3D73A

Crystal structure of a pheromone binding protein mutant d35a, from apis mellifera, at ph 7.0
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
119
structure length
119
Chain Sequence
APDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVAKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pheromone binding protein
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
total genus 38
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3d73A00
3RZSA 2WCMA 3FE9A 3B6XA 3BFBA 3D74A 1OOFA 3CZ0A 1OOGA 2P71A 3CABA 2WCHA 2H8VA 3K1EA 3PJIA 3S0FA 3R1VA 1OOHA 3D77A 3B88A 1TUJA 2PQLA 3V2LA 3OGNA 4JD9A 2WCKA 1QWVA 3R1OA 2QEOA 1C3ZA 3NHTA 2P70A 1C3YA 3L47A 3L4AA 1P28A 3L4LA 3R72A 2L2CA 3BFAA 1T14A 4INWA 2WC5A 3NHIA 2QEHA 2WC6A 1LS8A 2FJYA 3VB1A 3NGVA 4FQTA 2WCJA 2ERBA 1GM0A 2QEVA 3CYZA 3B86A 2QDIA 2QEBA 1XFRA 1OW4A 3S0AA 4F7FA 3B7AA 3BJHA 3R1PA 3D73A 3D76A 3S0BA 1DQEA 3D78A 4OZDA 1TWOA 3BFHA 3DXLA 3CDNA 3CZ2A 3S0DA 2WCLA 3CZ1A 3DY9A 3FE8A 1OOIX 3N7HA 5EL2A 2GTEA 3Q8IA 3S0GA 1ORGA 3S0EA 4PT1A 5DICA 4INXA 3D75A 2JPOA 3FE6A 3B87A 3DZTA 3DYEA 3QMEA 2KPHA
chains in the Genus database with same CATH superfamily
1AVSA 1B9AA 1DMOA 5FYXA 4OV2A 1YTZC 3PSRA 4JWQA 2LMUA 1YUSA 4L9MA 2WC8A 2JC2A 3VGOA 3CABA 4JPZB 3WHUB 1AJ4A 1NX0A 1XO5A 4IL1A 3WNXB 3I5GC 1U5IB 3K1EA 1Y1UA 3PJIA 3SJSA 3BUXB 3DVEA 4ICBA 2JOJA 1K96A 1FI6A 2JRFA 2BL0C 1AUIB 2LM5A 4OR9B 1R2UA 1CLBA 1TUJA 1RECA 3PFVA 1L2OB 4YGEB 4NQGA 1FBVA 1WRLA 3V2LA 1KWOB 1CFFA 4MN0A 4QJ5B 1K95A 2O5GA 1UHNA 2KI6D 1JF2A 2RGIA 4F0ZB 1KK8B 1S6JA 1MWNA 1F4QA 2CXJA 1AK8A 1C3ZA 2O60A 3EG5B 2CT9A 4BY4A 4PHNA 2G2BA 2P70A 1SNLA 1UHJA 2K0JA 2M3WA 2M9GA 3EK7A 4WQ3A 1A4PA 4YRUA 3I5IB 1FF1A 1SKTA 1IJ6A 2Q4UA 3EKHA 3KEVA 1SMGA 1B8LA 1S6IA 1XK4A 2WC5A 1QIWA 4YGDB 2R2IA 1UP5A 1OMRA 2QEHA 2H2KA 2HETA 2K8MB 3VB1A 1DJZA 5HL1A 1M39A 2LLUA 5AXIA 2LVJA 4CPVA 3JVTB 1CDNA 2KNEA 1QASA 2CNPA 2L98A 3LLEA 1H8BA 2KSPA 3CYZA 2KI4B 2JXCA 1NWDA 1YVHA 3CGAA 1CFPA 3SG7A 2QDIA 3PN7B 2Y1NA 4USLA 1ZUZA 3GK4X 1IIOA 1IWQA 2LLTA 3O6BA 4WRIA 3B7AA 2K7OA 2LHLA 1QVIZ 3D73A 1QATA 1M31A 5CSIA 3CR2A 4M2QA 1EXRA 3K21A 1PVAA 2LUXA 2CBLA 2LP2A 4MZKA 1F54A 1TWOA 2JPTA 2JNFA 2NCOA 2JT8A 3DF0B 4NDBA 2PASA 2BCBA 5IBWA 1XYDA 4MRXA 3RM1A 1CKKA 1W7IB 4XJKB 1F8HA 1CMGA 5GQQC 3I5GB 3N7HA 1DT7B 1DJYA 1QLSA 3CR5X 2F3ZA 2WCFA 3D10A 1TTXA 3LCPC 5HLVA 2KHNA 2JULA 1QX2A 1KFUL 2BL0B 1M46A 2I7AA 2KOTA 2LMVA 3S0EA 2KFHA 4PT1A 3OB2B 5DICA 3DVJA 2ZN9A 3CZTX 1B7TY 1K9PA 1NCZA 4HSZA 1CLLA 1J7RA 4YBHB 1J7PA 3OHMB 1WDCC 2JPOA 2L0PA 1B8CA 3GK1A 2ZRSA 4GFTA 1NPQA 1RJVA 4NDDA 2LLSA 3VRQA 2LVKA 5J3XA 2E30A 2F2OA 4BY5A 1PK0D 1BU3A 2I18A 3CS1A 1EG4A 3UNWA 5KSZA 1CMFA 2LUCA 4M2OA 4U8DA 2H61A 2B1UA 1HT9A 1XVJA 3B6XA 1WLZA 2LC5A 3SG4A 3BOWA 2LNKA 1IG5A 2F33A 1DVIA 4GGFA 1OOFA 2MA2A 3IF7A 1GGZA 4MEWA 2E6WA 1IQ3A 4R1EA 1N65A 1RWYA 2M1KB 1JSAA 1SYMA 3NSIA 3SS5A 3EKJA 2I94A 2SCPA 3R1VA 2Q91A 3VRPA 2KI4C 1G33A 1OOHA 2WCEA 3FIAA 2FCEA 3B88A 5TNCA 1A75A 1KK7Y 4PDZA 2K7CA 3OX5A 4A4BA 4CIDA 5ER5A 3TZ1A 1OMDA 4I5LB 1LXFC 4MZLA 1TRFA 3FWCA 3NSLA 4CFQA 3M0WA 1CLMA 1KFUS 1CB1A 5ER4X 2K7BA 3MSEB 5D69A 2QEOA 1OOJA 2AMIA 1D1OA 3EK4A 3L47A 4E68A 3LK0A 1K9KA 1P28A 3L4LA 3SIBA 1Z4HA 1F71A 2EC6B 3NSOA 1QXPA 4ORBB 1S26D 2JT3A 4MVFA 3PATA 1CDPA 1QIVA 3E3RA 1BJFA 3FS7A 2ZN8A 2PALA 3BFAA 2JXLA 4INWA 1MQ1A 4MZJA 3NHIA 3VRNA 2OS8B 3BQ3A 1SK6D 2WC6A 1LS8A 5DKNA 1UHKA 2LV7A 3QRXA 5HKYA 1AJ5A 2GGZA 2H61C 2WCJA 1CTRA 1K8UA 2ERBA 2Y1MA 1GM0A 2Y5IA 1OQPA 3OBVA 3SG5A 1WDCB 2MBXA 3SG2A 1EL4A 3F45A 5HLOA 1TN4A 1S36A 4P2YB 1SCVA 1TOPA 2NCPA 1YVLA 3CR4X 3S0AA 1NCYA 4PALA 2KAXA 5HKZA 2LHIA 5BPJA 3R1PA 2BKIB 2LVVA 3S0BA 1SSEB 3PLFB 5G08A 3PALA 1C07A 1WRKA 1FI5A 3O78A 1LINA 1K93D 1U5IA 1JC2A 1KSOA 2F3YA 3CDNA 3CZ2A 2M7LA 1BMOA 2K60A 1FW4A 1QS7A 1QJTA 2WCLA 3CZ1A 1KQMC 2DOQA 3IVTA 5HYDA 3PM8A 2L5XB 2GTEA 1QV1A 2JT0A 1OSAA 1R6PA 1YUTA 4DUQA 1EG3A 1L7ZA 2K2FA 3S0GA 2G9BA 1DF0B 1OMVA 2L4IA 3TDZA 1B47A 1ZOTB 4C0JA 1EH2A 1DJXA 3O4XA 4P5OE 1C7VA 2BNXA 1XFYO 5I2LA 3DYEA 5JOLA 2ZNDA 5CSFA 3ZNIA 3VRRA 3QMEA 1Y1AA 4ZCUA 1W7JB 2GGMA 3GK2A 1G4YR 1DEKA 2QPTA 3LL8B 4PHMA 3RZSA 1F55A 2EC6C 1BLQA 2VRGA 3ICBA 1S5GY 3FE9A 3SG6A 1XFVO 1NP8A 2MAZA 2L5YA 2FJUB 1BG1A 4PE1A 1W9ZA 2CTNA 1UHIA 1F70A 1MR8A 3D74A 1F4OA 5AFPA 1GGWA 2OS8C 5I94A 2ZRTA 1NSHA 1OOGA 2YGUA 3JTDB 5D3OA 2H8VA 4TNCA 1SCMC 5CSJA 2ISDA 4DS7A 3S0FA 1PRWA 2D8NA 5FI2A 2IS9A 2M97A 4MRYA 1B1GA 2L2EA 1PSRA 1SL7A 3BUMB 3I5FC 1YRUB 1QX5B 3A4UB 3D77A 1UWOA 2WORA 1LKJA 2BCAA 1XK4C 1BODA 3SS3A 2KLDA 3RLZA 1JUOA 1YURA 2JU0A 3CWGA 3OGNA 4JD9A 4A4CA 2WCKA 2LANA 2PMYA 2HQWA 5B8IB 4NDCA 3D0YA 2L4HA 4I5NB 1S5GZ 3R1OA 3PM2A 1IRJA 4I5JA 1JFKA 4MLWA 5PALA 3SG3A 3NHTA 5AERA 1OZSA 2MHHA 1BR4B 2L50A 1TNWA 2I2RE 3GOFA 1KFXS 2BE4A 3I5HB 5AEQA 4GBAA 4GGNA 1ALWA 1DTLA 2BE6A 4OKHA 4OVNF 3R72A 4N1GA 2WCBA 1KQMB 4C0KA 4UPGA 1TCFA 2MJWB 1B7TZ 2M7NA 1B4CA 1IKUA 2KBMA 1C3YA 2LE9B 4DIRA 1A03A 1SW8A 2HPSA 3BUWB 1K2HA 1RK9A 2KGRA 1S3PA 1BF5A 2KFFA 2KAYA 2OTGC 1M63B 1KCYA 1YR5A 2QEVA 5I2QA 1QLKA 3EVVA 3TUYB 1NX3A 1CNPA 1QX7A 4MBEA 1SL9A 2COLB 2LMTA 1G8IA 2KQ6A 1ALVA 2V53A 1MXEA 4FQOA 2KAVA 2JQ6A 4D1EA 2M8UA 4F7FA 3BUOB 1WY9A 2QACA 3AAKA 1XA5A 3HCMA 3HX4A 3OB1B 5D7FA 2EHBA 1CFCA 1DQEA 4ETOA 1NCXA 3NXAA 4I5KA 4PE4A 1GQMA 2F8PA 4OZDA 4QJ3B 3JTDC 1H4BA 1YX8A 1TNPA 5KU1A 1RTP1 1DC1A 3WXAA 1IH0A 2KGBC 1NUBA 3TDIA 1KK7Z 4HRGA 3SIAA 1JF0A 2M0RA 3DY9A 3FE8A 1TIZA 1OOIX 1SCMB 2GV5A 2OPOA 2ZKMX 5EL2A 5KTYA 1SBJA 1C7WA 2JTZA 2Y4QA 1SRAA 1IQ5A 1WLMA 3I5FB 4GGFC 4JQ0D 3CLNA 1ORGA 4Q04A 5I8NA 2BBNA 2PRUA 2CCMA 1CM1A 1NYAA 1OE9B 3D75A 1BR1B 3O4YA 3TS5C 3SS4A 4CFRA 3H4SE 1UHHA 5F6TA 3FE6A 1JWDA 1NX2A 1UURA 3B87A 3CTNA 1M45A 1AHRA 1SR6B 3DZTA 2KFGA 2NLNA 2ZNEA 1SY9A 1ZACA 3A8RA 1ZFSA 2KDHA 1PALA 2KI6C 2KPHA 3I5HC 3KHEA 5FI7A 2LVIA 5FI6A 1Z2CB 4GNKB 2WCMA 2EGDA 2K2AA 5DKRA 1V1GA 3UO9A 2M49B 3BXKA 1KQVA 4DCKA 1V1FA 4N1FA 2L51A 3BFBA 1YUUA 1QV0A 1LVCD 3CZ0A 2F2PA 2P71A 3ZWHA 2WCHA 1QVIY 3AKAA 3FWBA 4MSPA 4PE7A 2HQ8A 2KYCA 2NXQA 3WHTB 2ZFDA 4N5XA 1AP4A 4HREE 2LP3A 1FPWA 1VRKA 1SL8A 1KFXL 4DRWA 1A29A 1B8RA 4HRHA 3TUYC 2OTGB 1X02A 1Y6WA 2MLFC 1Y0VH 1PULA 3NSKA 5CSNA 4AQIA 1DJHA 2P6BB 4GAOA 1J1EA 2PQLA 5AANA 4YI9A 1KSMA 5K89A 1YX7A 4PHJA 4PE0A 2BCXA 1GJYA 3LK1A 2BBMA 1YRTB 1QWVA 1TNXA 2PVBA 4ORCB 1TCOB 1J7QA 1DELA 1N0YA 1Y1XA 2KLEA 3EVUA 1EJ3A 1S6CA 3KPXA 1DGVA 4OCIA 2KQYA 2JZIA 1XFXO 2FOTA 3L4AA 4CLNA 3EVRA 4IJ7A 2WOSA 1DGUA 1K94A 1UUSA 1XFUO 1Q80A 1DJGA 2M29A 2L2CA 1T14A 3D0YB 4PHKA 1DF0A 4M2PA 1A2XA 1JBAA 4YGBB 3KF9A 3AKBA 2JTTA 5HKWA 1CDMA 3BOWB 1DJIA 2FJYA 2NZ0A 2KYFA 1DJWA 1CM4A 3VROA 3NGVA 1CFDA 2BAPA 4FQTA 1LA0A 2PYQA 4GPLB 1XFWO 3TS5B 2K61A 2BKHB 1SR6C 4ORAB 3DF0A 3DVKA 1TNQA 1L2OC 1OZOA 3IQOA 1QTXA 1K9UA 1KWOC 2WNDA 2LAPA 3B86A 1S1EA 1SPYA 4YGCB 2QEBA 2SASA 1KK8C 1OW4A 1XFRA 2MLEC 1A75B 1LA3A 3C1VA 4KYNA 1PSBA 4XJKA 4YI8A 5I2OA 1MHOA 1IGVA 1MXLC 3BJHA 4JKTA 4AOMA 2KBIA 1HQVA 3D76A 1RROA 3D78A 2HF5A 1XFZO 3OX6A 1BT6A 2MRDA 3BFHA 2TN4A 3I5IC 5DKQA 3EK8A 3DXLA 1RFJA 1IJ5A 3BYAA 1JFJA 5CPVA 3S0DA 1N2DA 4C0LA 1PVBA 2PSRA 2K7DA 1MUXA 1WRZA 2FCDA 2JNXA 1ZMZA 3BUNB 4PCWA 1J7OA 4YGAA 3DVMA 2AAOA 2JWWA 3AAJA 3O2PA 1K90D 3Q8IA 4WQ2A 5JJGA 1BOCA 3DD4A 1MF8B 1J55A 1TUZA 4XYNA 2LCPA 4QJ4B 3TDUA 4INXA 3JVTC 4AQJA 3KO0A 1NIWA 1E8AA 1NX1A 2A4JA 4GUKA 1J1DA 1CDLA 3PN7C 3OP0A 4FTGA 2BECA 3IQQA 2AUCA 4ZCVA 1ODBA 2M1UA
chains in the Genus database with same CATH topology
3RZSA 2WCMA 3FE9A 3B6XA 3BFBA 3D74A 1OOFA 3CZ0A 1OOGA 2P71A 3CABA 2WCHA 2H8VA 3K1EA 3PJIA 3S0FA 3R1VA 1OOHA 3D77A 3B88A 1TUJA 2PQLA 3V2LA 3OGNA 4JD9A 2WCKA 1QWVA 3R1OA 2QEOA 1C3ZA 3NHTA 2P70A 1C3YA 3L47A 3L4AA 1P28A 3L4LA 3R72A 2L2CA 3BFAA 1T14A 4INWA 2WC5A 3NHIA 2QEHA 2WC6A 1LS8A 2FJYA 3VB1A 3NGVA 4FQTA 2WCJA 2ERBA 1GM0A 2QEVA 3CYZA 3B86A 2QDIA 2QEBA 1XFRA 1OW4A 3S0AA 4F7FA 3B7AA 3BJHA 3R1PA 3D73A 3D76A 3S0BA 1DQEA 3D78A 4OZDA 1TWOA 3BFHA 3DXLA 3CDNA 3CZ2A 3S0DA 2WCLA 3CZ1A 3DY9A 3FE8A 1OOIX 3N7HA 5EL2A 2GTEA 3Q8IA 3S0GA 1ORGA 3S0EA 4PT1A 5DICA 4INXA 3D75A 2JPOA 3FE6A 3B87A 3DZTA 3DYEA 3QMEA 2KPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZS A;  2WCM A;  3FE9 A;  3B6X A;  3BFB A;  3D74 A;  1OOF A;  3CZ0 A;  1OOG A;  2P71 A;  3CAB A;  2WCH A;  2H8V A;  3K1E A;  3PJI A;  3S0F A;  3R1V A;  1OOH A;  3D77 A;  3B88 A;  1TUJ A;  2PQL A;  3V2L A;  3OGN A;  4JD9 A;  2WCK A;  1QWV A;  3R1O A;  2QEO A;  1C3Z A;  3NHT A;  2P70 A;  1C3Y A;  3L47 A;  3L4A A;  1P28 A;  3L4L A;  3R72 A;  2L2C A;  3BFA A;  1T14 A;  4INW A;  2WC5 A;  3NHI A;  2QEH A;  2WC6 A;  1LS8 A;  2FJY A;  3VB1 A;  3NGV A;  4FQT A;  2WCJ A;  2ERB A;  1GM0 A;  2QEV A;  3CYZ A;  3B86 A;  2QDI A;  2QEB A;  1XFR A;  1OW4 A;  3S0A A;  4F7F A;  3B7A A;  3BJH A;  3R1P A;  3D73 A;  3D76 A;  3S0B A;  1DQE A;  3D78 A;  4OZD A;  1TWO A;  3BFH A;  3DXL A;  3CDN A;  3CZ2 A;  3S0D A;  2WCL A;  3CZ1 A;  3DY9 A;  3FE8 A;  1OOI X;  3N7H A;  5EL2 A;  2GTE A;  3Q8I A;  3S0G A;  1ORG A;  3S0E A;  4PT1 A;  5DIC A;  4INX A;  3D75 A;  2JPO A;  3FE6 A;  3B87 A;  3DZT A;  3DYE A;  3QME A;  2KPH A; 
#chains in the Genus database with same CATH topology
 1AVS A;  1B9A A;  1DMO A;  5FYX A;  4OV2 A;  1YTZ C;  3PSR A;  4JWQ A;  2LMU A;  1YUS A;  4L9M A;  2WC8 A;  2JC2 A;  3VGO A;  3CAB A;  4JPZ B;  3WHU B;  1AJ4 A;  1NX0 A;  1XO5 A;  4IL1 A;  3WNX B;  3I5G C;  1U5I B;  3K1E A;  1Y1U A;  3PJI A;  3SJS A;  3BUX B;  3DVE A;  4ICB A;  2JOJ A;  1K96 A;  1FI6 A;  2JRF A;  2BL0 C;  1AUI B;  2LM5 A;  4OR9 B;  1R2U A;  1CLB A;  1TUJ A;  1REC A;  3PFV A;  1L2O B;  4YGE B;  4NQG A;  1FBV A;  1WRL A;  3V2L A;  1KWO B;  1CFF A;  4MN0 A;  4QJ5 B;  1K95 A;  2O5G A;  1UHN A;  2KI6 D;  1JF2 A;  2RGI A;  4F0Z B;  1KK8 B;  1S6J A;  1MWN A;  1F4Q A;  2CXJ A;  1AK8 A;  1C3Z A;  2O60 A;  3EG5 B;  2CT9 A;  4BY4 A;  4PHN A;  2G2B A;  2P70 A;  1SNL A;  1UHJ A;  2K0J A;  2M3W A;  2M9G A;  3EK7 A;  4WQ3 A;  1A4P A;  4YRU A;  3I5I B;  1FF1 A;  1SKT A;  1IJ6 A;  2Q4U A;  3EKH A;  3KEV A;  1SMG A;  1B8L A;  1S6I A;  1XK4 A;  2WC5 A;  1QIW A;  4YGD B;  2R2I A;  1UP5 A;  1OMR A;  2QEH A;  2H2K A;  2HET A;  2K8M B;  3VB1 A;  1DJZ A;  5HL1 A;  1M39 A;  2LLU A;  5AXI A;  2LVJ A;  4CPV A;  3JVT B;  1CDN A;  2KNE A;  1QAS A;  2CNP A;  2L98 A;  3LLE A;  1H8B A;  2KSP A;  3CYZ A;  2KI4 B;  2JXC A;  1NWD A;  1YVH A;  3CGA A;  1CFP A;  3SG7 A;  2QDI A;  3PN7 B;  2Y1N A;  4USL A;  1ZUZ A;  3GK4 X;  1IIO A;  1IWQ A;  2LLT A;  3O6B A;  4WRI A;  3B7A A;  2K7O A;  2LHL A;  1QVI Z;  3D73 A;  1QAT A;  1M31 A;  5CSI A;  3CR2 A;  4M2Q A;  1EXR A;  3K21 A;  1PVA A;  2LUX A;  2CBL A;  2LP2 A;  4MZK A;  1F54 A;  1TWO A;  2JPT A;  2JNF A;  2NCO A;  2JT8 A;  3DF0 B;  4NDB A;  2PAS A;  2BCB A;  5IBW A;  1XYD A;  4MRX A;  3RM1 A;  1CKK A;  1W7I B;  4XJK B;  1F8H A;  1CMG A;  5GQQ C;  3I5G B;  3N7H A;  1DT7 B;  1DJY A;  1QLS A;  3CR5 X;  2F3Z A;  2WCF A;  3D10 A;  1TTX A;  3LCP C;  5HLV A;  2KHN A;  2JUL A;  1QX2 A;  1KFU L;  2BL0 B;  1M46 A;  2I7A A;  2KOT A;  2LMV A;  3S0E A;  2KFH A;  4PT1 A;  3OB2 B;  5DIC A;  3DVJ A;  2ZN9 A;  3CZT X;  1B7T Y;  1K9P A;  1NCZ A;  4HSZ A;  1CLL A;  1J7R A;  4YBH B;  1J7P A;  3OHM B;  1WDC C;  2JPO A;  2L0P A;  1B8C A;  3GK1 A;  2ZRS A;  4GFT A;  1NPQ A;  1RJV A;  4NDD A;  2LLS A;  3VRQ A;  2LVK A;  5J3X A;  2E30 A;  2F2O A;  4BY5 A;  1PK0 D;  1BU3 A;  2I18 A;  3CS1 A;  1EG4 A;  3UNW A;  5KSZ A;  1CMF A;  2LUC A;  4M2O A;  4U8D A;  2H61 A;  2B1U A;  1HT9 A;  1XVJ A;  3B6X A;  1WLZ A;  2LC5 A;  3SG4 A;  3BOW A;  2LNK A;  1IG5 A;  2F33 A;  1DVI A;  4GGF A;  1OOF A;  2MA2 A;  3IF7 A;  1GGZ A;  4MEW A;  2E6W A;  1IQ3 A;  4R1E A;  1N65 A;  1RWY A;  2M1K B;  1JSA A;  1SYM A;  3NSI A;  3SS5 A;  3EKJ A;  2I94 A;  2SCP A;  3R1V A;  2Q91 A;  3VRP A;  2KI4 C;  1G33 A;  1OOH A;  2WCE A;  3FIA A;  2FCE A;  3B88 A;  5TNC A;  1A75 A;  1KK7 Y;  4PDZ A;  2K7C A;  3OX5 A;  4A4B A;  4CID A;  5ER5 A;  3TZ1 A;  1OMD A;  4I5L B;  1LXF C;  4MZL A;  1TRF A;  3FWC A;  3NSL A;  4CFQ A;  3M0W A;  1CLM A;  1KFU S;  1CB1 A;  5ER4 X;  2K7B A;  3MSE B;  5D69 A;  2QEO A;  1OOJ A;  2AMI A;  1D1O A;  3EK4 A;  3L47 A;  4E68 A;  3LK0 A;  1K9K A;  1P28 A;  3L4L A;  3SIB A;  1Z4H A;  1F71 A;  2EC6 B;  3NSO A;  1QXP A;  4ORB B;  1S26 D;  2JT3 A;  4MVF A;  3PAT A;  1CDP A;  1QIV A;  3E3R A;  1BJF A;  3FS7 A;  2ZN8 A;  2PAL A;  3BFA A;  2JXL A;  4INW A;  1MQ1 A;  4MZJ A;  3NHI A;  3VRN A;  2OS8 B;  3BQ3 A;  1SK6 D;  2WC6 A;  1LS8 A;  5DKN A;  1UHK A;  2LV7 A;  3QRX A;  5HKY A;  1AJ5 A;  2GGZ A;  2H61 C;  2WCJ A;  1CTR A;  1K8U A;  2ERB A;  2Y1M A;  1GM0 A;  2Y5I A;  1OQP A;  3OBV A;  3SG5 A;  1WDC B;  2MBX A;  3SG2 A;  1EL4 A;  3F45 A;  5HLO A;  1TN4 A;  1S36 A;  4P2Y B;  1SCV A;  1TOP A;  2NCP A;  1YVL A;  3CR4 X;  3S0A A;  1NCY A;  4PAL A;  2KAX A;  5HKZ A;  2LHI A;  5BPJ A;  3R1P A;  2BKI B;  2LVV A;  3S0B A;  1SSE B;  3PLF B;  5G08 A;  3PAL A;  1C07 A;  1WRK A;  1FI5 A;  3O78 A;  1LIN A;  1K93 D;  1U5I A;  1JC2 A;  1KSO A;  2F3Y A;  3CDN A;  3CZ2 A;  2M7L A;  1BMO A;  2K60 A;  1FW4 A;  1QS7 A;  1QJT A;  2WCL A;  3CZ1 A;  1KQM C;  2DOQ A;  3IVT A;  5HYD A;  3PM8 A;  2L5X B;  2GTE A;  1QV1 A;  2JT0 A;  1OSA A;  1R6P A;  1YUT A;  4DUQ A;  1EG3 A;  1L7Z A;  2K2F A;  3S0G A;  2G9B A;  1DF0 B;  1OMV A;  2L4I A;  3TDZ A;  1B47 A;  1ZOT B;  4C0J A;  1EH2 A;  1DJX A;  3O4X A;  4P5O E;  1C7V A;  2BNX A;  1XFY O;  5I2L A;  3DYE A;  5JOL A;  2ZND A;  5CSF A;  3ZNI A;  3VRR A;  3QME A;  1Y1A A;  4ZCU A;  1W7J B;  2GGM A;  3GK2 A;  1G4Y R;  1DEK A;  2QPT A;  3LL8 B;  4PHM A;  3RZS A;  1F55 A;  2EC6 C;  1BLQ A;  2VRG A;  3ICB A;  1S5G Y;  3FE9 A;  3SG6 A;  1XFV O;  1NP8 A;  2MAZ A;  2L5Y A;  2FJU B;  1BG1 A;  4PE1 A;  1W9Z A;  2CTN A;  1UHI A;  1F70 A;  1MR8 A;  3D74 A;  1F4O A;  5AFP A;  1GGW A;  2OS8 C;  5I94 A;  2ZRT A;  1NSH A;  1OOG A;  2YGU A;  3JTD B;  5D3O A;  2H8V A;  4TNC A;  1SCM C;  5CSJ A;  2ISD A;  4DS7 A;  3S0F A;  1PRW A;  2D8N A;  5FI2 A;  2IS9 A;  2M97 A;  4MRY A;  1B1G A;  2L2E A;  1PSR A;  1SL7 A;  3BUM B;  3I5F C;  1YRU B;  1QX5 B;  3A4U B;  3D77 A;  1UWO A;  2WOR A;  1LKJ A;  2BCA A;  1XK4 C;  1BOD A;  3SS3 A;  2KLD A;  3RLZ A;  1JUO A;  1YUR A;  2JU0 A;  3CWG A;  3OGN A;  4JD9 A;  4A4C A;  2WCK A;  2LAN A;  2PMY A;  2HQW A;  5B8I B;  4NDC A;  3D0Y A;  2L4H A;  4I5N B;  1S5G Z;  3R1O A;  3PM2 A;  1IRJ A;  4I5J A;  1JFK A;  4MLW A;  5PAL A;  3SG3 A;  3NHT A;  5AER A;  1OZS A;  2MHH A;  1BR4 B;  2L50 A;  1TNW A;  2I2R E;  3GOF A;  1KFX S;  2BE4 A;  3I5H B;  5AEQ A;  4GBA A;  4GGN A;  1ALW A;  1DTL A;  2BE6 A;  4OKH A;  4OVN F;  3R72 A;  4N1G A;  2WCB A;  1KQM B;  4C0K A;  4UPG A;  1TCF A;  2MJW B;  1B7T Z;  2M7N A;  1B4C A;  1IKU A;  2KBM A;  1C3Y A;  2LE9 B;  4DIR A;  1A03 A;  1SW8 A;  2HPS A;  3BUW B;  1K2H A;  1RK9 A;  2KGR A;  1S3P A;  1BF5 A;  2KFF A;  2KAY A;  2OTG C;  1M63 B;  1KCY A;  1YR5 A;  2QEV A;  5I2Q A;  1QLK A;  3EVV A;  3TUY B;  1NX3 A;  1CNP A;  1QX7 A;  4MBE A;  1SL9 A;  2COL B;  2LMT A;  1G8I A;  2KQ6 A;  1ALV A;  2V53 A;  1MXE A;  4FQO A;  2KAV A;  2JQ6 A;  4D1E A;  2M8U A;  4F7F A;  3BUO B;  1WY9 A;  2QAC A;  3AAK A;  1XA5 A;  3HCM A;  3HX4 A;  3OB1 B;  5D7F A;  2EHB A;  1CFC A;  1DQE A;  4ETO A;  1NCX A;  3NXA A;  4I5K A;  4PE4 A;  1GQM A;  2F8P A;  4OZD A;  4QJ3 B;  3JTD C;  1H4B A;  1YX8 A;  1TNP A;  5KU1 A;  1RTP 1;  1DC1 A;  3WXA A;  1IH0 A;  2KGB C;  1NUB A;  3TDI A;  1KK7 Z;  4HRG A;  3SIA A;  1JF0 A;  2M0R A;  3DY9 A;  3FE8 A;  1TIZ A;  1OOI X;  1SCM B;  2GV5 A;  2OPO A;  2ZKM X;  5EL2 A;  5KTY A;  1SBJ A;  1C7W A;  2JTZ A;  2Y4Q A;  1SRA A;  1IQ5 A;  1WLM A;  3I5F B;  4GGF C;  4JQ0 D;  3CLN A;  1ORG A;  4Q04 A;  5I8N A;  2BBN A;  2PRU A;  2CCM A;  1CM1 A;  1NYA A;  1OE9 B;  3D75 A;  1BR1 B;  3O4Y A;  3TS5 C;  3SS4 A;  4CFR A;  3H4S E;  1UHH A;  5F6T A;  3FE6 A;  1JWD A;  1NX2 A;  1UUR A;  3B87 A;  3CTN A;  1M45 A;  1AHR A;  1SR6 B;  3DZT A;  2KFG A;  2NLN A;  2ZNE A;  1SY9 A;  1ZAC A;  3A8R A;  1ZFS A;  2KDH A;  1PAL A;  2KI6 C;  2KPH A;  3I5H C;  3KHE A;  5FI7 A;  2LVI A;  5FI6 A;  1Z2C B;  4GNK B;  2WCM A;  2EGD A;  2K2A A;  5DKR A;  1V1G A;  3UO9 A;  2M49 B;  3BXK A;  1KQV A;  4DCK A;  1V1F A;  4N1F A;  2L51 A;  3BFB A;  1YUU A;  1QV0 A;  1LVC D;  3CZ0 A;  2F2P A;  2P71 A;  3ZWH A;  2WCH A;  1QVI Y;  3AKA A;  3FWB A;  4MSP A;  4PE7 A;  2HQ8 A;  2KYC A;  2NXQ A;  3WHT B;  2ZFD A;  4N5X A;  1AP4 A;  4HRE E;  2LP3 A;  1FPW A;  1VRK A;  1SL8 A;  1KFX L;  4DRW A;  1A29 A;  1B8R A;  4HRH A;  3TUY C;  2OTG B;  1X02 A;  1Y6W A;  2MLF C;  1Y0V H;  1PUL A;  3NSK A;  5CSN A;  4AQI A;  1DJH A;  2P6B B;  4GAO A;  1J1E A;  2PQL A;  5AAN A;  4YI9 A;  1KSM A;  5K89 A;  1YX7 A;  4PHJ A;  4PE0 A;  2BCX A;  1GJY A;  3LK1 A;  2BBM A;  1YRT B;  1QWV A;  1TNX A;  2PVB A;  4ORC B;  1TCO B;  1J7Q A;  1DEL A;  1N0Y A;  1Y1X A;  2KLE A;  3EVU A;  1EJ3 A;  1S6C A;  3KPX A;  1DGV A;  4OCI A;  2KQY A;  2JZI A;  1XFX O;  2FOT A;  3L4A A;  4CLN A;  3EVR A;  4IJ7 A;  2WOS A;  1DGU A;  1K94 A;  1UUS A;  1XFU O;  1Q80 A;  1DJG A;  2M29 A;  2L2C A;  1T14 A;  3D0Y B;  4PHK A;  1DF0 A;  4M2P A;  1A2X A;  1JBA A;  4YGB B;  3KF9 A;  3AKB A;  2JTT A;  5HKW A;  1CDM A;  3BOW B;  1DJI A;  2FJY A;  2NZ0 A;  2KYF A;  1DJW A;  1CM4 A;  3VRO A;  3NGV A;  1CFD A;  2BAP A;  4FQT A;  1LA0 A;  2PYQ A;  4GPL B;  1XFW O;  3TS5 B;  2K61 A;  2BKH B;  1SR6 C;  4ORA B;  3DF0 A;  3DVK A;  1TNQ A;  1L2O C;  1OZO A;  3IQO A;  1QTX A;  1K9U A;  1KWO C;  2WND A;  2LAP A;  3B86 A;  1S1E A;  1SPY A;  4YGC B;  2QEB A;  2SAS A;  1KK8 C;  1OW4 A;  1XFR A;  2MLE C;  1A75 B;  1LA3 A;  3C1V A;  4KYN A;  1PSB A;  4XJK A;  4YI8 A;  5I2O A;  1MHO A;  1IGV A;  1MXL C;  3BJH A;  4JKT A;  4AOM A;  2KBI A;  1HQV A;  3D76 A;  1RRO A;  3D78 A;  2HF5 A;  1XFZ O;  3OX6 A;  1BT6 A;  2MRD A;  3BFH A;  2TN4 A;  3I5I C;  5DKQ A;  3EK8 A;  3DXL A;  1RFJ A;  1IJ5 A;  3BYA A;  1JFJ A;  5CPV A;  3S0D A;  1N2D A;  4C0L A;  1PVB A;  2PSR A;  2K7D A;  1MUX A;  1WRZ A;  2FCD A;  2JNX A;  1ZMZ A;  3BUN B;  4PCW A;  1J7O A;  4YGA A;  3DVM A;  2AAO A;  2JWW A;  3AAJ A;  3O2P A;  1K90 D;  3Q8I A;  4WQ2 A;  5JJG A;  1BOC A;  3DD4 A;  1MF8 B;  1J55 A;  1TUZ A;  4XYN A;  2LCP A;  4QJ4 B;  3TDU A;  4INX A;  3JVT C;  4AQJ A;  3KO0 A;  1NIW A;  1E8A A;  1NX1 A;  2A4J A;  4GUK A;  1J1D A;  1CDL A;  3PN7 C;  3OP0 A;  4FTG A;  2BEC A;  3IQQ A;  2AUC A;  4ZCV A;  1ODB A;  2M1U A; 
#chains in the Genus database with same CATH homology
 3RZS A;  2WCM A;  3FE9 A;  3B6X A;  3BFB A;  3D74 A;  1OOF A;  3CZ0 A;  1OOG A;  2P71 A;  3CAB A;  2WCH A;  2H8V A;  3K1E A;  3PJI A;  3S0F A;  3R1V A;  1OOH A;  3D77 A;  3B88 A;  1TUJ A;  2PQL A;  3V2L A;  3OGN A;  4JD9 A;  2WCK A;  1QWV A;  3R1O A;  2QEO A;  1C3Z A;  3NHT A;  2P70 A;  1C3Y A;  3L47 A;  3L4A A;  1P28 A;  3L4L A;  3R72 A;  2L2C A;  3BFA A;  1T14 A;  4INW A;  2WC5 A;  3NHI A;  2QEH A;  2WC6 A;  1LS8 A;  2FJY A;  3VB1 A;  3NGV A;  4FQT A;  2WCJ A;  2ERB A;  1GM0 A;  2QEV A;  3CYZ A;  3B86 A;  2QDI A;  2QEB A;  1XFR A;  1OW4 A;  3S0A A;  4F7F A;  3B7A A;  3BJH A;  3R1P A;  3D73 A;  3D76 A;  3S0B A;  1DQE A;  3D78 A;  4OZD A;  1TWO A;  3BFH A;  3DXL A;  3CDN A;  3CZ2 A;  3S0D A;  2WCL A;  3CZ1 A;  3DY9 A;  3FE8 A;  1OOI X;  3N7H A;  5EL2 A;  2GTE A;  3Q8I A;  3S0G A;  1ORG A;  3S0E A;  4PT1 A;  5DIC A;  4INX A;  3D75 A;  2JPO A;  3FE6 A;  3B87 A;  3DZT A;  3DYE A;  3QME A;  2KPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...