DVJA 1IG5A 1SMGA 1WRLA 1KK8B 3OP0A 1IJ6A 2MA2A 1F4OA 3VRRA 1EXRA 1B8CA 5AANA 1AJ5A 1C07A 1OOJA 2K2FA 3SG2A 4ORAB 2M1UA 4YI9A 3RM1A 4I5LB 5KU1A 2A4JA 3MSEB 1TRFA 2F2OA 2JPTA 3AAKA 1B7TY 4I5NB 4WRIA 2CBLA 3PATA 1MF8B 3DF0B 4GNKB 2BE4A 2I18A 5HKWA 2LHLA 4C0LA 4GGFC 4XJKA 2FOTA 3PALA 1KFUS 1TNWA 3CR5X 1WDCB 1F8HA 3VRNA 2KFGA 3K21A 1RFJA 1U5IB 4YGEB 1F54A 3D0YB 1RTP1 3ZNIA 3HX4A 4ZCVA 4OKHA 1KFXS 1B1GA 1QLKA 2L51A 2LHIA 3LLEA 4AOMA 2HETA 2K7BA 4FQOA 1DF0B 1G33A 1OSAA 3FIAA 1YRTB 1EG3A 1Y6WA 1ZFSA 2PRUA 1MR8A 3JTDB 1CMFA 1M46A 3SJSA 1SPYA 5HKYA 2LM5A 1CFCA 1J7QA 4N1GA 2BCXA 3BUXB 3EK8A 1J1DA 4YGAA 2JU0A 3H4SE 3CWGA 2WORA 3A8RA 1PALA 3VGOA 2H61C 2JQ6A 1IJ5A 4YBHB 3SIBA 1ALWA 2KYCA 4D1EA 1CFFA 2HQ8A 1UWOA 2Y5IA 1YUSA 3CR4X 3I5IC 1QXPA 3OX6A 4XJKB 2KFHA 2JXCA 1XFYO 4FTGA 5ER5A 3JVTB 3O4YA 1K9KA 1BT6A 2KAYA 1ZUZA 2EHBA 4MZJA 1CDLA 1HQVA 4OV2A 4MVFA 1M31A 2BKHB 2E6WA 2KGRA 3EK4A 5CSNA 2Y4QA 1XA5A 1K94A 4GGFA 5HLVA 2TN4A 1NX0A 1QS7A 1UHIA 2FCEA 2P6BB 3I5GC 2PMYA 1DT7B 2M9GA 1NCXA 2F2PA 3IQQA 1FI6A 2KQYA 1KQMC 1S6IA 1FI5A 4YRUA 1S5GY 4BY5A 1S6JA 1NX2A 1B47A 1IQ3A 5HKZA 1UP5A 3KF9A 2KAVA 2JXLA 2BECA 1JSAA 1SRAA 4MZLA 4GUKA 1CM4A 2KI6C 3GK1A 1DJXA 3PLFB 4DUQA 2CXJA 3AKAA 5HYDA 1YX8A 2F3ZA 1UHJA 4OR9B 3WNXB 3PSRA 5I8NA 1TNQA 2NCPA 1XK4C 3IF7A 4PCWA 2H61A 1BMOA 3FWCA 3SIAA 1OZOA 2R2IA 1CTRA 1MWNA 1RROA 4MBEA 1JF0A 1PK0D 1TN4A 1YTZC 3RLZA 3TUYB 3NSKA 5AERA 1LXFC 1M45A 1DJHA 1SL7A 4GFTA 4PE4A 4ORBB 1KWOC 4OCIA 4PHKA 1SCMC 1B8RA 3EVVA 1KK7Z 1TNPA 2BL0B 3TZ1A 2I7AA 1G4YR 1TIZA 3VRPA 3LL8B 2FCDA 2ZN8A 4PDZA 4WQ2A 5DKNA 1CDPA 3GK4X 1AK8A 3I5HC 4USLA 3PFVA 1AHRA 1BODA 1TCFA 4NDBA 4CPVA 1SY9A 5D69A 2MAZA 1MQ1A 4ICBA 2JTTA 2K7OA 1CMGA 1N65A 2K7CA 1PSRA 1QJTA 3NSIA 1B4CA 1ZMZA 1KCYA 2JNXA 3TDZA 1FF1A 1JF2A 1QVIY 1YRUB 2M49B 3E3RA 1FBVA 4M2PA 1UHKA 2LP2A 3VRQA 2BCAA 2GV5A 5D7FA 1J7RA 1AUIB 2ZN9A 3BXKA 1S6CA 5CSIA 3SG7A 1R2UA 1NCYA 2LUCA 2L5XB 4CFRA 1S36A 3KO0A 3KEVA 1BR1B 5TNCA 2DOQA 1K95A 2LMTA 2RGIA 2F3YA 4HREE 1IWQA 3I5IB 2JNFA 1QLSA 1J7OA 2KGBC 1LVCD 2MLFC 2ZFDA 2BBMA 2K2AA 3CGAA 4NDDA 5J3XA 1QX2A 2MLEC 2KHNA 4HRHA 1NWDA 2K8MB 1CFPA 1Q80A 1FW4A 5ER4X 1K8UA 2CTNA 3TS5C 2MHHA 4UPGA 1EL4A 2I2RE 4GPLB 1BJFA 2F8PA 5F6TA 1RJVA 1SL8A 1DMOA 1B8LA 3WXAA 2K61A 4NDCA 3DVEA 3EVRA 1KSMA 1NUBA 1ZOTB 1YVHA 2B1UA 1DGVA 2KSPA 4N1FA 1BF5A 5AXIA 4XYNA 1LA0A 1GJYA 1KK8C 1KQMB 3OHMB 1ODBA 2LUXA 2OPOA 5FYXA 3SG6A 4DIRA 2M97A 2LCPA 3FS7A 4YGBB 2K0JA 2LMUA 2LLUA 1S3PA 1K2HA 1L2OB 2OTGB 1C7WA 2GGZA 1NPQA 4QJ4B 1CLLA 3M0WA 2LLTA 1RECA 3OX5A 3EVUA 2SASA 1K90D 1CLBA 2M29A 2G2BA 2ZRSA 3CZTX 2M7LA 4P5OE 1XVJA 1PVBA 2KYFA 1NX1A 1IH0A 4I5KA 1Y1UA 1NCZA 1QIVA 2E30A 2NCOA 5I2QA 3BYAA 2LVIA 1EH2A 1CM1A 2L4IA 1K96A 3CR2A 2KAXA 4QJ5B 1KFUL 1IKUA 2LVVA 1UHNA 2OS8B 3BUOB 3TDUA 5CSJA 3OB1B 1KWOB 1QIWA 1BLQA 1CKKA 1GQMA 1QTXA 1CB1A 1AVSA 1LINA 3PM8A 4CFQA 1KFXL 4ETOA 1N0YA 1XFZO 4ORCB 1OZSA 3JTDC 1NP8A 3BUNB 1YUTA 4U8DA 3I5HB 4WQ3A 4CIDA 3PN7B 1UURA 4A4BA 2L2EA 1A75A 5AEQA 4MRYA 4OVNF 1Y0VH 3DD4A 1V1GA 1F71A 2LE9B 3DVKA 2NXQA 3SG3A 2WNDA 1A2XA 2EGDA 1ALVA 1SCVA 1J7PA 2KDHA 1R6PA 2BBNA 2D8NA 3I5FC 1EG4A 3AKBA 2KFFA 1IGVA 1K9UA 1WRZA 2PVBA 3KHEA 2V53A 2AAOA 3NSOA 2L0PA 4PHMA 3GK2A 4PHJA 3BUMB 1J1EA 2LP3A 1OE9B 1NIWA 1DJZA 3NXAA 4MSPA 1H8BA 2NZ0A 5JOLA 1G8IA 3WHTB 4DRWA 1MXLC 3DVMA 5JJGA 2CCMA 1WRKA 1FPWA 1MHOA 1QATA 4PE0A 1QV1A 1B7TZ 1J55A 2M7NA 1DJYA 1JFKA 1GGZA 1U5IA 4JPZB 2HQWA 2JULA 1KSOA 2AUCA 2JT3A 1M63B 1CNPA 4MN0A 2PSRA 2O60A 1LKJA 2EC6C 3O6BA 4M2QA 2JOJA 2K7DA 4C0KA 4R1EA 1Y1AA 4MRXA 1LA3A 5CPVA 3A4UB 1W7JB 4GBAA 1H4BA 4JQ0D 4L9MA 1KK7Y 3BUWB 2M3WA 1JC2A 1JBAA 2LVJA 1DJGA 1SR6C 3D10A 3BOWA 1JFJA 1NX3A 4JWQA 1F55A 2KQ6A 1OMDA 4NQGA 1OQPA 2LANA 5DKRA 1L7ZA 5I2LA 5KTYA 5DKQA 2AMIA 3CS1A 4HSZA 1UHHA 3OB2B 1AJ4A 1XK4A 2G9BA 1BR4B 1BU3A 1Y1XA 2M8UA 1F4QA 1PSBA 2JT8A 3LCPC 4TNCA 3TUYC 2JZIA 1JUOA 2HPSA 2Y1NA
chains in the Genus database with same CATH superfamily
1CFDA 1XFRA 2KI4C 1N2DA 2BL0C 3KPXA 3WHUB 1YURA 5K89A 2QPTA 4PALA 1BG1A 5I2OA 1GGWA 1S1EA 1ZACA 1B9AA 4MLWA 1KQVA 1E8AA 3I5GB 1SK6D 1QX7A 2LNKA 1K93D 1OMVA 1XFWO 2JT0A 3IVTA 4Q04A 3FWBA 2BCBA 5IBWA 2LAPA 2KNEA 3GOFA 1PULA 2F33A 1XFUO 5FI2A 1OMRA 4GGNA 3DY9A 3SG5A 4M2OA 1RWYA 2FJUB 4ZCUA 2ZNEA 5KSZA 1NSHA 1WY9A 1XYDA 2M1KB 3BOWB 2GGMA 2MJWB 4N5XA 5PALA 1RK9A 2JRFA 2L4HA 4INXA 3CABA 2PALA 2P70A 5GQQC 4DCKA 1DVIA 1SW8A 1DELA 3CTNA 1WLZA 1WDCC 4YGCB 5I94A 4JD9A 3S0EA 2BE6A 1YUUA 3I5FB 4QJ3B 1SBJA 1S5GZ 1TCOB 5DICA 1NYAA 5CSFA 3F45A 3NSLA 1A03A 3AAJA 3ZWHA 2WOSA 1A29A 2WCKA 4IL1A 3HCMA 3ICBA 1CDNA 1BOCA 1QASA 3UNWA 1YVLA 3EK7A 1SCMB 1VRKA 1MUXA 2JWWA 3LK0A 4YGDB 1XFVO 1DC1A 3SG4A 1DJIA 3O78A 2KLEA 1YR5A 5G08A 2ISDA 2CT9A 1F70A 4GAOA 2QACA 2ZRTA 2Q4UA 1TNXA 2QEOA 2LV7A 1WLMA 4PE1A 4YI8A 5HLOA 1DGUA 2LLSA 2WCEA 1AP4A 4AQJA 4HRGA 1C7VA 1M39A 2NLNA 2WCBA 4P2YB 2LVKA 2ZKMX 4A4CA 1EJ3A 1SNLA 5BPJA 3L4AA 2KI6D 2EC6B 2L98A 3D75A 3EKJA 1XO5A 4C0JA 4PHNA 4BY4A 1TTXA 2JC2A 3BQ3A 1L2OC 2COLB 2OTGC 1SSEB 3CLNA 2KOTA 1QV0A 3C1VA 3B6XA 1TUJA 2LMVA 2WCFA 2I94A 1HT9A 2LC5A 3LK1A 1XFXO 5AFPA 3QRXA 2ERBA 2HF5A 4KYNA 1W7IB 1IQ5A 1D1OA 1CLMA 1SYMA 2H8VA 3JVTC 1SL9A 4MZKA 2MRDA 2WC8A 1SR6B 1V1FA 1TOPA 1JWDA 2VRGA 2IS9A 2MBXA 3S0DA 3VROA 1PRWA 3DF0A 4IJ7A 4DS7A 2M0RA 2KBIA 2KBMA 3DYEA 2JTZA 2O5GA 1UUSA 2PASA 2Q91A 2ZNDA 1IRJA 2BKIB 2Y1MA 3PM2A 1PVAA 2SCPA 1S26D 1QVIZ 2CNPA 1K9PA 3EKHA 3TDIA 3D0YA 4MEWA 1A75B 2OS8C 3TS5B 1YX7A 3L4LA 1A4PA 1CDMA 4PE7A 4E68A 1SKTA 3O2PA 2KI4B 1DTLA 2H2KA 5B8IB 4AQIA 2L50A 4I5JA 1MXEA 4CLNA 1DJWA 1DF0A 3K1EA 3IQOA 4F0ZB 1QX5B 1X02A 3PN7C 3DVJA 1IG5A 1SMGA 1WRLA 1KK8B 3OP0A 1IJ6A 2MA2A 3NGVA 1F4OA 3VRRA 1EXRA 1B8CA 5AANA 1AJ5A 1C07A 1OOJA 2K2FA 3SG2A 4ORAB 2M1UA 4YI9A 3RM1A 4I5LB 5KU1A 3QMEA 2A4JA 3MSEB 1TRFA 2F2OA 2JPTA 3AAKA 1B7TY 4I5NB 4WRIA 2CBLA 3BJHA 2P71A 3PATA 1MF8B 3DF0B 4GNKB 3L47A 2BE4A 2I18A 5HKWA 2LHLA 4C0LA 4GGFC 4XJKA 2JPOA 2FOTA 3PALA 1KFUS 1TNWA 3CR5X 1WDCB 1F8HA 3VRNA 2KFGA 3K21A 1RFJA 1U5IB 4YGEB 1F54A 3BFAA 3D0YB 1RTP1 3V2LA 3ZNIA 3HX4A 2WCMA 4ZCVA 4FQTA 4OKHA 1KFXS 1B1GA 1DEKA 2YGUA 1QLKA 2L51A 2LHIA 3LLEA 4AOMA 2HETA 2K7BA 2WCJA 4FQOA 1DF0B 3D77A 5FI6A 1G33A 1OSAA 3FIAA 1YRTB 1EG3A 1Y6WA 1ZFSA 2PRUA 3VB1A 1MR8A 3JTDB 1CMFA 1M46A 3SJSA 1SPYA 5HKYA 2LM5A 1CFCA 1J7QA 3FE8A 2BCXA 3BUXB 4N1GA 3EK8A 1J1DA 4YGAA 2JU0A 3H4SE 3R1PA 3CWGA 2WORA 3A8RA 1PALA 3VGOA 2H61C 2JQ6A 1IJ5A 4YBHB 3FE6A 2WC5A 1ALWA 3SIBA 2KYCA 4D1EA 1CFFA 2HQ8A 1UWOA 2Y5IA 1YUSA 3CR4X 3I5IC 1QXPA 3OX6A 4XJKB 1C3YA 2KFHA 3CDNA 3D76A 2JXCA 1XFYO 4FTGA 5ER5A 2WCLA 3JVTB 3O4YA 5FI7A 3B86A 1K9KA 1BT6A 2KAYA 1ZUZA 2EHBA 4MZJA 1CDLA 1HQVA 5D3OA 4OV2A 4MVFA 1M31A 2BKHB 2E6WA 2KGRA 3BFBA 3EK4A 2Y4QA 5CSNA 1XA5A 1K94A 1Z2CB 4GGFA 5HLVA 2TN4A 3CZ0A 1NX0A 2KLDA 1QS7A 3S0BA 1UHIA 2FCEA 2KPHA 2P6BB 1OOHA 2PMYA 3I5GC 2M9GA 3S0GA 1DT7B 2QDIA 1NCXA 2F2PA 3IQQA 1FI6A 2KQYA 1KQMC 1S6IA 1FI5A 4YRUA 1S5GY 4BY5A 1S6JA 5HL1A 1NX2A 1GM0A 1B47A 1IQ3A 5HKZA 1UP5A 3KF9A 2KAVA 1OW4A 2JXLA 2BECA 1JSAA 1SRAA 3DXLA 4MZLA 4GUKA 1CM4A 2KI6C 3GK1A 1DJXA 3PLFB 3R1VA 4DUQA 2CXJA 3AKAA 5HYDA 1YX8A 3S0FA 2F3ZA 2BAPA 1UHJA 4OR9B 3WNXB 3PSRA 5I8NA 1TNQA 2NCPA 1XK4C 3IF7A 4PCWA 2H61A 1BMOA 3FWCA 3SIAA 3O4XA 1OZOA 2R2IA 1CTRA 1MWNA 1RROA 4MBEA 1JF0A 1PK0D 1TN4A 1YTZC 3RLZA 3TUYB 3NSKA 5AERA 1LXFC 1M45A 1DJHA 1SL7A 4GFTA 4PE4A 4ORBB 1KWOC 4OCIA 4PHKA 1QWVA 1SCMC 1B8RA 3EVVA 1KK7Z 1TNPA 2BL0B 3TZ1A 2I7AA 1G4YR 1TIZA 3VRPA 3LL8B 2FCDA 2ZN8A 3EG5B 4PDZA 4WQ2A 5DKNA 1CDPA 3SS5A 3GK4X 1AK8A 3I5HC 4USLA 3PFVA 1AHRA 1BODA 1TCFA 3B7AA 4NDBA 4CPVA 1LS8A 1T14A 1SY9A 5D69A 2MAZA 1MQ1A 4ICBA 2JTTA 2K7OA 4OZDA 1CMGA 1N65A 2K7CA 1PSRA 1QJTA 3NSIA 1B4CA 1ZMZA 1KCYA 2JNXA 3TDZA 3UO9A 1FF1A 1JF2A 1QVIY 1YRUB 2M49B 3E3RA 1FBVA 4M2PA 5EL2A 1UHKA 2LP2A 3BFHA 3NHIA 3VRQA 2BCAA 2GV5A 3OBVA 1J7RA 1AUIB 3R72A 5D7FA 2ZN9A 3BXKA 1S6CA 5CSIA 3SG7A 1R2UA 1NCYA 2LUCA 2L5XB 4CFRA 1S36A 3KO0A 3KEVA 1BR1B 5TNCA 2DOQA 1K95A 2LMTA 2RGIA 2F3YA 3OGNA 4HREE 1IWQA 3I5IB 2QEHA 2JNFA 1QLSA 3RZSA 1J7OA 3NHTA 2KGBC 1LVCD 1OOFA 2BNXA 2MLFC 2ZFDA 2BBMA 2K2AA 3CGAA 4NDDA 5J3XA 1QX2A 3SS3A 2MLEC 2KHNA 4HRHA 1NWDA 2K8MB 1CFPA 1Q80A 1FW4A 5ER4X 1K8UA 2CTNA 3TS5C 2MHHA 4UPGA 1EL4A 2I2RE 4GPLB 1BJFA 2F8PA 1IIOA 5F6TA 1RJVA 1SL8A 1DMOA 1B8LA 3WXAA 2K61A 2L2CA 4NDCA 3DVEA 3EVRA 1KSMA 1ORGA 3B88A 1NUBA 1ZOTB 1YVHA 2B1UA 1DGVA 2KSPA 4N1FA 1BF5A 5AXIA 4XYNA 1LA0A 1GJYA 1KK8C 1KQMB 3OHMB 1ODBA 2LUXA 2OPOA 5FYXA 3SG6A 4DIRA 2M97A 2LCPA 3FS7A 4YGBB 2K0JA 2LMUA 2LLUA 1S3PA 1K2HA 1L2OB 3D78A 2OTGB 1C7WA 2GGZA 1NPQA 4QJ4B 1CLLA 3M0WA 2LLTA 1RECA 3OX5A 3EVUA 2SASA 1K90D 1W9ZA 1CLBA 2M29A 2G2BA 2ZRSA 3CZTX 2M7LA 1OOGA 1XVJA 4P5OE 1PVBA 2KYFA 1NX1A 1IH0A 2L5YA 1Y1UA 1NCZA 1QIVA 3PJIA 4I5KA 2E30A 2NCOA 1TWOA 5I2QA 3BYAA 2LVIA 3CZ1A 1CM1A 1EH2A 2L4IA 1K96A 3CR2A 2KAXA 4QJ5B 1KFUL 1IKUA 2LVVA 1UHNA 2OS8B 3BUOB 3TDUA 5CSJA 3OB1B 1KWOB 4F7FA 1QIWA 1BLQA 1CKKA 1C3ZA 1GQMA 1QTXA 3R1OA 1AVSA 1CB1A 1LINA 3PM8A 4CFQA 1KFXL 4ETOA 1N0YA 2PYQA 3S0AA 1XFZO 4ORCB 1OZSA 3JTDC 1NP8A 3BUNB 1YUTA 4U8DA 3I5HB 4WQ3A 4CIDA 3CYZA 3PN7B 1UURA 4A4BA 2L2EA 1A75A 5AEQA 4MRYA 4OVNF 1Y0VH 3DD4A 1P28A 1V1GA 1F71A 2LE9B 3DVKA 2NXQA 2PQLA 3SG3A 2WNDA 1A2XA 2EGDA 1ALVA 1SCVA 1J7PA 2KDHA 1R6PA 2BBNA 4INWA 2D8NA 3I5FC 1EG4A 3AKBA 2KFFA 1IGVA 1K9UA 1WRZA 2PVBA 3FE9A 3KHEA 2V53A 2AAOA 3NSOA 2L0PA 4PHMA 2QEBA 3GK2A 4PHJA 3BUMB 1J1EA 2LP3A 1OE9B 1NIWA 1TUZA 1DJZA 3NXAA 4MSPA 1H8BA 2NZ0A 5JOLA 1G8IA 3WHTB 3Q8IA 4DRWA 1MXLC 3DZTA 3DVMA 5JJGA 2CCMA 1WRKA 1FPWA 2QEVA 1MHOA 1QATA 4PE0A 1QV1A 1B7TZ 1J55A 2M7NA 1DJYA 1JFKA 1GGZA 1U5IA 4JPZB 2HQWA 2JULA 1KSOA 2AUCA 2JT3A 1M63B 1CNPA 4MN0A 3SS4A 3N7HA 2PSRA 2O60A 2FJYA 1LKJA 2EC6C 3O6BA 3B87A 4M2QA 2K60A 2JOJA 2K7DA 4C0KA 2WC6A 1Y1AA 4MRXA 4R1EA 1LA3A 5CPVA 3D74A 3A4UB 1W7JB 4GBAA 1H4BA 4JQ0D 4L9MA 1KK7Y 3BUWB 2M3WA 1JC2A 1JBAA 2LVJA 1DJGA 3D73A 1DQEA 4PT1A 1SR6C 3D10A 3BOWA 1JFJA 1Z4HA 1NX3A 4JWQA 1F55A 2KQ6A 3CZ2A 1OMDA 4NQGA 1OQPA 2LANA 5DKRA 1L7ZA 2GTEA 5I2LA 5KTYA 5DKQA 2AMIA 3CS1A 4HSZA 1UHHA 3OB2B 1AJ4A 1XK4A 2G9BA 1BR4B 1BU3A 1OOIX 1Y1XA 2M8UA 1F4QA 1PSBA 2JT8A 3LCPC 4TNCA 3TUYC 2JZIA 1JUOA 4JKTA 2HPSA 2Y1NA 2WCHA
chains in the Genus database with same CATH topology
1CFDA 2KI4C 1N2DA 2BL0C 3KPXA 3WHUB 1YURA 5K89A 2QPTA 4PALA 1BG1A 5I2OA 1GGWA 1S1EA 1ZACA 1B9AA 4MLWA 1KQVA 1E8AA 3I5GB 1SK6D 1QX7A 2LNKA 1K93D 1OMVA 1XFWO 2JT0A 4Q04A 3FWBA 2BCBA 5IBWA 2LAPA 2KNEA 3GOFA 1PULA 2F33A 1XFUO 1OMRA 4GGNA 3SG5A 4M2OA 1RWYA 2FJUB 4ZCUA 2ZNEA 5KSZA 1NSHA 1WY9A 1XYDA 2M1KB 3BOWB 2GGMA 2MJWB 4N5XA 5PALA 1RK9A 2JRFA 2L4HA 2PALA 5GQQC 4DCKA 1DVIA 1SW8A 3CTNA 1WLZA 1WDCC 4YGCB 2BE6A 1YUUA 3I5FB 4QJ3B 1SBJA 1S5GZ 1TCOB 1NYAA 5CSFA 3F45A 3NSLA 1A03A 3AAJA 3ZWHA 2WOSA 1A29A 4IL1A 3HCMA 3ICBA 1CDNA 1BOCA 1QASA 1YVLA 3EK7A 1SCMB 1VRKA 1MUXA 2JWWA 3LK0A 4YGDB 1XFVO 3SG4A 1DJIA 3O78A 1YR5A 5G08A 2ISDA 2CT9A 1F70A 4GAOA 2QACA 2ZRTA 2Q4UA 1TNXA 2LV7A 1WLMA 4PE1A 4YI8A 5HLOA 1DGUA 2LLSA 2WCEA 1AP4A 4AQJA 4HRGA 1C7VA 1M39A 2NLNA 2WCBA 4P2YB 2LVKA 2ZKMX 4A4CA 1EJ3A 1SNLA 5BPJA 2KI6D 2EC6B 2L98A 4C0JA 3EKJA 1XO5A 4PHNA 4BY4A 1TTXA 2JC2A 3BQ3A 1L2OC 2COLB 2OTGC 3CLNA 2KOTA 1QV0A 3C1VA 2LMVA 2WCFA 2I94A 1HT9A 2LC5A 3LK1A 1XFXO 5AFPA 3QRXA 2HF5A 1W7IB 1IQ5A 1D1OA 1CLMA 1SYMA 3JVTC 4MZKA 1SL9A 2MRDA 2WC8A 1SR6B 1V1FA 1TOPA 1JWDA 2VRGA 2IS9A 2MBXA 3VROA 1PRWA 3DF0A 4DS7A 2M0RA 2KBIA 2KBMA 2JTZA 2O5GA 1UUSA 2PASA 2Q91A 2ZNDA 1IRJA 2BKIB 2Y1MA 1PVAA 2SCPA 1S26D 1QVIZ 2CNPA 1K9PA 3EKHA 3TDIA 3D0YA 4MEWA 1A75B 2OS8C 3TS5B 1YX7A 1A4PA 1CDMA 4PE7A 4E68A 1SKTA 3O2PA 2KI4B 1DTLA 2H2KA 5B8IB 4AQIA 2L50A 4I5JA 1MXEA 4CLNA 1DJWA 1DF0A 3IQOA 4F0ZB 1QX5B 1X02A 3PN7C 3DVJA 1IG5A 1SMGA 1WRLA 1KK8B 3OP0A 1IJ6A 2MA2A 1F4OA 3VRRA 1EXRA 1B8CA 5AANA 1AJ5A 1C07A 1OOJA 2K2FA 3SG2A 4ORAB 2M1UA 4YI9A 3RM1A 4I5LB 5KU1A 2A4JA 3MSEB 1TRFA 2F2OA 2JPTA 3AAKA 1B7TY 4I5NB 4WRIA 2CBLA 3PATA 1MF8B 3DF0B 4GNKB 2BE4A 2I18A 5HKWA 2LHLA 4C0LA 4GGFC 4XJKA 2FOTA 3PALA 1KFUS 1TNWA 3CR5X 1WDCB 1F8HA 3VRNA 2KFGA 3K21A 1RFJA 1U5IB 4YGEB 1F54A 3D0YB 1RTP1 3ZNIA 3HX4A 4ZCVA 4OKHA 1KFXS 1B1GA 1QLKA 2L51A 2LHIA 3LLEA 4AOMA 2HETA 2K7BA 4FQOA 1DF0B 1G33A 1OSAA 3FIAA 1YRTB 1EG3A 1Y6WA 1ZFSA 2PRUA 1MR8A 3JTDB 1CMFA 1M46A 3SJSA 1SPYA 5HKYA 2LM5A 1CFCA 1J7QA 4N1GA 2BCXA 3BUXB 3EK8A 1J1DA 4YGAA 2JU0A 3H4SE 3CWGA 2WORA 3A8RA 1PALA 3VGOA 2H61C 2JQ6A 1IJ5A 4YBHB 3SIBA 1ALWA 2KYCA 4D1EA 1CFFA 2HQ8A 1UWOA 2Y5IA 1YUSA 3CR4X 3I5IC 1QXPA 3OX6A 4XJKB 2KFHA 2JXCA 1XFYO 4FTGA 5ER5A 3JVTB 3O4YA 1K9KA 1BT6A 2KAYA 1ZUZA 2EHBA 4MZJA 1CDLA 1HQVA 4OV2A 4MVFA 1M31A 2BKHB 2E6WA 2KGRA 3EK4A 5CSNA 2Y4QA 1XA5A 1K94A 4GGFA 5HLVA 2TN4A 1NX0A 1QS7A 1UHIA 2FCEA 2P6BB 3I5GC 2PMYA 1DT7B 2M9GA 1NCXA 2F2PA 3IQQA 1FI6A 2KQYA 1KQMC 1S6IA 1FI5A 4YRUA 1S5GY 4BY5A 1S6JA 1NX2A 1B47A 1IQ3A 5HKZA 1UP5A 3KF9A 2KAVA 2JXLA 2BECA 1JSAA 1SRAA 4MZLA 4GUKA 1CM4A 2KI6C 3GK1A 1DJXA 3PLFB 4DUQA 2CXJA 3AKAA 5HYDA 1YX8A 2F3ZA 1UHJA 4OR9B 3WNXB 3PSRA 5I8NA 1TNQA 2NCPA 1XK4C 3IF7A 4PCWA 2H61A 1BMOA 3FWCA 3SIAA 1OZOA 2R2IA 1CTRA 1MWNA 1RROA 4MBEA 1JF0A 1PK0D 1TN4A 1YTZC 3RLZA 3TUYB 3NSKA 5AERA 1LXFC 1M45A 1DJHA 1SL7A 4GFTA 4PE4A 4ORBB 1KWOC 4OCIA 4PHKA 1SCMC 1B8RA 3EVVA 1KK7Z 1TNPA 2BL0B 3TZ1A 2I7AA 1G4YR 1TIZA 3VRPA 3LL8B 2FCDA 2ZN8A 4PDZA 4WQ2A 5DKNA 1CDPA 3GK4X 1AK8A 3I5HC 4USLA 3PFVA 1AHRA 1BODA 1TCFA 4NDBA 4CPVA 1SY9A 5D69A 2MAZA 1MQ1A 4ICBA 2JTTA 2K7OA 1CMGA 1N65A 2K7CA 1PSRA 1QJTA 3NSIA 1B4CA 1ZMZA 1KCYA 2JNXA 3TDZA 1FF1A 1JF2A 1QVIY 1YRUB 2M49B 3E3RA 1FBVA 4M2PA 1UHKA 2LP2A 3VRQA 2BCAA 2GV5A 5D7FA 1J7RA 1AUIB 2ZN9A 3BXKA 1S6CA 5CSIA 3SG7A 1R2UA 1NCYA 2LUCA 2L5XB 4CFRA 1S36A 3KO0A 3KEVA 1BR1B 5TNCA 2DOQA 1K95A 2LMTA 2RGIA 2F3YA 4HREE 1IWQA 3I5IB 2JNFA 1QLSA 1J7OA 2KGBC 1LVCD 2MLFC 2ZFDA 2BBMA 2K2AA 3CGAA 4NDDA 5J3XA 1QX2A 2MLEC 2KHNA 4HRHA 1NWDA 2K8MB 1CFPA 1Q80A 1FW4A 5ER4X 1K8UA 2CTNA 3TS5C 2MHHA 4UPGA 1EL4A 2I2RE 4GPLB 1BJFA 2F8PA 5F6TA 1RJVA 1SL8A 1DMOA 1B8LA 3WXAA 2K61A 4NDCA 3DVEA 3EVRA 1KSMA 1NUBA 1ZOTB 1YVHA 2B1UA 1DGVA 2KSPA 4N1FA 1BF5A 5AXIA 4XYNA 1LA0A 1GJYA 1KK8C 1KQMB 3OHMB 1ODBA 2LUXA 2OPOA 5FYXA 3SG6A 4DIRA 2M97A 2LCPA 3FS7A 4YGBB 2K0JA 2LMUA 2LLUA 1S3PA 1K2HA 1L2OB 2OTGB 1C7WA 2GGZA 1NPQA 4QJ4B 1CLLA 3M0WA 2LLTA 1RECA 3OX5A 3EVUA 2SASA 1K90D 1CLBA 2M29A 2G2BA 2ZRSA 3CZTX 2M7LA 4P5OE 1XVJA 1PVBA 2KYFA 1NX1A 1IH0A 4I5KA 1Y1UA 1NCZA 1QIVA 2E30A 2NCOA 5I2QA 3BYAA 2LVIA 1EH2A 1CM1A 2L4IA 1K96A 3CR2A 2KAXA 4QJ5B 1KFUL 1IKUA 2LVVA 1UHNA 2OS8B 3BUOB 3TDUA 5CSJA 3OB1B 1KWOB 1QIWA 1BLQA 1CKKA 1GQMA 1QTXA 1CB1A 1AVSA 1LINA 3PM8A 4CFQA 1KFXL 4ETOA 1N0YA 1XFZO 4ORCB 1OZSA 3JTDC 1NP8A 3BUNB 1YUTA 4U8DA 3I5HB 4WQ3A 4CIDA 3PN7B 1UURA 4A4BA 2L2EA 1A75A 5AEQA 4MRYA 4OVNF 1Y0VH 3DD4A 1V1GA 1F71A 2LE9B 3DVKA 2NXQA 3SG3A 2WNDA 1A2XA 2EGDA 1ALVA 1SCVA 1J7PA 2KDHA 1R6PA 2BBNA 2D8NA 3I5FC 1EG4A 3AKBA 2KFFA 1IGVA 1K9UA 1WRZA 2PVBA 3KHEA 2V53A 2AAOA 3NSOA 2L0PA 4PHMA 3GK2A 4PHJA 3BUMB 1J1EA 2LP3A 1OE9B 1NIWA 1DJZA 3NXAA 4MSPA 1H8BA 2NZ0A 5JOLA 1G8IA 3WHTB 4DRWA 1MXLC 3DVMA 5JJGA 2CCMA 1WRKA 1FPWA 1MHOA 1QATA 4PE0A 1QV1A 1B7TZ 1J55A 2M7NA 1DJYA 1JFKA 1GGZA 1U5IA 4JPZB 2HQWA 2JULA 1KSOA 2AUCA 2JT3A 1M63B 1CNPA 4MN0A 2PSRA 2O60A 1LKJA 2EC6C 3O6BA 4M2QA 2JOJA 2K7DA 4C0KA 4R1EA 1Y1AA 4MRXA 1LA3A 5CPVA 3A4UB 1W7JB 4GBAA 1H4BA 4JQ0D 4L9MA 1KK7Y 3BUWB 2M3WA 1JC2A 1JBAA 2LVJA 1DJGA 1SR6C 3D10A 3BOWA 1JFJA 1NX3A 4JWQA 1F55A 2KQ6A 1OMDA 4NQGA 1OQPA 2LANA 5DKRA 1L7ZA 5I2LA 5KTYA 5DKQA 2AMIA 3CS1A 4HSZA 1UHHA 3OB2B 1AJ4A 1XK4A 2G9BA 1BR4B 1BU3A 1Y1XA 2M8UA 1F4QA 1PSBA 2JT8A 3LCPC 4TNCA 3TUYC 2JZIA 1JUOA 2HPSA 2Y1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CFD A;  2KI4 C;  1N2D A;  2BL0 C;  3KPX A;  3WHU B;  1YUR A;  5K89 A;  2QPT A;  4PAL A;  1BG1 A;  5I2O A;  1GGW A;  1S1E A;  1ZAC A;  1B9A A;  4MLW A;  1KQV A;  1E8A A;  3I5G B;  1SK6 D;  1QX7 A;  2LNK A;  1K93 D;  1OMV A;  1XFW O;  2JT0 A;  4Q04 A;  3FWB A;  2BCB A;  5IBW A;  2LAP A;  2KNE A;  3GOF A;  1PUL A;  2F33 A;  1XFU O;  1OMR A;  4GGN A;  3SG5 A;  4M2O A;  1RWY A;  2FJU B;  4ZCU A;  2ZNE A;  5KSZ A;  1NSH A;  1WY9 A;  1XYD A;  2M1K B;  3BOW B;  2GGM A;  2MJW B;  4N5X A;  5PAL A;  1RK9 A;  2JRF A;  2L4H A;  2PAL A;  5GQQ C;  4DCK A;  1DVI A;  1SW8 A;  3CTN A;  1WLZ A;  1WDC C;  4YGC B;  2BE6 A;  1YUU A;  3I5F B;  4QJ3 B;  1SBJ A;  1S5G Z;  1TCO B;  1NYA A;  5CSF A;  3F45 A;  3NSL A;  1A03 A;  3AAJ A;  3ZWH A;  2WOS A;  1A29 A;  4IL1 A;  3HCM A;  3ICB A;  1CDN A;  1BOC A;  1QAS A;  1YVL A;  3EK7 A;  1SCM B;  1VRK A;  1MUX A;  2JWW A;  3LK0 A;  4YGD B;  1XFV O;  3SG4 A;  1DJI A;  3O78 A;  1YR5 A;  5G08 A;  2ISD A;  2CT9 A;  1F70 A;  4GAO A;  2QAC A;  2ZRT A;  2Q4U A;  1TNX A;  2LV7 A;  1WLM A;  4PE1 A;  4YI8 A;  5HLO A;  1DGU A;  2LLS A;  2WCE A;  1AP4 A;  4AQJ A;  4HRG A;  1C7V A;  1M39 A;  2NLN A;  2WCB A;  4P2Y B;  2LVK A;  2ZKM X;  4A4C A;  1EJ3 A;  1SNL A;  5BPJ A;  2KI6 D;  2EC6 B;  2L98 A;  4C0J A;  3EKJ A;  1XO5 A;  4PHN A;  4BY4 A;  1TTX A;  2JC2 A;  3BQ3 A;  1L2O C;  2COL B;  2OTG C;  3CLN A;  2KOT A;  1QV0 A;  3C1V A;  2LMV A;  2WCF A;  2I94 A;  1HT9 A;  2LC5 A;  3LK1 A;  1XFX O;  5AFP A;  3QRX A;  2HF5 A;  1W7I B;  1IQ5 A;  1D1O A;  1CLM A;  1SYM A;  3JVT C;  4MZK A;  1SL9 A;  2MRD A;  2WC8 A;  1SR6 B;  1V1F A;  1TOP A;  1JWD A;  2VRG A;  2IS9 A;  2MBX A;  3VRO A;  1PRW A;  3DF0 A;  4DS7 A;  2M0R A;  2KBI A;  2KBM A;  2JTZ A;  2O5G A;  1UUS A;  2PAS A;  2Q91 A;  2ZND A;  1IRJ A;  2BKI B;  2Y1M A;  1PVA A;  2SCP A;  1S26 D;  1QVI Z;  2CNP A;  1K9P A;  3EKH A;  3TDI A;  3D0Y A;  4MEW A;  1A75 B;  2OS8 C;  3TS5 B;  1YX7 A;  1A4P A;  1CDM A;  4PE7 A;  4E68 A;  1SKT A;  3O2P A;  2KI4 B;  1DTL A;  2H2K A;  5B8I B;  4AQI A;  2L50 A;  4I5J A;  1MXE A;  4CLN A;  1DJW A;  1DF0 A;  3IQO A;  4F0Z B;  1QX5 B;  1X02 A;  3PN7 C;  3DVJ A;  1IG5 A;  1SMG A;  1WRL A;  1KK8 B;  3OP0 A;  1IJ6 A;  2MA2 A;  1F4O A;  3VRR A;  1EXR A;  1B8C A;  5AAN A;  1AJ5 A;  1C07 A;  1OOJ A;  2K2F A;  3SG2 A;  4ORA B;  2M1U A;  4YI9 A;  3RM1 A;  4I5L B;  5KU1 A;  2A4J A;  3MSE B;  1TRF A;  2F2O A;  2JPT A;  3AAK A;  1B7T Y;  4I5N B;  4WRI A;  2CBL A;  3PAT A;  1MF8 B;  3DF0 B;  4GNK B;  2BE4 A;  2I18 A;  5HKW A;  2LHL A;  4C0L A;  4GGF C;  4XJK A;  2FOT A;  3PAL A;  1KFU S;  1TNW A;  3CR5 X;  1WDC B;  1F8H A;  3VRN A;  2KFG A;  3K21 A;  1RFJ A;  1U5I B;  4YGE B;  1F54 A;  3D0Y B;  1RTP 1;  3ZNI A;  3HX4 A;  4ZCV A;  4OKH A;  1KFX S;  1B1G A;  1QLK A;  2L51 A;  2LHI A;  3LLE A;  4AOM A;  2HET A;  2K7B A;  4FQO A;  1DF0 B;  1G33 A;  1OSA A;  3FIA A;  1YRT B;  1EG3 A;  1Y6W A;  1ZFS A;  2PRU A;  1MR8 A;  3JTD B;  1CMF A;  1M46 A;  3SJS A;  1SPY A;  5HKY A;  2LM5 A;  1CFC A;  1J7Q A;  4N1G A;  2BCX A;  3BUX B;  3EK8 A;  1J1D A;  4YGA A;  2JU0 A;  3H4S E;  3CWG A;  2WOR A;  3A8R A;  1PAL A;  3VGO A;  2H61 C;  2JQ6 A;  1IJ5 A;  4YBH B;  3SIB A;  1ALW A;  2KYC A;  4D1E A;  1CFF A;  2HQ8 A;  1UWO A;  2Y5I A;  1YUS A;  3CR4 X;  3I5I C;  1QXP A;  3OX6 A;  4XJK B;  2KFH A;  2JXC A;  1XFY O;  4FTG A;  5ER5 A;  3JVT B;  3O4Y A;  1K9K A;  1BT6 A;  2KAY A;  1ZUZ A;  2EHB A;  4MZJ A;  1CDL A;  1HQV A;  4OV2 A;  4MVF A;  1M31 A;  2BKH B;  2E6W A;  2KGR A;  3EK4 A;  5CSN A;  2Y4Q A;  1XA5 A;  1K94 A;  4GGF A;  5HLV A;  2TN4 A;  1NX0 A;  1QS7 A;  1UHI A;  2FCE A;  2P6B B;  3I5G C;  2PMY A;  1DT7 B;  2M9G A;  1NCX A;  2F2P A;  3IQQ A;  1FI6 A;  2KQY A;  1KQM C;  1S6I A;  1FI5 A;  4YRU A;  1S5G Y;  4BY5 A;  1S6J A;  1NX2 A;  1B47 A;  1IQ3 A;  5HKZ A;  1UP5 A;  3KF9 A;  2KAV A;  2JXL A;  2BEC A;  1JSA A;  1SRA A;  4MZL A;  4GUK A;  1CM4 A;  2KI6 C;  3GK1 A;  1DJX A;  3PLF B;  4DUQ A;  2CXJ A;  3AKA A;  5HYD A;  1YX8 A;  2F3Z A;  1UHJ A;  4OR9 B;  3WNX B;  3PSR A;  5I8N A;  1TNQ A;  2NCP A;  1XK4 C;  3IF7 A;  4PCW A;  2H61 A;  1BMO A;  3FWC A;  3SIA A;  1OZO A;  2R2I A;  1CTR A;  1MWN A;  1RRO A;  4MBE A;  1JF0 A;  1PK0 D;  1TN4 A;  1YTZ C;  3RLZ A;  3TUY B;  3NSK A;  5AER A;  1LXF C;  1M45 A;  1DJH A;  1SL7 A;  4GFT A;  4PE4 A;  4ORB B;  1KWO C;  4OCI A;  4PHK A;  1SCM C;  1B8R A;  3EVV A;  1KK7 Z;  1TNP A;  2BL0 B;  3TZ1 A;  2I7A A;  1G4Y R;  1TIZ A;  3VRP A;  3LL8 B;  2FCD A;  2ZN8 A;  4PDZ A;  4WQ2 A;  5DKN A;  1CDP A;  3GK4 X;  1AK8 A;  3I5H C;  4USL A;  3PFV A;  1AHR A;  1BOD A;  1TCF A;  4NDB A;  4CPV A;  1SY9 A;  5D69 A;  2MAZ A;  1MQ1 A;  4ICB A;  2JTT A;  2K7O A;  1CMG A;  1N65 A;  2K7C A;  1PSR A;  1QJT A;  3NSI A;  1B4C A;  1ZMZ A;  1KCY A;  2JNX A;  3TDZ A;  1FF1 A;  1JF2 A;  1QVI Y;  1YRU B;  2M49 B;  3E3R A;  1FBV A;  4M2P A;  1UHK A;  2LP2 A;  3VRQ A;  2BCA A;  2GV5 A;  5D7F A;  1J7R A;  1AUI B;  2ZN9 A;  3BXK A;  1S6C A;  5CSI A;  3SG7 A;  1R2U A;  1NCY A;  2LUC A;  2L5X B;  4CFR A;  1S36 A;  3KO0 A;  3KEV A;  1BR1 B;  5TNC A;  2DOQ A;  1K95 A;  2LMT A;  2RGI A;  2F3Y A;  4HRE E;  1IWQ A;  3I5I B;  2JNF A;  1QLS A;  1J7O A;  2KGB C;  1LVC D;  2MLF C;  2ZFD A;  2BBM A;  2K2A A;  3CGA A;  4NDD A;  5J3X A;  1QX2 A;  2MLE C;  2KHN A;  4HRH A;  1NWD A;  2K8M B;  1CFP A;  1Q80 A;  1FW4 A;  5ER4 X;  1K8U A;  2CTN A;  3TS5 C;  2MHH A;  4UPG A;  1EL4 A;  2I2R E;  4GPL B;  1BJF A;  2F8P A;  5F6T A;  1RJV A;  1SL8 A;  1DMO A;  1B8L A;  3WXA A;  2K61 A;  4NDC A;  3DVE A;  3EVR A;  1KSM A;  1NUB A;  1ZOT B;  1YVH A;  2B1U A;  1DGV A;  2KSP A;  4N1F A;  1BF5 A;  5AXI A;  4XYN A;  1LA0 A;  1GJY A;  1KK8 C;  1KQM B;  3OHM B;  1ODB A;  2LUX A;  2OPO A;  5FYX A;  3SG6 A;  4DIR A;  2M97 A;  2LCP A;  3FS7 A;  4YGB B;  2K0J A;  2LMU A;  2LLU A;  1S3P A;  1K2H A;  1L2O B;  2OTG B;  1C7W A;  2GGZ A;  1NPQ A;  4QJ4 B;  1CLL A;  3M0W A;  2LLT A;  1REC A;  3OX5 A;  3EVU A;  2SAS A;  1K90 D;  1CLB A;  2M29 A;  2G2B A;  2ZRS A;  3CZT X;  2M7L A;  4P5O E;  1XVJ A;  1PVB A;  2KYF A;  1NX1 A;  1IH0 A;  4I5K A;  1Y1U A;  1NCZ A;  1QIV A;  2E30 A;  2NCO A;  5I2Q A;  3BYA A;  2LVI A;  1EH2 A;  1CM1 A;  2L4I A;  1K96 A;  3CR2 A;  2KAX A;  4QJ5 B;  1KFU L;  1IKU A;  2LVV A;  1UHN A;  2OS8 B;  3BUO B;  3TDU A;  5CSJ A;  3OB1 B;  1KWO B;  1QIW A;  1BLQ A;  1CKK A;  1GQM A;  1QTX A;  1CB1 A;  1AVS A;  1LIN A;  3PM8 A;  4CFQ A;  1KFX L;  4ETO A;  1N0Y A;  1XFZ O;  4ORC B;  1OZS A;  3JTD C;  1NP8 A;  3BUN B;  1YUT A;  4U8D A;  3I5H B;  4WQ3 A;  4CID A;  3PN7 B;  1UUR A;  4A4B A;  2L2E A;  1A75 A;  5AEQ A;  4MRY A;  4OVN F;  1Y0V H;  3DD4 A;  1V1G A;  1F71 A;  2LE9 B;  3DVK A;  2NXQ A;  3SG3 A;  2WND A;  1A2X A;  2EGD A;  1ALV A;  1SCV A;  1J7P A;  2KDH A;  1R6P A;  2BBN A;  2D8N A;  3I5F C;  1EG4 A;  3AKB A;  2KFF A;  1IGV A;  1K9U A;  1WRZ A;  2PVB A;  3KHE A;  2V53 A;  2AAO A;  3NSO A;  2L0P A;  4PHM A;  3GK2 A;  4PHJ A;  3BUM B;  1J1E A;  2LP3 A;  1OE9 B;  1NIW A;  1DJZ A;  3NXA A;  4MSP A;  1H8B A;  2NZ0 A;  5JOL A;  1G8I A;  3WHT B;  4DRW A;  1MXL C;  3DVM A;  5JJG A;  2CCM A;  1WRK A;  1FPW A;  1MHO A;  1QAT A;  4PE0 A;  1QV1 A;  1B7T Z;  1J55 A;  2M7N A;  1DJY A;  1JFK A;  1GGZ A;  1U5I A;  4JPZ B;  2HQW A;  2JUL A;  1KSO A;  2AUC A;  2JT3 A;  1M63 B;  1CNP A;  4MN0 A;  2PSR A;  2O60 A;  1LKJ A;  2EC6 C;  3O6B A;  4M2Q A;  2JOJ A;  2K7D A;  4C0K A;  4R1E A;  1Y1A A;  4MRX A;  1LA3 A;  5CPV A;  3A4U B;  1W7J B;  4GBA A;  1H4B A;  4JQ0 D;  4L9M A;  1KK7 Y;  3BUW B;  2M3W A;  1JC2 A;  1JBA A;  2LVJ A;  1DJG A;  1SR6 C;  3D10 A;  3BOW A;  1JFJ A;  1NX3 A;  4JWQ A;  1F55 A;  2KQ6 A;  1OMD A;  4NQG A;  1OQP A;  2LAN A;  5DKR A;  1L7Z A;  5I2L A;  5KTY A;  5DKQ A;  2AMI A;  3CS1 A;  4HSZ A;  1UHH A;  3OB2 B;  1AJ4 A;  1XK4 A;  2G9B A;  1BR4 B;  1BU3 A;  1Y1X A;  2M8U A;  1F4Q A;  1PSB A;  2JT8 A;  3LCP C;  4TNC A;  3TUY C;  2JZI A;  1JUO A;  2HPS A;  2Y1N A; 
#chains in the Genus database with same CATH topology
 1CFD A;  1XFR A;  2KI4 C;  1N2D A;  2BL0 C;  3KPX A;  3WHU B;  1YUR A;  5K89 A;  2QPT A;  4PAL A;  1BG1 A;  5I2O A;  1GGW A;  1S1E A;  1ZAC A;  1B9A A;  4MLW A;  1KQV A;  1E8A A;  3I5G B;  1SK6 D;  1QX7 A;  2LNK A;  1K93 D;  1OMV A;  1XFW O;  2JT0 A;  3IVT A;  4Q04 A;  3FWB A;  2BCB A;  5IBW A;  2LAP A;  2KNE A;  3GOF A;  1PUL A;  2F33 A;  1XFU O;  5FI2 A;  1OMR A;  4GGN A;  3DY9 A;  3SG5 A;  4M2O A;  1RWY A;  2FJU B;  4ZCU A;  2ZNE A;  5KSZ A;  1NSH A;  1WY9 A;  1XYD A;  2M1K B;  3BOW B;  2GGM A;  2MJW B;  4N5X A;  5PAL A;  1RK9 A;  2JRF A;  2L4H A;  4INX A;  3CAB A;  2PAL A;  2P70 A;  5GQQ C;  4DCK A;  1DVI A;  1SW8 A;  1DEL A;  3CTN A;  1WLZ A;  1WDC C;  4YGC B;  5I94 A;  4JD9 A;  3S0E A;  2BE6 A;  1YUU A;  3I5F B;  4QJ3 B;  1SBJ A;  1S5G Z;  1TCO B;  5DIC A;  1NYA A;  5CSF A;  3F45 A;  3NSL A;  1A03 A;  3AAJ A;  3ZWH A;  2WOS A;  1A29 A;  2WCK A;  4IL1 A;  3HCM A;  3ICB A;  1CDN A;  1BOC A;  1QAS A;  3UNW A;  1YVL A;  3EK7 A;  1SCM B;  1VRK A;  1MUX A;  2JWW A;  3LK0 A;  4YGD B;  1XFV O;  1DC1 A;  3SG4 A;  1DJI A;  3O78 A;  2KLE A;  1YR5 A;  5G08 A;  2ISD A;  2CT9 A;  1F70 A;  4GAO A;  2QAC A;  2ZRT A;  2Q4U A;  1TNX A;  2QEO A;  2LV7 A;  1WLM A;  4PE1 A;  4YI8 A;  5HLO A;  1DGU A;  2LLS A;  2WCE A;  1AP4 A;  4AQJ A;  4HRG A;  1C7V A;  1M39 A;  2NLN A;  2WCB A;  4P2Y B;  2LVK A;  2ZKM X;  4A4C A;  1EJ3 A;  1SNL A;  5BPJ A;  3L4A A;  2KI6 D;  2EC6 B;  2L98 A;  3D75 A;  3EKJ A;  1XO5 A;  4C0J A;  4PHN A;  4BY4 A;  1TTX A;  2JC2 A;  3BQ3 A;  1L2O C;  2COL B;  2OTG C;  1SSE B;  3CLN A;  2KOT A;  1QV0 A;  3C1V A;  3B6X A;  1TUJ A;  2LMV A;  2WCF A;  2I94 A;  1HT9 A;  2LC5 A;  3LK1 A;  1XFX O;  5AFP A;  3QRX A;  2ERB A;  2HF5 A;  4KYN A;  1W7I B;  1IQ5 A;  1D1O A;  1CLM A;  1SYM A;  2H8V A;  3JVT C;  1SL9 A;  4MZK A;  2MRD A;  2WC8 A;  1SR6 B;  1V1F A;  1TOP A;  1JWD A;  2VRG A;  2IS9 A;  2MBX A;  3S0D A;  3VRO A;  1PRW A;  3DF0 A;  4IJ7 A;  4DS7 A;  2M0R A;  2KBI A;  2KBM A;  3DYE A;  2JTZ A;  2O5G A;  1UUS A;  2PAS A;  2Q91 A;  2ZND A;  1IRJ A;  2BKI B;  2Y1M A;  3PM2 A;  1PVA A;  2SCP A;  1S26 D;  1QVI Z;  2CNP A;  1K9P A;  3EKH A;  3TDI A;  3D0Y A;  4MEW A;  1A75 B;  2OS8 C;  3TS5 B;  1YX7 A;  3L4L A;  1A4P A;  1CDM A;  4PE7 A;  4E68 A;  1SKT A;  3O2P A;  2KI4 B;  1DTL A;  2H2K A;  5B8I B;  4AQI A;  2L50 A;  4I5J A;  1MXE A;  4CLN A;  1DJW A;  1DF0 A;  3K1E A;  3IQO A;  4F0Z B;  1QX5 B;  1X02 A;  3PN7 C;  3DVJ A;  1IG5 A;  1SMG A;  1WRL A;  1KK8 B;  3OP0 A;  1IJ6 A;  2MA2 A;  3NGV A;  1F4O A;  3VRR A;  1EXR A;  1B8C A;  5AAN A;  1AJ5 A;  1C07 A;  1OOJ A;  2K2F A;  3SG2 A;  4ORA B;  2M1U A;  4YI9 A;  3RM1 A;  4I5L B;  5KU1 A;  3QME A;  2A4J A;  3MSE B;  1TRF A;  2F2O A;  2JPT A;  3AAK A;  1B7T Y;  4I5N B;  4WRI A;  2CBL A;  3BJH A;  2P71 A;  3PAT A;  1MF8 B;  3DF0 B;  4GNK B;  3L47 A;  2BE4 A;  2I18 A;  5HKW A;  2LHL A;  4C0L A;  4GGF C;  4XJK A;  2JPO A;  2FOT A;  3PAL A;  1KFU S;  1TNW A;  3CR5 X;  1WDC B;  1F8H A;  3VRN A;  2KFG A;  3K21 A;  1RFJ A;  1U5I B;  4YGE B;  1F54 A;  3BFA A;  3D0Y B;  1RTP 1;  3V2L A;  3ZNI A;  3HX4 A;  2WCM A;  4ZCV A;  4FQT A;  4OKH A;  1KFX S;  1B1G A;  1DEK A;  2YGU A;  1QLK A;  2L51 A;  2LHI A;  3LLE A;  4AOM A;  2HET A;  2K7B A;  2WCJ A;  4FQO A;  1DF0 B;  3D77 A;  5FI6 A;  1G33 A;  1OSA A;  3FIA A;  1YRT B;  1EG3 A;  1Y6W A;  1ZFS A;  2PRU A;  3VB1 A;  1MR8 A;  3JTD B;  1CMF A;  1M46 A;  3SJS A;  1SPY A;  5HKY A;  2LM5 A;  1CFC A;  1J7Q A;  3FE8 A;  2BCX A;  3BUX B;  4N1G A;  3EK8 A;  1J1D A;  4YGA A;  2JU0 A;  3H4S E;  3R1P A;  3CWG A;  2WOR A;  3A8R A;  1PAL A;  3VGO A;  2H61 C;  2JQ6 A;  1IJ5 A;  4YBH B;  3FE6 A;  2WC5 A;  1ALW A;  3SIB A;  2KYC A;  4D1E A;  1CFF A;  2HQ8 A;  1UWO A;  2Y5I A;  1YUS A;  3CR4 X;  3I5I C;  1QXP A;  3OX6 A;  4XJK B;  1C3Y A;  2KFH A;  3CDN A;  3D76 A;  2JXC A;  1XFY O;  4FTG A;  5ER5 A;  2WCL A;  3JVT B;  3O4Y A;  5FI7 A;  3B86 A;  1K9K A;  1BT6 A;  2KAY A;  1ZUZ A;  2EHB A;  4MZJ A;  1CDL A;  1HQV A;  5D3O A;  4OV2 A;  4MVF A;  1M31 A;  2BKH B;  2E6W A;  2KGR A;  3BFB A;  3EK4 A;  2Y4Q A;  5CSN A;  1XA5 A;  1K94 A;  1Z2C B;  4GGF A;  5HLV A;  2TN4 A;  3CZ0 A;  1NX0 A;  2KLD A;  1QS7 A;  3S0B A;  1UHI A;  2FCE A;  2KPH A;  2P6B B;  1OOH A;  2PMY A;  3I5G C;  2M9G A;  3S0G A;  1DT7 B;  2QDI A;  1NCX A;  2F2P A;  3IQQ A;  1FI6 A;  2KQY A;  1KQM C;  1S6I A;  1FI5 A;  4YRU A;  1S5G Y;  4BY5 A;  1S6J A;  5HL1 A;  1NX2 A;  1GM0 A;  1B47 A;  1IQ3 A;  5HKZ A;  1UP5 A;  3KF9 A;  2KAV A;  1OW4 A;  2JXL A;  2BEC A;  1JSA A;  1SRA A;  3DXL A;  4MZL A;  4GUK A;  1CM4 A;  2KI6 C;  3GK1 A;  1DJX A;  3PLF B;  3R1V A;  4DUQ A;  2CXJ A;  3AKA A;  5HYD A;  1YX8 A;  3S0F A;  2F3Z A;  2BAP A;  1UHJ A;  4OR9 B;  3WNX B;  3PSR A;  5I8N A;  1TNQ A;  2NCP A;  1XK4 C;  3IF7 A;  4PCW A;  2H61 A;  1BMO A;  3FWC A;  3SIA A;  3O4X A;  1OZO A;  2R2I A;  1CTR A;  1MWN A;  1RRO A;  4MBE A;  1JF0 A;  1PK0 D;  1TN4 A;  1YTZ C;  3RLZ A;  3TUY B;  3NSK A;  5AER A;  1LXF C;  1M45 A;  1DJH A;  1SL7 A;  4GFT A;  4PE4 A;  4ORB B;  1KWO C;  4OCI A;  4PHK A;  1QWV A;  1SCM C;  1B8R A;  3EVV A;  1KK7 Z;  1TNP A;  2BL0 B;  3TZ1 A;  2I7A A;  1G4Y R;  1TIZ A;  3VRP A;  3LL8 B;  2FCD A;  2ZN8 A;  3EG5 B;  4PDZ A;  4WQ2 A;  5DKN A;  1CDP A;  3SS5 A;  3GK4 X;  1AK8 A;  3I5H C;  4USL A;  3PFV A;  1AHR A;  1BOD A;  1TCF A;  3B7A A;  4NDB A;  4CPV A;  1LS8 A;  1T14 A;  1SY9 A;  5D69 A;  2MAZ A;  1MQ1 A;  4ICB A;  2JTT A;  2K7O A;  4OZD A;  1CMG A;  1N65 A;  2K7C A;  1PSR A;  1QJT A;  3NSI A;  1B4C A;  1ZMZ A;  1KCY A;  2JNX A;  3TDZ A;  3UO9 A;  1FF1 A;  1JF2 A;  1QVI Y;  1YRU B;  2M49 B;  3E3R A;  1FBV A;  4M2P A;  5EL2 A;  1UHK A;  2LP2 A;  3BFH A;  3NHI A;  3VRQ A;  2BCA A;  2GV5 A;  3OBV A;  1J7R A;  1AUI B;  3R72 A;  5D7F A;  2ZN9 A;  3BXK A;  1S6C A;  5CSI A;  3SG7 A;  1R2U A;  1NCY A;  2LUC A;  2L5X B;  4CFR A;  1S36 A;  3KO0 A;  3KEV A;  1BR1 B;  5TNC A;  2DOQ A;  1K95 A;  2LMT A;  2RGI A;  2F3Y A;  3OGN A;  4HRE E;  1IWQ A;  3I5I B;  2QEH A;  2JNF A;  1QLS A;  3RZS A;  1J7O A;  3NHT A;  2KGB C;  1LVC D;  1OOF A;  2BNX A;  2MLF C;  2ZFD A;  2BBM A;  2K2A A;  3CGA A;  4NDD A;  5J3X A;  1QX2 A;  3SS3 A;  2MLE C;  2KHN A;  4HRH A;  1NWD A;  2K8M B;  1CFP A;  1Q80 A;  1FW4 A;  5ER4 X;  1K8U A;  2CTN A;  3TS5 C;  2MHH A;  4UPG A;  1EL4 A;  2I2R E;  4GPL B;  1BJF A;  2F8P A;  1IIO A;  5F6T A;  1RJV A;  1SL8 A;  1DMO A;  1B8L A;  3WXA A;  2K61 A;  2L2C A;  4NDC A;  3DVE A;  3EVR A;  1KSM A;  1ORG A;  3B88 A;  1NUB A;  1ZOT B;  1YVH A;  2B1U A;  1DGV A;  2KSP A;  4N1F A;  1BF5 A;  5AXI A;  4XYN A;  1LA0 A;  1GJY A;  1KK8 C;  1KQM B;  3OHM B;  1ODB A;  2LUX A;  2OPO A;  5FYX A;  3SG6 A;  4DIR A;  2M97 A;  2LCP A;  3FS7 A;  4YGB B;  2K0J A;  2LMU A;  2LLU A;  1S3P A;  1K2H A;  1L2O B;  3D78 A;  2OTG B;  1C7W A;  2GGZ A;  1NPQ A;  4QJ4 B;  1CLL A;  3M0W A;  2LLT A;  1REC A;  3OX5 A;  3EVU A;  2SAS A;  1K90 D;  1W9Z A;  1CLB A;  2M29 A;  2G2B A;  2ZRS A;  3CZT X;  2M7L A;  1OOG A;  1XVJ A;  4P5O E;  1PVB A;  2KYF A;  1NX1 A;  1IH0 A;  2L5Y A;  1Y1U A;  1NCZ A;  1QIV A;  3PJI A;  4I5K A;  2E30 A;  2NCO A;  1TWO A;  5I2Q A;  3BYA A;  2LVI A;  3CZ1 A;  1CM1 A;  1EH2 A;  2L4I A;  1K96 A;  3CR2 A;  2KAX A;  4QJ5 B;  1KFU L;  1IKU A;  2LVV A;  1UHN A;  2OS8 B;  3BUO B;  3TDU A;  5CSJ A;  3OB1 B;  1KWO B;  4F7F A;  1QIW A;  1BLQ A;  1CKK A;  1C3Z A;  1GQM A;  1QTX A;  3R1O A;  1AVS A;  1CB1 A;  1LIN A;  3PM8 A;  4CFQ A;  1KFX L;  4ETO A;  1N0Y A;  2PYQ A;  3S0A A;  1XFZ O;  4ORC B;  1OZS A;  3JTD C;  1NP8 A;  3BUN B;  1YUT A;  4U8D A;  3I5H B;  4WQ3 A;  4CID A;  3CYZ A;  3PN7 B;  1UUR A;  4A4B A;  2L2E A;  1A75 A;  5AEQ A;  4MRY A;  4OVN F;  1Y0V H;  3DD4 A;  1P28 A;  1V1G A;  1F71 A;  2LE9 B;  3DVK A;  2NXQ A;  2PQL A;  3SG3 A;  2WND A;  1A2X A;  2EGD A;  1ALV A;  1SCV A;  1J7P A;  2KDH A;  1R6P A;  2BBN A;  4INW A;  2D8N A;  3I5F C;  1EG4 A;  3AKB A;  2KFF A;  1IGV A;  1K9U A;  1WRZ A;  2PVB A;  3FE9 A;  3KHE A;  2V53 A;  2AAO A;  3NSO A;  2L0P A;  4PHM A;  2QEB A;  3GK2 A;  4PHJ A;  3BUM B;  1J1E A;  2LP3 A;  1OE9 B;  1NIW A;  1TUZ A;  1DJZ A;  3NXA A;  4MSP A;  1H8B A;  2NZ0 A;  5JOL A;  1G8I A;  3WHT B;  3Q8I A;  4DRW A;  1MXL C;  3DZT A;  3DVM A;  5JJG A;  2CCM A;  1WRK A;  1FPW A;  2QEV A;  1MHO A;  1QAT A;  4PE0 A;  1QV1 A;  1B7T Z;  1J55 A;  2M7N A;  1DJY A;  1JFK A;  1GGZ A;  1U5I A;  4JPZ B;  2HQW A;  2JUL A;  1KSO A;  2AUC A;  2JT3 A;  1M63 B;  1CNP A;  4MN0 A;  3SS4 A;  3N7H A;  2PSR A;  2O60 A;  2FJY A;  1LKJ A;  2EC6 C;  3O6B A;  3B87 A;  4M2Q A;  2K60 A;  2JOJ A;  2K7D A;  4C0K A;  2WC6 A;  1Y1A A;  4MRX A;  4R1E A;  1LA3 A;  5CPV A;  3D74 A;  3A4U B;  1W7J B;  4GBA A;  1H4B A;  4JQ0 D;  4L9M A;  1KK7 Y;  3BUW B;  2M3W A;  1JC2 A;  1JBA A;  2LVJ A;  1DJG A;  3D73 A;  1DQE A;  4PT1 A;  1SR6 C;  3D10 A;  3BOW A;  1JFJ A;  1Z4H A;  1NX3 A;  4JWQ A;  1F55 A;  2KQ6 A;  3CZ2 A;  1OMD A;  4NQG A;  1OQP A;  2LAN A;  5DKR A;  1L7Z A;  2GTE A;  5I2L A;  5KTY A;  5DKQ A;  2AMI A;  3CS1 A;  4HSZ A;  1UHH A;  3OB2 B;  1AJ4 A;  1XK4 A;  2G9B A;  1BR4 B;  1BU3 A;  1OOI X;  1Y1X A;  2M8U A;  1F4Q A;  1PSB A;  2JT8 A;  3LCP C;  4TNC A;  3TUY C;  2JZI A;  1JUO A;  4JKT A;  2HPS A;  2Y1N A;  2WCH A; 
#chains in the Genus database with same CATH homology
 1CFD A;  2KI4 C;  1N2D A;  2BL0 C;  3KPX A;  3WHU B;  1YUR A;  5K89 A;  2QPT A;  4PAL A;  1BG1 A;  5I2O A;  1GGW A;  1S1E A;  1ZAC A;  1B9A A;  4MLW A;  1KQV A;  1E8A A;  3I5G B;  1SK6 D;  1QX7 A;  2LNK A;  1K93 D;  1OMV A;  1XFW O;  2JT0 A;  4Q04 A;  3FWB A;  2BCB A;  5IBW A;  2LAP A;  2KNE A;  3GOF A;  1PUL A;  2F33 A;  1XFU O;  1OMR A;  4GGN A;  3SG5 A;  4M2O A;  1RWY A;  2FJU B;  4ZCU A;  2ZNE A;  5KSZ A;  1NSH A;  1WY9 A;  1XYD A;  2M1K B;  3BOW B;  2GGM A;  2MJW B;  4N5X A;  5PAL A;  1RK9 A;  2JRF A;  2L4H A;  2PAL A;  5GQQ C;  4DCK A;  1DVI A;  1SW8 A;  3CTN A;  1WLZ A;  1WDC C;  4YGC B;  2BE6 A;  1YUU A;  3I5F B;  4QJ3 B;  1SBJ A;  1S5G Z;  1TCO B;  1NYA A;  5CSF A;  3F45 A;  3NSL A;  1A03 A;  3AAJ A;  3ZWH A;  2WOS A;  1A29 A;  4IL1 A;  3HCM A;  3ICB A;  1CDN A;  1BOC A;  1QAS A;  1YVL A;  3EK7 A;  1SCM B;  1VRK A;  1MUX A;  2JWW A;  3LK0 A;  4YGD B;  1XFV O;  3SG4 A;  1DJI A;  3O78 A;  1YR5 A;  5G08 A;  2ISD A;  2CT9 A;  1F70 A;  4GAO A;  2QAC A;  2ZRT A;  2Q4U A;  1TNX A;  2LV7 A;  1WLM A;  4PE1 A;  4YI8 A;  5HLO A;  1DGU A;  2LLS A;  2WCE A;  1AP4 A;  4AQJ A;  4HRG A;  1C7V A;  1M39 A;  2NLN A;  2WCB A;  4P2Y B;  2LVK A;  2ZKM X;  4A4C A;  1EJ3 A;  1SNL A;  5BPJ A;  2KI6 D;  2EC6 B;  2L98 A;  4C0J A;  3EKJ A;  1XO5 A;  4PHN A;  4BY4 A;  1TTX A;  2JC2 A;  3BQ3 A;  1L2O C;  2COL B;  2OTG C;  3CLN A;  2KOT A;  1QV0 A;  3C1V A;  2LMV A;  2WCF A;  2I94 A;  1HT9 A;  2LC5 A;  3LK1 A;  1XFX O;  5AFP A;  3QRX A;  2HF5 A;  1W7I B;  1IQ5 A;  1D1O A;  1CLM A;  1SYM A;  3JVT C;  4MZK A;  1SL9 A;  2MRD A;  2WC8 A;  1SR6 B;  1V1F A;  1TOP A;  1JWD A;  2VRG A;  2IS9 A;  2MBX A;  3VRO A;  1PRW A;  3DF0 A;  4DS7 A;  2M0R A;  2KBI A;  2KBM A;  2JTZ A;  2O5G A;  1UUS A;  2PAS A;  2Q91 A;  2ZND A;  1IRJ A;  2BKI B;  2Y1M A;  1PVA A;  2SCP A;  1S26 D;  1QVI Z;  2CNP A;  1K9P A;  3EKH A;  3TDI A;  3D0Y A;  4MEW A;  1A75 B;  2OS8 C;  3TS5 B;  1YX7 A;  1A4P A;  1CDM A;  4PE7 A;  4E68 A;  1SKT A;  3O2P A;  2KI4 B;  1DTL A;  2H2K A;  5B8I B;  4AQI A;  2L50 A;  4I5J A;  1MXE A;  4CLN A;  1DJW A;  1DF0 A;  3IQO A;  4F0Z B;  1QX5 B;  1X02 A;  3PN7 C;  3DVJ A;  1IG5 A;  1SMG A;  1WRL A;  1KK8 B;  3OP0 A;  1IJ6 A;  2MA2 A;  1F4O A;  3VRR A;  1EXR A;  1B8C A;  5AAN A;  1AJ5 A;  1C07 A;  1OOJ A;  2K2F A;  3SG2 A;  4ORA B;  2M1U A;  4YI9 A;  3RM1 A;  4I5L B;  5KU1 A;  2A4J A;  3MSE B;  1TRF A;  2F2O A;  2JPT A;  3AAK A;  1B7T Y;  4I5N B;  4WRI A;  2CBL A;  3PAT A;  1MF8 B;  3DF0 B;  4GNK B;  2BE4 A;  2I18 A;  5HKW A;  2LHL A;  4C0L A;  4GGF C;  4XJK A;  2FOT A;  3PAL A;  1KFU S;  1TNW A;  3CR5 X;  1WDC B;  1F8H A;  3VRN A;  2KFG A;  3K21 A;  1RFJ A;  1U5I B;  4YGE B;  1F54 A;  3D0Y B;  1RTP 1;  3ZNI A;  3HX4 A;  4ZCV A;  4OKH A;  1KFX S;  1B1G A;  1QLK A;  2L51 A;  2LHI A;  3LLE A;  4AOM A;  2HET A;  2K7B A;  4FQO A;  1DF0 B;  1G33 A;  1OSA A;  3FIA A;  1YRT B;  1EG3 A;  1Y6W A;  1ZFS A;  2PRU A;  1MR8 A;  3JTD B;  1CMF A;  1M46 A;  3SJS A;  1SPY A;  5HKY A;  2LM5 A;  1CFC A;  1J7Q A;  4N1G A;  2BCX A;  3BUX B;  3EK8 A;  1J1D A;  4YGA A;  2JU0 A;  3H4S E;  3CWG A;  2WOR A;  3A8R A;  1PAL A;  3VGO A;  2H61 C;  2JQ6 A;  1IJ5 A;  4YBH B;  3SIB A;  1ALW A;  2KYC A;  4D1E A;  1CFF A;  2HQ8 A;  1UWO A;  2Y5I A;  1YUS A;  3CR4 X;  3I5I C;  1QXP A;  3OX6 A;  4XJK B;  2KFH A;  2JXC A;  1XFY O;  4FTG A;  5ER5 A;  3JVT B;  3O4Y A;  1K9K A;  1BT6 A;  2KAY A;  1ZUZ A;  2EHB A;  4MZJ A;  1CDL A;  1HQV A;  4OV2 A;  4MVF A;  1M31 A;  2BKH B;  2E6W A;  2KGR A;  3EK4 A;  5CSN A;  2Y4Q A;  1XA5 A;  1K94 A;  4GGF A;  5HLV A;  2TN4 A;  1NX0 A;  1QS7 A;  1UHI A;  2FCE A;  2P6B B;  3I5G C;  2PMY A;  1DT7 B;  2M9G A;  1NCX A;  2F2P A;  3IQQ A;  1FI6 A;  2KQY A;  1KQM C;  1S6I A;  1FI5 A;  4YRU A;  1S5G Y;  4BY5 A;  1S6J A;  1NX2 A;  1B47 A;  1IQ3 A;  5HKZ A;  1UP5 A;  3KF9 A;  2KAV A;  2JXL A;  2BEC A;  1JSA A;  1SRA A;  4MZL A;  4GUK A;  1CM4 A;  2KI6 C;  3GK1 A;  1DJX A;  3PLF B;  4DUQ A;  2CXJ A;  3AKA A;  5HYD A;  1YX8 A;  2F3Z A;  1UHJ A;  4OR9 B;  3WNX B;  3PSR A;  5I8N A;  1TNQ A;  2NCP A;  1XK4 C;  3IF7 A;  4PCW A;  2H61 A;  1BMO A;  3FWC A;  3SIA A;  1OZO A;  2R2I A;  1CTR A;  1MWN A;  1RRO A;  4MBE A;  1JF0 A;  1PK0 D;  1TN4 A;  1YTZ C;  3RLZ A;  3TUY B;  3NSK A;  5AER A;  1LXF C;  1M45 A;  1DJH A;  1SL7 A;  4GFT A;  4PE4 A;  4ORB B;  1KWO C;  4OCI A;  4PHK A;  1SCM C;  1B8R A;  3EVV A;  1KK7 Z;  1TNP A;  2BL0 B;  3TZ1 A;  2I7A A;  1G4Y R;  1TIZ A;  3VRP A;  3LL8 B;  2FCD A;  2ZN8 A;  4PDZ A;  4WQ2 A;  5DKN A;  1CDP A;  3GK4 X;  1AK8 A;  3I5H C;  4USL A;  3PFV A;  1AHR A;  1BOD A;  1TCF A;  4NDB A;  4CPV A;  1SY9 A;  5D69 A;  2MAZ A;  1MQ1 A;  4ICB A;  2JTT A;  2K7O A;  1CMG A;  1N65 A;  2K7C A;  1PSR A;  1QJT A;  3NSI A;  1B4C A;  1ZMZ A;  1KCY A;  2JNX A;  3TDZ A;  1FF1 A;  1JF2 A;  1QVI Y;  1YRU B;  2M49 B;  3E3R A;  1FBV A;  4M2P A;  1UHK A;  2LP2 A;  3VRQ A;  2BCA A;  2GV5 A;  5D7F A;  1J7R A;  1AUI B;  2ZN9 A;  3BXK A;  1S6C A;  5CSI A;  3SG7 A;  1R2U A;  1NCY A;  2LUC A;  2L5X B;  4CFR A;  1S36 A;  3KO0 A;  3KEV A;  1BR1 B;  5TNC A;  2DOQ A;  1K95 A;  2LMT A;  2RGI A;  2F3Y A;  4HRE E;  1IWQ A;  3I5I B;  2JNF A;  1QLS A;  1J7O A;  2KGB C;  1LVC D;  2MLF C;  2ZFD A;  2BBM A;  2K2A A;  3CGA A;  4NDD A;  5J3X A;  1QX2 A;  2MLE C;  2KHN A;  4HRH A;  1NWD A;  2K8M B;  1CFP A;  1Q80 A;  1FW4 A;  5ER4 X;  1K8U A;  2CTN A;  3TS5 C;  2MHH A;  4UPG A;  1EL4 A;  2I2R E;  4GPL B;  1BJF A;  2F8P A;  5F6T A;  1RJV A;  1SL8 A;  1DMO A;  1B8L A;  3WXA A;  2K61 A;  4NDC A;  3DVE A;  3EVR A;  1KSM A;  1NUB A;  1ZOT B;  1YVH A;  2B1U A;  1DGV A;  2KSP A;  4N1F A;  1BF5 A;  5AXI A;  4XYN A;  1LA0 A;  1GJY A;  1KK8 C;  1KQM B;  3OHM B;  1ODB A;  2LUX A;  2OPO A;  5FYX A;  3SG6 A;  4DIR A;  2M97 A;  2LCP A;  3FS7 A;  4YGB B;  2K0J A;  2LMU A;  2LLU A;  1S3P A;  1K2H A;  1L2O B;  2OTG B;  1C7W A;  2GGZ A;  1NPQ A;  4QJ4 B;  1CLL A;  3M0W A;  2LLT A;  1REC A;  3OX5 A;  3EVU A;  2SAS A;  1K90 D;  1CLB A;  2M29 A;  2G2B A;  2ZRS A;  3CZT X;  2M7L A;  4P5O E;  1XVJ A;  1PVB A;  2KYF A;  1NX1 A;  1IH0 A;  4I5K A;  1Y1U A;  1NCZ A;  1QIV A;  2E30 A;  2NCO A;  5I2Q A;  3BYA A;  2LVI A;  1EH2 A;  1CM1 A;  2L4I A;  1K96 A;  3CR2 A;  2KAX A;  4QJ5 B;  1KFU L;  1IKU A;  2LVV A;  1UHN A;  2OS8 B;  3BUO B;  3TDU A;  5CSJ A;  3OB1 B;  1KWO B;  1QIW A;  1BLQ A;  1CKK A;  1GQM A;  1QTX A;  1CB1 A;  1AVS A;  1LIN A;  3PM8 A;  4CFQ A;  1KFX L;  4ETO A;  1N0Y A;  1XFZ O;  4ORC B;  1OZS A;  3JTD C;  1NP8 A;  3BUN B;  1YUT A;  4U8D A;  3I5H B;  4WQ3 A;  4CID A;  3PN7 B;  1UUR A;  4A4B A;  2L2E A;  1A75 A;  5AEQ A;  4MRY A;  4OVN F;  1Y0V H;  3DD4 A;  1V1G A;  1F71 A;  2LE9 B;  3DVK A;  2NXQ A;  3SG3 A;  2WND A;  1A2X A;  2EGD A;  1ALV A;  1SCV A;  1J7P A;  2KDH A;  1R6P A;  2BBN A;  2D8N A;  3I5F C;  1EG4 A;  3AKB A;  2KFF A;  1IGV A;  1K9U A;  1WRZ A;  2PVB A;  3KHE A;  2V53 A;  2AAO A;  3NSO A;  2L0P A;  4PHM A;  3GK2 A;  4PHJ A;  3BUM B;  1J1E A;  2LP3 A;  1OE9 B;  1NIW A;  1DJZ A;  3NXA A;  4MSP A;  1H8B A;  2NZ0 A;  5JOL A;  1G8I A;  3WHT B;  4DRW A;  1MXL C;  3DVM A;  5JJG A;  2CCM A;  1WRK A;  1FPW A;  1MHO A;  1QAT A;  4PE0 A;  1QV1 A;  1B7T Z;  1J55 A;  2M7N A;  1DJY A;  1JFK A;  1GGZ A;  1U5I A;  4JPZ B;  2HQW A;  2JUL A;  1KSO A;  2AUC A;  2JT3 A;  1M63 B;  1CNP A;  4MN0 A;  2PSR A;  2O60 A;  1LKJ A;  2EC6 C;  3O6B A;  4M2Q A;  2JOJ A;  2K7D A;  4C0K A;  4R1E A;  1Y1A A;  4MRX A;  1LA3 A;  5CPV A;  3A4U B;  1W7J B;  4GBA A;  1H4B A;  4JQ0 D;  4L9M A;  1KK7 Y;  3BUW B;  2M3W A;  1JC2 A;  1JBA A;  2LVJ A;  1DJG A;  1SR6 C;  3D10 A;  3BOW A;  1JFJ A;  1NX3 A;  4JWQ A;  1F55 A;  2KQ6 A;  1OMD A;  4NQG A;  1OQP A;  2LAN A;  5DKR A;  1L7Z A;  5I2L A;  5KTY A;  5DKQ A;  2AMI A;  3CS1 A;  4HSZ A;  1UHH A;  3OB2 B;  1AJ4 A;  1XK4 A;  2G9B A;  1BR4 B;  1BU3 A;  1Y1X A;  2M8U A;  1F4Q A;  1PSB A;  2JT8 A;  3LCP C;  4TNC A;  3TUY C;  2JZI A;  1JUO A;  2HPS A;  2Y1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...