1CLMA

Structure of paramecium tetraurelia calmodulin at 1.8 angstroms resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
144
structure length
144
Chain Sequence
LTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Structure of Paramecium tetraurelia calmodulin at 1.8 A resolution.
pubmed rcsb
source organism Paramecium tetraurelia
molecule tags Calcium-binding protein
total genus 55
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 1993-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1clmA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1clmA02
1XVJA 1SL7A 1BT6A 2GV5A 2LUXA 1DTLA 4MLWA 1J1DA 2LANA 1Y6WA 1KCYA 1OOJA 2H61C 2L51A 5KU1A 2H61A 2E30A 3DF0A 1SCMB 3PSRA 1DT7B 2HETA 4PHKA 2BECA 2OS8B 1IJ5A 1PRWA 3QRXA 1SL8A 1JF0A 4GPLB 3WHUB 1A03A 1B7TY 1CDPA 1TNPA 3GOFA 1CTRA 3H4SE 4USLA 2LMUA 2L0PA 1AJ4A 2JU0A 4QJ4B 2KOTA 2JT0A 1U5IA 1WLZA 5JOLA 2BBMA 2ZKMX 1W7JB 2JULA 1B8LA 3FIAA 2R2IA 1AVSA 1AK8A 1UURA 3OX5A 2WCEA 1XK4C 2ZNEA 1XK4A 1B8CA 1JFKA 4M2PA 1AUIB 1ODBA 1CMFA 4MZLA 2K61A 3K21A 1YUUA 1CDMA 3EVRA 1XO5A 4CLNA 4M2QA 2MHHA 1QXPA 1C7VA 1QS7A 1RK9A 2MRDA 4JQ0D 5D7FA 1PSRA 4GAOA 3PN7C 5HKZA 3TDZA 1J7OA 1F8HA 5BPJA 2WC8A 2CCMA 3I5HC 1S3PA 1TN4A 3PATA 2DOQA 1RROA 4ORBB 3E3RA 1CNPA 3VRPA 3BOWA 1IG5A 1IRJA 3EVUA 4PDZA 2KNEA 2NCPA 3HCMA 1XFWO 1KQMB 2HQWA 3EKHA 1KK8B 1OMDA 1DJZA 1BG1A 2G9BA 2LMVA 2PRUA 2L4IA 4MZKA 1ZUZA 1BR4B 1KFXL 1CM4A 1PULA 1YR5A 1DJHA 4OVNF 1R6PA 3O4YA 2BKIB 2K7OA 1SR6C 2I18A 2KI6C 2LVVA 4L9MA 4P5OE 1QV0A 4E68A 4AQJA 3DF0B 2RGIA 3AKBA 1UWOA 1GQMA 4GFTA 4MRYA 1XFXO 2M9GA 2A4JA 1MF8B 4BY5A 1XA5A 1UHIA 2LLUA 3GK1A 5AXIA 5I2QA 1B1GA 5KSZA 5FYXA 3CS1A 4HSZA 1LA3A 4AOMA 1QATA 3D0YB 1HT9A 1E8AA 2JXCA 1W7IB 2KGRA 2LUCA 2VRGA 4DCKA 2LP2A 1YVHA 1QVIY 1CFCA 1TNQA 4I5KA 5TNCA 3SG7A 1DJXA 2PASA 3FS7A 5CSNA 1GJYA 1S6IA 1YRUB 4GBAA 2M29A 1SCVA 3ICBA 1QJTA 2O60A 4QJ5B 1CDNA 3MSEB 1NCXA 2SASA 1YURA 1AHRA 3RLZA 2K7CA 2HF5A 1WDCC 1CFFA 1K9KA 3KF9A 1YUTA 2I7AA 4F0ZB 5J3XA 4YGBB 2KFFA 2E6WA 4PHNA 3SG2A 3SIAA 5HKYA 1RJVA 1V1FA 5G08A 1B8RA 4GGFA 2QACA 1EH2A 1Q80A 1UHKA 2JQ6A 4A4BA 1QIVA 1K2HA 4ICBA 4N1FA 3CR5X 1JF2A 1J7QA 1IKUA 1K93D 4YGAA 4MBEA 1B4CA 1KFUL 2LLTA 1PVAA 5JJGA 1SW8A 2LLSA 5KTYA 2BBNA 3JTDC 1EJ3A 4DRWA 1JC2A 1G4YR 4DUQA 3SG6A 2K2FA 2BE4A 3IQOA 2F8PA 5HYDA 1KWOB 2PMYA 3OB2B 4CFQA 2GGZA 5GQQC 1NUBA 1M46A 3EK7A 4I5JA 1SR6B 1S6CA 3GK2A 3VRQA 2AUCA 2BKHB 3F45A 1S36A 2KHNA 2LVKA 3ZWHA 3A8RA 1CFPA 2Y1NA 2K7DA 3OHMB 1UP5A 1BJFA 3IF7A 1LKJA 1TCFA 3HX4A 2QPTA 2HPSA 2LE9B 3VRNA 1BODA 4I5NB 1YX7A 1G33A 1DF0B 3NSOA 1A4PA 1QLSA 2I94A 4R1EA 3BYAA 5B8IB 2Y4QA 4MZJA 5PALA 1FF1A 2ZN9A 3TUYC 3CZTX 1EXRA 1A75A 1S6JA 4QJ3B 4YI9A 4YRUA 1ZFSA 4HRGA 1WDCB 3BUXB 3RM1A 2EC6B 4NDBA 2K7BA 1XFZO 1NWDA 1X02A 3D10A 1DGVA 2EHBA 3I5FB 1TTXA 1A2XA 3AKAA 3KPXA 5HLVA 2EGDA 2CTNA 3BUNB 2KQ6A 3O78A 4AQIA 2K8MB 3DD4A 4M2OA 2L2EA 1QTXA 1YUSA 5AFPA 1SYMA 3I5IC 3KEVA 4PE0A 1YTZC 5ER4X 1GGWA 4MRXA 2L4HA 3O6BA 3KO0A 2KFHA 1F54A 1B7TZ 1MXLC 3JTDB 3NSIA 1WRKA 4YGCB 1L2OB 1DJWA 4CIDA 2OTGC 1NIWA 4GNKB 1YX8A 3BUOB 3SG4A 2L98A 1FI6A 1SBJA 2F3YA 2MBXA 2PVBA 1LINA 1MWNA 4C0JA 1LXFC 3I5GC 4YBHB 2FCDA 2M49B 4CFRA 1CLBA 1J1EA 2Y5IA 3IQQA 3SIBA 2F2OA 2KAVA 1BR1B 3CTNA 4PCWA 1KFXS 4HREE 2JTTA 1FI5A 1QV1A 2BE6A 1QX2A 3CGAA 2JNXA 4C0LA 1DMOA 2V53A 1F4QA 2KI4C 2LAPA 4PALA 1CM1A 2D8NA 1QIWA 2K0JA 1KSMA 1K8UA 1EG3A 3SJSA 1KSOA 1SRAA 2M1UA 5DKRA 1HQVA 1OMRA 1B9AA 1U5IB 1LA0A 4DS7A 4D1EA 1JUOA 1SCMC 2IS9A 3M0WA 1WRLA 1NX2A 2M8UA 1XFVO 3KHEA 2JPTA 2OS8C 5ER5A 4A4CA 2H2KA 2P6BB 2M0RA 1AP4A 1SK6D 1PALA 4FQOA 3VRRA 1SL9A 1C7WA 2WNDA 4CPVA 3PM8A 1OQPA 3WXAA 2KAXA 1QASA 2KYFA 2Y1MA 2LP3A 4MSPA 2OPOA 3PN7B 5DKNA 3I5HB 4OR9B 1Y0VH 3DVKA 2JOJA 2MLEC 1R2UA 1N0YA 1Y1UA 4TNCA 4PE1A 3CWGA 3TS5C 2F3ZA 1ZOTB 3BOWB 3NXAA 2LHLA 2LVIA 2KSPA 3I5IB 2M1KB 1XFYO 3NSKA 1UHNA 2JWWA 4WQ2A 2M7LA 4NDDA 1MHOA 1F4OA 1MXEA 1QVIZ 2KBMA 1SKTA 2OTGB 4ORCB 1WY9A 1MR8A 3WNXB 3BUMB 1IQ5A 1KQVA 2KBIA 2JZIA 4PE4A 1GGZA 1K96A 1DGUA 4HRHA 3LCPC 5CSJA 3FWCA 1NX3A 2K2AA 2ZRTA 1BOCA 2JTZA 1DJGA 2LCPA 1YVLA 1TRFA 4PE7A 1JWDA 3LK1A 1NYAA 5HLOA 1MQ1A 1KQMC 2Q4UA 3ZNIA 2BCBA 4ZCVA 4MN0A 2KI4B 4ZCUA 1DVIA 1UHHA 1FBVA 2LM5A 4XYNA 1MUXA 2L5XB 1TOPA 2ZN8A 3AAJA 3FWBA 2ISDA 3TZ1A 1RTP1 3DVMA 3JVTC 2CXJA 1K9PA 2MJWB 1TNWA 2BCAA 1WLMA 3EK4A 5F6TA 4IL1A 2F2PA 1YRTB 4C0KA 2MA2A 2MLFC 1VRKA 2PALA 2WORA 3EVVA 2BL0C 1H8BA 3CLNA 1SMGA 3A4UB 3C1VA 1OSAA 3TDUA 1K94A 2FJUB 2AAOA 2CNPA 2CBLA 3D0YA 2KDHA 1M63B 1S26D 2JNFA 1WRZA 2NZ0A 1OE9B 4OV2A 1B47A 1M31A 2MAZA 3LLEA 3SG5A 5IBWA 1CB1A 1J7RA 2JRFA 3BXKA 1XFUO 2KYCA 5CSIA 1TCOB 3NSLA 3BQ3A 3O2PA 2FCEA 3OX6A 1CLLA 5K89A 1JBAA 2TN4A 2M3WA 2L50A 3TS5B 4NDCA 2SCPA 4FTGA 4ORAB 5I2OA 5D69A 1PSBA 2LVJA 1TIZA 2B1UA 1SPYA 2I2RE 1F71A 2ZFDA 1RWYA 4U8DA 1F55A 1J55A 1JSAA 4YGEB 4ETOA 4MEWA 4DIRA 4I5LB 4XJKA 3VROA 1NP8A 3EK8A 1QX7A 2ZNDA 4OKHA 2KQYA 2LV7A 1BLQA 4PHMA 5AANA 1NX0A 1OZOA 4JPZB 1D1OA 5CSFA 1CFDA 3AAKA 1Y1AA 4JWQA 2WOSA 4UPGA 1K90D 1BF5A 1IH0A 1K95A 4PHJA 1FW4A 1UHJA 2WCFA 1KWOC 1H4BA 2PSRA 4Q04A 3VGOA 4N1GA 1NPQA 3EKJA 3CR4X 4MVFA 4OCIA 2BCXA 1RFJA 1J7PA 2KGBC 1A29A 1M45A 3JVTB 1KK7Y 1NCYA 1OMVA 1IQ3A 1F70A 1G8IA 3PALA 1IGVA 1S1EA 1A75B 4P2YB 2LC5A 3TUYB 1S5GY 2M97A 3LL8B 1LVCD 1ZACA 1EG4A 2BL0B 2HQ8A 4GUKA 5DKQA 5AERA 5I8NA 4WRIA 3TDIA 2JT8A 3PLFB 2NXQA 2Q91A 2FOTA 3SG3A 1DF0A 1XYDA 1PK0D 3LK0A 1SNLA 2JC2A 1OZSA 1PVBA 3DVEA 2M7NA 2GGMA 2KI6D 2WCBA 2G2BA 2O5GA 1NX1A 1C07A 1IJ6A 1NSHA 2LMTA 3GK4X 4BY4A 2AMIA 2EC6C 2JT3A 1DJYA 4YGDB 2CT9A 1BMOA 1ALWA 4NQGA 3I5FC 4GGFC 5CPVA 2KFGA 1KFUS 2ZRSA 1CDLA 1CLMA 1SY9A 1CKKA 4XJKB 2F33A 1IWQA 3BUWB 1ZMZA 2NCOA 1N2DA 1NCZA 1EL4A 1KK7Z 1QX5B 3I5GB 1L7ZA 1K9UA 1Y1XA 3WHTB 3CR2A 1FPWA 1ALVA 2COLB 1DJIA 4N5XA 4WQ3A 5HKWA 1AJ5A 1S5GZ 1RECA 3PFVA 2LHIA 4GGNA 3OB1B 2KAYA 1V1GA 1KK8C 1QLKA 1L2OC 1UUSA 3DVJA 1N65A 5I2LA 2JXLA 5AEQA 2NLNA 4YI8A 1CMGA 2LNKA 1JFJA 1TNXA 3OP0A 1BU3A 1M39A
chains in the Genus database with same CATH superfamily
1XVJA 1SL7A 1BT6A 2GV5A 2LUXA 1DTLA 4MLWA 5FI2A 1J1DA 2LANA 1Y6WA 1KCYA 1OOJA 2H61C 2L51A 5KU1A 3PJIA 2H61A 2E30A 3DF0A 1SCMB 3PSRA 1XFRA 1DT7B 2HETA 4PHKA 2BECA 2OS8B 3S0BA 1IJ5A 1PRWA 3QRXA 4KYNA 1SL8A 1JF0A 5FI7A 4GPLB 1QWVA 3WHUB 1A03A 1B7TY 4INXA 1CDPA 1TNPA 3GOFA 1CTRA 3H4SE 2QDIA 4OZDA 4USLA 2LMUA 2L0PA 1AJ4A 2JU0A 4QJ4B 2KOTA 2JT0A 1U5IA 1WLZA 5JOLA 2BBMA 2ZKMX 1W7JB 2JULA 1B8LA 3FIAA 2R2IA 1AVSA 1AK8A 1UURA 3IVTA 2WCEA 3OX5A 1XK4C 2ZNEA 3N7HA 1XK4A 1B8CA 1JFKA 4M2PA 1AUIB 1ODBA 1CMFA 4MZLA 2H8VA 2K61A 3K21A 1YUUA 1CDMA 3EVRA 1XO5A 4CLNA 4M2QA 3D74A 2MHHA 1QXPA 1C7VA 1QS7A 1RK9A 2MRDA 4JQ0D 5D7FA 1PSRA 1Z4HA 4GAOA 3PN7C 2GTEA 5HKZA 3TDZA 1J7OA 1W9ZA 1F8HA 5BPJA 2WC8A 2CCMA 2QEHA 3I5HC 3SS4A 1S3PA 1TN4A 3PATA 2DOQA 1AP4A 1RROA 4ORBB 3E3RA 1CNPA 3VRPA 3BOWA 1IG5A 1IRJA 3EVUA 4PDZA 2KNEA 2NCPA 3HCMA 2WCHA 1XFWO 1KQMB 2HQWA 3B6XA 3CZ0A 1KK8B 1OMDA 3EKHA 2KLDA 1DJZA 1BG1A 2G9BA 2LMVA 2PRUA 2L4IA 4MZKA 1ZUZA 1BR4B 1KFXL 1CM4A 2ERBA 1PULA 1YR5A 1DJHA 4OVNF 1R6PA 3O4YA 2BKIB 2K7OA 1SR6C 2I18A 2KI6C 2LVVA 3L4AA 4L9MA 1QV0A 4P5OE 4E68A 4AQJA 3DF0B 2RGIA 3AKBA 1UWOA 3B87A 1GQMA 4GFTA 4MRYA 1XFXO 2M9GA 1T14A 2A4JA 1MF8B 4BY5A 1XA5A 1UHIA 2LLUA 3EG5B 3GK1A 5AXIA 5I2QA 1B1GA 5KSZA 5FYXA 3CS1A 4HSZA 1LA3A 4AOMA 1QATA 3D0YB 1HT9A 1E8AA 2JXCA 1W7IB 2KGRA 2LUCA 2VRGA 4DCKA 2LP2A 1YVHA 4INWA 1QVIY 1CFCA 3S0FA 1TNQA 4I5KA 5FI6A 3DZTA 5TNCA 3SG7A 1DJXA 2PASA 3FS7A 5CSNA 1GJYA 1S6IA 1YRUB 4GBAA 2M29A 1SCVA 3ICBA 1QJTA 2O60A 4QJ5B 1CDNA 3MSEB 3OGNA 1NCXA 2SASA 1YURA 1AHRA 3RLZA 2K7CA 2WCKA 2HF5A 1WDCC 1CFFA 1K9KA 3DY9A 3KF9A 1YUTA 2I7AA 4F0ZB 5J3XA 2QEOA 4YGBB 2KFFA 2E6WA 3OBVA 4PHNA 3D75A 3SG2A 3SIAA 5HKYA 1RJVA 1DQEA 1V1FA 5G08A 1B8RA 3L47A 4GGFA 3FE8A 2QACA 1EH2A 1Q80A 1UHKA 2JQ6A 4A4BA 1QIVA 1K2HA 4ICBA 4N1FA 3CR5X 3R1PA 1JF2A 1J7QA 1IKUA 1K93D 4YGAA 4MBEA 1B4CA 1KFUL 2LLTA 3D76A 3Q8IA 1PVAA 5JJGA 1SW8A 2LLSA 5KTYA 2BBNA 3JTDC 1EJ3A 4DRWA 1JC2A 1G4YR 2PYQA 3SG6A 2K2FA 2BE4A 3IQOA 4DUQA 2F8PA 5HYDA 2QEVA 1KWOB 2PMYA 3OB2B 4CFQA 4FQTA 2GGZA 5GQQC 1NUBA 1M46A 3EK7A 4I5JA 1SR6B 1S6CA 3GK2A 3VRQA 2AUCA 2BKHB 3B86A 3F45A 1S36A 2BAPA 2KHNA 1C3YA 2LVKA 2P71A 3A8RA 3ZWHA 1CFPA 2K60A 2Y1NA 2K7DA 3OHMB 1UP5A 1BJFA 2L2CA 3IF7A 1LKJA 1TCFA 3HX4A 5EL2A 2QPTA 2HPSA 2LE9B 3VRNA 1BODA 4I5NB 1YX7A 1G33A 1DF0B 2WC5A 3NSOA 1A4PA 1QLSA 2I94A 4R1EA 3BYAA 5B8IB 2Y4QA 4MZJA 5PALA 3FE6A 1FF1A 3D77A 2ZN9A 3TUYC 3CZTX 1EXRA 1A75A 1S6JA 1P28A 4QJ3B 4YI9A 4YRUA 1GM0A 1ZFSA 4HRGA 1WDCB 3BUXB 3RM1A 2EC6B 3R1OA 4NDBA 2K7BA 1XFZO 1NWDA 1X02A 3D10A 3DXLA 1DGVA 2EHBA 3BJHA 3I5FB 1TTXA 1A2XA 3AKAA 3KPXA 5HLVA 2EGDA 3S0EA 2CTNA 3BUNB 3B88A 2KQ6A 3O78A 4AQIA 2K8MB 3DD4A 1IIOA 4M2OA 2L2EA 1QTXA 1YUSA 5AFPA 1SYMA 3I5IC 3KEVA 4PE0A 1YTZC 5ER4X 1GGWA 4MRXA 2L4HA 3O6BA 3KO0A 2KFHA 1F54A 1B7TZ 1MXLC 3JTDB 3NSIA 1WRKA 4YGCB 3D73A 1L2OB 1DJWA 1OOIX 4CIDA 2OTGC 1NIWA 4GNKB 1YX8A 3BUOB 3SG4A 2L98A 1FI6A 1SBJA 1TUJA 2F3YA 3BFHA 2PVBA 1LINA 1MWNA 2MBXA 4C0JA 1LXFC 3I5GC 4YBHB 2FCDA 2M49B 4CFRA 1CLBA 1J1EA 2KPHA 2Y5IA 3IQQA 3SIBA 2F2OA 2KAVA 1BR1B 3CTNA 4PCWA 1OW4A 1KFXS 2L5YA 4HREE 2JTTA 1FI5A 1QV1A 2BE6A 1QX2A 2BNXA 3FE9A 3CGAA 2JNXA 4C0LA 1DMOA 2V53A 1F4QA 2KI4C 2LAPA 1ORGA 1CM1A 2D8NA 1QIWA 2JPOA 4PALA 2K0JA 1KSMA 3QMEA 1K8UA 1EG3A 3SJSA 1KSOA 1SRAA 2M1UA 3SS3A 5DKRA 1HQVA 3RZSA 1OMRA 5D3OA 1B9AA 1U5IB 1LA0A 4DS7A 3PM2A 4D1EA 1JUOA 1SCMC 2IS9A 3M0WA 1WRLA 1NX2A 2M8UA 4JD9A 1XFVO 3KHEA 2JPTA 2OS8C 3CYZA 5ER5A 2H2KA 2P6BB 2M0RA 4A4CA 1SK6D 1PALA 4FQOA 3VRRA 1SL9A 1C7WA 2WNDA 3BFAA 2PQLA 4CPVA 3PM8A 1OQPA 3CZ2A 3WXAA 2KAXA 1QASA 2KYFA 2Y1MA 2LP3A 3S0AA 4MSPA 2OPOA 3S0DA 1JFJA 2WCMA 2KLEA 3PN7B 5DKNA 3I5HB 4OR9B 1Y0VH 3DVKA 2JOJA 2MLEC 1R2UA 1N0YA 1Y1UA 4TNCA 4PE1A 3CWGA 3TS5C 2F3ZA 1ZOTB 3BOWB 3NXAA 2LHLA 2LVIA 2KSPA 3I5IB 2M1KB 1XFYO 3NSKA 1UHNA 2JWWA 4WQ2A 2M7LA 4NDDA 2QEBA 1SSEB 1MHOA 3B7AA 1F4OA 1MXEA 1QVIZ 2KBMA 1SKTA 2OTGB 4ORCB 1WY9A 3UNWA 1MR8A 3WNXB 3BUMB 5DICA 3S0GA 1IQ5A 1KQVA 2KBIA 2JZIA 4PE4A 1GGZA 1K96A 3VB1A 1DGUA 4HRHA 3LCPC 5CSJA 2WC6A 3FWCA 1NX3A 2K2AA 2ZRTA 1BOCA 2JTZA 1DJGA 2LCPA 1YVLA 1TRFA 4PE7A 1JWDA 3LK1A 1NYAA 5HLOA 1MQ1A 1KQMC 1OOFA 2Q4UA 3ZNIA 3NHTA 2BCBA 4ZCVA 4MN0A 2KI4B 3BFBA 4ZCUA 1DVIA 1UHHA 1FBVA 2LM5A 4XYNA 1MUXA 2L5XB 1TOPA 2ZN8A 3AAJA 3FWBA 2ISDA 3TZ1A 1RTP1 3DVMA 3JVTC 2CXJA 1K9PA 2MJWB 1TNWA 2BCAA 1WLMA 3EK4A 5F6TA 1OOHA 3CDNA 4IL1A 2F2PA 1YRTB 4C0KA 2MA2A 2MLFC 1VRKA 2PALA 2WORA 3EVVA 2BL0C 1H8BA 3NHIA 3CLNA 1SMGA 3A4UB 3C1VA 1OSAA 3TDUA 1K94A 2FJUB 1LS8A 2AAOA 2CBLA 2CNPA 2KDHA 3D0YA 1M63B 4PT1A 1S26D 2JNFA 1WRZA 2NZ0A 1OE9B 3NGVA 4OV2A 1B47A 1M31A 2MAZA 3LLEA 3SG5A 5IBWA 1CB1A 1J7RA 2JRFA 3BXKA 1XFUO 2KYCA 5CSIA 1TCOB 3NSLA 1OOGA 3BQ3A 3O2PA 2FCEA 3OX6A 1CLLA 5K89A 1JBAA 2TN4A 2M3WA 2L50A 3TS5B 4NDCA 4IJ7A 2SCPA 4FTGA 3R72A 4ORAB 5I2OA 5D69A 1PSBA 2LVJA 1TIZA 2B1UA 1SPYA 2I2RE 1F71A 2ZFDA 1RWYA 1Z2CB 4U8DA 1F55A 1J55A 1JSAA 4YGEB 4ETOA 4MEWA 4DIRA 4I5LB 4XJKA 3VROA 1NP8A 3EK8A 1QX7A 2ZNDA 4OKHA 2KQYA 2LV7A 2P70A 1BLQA 4PHMA 5AANA 1NX0A 1OZOA 4JPZB 1D1OA 1TUZA 5CSFA 3O4XA 5HL1A 3SS5A 1CFDA 3AAKA 1Y1AA 4JWQA 5I94A 2WOSA 4UPGA 1K90D 3R1VA 1BF5A 1IH0A 1K95A 4PHJA 3DYEA 1FW4A 1UHJA 2WCFA 1KWOC 1H4BA 2PSRA 4Q04A 3VGOA 4N1GA 1C3ZA 1NPQA 3EKJA 3L4LA 3CR4X 3CZ1A 4MVFA 2YGUA 4OCIA 2BCXA 1RFJA 3CABA 1J7PA 2KGBC 1A29A 1M45A 3JVTB 1KK7Y 1NCYA 1OMVA 1IQ3A 1F70A 1G8IA 3PALA 1IGVA 1S1EA 1A75B 4P2YB 2LC5A 3TUYB 1S5GY 3D78A 2M97A 3LL8B 1LVCD 3V2LA 1ZACA 1EG4A 2BL0B 2HQ8A 4GUKA 5DKQA 5AERA 3UO9A 5I8NA 4WRIA 3TDIA 2JT8A 3PLFB 4F7FA 2NXQA 2Q91A 2FOTA 3SG3A 1DF0A 1XYDA 1PK0D 3LK0A 1SNLA 2JC2A 1OZSA 1PVBA 3DVEA 2M7NA 2GGMA 2KI6D 2WCBA 2G2BA 2O5GA 1NX1A 1C07A 1DELA 1IJ6A 1NSHA 2LMTA 3GK4X 4BY4A 2AMIA 3K1EA 2EC6C 2JT3A 1DJYA 4YGDB 2CT9A 1BMOA 1ALWA 4NQGA 2WCLA 3I5FC 4GGFC 5CPVA 2FJYA 2KFGA 1KFUS 2ZRSA 1CDLA 1CLMA 1SY9A 1CKKA 4XJKB 2F33A 1IWQA 3BUWB 1ZMZA 2NCOA 1N2DA 1NCZA 1EL4A 1KK7Z 1QX5B 3I5GB 1DC1A 1L7ZA 1K9UA 1Y1XA 4JKTA 3WHTB 3CR2A 1FPWA 1ALVA 2COLB 1DJIA 4N5XA 4WQ3A 5HKWA 1AJ5A 1S5GZ 1RECA 3PFVA 2LHIA 4GGNA 1TWOA 3OB1B 2KAYA 1V1GA 1KK8C 1QLKA 2WCJA 1L2OC 1UUSA 1DEKA 1N65A 3DVJA 2JXLA 5I2LA 2NLNA 4YI8A 5AEQA 2LNKA 1CMGA 1TNXA 3OP0A 1BU3A 1M39A
chains in the Genus database with same CATH topology
1XVJA 1SL7A 1BT6A 2GV5A 2LUXA 1DTLA 4MLWA 1J1DA 2LANA 1Y6WA 1KCYA 1OOJA 2H61C 2L51A 5KU1A 2H61A 2E30A 3DF0A 1SCMB 3PSRA 1DT7B 2HETA 4PHKA 2BECA 2OS8B 1IJ5A 1PRWA 3QRXA 1SL8A 1JF0A 4GPLB 3WHUB 1A03A 1B7TY 1CDPA 1TNPA 3GOFA 1CTRA 3H4SE 4USLA 2LMUA 2L0PA 1AJ4A 2JU0A 4QJ4B 2KOTA 2JT0A 1U5IA 1WLZA 5JOLA 2BBMA 2ZKMX 1W7JB 2JULA 1B8LA 3FIAA 2R2IA 1AVSA 1AK8A 1UURA 3OX5A 2WCEA 1XK4C 2ZNEA 1XK4A 1B8CA 1JFKA 4M2PA 1AUIB 1ODBA 1CMFA 4MZLA 2K61A 3K21A 1YUUA 1CDMA 3EVRA 1XO5A 4CLNA 4M2QA 2MHHA 1QXPA 1C7VA 1QS7A 1RK9A 2MRDA 4JQ0D 5D7FA 1PSRA 4GAOA 3PN7C 5HKZA 3TDZA 1J7OA 1F8HA 5BPJA 2WC8A 2CCMA 3I5HC 1S3PA 1TN4A 3PATA 2DOQA 1RROA 4ORBB 3E3RA 1CNPA 3VRPA 3BOWA 1IG5A 1IRJA 3EVUA 4PDZA 2KNEA 2NCPA 3HCMA 1XFWO 1KQMB 2HQWA 3EKHA 1KK8B 1OMDA 1DJZA 1BG1A 2G9BA 2LMVA 2PRUA 2L4IA 4MZKA 1ZUZA 1BR4B 1KFXL 1CM4A 1PULA 1YR5A 1DJHA 4OVNF 1R6PA 3O4YA 2BKIB 2K7OA 1SR6C 2I18A 2KI6C 2LVVA 4L9MA 4P5OE 1QV0A 4E68A 4AQJA 3DF0B 2RGIA 3AKBA 1UWOA 1GQMA 4GFTA 4MRYA 1XFXO 2M9GA 2A4JA 1MF8B 4BY5A 1XA5A 1UHIA 2LLUA 3GK1A 5AXIA 5I2QA 1B1GA 5KSZA 5FYXA 3CS1A 4HSZA 1LA3A 4AOMA 1QATA 3D0YB 1HT9A 1E8AA 2JXCA 1W7IB 2KGRA 2LUCA 2VRGA 4DCKA 2LP2A 1YVHA 1QVIY 1CFCA 1TNQA 4I5KA 5TNCA 3SG7A 1DJXA 2PASA 3FS7A 5CSNA 1GJYA 1S6IA 1YRUB 4GBAA 2M29A 1SCVA 3ICBA 1QJTA 2O60A 4QJ5B 1CDNA 3MSEB 1NCXA 2SASA 1YURA 1AHRA 3RLZA 2K7CA 2HF5A 1WDCC 1CFFA 1K9KA 3KF9A 1YUTA 2I7AA 4F0ZB 5J3XA 4YGBB 2KFFA 2E6WA 4PHNA 3SG2A 3SIAA 5HKYA 1RJVA 1V1FA 5G08A 1B8RA 4GGFA 2QACA 1EH2A 1Q80A 1UHKA 2JQ6A 4A4BA 1QIVA 1K2HA 4ICBA 4N1FA 3CR5X 1JF2A 1J7QA 1IKUA 1K93D 4YGAA 4MBEA 1B4CA 1KFUL 2LLTA 1PVAA 5JJGA 1SW8A 2LLSA 5KTYA 2BBNA 3JTDC 1EJ3A 4DRWA 1JC2A 1G4YR 4DUQA 3SG6A 2K2FA 2BE4A 3IQOA 2F8PA 5HYDA 1KWOB 2PMYA 3OB2B 4CFQA 2GGZA 5GQQC 1NUBA 1M46A 3EK7A 4I5JA 1SR6B 1S6CA 3GK2A 3VRQA 2AUCA 2BKHB 3F45A 1S36A 2KHNA 2LVKA 3ZWHA 3A8RA 1CFPA 2Y1NA 2K7DA 3OHMB 1UP5A 1BJFA 3IF7A 1LKJA 1TCFA 3HX4A 2QPTA 2HPSA 2LE9B 3VRNA 1BODA 4I5NB 1YX7A 1G33A 1DF0B 3NSOA 1A4PA 1QLSA 2I94A 4R1EA 3BYAA 5B8IB 2Y4QA 4MZJA 5PALA 1FF1A 2ZN9A 3TUYC 3CZTX 1EXRA 1A75A 1S6JA 4QJ3B 4YI9A 4YRUA 1ZFSA 4HRGA 1WDCB 3BUXB 3RM1A 2EC6B 4NDBA 2K7BA 1XFZO 1NWDA 1X02A 3D10A 1DGVA 2EHBA 3I5FB 1TTXA 1A2XA 3AKAA 3KPXA 5HLVA 2EGDA 2CTNA 3BUNB 2KQ6A 3O78A 4AQIA 2K8MB 3DD4A 4M2OA 2L2EA 1QTXA 1YUSA 5AFPA 1SYMA 3I5IC 3KEVA 4PE0A 1YTZC 5ER4X 1GGWA 4MRXA 2L4HA 3O6BA 3KO0A 2KFHA 1F54A 1B7TZ 1MXLC 3JTDB 3NSIA 1WRKA 4YGCB 1L2OB 1DJWA 4CIDA 2OTGC 1NIWA 4GNKB 1YX8A 3BUOB 3SG4A 2L98A 1FI6A 1SBJA 2F3YA 2MBXA 2PVBA 1LINA 1MWNA 4C0JA 1LXFC 3I5GC 4YBHB 2FCDA 2M49B 4CFRA 1CLBA 1J1EA 2Y5IA 3IQQA 3SIBA 2F2OA 2KAVA 1BR1B 3CTNA 4PCWA 1KFXS 4HREE 2JTTA 1FI5A 1QV1A 2BE6A 1QX2A 3CGAA 2JNXA 4C0LA 1DMOA 2V53A 1F4QA 2KI4C 2LAPA 4PALA 1CM1A 2D8NA 1QIWA 2K0JA 1KSMA 1K8UA 1EG3A 3SJSA 1KSOA 1SRAA 2M1UA 5DKRA 1HQVA 1OMRA 1B9AA 1U5IB 1LA0A 4DS7A 4D1EA 1JUOA 1SCMC 2IS9A 3M0WA 1WRLA 1NX2A 2M8UA 1XFVO 3KHEA 2JPTA 2OS8C 5ER5A 4A4CA 2H2KA 2P6BB 2M0RA 1AP4A 1SK6D 1PALA 4FQOA 3VRRA 1SL9A 1C7WA 2WNDA 4CPVA 3PM8A 1OQPA 3WXAA 2KAXA 1QASA 2KYFA 2Y1MA 2LP3A 4MSPA 2OPOA 3PN7B 5DKNA 3I5HB 4OR9B 1Y0VH 3DVKA 2JOJA 2MLEC 1R2UA 1N0YA 1Y1UA 4TNCA 4PE1A 3CWGA 3TS5C 2F3ZA 1ZOTB 3BOWB 3NXAA 2LHLA 2LVIA 2KSPA 3I5IB 2M1KB 1XFYO 3NSKA 1UHNA 2JWWA 4WQ2A 2M7LA 4NDDA 1MHOA 1F4OA 1MXEA 1QVIZ 2KBMA 1SKTA 2OTGB 4ORCB 1WY9A 1MR8A 3WNXB 3BUMB 1IQ5A 1KQVA 2KBIA 2JZIA 4PE4A 1GGZA 1K96A 1DGUA 4HRHA 3LCPC 5CSJA 3FWCA 1NX3A 2K2AA 2ZRTA 1BOCA 2JTZA 1DJGA 2LCPA 1YVLA 1TRFA 4PE7A 1JWDA 3LK1A 1NYAA 5HLOA 1MQ1A 1KQMC 2Q4UA 3ZNIA 2BCBA 4ZCVA 4MN0A 2KI4B 4ZCUA 1DVIA 1UHHA 1FBVA 2LM5A 4XYNA 1MUXA 2L5XB 1TOPA 2ZN8A 3AAJA 3FWBA 2ISDA 3TZ1A 1RTP1 3DVMA 3JVTC 2CXJA 1K9PA 2MJWB 1TNWA 2BCAA 1WLMA 3EK4A 5F6TA 4IL1A 2F2PA 1YRTB 4C0KA 2MA2A 2MLFC 1VRKA 2PALA 2WORA 3EVVA 2BL0C 1H8BA 3CLNA 1SMGA 3A4UB 3C1VA 1OSAA 3TDUA 1K94A 2FJUB 2AAOA 2CNPA 2CBLA 3D0YA 2KDHA 1M63B 1S26D 2JNFA 1WRZA 2NZ0A 1OE9B 4OV2A 1B47A 1M31A 2MAZA 3LLEA 3SG5A 5IBWA 1CB1A 1J7RA 2JRFA 3BXKA 1XFUO 2KYCA 5CSIA 1TCOB 3NSLA 3BQ3A 3O2PA 2FCEA 3OX6A 1CLLA 5K89A 1JBAA 2TN4A 2M3WA 2L50A 3TS5B 4NDCA 2SCPA 4FTGA 4ORAB 5I2OA 5D69A 1PSBA 2LVJA 1TIZA 2B1UA 1SPYA 2I2RE 1F71A 2ZFDA 1RWYA 4U8DA 1F55A 1J55A 1JSAA 4YGEB 4ETOA 4MEWA 4DIRA 4I5LB 4XJKA 3VROA 1NP8A 3EK8A 1QX7A 2ZNDA 4OKHA 2KQYA 2LV7A 1BLQA 4PHMA 5AANA 1NX0A 1OZOA 4JPZB 1D1OA 5CSFA 1CFDA 3AAKA 1Y1AA 4JWQA 2WOSA 4UPGA 1K90D 1BF5A 1IH0A 1K95A 4PHJA 1FW4A 1UHJA 2WCFA 1KWOC 1H4BA 2PSRA 4Q04A 3VGOA 4N1GA 1NPQA 3EKJA 3CR4X 4MVFA 4OCIA 2BCXA 1RFJA 1J7PA 2KGBC 1A29A 1M45A 3JVTB 1KK7Y 1NCYA 1OMVA 1IQ3A 1F70A 1G8IA 3PALA 1IGVA 1S1EA 1A75B 4P2YB 2LC5A 3TUYB 1S5GY 2M97A 3LL8B 1LVCD 1ZACA 1EG4A 2BL0B 2HQ8A 4GUKA 5DKQA 5AERA 5I8NA 4WRIA 3TDIA 2JT8A 3PLFB 2NXQA 2Q91A 2FOTA 3SG3A 1DF0A 1XYDA 1PK0D 3LK0A 1SNLA 2JC2A 1OZSA 1PVBA 3DVEA 2M7NA 2GGMA 2KI6D 2WCBA 2G2BA 2O5GA 1NX1A 1C07A 1IJ6A 1NSHA 2LMTA 3GK4X 4BY4A 2AMIA 2EC6C 2JT3A 1DJYA 4YGDB 2CT9A 1BMOA 1ALWA 4NQGA 3I5FC 4GGFC 5CPVA 2KFGA 1KFUS 2ZRSA 1CDLA 1CLMA 1SY9A 1CKKA 4XJKB 2F33A 1IWQA 3BUWB 1ZMZA 2NCOA 1N2DA 1NCZA 1EL4A 1KK7Z 1QX5B 3I5GB 1L7ZA 1K9UA 1Y1XA 3WHTB 3CR2A 1FPWA 1ALVA 2COLB 1DJIA 4N5XA 4WQ3A 5HKWA 1AJ5A 1S5GZ 1RECA 3PFVA 2LHIA 4GGNA 3OB1B 2KAYA 1V1GA 1KK8C 1QLKA 1L2OC 1UUSA 3DVJA 1N65A 5I2LA 2JXLA 5AEQA 2NLNA 4YI8A 1CMGA 2LNKA 1JFJA 1TNXA 3OP0A 1BU3A 1M39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XVJ A;  1SL7 A;  1BT6 A;  2GV5 A;  2LUX A;  1DTL A;  4MLW A;  1J1D A;  2LAN A;  1Y6W A;  1KCY A;  1OOJ A;  2H61 C;  2L51 A;  5KU1 A;  2H61 A;  2E30 A;  3DF0 A;  1SCM B;  3PSR A;  1DT7 B;  2HET A;  4PHK A;  2BEC A;  2OS8 B;  1IJ5 A;  1PRW A;  3QRX A;  1SL8 A;  1JF0 A;  4GPL B;  3WHU B;  1A03 A;  1B7T Y;  1CDP A;  1TNP A;  3GOF A;  1CTR A;  3H4S E;  4USL A;  2LMU A;  2L0P A;  1AJ4 A;  2JU0 A;  4QJ4 B;  2KOT A;  2JT0 A;  1U5I A;  1WLZ A;  5JOL A;  2BBM A;  2ZKM X;  1W7J B;  2JUL A;  1B8L A;  3FIA A;  2R2I A;  1AVS A;  1AK8 A;  1UUR A;  3OX5 A;  2WCE A;  1XK4 C;  2ZNE A;  1XK4 A;  1B8C A;  1JFK A;  4M2P A;  1AUI B;  1ODB A;  1CMF A;  4MZL A;  2K61 A;  3K21 A;  1YUU A;  1CDM A;  3EVR A;  1XO5 A;  4CLN A;  4M2Q A;  2MHH A;  1QXP A;  1C7V A;  1QS7 A;  1RK9 A;  2MRD A;  4JQ0 D;  5D7F A;  1PSR A;  4GAO A;  3PN7 C;  5HKZ A;  3TDZ A;  1J7O A;  1F8H A;  5BPJ A;  2WC8 A;  2CCM A;  3I5H C;  1S3P A;  1TN4 A;  3PAT A;  2DOQ A;  1RRO A;  4ORB B;  3E3R A;  1CNP A;  3VRP A;  3BOW A;  1IG5 A;  1IRJ A;  3EVU A;  4PDZ A;  2KNE A;  2NCP A;  3HCM A;  1XFW O;  1KQM B;  2HQW A;  3EKH A;  1KK8 B;  1OMD A;  1DJZ A;  1BG1 A;  2G9B A;  2LMV A;  2PRU A;  2L4I A;  4MZK A;  1ZUZ A;  1BR4 B;  1KFX L;  1CM4 A;  1PUL A;  1YR5 A;  1DJH A;  4OVN F;  1R6P A;  3O4Y A;  2BKI B;  2K7O A;  1SR6 C;  2I18 A;  2KI6 C;  2LVV A;  4L9M A;  4P5O E;  1QV0 A;  4E68 A;  4AQJ A;  3DF0 B;  2RGI A;  3AKB A;  1UWO A;  1GQM A;  4GFT A;  4MRY A;  1XFX O;  2M9G A;  2A4J A;  1MF8 B;  4BY5 A;  1XA5 A;  1UHI A;  2LLU A;  3GK1 A;  5AXI A;  5I2Q A;  1B1G A;  5KSZ A;  5FYX A;  3CS1 A;  4HSZ A;  1LA3 A;  4AOM A;  1QAT A;  3D0Y B;  1HT9 A;  1E8A A;  2JXC A;  1W7I B;  2KGR A;  2LUC A;  2VRG A;  4DCK A;  2LP2 A;  1YVH A;  1QVI Y;  1CFC A;  1TNQ A;  4I5K A;  5TNC A;  3SG7 A;  1DJX A;  2PAS A;  3FS7 A;  5CSN A;  1GJY A;  1S6I A;  1YRU B;  4GBA A;  2M29 A;  1SCV A;  3ICB A;  1QJT A;  2O60 A;  4QJ5 B;  1CDN A;  3MSE B;  1NCX A;  2SAS A;  1YUR A;  1AHR A;  3RLZ A;  2K7C A;  2HF5 A;  1WDC C;  1CFF A;  1K9K A;  3KF9 A;  1YUT A;  2I7A A;  4F0Z B;  5J3X A;  4YGB B;  2KFF A;  2E6W A;  4PHN A;  3SG2 A;  3SIA A;  5HKY A;  1RJV A;  1V1F A;  5G08 A;  1B8R A;  4GGF A;  2QAC A;  1EH2 A;  1Q80 A;  1UHK A;  2JQ6 A;  4A4B A;  1QIV A;  1K2H A;  4ICB A;  4N1F A;  3CR5 X;  1JF2 A;  1J7Q A;  1IKU A;  1K93 D;  4YGA A;  4MBE A;  1B4C A;  1KFU L;  2LLT A;  1PVA A;  5JJG A;  1SW8 A;  2LLS A;  5KTY A;  2BBN A;  3JTD C;  1EJ3 A;  4DRW A;  1JC2 A;  1G4Y R;  4DUQ A;  3SG6 A;  2K2F A;  2BE4 A;  3IQO A;  2F8P A;  5HYD A;  1KWO B;  2PMY A;  3OB2 B;  4CFQ A;  2GGZ A;  5GQQ C;  1NUB A;  1M46 A;  3EK7 A;  4I5J A;  1SR6 B;  1S6C A;  3GK2 A;  3VRQ A;  2AUC A;  2BKH B;  3F45 A;  1S36 A;  2KHN A;  2LVK A;  3ZWH A;  3A8R A;  1CFP A;  2Y1N A;  2K7D A;  3OHM B;  1UP5 A;  1BJF A;  3IF7 A;  1LKJ A;  1TCF A;  3HX4 A;  2QPT A;  2HPS A;  2LE9 B;  3VRN A;  1BOD A;  4I5N B;  1YX7 A;  1G33 A;  1DF0 B;  3NSO A;  1A4P A;  1QLS A;  2I94 A;  4R1E A;  3BYA A;  5B8I B;  2Y4Q A;  4MZJ A;  5PAL A;  1FF1 A;  2ZN9 A;  3TUY C;  3CZT X;  1EXR A;  1A75 A;  1S6J A;  4QJ3 B;  4YI9 A;  4YRU A;  1ZFS A;  4HRG A;  1WDC B;  3BUX B;  3RM1 A;  2EC6 B;  4NDB A;  2K7B A;  1XFZ O;  1NWD A;  1X02 A;  3D10 A;  1DGV A;  2EHB A;  3I5F B;  1TTX A;  1A2X A;  3AKA A;  3KPX A;  5HLV A;  2EGD A;  2CTN A;  3BUN B;  2KQ6 A;  3O78 A;  4AQI A;  2K8M B;  3DD4 A;  4M2O A;  2L2E A;  1QTX A;  1YUS A;  5AFP A;  1SYM A;  3I5I C;  3KEV A;  4PE0 A;  1YTZ C;  5ER4 X;  1GGW A;  4MRX A;  2L4H A;  3O6B A;  3KO0 A;  2KFH A;  1F54 A;  1B7T Z;  1MXL C;  3JTD B;  3NSI A;  1WRK A;  4YGC B;  1L2O B;  1DJW A;  4CID A;  2OTG C;  1NIW A;  4GNK B;  1YX8 A;  3BUO B;  3SG4 A;  2L98 A;  1FI6 A;  1SBJ A;  2F3Y A;  2MBX A;  2PVB A;  1LIN A;  1MWN A;  4C0J A;  1LXF C;  3I5G C;  4YBH B;  2FCD A;  2M49 B;  4CFR A;  1CLB A;  1J1E A;  2Y5I A;  3IQQ A;  3SIB A;  2F2O A;  2KAV A;  1BR1 B;  3CTN A;  4PCW A;  1KFX S;  4HRE E;  2JTT A;  1FI5 A;  1QV1 A;  2BE6 A;  1QX2 A;  3CGA A;  2JNX A;  4C0L A;  1DMO A;  2V53 A;  1F4Q A;  2KI4 C;  2LAP A;  4PAL A;  1CM1 A;  2D8N A;  1QIW A;  2K0J A;  1KSM A;  1K8U A;  1EG3 A;  3SJS A;  1KSO A;  1SRA A;  2M1U A;  5DKR A;  1HQV A;  1OMR A;  1B9A A;  1U5I B;  1LA0 A;  4DS7 A;  4D1E A;  1JUO A;  1SCM C;  2IS9 A;  3M0W A;  1WRL A;  1NX2 A;  2M8U A;  1XFV O;  3KHE A;  2JPT A;  2OS8 C;  5ER5 A;  4A4C A;  2H2K A;  2P6B B;  2M0R A;  1AP4 A;  1SK6 D;  1PAL A;  4FQO A;  3VRR A;  1SL9 A;  1C7W A;  2WND A;  4CPV A;  3PM8 A;  1OQP A;  3WXA A;  2KAX A;  1QAS A;  2KYF A;  2Y1M A;  2LP3 A;  4MSP A;  2OPO A;  3PN7 B;  5DKN A;  3I5H B;  4OR9 B;  1Y0V H;  3DVK A;  2JOJ A;  2MLE C;  1R2U A;  1N0Y A;  1Y1U A;  4TNC A;  4PE1 A;  3CWG A;  3TS5 C;  2F3Z A;  1ZOT B;  3BOW B;  3NXA A;  2LHL A;  2LVI A;  2KSP A;  3I5I B;  2M1K B;  1XFY O;  3NSK A;  1UHN A;  2JWW A;  4WQ2 A;  2M7L A;  4NDD A;  1MHO A;  1F4O A;  1MXE A;  1QVI Z;  2KBM A;  1SKT A;  2OTG B;  4ORC B;  1WY9 A;  1MR8 A;  3WNX B;  3BUM B;  1IQ5 A;  1KQV A;  2KBI A;  2JZI A;  4PE4 A;  1GGZ A;  1K96 A;  1DGU A;  4HRH A;  3LCP C;  5CSJ A;  3FWC A;  1NX3 A;  2K2A A;  2ZRT A;  1BOC A;  2JTZ A;  1DJG A;  2LCP A;  1YVL A;  1TRF A;  4PE7 A;  1JWD A;  3LK1 A;  1NYA A;  5HLO A;  1MQ1 A;  1KQM C;  2Q4U A;  3ZNI A;  2BCB A;  4ZCV A;  4MN0 A;  2KI4 B;  4ZCU A;  1DVI A;  1UHH A;  1FBV A;  2LM5 A;  4XYN A;  1MUX A;  2L5X B;  1TOP A;  2ZN8 A;  3AAJ A;  3FWB A;  2ISD A;  3TZ1 A;  1RTP 1;  3DVM A;  3JVT C;  2CXJ A;  1K9P A;  2MJW B;  1TNW A;  2BCA A;  1WLM A;  3EK4 A;  5F6T A;  4IL1 A;  2F2P A;  1YRT B;  4C0K A;  2MA2 A;  2MLF C;  1VRK A;  2PAL A;  2WOR A;  3EVV A;  2BL0 C;  1H8B A;  3CLN A;  1SMG A;  3A4U B;  3C1V A;  1OSA A;  3TDU A;  1K94 A;  2FJU B;  2AAO A;  2CNP A;  2CBL A;  3D0Y A;  2KDH A;  1M63 B;  1S26 D;  2JNF A;  1WRZ A;  2NZ0 A;  1OE9 B;  4OV2 A;  1B47 A;  1M31 A;  2MAZ A;  3LLE A;  3SG5 A;  5IBW A;  1CB1 A;  1J7R A;  2JRF A;  3BXK A;  1XFU O;  2KYC A;  5CSI A;  1TCO B;  3NSL A;  3BQ3 A;  3O2P A;  2FCE A;  3OX6 A;  1CLL A;  5K89 A;  1JBA A;  2TN4 A;  2M3W A;  2L50 A;  3TS5 B;  4NDC A;  2SCP A;  4FTG A;  4ORA B;  5I2O A;  5D69 A;  1PSB A;  2LVJ A;  1TIZ A;  2B1U A;  1SPY A;  2I2R E;  1F71 A;  2ZFD A;  1RWY A;  4U8D A;  1F55 A;  1J55 A;  1JSA A;  4YGE B;  4ETO A;  4MEW A;  4DIR A;  4I5L B;  4XJK A;  3VRO A;  1NP8 A;  3EK8 A;  1QX7 A;  2ZND A;  4OKH A;  2KQY A;  2LV7 A;  1BLQ A;  4PHM A;  5AAN A;  1NX0 A;  1OZO A;  4JPZ B;  1D1O A;  5CSF A;  1CFD A;  3AAK A;  1Y1A A;  4JWQ A;  2WOS A;  4UPG A;  1K90 D;  1BF5 A;  1IH0 A;  1K95 A;  4PHJ A;  1FW4 A;  1UHJ A;  2WCF A;  1KWO C;  1H4B A;  2PSR A;  4Q04 A;  3VGO A;  4N1G A;  1NPQ A;  3EKJ A;  3CR4 X;  4MVF A;  4OCI A;  2BCX A;  1RFJ A;  1J7P A;  2KGB C;  1A29 A;  1M45 A;  3JVT B;  1KK7 Y;  1NCY A;  1OMV A;  1IQ3 A;  1F70 A;  1G8I A;  3PAL A;  1IGV A;  1S1E A;  1A75 B;  4P2Y B;  2LC5 A;  3TUY B;  1S5G Y;  2M97 A;  3LL8 B;  1LVC D;  1ZAC A;  1EG4 A;  2BL0 B;  2HQ8 A;  4GUK A;  5DKQ A;  5AER A;  5I8N A;  4WRI A;  3TDI A;  2JT8 A;  3PLF B;  2NXQ A;  2Q91 A;  2FOT A;  3SG3 A;  1DF0 A;  1XYD A;  1PK0 D;  3LK0 A;  1SNL A;  2JC2 A;  1OZS A;  1PVB A;  3DVE A;  2M7N A;  2GGM A;  2KI6 D;  2WCB A;  2G2B A;  2O5G A;  1NX1 A;  1C07 A;  1IJ6 A;  1NSH A;  2LMT A;  3GK4 X;  4BY4 A;  2AMI A;  2EC6 C;  2JT3 A;  1DJY A;  4YGD B;  2CT9 A;  1BMO A;  1ALW A;  4NQG A;  3I5F C;  4GGF C;  5CPV A;  2KFG A;  1KFU S;  2ZRS A;  1CDL A;  1CLM A;  1SY9 A;  1CKK A;  4XJK B;  2F33 A;  1IWQ A;  3BUW B;  1ZMZ A;  2NCO A;  1N2D A;  1NCZ A;  1EL4 A;  1KK7 Z;  1QX5 B;  3I5G B;  1L7Z A;  1K9U A;  1Y1X A;  3WHT B;  3CR2 A;  1FPW A;  1ALV A;  2COL B;  1DJI A;  4N5X A;  4WQ3 A;  5HKW A;  1AJ5 A;  1S5G Z;  1REC A;  3PFV A;  2LHI A;  4GGN A;  3OB1 B;  2KAY A;  1V1G A;  1KK8 C;  1QLK A;  1L2O C;  1UUS A;  3DVJ A;  1N65 A;  5I2L A;  2JXL A;  5AEQ A;  2NLN A;  4YI8 A;  1CMG A;  2LNK A;  1JFJ A;  1TNX A;  3OP0 A;  1BU3 A;  1M39 A; 
#chains in the Genus database with same CATH topology
 1XVJ A;  1SL7 A;  1BT6 A;  2GV5 A;  2LUX A;  1DTL A;  4MLW A;  5FI2 A;  1J1D A;  2LAN A;  1Y6W A;  1KCY A;  1OOJ A;  2H61 C;  2L51 A;  5KU1 A;  3PJI A;  2H61 A;  2E30 A;  3DF0 A;  1SCM B;  3PSR A;  1XFR A;  1DT7 B;  2HET A;  4PHK A;  2BEC A;  2OS8 B;  3S0B A;  1IJ5 A;  1PRW A;  3QRX A;  4KYN A;  1SL8 A;  1JF0 A;  5FI7 A;  4GPL B;  1QWV A;  3WHU B;  1A03 A;  1B7T Y;  4INX A;  1CDP A;  1TNP A;  3GOF A;  1CTR A;  3H4S E;  2QDI A;  4OZD A;  4USL A;  2LMU A;  2L0P A;  1AJ4 A;  2JU0 A;  4QJ4 B;  2KOT A;  2JT0 A;  1U5I A;  1WLZ A;  5JOL A;  2BBM A;  2ZKM X;  1W7J B;  2JUL A;  1B8L A;  3FIA A;  2R2I A;  1AVS A;  1AK8 A;  1UUR A;  3IVT A;  2WCE A;  3OX5 A;  1XK4 C;  2ZNE A;  3N7H A;  1XK4 A;  1B8C A;  1JFK A;  4M2P A;  1AUI B;  1ODB A;  1CMF A;  4MZL A;  2H8V A;  2K61 A;  3K21 A;  1YUU A;  1CDM A;  3EVR A;  1XO5 A;  4CLN A;  4M2Q A;  3D74 A;  2MHH A;  1QXP A;  1C7V A;  1QS7 A;  1RK9 A;  2MRD A;  4JQ0 D;  5D7F A;  1PSR A;  1Z4H A;  4GAO A;  3PN7 C;  2GTE A;  5HKZ A;  3TDZ A;  1J7O A;  1W9Z A;  1F8H A;  5BPJ A;  2WC8 A;  2CCM A;  2QEH A;  3I5H C;  3SS4 A;  1S3P A;  1TN4 A;  3PAT A;  2DOQ A;  1AP4 A;  1RRO A;  4ORB B;  3E3R A;  1CNP A;  3VRP A;  3BOW A;  1IG5 A;  1IRJ A;  3EVU A;  4PDZ A;  2KNE A;  2NCP A;  3HCM A;  2WCH A;  1XFW O;  1KQM B;  2HQW A;  3B6X A;  3CZ0 A;  1KK8 B;  1OMD A;  3EKH A;  2KLD A;  1DJZ A;  1BG1 A;  2G9B A;  2LMV A;  2PRU A;  2L4I A;  4MZK A;  1ZUZ A;  1BR4 B;  1KFX L;  1CM4 A;  2ERB A;  1PUL A;  1YR5 A;  1DJH A;  4OVN F;  1R6P A;  3O4Y A;  2BKI B;  2K7O A;  1SR6 C;  2I18 A;  2KI6 C;  2LVV A;  3L4A A;  4L9M A;  1QV0 A;  4P5O E;  4E68 A;  4AQJ A;  3DF0 B;  2RGI A;  3AKB A;  1UWO A;  3B87 A;  1GQM A;  4GFT A;  4MRY A;  1XFX O;  2M9G A;  1T14 A;  2A4J A;  1MF8 B;  4BY5 A;  1XA5 A;  1UHI A;  2LLU A;  3EG5 B;  3GK1 A;  5AXI A;  5I2Q A;  1B1G A;  5KSZ A;  5FYX A;  3CS1 A;  4HSZ A;  1LA3 A;  4AOM A;  1QAT A;  3D0Y B;  1HT9 A;  1E8A A;  2JXC A;  1W7I B;  2KGR A;  2LUC A;  2VRG A;  4DCK A;  2LP2 A;  1YVH A;  4INW A;  1QVI Y;  1CFC A;  3S0F A;  1TNQ A;  4I5K A;  5FI6 A;  3DZT A;  5TNC A;  3SG7 A;  1DJX A;  2PAS A;  3FS7 A;  5CSN A;  1GJY A;  1S6I A;  1YRU B;  4GBA A;  2M29 A;  1SCV A;  3ICB A;  1QJT A;  2O60 A;  4QJ5 B;  1CDN A;  3MSE B;  3OGN A;  1NCX A;  2SAS A;  1YUR A;  1AHR A;  3RLZ A;  2K7C A;  2WCK A;  2HF5 A;  1WDC C;  1CFF A;  1K9K A;  3DY9 A;  3KF9 A;  1YUT A;  2I7A A;  4F0Z B;  5J3X A;  2QEO A;  4YGB B;  2KFF A;  2E6W A;  3OBV A;  4PHN A;  3D75 A;  3SG2 A;  3SIA A;  5HKY A;  1RJV A;  1DQE A;  1V1F A;  5G08 A;  1B8R A;  3L47 A;  4GGF A;  3FE8 A;  2QAC A;  1EH2 A;  1Q80 A;  1UHK A;  2JQ6 A;  4A4B A;  1QIV A;  1K2H A;  4ICB A;  4N1F A;  3CR5 X;  3R1P A;  1JF2 A;  1J7Q A;  1IKU A;  1K93 D;  4YGA A;  4MBE A;  1B4C A;  1KFU L;  2LLT A;  3D76 A;  3Q8I A;  1PVA A;  5JJG A;  1SW8 A;  2LLS A;  5KTY A;  2BBN A;  3JTD C;  1EJ3 A;  4DRW A;  1JC2 A;  1G4Y R;  2PYQ A;  3SG6 A;  2K2F A;  2BE4 A;  3IQO A;  4DUQ A;  2F8P A;  5HYD A;  2QEV A;  1KWO B;  2PMY A;  3OB2 B;  4CFQ A;  4FQT A;  2GGZ A;  5GQQ C;  1NUB A;  1M46 A;  3EK7 A;  4I5J A;  1SR6 B;  1S6C A;  3GK2 A;  3VRQ A;  2AUC A;  2BKH B;  3B86 A;  3F45 A;  1S36 A;  2BAP A;  2KHN A;  1C3Y A;  2LVK A;  2P71 A;  3A8R A;  3ZWH A;  1CFP A;  2K60 A;  2Y1N A;  2K7D A;  3OHM B;  1UP5 A;  1BJF A;  2L2C A;  3IF7 A;  1LKJ A;  1TCF A;  3HX4 A;  5EL2 A;  2QPT A;  2HPS A;  2LE9 B;  3VRN A;  1BOD A;  4I5N B;  1YX7 A;  1G33 A;  1DF0 B;  2WC5 A;  3NSO A;  1A4P A;  1QLS A;  2I94 A;  4R1E A;  3BYA A;  5B8I B;  2Y4Q A;  4MZJ A;  5PAL A;  3FE6 A;  1FF1 A;  3D77 A;  2ZN9 A;  3TUY C;  3CZT X;  1EXR A;  1A75 A;  1S6J A;  1P28 A;  4QJ3 B;  4YI9 A;  4YRU A;  1GM0 A;  1ZFS A;  4HRG A;  1WDC B;  3BUX B;  3RM1 A;  2EC6 B;  3R1O A;  4NDB A;  2K7B A;  1XFZ O;  1NWD A;  1X02 A;  3D10 A;  3DXL A;  1DGV A;  2EHB A;  3BJH A;  3I5F B;  1TTX A;  1A2X A;  3AKA A;  3KPX A;  5HLV A;  2EGD A;  3S0E A;  2CTN A;  3BUN B;  3B88 A;  2KQ6 A;  3O78 A;  4AQI A;  2K8M B;  3DD4 A;  1IIO A;  4M2O A;  2L2E A;  1QTX A;  1YUS A;  5AFP A;  1SYM A;  3I5I C;  3KEV A;  4PE0 A;  1YTZ C;  5ER4 X;  1GGW A;  4MRX A;  2L4H A;  3O6B A;  3KO0 A;  2KFH A;  1F54 A;  1B7T Z;  1MXL C;  3JTD B;  3NSI A;  1WRK A;  4YGC B;  3D73 A;  1L2O B;  1DJW A;  1OOI X;  4CID A;  2OTG C;  1NIW A;  4GNK B;  1YX8 A;  3BUO B;  3SG4 A;  2L98 A;  1FI6 A;  1SBJ A;  1TUJ A;  2F3Y A;  3BFH A;  2PVB A;  1LIN A;  1MWN A;  2MBX A;  4C0J A;  1LXF C;  3I5G C;  4YBH B;  2FCD A;  2M49 B;  4CFR A;  1CLB A;  1J1E A;  2KPH A;  2Y5I A;  3IQQ A;  3SIB A;  2F2O A;  2KAV A;  1BR1 B;  3CTN A;  4PCW A;  1OW4 A;  1KFX S;  2L5Y A;  4HRE E;  2JTT A;  1FI5 A;  1QV1 A;  2BE6 A;  1QX2 A;  2BNX A;  3FE9 A;  3CGA A;  2JNX A;  4C0L A;  1DMO A;  2V53 A;  1F4Q A;  2KI4 C;  2LAP A;  1ORG A;  1CM1 A;  2D8N A;  1QIW A;  2JPO A;  4PAL A;  2K0J A;  1KSM A;  3QME A;  1K8U A;  1EG3 A;  3SJS A;  1KSO A;  1SRA A;  2M1U A;  3SS3 A;  5DKR A;  1HQV A;  3RZS A;  1OMR A;  5D3O A;  1B9A A;  1U5I B;  1LA0 A;  4DS7 A;  3PM2 A;  4D1E A;  1JUO A;  1SCM C;  2IS9 A;  3M0W A;  1WRL A;  1NX2 A;  2M8U A;  4JD9 A;  1XFV O;  3KHE A;  2JPT A;  2OS8 C;  3CYZ A;  5ER5 A;  2H2K A;  2P6B B;  2M0R A;  4A4C A;  1SK6 D;  1PAL A;  4FQO A;  3VRR A;  1SL9 A;  1C7W A;  2WND A;  3BFA A;  2PQL A;  4CPV A;  3PM8 A;  1OQP A;  3CZ2 A;  3WXA A;  2KAX A;  1QAS A;  2KYF A;  2Y1M A;  2LP3 A;  3S0A A;  4MSP A;  2OPO A;  3S0D A;  1JFJ A;  2WCM A;  2KLE A;  3PN7 B;  5DKN A;  3I5H B;  4OR9 B;  1Y0V H;  3DVK A;  2JOJ A;  2MLE C;  1R2U A;  1N0Y A;  1Y1U A;  4TNC A;  4PE1 A;  3CWG A;  3TS5 C;  2F3Z A;  1ZOT B;  3BOW B;  3NXA A;  2LHL A;  2LVI A;  2KSP A;  3I5I B;  2M1K B;  1XFY O;  3NSK A;  1UHN A;  2JWW A;  4WQ2 A;  2M7L A;  4NDD A;  2QEB A;  1SSE B;  1MHO A;  3B7A A;  1F4O A;  1MXE A;  1QVI Z;  2KBM A;  1SKT A;  2OTG B;  4ORC B;  1WY9 A;  3UNW A;  1MR8 A;  3WNX B;  3BUM B;  5DIC A;  3S0G A;  1IQ5 A;  1KQV A;  2KBI A;  2JZI A;  4PE4 A;  1GGZ A;  1K96 A;  3VB1 A;  1DGU A;  4HRH A;  3LCP C;  5CSJ A;  2WC6 A;  3FWC A;  1NX3 A;  2K2A A;  2ZRT A;  1BOC A;  2JTZ A;  1DJG A;  2LCP A;  1YVL A;  1TRF A;  4PE7 A;  1JWD A;  3LK1 A;  1NYA A;  5HLO A;  1MQ1 A;  1KQM C;  1OOF A;  2Q4U A;  3ZNI A;  3NHT A;  2BCB A;  4ZCV A;  4MN0 A;  2KI4 B;  3BFB A;  4ZCU A;  1DVI A;  1UHH A;  1FBV A;  2LM5 A;  4XYN A;  1MUX A;  2L5X B;  1TOP A;  2ZN8 A;  3AAJ A;  3FWB A;  2ISD A;  3TZ1 A;  1RTP 1;  3DVM A;  3JVT C;  2CXJ A;  1K9P A;  2MJW B;  1TNW A;  2BCA A;  1WLM A;  3EK4 A;  5F6T A;  1OOH A;  3CDN A;  4IL1 A;  2F2P A;  1YRT B;  4C0K A;  2MA2 A;  2MLF C;  1VRK A;  2PAL A;  2WOR A;  3EVV A;  2BL0 C;  1H8B A;  3NHI A;  3CLN A;  1SMG A;  3A4U B;  3C1V A;  1OSA A;  3TDU A;  1K94 A;  2FJU B;  1LS8 A;  2AAO A;  2CBL A;  2CNP A;  2KDH A;  3D0Y A;  1M63 B;  4PT1 A;  1S26 D;  2JNF A;  1WRZ A;  2NZ0 A;  1OE9 B;  3NGV A;  4OV2 A;  1B47 A;  1M31 A;  2MAZ A;  3LLE A;  3SG5 A;  5IBW A;  1CB1 A;  1J7R A;  2JRF A;  3BXK A;  1XFU O;  2KYC A;  5CSI A;  1TCO B;  3NSL A;  1OOG A;  3BQ3 A;  3O2P A;  2FCE A;  3OX6 A;  1CLL A;  5K89 A;  1JBA A;  2TN4 A;  2M3W A;  2L50 A;  3TS5 B;  4NDC A;  4IJ7 A;  2SCP A;  4FTG A;  3R72 A;  4ORA B;  5I2O A;  5D69 A;  1PSB A;  2LVJ A;  1TIZ A;  2B1U A;  1SPY A;  2I2R E;  1F71 A;  2ZFD A;  1RWY A;  1Z2C B;  4U8D A;  1F55 A;  1J55 A;  1JSA A;  4YGE B;  4ETO A;  4MEW A;  4DIR A;  4I5L B;  4XJK A;  3VRO A;  1NP8 A;  3EK8 A;  1QX7 A;  2ZND A;  4OKH A;  2KQY A;  2LV7 A;  2P70 A;  1BLQ A;  4PHM A;  5AAN A;  1NX0 A;  1OZO A;  4JPZ B;  1D1O A;  1TUZ A;  5CSF A;  3O4X A;  5HL1 A;  3SS5 A;  1CFD A;  3AAK A;  1Y1A A;  4JWQ A;  5I94 A;  2WOS A;  4UPG A;  1K90 D;  3R1V A;  1BF5 A;  1IH0 A;  1K95 A;  4PHJ A;  3DYE A;  1FW4 A;  1UHJ A;  2WCF A;  1KWO C;  1H4B A;  2PSR A;  4Q04 A;  3VGO A;  4N1G A;  1C3Z A;  1NPQ A;  3EKJ A;  3L4L A;  3CR4 X;  3CZ1 A;  4MVF A;  2YGU A;  4OCI A;  2BCX A;  1RFJ A;  3CAB A;  1J7P A;  2KGB C;  1A29 A;  1M45 A;  3JVT B;  1KK7 Y;  1NCY A;  1OMV A;  1IQ3 A;  1F70 A;  1G8I A;  3PAL A;  1IGV A;  1S1E A;  1A75 B;  4P2Y B;  2LC5 A;  3TUY B;  1S5G Y;  3D78 A;  2M97 A;  3LL8 B;  1LVC D;  3V2L A;  1ZAC A;  1EG4 A;  2BL0 B;  2HQ8 A;  4GUK A;  5DKQ A;  5AER A;  3UO9 A;  5I8N A;  4WRI A;  3TDI A;  2JT8 A;  3PLF B;  4F7F A;  2NXQ A;  2Q91 A;  2FOT A;  3SG3 A;  1DF0 A;  1XYD A;  1PK0 D;  3LK0 A;  1SNL A;  2JC2 A;  1OZS A;  1PVB A;  3DVE A;  2M7N A;  2GGM A;  2KI6 D;  2WCB A;  2G2B A;  2O5G A;  1NX1 A;  1C07 A;  1DEL A;  1IJ6 A;  1NSH A;  2LMT A;  3GK4 X;  4BY4 A;  2AMI A;  3K1E A;  2EC6 C;  2JT3 A;  1DJY A;  4YGD B;  2CT9 A;  1BMO A;  1ALW A;  4NQG A;  2WCL A;  3I5F C;  4GGF C;  5CPV A;  2FJY A;  2KFG A;  1KFU S;  2ZRS A;  1CDL A;  1CLM A;  1SY9 A;  1CKK A;  4XJK B;  2F33 A;  1IWQ A;  3BUW B;  1ZMZ A;  2NCO A;  1N2D A;  1NCZ A;  1EL4 A;  1KK7 Z;  1QX5 B;  3I5G B;  1DC1 A;  1L7Z A;  1K9U A;  1Y1X A;  4JKT A;  3WHT B;  3CR2 A;  1FPW A;  1ALV A;  2COL B;  1DJI A;  4N5X A;  4WQ3 A;  5HKW A;  1AJ5 A;  1S5G Z;  1REC A;  3PFV A;  2LHI A;  4GGN A;  1TWO A;  3OB1 B;  2KAY A;  1V1G A;  1KK8 C;  1QLK A;  2WCJ A;  1L2O C;  1UUS A;  1DEK A;  1N65 A;  3DVJ A;  2JXL A;  5I2L A;  2NLN A;  4YI8 A;  5AEQ A;  2LNK A;  1CMG A;  1TNX A;  3OP0 A;  1BU3 A;  1M39 A; 
#chains in the Genus database with same CATH homology
 1XVJ A;  1SL7 A;  1BT6 A;  2GV5 A;  2LUX A;  1DTL A;  4MLW A;  1J1D A;  2LAN A;  1Y6W A;  1KCY A;  1OOJ A;  2H61 C;  2L51 A;  5KU1 A;  2H61 A;  2E30 A;  3DF0 A;  1SCM B;  3PSR A;  1DT7 B;  2HET A;  4PHK A;  2BEC A;  2OS8 B;  1IJ5 A;  1PRW A;  3QRX A;  1SL8 A;  1JF0 A;  4GPL B;  3WHU B;  1A03 A;  1B7T Y;  1CDP A;  1TNP A;  3GOF A;  1CTR A;  3H4S E;  4USL A;  2LMU A;  2L0P A;  1AJ4 A;  2JU0 A;  4QJ4 B;  2KOT A;  2JT0 A;  1U5I A;  1WLZ A;  5JOL A;  2BBM A;  2ZKM X;  1W7J B;  2JUL A;  1B8L A;  3FIA A;  2R2I A;  1AVS A;  1AK8 A;  1UUR A;  3OX5 A;  2WCE A;  1XK4 C;  2ZNE A;  1XK4 A;  1B8C A;  1JFK A;  4M2P A;  1AUI B;  1ODB A;  1CMF A;  4MZL A;  2K61 A;  3K21 A;  1YUU A;  1CDM A;  3EVR A;  1XO5 A;  4CLN A;  4M2Q A;  2MHH A;  1QXP A;  1C7V A;  1QS7 A;  1RK9 A;  2MRD A;  4JQ0 D;  5D7F A;  1PSR A;  4GAO A;  3PN7 C;  5HKZ A;  3TDZ A;  1J7O A;  1F8H A;  5BPJ A;  2WC8 A;  2CCM A;  3I5H C;  1S3P A;  1TN4 A;  3PAT A;  2DOQ A;  1RRO A;  4ORB B;  3E3R A;  1CNP A;  3VRP A;  3BOW A;  1IG5 A;  1IRJ A;  3EVU A;  4PDZ A;  2KNE A;  2NCP A;  3HCM A;  1XFW O;  1KQM B;  2HQW A;  3EKH A;  1KK8 B;  1OMD A;  1DJZ A;  1BG1 A;  2G9B A;  2LMV A;  2PRU A;  2L4I A;  4MZK A;  1ZUZ A;  1BR4 B;  1KFX L;  1CM4 A;  1PUL A;  1YR5 A;  1DJH A;  4OVN F;  1R6P A;  3O4Y A;  2BKI B;  2K7O A;  1SR6 C;  2I18 A;  2KI6 C;  2LVV A;  4L9M A;  4P5O E;  1QV0 A;  4E68 A;  4AQJ A;  3DF0 B;  2RGI A;  3AKB A;  1UWO A;  1GQM A;  4GFT A;  4MRY A;  1XFX O;  2M9G A;  2A4J A;  1MF8 B;  4BY5 A;  1XA5 A;  1UHI A;  2LLU A;  3GK1 A;  5AXI A;  5I2Q A;  1B1G A;  5KSZ A;  5FYX A;  3CS1 A;  4HSZ A;  1LA3 A;  4AOM A;  1QAT A;  3D0Y B;  1HT9 A;  1E8A A;  2JXC A;  1W7I B;  2KGR A;  2LUC A;  2VRG A;  4DCK A;  2LP2 A;  1YVH A;  1QVI Y;  1CFC A;  1TNQ A;  4I5K A;  5TNC A;  3SG7 A;  1DJX A;  2PAS A;  3FS7 A;  5CSN A;  1GJY A;  1S6I A;  1YRU B;  4GBA A;  2M29 A;  1SCV A;  3ICB A;  1QJT A;  2O60 A;  4QJ5 B;  1CDN A;  3MSE B;  1NCX A;  2SAS A;  1YUR A;  1AHR A;  3RLZ A;  2K7C A;  2HF5 A;  1WDC C;  1CFF A;  1K9K A;  3KF9 A;  1YUT A;  2I7A A;  4F0Z B;  5J3X A;  4YGB B;  2KFF A;  2E6W A;  4PHN A;  3SG2 A;  3SIA A;  5HKY A;  1RJV A;  1V1F A;  5G08 A;  1B8R A;  4GGF A;  2QAC A;  1EH2 A;  1Q80 A;  1UHK A;  2JQ6 A;  4A4B A;  1QIV A;  1K2H A;  4ICB A;  4N1F A;  3CR5 X;  1JF2 A;  1J7Q A;  1IKU A;  1K93 D;  4YGA A;  4MBE A;  1B4C A;  1KFU L;  2LLT A;  1PVA A;  5JJG A;  1SW8 A;  2LLS A;  5KTY A;  2BBN A;  3JTD C;  1EJ3 A;  4DRW A;  1JC2 A;  1G4Y R;  4DUQ A;  3SG6 A;  2K2F A;  2BE4 A;  3IQO A;  2F8P A;  5HYD A;  1KWO B;  2PMY A;  3OB2 B;  4CFQ A;  2GGZ A;  5GQQ C;  1NUB A;  1M46 A;  3EK7 A;  4I5J A;  1SR6 B;  1S6C A;  3GK2 A;  3VRQ A;  2AUC A;  2BKH B;  3F45 A;  1S36 A;  2KHN A;  2LVK A;  3ZWH A;  3A8R A;  1CFP A;  2Y1N A;  2K7D A;  3OHM B;  1UP5 A;  1BJF A;  3IF7 A;  1LKJ A;  1TCF A;  3HX4 A;  2QPT A;  2HPS A;  2LE9 B;  3VRN A;  1BOD A;  4I5N B;  1YX7 A;  1G33 A;  1DF0 B;  3NSO A;  1A4P A;  1QLS A;  2I94 A;  4R1E A;  3BYA A;  5B8I B;  2Y4Q A;  4MZJ A;  5PAL A;  1FF1 A;  2ZN9 A;  3TUY C;  3CZT X;  1EXR A;  1A75 A;  1S6J A;  4QJ3 B;  4YI9 A;  4YRU A;  1ZFS A;  4HRG A;  1WDC B;  3BUX B;  3RM1 A;  2EC6 B;  4NDB A;  2K7B A;  1XFZ O;  1NWD A;  1X02 A;  3D10 A;  1DGV A;  2EHB A;  3I5F B;  1TTX A;  1A2X A;  3AKA A;  3KPX A;  5HLV A;  2EGD A;  2CTN A;  3BUN B;  2KQ6 A;  3O78 A;  4AQI A;  2K8M B;  3DD4 A;  4M2O A;  2L2E A;  1QTX A;  1YUS A;  5AFP A;  1SYM A;  3I5I C;  3KEV A;  4PE0 A;  1YTZ C;  5ER4 X;  1GGW A;  4MRX A;  2L4H A;  3O6B A;  3KO0 A;  2KFH A;  1F54 A;  1B7T Z;  1MXL C;  3JTD B;  3NSI A;  1WRK A;  4YGC B;  1L2O B;  1DJW A;  4CID A;  2OTG C;  1NIW A;  4GNK B;  1YX8 A;  3BUO B;  3SG4 A;  2L98 A;  1FI6 A;  1SBJ A;  2F3Y A;  2MBX A;  2PVB A;  1LIN A;  1MWN A;  4C0J A;  1LXF C;  3I5G C;  4YBH B;  2FCD A;  2M49 B;  4CFR A;  1CLB A;  1J1E A;  2Y5I A;  3IQQ A;  3SIB A;  2F2O A;  2KAV A;  1BR1 B;  3CTN A;  4PCW A;  1KFX S;  4HRE E;  2JTT A;  1FI5 A;  1QV1 A;  2BE6 A;  1QX2 A;  3CGA A;  2JNX A;  4C0L A;  1DMO A;  2V53 A;  1F4Q A;  2KI4 C;  2LAP A;  4PAL A;  1CM1 A;  2D8N A;  1QIW A;  2K0J A;  1KSM A;  1K8U A;  1EG3 A;  3SJS A;  1KSO A;  1SRA A;  2M1U A;  5DKR A;  1HQV A;  1OMR A;  1B9A A;  1U5I B;  1LA0 A;  4DS7 A;  4D1E A;  1JUO A;  1SCM C;  2IS9 A;  3M0W A;  1WRL A;  1NX2 A;  2M8U A;  1XFV O;  3KHE A;  2JPT A;  2OS8 C;  5ER5 A;  4A4C A;  2H2K A;  2P6B B;  2M0R A;  1AP4 A;  1SK6 D;  1PAL A;  4FQO A;  3VRR A;  1SL9 A;  1C7W A;  2WND A;  4CPV A;  3PM8 A;  1OQP A;  3WXA A;  2KAX A;  1QAS A;  2KYF A;  2Y1M A;  2LP3 A;  4MSP A;  2OPO A;  3PN7 B;  5DKN A;  3I5H B;  4OR9 B;  1Y0V H;  3DVK A;  2JOJ A;  2MLE C;  1R2U A;  1N0Y A;  1Y1U A;  4TNC A;  4PE1 A;  3CWG A;  3TS5 C;  2F3Z A;  1ZOT B;  3BOW B;  3NXA A;  2LHL A;  2LVI A;  2KSP A;  3I5I B;  2M1K B;  1XFY O;  3NSK A;  1UHN A;  2JWW A;  4WQ2 A;  2M7L A;  4NDD A;  1MHO A;  1F4O A;  1MXE A;  1QVI Z;  2KBM A;  1SKT A;  2OTG B;  4ORC B;  1WY9 A;  1MR8 A;  3WNX B;  3BUM B;  1IQ5 A;  1KQV A;  2KBI A;  2JZI A;  4PE4 A;  1GGZ A;  1K96 A;  1DGU A;  4HRH A;  3LCP C;  5CSJ A;  3FWC A;  1NX3 A;  2K2A A;  2ZRT A;  1BOC A;  2JTZ A;  1DJG A;  2LCP A;  1YVL A;  1TRF A;  4PE7 A;  1JWD A;  3LK1 A;  1NYA A;  5HLO A;  1MQ1 A;  1KQM C;  2Q4U A;  3ZNI A;  2BCB A;  4ZCV A;  4MN0 A;  2KI4 B;  4ZCU A;  1DVI A;  1UHH A;  1FBV A;  2LM5 A;  4XYN A;  1MUX A;  2L5X B;  1TOP A;  2ZN8 A;  3AAJ A;  3FWB A;  2ISD A;  3TZ1 A;  1RTP 1;  3DVM A;  3JVT C;  2CXJ A;  1K9P A;  2MJW B;  1TNW A;  2BCA A;  1WLM A;  3EK4 A;  5F6T A;  4IL1 A;  2F2P A;  1YRT B;  4C0K A;  2MA2 A;  2MLF C;  1VRK A;  2PAL A;  2WOR A;  3EVV A;  2BL0 C;  1H8B A;  3CLN A;  1SMG A;  3A4U B;  3C1V A;  1OSA A;  3TDU A;  1K94 A;  2FJU B;  2AAO A;  2CNP A;  2CBL A;  3D0Y A;  2KDH A;  1M63 B;  1S26 D;  2JNF A;  1WRZ A;  2NZ0 A;  1OE9 B;  4OV2 A;  1B47 A;  1M31 A;  2MAZ A;  3LLE A;  3SG5 A;  5IBW A;  1CB1 A;  1J7R A;  2JRF A;  3BXK A;  1XFU O;  2KYC A;  5CSI A;  1TCO B;  3NSL A;  3BQ3 A;  3O2P A;  2FCE A;  3OX6 A;  1CLL A;  5K89 A;  1JBA A;  2TN4 A;  2M3W A;  2L50 A;  3TS5 B;  4NDC A;  2SCP A;  4FTG A;  4ORA B;  5I2O A;  5D69 A;  1PSB A;  2LVJ A;  1TIZ A;  2B1U A;  1SPY A;  2I2R E;  1F71 A;  2ZFD A;  1RWY A;  4U8D A;  1F55 A;  1J55 A;  1JSA A;  4YGE B;  4ETO A;  4MEW A;  4DIR A;  4I5L B;  4XJK A;  3VRO A;  1NP8 A;  3EK8 A;  1QX7 A;  2ZND A;  4OKH A;  2KQY A;  2LV7 A;  1BLQ A;  4PHM A;  5AAN A;  1NX0 A;  1OZO A;  4JPZ B;  1D1O A;  5CSF A;  1CFD A;  3AAK A;  1Y1A A;  4JWQ A;  2WOS A;  4UPG A;  1K90 D;  1BF5 A;  1IH0 A;  1K95 A;  4PHJ A;  1FW4 A;  1UHJ A;  2WCF A;  1KWO C;  1H4B A;  2PSR A;  4Q04 A;  3VGO A;  4N1G A;  1NPQ A;  3EKJ A;  3CR4 X;  4MVF A;  4OCI A;  2BCX A;  1RFJ A;  1J7P A;  2KGB C;  1A29 A;  1M45 A;  3JVT B;  1KK7 Y;  1NCY A;  1OMV A;  1IQ3 A;  1F70 A;  1G8I A;  3PAL A;  1IGV A;  1S1E A;  1A75 B;  4P2Y B;  2LC5 A;  3TUY B;  1S5G Y;  2M97 A;  3LL8 B;  1LVC D;  1ZAC A;  1EG4 A;  2BL0 B;  2HQ8 A;  4GUK A;  5DKQ A;  5AER A;  5I8N A;  4WRI A;  3TDI A;  2JT8 A;  3PLF B;  2NXQ A;  2Q91 A;  2FOT A;  3SG3 A;  1DF0 A;  1XYD A;  1PK0 D;  3LK0 A;  1SNL A;  2JC2 A;  1OZS A;  1PVB A;  3DVE A;  2M7N A;  2GGM A;  2KI6 D;  2WCB A;  2G2B A;  2O5G A;  1NX1 A;  1C07 A;  1IJ6 A;  1NSH A;  2LMT A;  3GK4 X;  4BY4 A;  2AMI A;  2EC6 C;  2JT3 A;  1DJY A;  4YGD B;  2CT9 A;  1BMO A;  1ALW A;  4NQG A;  3I5F C;  4GGF C;  5CPV A;  2KFG A;  1KFU S;  2ZRS A;  1CDL A;  1CLM A;  1SY9 A;  1CKK A;  4XJK B;  2F33 A;  1IWQ A;  3BUW B;  1ZMZ A;  2NCO A;  1N2D A;  1NCZ A;  1EL4 A;  1KK7 Z;  1QX5 B;  3I5G B;  1L7Z A;  1K9U A;  1Y1X A;  3WHT B;  3CR2 A;  1FPW A;  1ALV A;  2COL B;  1DJI A;  4N5X A;  4WQ3 A;  5HKW A;  1AJ5 A;  1S5G Z;  1REC A;  3PFV A;  2LHI A;  4GGN A;  3OB1 B;  2KAY A;  1V1G A;  1KK8 C;  1QLK A;  1L2O C;  1UUS A;  3DVJ A;  1N65 A;  5I2L A;  2JXL A;  5AEQ A;  2NLN A;  4YI8 A;  1CMG A;  2LNK A;  1JFJ A;  1TNX A;  3OP0 A;  1BU3 A;  1M39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...