3D73A

Crystal structure of a pheromone binding protein mutant d35a, from apis mellifera, at ph 7.0
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
119
structure length
119
Chain Sequence
APDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVAKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 38
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3d73A00
3BFAA 3OGNA 3R1VA 3L4LA 3BFBA 3D73A 1OOFA 2WC6A 1DQEA 4FQTA 3Q8IA 3D74A 3K1EA 3DY9A 2JPOA 3CABA 1ORGA 1T14A 3S0DA 3S0AA 3B7AA 3DZTA 3B88A 3DXLA 3S0GA 1OOIX 2PQLA 2QEVA 3PJIA 2L2CA 2QDIA 3R1PA 4F7FA 2QEBA 1QWVA 2GTEA 2WCLA 2WC5A 3D76A 3FE9A 3CZ2A 3CYZA 3RZSA 2P70A 2WCJA 2KPHA 1LS8A 2H8VA 2P71A 3BFHA 3L47A 3B6XA 4INXA 3D77A 3CDNA 2QEOA 1C3YA 5EL2A 1TWOA 3CZ1A 3D78A 3DYEA 4OZDA 3B86A 1P28A 1TUJA 3D75A 2QEHA 2WCKA 3BJHA 3S0EA 3V2LA 1OOHA 3S0BA 3S0FA 2ERBA 4INWA 2WCHA 3N7HA 3FE6A 3R1OA 3L4AA 2WCMA 3R72A 3NGVA 1C3ZA 3FE8A 1GM0A 3NHTA 4JD9A 5DICA 4PT1A 2FJYA 3B87A 3VB1A 1XFRA 3QMEA 1OOGA 1OW4A 3NHIA 3CZ0A
chains in the Genus database with same CATH superfamily
3BFAA 5CSIA 3EKHA 5DKNA 2LVKA 3KF9A 3NSKA 3R1VA 1YTZC 5HYDA 3JTDC 2QPTA 3FWCA 4Q04A 2Y5IA 3HX4A 4U8DA 1CB1A 1OOFA 1NYAA 1S1EA 1EJ3A 1S36A 2JTTA 2WC6A 1DQEA 1IGVA 5HLVA 1XFUO 2BE6A 3Q8IA 1LA3A 1XA5A 3JTDB 2G2BA 1CDMA 3K1EA 3DY9A 3OX5A 1ALWA 3UO9A 1K2HA 1A75B 5FYXA 4JWQA 2VRGA 3BUNB 1AUIB 3PN7C 2LHLA 1DJHA 4OKHA 2K7OA 1MF8B 2V53A 2Y1MA 1T14A 1SL9A 3CABA 2MBXA 2CTNA 1SL7A 4L9MA 1V1FA 1RJVA 4QJ4B 1PRWA 4PHKA 1WLMA 3PN7B 1YVLA 3S0GA 2EHBA 2K7DA 2LM5A 1PSBA 1IH0A 1AJ4A 2I7AA 1OOIX 2LMTA 2ZNDA 1UHNA 3K21A 3CTNA 2QDIA 2CCMA 1QS7A 3EKJA 1OMDA 1JFKA 2O5GA 1QX2A 4PE4A 1YRUB 1MWNA 3QRXA 1IRJA 1M63B 1BOCA 2WOSA 3FE9A 3SIBA 1DELA 1NSHA 1DF0A 2JNXA 1XYDA 2P70A 2ZRSA 3CYZA 5CPVA 5HKZA 2AAOA 1WRKA 4HRHA 3TDIA 2BAPA 3SS4A 4I5JA 1JC2A 5JOLA 2CXJA 1SSEB 1Z2CB 1TNXA 2LHIA 3A8RA 3AAKA 1GGWA 5HKYA 5KTYA 1AP4A 5D3OA 3I5FB 4OR9B 1K9PA 2QACA 1NCZA 4N1GA 1DJZA 1IG5A 1Q80A 3BFHA 1CNPA 2BCXA 3B6XA 3LK0A 1DGUA 1ODBA 2M7NA 1A03A 3DD4A 5CSJA 1G8IA 4I5KA 1K96A 2NZ0A 2E30A 1DVIA 2OTGC 4M2PA 3HCMA 4C0LA 2PVBA 2JXCA 4M2OA 1R2UA 1SYMA 3TDUA 2K0JA 5FI7A 1MHOA 1CKKA 2RGIA 3DVMA 3EVUA 1IQ3A 1P28A 1UHHA 1B47A 3VRNA 1F71A 2LLSA 1RECA 2OTGB 5HLOA 3VRQA 3EK7A 4NDCA 2WCFA 3D75A 1KWOC 1Y0VH 2WCEA 1UP5A 3BQ3A 1Z4HA 2PYQA 2PSRA 3S0EA 1TRFA 3V2LA 3WXAA 2E6WA 1N65A 2NXQA 2HF5A 2PASA 4ORBB 3VROA 5I8NA 3S0FA 1M39A 3BUXB 1GJYA 5AERA 1KWOB 1SCVA 3ICBA 4MVFA 3FE6A 3KPXA 1CFDA 2M1KB 1MQ1A 1PVBA 2L4HA 3L4AA 1EL4A 2KYCA 4E68A 2ISDA 3WNXB 1PSRA 3CGAA 1XVJA 1Y1UA 3VGOA 2H61A 3FE8A 2KFGA 1CTRA 3MSEB 1D1OA 1WRLA 1EXRA 1UHJA 3BUWB 1ZMZA 3PALA 5TNCA 2KFHA 2GV5A 1CLMA 2Y1NA 2Y4QA 3EVVA 1XFRA 1SR6C 4HREE 2FCDA 3SIAA 2G9BA 4GBAA 2K7CA 4FQOA 1QTXA 4AOMA 1LXFC 1UWOA 1C7VA 1XFXO 1XK4A 2KSPA 2JC2A 2L2EA 1XO5A 2D8NA 2TN4A 2M9GA 1SR6B 2JXLA 3O6BA 2M97A 1FPWA 5KSZA 2K8MB 4IL1A 1UUSA 1QXPA 4PALA 3UNWA 1ZFSA 1JF0A 3AKAA 2HQ8A 1W9ZA 2FCEA 2L4IA 1B1GA 1QLKA 2F2PA 4OV2A 1J55A 3CS1A 2EGDA 3TZ1A 1LINA 4CLNA 2LANA 1NCXA 1KFXL 1ORGA 3DVEA 1K95A 2LLUA 2OS8C 1CFPA 2KI6D 3BOWB 3H4SE 1AVSA 1VRKA 2P6BB 3DZTA 1IJ6A 1DJWA 3GK2A 2KAYA 1TNPA 2PMYA 3D0YA 2LC5A 2OS8B 2ZN8A 1NX1A 2QEVA 3BUMB 2KGBC 2CT9A 3IQQA 2KBMA 1XFZO 4PCWA 2K60A 2KLEA 5I2OA 1QWVA 1J7RA 2WORA 2Q91A 1LA0A 4NDBA 1BR1B 3RZSA 1B8CA 4GGFA 1IWQA 3DF0B 3A4UB 1UHKA 3FIAA 2KOTA 3KHEA 1YUTA 4ORCB 1KQVA 4GPLB 1F4OA 4FTGA 4NQGA 1DMOA 2LMUA 1BMOA 1BJFA 2P71A 4QJ5B 1AHRA 1WLZA 2M29A 5HKWA 1K8UA 1NPQA 1QASA 2YGUA 3PLFB 1TCFA 1YR5A 5G08A 3EG5B 4TNCA 3DVKA 2BBMA 2BKIB 2QEOA 4QJ3B 1KSOA 2LUCA 5EL2A 2LLTA 4D1EA 4XJKA 1XFVO 4DUQA 4F0ZB 3B86A 3SG4A 1DEKA 3OB2B 5HL1A 1F54A 1TUJA 3I5FC 1J7OA 2LP2A 1OQPA 2MJWB 1TN4A 3BJHA 2KDHA 3GK1A 4PHNA 1UHIA 4A4CA 3S0BA 1CMFA 5AEQA 3I5GC 1RTP1 3PM2A 4INWA 2BL0C 2F2OA 3CZTX 3O4YA 4USLA 2NLNA 3F45A 2JOJA 4CPVA 3TUYC 4WRIA 1S26D 1BG1A 1DJIA 2K61A 3I5GB 2JRFA 2BL0B 1KFUL 2COLB 1BT6A 1C3ZA 1F55A 1ZACA 1DJXA 2JT3A 2KFFA 3WHUB 3TUYB 1MUXA 1UURA 1A75A 3NHTA 5CSNA 1SW8A 4JD9A 5DICA 1H4BA 2GGMA 2MRDA 1GQMA 1CDPA 4P5OE 5FI6A 3I5IC 1SK6D 3LCPC 4AQIA 1BU3A 2BE4A 1IJ5A 5AANA 1OW4A 4DRWA 1WY9A 2FJUB 2ZKMX 5I2QA 1SL8A 3CR5X 1ZOTB 3OGNA 1R6PA 1W7IB 3I5IB 4YI9A 2BNXA 4CIDA 2WC8A 1J7PA 4M2QA 4MN0A 1TUZA 2EC6C 2K2FA 5J3XA 1WRZA 2KAVA 3PSRA 4YGCB 1B9AA 3CR4X 1QX5B 2M7LA 2SASA 1JBAA 1YX8A 2EC6B 2LAPA 3D74A 2KLDA 1PK0D 2L98A 1NX3A 1OZSA 1PALA 1TIZA 2JPOA 2LNKA 2MHHA 3GK4X 4MRYA 4DIRA 1OE9B 5PALA 1U5IB 1CDLA 2IS9A 1SPYA 2OPOA 1DJGA 3IQOA 2ZN9A 1OMVA 1CLLA 3B7AA 4OCIA 1YX7A 3B88A 1SBJA 1NCYA 1WDCC 3DXLA 4ZCVA 3NSOA 3SS5A 1SKTA 1K93D 1OOJA 2K2AA 2PQLA 1TNWA 4PHMA 1M45A 3RLZA 2L2CA 4WQ3A 1QV0A 1WDCB 4CFRA 1QLSA 1IQ5A 3R1PA 1NX2A 3SG3A 3JVTC 1X02A 1ALVA 2QEBA 3O78A 2WCLA 2KI6C 2M3WA 2WC5A 3D76A 4GFTA 4GUKA 4BY4A 5KU1A 1J1DA 1FI6A 2A4JA 1LS8A 3CLNA 3JVTB 1A29A 1OSAA 4IJ7A 1RWYA 1EH2A 2DOQA 1KK8C 1DT7B 4CFQA 4A4BA 5JJGA 2M1UA 2O60A 2AUCA 3L47A 1TNQA 1NUBA 4MZKA 3O4XA 3CR2A 4INXA 3D77A 1F4QA 3BUOB 5BPJA 1F70A 1KK8B 1M46A 1RROA 3CDNA 1SMGA 1IIOA 1C3YA 3SG6A 2F8PA 4OZDA 3D78A 1KSMA 3M0WA 1DF0B 2MLFC 3PM8A 4ICBA 2LVVA 5D7FA 2KHNA 4XYNA 2HPSA 4C0JA 2PRUA 3FWBA 2WCKA 3IF7A 5GQQC 4PE1A 1CFFA 1CFCA 3I5HC 3KEVA 1FBVA 2KAXA 2I18A 1IKUA 1NX0A 2LCPA 1HT9A 1LVCD 3DVJA 1BR4B 1Y6WA 1S6IA 3NSIA 4GAOA 1NWDA 4KYNA 1CM4A 1QX7A 1S6CA 2KQYA 3BYAA 3NXAA 4GGNA 4JQ0D 2MAZA 3I5HB 2F3ZA 2JWWA 4GNKB 5I2LA 1MXLC 1QIVA 1XFWO 3NGVA 4PDZA 3CWGA 1W7JB 1S5GZ 2BCAA 1LKJA 2PALA 1GM0A 2LE9B 2L0PA 2CNPA 2ZFDA 5D69A 3TS5C 1QVIZ 1C07A 1EG4A 1SRAA 1TTXA 4PT1A 3B87A 3VB1A 2JU0A 3PFVA 3TDZA 1BODA 1NIWA 2L5XB 3BOWA 1J7QA 1SCMC 2KYFA 3TS5B 3NHIA 3GOFA 1SY9A 3CZ0A 4DS7A 1Y1XA 4DCKA 3D10A 2LUXA 1GGZA 1KFXS 3L4LA 2H61C 1G33A 3BFBA 3D73A 1SCMB 3E3RA 5F6TA 1QATA 3SG7A 3SJSA 1CLBA 1CMGA 4OVNF 2ZNEA 2BCBA 3LL8B 1B8LA 4FQTA 2CBLA 2JT8A 1B7TZ 1YRTB 1N0YA 5ER4X 4MZJA 3PATA 4UPGA 1DGVA 3DF0A 4WQ2A 1HQVA 1XK4C 1YUSA 3VRPA 1OZOA 2L51A 4YGAA 1K94A 1B8RA 2ZRTA 3AAJA 2HETA 2I94A 5AXIA 1S5GY 2K7BA 2SCPA 3S0DA 2GGZA 3S0AA 4YBHB 4C0KA 4YI8A 1QVIY 5B8IB 1DTLA 1JWDA 1KK7Z 4HRGA 2H2KA 2AMIA 4PHJA 2BECA 3EK8A 4N1FA 2KI4C 3SS3A 1A4PA 1E8AA 2LMVA 3OP0A 5K89A 5DKQA 2LVJA 1SNLA 1AJ5A 1OMRA 1C7WA 3PJIA 1L2OC 2JZIA 3OX6A 3RM1A 2BBNA 1EG3A 1TOPA 2KI4B 4F7FA 2F33A 4N5XA 2GTEA 2MLEC 2Q4UA 1N2DA 1YUUA 2LV7A 2B1UA 2JPTA 2LVIA 3LK1A 1ZUZA 3CZ2A 3WHTB 1K9UA 2M8UA 4YRUA 1L2OB 3OHMB 2WCJA 5AFPA 1S6JA 1JF2A 2KPHA 4ZCUA 3VRRA 1DC1A 1TCOB 1JFJA 5CSFA 4BY5A 2F3YA 2JQ6A 1B7TY 1K90D 1RFJA 2M49B 1YVHA 3BXKA 5IBWA 1BLQA 2H8VA 1QIWA 2HQWA 2FOTA 2NCOA 3NSLA 4JKTA 2KQ6A 1M31A 3D0YB 4MZLA 1PVAA 3IVTA 1NP8A 1KQMC 5FI2A 3ZWHA 1DJYA 2BKHB 1F8HA 4GGFC 3C1VA 1KK7Y 1H8BA 4ETOA 2L50A 2WCBA 2LP3A 1KQMB 1TWOA 1V1GA 3CZ1A 4PE0A 1K9KA 3DYEA 4YGBB 3ZNIA 1B4CA 3AKBA 2JULA 4HSZA 1FF1A 1KCYA 1XFYO 4MRXA 2L5YA 4P2YB 1RK9A 2I2RE 2M0RA 2QEHA 3OB1B 4ORAB 1KFUS 1OOHA 2JNFA 4MBEA 2ERBA 4YGDB 1YURA 2WCHA 1MR8A 2R2IA 4PE7A 2MA2A 1QJTA 3N7HA 4I5LB 1CM1A 2JT0A 1JUOA 1L7ZA 2NCPA 4NDDA 3SG2A 1BF5A 1MXEA 3R1OA 1S3PA 1G4YR 4R1EA 3SG5A 4I5NB 2WCMA 1J1EA 5DKRA 1QV1A 4MLWA 5ER5A 2JTZA 1JSAA 3R72A 5I94A 4YGEB 4AQJA 1AK8A 4XJKB 3EVRA 2KNEA 4MSPA 3EK4A 3FS7A 3KO0A 4JPZB 2WNDA 2KGRA 3OBVA 1FI5A 1Y1AA 3O2PA 2FJYA 1PULA 1U5IA 3QMEA 1OOGA 3LLEA 1FW4A 1A2XA 4MEWA 1CDNA 2KBIA
chains in the Genus database with same CATH topology
3BFAA 3OGNA 3R1VA 3L4LA 3BFBA 3D73A 1OOFA 2WC6A 1DQEA 4FQTA 3Q8IA 3D74A 3K1EA 3DY9A 2JPOA 3CABA 1ORGA 1T14A 3S0DA 3S0AA 3B7AA 3DZTA 3B88A 3DXLA 3S0GA 1OOIX 2PQLA 2QEVA 3PJIA 2L2CA 2QDIA 3R1PA 4F7FA 2QEBA 1QWVA 2GTEA 2WCLA 2WC5A 3D76A 3FE9A 3CZ2A 3CYZA 3RZSA 2P70A 2WCJA 2KPHA 1LS8A 2H8VA 2P71A 3BFHA 3L47A 3B6XA 4INXA 3D77A 3CDNA 2QEOA 1C3YA 5EL2A 1TWOA 3CZ1A 3D78A 3DYEA 4OZDA 3B86A 1P28A 1TUJA 3D75A 2QEHA 2WCKA 3BJHA 3S0EA 3V2LA 1OOHA 3S0BA 3S0FA 2ERBA 4INWA 2WCHA 3N7HA 3FE6A 3R1OA 3L4AA 2WCMA 3R72A 3NGVA 1C3ZA 3FE8A 1GM0A 3NHTA 4JD9A 5DICA 4PT1A 2FJYA 3B87A 3VB1A 1XFRA 3QMEA 1OOGA 1OW4A 3NHIA 3CZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BFA A;  3OGN A;  3R1V A;  3L4L A;  3BFB A;  3D73 A;  1OOF A;  2WC6 A;  1DQE A;  4FQT A;  3Q8I A;  3D74 A;  3K1E A;  3DY9 A;  2JPO A;  3CAB A;  1ORG A;  1T14 A;  3S0D A;  3S0A A;  3B7A A;  3DZT A;  3B88 A;  3DXL A;  3S0G A;  1OOI X;  2PQL A;  2QEV A;  3PJI A;  2L2C A;  2QDI A;  3R1P A;  4F7F A;  2QEB A;  1QWV A;  2GTE A;  2WCL A;  2WC5 A;  3D76 A;  3FE9 A;  3CZ2 A;  3CYZ A;  3RZS A;  2P70 A;  2WCJ A;  2KPH A;  1LS8 A;  2H8V A;  2P71 A;  3BFH A;  3L47 A;  3B6X A;  4INX A;  3D77 A;  3CDN A;  2QEO A;  1C3Y A;  5EL2 A;  1TWO A;  3CZ1 A;  3D78 A;  3DYE A;  4OZD A;  3B86 A;  1P28 A;  1TUJ A;  3D75 A;  2QEH A;  2WCK A;  3BJH A;  3S0E A;  3V2L A;  1OOH A;  3S0B A;  3S0F A;  2ERB A;  4INW A;  2WCH A;  3N7H A;  3FE6 A;  3R1O A;  3L4A A;  2WCM A;  3R72 A;  3NGV A;  1C3Z A;  3FE8 A;  1GM0 A;  3NHT A;  4JD9 A;  5DIC A;  4PT1 A;  2FJY A;  3B87 A;  3VB1 A;  1XFR A;  3QME A;  1OOG A;  1OW4 A;  3NHI A;  3CZ0 A; 
#chains in the Genus database with same CATH topology
 3BFA A;  5CSI A;  3EKH A;  5DKN A;  2LVK A;  3KF9 A;  3NSK A;  3R1V A;  1YTZ C;  5HYD A;  3JTD C;  2QPT A;  3FWC A;  4Q04 A;  2Y5I A;  3HX4 A;  4U8D A;  1CB1 A;  1OOF A;  1NYA A;  1S1E A;  1EJ3 A;  1S36 A;  2JTT A;  2WC6 A;  1DQE A;  1IGV A;  5HLV A;  1XFU O;  2BE6 A;  3Q8I A;  1LA3 A;  1XA5 A;  3JTD B;  2G2B A;  1CDM A;  3K1E A;  3DY9 A;  3OX5 A;  1ALW A;  3UO9 A;  1K2H A;  1A75 B;  5FYX A;  4JWQ A;  2VRG A;  3BUN B;  1AUI B;  3PN7 C;  2LHL A;  1DJH A;  4OKH A;  2K7O A;  1MF8 B;  2V53 A;  2Y1M A;  1T14 A;  1SL9 A;  3CAB A;  2MBX A;  2CTN A;  1SL7 A;  4L9M A;  1V1F A;  1RJV A;  4QJ4 B;  1PRW A;  4PHK A;  1WLM A;  3PN7 B;  1YVL A;  3S0G A;  2EHB A;  2K7D A;  2LM5 A;  1PSB A;  1IH0 A;  1AJ4 A;  2I7A A;  1OOI X;  2LMT A;  2ZND A;  1UHN A;  3K21 A;  3CTN A;  2QDI A;  2CCM A;  1QS7 A;  3EKJ A;  1OMD A;  1JFK A;  2O5G A;  1QX2 A;  4PE4 A;  1YRU B;  1MWN A;  3QRX A;  1IRJ A;  1M63 B;  1BOC A;  2WOS A;  3FE9 A;  3SIB A;  1DEL A;  1NSH A;  1DF0 A;  2JNX A;  1XYD A;  2P70 A;  2ZRS A;  3CYZ A;  5CPV A;  5HKZ A;  2AAO A;  1WRK A;  4HRH A;  3TDI A;  2BAP A;  3SS4 A;  4I5J A;  1JC2 A;  5JOL A;  2CXJ A;  1SSE B;  1Z2C B;  1TNX A;  2LHI A;  3A8R A;  3AAK A;  1GGW A;  5HKY A;  5KTY A;  1AP4 A;  5D3O A;  3I5F B;  4OR9 B;  1K9P A;  2QAC A;  1NCZ A;  4N1G A;  1DJZ A;  1IG5 A;  1Q80 A;  3BFH A;  1CNP A;  2BCX A;  3B6X A;  3LK0 A;  1DGU A;  1ODB A;  2M7N A;  1A03 A;  3DD4 A;  5CSJ A;  1G8I A;  4I5K A;  1K96 A;  2NZ0 A;  2E30 A;  1DVI A;  2OTG C;  4M2P A;  3HCM A;  4C0L A;  2PVB A;  2JXC A;  4M2O A;  1R2U A;  1SYM A;  3TDU A;  2K0J A;  5FI7 A;  1MHO A;  1CKK A;  2RGI A;  3DVM A;  3EVU A;  1IQ3 A;  1P28 A;  1UHH A;  1B47 A;  3VRN A;  1F71 A;  2LLS A;  1REC A;  2OTG B;  5HLO A;  3VRQ A;  3EK7 A;  4NDC A;  2WCF A;  3D75 A;  1KWO C;  1Y0V H;  2WCE A;  1UP5 A;  3BQ3 A;  1Z4H A;  2PYQ A;  2PSR A;  3S0E A;  1TRF A;  3V2L A;  3WXA A;  2E6W A;  1N65 A;  2NXQ A;  2HF5 A;  2PAS A;  4ORB B;  3VRO A;  5I8N A;  3S0F A;  1M39 A;  3BUX B;  1GJY A;  5AER A;  1KWO B;  1SCV A;  3ICB A;  4MVF A;  3FE6 A;  3KPX A;  1CFD A;  2M1K B;  1MQ1 A;  1PVB A;  2L4H A;  3L4A A;  1EL4 A;  2KYC A;  4E68 A;  2ISD A;  3WNX B;  1PSR A;  3CGA A;  1XVJ A;  1Y1U A;  3VGO A;  2H61 A;  3FE8 A;  2KFG A;  1CTR A;  3MSE B;  1D1O A;  1WRL A;  1EXR A;  1UHJ A;  3BUW B;  1ZMZ A;  3PAL A;  5TNC A;  2KFH A;  2GV5 A;  1CLM A;  2Y1N A;  2Y4Q A;  3EVV A;  1XFR A;  1SR6 C;  4HRE E;  2FCD A;  3SIA A;  2G9B A;  4GBA A;  2K7C A;  4FQO A;  1QTX A;  4AOM A;  1LXF C;  1UWO A;  1C7V A;  1XFX O;  1XK4 A;  2KSP A;  2JC2 A;  2L2E A;  1XO5 A;  2D8N A;  2TN4 A;  2M9G A;  1SR6 B;  2JXL A;  3O6B A;  2M97 A;  1FPW A;  5KSZ A;  2K8M B;  4IL1 A;  1UUS A;  1QXP A;  4PAL A;  3UNW A;  1ZFS A;  1JF0 A;  3AKA A;  2HQ8 A;  1W9Z A;  2FCE A;  2L4I A;  1B1G A;  1QLK A;  2F2P A;  4OV2 A;  1J55 A;  3CS1 A;  2EGD A;  3TZ1 A;  1LIN A;  4CLN A;  2LAN A;  1NCX A;  1KFX L;  1ORG A;  3DVE A;  1K95 A;  2LLU A;  2OS8 C;  1CFP A;  2KI6 D;  3BOW B;  3H4S E;  1AVS A;  1VRK A;  2P6B B;  3DZT A;  1IJ6 A;  1DJW A;  3GK2 A;  2KAY A;  1TNP A;  2PMY A;  3D0Y A;  2LC5 A;  2OS8 B;  2ZN8 A;  1NX1 A;  2QEV A;  3BUM B;  2KGB C;  2CT9 A;  3IQQ A;  2KBM A;  1XFZ O;  4PCW A;  2K60 A;  2KLE A;  5I2O A;  1QWV A;  1J7R A;  2WOR A;  2Q91 A;  1LA0 A;  4NDB A;  1BR1 B;  3RZS A;  1B8C A;  4GGF A;  1IWQ A;  3DF0 B;  3A4U B;  1UHK A;  3FIA A;  2KOT A;  3KHE A;  1YUT A;  4ORC B;  1KQV A;  4GPL B;  1F4O A;  4FTG A;  4NQG A;  1DMO A;  2LMU A;  1BMO A;  1BJF A;  2P71 A;  4QJ5 B;  1AHR A;  1WLZ A;  2M29 A;  5HKW A;  1K8U A;  1NPQ A;  1QAS A;  2YGU A;  3PLF B;  1TCF A;  1YR5 A;  5G08 A;  3EG5 B;  4TNC A;  3DVK A;  2BBM A;  2BKI B;  2QEO A;  4QJ3 B;  1KSO A;  2LUC A;  5EL2 A;  2LLT A;  4D1E A;  4XJK A;  1XFV O;  4DUQ A;  4F0Z B;  3B86 A;  3SG4 A;  1DEK A;  3OB2 B;  5HL1 A;  1F54 A;  1TUJ A;  3I5F C;  1J7O A;  2LP2 A;  1OQP A;  2MJW B;  1TN4 A;  3BJH A;  2KDH A;  3GK1 A;  4PHN A;  1UHI A;  4A4C A;  3S0B A;  1CMF A;  5AEQ A;  3I5G C;  1RTP 1;  3PM2 A;  4INW A;  2BL0 C;  2F2O A;  3CZT X;  3O4Y A;  4USL A;  2NLN A;  3F45 A;  2JOJ A;  4CPV A;  3TUY C;  4WRI A;  1S26 D;  1BG1 A;  1DJI A;  2K61 A;  3I5G B;  2JRF A;  2BL0 B;  1KFU L;  2COL B;  1BT6 A;  1C3Z A;  1F55 A;  1ZAC A;  1DJX A;  2JT3 A;  2KFF A;  3WHU B;  3TUY B;  1MUX A;  1UUR A;  1A75 A;  3NHT A;  5CSN A;  1SW8 A;  4JD9 A;  5DIC A;  1H4B A;  2GGM A;  2MRD A;  1GQM A;  1CDP A;  4P5O E;  5FI6 A;  3I5I C;  1SK6 D;  3LCP C;  4AQI A;  1BU3 A;  2BE4 A;  1IJ5 A;  5AAN A;  1OW4 A;  4DRW A;  1WY9 A;  2FJU B;  2ZKM X;  5I2Q A;  1SL8 A;  3CR5 X;  1ZOT B;  3OGN A;  1R6P A;  1W7I B;  3I5I B;  4YI9 A;  2BNX A;  4CID A;  2WC8 A;  1J7P A;  4M2Q A;  4MN0 A;  1TUZ A;  2EC6 C;  2K2F A;  5J3X A;  1WRZ A;  2KAV A;  3PSR A;  4YGC B;  1B9A A;  3CR4 X;  1QX5 B;  2M7L A;  2SAS A;  1JBA A;  1YX8 A;  2EC6 B;  2LAP A;  3D74 A;  2KLD A;  1PK0 D;  2L98 A;  1NX3 A;  1OZS A;  1PAL A;  1TIZ A;  2JPO A;  2LNK A;  2MHH A;  3GK4 X;  4MRY A;  4DIR A;  1OE9 B;  5PAL A;  1U5I B;  1CDL A;  2IS9 A;  1SPY A;  2OPO A;  1DJG A;  3IQO A;  2ZN9 A;  1OMV A;  1CLL A;  3B7A A;  4OCI A;  1YX7 A;  3B88 A;  1SBJ A;  1NCY A;  1WDC C;  3DXL A;  4ZCV A;  3NSO A;  3SS5 A;  1SKT A;  1K93 D;  1OOJ A;  2K2A A;  2PQL A;  1TNW A;  4PHM A;  1M45 A;  3RLZ A;  2L2C A;  4WQ3 A;  1QV0 A;  1WDC B;  4CFR A;  1QLS A;  1IQ5 A;  3R1P A;  1NX2 A;  3SG3 A;  3JVT C;  1X02 A;  1ALV A;  2QEB A;  3O78 A;  2WCL A;  2KI6 C;  2M3W A;  2WC5 A;  3D76 A;  4GFT A;  4GUK A;  4BY4 A;  5KU1 A;  1J1D A;  1FI6 A;  2A4J A;  1LS8 A;  3CLN A;  3JVT B;  1A29 A;  1OSA A;  4IJ7 A;  1RWY A;  1EH2 A;  2DOQ A;  1KK8 C;  1DT7 B;  4CFQ A;  4A4B A;  5JJG A;  2M1U A;  2O60 A;  2AUC A;  3L47 A;  1TNQ A;  1NUB A;  4MZK A;  3O4X A;  3CR2 A;  4INX A;  3D77 A;  1F4Q A;  3BUO B;  5BPJ A;  1F70 A;  1KK8 B;  1M46 A;  1RRO A;  3CDN A;  1SMG A;  1IIO A;  1C3Y A;  3SG6 A;  2F8P A;  4OZD A;  3D78 A;  1KSM A;  3M0W A;  1DF0 B;  2MLF C;  3PM8 A;  4ICB A;  2LVV A;  5D7F A;  2KHN A;  4XYN A;  2HPS A;  4C0J A;  2PRU A;  3FWB A;  2WCK A;  3IF7 A;  5GQQ C;  4PE1 A;  1CFF A;  1CFC A;  3I5H C;  3KEV A;  1FBV A;  2KAX A;  2I18 A;  1IKU A;  1NX0 A;  2LCP A;  1HT9 A;  1LVC D;  3DVJ A;  1BR4 B;  1Y6W A;  1S6I A;  3NSI A;  4GAO A;  1NWD A;  4KYN A;  1CM4 A;  1QX7 A;  1S6C A;  2KQY A;  3BYA A;  3NXA A;  4GGN A;  4JQ0 D;  2MAZ A;  3I5H B;  2F3Z A;  2JWW A;  4GNK B;  5I2L A;  1MXL C;  1QIV A;  1XFW O;  3NGV A;  4PDZ A;  3CWG A;  1W7J B;  1S5G Z;  2BCA A;  1LKJ A;  2PAL A;  1GM0 A;  2LE9 B;  2L0P A;  2CNP A;  2ZFD A;  5D69 A;  3TS5 C;  1QVI Z;  1C07 A;  1EG4 A;  1SRA A;  1TTX A;  4PT1 A;  3B87 A;  3VB1 A;  2JU0 A;  3PFV A;  3TDZ A;  1BOD A;  1NIW A;  2L5X B;  3BOW A;  1J7Q A;  1SCM C;  2KYF A;  3TS5 B;  3NHI A;  3GOF A;  1SY9 A;  3CZ0 A;  4DS7 A;  1Y1X A;  4DCK A;  3D10 A;  2LUX A;  1GGZ A;  1KFX S;  3L4L A;  2H61 C;  1G33 A;  3BFB A;  3D73 A;  1SCM B;  3E3R A;  5F6T A;  1QAT A;  3SG7 A;  3SJS A;  1CLB A;  1CMG A;  4OVN F;  2ZNE A;  2BCB A;  3LL8 B;  1B8L A;  4FQT A;  2CBL A;  2JT8 A;  1B7T Z;  1YRT B;  1N0Y A;  5ER4 X;  4MZJ A;  3PAT A;  4UPG A;  1DGV A;  3DF0 A;  4WQ2 A;  1HQV A;  1XK4 C;  1YUS A;  3VRP A;  1OZO A;  2L51 A;  4YGA A;  1K94 A;  1B8R A;  2ZRT A;  3AAJ A;  2HET A;  2I94 A;  5AXI A;  1S5G Y;  2K7B A;  2SCP A;  3S0D A;  2GGZ A;  3S0A A;  4YBH B;  4C0K A;  4YI8 A;  1QVI Y;  5B8I B;  1DTL A;  1JWD A;  1KK7 Z;  4HRG A;  2H2K A;  2AMI A;  4PHJ A;  2BEC A;  3EK8 A;  4N1F A;  2KI4 C;  3SS3 A;  1A4P A;  1E8A A;  2LMV A;  3OP0 A;  5K89 A;  5DKQ A;  2LVJ A;  1SNL A;  1AJ5 A;  1OMR A;  1C7W A;  3PJI A;  1L2O C;  2JZI A;  3OX6 A;  3RM1 A;  2BBN A;  1EG3 A;  1TOP A;  2KI4 B;  4F7F A;  2F33 A;  4N5X A;  2GTE A;  2MLE C;  2Q4U A;  1N2D A;  1YUU A;  2LV7 A;  2B1U A;  2JPT A;  2LVI A;  3LK1 A;  1ZUZ A;  3CZ2 A;  3WHT B;  1K9U A;  2M8U A;  4YRU A;  1L2O B;  3OHM B;  2WCJ A;  5AFP A;  1S6J A;  1JF2 A;  2KPH A;  4ZCU A;  3VRR A;  1DC1 A;  1TCO B;  1JFJ A;  5CSF A;  4BY5 A;  2F3Y A;  2JQ6 A;  1B7T Y;  1K90 D;  1RFJ A;  2M49 B;  1YVH A;  3BXK A;  5IBW A;  1BLQ A;  2H8V A;  1QIW A;  2HQW A;  2FOT A;  2NCO A;  3NSL A;  4JKT A;  2KQ6 A;  1M31 A;  3D0Y B;  4MZL A;  1PVA A;  3IVT A;  1NP8 A;  1KQM C;  5FI2 A;  3ZWH A;  1DJY A;  2BKH B;  1F8H A;  4GGF C;  3C1V A;  1KK7 Y;  1H8B A;  4ETO A;  2L50 A;  2WCB A;  2LP3 A;  1KQM B;  1TWO A;  1V1G A;  3CZ1 A;  4PE0 A;  1K9K A;  3DYE A;  4YGB B;  3ZNI A;  1B4C A;  3AKB A;  2JUL A;  4HSZ A;  1FF1 A;  1KCY A;  1XFY O;  4MRX A;  2L5Y A;  4P2Y B;  1RK9 A;  2I2R E;  2M0R A;  2QEH A;  3OB1 B;  4ORA B;  1KFU S;  1OOH A;  2JNF A;  4MBE A;  2ERB A;  4YGD B;  1YUR A;  2WCH A;  1MR8 A;  2R2I A;  4PE7 A;  2MA2 A;  1QJT A;  3N7H A;  4I5L B;  1CM1 A;  2JT0 A;  1JUO A;  1L7Z A;  2NCP A;  4NDD A;  3SG2 A;  1BF5 A;  1MXE A;  3R1O A;  1S3P A;  1G4Y R;  4R1E A;  3SG5 A;  4I5N B;  2WCM A;  1J1E A;  5DKR A;  1QV1 A;  4MLW A;  5ER5 A;  2JTZ A;  1JSA A;  3R72 A;  5I94 A;  4YGE B;  4AQJ A;  1AK8 A;  4XJK B;  3EVR A;  2KNE A;  4MSP A;  3EK4 A;  3FS7 A;  3KO0 A;  4JPZ B;  2WND A;  2KGR A;  3OBV A;  1FI5 A;  1Y1A A;  3O2P A;  2FJY A;  1PUL A;  1U5I A;  3QME A;  1OOG A;  3LLE A;  1FW4 A;  1A2X A;  4MEW A;  1CDN A;  2KBI A; 
#chains in the Genus database with same CATH homology
 3BFA A;  3OGN A;  3R1V A;  3L4L A;  3BFB A;  3D73 A;  1OOF A;  2WC6 A;  1DQE A;  4FQT A;  3Q8I A;  3D74 A;  3K1E A;  3DY9 A;  2JPO A;  3CAB A;  1ORG A;  1T14 A;  3S0D A;  3S0A A;  3B7A A;  3DZT A;  3B88 A;  3DXL A;  3S0G A;  1OOI X;  2PQL A;  2QEV A;  3PJI A;  2L2C A;  2QDI A;  3R1P A;  4F7F A;  2QEB A;  1QWV A;  2GTE A;  2WCL A;  2WC5 A;  3D76 A;  3FE9 A;  3CZ2 A;  3CYZ A;  3RZS A;  2P70 A;  2WCJ A;  2KPH A;  1LS8 A;  2H8V A;  2P71 A;  3BFH A;  3L47 A;  3B6X A;  4INX A;  3D77 A;  3CDN A;  2QEO A;  1C3Y A;  5EL2 A;  1TWO A;  3CZ1 A;  3D78 A;  3DYE A;  4OZD A;  3B86 A;  1P28 A;  1TUJ A;  3D75 A;  2QEH A;  2WCK A;  3BJH A;  3S0E A;  3V2L A;  1OOH A;  3S0B A;  3S0F A;  2ERB A;  4INW A;  2WCH A;  3N7H A;  3FE6 A;  3R1O A;  3L4A A;  2WCM A;  3R72 A;  3NGV A;  1C3Z A;  3FE8 A;  1GM0 A;  3NHT A;  4JD9 A;  5DIC A;  4PT1 A;  2FJY A;  3B87 A;  3VB1 A;  1XFR A;  3QME A;  1OOG A;  1OW4 A;  3NHI A;  3CZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...