3D73A

Crystal structure of a pheromone binding protein mutant d35a, from apis mellifera, at ph 7.0
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
119
structure length
119
Chain Sequence
APDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVAKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 38
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3d73A00
1C3YA 1OW4A 1LS8A 4INXA 1GM0A 4FQTA 4JD9A 1OOHA 3R1PA 1OOGA 3D77A 2P71A 3R1OA 2PQLA 1TUJA 3S0FA 4INWA 1C3ZA 3BFHA 1DQEA 3K1EA 3CABA 3QMEA 3FE8A 2H8VA 3CZ2A 3B7AA 2WCJA 3Q8IA 3RZSA 3DY9A 2QEVA 3D74A 3DYEA 2WCHA 3VB1A 3S0EA 3L47A 3NGVA 3B6XA 3D73A 3D78A 1OOFA 1T14A 2QEBA 5DICA 2ERBA 2QEOA 3DXLA 2P70A 3CDNA 3BJHA 1XFRA 2QDIA 2WC5A 3DZTA 2QEHA 2FJYA 3S0AA 3BFAA 3FE9A 2WCLA 4OZDA 3CZ0A 2WC6A 3S0GA 2L2CA 3N7HA 3S0DA 3CYZA 3NHIA 3BFBA 3PJIA 5EL2A 3R72A 1ORGA 2WCKA 2WCMA 4PT1A 1TWOA 1OOIX 1P28A 3B87A 1QWVA 3B88A 3L4LA 3B86A 3L4AA 3S0BA 3V2LA 3NHTA 3D76A 2JPOA 3R1VA 2KPHA 3D75A 3FE6A 2GTEA 4F7FA 3CZ1A 3OGNA
chains in the Genus database with same CATH superfamily
3SIBA 1K93D 2KLEA 2PYQA 3K21A 3VROA 3VRRA 3SJSA 1LS8A 3OX6A 1TOPA 2K2AA 2EC6B 4JD9A 1RROA 1JFJA 2KGBC 1K8UA 3C1VA 3VGOA 4A4BA 1F71A 2LVJA 3MSEB 2K61A 5D3OA 1OOGA 1FI6A 2K8MB 2L0PA 3OGNA 1MXEA 3KO0A 1LVCD 2JPTA 2ISDA 1TNPA 2ZKMX 1K9UA 4QJ5B 2WOSA 1S6JA 5ER4X 1PSBA 2LC5A 3OX5A 2K2FA 3CR5X 1U5IB 1A03A 1DJZA 1GQMA 1SL8A 2L2EA 2ZN8A 2JULA 4C0LA 5I2OA 1HQVA 2GV5A 1PSRA 3CABA 3ZNIA 3M0WA 2NLNA 4NQGA 1J7RA 3B7AA 1FI5A 5AXIA 3ZWHA 2ZN9A 2CT9A 3CZTX 4GBAA 4AQJA 1KQMC 4U8DA 3IVTA 2KYCA 3GOFA 4Q04A 2FCDA 1OZSA 1TIZA 3DYEA 2WCHA 4I5KA 4YBHB 1OOJA 3VB1A 1XA5A 4MRYA 4PE4A 2H61C 4GGNA 1RFJA 1S36A 1SPYA 3B6XA 3OB2B 2KI6C 3D10A 3LK0A 4GUKA 1JFKA 1ZFSA 3GK4X 2KI4C 1Z2CB 1NSHA 3CR2A 2QEBA 3JVTC 2JT0A 1K9KA 1QASA 4HRHA 2P70A 2KFHA 2MA2A 4ICBA 1MWNA 2MHHA 1B47A 3PN7B 4DUQA 1JSAA 5BPJA 1GGZA 4YI9A 1K2HA 1J1DA 1NWDA 3FS7A 2BBMA 4YGDB 1KWOB 1S6CA 1SMGA 2L4HA 2RGIA 3FWCA 3JTDC 3I5GC 5HYDA 3S0AA 1QS7A 4OZDA 3CZ0A 4PHMA 1BOCA 1V1GA 3O4YA 1SCMC 5AFPA 2JT8A 3IQOA 1BG1A 1B7TY 2LMUA 3PLFB 5I94A 4CFQA 1WDCB 1BMOA 1CDLA 1LINA 1XFWO 2Y4QA 2ZRSA 4MN0A 2JNFA 1NX3A 1K94A 1WRZA 3UNWA 4C0KA 1BF5A 1G8IA 1FPWA 1ORGA 1J7PA 1KQVA 3SS4A 5KU1A 1PVBA 2KHNA 3DD4A 4MEWA 4YI8A 1KFXS 2HF5A 1BU3A 2WCMA 2BBNA 1OOIX 1QWVA 3IF7A 1NPQA 1NX0A 2CNPA 3L4AA 3VRQA 4N1FA 3S0BA 2E6WA 4PALA 1JUOA 2CXJA 2KBIA 3I5IB 1S1EA 1S6IA 2BECA 1K90D 2HPSA 3OBVA 3EK8A 5JOLA 1PRWA 5I2QA 2F2OA 3D76A 2M1KB 2FJUB 1YRTB 2AUCA 3R1VA 4GGFC 2D8NA 4QJ3B 4PHJA 2CBLA 3WXAA 1BLQA 3WNXB 2ZNEA 3AAJA 3I5HC 3SG4A 3DVEA 1J55A 1XFYO 2OTGB 1OW4A 3AKAA 2QACA 1N0YA 5D7FA 2L5XB 1F54A 4INXA 1OE9B 1SNLA 1MF8B 1UHKA 1WLZA 5PALA 2PRUA 4CPVA 2LCPA 2KBMA 3PSRA 1XO5A 3TDIA 4DRWA 1OMRA 1XVJA 1ODBA 4L9MA 1ZACA 3CTNA 1JWDA 1L2OB 1SR6B 1W7JB 1G33A 1CLLA 1DJGA 4YGEB 4I5NB 2G2BA 1PALA 3BYAA 1IJ5A 3PATA 3S0FA 1FBVA 2PMYA 3PM8A 4INWA 3TUYC 5AEQA 1RK9A 1SL9A 1TUZA 4XYNA 5HL1A 3QMEA 5CSJA 2EC6C 1AJ4A 4NDDA 2H8VA 2ZRTA 3CZ2A 1BR1B 2LNKA 2PALA 4OR9B 1C7WA 1QXPA 3SG3A 3A8RA 1IQ5A 3D0YA 1ZOTB 1RECA 2F33A 1OQPA 2MAZA 4PHKA 1TCOB 2O5GA 1M46A 1EL4A 5D69A 1KFXL 2NXQA 2WCEA 2MJWB 4ZCUA 3UO9A 2K7CA 4MRXA 5FI7A 4QJ4B 4AOMA 2KAXA 1QTXA 1UHJA 2WCBA 2COLB 1J7QA 1AHRA 3D78A 2NZ0A 4JKTA 4WRIA 5J3XA 5GQQC 1QX2A 1DJXA 2ERBA 5DICA 1H4BA 4D1EA 5AANA 1TNQA 1K96A 1MQ1A 2L50A 3OB1B 4M2QA 4N5XA 2Y5IA 3SG6A 1SW8A 2JXLA 3CDNA 1QLKA 2KSPA 3BUMB 1EG3A 1SCVA 2WC8A 3KEVA 5IBWA 1W7IB 1KFUS 2LAPA 1IG5A 2LUXA 1LXFC 4OV2A 2KAYA 1IKUA 1CTRA 4TNCA 2LV7A 2WC5A 1CKKA 1IIOA 1KK8B 1M31A 2MRDA 3BFAA 3FE9A 1W9ZA 4IJ7A 2H2KA 1L7ZA 2SASA 4MLWA 1NX1A 2EGDA 2WCFA 1K9PA 2IS9A 1DMOA 5I8NA 1YRUB 3S0DA 1YUUA 4MVFA 2KGRA 1NCXA 1OSAA 1PVAA 4PE7A 1UUSA 1JC2A 1A4PA 3CYZA 3NHIA 1FW4A 4WQ2A 3BFBA 3GK1A 2M9GA 2KI6D 4GAOA 2FCEA 4USLA 2Q91A 4HRGA 1UHHA 4ZCVA 4OVNF 2KNEA 2LVVA 1VRKA 3PN7C 2M7LA 2PVBA 2V53A 1YX8A 2OS8B 4JWQA 1IQ3A 1KWOC 5KTYA 3TDZA 3B87A 2LP2A 2KQYA 1B1GA 2R2IA 3LLEA 2K0JA 2JU0A 1NP8A 3CR4X 2LANA 1XK4A 3O6BA 1WDCC 2M1UA 3TZ1A 2Q4UA 3V2LA 1RTP1 3CS1A 2YGUA 3NHTA 1TNXA 4R1EA 1YUSA 5AERA 1QLSA 2KPHA 2L5YA 2L98A 3DVJA 1AVSA 3PFVA 3I5FC 2GTEA 1SY9A 2WNDA 5FYXA 2JC2A 1MR8A 2BCAA 3TS5B 1C3YA 1CDNA 3RLZA 4FQTA 1NYAA 2K7DA 1F4QA 1NCZA 3LK1A 1YURA 4YRUA 3R1PA 1Y0VH 3H4SE 3E3RA 4JQ0D 3SG7A 1Q80A 3D0YB 4CLNA 3D77A 1HT9A 4DIRA 4PHNA 5FI6A 1D1OA 4MSPA 4UPGA 2PSRA 1KFUL 2G9BA 2SCPA 1TUJA 3NSLA 4ORBB 5F6TA 2JWWA 2BL0B 1ALWA 1CFDA 1N65A 1JF2A 4A4CA 2OTGC 1WRLA 1B4CA 2I7AA 2LVIA 1OMVA 2M7NA 4P5OE 4BY4A 4MZJA 3NXAA 2KAVA 3KHEA 5HLOA 1RWYA 2F3ZA 1QX5B 1M39A 4YGBB 2NCPA 1KSMA 3RM1A 3RZSA 1MXLC 3NSOA 1L2OC 4ORCB 5K89A 5B8IB 2H61A 1IGVA 1SR6C 3L47A 1CFPA 4PE0A 2PASA 2JTTA 1R6PA 2JXCA 5CSFA 3ICBA 5CPVA 2KYFA 5CSIA 5I2LA 2KFGA 2P6BB 1CLMA 1F8HA 1CFCA 1OOFA 1XFVO 1KSOA 1SYMA 4WQ3A 3HX4A 2AAOA 2QEOA 5HKYA 4NDCA 3EVVA 1TRFA 2BAPA 3DXLA 3NSKA 1TCFA 2BKHB 4HSZA 2LLSA 3QRXA 2QDIA 2Y1NA 3GK2A 1TNWA 2I18A 1YTZC 4GFTA 3DZTA 2QEHA 2FJYA 3O78A 5DKNA 3SG5A 2WCLA 1SRAA 3BQ3A 3EG5B 3HCMA 1TTXA 2NCOA 3FWBA 4JPZB 2WC6A 4PCWA 1KK7Y 3O2PA 4DCKA 1AUIB 2L2CA 1DGUA 1DF0A 1EG4A 2HETA 2L4IA 4OCIA 1G4YR 1QJTA 1KCYA 4FQOA 2HQWA 1SKTA 4N1GA 3WHTB 3BUOB 2M29A 3PJIA 5EL2A 1F4OA 1XFXO 3SS3A 1MUXA 2LMTA 2JOJA 1RJVA 1BODA 4GNKB 1PK0D 1QIWA 2JQ6A 3A4UB 1XYDA 1AJ5A 3R72A 2ZFDA 2M0RA 4MBEA 1R2UA 1WRKA 2WCKA 1ZUZA 4AQIA 1A29A 1DJHA 1SK6D 1OMDA 5JJGA 1DT7B 1KK8C 2F8PA 1S3PA 2KOTA 2M49B 3BOWA 1PULA 3B86A 1J1EA 2K7OA 1BT6A 2JZIA 1LA3A 2BKIB 1CFFA 1S5GY 1UP5A 1CB1A 1A75A 2BCXA 2AMIA 2LLTA 1CDPA 2LHIA 3DF0A 4GGFA 2JPOA 3FE6A 3KPXA 3EK4A 1B8CA 2LVKA 1M45A 4C0JA 3SS5A 3EKJA 4PDZA 3TDUA 2MLFC 2OS8C 4PT1A 4F0ZB 2BE6A 3BUWB 1DJYA 2I2RE 1MHOA 1GM0A 4HREE 1WY9A 4PE1A 4DS7A 1F55A 1BR4B 3CLNA 2CTNA 1OOHA 5HLVA 1A2XA 1B8RA 1EH2A 1GGWA 1QATA 2VRGA 1KQMB 2LP3A 4XJKA 5HKWA 1UWOA 1TN4A 2DOQA 1AP4A 2F2PA 1CLBA 3O4XA 4ETOA 2K7BA 2K60A 2LLUA 1CM4A 2P71A 1YR5A 2KLDA 2PQLA 2M97A 3BXKA 2M8UA 3R1OA 4I5LB 3BUXB 1CMGA 1K95A 3KF9A 4KYNA 1KK7Z 5DKRA 1CNPA 2F3YA 4M2OA 5CSNA 1DGVA 2KI4B 1IRJA 1E8AA 1X02A 1Z4HA 2LHLA 3TS5C 1C3ZA 3BFHA 1DQEA 4CIDA 3EKHA 3JVTB 3K1EA 1IWQA 1CMFA 1JBAA 3FE8A 1NCYA 2L51A 1C7VA 2GGMA 2WCJA 3Q8IA 1IJ6A 3DY9A 1QVIY 5KSZA 1NX2A 1XFUO 2QEVA 3LCPC 1AK8A 3D74A 2FOTA 1XFZO 1YX7A 1QV0A 1WLMA 3I5IC 3JTDB 3S0EA 2I94A 3I5GB 3FIAA 3NGVA 4YGCB 3D73A 2BL0C 1BJFA 3CWGA 2LMVA 4NDBA 1SCMB 1N2DA 1CM1A 1U5IA 1S5GZ 1Y1AA 1LKJA 1EXRA 2KDHA 1QX7A 1DF0B 1DELA 2CCMA 5ER5A 4OKHA 3VRNA 1T14A 4FTGA 4P2YB 4YGAA 3PM2A 1GJYA 1YVHA 1SBJA 3I5FB 3OP0A 1DJIA 1QV1A 1S26D 2LM5A 1V1FA 1QIVA 3BJHA 3BUNB 3WHUB 3VRPA 2B1UA 3AKBA 1XFRA 3EVRA 4I5JA 2KQ6A 4GPLB 5FI2A 2OPOA 2Y1MA 2LUCA 3IQQA 1H8BA 1YUTA 1M63B 1CDMA 1LA0A 3BOWB 3DVMA 3S0GA 1YVLA 1ALVA 1ZMZA 2BNXA 3N7HA 2WORA 1Y6WA 1FF1A 2A4JA 1A75B 2O60A 2QPTA 4E68A 3CGAA 2MLEC 3DF0B 2M3WA 1UHIA 2MBXA 1Y1UA 2TN4A 3EVUA 3DVKA 1NIWA 1UURA 3NSIA 1F70A 3PALA 5DKQA 2LE9B 3AAKA 4IL1A 2BCBA 2JRFA 1B8LA 3F45A 3I5HB 3SIAA 1C07A 1DVIA 1TWOA 4MZKA 1P28A 3SG2A 4CFRA 1DC1A 2HQ8A 1SL7A 3LL8B 3B88A 1OZOA 3L4LA 1NUBA 2KFFA 2JT3A 1UHNA 1Y1XA 3OHMB 1SSEB 5TNCA 1QVIZ 1IH0A 2JTZA 4XJKB 1JF0A 4M2PA 1EJ3A 2E30A 2GGZA 1XK4C 4BY5A 5G08A 5HKZA 2ZNDA 1DTLA 1B9AA 1B7TZ 2BE4A 1DEKA 3D75A 2EHBA 2JNXA 3EK7A 4F7FA 1J7OA 1DJWA 4MZLA 4ORAB 3TUYB 3CZ1A
chains in the Genus database with same CATH topology
1C3YA 1OW4A 1LS8A 4INXA 1GM0A 4FQTA 4JD9A 1OOHA 3R1PA 1OOGA 3D77A 2P71A 3R1OA 2PQLA 1TUJA 3S0FA 4INWA 1C3ZA 3BFHA 1DQEA 3K1EA 3CABA 3QMEA 3FE8A 2H8VA 3CZ2A 3B7AA 2WCJA 3Q8IA 3RZSA 3DY9A 2QEVA 3D74A 3DYEA 2WCHA 3VB1A 3S0EA 3L47A 3NGVA 3B6XA 3D73A 3D78A 1OOFA 1T14A 2QEBA 5DICA 2ERBA 2QEOA 3DXLA 2P70A 3CDNA 3BJHA 1XFRA 2QDIA 2WC5A 3DZTA 2QEHA 2FJYA 3S0AA 3BFAA 3FE9A 2WCLA 4OZDA 3CZ0A 2WC6A 3S0GA 2L2CA 3N7HA 3S0DA 3CYZA 3NHIA 3BFBA 3PJIA 5EL2A 3R72A 1ORGA 2WCKA 2WCMA 4PT1A 1TWOA 1OOIX 1P28A 3B87A 1QWVA 3B88A 3L4LA 3B86A 3L4AA 3S0BA 3V2LA 3NHTA 3D76A 2JPOA 3R1VA 2KPHA 3D75A 3FE6A 2GTEA 4F7FA 3CZ1A 3OGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C3Y A;  1OW4 A;  1LS8 A;  4INX A;  1GM0 A;  4FQT A;  4JD9 A;  1OOH A;  3R1P A;  1OOG A;  3D77 A;  2P71 A;  3R1O A;  2PQL A;  1TUJ A;  3S0F A;  4INW A;  1C3Z A;  3BFH A;  1DQE A;  3K1E A;  3CAB A;  3QME A;  3FE8 A;  2H8V A;  3CZ2 A;  3B7A A;  2WCJ A;  3Q8I A;  3RZS A;  3DY9 A;  2QEV A;  3D74 A;  3DYE A;  2WCH A;  3VB1 A;  3S0E A;  3L47 A;  3NGV A;  3B6X A;  3D73 A;  3D78 A;  1OOF A;  1T14 A;  2QEB A;  5DIC A;  2ERB A;  2QEO A;  3DXL A;  2P70 A;  3CDN A;  3BJH A;  1XFR A;  2QDI A;  2WC5 A;  3DZT A;  2QEH A;  2FJY A;  3S0A A;  3BFA A;  3FE9 A;  2WCL A;  4OZD A;  3CZ0 A;  2WC6 A;  3S0G A;  2L2C A;  3N7H A;  3S0D A;  3CYZ A;  3NHI A;  3BFB A;  3PJI A;  5EL2 A;  3R72 A;  1ORG A;  2WCK A;  2WCM A;  4PT1 A;  1TWO A;  1OOI X;  1P28 A;  3B87 A;  1QWV A;  3B88 A;  3L4L A;  3B86 A;  3L4A A;  3S0B A;  3V2L A;  3NHT A;  3D76 A;  2JPO A;  3R1V A;  2KPH A;  3D75 A;  3FE6 A;  2GTE A;  4F7F A;  3CZ1 A;  3OGN A; 
#chains in the Genus database with same CATH topology
 3SIB A;  1K93 D;  2KLE A;  2PYQ A;  3K21 A;  3VRO A;  3VRR A;  3SJS A;  1LS8 A;  3OX6 A;  1TOP A;  2K2A A;  2EC6 B;  4JD9 A;  1RRO A;  1JFJ A;  2KGB C;  1K8U A;  3C1V A;  3VGO A;  4A4B A;  1F71 A;  2LVJ A;  3MSE B;  2K61 A;  5D3O A;  1OOG A;  1FI6 A;  2K8M B;  2L0P A;  3OGN A;  1MXE A;  3KO0 A;  1LVC D;  2JPT A;  2ISD A;  1TNP A;  2ZKM X;  1K9U A;  4QJ5 B;  2WOS A;  1S6J A;  5ER4 X;  1PSB A;  2LC5 A;  3OX5 A;  2K2F A;  3CR5 X;  1U5I B;  1A03 A;  1DJZ A;  1GQM A;  1SL8 A;  2L2E A;  2ZN8 A;  2JUL A;  4C0L A;  5I2O A;  1HQV A;  2GV5 A;  1PSR A;  3CAB A;  3ZNI A;  3M0W A;  2NLN A;  4NQG A;  1J7R A;  3B7A A;  1FI5 A;  5AXI A;  3ZWH A;  2ZN9 A;  2CT9 A;  3CZT X;  4GBA A;  4AQJ A;  1KQM C;  4U8D A;  3IVT A;  2KYC A;  3GOF A;  4Q04 A;  2FCD A;  1OZS A;  1TIZ A;  3DYE A;  2WCH A;  4I5K A;  4YBH B;  1OOJ A;  3VB1 A;  1XA5 A;  4MRY A;  4PE4 A;  2H61 C;  4GGN A;  1RFJ A;  1S36 A;  1SPY A;  3B6X A;  3OB2 B;  2KI6 C;  3D10 A;  3LK0 A;  4GUK A;  1JFK A;  1ZFS A;  3GK4 X;  2KI4 C;  1Z2C B;  1NSH A;  3CR2 A;  2QEB A;  3JVT C;  2JT0 A;  1K9K A;  1QAS A;  4HRH A;  2P70 A;  2KFH A;  2MA2 A;  4ICB A;  1MWN A;  2MHH A;  1B47 A;  3PN7 B;  4DUQ A;  1JSA A;  5BPJ A;  1GGZ A;  4YI9 A;  1K2H A;  1J1D A;  1NWD A;  3FS7 A;  2BBM A;  4YGD B;  1KWO B;  1S6C A;  1SMG A;  2L4H A;  2RGI A;  3FWC A;  3JTD C;  3I5G C;  5HYD A;  3S0A A;  1QS7 A;  4OZD A;  3CZ0 A;  4PHM A;  1BOC A;  1V1G A;  3O4Y A;  1SCM C;  5AFP A;  2JT8 A;  3IQO A;  1BG1 A;  1B7T Y;  2LMU A;  3PLF B;  5I94 A;  4CFQ A;  1WDC B;  1BMO A;  1CDL A;  1LIN A;  1XFW O;  2Y4Q A;  2ZRS A;  4MN0 A;  2JNF A;  1NX3 A;  1K94 A;  1WRZ A;  3UNW A;  4C0K A;  1BF5 A;  1G8I A;  1FPW A;  1ORG A;  1J7P A;  1KQV A;  3SS4 A;  5KU1 A;  1PVB A;  2KHN A;  3DD4 A;  4MEW A;  4YI8 A;  1KFX S;  2HF5 A;  1BU3 A;  2WCM A;  2BBN A;  1OOI X;  1QWV A;  3IF7 A;  1NPQ A;  1NX0 A;  2CNP A;  3L4A A;  3VRQ A;  4N1F A;  3S0B A;  2E6W A;  4PAL A;  1JUO A;  2CXJ A;  2KBI A;  3I5I B;  1S1E A;  1S6I A;  2BEC A;  1K90 D;  2HPS A;  3OBV A;  3EK8 A;  5JOL A;  1PRW A;  5I2Q A;  2F2O A;  3D76 A;  2M1K B;  2FJU B;  1YRT B;  2AUC A;  3R1V A;  4GGF C;  2D8N A;  4QJ3 B;  4PHJ A;  2CBL A;  3WXA A;  1BLQ A;  3WNX B;  2ZNE A;  3AAJ A;  3I5H C;  3SG4 A;  3DVE A;  1J55 A;  1XFY O;  2OTG B;  1OW4 A;  3AKA A;  2QAC A;  1N0Y A;  5D7F A;  2L5X B;  1F54 A;  4INX A;  1OE9 B;  1SNL A;  1MF8 B;  1UHK A;  1WLZ A;  5PAL A;  2PRU A;  4CPV A;  2LCP A;  2KBM A;  3PSR A;  1XO5 A;  3TDI A;  4DRW A;  1OMR A;  1XVJ A;  1ODB A;  4L9M A;  1ZAC A;  3CTN A;  1JWD A;  1L2O B;  1SR6 B;  1W7J B;  1G33 A;  1CLL A;  1DJG A;  4YGE B;  4I5N B;  2G2B A;  1PAL A;  3BYA A;  1IJ5 A;  3PAT A;  3S0F A;  1FBV A;  2PMY A;  3PM8 A;  4INW A;  3TUY C;  5AEQ A;  1RK9 A;  1SL9 A;  1TUZ A;  4XYN A;  5HL1 A;  3QME A;  5CSJ A;  2EC6 C;  1AJ4 A;  4NDD A;  2H8V A;  2ZRT A;  3CZ2 A;  1BR1 B;  2LNK A;  2PAL A;  4OR9 B;  1C7W A;  1QXP A;  3SG3 A;  3A8R A;  1IQ5 A;  3D0Y A;  1ZOT B;  1REC A;  2F33 A;  1OQP A;  2MAZ A;  4PHK A;  1TCO B;  2O5G A;  1M46 A;  1EL4 A;  5D69 A;  1KFX L;  2NXQ A;  2WCE A;  2MJW B;  4ZCU A;  3UO9 A;  2K7C A;  4MRX A;  5FI7 A;  4QJ4 B;  4AOM A;  2KAX A;  1QTX A;  1UHJ A;  2WCB A;  2COL B;  1J7Q A;  1AHR A;  3D78 A;  2NZ0 A;  4JKT A;  4WRI A;  5J3X A;  5GQQ C;  1QX2 A;  1DJX A;  2ERB A;  5DIC A;  1H4B A;  4D1E A;  5AAN A;  1TNQ A;  1K96 A;  1MQ1 A;  2L50 A;  3OB1 B;  4M2Q A;  4N5X A;  2Y5I A;  3SG6 A;  1SW8 A;  2JXL A;  3CDN A;  1QLK A;  2KSP A;  3BUM B;  1EG3 A;  1SCV A;  2WC8 A;  3KEV A;  5IBW A;  1W7I B;  1KFU S;  2LAP A;  1IG5 A;  2LUX A;  1LXF C;  4OV2 A;  2KAY A;  1IKU A;  1CTR A;  4TNC A;  2LV7 A;  2WC5 A;  1CKK A;  1IIO A;  1KK8 B;  1M31 A;  2MRD A;  3BFA A;  3FE9 A;  1W9Z A;  4IJ7 A;  2H2K A;  1L7Z A;  2SAS A;  4MLW A;  1NX1 A;  2EGD A;  2WCF A;  1K9P A;  2IS9 A;  1DMO A;  5I8N A;  1YRU B;  3S0D A;  1YUU A;  4MVF A;  2KGR A;  1NCX A;  1OSA A;  1PVA A;  4PE7 A;  1UUS A;  1JC2 A;  1A4P A;  3CYZ A;  3NHI A;  1FW4 A;  4WQ2 A;  3BFB A;  3GK1 A;  2M9G A;  2KI6 D;  4GAO A;  2FCE A;  4USL A;  2Q91 A;  4HRG A;  1UHH A;  4ZCV A;  4OVN F;  2KNE A;  2LVV A;  1VRK A;  3PN7 C;  2M7L A;  2PVB A;  2V53 A;  1YX8 A;  2OS8 B;  4JWQ A;  1IQ3 A;  1KWO C;  5KTY A;  3TDZ A;  3B87 A;  2LP2 A;  2KQY A;  1B1G A;  2R2I A;  3LLE A;  2K0J A;  2JU0 A;  1NP8 A;  3CR4 X;  2LAN A;  1XK4 A;  3O6B A;  1WDC C;  2M1U A;  3TZ1 A;  2Q4U A;  3V2L A;  1RTP 1;  3CS1 A;  2YGU A;  3NHT A;  1TNX A;  4R1E A;  1YUS A;  5AER A;  1QLS A;  2KPH A;  2L5Y A;  2L98 A;  3DVJ A;  1AVS A;  3PFV A;  3I5F C;  2GTE A;  1SY9 A;  2WND A;  5FYX A;  2JC2 A;  1MR8 A;  2BCA A;  3TS5 B;  1C3Y A;  1CDN A;  3RLZ A;  4FQT A;  1NYA A;  2K7D A;  1F4Q A;  1NCZ A;  3LK1 A;  1YUR A;  4YRU A;  3R1P A;  1Y0V H;  3H4S E;  3E3R A;  4JQ0 D;  3SG7 A;  1Q80 A;  3D0Y B;  4CLN A;  3D77 A;  1HT9 A;  4DIR A;  4PHN A;  5FI6 A;  1D1O A;  4MSP A;  4UPG A;  2PSR A;  1KFU L;  2G9B A;  2SCP A;  1TUJ A;  3NSL A;  4ORB B;  5F6T A;  2JWW A;  2BL0 B;  1ALW A;  1CFD A;  1N65 A;  1JF2 A;  4A4C A;  2OTG C;  1WRL A;  1B4C A;  2I7A A;  2LVI A;  1OMV A;  2M7N A;  4P5O E;  4BY4 A;  4MZJ A;  3NXA A;  2KAV A;  3KHE A;  5HLO A;  1RWY A;  2F3Z A;  1QX5 B;  1M39 A;  4YGB B;  2NCP A;  1KSM A;  3RM1 A;  3RZS A;  1MXL C;  3NSO A;  1L2O C;  4ORC B;  5K89 A;  5B8I B;  2H61 A;  1IGV A;  1SR6 C;  3L47 A;  1CFP A;  4PE0 A;  2PAS A;  2JTT A;  1R6P A;  2JXC A;  5CSF A;  3ICB A;  5CPV A;  2KYF A;  5CSI A;  5I2L A;  2KFG A;  2P6B B;  1CLM A;  1F8H A;  1CFC A;  1OOF A;  1XFV O;  1KSO A;  1SYM A;  4WQ3 A;  3HX4 A;  2AAO A;  2QEO A;  5HKY A;  4NDC A;  3EVV A;  1TRF A;  2BAP A;  3DXL A;  3NSK A;  1TCF A;  2BKH B;  4HSZ A;  2LLS A;  3QRX A;  2QDI A;  2Y1N A;  3GK2 A;  1TNW A;  2I18 A;  1YTZ C;  4GFT A;  3DZT A;  2QEH A;  2FJY A;  3O78 A;  5DKN A;  3SG5 A;  2WCL A;  1SRA A;  3BQ3 A;  3EG5 B;  3HCM A;  1TTX A;  2NCO A;  3FWB A;  4JPZ B;  2WC6 A;  4PCW A;  1KK7 Y;  3O2P A;  4DCK A;  1AUI B;  2L2C A;  1DGU A;  1DF0 A;  1EG4 A;  2HET A;  2L4I A;  4OCI A;  1G4Y R;  1QJT A;  1KCY A;  4FQO A;  2HQW A;  1SKT A;  4N1G A;  3WHT B;  3BUO B;  2M29 A;  3PJI A;  5EL2 A;  1F4O A;  1XFX O;  3SS3 A;  1MUX A;  2LMT A;  2JOJ A;  1RJV A;  1BOD A;  4GNK B;  1PK0 D;  1QIW A;  2JQ6 A;  3A4U B;  1XYD A;  1AJ5 A;  3R72 A;  2ZFD A;  2M0R A;  4MBE A;  1R2U A;  1WRK A;  2WCK A;  1ZUZ A;  4AQI A;  1A29 A;  1DJH A;  1SK6 D;  1OMD A;  5JJG A;  1DT7 B;  1KK8 C;  2F8P A;  1S3P A;  2KOT A;  2M49 B;  3BOW A;  1PUL A;  3B86 A;  1J1E A;  2K7O A;  1BT6 A;  2JZI A;  1LA3 A;  2BKI B;  1CFF A;  1S5G Y;  1UP5 A;  1CB1 A;  1A75 A;  2BCX A;  2AMI A;  2LLT A;  1CDP A;  2LHI A;  3DF0 A;  4GGF A;  2JPO A;  3FE6 A;  3KPX A;  3EK4 A;  1B8C A;  2LVK A;  1M45 A;  4C0J A;  3SS5 A;  3EKJ A;  4PDZ A;  3TDU A;  2MLF C;  2OS8 C;  4PT1 A;  4F0Z B;  2BE6 A;  3BUW B;  1DJY A;  2I2R E;  1MHO A;  1GM0 A;  4HRE E;  1WY9 A;  4PE1 A;  4DS7 A;  1F55 A;  1BR4 B;  3CLN A;  2CTN A;  1OOH A;  5HLV A;  1A2X A;  1B8R A;  1EH2 A;  1GGW A;  1QAT A;  2VRG A;  1KQM B;  2LP3 A;  4XJK A;  5HKW A;  1UWO A;  1TN4 A;  2DOQ A;  1AP4 A;  2F2P A;  1CLB A;  3O4X A;  4ETO A;  2K7B A;  2K60 A;  2LLU A;  1CM4 A;  2P71 A;  1YR5 A;  2KLD A;  2PQL A;  2M97 A;  3BXK A;  2M8U A;  3R1O A;  4I5L B;  3BUX B;  1CMG A;  1K95 A;  3KF9 A;  4KYN A;  1KK7 Z;  5DKR A;  1CNP A;  2F3Y A;  4M2O A;  5CSN A;  1DGV A;  2KI4 B;  1IRJ A;  1E8A A;  1X02 A;  1Z4H A;  2LHL A;  3TS5 C;  1C3Z A;  3BFH A;  1DQE A;  4CID A;  3EKH A;  3JVT B;  3K1E A;  1IWQ A;  1CMF A;  1JBA A;  3FE8 A;  1NCY A;  2L51 A;  1C7V A;  2GGM A;  2WCJ A;  3Q8I A;  1IJ6 A;  3DY9 A;  1QVI Y;  5KSZ A;  1NX2 A;  1XFU O;  2QEV A;  3LCP C;  1AK8 A;  3D74 A;  2FOT A;  1XFZ O;  1YX7 A;  1QV0 A;  1WLM A;  3I5I C;  3JTD B;  3S0E A;  2I94 A;  3I5G B;  3FIA A;  3NGV A;  4YGC B;  3D73 A;  2BL0 C;  1BJF A;  3CWG A;  2LMV A;  4NDB A;  1SCM B;  1N2D A;  1CM1 A;  1U5I A;  1S5G Z;  1Y1A A;  1LKJ A;  1EXR A;  2KDH A;  1QX7 A;  1DF0 B;  1DEL A;  2CCM A;  5ER5 A;  4OKH A;  3VRN A;  1T14 A;  4FTG A;  4P2Y B;  4YGA A;  3PM2 A;  1GJY A;  1YVH A;  1SBJ A;  3I5F B;  3OP0 A;  1DJI A;  1QV1 A;  1S26 D;  2LM5 A;  1V1F A;  1QIV A;  3BJH A;  3BUN B;  3WHU B;  3VRP A;  2B1U A;  3AKB A;  1XFR A;  3EVR A;  4I5J A;  2KQ6 A;  4GPL B;  5FI2 A;  2OPO A;  2Y1M A;  2LUC A;  3IQQ A;  1H8B A;  1YUT A;  1M63 B;  1CDM A;  1LA0 A;  3BOW B;  3DVM A;  3S0G A;  1YVL A;  1ALV A;  1ZMZ A;  2BNX A;  3N7H A;  2WOR A;  1Y6W A;  1FF1 A;  2A4J A;  1A75 B;  2O60 A;  2QPT A;  4E68 A;  3CGA A;  2MLE C;  3DF0 B;  2M3W A;  1UHI A;  2MBX A;  1Y1U A;  2TN4 A;  3EVU A;  3DVK A;  1NIW A;  1UUR A;  3NSI A;  1F70 A;  3PAL A;  5DKQ A;  2LE9 B;  3AAK A;  4IL1 A;  2BCB A;  2JRF A;  1B8L A;  3F45 A;  3I5H B;  3SIA A;  1C07 A;  1DVI A;  1TWO A;  4MZK A;  1P28 A;  3SG2 A;  4CFR A;  1DC1 A;  2HQ8 A;  1SL7 A;  3LL8 B;  3B88 A;  1OZO A;  3L4L A;  1NUB A;  2KFF A;  2JT3 A;  1UHN A;  1Y1X A;  3OHM B;  1SSE B;  5TNC A;  1QVI Z;  1IH0 A;  2JTZ A;  4XJK B;  1JF0 A;  4M2P A;  1EJ3 A;  2E30 A;  2GGZ A;  1XK4 C;  4BY5 A;  5G08 A;  5HKZ A;  2ZND A;  1DTL A;  1B9A A;  1B7T Z;  2BE4 A;  1DEK A;  3D75 A;  2EHB A;  2JNX A;  3EK7 A;  4F7F A;  1J7O A;  1DJW A;  4MZL A;  4ORA B;  3TUY B;  3CZ1 A; 
#chains in the Genus database with same CATH homology
 1C3Y A;  1OW4 A;  1LS8 A;  4INX A;  1GM0 A;  4FQT A;  4JD9 A;  1OOH A;  3R1P A;  1OOG A;  3D77 A;  2P71 A;  3R1O A;  2PQL A;  1TUJ A;  3S0F A;  4INW A;  1C3Z A;  3BFH A;  1DQE A;  3K1E A;  3CAB A;  3QME A;  3FE8 A;  2H8V A;  3CZ2 A;  3B7A A;  2WCJ A;  3Q8I A;  3RZS A;  3DY9 A;  2QEV A;  3D74 A;  3DYE A;  2WCH A;  3VB1 A;  3S0E A;  3L47 A;  3NGV A;  3B6X A;  3D73 A;  3D78 A;  1OOF A;  1T14 A;  2QEB A;  5DIC A;  2ERB A;  2QEO A;  3DXL A;  2P70 A;  3CDN A;  3BJH A;  1XFR A;  2QDI A;  2WC5 A;  3DZT A;  2QEH A;  2FJY A;  3S0A A;  3BFA A;  3FE9 A;  2WCL A;  4OZD A;  3CZ0 A;  2WC6 A;  3S0G A;  2L2C A;  3N7H A;  3S0D A;  3CYZ A;  3NHI A;  3BFB A;  3PJI A;  5EL2 A;  3R72 A;  1ORG A;  2WCK A;  2WCM A;  4PT1 A;  1TWO A;  1OOI X;  1P28 A;  3B87 A;  1QWV A;  3B88 A;  3L4L A;  3B86 A;  3L4A A;  3S0B A;  3V2L A;  3NHT A;  3D76 A;  2JPO A;  3R1V A;  2KPH A;  3D75 A;  3FE6 A;  2GTE A;  4F7F A;  3CZ1 A;  3OGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...