1XYDA

Nmr solution structure of rat zinc-calcium-s100b, 20 structures
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
92
structure length
92
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-100 protein, beta chain
publication title Solution Structure of Zinc- and Calcium-Bound Rat S100B as Determined by Nuclear Magnetic Resonance Spectroscopy
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 26
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xydA00
1MWNA 1QV1A 1NWDA 4PHKA 4MZKA 1UP5A 1EH2A 4N1GA 2JT3A 4PE4A 5HKZA 3CLNA 1OMRA 1FBVA 1KQMB 1XFZO 1C7WA 3ICBA 3CR2A 2P6BB 2M9GA 5HKWA 1Y1AA 4CFQA 4I5KA 1CM1A 1BR4B 1OZSA 2KSPA 1K90D 3DF0B 4AQJA 1W7JB 1U5IA 1KK7Z 1XVJA 2L0PA 1TNWA 1BR1B 1KK7Y 2KAXA 4ICBA 2L51A 4CIDA 2CTNA 1AK8A 1IQ5A 2HETA 1CDNA 1CKKA 3SIBA 1EG4A 2JNXA 1CTRA 4A4CA 2WORA 2A4JA 2F3ZA 3DVMA 1JUOA 2BBNA 3EVRA 3NSIA 2H61A 2LAPA 1QVIZ 2KGBC 2WCFA 1FW4A 3A8RA 1WDCC 2PALA 1QVIY 1UHJA 1JSAA 1JC2A 1KSMA 3WHUB 3I5IC 1YTZC 4GAOA 1QS7A 1TCFA 5ER5A 3DVEA 1CFPA 1K2HA 2D8NA 1M31A 2KNEA 1DVIA 2I2RE 1CMGA 3BXKA 4OCIA 3BUNB 3VRNA 1IQ3A 1U5IB 1J55A 1CNPA 1NX2A 4HSZA 2NXQA 2LLSA 2V53A 1Y1XA 2TN4A 1QJTA 2BL0C 1AVSA 3I5FC 2JRFA 3O6BA 1XFUO 3TS5C 4MZLA 2Q91A 2PSRA 1AJ5A 2EGDA 2JZIA 1SNLA 4PDZA 1UHHA 1LA0A 1YUTA 1IH0A 5IBWA 4CLNA 3AAKA 4C0JA 1CDPA 1SYMA 2B1UA 2LC5A 3ZWHA 4PE1A 4NQGA 3VGOA 1UHKA 1NX0A 1SR6C 3FIAA 4GGNA 2CT9A 2JTZA 3DVJA 1TNXA 2BECA 3TDUA 1WRLA 1CFFA 1ZACA 1TN4A 5CSNA 4PHNA 2BCAA 2NCOA 2M97A 2NZ0A 4GUKA 3SG6A 1WDCB 1EG3A 5CSJA 3H4SE 5HYDA 1MR8A 1EJ3A 2Q4UA 4ZCUA 3I5IB 3TUYB 1G8IA 1UHIA 1DT7B 4M2OA 4MSPA 1PVBA 2HF5A 2LHLA 3KHEA 2KQ6A 3BUMB 4P2YB 3PM8A 2KFGA 1BMOA 1B9AA 1SY9A 3IQOA 2CNPA 3NXAA 4AQIA 1PSBA 2LMVA 3KPXA 2LVVA 1CFDA 2PRUA 3VRPA 1OMVA 1JF0A 3EK7A 2BL0B 4BY4A 1MXLC 1IKUA 1TRFA 2CXJA 3TS5B 1G4YR 2BE6A 1B8CA 3EK8A 2KQYA 1F70A 4WQ3A 1B8RA 1B8LA 5D69A 1NCZA 3CTNA 4GBAA 2MLFC 1J7OA 2L4IA 1S6CA 3PFVA 4PALA 3SG5A 1J7RA 1PSRA 4C0KA 2K0JA 1NSHA 1XFWO 3RLZA 2F3YA 1MF8B 1LVCD 2LP2A 2RGIA 3HCMA 4NDCA 4PE7A 1J7PA 1FPWA 1RROA 1QATA 4ORBB 3KEVA 3BYAA 2WCBA 2ZKMX 1YUUA 2LLTA 3EKHA 2NCPA 4L9MA 1QV0A 1KK8C 1XA5A 2ZFDA 1N65A 1S26D 2PVBA 5HLOA 5G08A 1OSAA 4D1EA 1JFJA 1MHOA 4MN0A 4YRUA 1NCYA 2KBIA 2L4HA 3C1VA 2Y4QA 1NIWA 3SG3A 1DJHA 1IG5A 3OP0A 1KFUS 1SBJA 1YRUB 2KAVA 1NX3A 3AKAA 2M8UA 1S6IA 5AXIA 1KFXS 1QLKA 2MA2A 5I8NA 1TNPA 3WHTB 2LANA 2L5XB 5D7FA 1A4PA 4GNKB 2OS8B 4PE0A 1C07A 3M0WA 3PATA 2WCEA 1F4QA 2LE9B 1JBAA 4Q04A 1H8BA 1K95A 1DJZA 1CDMA 1CLLA 3OHMB 5JJGA 2H2KA 1BOCA 1QX7A 1LKJA 1PVAA 1A2XA 3EK4A 5DKNA 4CPVA 1KWOC 3F45A 2G9BA 1ZMZA 3GK1A 3NSOA 3SG7A 4GFTA 2OTGB 2LNKA 2KI4B 1F8HA 2O5GA 5AANA 1QASA 1DGVA 3BUWB 4P5OE 1YR5A 5AFPA 3BUXB 5J3XA 1SL8A 2KOTA 5AEQA 1IRJA 4DS7A 1FI5A 1A29A 1G33A 5KSZA 1K9PA 3PN7C 2E30A 1XFYO 1B7TZ 4M2PA 2K7OA 3BOWA 2LUCA 4AOMA 1B7TY 1WY9A 1XO5A 1F54A 1A75A 1WLMA 3DD4A 1K94A 1QXPA 2FCEA 1K8UA 1NYAA 2L2EA 1W7IB 4MZJA 5HLVA 1ZUZA 1HT9A 4MVFA 4WQ2A 3EVUA 1QIVA 1DGUA 2ZRSA 4JPZB 2JNFA 3VROA 4U8DA 3CGAA 3MSEB 1N0YA 3I5GC 1RJVA 1KWOB 4IL1A 3BQ3A 1PALA 1OOJA 1BU3A 1IGVA 3I5HC 2EC6C 1R6PA 1DMOA 2LM5A 3CWGA 1SL9A 2LMUA 5B8IB 1WRZA 3BOWB 2JULA 2CCMA 2JTTA 5DKQA 1NUBA 1DJWA 1NPQA 1TTXA 3KO0A 1A75B 4OKHA 5I2LA 5CSFA 3FWCA 3PLFB 5CPVA 1L2OC 1WLZA 2M1KB 1WRKA 1CFCA 1JF2A 4I5NB 2JC2A 2M49B 1AUIB 3I5FB 5I2OA 1ALWA 1ZOTB 5FYXA 4GGFC 1KSOA 1SKTA 1XFVO 2LHIA 2I18A 2WNDA 1KFUL 1EXRA 2LVKA 1SCMC 1SCVA 1SMGA 3TZ1A 1MUXA 2MBXA 2JXCA 1SR6B 1K96A 1TIZA 2KI6D 4GGFA 1GGWA 4USLA 1KFXL 1BG1A 4ORCB 1YX7A 2LUXA 1B47A 3D0YA 3I5GB 3A4UB 1BLQA 3DVKA 2LCPA 1LXFC 3I5HB 5AERA 2EC6B 1ALVA 2ZNDA 3TDIA 2JT0A 1TNQA 4YBHB 2JOJA 2EHBA 4JWQA 1RK9A 2I7AA 1TCOB 5DKRA 2ZN9A 3GK2A 1VRKA 3FWBA 4N1FA 3TDZA 1SK6D 3CR4X 2AAOA 1X02A 1NP8A 2JPTA 2Y1MA 4R1EA 3RM1A 1A03A 1L2OB 4BY5A 1QTXA 1YUSA 4HRGA 2Y5IA 1BODA 2BBMA 3D10A 1S6JA 4OV2A 2M7LA 4ETOA 4YI9A 4I5JA 1MQ1A 3NSLA 5HKYA 3NSKA 1OE9B 1R2UA 2MHHA 1TOPA 1NCXA 2JQ6A 2KFFA 2M29A 3JVTC 3D0YB 3IQQA 4MBEA 1SCMB 3WNXB 4QJ5B 4GPLB 2IS9A 1D1OA 1KQVA 1HQVA 4E68A 2M7NA 4FTGA 1F55A 2MLEC 1EL4A 3QRXA 4XYNA 2JT8A 4YGEB 4UPGA 1Q80A 3GK4X 4PHJA 2BCBA 5CSIA 2K7CA 4YI8A 1H4BA 3LLEA 1K9KA 2SCPA 1CB1A 4PHMA 1UURA 4MEWA 3OX5A 1RFJA 2CBLA 1S3PA 2K2AA 4ZCVA 1IJ5A 1KK8B 3JTDC 1YVLA 1M45A 1OZOA 2MJWB 4CFRA 1M39A 4MRYA 1UUSA 5GQQC 1MXEA 2MRDA 3O4YA 1XYDA 3LCPC 1XFXO 2QPTA 1RECA 2H61C 2BCXA 2KAYA 4M2QA 4WRIA 1V1FA 4N5XA 3SG2A 2K8MB 1NX1A 2MAZA 4QJ4B 1CLBA 1N2DA 1SPYA 2GV5A 2M3WA 1AJ4A 2K61A 1UWOA 1LA3A 1J1EA 4YGAA 1KCYA 4ORAB 3JVTB 1PK0D 5KU1A 2BKIB 2ZN8A 1CM4A 1V1GA 1CLMA 2HPSA 2E6WA 4HRHA 1K93D 1DJXA 1SW8A 2L50A 2AUCA 2AMIA 1RWYA 2K2FA 1YX8A 1IJ6A 1DJGA 2ZNEA 4DUQA 1GGZA 2LVJA 2LMTA 4I5LB 3TUYC 3HX4A 4NDDA 2F2PA 1M46A 2KBMA 3BUOB 4PCWA 3SG4A 3K21A 2LLUA 1BF5A 1J1DA 2GGMA 2FJUB 4A4BA 1J7QA 4DIRA 3EVVA 1RTP1 1S36A 2KDHA 1E8AA 1FF1A 2LV7A 1IWQA 1DF0A 4YGDB 2VRGA 3JTDB 4XJKA 2BKHB 2NLNA 1PRWA 1JWDA 1QX5B 1ZFSA 4HREE 1SL7A 3OB1B 3PSRA 2F2OA 2QACA 1CMFA 2LVIA 3LK1A 1DJIA 1OMDA 1PULA 4FQOA 4MRXA 3KF9A 1BT6A 3PN7B 1LINA 1Y1UA 2F8PA 4DRWA 2KI6C 2BE4A 1DTLA 1QIWA 2KYFA 3EKJA 3PALA 2K7DA 1QLSA 3AKBA 2HQWA 3WXAA 2FOTA 5BPJA 2DOQA 3OX6A 1JFKA 1F4OA 3IF7A 2KFHA 3LK0A 1CDLA 2KYCA 5K89A 2O60A 1Y0VH 3ZNIA 1DJYA 2JWWA 2ZRTA 1DF0B 4JQ0D 2L98A 4OVNF 4XJKB 5I2QA 2ISDA 1YURA 2COLB 2JXLA 1GJYA 1GQMA 5KTYA 5PALA 1S5GZ 2HQ8A 2R2IA 2SASA 4YGCB 1Y6WA 4C0LA 2WOSA 2LP3A 2GGZA 4OR9B 3SIAA 1S5GY 1QX2A 2JU0A 1L7ZA 2Y1NA 5ER4X 1K9UA 4DCKA 1FI6A 4F0ZB 1KQMC 4NDBA 1AP4A 3VRQA 3O2PA 1YRTB 2KGRA 2OPOA 3CZTX 4TNCA 2F33A 1BJFA 2OS8C 2M1UA 1XK4C 3O78A 2G2BA 1SRAA 3OB2B 4MLWA 3CR5X 1OQPA 3DF0A 4YGBB 3CS1A 1XK4A 2FCDA 2M0RA 5F6TA 1UHNA 4QJ3B 5JOLA 1YVHA 1F71A 2WC8A 2PMYA 3VRRA 3E3RA 1S1EA 1AHRA 1M63B 1B4CA 2I94A 2OTGC 3FS7A 3GOFA 2KI4C 3LL8B 3SJSA 1ODBA 1B1GA 2K7BA 5TNCA 3AAJA 2PASA 1C7VA 2KHNA
chains in the Genus database with same CATH superfamily
1MWNA 2WCKA 1QV1A 1NWDA 4PHKA 4MZKA 1UP5A 1EH2A 4N1GA 2JT3A 4PE4A 5HKZA 2WC5A 3CLNA 2BNXA 1OMRA 1FBVA 1KQMB 1XFZO 1C7WA 3ICBA 3CR2A 2P6BB 2M9GA 5HKWA 1DC1A 3K1EA 1Y1AA 4CFQA 1DELA 4I5KA 1CM1A 1BR4B 1OZSA 2KSPA 1K90D 3DF0B 4AQJA 1W7JB 1U5IA 1KK7Z 1XVJA 2ERBA 2L0PA 3B86A 3CZ0A 1TNWA 1BR1B 1KK7Y 2KAXA 4ICBA 2L51A 4CIDA 2CTNA 1AK8A 2WCLA 1IQ5A 2HETA 1CDNA 1CKKA 3SIBA 1EG4A 3N7HA 2JNXA 1CTRA 4A4CA 2WORA 2A4JA 2F3ZA 3DVMA 1JUOA 2BBNA 3EVRA 3FE8A 3NSIA 2H61A 2LAPA 1QVIZ 4PT1A 2KGBC 1C3ZA 2WCFA 1FW4A 3A8RA 4INXA 1WDCC 2PALA 1QVIY 1UHJA 1JSAA 1JC2A 1KSMA 3WHUB 3I5IC 1YTZC 2KLDA 4GAOA 1QS7A 1TCFA 1ORGA 2P70A 3DVEA 5ER5A 1CFPA 1K2HA 2D8NA 1M31A 2KNEA 1DVIA 2I2RE 1CMGA 3BXKA 4OCIA 3BUNB 3VRNA 1IQ3A 1U5IB 3B88A 1J55A 1CNPA 1NX2A 4HSZA 2NXQA 2LLSA 2V53A 1Y1XA 2TN4A 1QJTA 2BL0C 1AVSA 2GTEA 2JRFA 3I5FC 3O6BA 3Q8IA 1XFUO 3TS5C 4MZLA 2Q91A 2PSRA 1AJ5A 2EGDA 2JZIA 1SNLA 4PDZA 3S0AA 1UHHA 1LA0A 1YUTA 1IH0A 5IBWA 4CLNA 3AAKA 4C0JA 1CDPA 1SYMA 2B1UA 2LC5A 2QDIA 3ZWHA 2BAPA 4PE1A 4NQGA 3VGOA 1UHKA 1NX0A 1SR6C 3V2LA 3B7AA 3FIAA 4GGNA 2CT9A 2JTZA 1OW4A 3DVJA 1TNXA 2BECA 3TDUA 4JKTA 1WRLA 1CFFA 1ZACA 1TN4A 5CSNA 4PHNA 2BCAA 2NCOA 2M97A 2NZ0A 4GUKA 3BFAA 3SG6A 1WDCB 1EG3A 3O4XA 3H4SE 5CSJA 5HYDA 1MR8A 3S0GA 1EJ3A 2Q4UA 4ZCUA 3I5IB 3TUYB 1G8IA 1UHIA 1DT7B 4M2OA 4MSPA 1PVBA 2HF5A 2LHLA 3KHEA 2KQ6A 3BUMB 4P2YB 3PM8A 2KFGA 5HL1A 3RZSA 1BMOA 1B9AA 1SY9A 3IQOA 2CNPA 3B6XA 3L4AA 3NXAA 4AQIA 1PSBA 2KPHA 2LMVA 3KPXA 2LVVA 1CFDA 2PRUA 3VRPA 1OMVA 1JF0A 3EK7A 2BL0B 3D73A 4BY4A 1MXLC 1IKUA 1TRFA 2CXJA 2KLEA 5FI6A 3TS5B 1G4YR 3NHIA 2WCJA 2BE6A 1TUZA 1B8CA 3EK8A 2KQYA 1F70A 4WQ3A 1B8RA 1B8LA 5D69A 1NCZA 3CTNA 4GBAA 2JPOA 2MLFC 1J7OA 2L4IA 1LS8A 1S6CA 3PFVA 4PALA 3SG5A 1J7RA 1PSRA 3S0EA 4C0KA 2K0JA 1NSHA 1XFWO 3RLZA 2F3YA 5I94A 1MF8B 1LVCD 2LP2A 2RGIA 3HCMA 4NDCA 3NHTA 3B87A 4PE7A 1J7PA 1FPWA 3S0FA 3BFBA 1RROA 1QATA 3D77A 4ORBB 3KEVA 2WC6A 3BYAA 2WCBA 2ZKMX 1YUUA 2LLTA 3EKHA 2NCPA 4L9MA 3SS3A 1QV0A 1KK8C 1XA5A 2ZFDA 1N65A 1TWOA 1S26D 2PVBA 5HLOA 5G08A 1OSAA 4D1EA 1JFJA 1MHOA 4MN0A 4YRUA 1NCYA 2KBIA 2L4HA 3C1VA 2Y4QA 4KYNA 1NIWA 3SG3A 1DJHA 1IG5A 3OP0A 2FJYA 1KFUS 1SBJA 1YRUB 3DYEA 2KAVA 1NX3A 3AKAA 3OBVA 2M8UA 1S6IA 5AXIA 1KFXS 1QLKA 2MA2A 5I8NA 1TNPA 2PYQA 3WHTB 3L47A 2LANA 2L5XB 5D7FA 1QWVA 1A4PA 4GNKB 2OS8B 4PE0A 3CDNA 1DQEA 1C07A 3M0WA 3PATA 2WCEA 1F4QA 2LE9B 1JBAA 4Q04A 1H8BA 1K95A 1DJZA 1CDMA 1CLLA 3OHMB 5JJGA 3BFHA 2H2KA 3DXLA 1BOCA 1QX7A 1LKJA 1PVAA 1A2XA 1P28A 3EK4A 5DKNA 4CPVA 1KWOC 3F45A 2G9BA 1ZMZA 3GK1A 3NSOA 3SG7A 3UO9A 4GFTA 2OTGB 2LNKA 2KI4B 1F8HA 2O5GA 5AANA 3SS4A 1QASA 4JD9A 1DGVA 3BUWB 4P5OE 3VB1A 1YR5A 5AFPA 3BUXB 5J3XA 1SL8A 2KOTA 5AEQA 1IRJA 4DS7A 1FI5A 1A29A 1G33A 5KSZA 1K9PA 3PN7C 2E30A 1XFYO 1B7TZ 4M2PA 2K7OA 3BOWA 2LUCA 3CZ2A 4AOMA 1B7TY 1WY9A 1XO5A 1F54A 1A75A 3D74A 1WLMA 3DD4A 1K94A 2P71A 1QXPA 2FCEA 1K8UA 1NYAA 2L2EA 1W7IB 4MZJA 5HLVA 1ZUZA 2YGUA 3R1OA 5EL2A 1HT9A 4MVFA 4WQ2A 3EVUA 1OOFA 1QIVA 1DGUA 2ZRSA 4JPZB 2JNFA 3VROA 4U8DA 3CGAA 1IIOA 3MSEB 1N0YA 3I5GC 1RJVA 1KWOB 4IL1A 3BQ3A 1PALA 1OOJA 1BU3A 1IGVA 3I5HC 2EC6C 3S0DA 1R6PA 1DMOA 4IJ7A 2LM5A 3CWGA 1SL9A 2LMUA 5B8IB 1WRZA 3BOWB 2JULA 2CCMA 2JTTA 5DKQA 1NUBA 1DJWA 1NPQA 1TTXA 3KO0A 1A75B 4OKHA 5I2LA 3PM2A 5CSFA 3FWCA 3PLFB 5CPVA 1L2OC 1WLZA 2M1KB 3DZTA 1WRKA 1CFCA 1JF2A 4I5NB 2JC2A 2M49B 1AUIB 1TUJA 3I5FB 5I2OA 1ALWA 1ZOTB 5FYXA 4GGFC 1KSOA 1SKTA 1XFVO 2LHIA 2I18A 2WNDA 1OOIX 1KFUL 1EXRA 2LVKA 1SCMC 1SCVA 1SMGA 5DICA 3TZ1A 1MUXA 3UNWA 2MBXA 2JXCA 1SR6B 1K96A 1TIZA 2KI6D 4GGFA 1GGWA 4USLA 1KFXL 1BG1A 4ORCB 1YX7A 2LUXA 1B47A 3D0YA 3I5GB 3A4UB 3OGNA 1BLQA 3DVKA 2LCPA 1LXFC 3I5HB 3D75A 5AERA 2EC6B 1ALVA 2ZNDA 3TDIA 2JT0A 1TNQA 2QEVA 4YBHB 3CZ1A 2JOJA 1Z4HA 2EHBA 4JWQA 1RK9A 2I7AA 1TCOB 5DKRA 2ZN9A 3GK2A 1VRKA 3FWBA 4N1FA 3TDZA 1SK6D 3CR4X 2AAOA 1X02A 1NP8A 2JPTA 2Y1MA 3BJHA 3R1VA 4R1EA 3RM1A 1A03A 1L2OB 4BY5A 2H8VA 1QTXA 1YUSA 4HRGA 2Y5IA 1BODA 2BBMA 3D10A 1S6JA 2QEHA 4OV2A 2M7LA 4ETOA 4YI9A 4I5JA 1MQ1A 3NSLA 5HKYA 3NSKA 3R72A 1OE9B 1R2UA 2MHHA 1TOPA 3QMEA 1NCXA 2JQ6A 2KFFA 2M29A 3JVTC 4F7FA 3EG5B 3D0YB 3IQQA 4MBEA 1SCMB 3WNXB 4QJ5B 4GPLB 2IS9A 1D1OA 1KQVA 1HQVA 4E68A 2M7NA 4FTGA 1F55A 2MLEC 1EL4A 3QRXA 4XYNA 2JT8A 4YGEB 4UPGA 1Q80A 3GK4X 4PHJA 2BCBA 5CSIA 2K7CA 4YI8A 1H4BA 3LLEA 1K9KA 3FE6A 2SCPA 1CB1A 4PHMA 1UURA 4MEWA 3OX5A 1RFJA 1T14A 2CBLA 1S3PA 2K2AA 4ZCVA 1IJ5A 2QEOA 1KK8B 4FQTA 3SS5A 3JTDC 1YVLA 1M45A 1OZOA 2MJWB 3D76A 4CFRA 1M39A 4MRYA 1UUSA 5GQQC 1MXEA 2MRDA 3O4YA 1XYDA 1DEKA 3LCPC 1XFXO 2QPTA 1RECA 1XFRA 5FI7A 2H61C 2BCXA 2KAYA 4M2QA 4WRIA 1V1FA 4N5XA 3SG2A 2K8MB 1NX1A 2MAZA 4QJ4B 1CLBA 1N2DA 1SPYA 2GV5A 2M3WA 1AJ4A 2K61A 1UWOA 1LA3A 1J1EA 4YGAA 1KCYA 4ORAB 3JVTB 1PK0D 5KU1A 2BKIB 2ZN8A 1CM4A 1V1GA 3R1PA 1CLMA 2HPSA 2E6WA 4HRHA 1K93D 1DJXA 1SW8A 2L50A 2AUCA 2AMIA 1RWYA 2K2FA 1YX8A 1IJ6A 1DJGA 2ZNEA 4DUQA 1GGZA 2LVJA 2LMTA 4I5LB 3TUYC 3HX4A 4NDDA 2F2PA 1M46A 2KBMA 3BUOB 4PCWA 3SG4A 5FI2A 3K21A 2LLUA 1BF5A 1J1DA 2GGMA 2FJUB 3CABA 1OOGA 4A4BA 1J7QA 4DIRA 3EVVA 1RTP1 1S36A 2KDHA 1E8AA 1FF1A 2LV7A 1IWQA 1DF0A 4YGDB 2VRGA 3JTDB 4XJKA 2BKHB 2NLNA 1PRWA 1JWDA 1QX5B 1ZFSA 4HREE 1SL7A 3OB1B 3PSRA 2F2OA 2QACA 1CMFA 2WCHA 2LVIA 3LK1A 1DJIA 1OMDA 1PULA 4FQOA 4MRXA 3KF9A 1BT6A 5K89A 3PN7B 3NGVA 1LINA 1Y1UA 2F8PA 2L2CA 4DRWA 2KI6C 2BE4A 3IVTA 1DTLA 1QIWA 2KYFA 3EKJA 3PALA 2K7DA 1QLSA 2PQLA 3CYZA 3AKBA 4OZDA 2HQWA 3WXAA 2FOTA 5BPJA 3L4LA 2DOQA 3OX6A 1JFKA 1F4OA 1Z2CB 2KFHA 3D78A 1CDLA 2KYCA 3IF7A 2O60A 1Y0VH 3LK0A 5D3OA 1DJYA 2JWWA 3ZNIA 2ZRTA 2QEBA 1DF0B 4JQ0D 2L98A 4OVNF 4XJKB 5I2QA 2ISDA 1YURA 2COLB 2JXLA 2WCMA 1GJYA 1GQMA 5KTYA 5PALA 1S5GZ 2HQ8A 1OOHA 2R2IA 2SASA 4YGCB 1Y6WA 4C0LA 2WOSA 2LP3A 2GGZA 4OR9B 3SIAA 1S5GY 1QX2A 2JU0A 1L7ZA 2Y1NA 5ER4X 1K9UA 4DCKA 1FI6A 4F0ZB 1KQMC 4NDBA 1AP4A 3VRQA 3O2PA 1YRTB 2KGRA 2L5YA 2OPOA 1SSEB 3CZTX 4TNCA 2F33A 4INWA 1C3YA 3FE9A 1BJFA 2OS8C 3S0BA 2M1UA 1XK4C 3O78A 2G2BA 1SRAA 3OB2B 4MLWA 3CR5X 1OQPA 3DF0A 4YGBB 3DY9A 3CS1A 1XK4A 2FCDA 2M0RA 5F6TA 1UHNA 4QJ3B 5JOLA 1YVHA 1F71A 2WC8A 2PMYA 1GM0A 3VRRA 3E3RA 1S1EA 1AHRA 1M63B 1B4CA 2I94A 2OTGC 3FS7A 3GOFA 2KI4C 3LL8B 3PJIA 2K60A 3SJSA 1ODBA 1B1GA 2K7BA 5TNCA 3AAJA 2PASA 1C7VA 2KHNA 1W9ZA
chains in the Genus database with same CATH topology
1MWNA 1QV1A 1NWDA 4PHKA 4MZKA 1UP5A 1EH2A 4N1GA 2JT3A 4PE4A 5HKZA 3CLNA 1OMRA 1FBVA 1KQMB 1XFZO 1C7WA 3ICBA 3CR2A 2P6BB 2M9GA 5HKWA 1Y1AA 4CFQA 4I5KA 1CM1A 1BR4B 1OZSA 2KSPA 1K90D 3DF0B 4AQJA 1W7JB 1U5IA 1KK7Z 1XVJA 2L0PA 1TNWA 1BR1B 1KK7Y 2KAXA 4ICBA 2L51A 4CIDA 2CTNA 1AK8A 1IQ5A 2HETA 1CDNA 1CKKA 3SIBA 1EG4A 2JNXA 1CTRA 4A4CA 2WORA 2A4JA 2F3ZA 3DVMA 1JUOA 2BBNA 3EVRA 3NSIA 2H61A 2LAPA 1QVIZ 2KGBC 2WCFA 1FW4A 3A8RA 1WDCC 2PALA 1QVIY 1UHJA 1JSAA 1JC2A 1KSMA 3WHUB 3I5IC 1YTZC 4GAOA 1QS7A 1TCFA 5ER5A 3DVEA 1CFPA 1K2HA 2D8NA 1M31A 2KNEA 1DVIA 2I2RE 1CMGA 3BXKA 4OCIA 3BUNB 3VRNA 1IQ3A 1U5IB 1J55A 1CNPA 1NX2A 4HSZA 2NXQA 2LLSA 2V53A 1Y1XA 2TN4A 1QJTA 2BL0C 1AVSA 3I5FC 2JRFA 3O6BA 1XFUO 3TS5C 4MZLA 2Q91A 2PSRA 1AJ5A 2EGDA 2JZIA 1SNLA 4PDZA 1UHHA 1LA0A 1YUTA 1IH0A 5IBWA 4CLNA 3AAKA 4C0JA 1CDPA 1SYMA 2B1UA 2LC5A 3ZWHA 4PE1A 4NQGA 3VGOA 1UHKA 1NX0A 1SR6C 3FIAA 4GGNA 2CT9A 2JTZA 3DVJA 1TNXA 2BECA 3TDUA 1WRLA 1CFFA 1ZACA 1TN4A 5CSNA 4PHNA 2BCAA 2NCOA 2M97A 2NZ0A 4GUKA 3SG6A 1WDCB 1EG3A 5CSJA 3H4SE 5HYDA 1MR8A 1EJ3A 2Q4UA 4ZCUA 3I5IB 3TUYB 1G8IA 1UHIA 1DT7B 4M2OA 4MSPA 1PVBA 2HF5A 2LHLA 3KHEA 2KQ6A 3BUMB 4P2YB 3PM8A 2KFGA 1BMOA 1B9AA 1SY9A 3IQOA 2CNPA 3NXAA 4AQIA 1PSBA 2LMVA 3KPXA 2LVVA 1CFDA 2PRUA 3VRPA 1OMVA 1JF0A 3EK7A 2BL0B 4BY4A 1MXLC 1IKUA 1TRFA 2CXJA 3TS5B 1G4YR 2BE6A 1B8CA 3EK8A 2KQYA 1F70A 4WQ3A 1B8RA 1B8LA 5D69A 1NCZA 3CTNA 4GBAA 2MLFC 1J7OA 2L4IA 1S6CA 3PFVA 4PALA 3SG5A 1J7RA 1PSRA 4C0KA 2K0JA 1NSHA 1XFWO 3RLZA 2F3YA 1MF8B 1LVCD 2LP2A 2RGIA 3HCMA 4NDCA 4PE7A 1J7PA 1FPWA 1RROA 1QATA 4ORBB 3KEVA 3BYAA 2WCBA 2ZKMX 1YUUA 2LLTA 3EKHA 2NCPA 4L9MA 1QV0A 1KK8C 1XA5A 2ZFDA 1N65A 1S26D 2PVBA 5HLOA 5G08A 1OSAA 4D1EA 1JFJA 1MHOA 4MN0A 4YRUA 1NCYA 2KBIA 2L4HA 3C1VA 2Y4QA 1NIWA 3SG3A 1DJHA 1IG5A 3OP0A 1KFUS 1SBJA 1YRUB 2KAVA 1NX3A 3AKAA 2M8UA 1S6IA 5AXIA 1KFXS 1QLKA 2MA2A 5I8NA 1TNPA 3WHTB 2LANA 2L5XB 5D7FA 1A4PA 4GNKB 2OS8B 4PE0A 1C07A 3M0WA 3PATA 2WCEA 1F4QA 2LE9B 1JBAA 4Q04A 1H8BA 1K95A 1DJZA 1CDMA 1CLLA 3OHMB 5JJGA 2H2KA 1BOCA 1QX7A 1LKJA 1PVAA 1A2XA 3EK4A 5DKNA 4CPVA 1KWOC 3F45A 2G9BA 1ZMZA 3GK1A 3NSOA 3SG7A 4GFTA 2OTGB 2LNKA 2KI4B 1F8HA 2O5GA 5AANA 1QASA 1DGVA 3BUWB 4P5OE 1YR5A 5AFPA 3BUXB 5J3XA 1SL8A 2KOTA 5AEQA 1IRJA 4DS7A 1FI5A 1A29A 1G33A 5KSZA 1K9PA 3PN7C 2E30A 1XFYO 1B7TZ 4M2PA 2K7OA 3BOWA 2LUCA 4AOMA 1B7TY 1WY9A 1XO5A 1F54A 1A75A 1WLMA 3DD4A 1K94A 1QXPA 2FCEA 1K8UA 1NYAA 2L2EA 1W7IB 4MZJA 5HLVA 1ZUZA 1HT9A 4MVFA 4WQ2A 3EVUA 1QIVA 1DGUA 2ZRSA 4JPZB 2JNFA 3VROA 4U8DA 3CGAA 3MSEB 1N0YA 3I5GC 1RJVA 1KWOB 4IL1A 3BQ3A 1PALA 1OOJA 1BU3A 1IGVA 3I5HC 2EC6C 1R6PA 1DMOA 2LM5A 3CWGA 1SL9A 2LMUA 5B8IB 1WRZA 3BOWB 2JULA 2CCMA 2JTTA 5DKQA 1NUBA 1DJWA 1NPQA 1TTXA 3KO0A 1A75B 4OKHA 5I2LA 5CSFA 3FWCA 3PLFB 5CPVA 1L2OC 1WLZA 2M1KB 1WRKA 1CFCA 1JF2A 4I5NB 2JC2A 2M49B 1AUIB 3I5FB 5I2OA 1ALWA 1ZOTB 5FYXA 4GGFC 1KSOA 1SKTA 1XFVO 2LHIA 2I18A 2WNDA 1KFUL 1EXRA 2LVKA 1SCMC 1SCVA 1SMGA 3TZ1A 1MUXA 2MBXA 2JXCA 1SR6B 1K96A 1TIZA 2KI6D 4GGFA 1GGWA 4USLA 1KFXL 1BG1A 4ORCB 1YX7A 2LUXA 1B47A 3D0YA 3I5GB 3A4UB 1BLQA 3DVKA 2LCPA 1LXFC 3I5HB 5AERA 2EC6B 1ALVA 2ZNDA 3TDIA 2JT0A 1TNQA 4YBHB 2JOJA 2EHBA 4JWQA 1RK9A 2I7AA 1TCOB 5DKRA 2ZN9A 3GK2A 1VRKA 3FWBA 4N1FA 3TDZA 1SK6D 3CR4X 2AAOA 1X02A 1NP8A 2JPTA 2Y1MA 4R1EA 3RM1A 1A03A 1L2OB 4BY5A 1QTXA 1YUSA 4HRGA 2Y5IA 1BODA 2BBMA 3D10A 1S6JA 4OV2A 2M7LA 4ETOA 4YI9A 4I5JA 1MQ1A 3NSLA 5HKYA 3NSKA 1OE9B 1R2UA 2MHHA 1TOPA 1NCXA 2JQ6A 2KFFA 2M29A 3JVTC 3D0YB 3IQQA 4MBEA 1SCMB 3WNXB 4QJ5B 4GPLB 2IS9A 1D1OA 1KQVA 1HQVA 4E68A 2M7NA 4FTGA 1F55A 2MLEC 1EL4A 3QRXA 4XYNA 2JT8A 4YGEB 4UPGA 1Q80A 3GK4X 4PHJA 2BCBA 5CSIA 2K7CA 4YI8A 1H4BA 3LLEA 1K9KA 2SCPA 1CB1A 4PHMA 1UURA 4MEWA 3OX5A 1RFJA 2CBLA 1S3PA 2K2AA 4ZCVA 1IJ5A 1KK8B 3JTDC 1YVLA 1M45A 1OZOA 2MJWB 4CFRA 1M39A 4MRYA 1UUSA 5GQQC 1MXEA 2MRDA 3O4YA 1XYDA 3LCPC 1XFXO 2QPTA 1RECA 2H61C 2BCXA 2KAYA 4M2QA 4WRIA 1V1FA 4N5XA 3SG2A 2K8MB 1NX1A 2MAZA 4QJ4B 1CLBA 1N2DA 1SPYA 2GV5A 2M3WA 1AJ4A 2K61A 1UWOA 1LA3A 1J1EA 4YGAA 1KCYA 4ORAB 3JVTB 1PK0D 5KU1A 2BKIB 2ZN8A 1CM4A 1V1GA 1CLMA 2HPSA 2E6WA 4HRHA 1K93D 1DJXA 1SW8A 2L50A 2AUCA 2AMIA 1RWYA 2K2FA 1YX8A 1IJ6A 1DJGA 2ZNEA 4DUQA 1GGZA 2LVJA 2LMTA 4I5LB 3TUYC 3HX4A 4NDDA 2F2PA 1M46A 2KBMA 3BUOB 4PCWA 3SG4A 3K21A 2LLUA 1BF5A 1J1DA 2GGMA 2FJUB 4A4BA 1J7QA 4DIRA 3EVVA 1RTP1 1S36A 2KDHA 1E8AA 1FF1A 2LV7A 1IWQA 1DF0A 4YGDB 2VRGA 3JTDB 4XJKA 2BKHB 2NLNA 1PRWA 1JWDA 1QX5B 1ZFSA 4HREE 1SL7A 3OB1B 3PSRA 2F2OA 2QACA 1CMFA 2LVIA 3LK1A 1DJIA 1OMDA 1PULA 4FQOA 4MRXA 3KF9A 1BT6A 3PN7B 1LINA 1Y1UA 2F8PA 4DRWA 2KI6C 2BE4A 1DTLA 1QIWA 2KYFA 3EKJA 3PALA 2K7DA 1QLSA 3AKBA 2HQWA 3WXAA 2FOTA 5BPJA 2DOQA 3OX6A 1JFKA 1F4OA 3IF7A 2KFHA 3LK0A 1CDLA 2KYCA 5K89A 2O60A 1Y0VH 3ZNIA 1DJYA 2JWWA 2ZRTA 1DF0B 4JQ0D 2L98A 4OVNF 4XJKB 5I2QA 2ISDA 1YURA 2COLB 2JXLA 1GJYA 1GQMA 5KTYA 5PALA 1S5GZ 2HQ8A 2R2IA 2SASA 4YGCB 1Y6WA 4C0LA 2WOSA 2LP3A 2GGZA 4OR9B 3SIAA 1S5GY 1QX2A 2JU0A 1L7ZA 2Y1NA 5ER4X 1K9UA 4DCKA 1FI6A 4F0ZB 1KQMC 4NDBA 1AP4A 3VRQA 3O2PA 1YRTB 2KGRA 2OPOA 3CZTX 4TNCA 2F33A 1BJFA 2OS8C 2M1UA 1XK4C 3O78A 2G2BA 1SRAA 3OB2B 4MLWA 3CR5X 1OQPA 3DF0A 4YGBB 3CS1A 1XK4A 2FCDA 2M0RA 5F6TA 1UHNA 4QJ3B 5JOLA 1YVHA 1F71A 2WC8A 2PMYA 3VRRA 3E3RA 1S1EA 1AHRA 1M63B 1B4CA 2I94A 2OTGC 3FS7A 3GOFA 2KI4C 3LL8B 3SJSA 1ODBA 1B1GA 2K7BA 5TNCA 3AAJA 2PASA 1C7VA 2KHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MWN A;  1QV1 A;  1NWD A;  4PHK A;  4MZK A;  1UP5 A;  1EH2 A;  4N1G A;  2JT3 A;  4PE4 A;  5HKZ A;  3CLN A;  1OMR A;  1FBV A;  1KQM B;  1XFZ O;  1C7W A;  3ICB A;  3CR2 A;  2P6B B;  2M9G A;  5HKW A;  1Y1A A;  4CFQ A;  4I5K A;  1CM1 A;  1BR4 B;  1OZS A;  2KSP A;  1K90 D;  3DF0 B;  4AQJ A;  1W7J B;  1U5I A;  1KK7 Z;  1XVJ A;  2L0P A;  1TNW A;  1BR1 B;  1KK7 Y;  2KAX A;  4ICB A;  2L51 A;  4CID A;  2CTN A;  1AK8 A;  1IQ5 A;  2HET A;  1CDN A;  1CKK A;  3SIB A;  1EG4 A;  2JNX A;  1CTR A;  4A4C A;  2WOR A;  2A4J A;  2F3Z A;  3DVM A;  1JUO A;  2BBN A;  3EVR A;  3NSI A;  2H61 A;  2LAP A;  1QVI Z;  2KGB C;  2WCF A;  1FW4 A;  3A8R A;  1WDC C;  2PAL A;  1QVI Y;  1UHJ A;  1JSA A;  1JC2 A;  1KSM A;  3WHU B;  3I5I C;  1YTZ C;  4GAO A;  1QS7 A;  1TCF A;  5ER5 A;  3DVE A;  1CFP A;  1K2H A;  2D8N A;  1M31 A;  2KNE A;  1DVI A;  2I2R E;  1CMG A;  3BXK A;  4OCI A;  3BUN B;  3VRN A;  1IQ3 A;  1U5I B;  1J55 A;  1CNP A;  1NX2 A;  4HSZ A;  2NXQ A;  2LLS A;  2V53 A;  1Y1X A;  2TN4 A;  1QJT A;  2BL0 C;  1AVS A;  3I5F C;  2JRF A;  3O6B A;  1XFU O;  3TS5 C;  4MZL A;  2Q91 A;  2PSR A;  1AJ5 A;  2EGD A;  2JZI A;  1SNL A;  4PDZ A;  1UHH A;  1LA0 A;  1YUT A;  1IH0 A;  5IBW A;  4CLN A;  3AAK A;  4C0J A;  1CDP A;  1SYM A;  2B1U A;  2LC5 A;  3ZWH A;  4PE1 A;  4NQG A;  3VGO A;  1UHK A;  1NX0 A;  1SR6 C;  3FIA A;  4GGN A;  2CT9 A;  2JTZ A;  3DVJ A;  1TNX A;  2BEC A;  3TDU A;  1WRL A;  1CFF A;  1ZAC A;  1TN4 A;  5CSN A;  4PHN A;  2BCA A;  2NCO A;  2M97 A;  2NZ0 A;  4GUK A;  3SG6 A;  1WDC B;  1EG3 A;  5CSJ A;  3H4S E;  5HYD A;  1MR8 A;  1EJ3 A;  2Q4U A;  4ZCU A;  3I5I B;  3TUY B;  1G8I A;  1UHI A;  1DT7 B;  4M2O A;  4MSP A;  1PVB A;  2HF5 A;  2LHL A;  3KHE A;  2KQ6 A;  3BUM B;  4P2Y B;  3PM8 A;  2KFG A;  1BMO A;  1B9A A;  1SY9 A;  3IQO A;  2CNP A;  3NXA A;  4AQI A;  1PSB A;  2LMV A;  3KPX A;  2LVV A;  1CFD A;  2PRU A;  3VRP A;  1OMV A;  1JF0 A;  3EK7 A;  2BL0 B;  4BY4 A;  1MXL C;  1IKU A;  1TRF A;  2CXJ A;  3TS5 B;  1G4Y R;  2BE6 A;  1B8C A;  3EK8 A;  2KQY A;  1F70 A;  4WQ3 A;  1B8R A;  1B8L A;  5D69 A;  1NCZ A;  3CTN A;  4GBA A;  2MLF C;  1J7O A;  2L4I A;  1S6C A;  3PFV A;  4PAL A;  3SG5 A;  1J7R A;  1PSR A;  4C0K A;  2K0J A;  1NSH A;  1XFW O;  3RLZ A;  2F3Y A;  1MF8 B;  1LVC D;  2LP2 A;  2RGI A;  3HCM A;  4NDC A;  4PE7 A;  1J7P A;  1FPW A;  1RRO A;  1QAT A;  4ORB B;  3KEV A;  3BYA A;  2WCB A;  2ZKM X;  1YUU A;  2LLT A;  3EKH A;  2NCP A;  4L9M A;  1QV0 A;  1KK8 C;  1XA5 A;  2ZFD A;  1N65 A;  1S26 D;  2PVB A;  5HLO A;  5G08 A;  1OSA A;  4D1E A;  1JFJ A;  1MHO A;  4MN0 A;  4YRU A;  1NCY A;  2KBI A;  2L4H A;  3C1V A;  2Y4Q A;  1NIW A;  3SG3 A;  1DJH A;  1IG5 A;  3OP0 A;  1KFU S;  1SBJ A;  1YRU B;  2KAV A;  1NX3 A;  3AKA A;  2M8U A;  1S6I A;  5AXI A;  1KFX S;  1QLK A;  2MA2 A;  5I8N A;  1TNP A;  3WHT B;  2LAN A;  2L5X B;  5D7F A;  1A4P A;  4GNK B;  2OS8 B;  4PE0 A;  1C07 A;  3M0W A;  3PAT A;  2WCE A;  1F4Q A;  2LE9 B;  1JBA A;  4Q04 A;  1H8B A;  1K95 A;  1DJZ A;  1CDM A;  1CLL A;  3OHM B;  5JJG A;  2H2K A;  1BOC A;  1QX7 A;  1LKJ A;  1PVA A;  1A2X A;  3EK4 A;  5DKN A;  4CPV A;  1KWO C;  3F45 A;  2G9B A;  1ZMZ A;  3GK1 A;  3NSO A;  3SG7 A;  4GFT A;  2OTG B;  2LNK A;  2KI4 B;  1F8H A;  2O5G A;  5AAN A;  1QAS A;  1DGV A;  3BUW B;  4P5O E;  1YR5 A;  5AFP A;  3BUX B;  5J3X A;  1SL8 A;  2KOT A;  5AEQ A;  1IRJ A;  4DS7 A;  1FI5 A;  1A29 A;  1G33 A;  5KSZ A;  1K9P A;  3PN7 C;  2E30 A;  1XFY O;  1B7T Z;  4M2P A;  2K7O A;  3BOW A;  2LUC A;  4AOM A;  1B7T Y;  1WY9 A;  1XO5 A;  1F54 A;  1A75 A;  1WLM A;  3DD4 A;  1K94 A;  1QXP A;  2FCE A;  1K8U A;  1NYA A;  2L2E A;  1W7I B;  4MZJ A;  5HLV A;  1ZUZ A;  1HT9 A;  4MVF A;  4WQ2 A;  3EVU A;  1QIV A;  1DGU A;  2ZRS A;  4JPZ B;  2JNF A;  3VRO A;  4U8D A;  3CGA A;  3MSE B;  1N0Y A;  3I5G C;  1RJV A;  1KWO B;  4IL1 A;  3BQ3 A;  1PAL A;  1OOJ A;  1BU3 A;  1IGV A;  3I5H C;  2EC6 C;  1R6P A;  1DMO A;  2LM5 A;  3CWG A;  1SL9 A;  2LMU A;  5B8I B;  1WRZ A;  3BOW B;  2JUL A;  2CCM A;  2JTT A;  5DKQ A;  1NUB A;  1DJW A;  1NPQ A;  1TTX A;  3KO0 A;  1A75 B;  4OKH A;  5I2L A;  5CSF A;  3FWC A;  3PLF B;  5CPV A;  1L2O C;  1WLZ A;  2M1K B;  1WRK A;  1CFC A;  1JF2 A;  4I5N B;  2JC2 A;  2M49 B;  1AUI B;  3I5F B;  5I2O A;  1ALW A;  1ZOT B;  5FYX A;  4GGF C;  1KSO A;  1SKT A;  1XFV O;  2LHI A;  2I18 A;  2WND A;  1KFU L;  1EXR A;  2LVK A;  1SCM C;  1SCV A;  1SMG A;  3TZ1 A;  1MUX A;  2MBX A;  2JXC A;  1SR6 B;  1K96 A;  1TIZ A;  2KI6 D;  4GGF A;  1GGW A;  4USL A;  1KFX L;  1BG1 A;  4ORC B;  1YX7 A;  2LUX A;  1B47 A;  3D0Y A;  3I5G B;  3A4U B;  1BLQ A;  3DVK A;  2LCP A;  1LXF C;  3I5H B;  5AER A;  2EC6 B;  1ALV A;  2ZND A;  3TDI A;  2JT0 A;  1TNQ A;  4YBH B;  2JOJ A;  2EHB A;  4JWQ A;  1RK9 A;  2I7A A;  1TCO B;  5DKR A;  2ZN9 A;  3GK2 A;  1VRK A;  3FWB A;  4N1F A;  3TDZ A;  1SK6 D;  3CR4 X;  2AAO A;  1X02 A;  1NP8 A;  2JPT A;  2Y1M A;  4R1E A;  3RM1 A;  1A03 A;  1L2O B;  4BY5 A;  1QTX A;  1YUS A;  4HRG A;  2Y5I A;  1BOD A;  2BBM A;  3D10 A;  1S6J A;  4OV2 A;  2M7L A;  4ETO A;  4YI9 A;  4I5J A;  1MQ1 A;  3NSL A;  5HKY A;  3NSK A;  1OE9 B;  1R2U A;  2MHH A;  1TOP A;  1NCX A;  2JQ6 A;  2KFF A;  2M29 A;  3JVT C;  3D0Y B;  3IQQ A;  4MBE A;  1SCM B;  3WNX B;  4QJ5 B;  4GPL B;  2IS9 A;  1D1O A;  1KQV A;  1HQV A;  4E68 A;  2M7N A;  4FTG A;  1F55 A;  2MLE C;  1EL4 A;  3QRX A;  4XYN A;  2JT8 A;  4YGE B;  4UPG A;  1Q80 A;  3GK4 X;  4PHJ A;  2BCB A;  5CSI A;  2K7C A;  4YI8 A;  1H4B A;  3LLE A;  1K9K A;  2SCP A;  1CB1 A;  4PHM A;  1UUR A;  4MEW A;  3OX5 A;  1RFJ A;  2CBL A;  1S3P A;  2K2A A;  4ZCV A;  1IJ5 A;  1KK8 B;  3JTD C;  1YVL A;  1M45 A;  1OZO A;  2MJW B;  4CFR A;  1M39 A;  4MRY A;  1UUS A;  5GQQ C;  1MXE A;  2MRD A;  3O4Y A;  1XYD A;  3LCP C;  1XFX O;  2QPT A;  1REC A;  2H61 C;  2BCX A;  2KAY A;  4M2Q A;  4WRI A;  1V1F A;  4N5X A;  3SG2 A;  2K8M B;  1NX1 A;  2MAZ A;  4QJ4 B;  1CLB A;  1N2D A;  1SPY A;  2GV5 A;  2M3W A;  1AJ4 A;  2K61 A;  1UWO A;  1LA3 A;  1J1E A;  4YGA A;  1KCY A;  4ORA B;  3JVT B;  1PK0 D;  5KU1 A;  2BKI B;  2ZN8 A;  1CM4 A;  1V1G A;  1CLM A;  2HPS A;  2E6W A;  4HRH A;  1K93 D;  1DJX A;  1SW8 A;  2L50 A;  2AUC A;  2AMI A;  1RWY A;  2K2F A;  1YX8 A;  1IJ6 A;  1DJG A;  2ZNE A;  4DUQ A;  1GGZ A;  2LVJ A;  2LMT A;  4I5L B;  3TUY C;  3HX4 A;  4NDD A;  2F2P A;  1M46 A;  2KBM A;  3BUO B;  4PCW A;  3SG4 A;  3K21 A;  2LLU A;  1BF5 A;  1J1D A;  2GGM A;  2FJU B;  4A4B A;  1J7Q A;  4DIR A;  3EVV A;  1RTP 1;  1S36 A;  2KDH A;  1E8A A;  1FF1 A;  2LV7 A;  1IWQ A;  1DF0 A;  4YGD B;  2VRG A;  3JTD B;  4XJK A;  2BKH B;  2NLN A;  1PRW A;  1JWD A;  1QX5 B;  1ZFS A;  4HRE E;  1SL7 A;  3OB1 B;  3PSR A;  2F2O A;  2QAC A;  1CMF A;  2LVI A;  3LK1 A;  1DJI A;  1OMD A;  1PUL A;  4FQO A;  4MRX A;  3KF9 A;  1BT6 A;  3PN7 B;  1LIN A;  1Y1U A;  2F8P A;  4DRW A;  2KI6 C;  2BE4 A;  1DTL A;  1QIW A;  2KYF A;  3EKJ A;  3PAL A;  2K7D A;  1QLS A;  3AKB A;  2HQW A;  3WXA A;  2FOT A;  5BPJ A;  2DOQ A;  3OX6 A;  1JFK A;  1F4O A;  3IF7 A;  2KFH A;  3LK0 A;  1CDL A;  2KYC A;  5K89 A;  2O60 A;  1Y0V H;  3ZNI A;  1DJY A;  2JWW A;  2ZRT A;  1DF0 B;  4JQ0 D;  2L98 A;  4OVN F;  4XJK B;  5I2Q A;  2ISD A;  1YUR A;  2COL B;  2JXL A;  1GJY A;  1GQM A;  5KTY A;  5PAL A;  1S5G Z;  2HQ8 A;  2R2I A;  2SAS A;  4YGC B;  1Y6W A;  4C0L A;  2WOS A;  2LP3 A;  2GGZ A;  4OR9 B;  3SIA A;  1S5G Y;  1QX2 A;  2JU0 A;  1L7Z A;  2Y1N A;  5ER4 X;  1K9U A;  4DCK A;  1FI6 A;  4F0Z B;  1KQM C;  4NDB A;  1AP4 A;  3VRQ A;  3O2P A;  1YRT B;  2KGR A;  2OPO A;  3CZT X;  4TNC A;  2F33 A;  1BJF A;  2OS8 C;  2M1U A;  1XK4 C;  3O78 A;  2G2B A;  1SRA A;  3OB2 B;  4MLW A;  3CR5 X;  1OQP A;  3DF0 A;  4YGB B;  3CS1 A;  1XK4 A;  2FCD A;  2M0R A;  5F6T A;  1UHN A;  4QJ3 B;  5JOL A;  1YVH A;  1F71 A;  2WC8 A;  2PMY A;  3VRR A;  3E3R A;  1S1E A;  1AHR A;  1M63 B;  1B4C A;  2I94 A;  2OTG C;  3FS7 A;  3GOF A;  2KI4 C;  3LL8 B;  3SJS A;  1ODB A;  1B1G A;  2K7B A;  5TNC A;  3AAJ A;  2PAS A;  1C7V A;  2KHN A; 
#chains in the Genus database with same CATH topology
 1MWN A;  2WCK A;  1QV1 A;  1NWD A;  4PHK A;  4MZK A;  1UP5 A;  1EH2 A;  4N1G A;  2JT3 A;  4PE4 A;  5HKZ A;  2WC5 A;  3CLN A;  2BNX A;  1OMR A;  1FBV A;  1KQM B;  1XFZ O;  1C7W A;  3ICB A;  3CR2 A;  2P6B B;  2M9G A;  5HKW A;  1DC1 A;  3K1E A;  1Y1A A;  4CFQ A;  1DEL A;  4I5K A;  1CM1 A;  1BR4 B;  1OZS A;  2KSP A;  1K90 D;  3DF0 B;  4AQJ A;  1W7J B;  1U5I A;  1KK7 Z;  1XVJ A;  2ERB A;  2L0P A;  3B86 A;  3CZ0 A;  1TNW A;  1BR1 B;  1KK7 Y;  2KAX A;  4ICB A;  2L51 A;  4CID A;  2CTN A;  1AK8 A;  2WCL A;  1IQ5 A;  2HET A;  1CDN A;  1CKK A;  3SIB A;  1EG4 A;  3N7H A;  2JNX A;  1CTR A;  4A4C A;  2WOR A;  2A4J A;  2F3Z A;  3DVM A;  1JUO A;  2BBN A;  3EVR A;  3FE8 A;  3NSI A;  2H61 A;  2LAP A;  1QVI Z;  4PT1 A;  2KGB C;  1C3Z A;  2WCF A;  1FW4 A;  3A8R A;  4INX A;  1WDC C;  2PAL A;  1QVI Y;  1UHJ A;  1JSA A;  1JC2 A;  1KSM A;  3WHU B;  3I5I C;  1YTZ C;  2KLD A;  4GAO A;  1QS7 A;  1TCF A;  1ORG A;  2P70 A;  3DVE A;  5ER5 A;  1CFP A;  1K2H A;  2D8N A;  1M31 A;  2KNE A;  1DVI A;  2I2R E;  1CMG A;  3BXK A;  4OCI A;  3BUN B;  3VRN A;  1IQ3 A;  1U5I B;  3B88 A;  1J55 A;  1CNP A;  1NX2 A;  4HSZ A;  2NXQ A;  2LLS A;  2V53 A;  1Y1X A;  2TN4 A;  1QJT A;  2BL0 C;  1AVS A;  2GTE A;  2JRF A;  3I5F C;  3O6B A;  3Q8I A;  1XFU O;  3TS5 C;  4MZL A;  2Q91 A;  2PSR A;  1AJ5 A;  2EGD A;  2JZI A;  1SNL A;  4PDZ A;  3S0A A;  1UHH A;  1LA0 A;  1YUT A;  1IH0 A;  5IBW A;  4CLN A;  3AAK A;  4C0J A;  1CDP A;  1SYM A;  2B1U A;  2LC5 A;  2QDI A;  3ZWH A;  2BAP A;  4PE1 A;  4NQG A;  3VGO A;  1UHK A;  1NX0 A;  1SR6 C;  3V2L A;  3B7A A;  3FIA A;  4GGN A;  2CT9 A;  2JTZ A;  1OW4 A;  3DVJ A;  1TNX A;  2BEC A;  3TDU A;  4JKT A;  1WRL A;  1CFF A;  1ZAC A;  1TN4 A;  5CSN A;  4PHN A;  2BCA A;  2NCO A;  2M97 A;  2NZ0 A;  4GUK A;  3BFA A;  3SG6 A;  1WDC B;  1EG3 A;  3O4X A;  3H4S E;  5CSJ A;  5HYD A;  1MR8 A;  3S0G A;  1EJ3 A;  2Q4U A;  4ZCU A;  3I5I B;  3TUY B;  1G8I A;  1UHI A;  1DT7 B;  4M2O A;  4MSP A;  1PVB A;  2HF5 A;  2LHL A;  3KHE A;  2KQ6 A;  3BUM B;  4P2Y B;  3PM8 A;  2KFG A;  5HL1 A;  3RZS A;  1BMO A;  1B9A A;  1SY9 A;  3IQO A;  2CNP A;  3B6X A;  3L4A A;  3NXA A;  4AQI A;  1PSB A;  2KPH A;  2LMV A;  3KPX A;  2LVV A;  1CFD A;  2PRU A;  3VRP A;  1OMV A;  1JF0 A;  3EK7 A;  2BL0 B;  3D73 A;  4BY4 A;  1MXL C;  1IKU A;  1TRF A;  2CXJ A;  2KLE A;  5FI6 A;  3TS5 B;  1G4Y R;  3NHI A;  2WCJ A;  2BE6 A;  1TUZ A;  1B8C A;  3EK8 A;  2KQY A;  1F70 A;  4WQ3 A;  1B8R A;  1B8L A;  5D69 A;  1NCZ A;  3CTN A;  4GBA A;  2JPO A;  2MLF C;  1J7O A;  2L4I A;  1LS8 A;  1S6C A;  3PFV A;  4PAL A;  3SG5 A;  1J7R A;  1PSR A;  3S0E A;  4C0K A;  2K0J A;  1NSH A;  1XFW O;  3RLZ A;  2F3Y A;  5I94 A;  1MF8 B;  1LVC D;  2LP2 A;  2RGI A;  3HCM A;  4NDC A;  3NHT A;  3B87 A;  4PE7 A;  1J7P A;  1FPW A;  3S0F A;  3BFB A;  1RRO A;  1QAT A;  3D77 A;  4ORB B;  3KEV A;  2WC6 A;  3BYA A;  2WCB A;  2ZKM X;  1YUU A;  2LLT A;  3EKH A;  2NCP A;  4L9M A;  3SS3 A;  1QV0 A;  1KK8 C;  1XA5 A;  2ZFD A;  1N65 A;  1TWO A;  1S26 D;  2PVB A;  5HLO A;  5G08 A;  1OSA A;  4D1E A;  1JFJ A;  1MHO A;  4MN0 A;  4YRU A;  1NCY A;  2KBI A;  2L4H A;  3C1V A;  2Y4Q A;  4KYN A;  1NIW A;  3SG3 A;  1DJH A;  1IG5 A;  3OP0 A;  2FJY A;  1KFU S;  1SBJ A;  1YRU B;  3DYE A;  2KAV A;  1NX3 A;  3AKA A;  3OBV A;  2M8U A;  1S6I A;  5AXI A;  1KFX S;  1QLK A;  2MA2 A;  5I8N A;  1TNP A;  2PYQ A;  3WHT B;  3L47 A;  2LAN A;  2L5X B;  5D7F A;  1QWV A;  1A4P A;  4GNK B;  2OS8 B;  4PE0 A;  3CDN A;  1DQE A;  1C07 A;  3M0W A;  3PAT A;  2WCE A;  1F4Q A;  2LE9 B;  1JBA A;  4Q04 A;  1H8B A;  1K95 A;  1DJZ A;  1CDM A;  1CLL A;  3OHM B;  5JJG A;  3BFH A;  2H2K A;  3DXL A;  1BOC A;  1QX7 A;  1LKJ A;  1PVA A;  1A2X A;  1P28 A;  3EK4 A;  5DKN A;  4CPV A;  1KWO C;  3F45 A;  2G9B A;  1ZMZ A;  3GK1 A;  3NSO A;  3SG7 A;  3UO9 A;  4GFT A;  2OTG B;  2LNK A;  2KI4 B;  1F8H A;  2O5G A;  5AAN A;  3SS4 A;  1QAS A;  4JD9 A;  1DGV A;  3BUW B;  4P5O E;  3VB1 A;  1YR5 A;  5AFP A;  3BUX B;  5J3X A;  1SL8 A;  2KOT A;  5AEQ A;  1IRJ A;  4DS7 A;  1FI5 A;  1A29 A;  1G33 A;  5KSZ A;  1K9P A;  3PN7 C;  2E30 A;  1XFY O;  1B7T Z;  4M2P A;  2K7O A;  3BOW A;  2LUC A;  3CZ2 A;  4AOM A;  1B7T Y;  1WY9 A;  1XO5 A;  1F54 A;  1A75 A;  3D74 A;  1WLM A;  3DD4 A;  1K94 A;  2P71 A;  1QXP A;  2FCE A;  1K8U A;  1NYA A;  2L2E A;  1W7I B;  4MZJ A;  5HLV A;  1ZUZ A;  2YGU A;  3R1O A;  5EL2 A;  1HT9 A;  4MVF A;  4WQ2 A;  3EVU A;  1OOF A;  1QIV A;  1DGU A;  2ZRS A;  4JPZ B;  2JNF A;  3VRO A;  4U8D A;  3CGA A;  1IIO A;  3MSE B;  1N0Y A;  3I5G C;  1RJV A;  1KWO B;  4IL1 A;  3BQ3 A;  1PAL A;  1OOJ A;  1BU3 A;  1IGV A;  3I5H C;  2EC6 C;  3S0D A;  1R6P A;  1DMO A;  4IJ7 A;  2LM5 A;  3CWG A;  1SL9 A;  2LMU A;  5B8I B;  1WRZ A;  3BOW B;  2JUL A;  2CCM A;  2JTT A;  5DKQ A;  1NUB A;  1DJW A;  1NPQ A;  1TTX A;  3KO0 A;  1A75 B;  4OKH A;  5I2L A;  3PM2 A;  5CSF A;  3FWC A;  3PLF B;  5CPV A;  1L2O C;  1WLZ A;  2M1K B;  3DZT A;  1WRK A;  1CFC A;  1JF2 A;  4I5N B;  2JC2 A;  2M49 B;  1AUI B;  1TUJ A;  3I5F B;  5I2O A;  1ALW A;  1ZOT B;  5FYX A;  4GGF C;  1KSO A;  1SKT A;  1XFV O;  2LHI A;  2I18 A;  2WND A;  1OOI X;  1KFU L;  1EXR A;  2LVK A;  1SCM C;  1SCV A;  1SMG A;  5DIC A;  3TZ1 A;  1MUX A;  3UNW A;  2MBX A;  2JXC A;  1SR6 B;  1K96 A;  1TIZ A;  2KI6 D;  4GGF A;  1GGW A;  4USL A;  1KFX L;  1BG1 A;  4ORC B;  1YX7 A;  2LUX A;  1B47 A;  3D0Y A;  3I5G B;  3A4U B;  3OGN A;  1BLQ A;  3DVK A;  2LCP A;  1LXF C;  3I5H B;  3D75 A;  5AER A;  2EC6 B;  1ALV A;  2ZND A;  3TDI A;  2JT0 A;  1TNQ A;  2QEV A;  4YBH B;  3CZ1 A;  2JOJ A;  1Z4H A;  2EHB A;  4JWQ A;  1RK9 A;  2I7A A;  1TCO B;  5DKR A;  2ZN9 A;  3GK2 A;  1VRK A;  3FWB A;  4N1F A;  3TDZ A;  1SK6 D;  3CR4 X;  2AAO A;  1X02 A;  1NP8 A;  2JPT A;  2Y1M A;  3BJH A;  3R1V A;  4R1E A;  3RM1 A;  1A03 A;  1L2O B;  4BY5 A;  2H8V A;  1QTX A;  1YUS A;  4HRG A;  2Y5I A;  1BOD A;  2BBM A;  3D10 A;  1S6J A;  2QEH A;  4OV2 A;  2M7L A;  4ETO A;  4YI9 A;  4I5J A;  1MQ1 A;  3NSL A;  5HKY A;  3NSK A;  3R72 A;  1OE9 B;  1R2U A;  2MHH A;  1TOP A;  3QME A;  1NCX A;  2JQ6 A;  2KFF A;  2M29 A;  3JVT C;  4F7F A;  3EG5 B;  3D0Y B;  3IQQ A;  4MBE A;  1SCM B;  3WNX B;  4QJ5 B;  4GPL B;  2IS9 A;  1D1O A;  1KQV A;  1HQV A;  4E68 A;  2M7N A;  4FTG A;  1F55 A;  2MLE C;  1EL4 A;  3QRX A;  4XYN A;  2JT8 A;  4YGE B;  4UPG A;  1Q80 A;  3GK4 X;  4PHJ A;  2BCB A;  5CSI A;  2K7C A;  4YI8 A;  1H4B A;  3LLE A;  1K9K A;  3FE6 A;  2SCP A;  1CB1 A;  4PHM A;  1UUR A;  4MEW A;  3OX5 A;  1RFJ A;  1T14 A;  2CBL A;  1S3P A;  2K2A A;  4ZCV A;  1IJ5 A;  2QEO A;  1KK8 B;  4FQT A;  3SS5 A;  3JTD C;  1YVL A;  1M45 A;  1OZO A;  2MJW B;  3D76 A;  4CFR A;  1M39 A;  4MRY A;  1UUS A;  5GQQ C;  1MXE A;  2MRD A;  3O4Y A;  1XYD A;  1DEK A;  3LCP C;  1XFX O;  2QPT A;  1REC A;  1XFR A;  5FI7 A;  2H61 C;  2BCX A;  2KAY A;  4M2Q A;  4WRI A;  1V1F A;  4N5X A;  3SG2 A;  2K8M B;  1NX1 A;  2MAZ A;  4QJ4 B;  1CLB A;  1N2D A;  1SPY A;  2GV5 A;  2M3W A;  1AJ4 A;  2K61 A;  1UWO A;  1LA3 A;  1J1E A;  4YGA A;  1KCY A;  4ORA B;  3JVT B;  1PK0 D;  5KU1 A;  2BKI B;  2ZN8 A;  1CM4 A;  1V1G A;  3R1P A;  1CLM A;  2HPS A;  2E6W A;  4HRH A;  1K93 D;  1DJX A;  1SW8 A;  2L50 A;  2AUC A;  2AMI A;  1RWY A;  2K2F A;  1YX8 A;  1IJ6 A;  1DJG A;  2ZNE A;  4DUQ A;  1GGZ A;  2LVJ A;  2LMT A;  4I5L B;  3TUY C;  3HX4 A;  4NDD A;  2F2P A;  1M46 A;  2KBM A;  3BUO B;  4PCW A;  3SG4 A;  5FI2 A;  3K21 A;  2LLU A;  1BF5 A;  1J1D A;  2GGM A;  2FJU B;  3CAB A;  1OOG A;  4A4B A;  1J7Q A;  4DIR A;  3EVV A;  1RTP 1;  1S36 A;  2KDH A;  1E8A A;  1FF1 A;  2LV7 A;  1IWQ A;  1DF0 A;  4YGD B;  2VRG A;  3JTD B;  4XJK A;  2BKH B;  2NLN A;  1PRW A;  1JWD A;  1QX5 B;  1ZFS A;  4HRE E;  1SL7 A;  3OB1 B;  3PSR A;  2F2O A;  2QAC A;  1CMF A;  2WCH A;  2LVI A;  3LK1 A;  1DJI A;  1OMD A;  1PUL A;  4FQO A;  4MRX A;  3KF9 A;  1BT6 A;  5K89 A;  3PN7 B;  3NGV A;  1LIN A;  1Y1U A;  2F8P A;  2L2C A;  4DRW A;  2KI6 C;  2BE4 A;  3IVT A;  1DTL A;  1QIW A;  2KYF A;  3EKJ A;  3PAL A;  2K7D A;  1QLS A;  2PQL A;  3CYZ A;  3AKB A;  4OZD A;  2HQW A;  3WXA A;  2FOT A;  5BPJ A;  3L4L A;  2DOQ A;  3OX6 A;  1JFK A;  1F4O A;  1Z2C B;  2KFH A;  3D78 A;  1CDL A;  2KYC A;  3IF7 A;  2O60 A;  1Y0V H;  3LK0 A;  5D3O A;  1DJY A;  2JWW A;  3ZNI A;  2ZRT A;  2QEB A;  1DF0 B;  4JQ0 D;  2L98 A;  4OVN F;  4XJK B;  5I2Q A;  2ISD A;  1YUR A;  2COL B;  2JXL A;  2WCM A;  1GJY A;  1GQM A;  5KTY A;  5PAL A;  1S5G Z;  2HQ8 A;  1OOH A;  2R2I A;  2SAS A;  4YGC B;  1Y6W A;  4C0L A;  2WOS A;  2LP3 A;  2GGZ A;  4OR9 B;  3SIA A;  1S5G Y;  1QX2 A;  2JU0 A;  1L7Z A;  2Y1N A;  5ER4 X;  1K9U A;  4DCK A;  1FI6 A;  4F0Z B;  1KQM C;  4NDB A;  1AP4 A;  3VRQ A;  3O2P A;  1YRT B;  2KGR A;  2L5Y A;  2OPO A;  1SSE B;  3CZT X;  4TNC A;  2F33 A;  4INW A;  1C3Y A;  3FE9 A;  1BJF A;  2OS8 C;  3S0B A;  2M1U A;  1XK4 C;  3O78 A;  2G2B A;  1SRA A;  3OB2 B;  4MLW A;  3CR5 X;  1OQP A;  3DF0 A;  4YGB B;  3DY9 A;  3CS1 A;  1XK4 A;  2FCD A;  2M0R A;  5F6T A;  1UHN A;  4QJ3 B;  5JOL A;  1YVH A;  1F71 A;  2WC8 A;  2PMY A;  1GM0 A;  3VRR A;  3E3R A;  1S1E A;  1AHR A;  1M63 B;  1B4C A;  2I94 A;  2OTG C;  3FS7 A;  3GOF A;  2KI4 C;  3LL8 B;  3PJI A;  2K60 A;  3SJS A;  1ODB A;  1B1G A;  2K7B A;  5TNC A;  3AAJ A;  2PAS A;  1C7V A;  2KHN A;  1W9Z A; 
#chains in the Genus database with same CATH homology
 1MWN A;  1QV1 A;  1NWD A;  4PHK A;  4MZK A;  1UP5 A;  1EH2 A;  4N1G A;  2JT3 A;  4PE4 A;  5HKZ A;  3CLN A;  1OMR A;  1FBV A;  1KQM B;  1XFZ O;  1C7W A;  3ICB A;  3CR2 A;  2P6B B;  2M9G A;  5HKW A;  1Y1A A;  4CFQ A;  4I5K A;  1CM1 A;  1BR4 B;  1OZS A;  2KSP A;  1K90 D;  3DF0 B;  4AQJ A;  1W7J B;  1U5I A;  1KK7 Z;  1XVJ A;  2L0P A;  1TNW A;  1BR1 B;  1KK7 Y;  2KAX A;  4ICB A;  2L51 A;  4CID A;  2CTN A;  1AK8 A;  1IQ5 A;  2HET A;  1CDN A;  1CKK A;  3SIB A;  1EG4 A;  2JNX A;  1CTR A;  4A4C A;  2WOR A;  2A4J A;  2F3Z A;  3DVM A;  1JUO A;  2BBN A;  3EVR A;  3NSI A;  2H61 A;  2LAP A;  1QVI Z;  2KGB C;  2WCF A;  1FW4 A;  3A8R A;  1WDC C;  2PAL A;  1QVI Y;  1UHJ A;  1JSA A;  1JC2 A;  1KSM A;  3WHU B;  3I5I C;  1YTZ C;  4GAO A;  1QS7 A;  1TCF A;  5ER5 A;  3DVE A;  1CFP A;  1K2H A;  2D8N A;  1M31 A;  2KNE A;  1DVI A;  2I2R E;  1CMG A;  3BXK A;  4OCI A;  3BUN B;  3VRN A;  1IQ3 A;  1U5I B;  1J55 A;  1CNP A;  1NX2 A;  4HSZ A;  2NXQ A;  2LLS A;  2V53 A;  1Y1X A;  2TN4 A;  1QJT A;  2BL0 C;  1AVS A;  3I5F C;  2JRF A;  3O6B A;  1XFU O;  3TS5 C;  4MZL A;  2Q91 A;  2PSR A;  1AJ5 A;  2EGD A;  2JZI A;  1SNL A;  4PDZ A;  1UHH A;  1LA0 A;  1YUT A;  1IH0 A;  5IBW A;  4CLN A;  3AAK A;  4C0J A;  1CDP A;  1SYM A;  2B1U A;  2LC5 A;  3ZWH A;  4PE1 A;  4NQG A;  3VGO A;  1UHK A;  1NX0 A;  1SR6 C;  3FIA A;  4GGN A;  2CT9 A;  2JTZ A;  3DVJ A;  1TNX A;  2BEC A;  3TDU A;  1WRL A;  1CFF A;  1ZAC A;  1TN4 A;  5CSN A;  4PHN A;  2BCA A;  2NCO A;  2M97 A;  2NZ0 A;  4GUK A;  3SG6 A;  1WDC B;  1EG3 A;  5CSJ A;  3H4S E;  5HYD A;  1MR8 A;  1EJ3 A;  2Q4U A;  4ZCU A;  3I5I B;  3TUY B;  1G8I A;  1UHI A;  1DT7 B;  4M2O A;  4MSP A;  1PVB A;  2HF5 A;  2LHL A;  3KHE A;  2KQ6 A;  3BUM B;  4P2Y B;  3PM8 A;  2KFG A;  1BMO A;  1B9A A;  1SY9 A;  3IQO A;  2CNP A;  3NXA A;  4AQI A;  1PSB A;  2LMV A;  3KPX A;  2LVV A;  1CFD A;  2PRU A;  3VRP A;  1OMV A;  1JF0 A;  3EK7 A;  2BL0 B;  4BY4 A;  1MXL C;  1IKU A;  1TRF A;  2CXJ A;  3TS5 B;  1G4Y R;  2BE6 A;  1B8C A;  3EK8 A;  2KQY A;  1F70 A;  4WQ3 A;  1B8R A;  1B8L A;  5D69 A;  1NCZ A;  3CTN A;  4GBA A;  2MLF C;  1J7O A;  2L4I A;  1S6C A;  3PFV A;  4PAL A;  3SG5 A;  1J7R A;  1PSR A;  4C0K A;  2K0J A;  1NSH A;  1XFW O;  3RLZ A;  2F3Y A;  1MF8 B;  1LVC D;  2LP2 A;  2RGI A;  3HCM A;  4NDC A;  4PE7 A;  1J7P A;  1FPW A;  1RRO A;  1QAT A;  4ORB B;  3KEV A;  3BYA A;  2WCB A;  2ZKM X;  1YUU A;  2LLT A;  3EKH A;  2NCP A;  4L9M A;  1QV0 A;  1KK8 C;  1XA5 A;  2ZFD A;  1N65 A;  1S26 D;  2PVB A;  5HLO A;  5G08 A;  1OSA A;  4D1E A;  1JFJ A;  1MHO A;  4MN0 A;  4YRU A;  1NCY A;  2KBI A;  2L4H A;  3C1V A;  2Y4Q A;  1NIW A;  3SG3 A;  1DJH A;  1IG5 A;  3OP0 A;  1KFU S;  1SBJ A;  1YRU B;  2KAV A;  1NX3 A;  3AKA A;  2M8U A;  1S6I A;  5AXI A;  1KFX S;  1QLK A;  2MA2 A;  5I8N A;  1TNP A;  3WHT B;  2LAN A;  2L5X B;  5D7F A;  1A4P A;  4GNK B;  2OS8 B;  4PE0 A;  1C07 A;  3M0W A;  3PAT A;  2WCE A;  1F4Q A;  2LE9 B;  1JBA A;  4Q04 A;  1H8B A;  1K95 A;  1DJZ A;  1CDM A;  1CLL A;  3OHM B;  5JJG A;  2H2K A;  1BOC A;  1QX7 A;  1LKJ A;  1PVA A;  1A2X A;  3EK4 A;  5DKN A;  4CPV A;  1KWO C;  3F45 A;  2G9B A;  1ZMZ A;  3GK1 A;  3NSO A;  3SG7 A;  4GFT A;  2OTG B;  2LNK A;  2KI4 B;  1F8H A;  2O5G A;  5AAN A;  1QAS A;  1DGV A;  3BUW B;  4P5O E;  1YR5 A;  5AFP A;  3BUX B;  5J3X A;  1SL8 A;  2KOT A;  5AEQ A;  1IRJ A;  4DS7 A;  1FI5 A;  1A29 A;  1G33 A;  5KSZ A;  1K9P A;  3PN7 C;  2E30 A;  1XFY O;  1B7T Z;  4M2P A;  2K7O A;  3BOW A;  2LUC A;  4AOM A;  1B7T Y;  1WY9 A;  1XO5 A;  1F54 A;  1A75 A;  1WLM A;  3DD4 A;  1K94 A;  1QXP A;  2FCE A;  1K8U A;  1NYA A;  2L2E A;  1W7I B;  4MZJ A;  5HLV A;  1ZUZ A;  1HT9 A;  4MVF A;  4WQ2 A;  3EVU A;  1QIV A;  1DGU A;  2ZRS A;  4JPZ B;  2JNF A;  3VRO A;  4U8D A;  3CGA A;  3MSE B;  1N0Y A;  3I5G C;  1RJV A;  1KWO B;  4IL1 A;  3BQ3 A;  1PAL A;  1OOJ A;  1BU3 A;  1IGV A;  3I5H C;  2EC6 C;  1R6P A;  1DMO A;  2LM5 A;  3CWG A;  1SL9 A;  2LMU A;  5B8I B;  1WRZ A;  3BOW B;  2JUL A;  2CCM A;  2JTT A;  5DKQ A;  1NUB A;  1DJW A;  1NPQ A;  1TTX A;  3KO0 A;  1A75 B;  4OKH A;  5I2L A;  5CSF A;  3FWC A;  3PLF B;  5CPV A;  1L2O C;  1WLZ A;  2M1K B;  1WRK A;  1CFC A;  1JF2 A;  4I5N B;  2JC2 A;  2M49 B;  1AUI B;  3I5F B;  5I2O A;  1ALW A;  1ZOT B;  5FYX A;  4GGF C;  1KSO A;  1SKT A;  1XFV O;  2LHI A;  2I18 A;  2WND A;  1KFU L;  1EXR A;  2LVK A;  1SCM C;  1SCV A;  1SMG A;  3TZ1 A;  1MUX A;  2MBX A;  2JXC A;  1SR6 B;  1K96 A;  1TIZ A;  2KI6 D;  4GGF A;  1GGW A;  4USL A;  1KFX L;  1BG1 A;  4ORC B;  1YX7 A;  2LUX A;  1B47 A;  3D0Y A;  3I5G B;  3A4U B;  1BLQ A;  3DVK A;  2LCP A;  1LXF C;  3I5H B;  5AER A;  2EC6 B;  1ALV A;  2ZND A;  3TDI A;  2JT0 A;  1TNQ A;  4YBH B;  2JOJ A;  2EHB A;  4JWQ A;  1RK9 A;  2I7A A;  1TCO B;  5DKR A;  2ZN9 A;  3GK2 A;  1VRK A;  3FWB A;  4N1F A;  3TDZ A;  1SK6 D;  3CR4 X;  2AAO A;  1X02 A;  1NP8 A;  2JPT A;  2Y1M A;  4R1E A;  3RM1 A;  1A03 A;  1L2O B;  4BY5 A;  1QTX A;  1YUS A;  4HRG A;  2Y5I A;  1BOD A;  2BBM A;  3D10 A;  1S6J A;  4OV2 A;  2M7L A;  4ETO A;  4YI9 A;  4I5J A;  1MQ1 A;  3NSL A;  5HKY A;  3NSK A;  1OE9 B;  1R2U A;  2MHH A;  1TOP A;  1NCX A;  2JQ6 A;  2KFF A;  2M29 A;  3JVT C;  3D0Y B;  3IQQ A;  4MBE A;  1SCM B;  3WNX B;  4QJ5 B;  4GPL B;  2IS9 A;  1D1O A;  1KQV A;  1HQV A;  4E68 A;  2M7N A;  4FTG A;  1F55 A;  2MLE C;  1EL4 A;  3QRX A;  4XYN A;  2JT8 A;  4YGE B;  4UPG A;  1Q80 A;  3GK4 X;  4PHJ A;  2BCB A;  5CSI A;  2K7C A;  4YI8 A;  1H4B A;  3LLE A;  1K9K A;  2SCP A;  1CB1 A;  4PHM A;  1UUR A;  4MEW A;  3OX5 A;  1RFJ A;  2CBL A;  1S3P A;  2K2A A;  4ZCV A;  1IJ5 A;  1KK8 B;  3JTD C;  1YVL A;  1M45 A;  1OZO A;  2MJW B;  4CFR A;  1M39 A;  4MRY A;  1UUS A;  5GQQ C;  1MXE A;  2MRD A;  3O4Y A;  1XYD A;  3LCP C;  1XFX O;  2QPT A;  1REC A;  2H61 C;  2BCX A;  2KAY A;  4M2Q A;  4WRI A;  1V1F A;  4N5X A;  3SG2 A;  2K8M B;  1NX1 A;  2MAZ A;  4QJ4 B;  1CLB A;  1N2D A;  1SPY A;  2GV5 A;  2M3W A;  1AJ4 A;  2K61 A;  1UWO A;  1LA3 A;  1J1E A;  4YGA A;  1KCY A;  4ORA B;  3JVT B;  1PK0 D;  5KU1 A;  2BKI B;  2ZN8 A;  1CM4 A;  1V1G A;  1CLM A;  2HPS A;  2E6W A;  4HRH A;  1K93 D;  1DJX A;  1SW8 A;  2L50 A;  2AUC A;  2AMI A;  1RWY A;  2K2F A;  1YX8 A;  1IJ6 A;  1DJG A;  2ZNE A;  4DUQ A;  1GGZ A;  2LVJ A;  2LMT A;  4I5L B;  3TUY C;  3HX4 A;  4NDD A;  2F2P A;  1M46 A;  2KBM A;  3BUO B;  4PCW A;  3SG4 A;  3K21 A;  2LLU A;  1BF5 A;  1J1D A;  2GGM A;  2FJU B;  4A4B A;  1J7Q A;  4DIR A;  3EVV A;  1RTP 1;  1S36 A;  2KDH A;  1E8A A;  1FF1 A;  2LV7 A;  1IWQ A;  1DF0 A;  4YGD B;  2VRG A;  3JTD B;  4XJK A;  2BKH B;  2NLN A;  1PRW A;  1JWD A;  1QX5 B;  1ZFS A;  4HRE E;  1SL7 A;  3OB1 B;  3PSR A;  2F2O A;  2QAC A;  1CMF A;  2LVI A;  3LK1 A;  1DJI A;  1OMD A;  1PUL A;  4FQO A;  4MRX A;  3KF9 A;  1BT6 A;  3PN7 B;  1LIN A;  1Y1U A;  2F8P A;  4DRW A;  2KI6 C;  2BE4 A;  1DTL A;  1QIW A;  2KYF A;  3EKJ A;  3PAL A;  2K7D A;  1QLS A;  3AKB A;  2HQW A;  3WXA A;  2FOT A;  5BPJ A;  2DOQ A;  3OX6 A;  1JFK A;  1F4O A;  3IF7 A;  2KFH A;  3LK0 A;  1CDL A;  2KYC A;  5K89 A;  2O60 A;  1Y0V H;  3ZNI A;  1DJY A;  2JWW A;  2ZRT A;  1DF0 B;  4JQ0 D;  2L98 A;  4OVN F;  4XJK B;  5I2Q A;  2ISD A;  1YUR A;  2COL B;  2JXL A;  1GJY A;  1GQM A;  5KTY A;  5PAL A;  1S5G Z;  2HQ8 A;  2R2I A;  2SAS A;  4YGC B;  1Y6W A;  4C0L A;  2WOS A;  2LP3 A;  2GGZ A;  4OR9 B;  3SIA A;  1S5G Y;  1QX2 A;  2JU0 A;  1L7Z A;  2Y1N A;  5ER4 X;  1K9U A;  4DCK A;  1FI6 A;  4F0Z B;  1KQM C;  4NDB A;  1AP4 A;  3VRQ A;  3O2P A;  1YRT B;  2KGR A;  2OPO A;  3CZT X;  4TNC A;  2F33 A;  1BJF A;  2OS8 C;  2M1U A;  1XK4 C;  3O78 A;  2G2B A;  1SRA A;  3OB2 B;  4MLW A;  3CR5 X;  1OQP A;  3DF0 A;  4YGB B;  3CS1 A;  1XK4 A;  2FCD A;  2M0R A;  5F6T A;  1UHN A;  4QJ3 B;  5JOL A;  1YVH A;  1F71 A;  2WC8 A;  2PMY A;  3VRR A;  3E3R A;  1S1E A;  1AHR A;  1M63 B;  1B4C A;  2I94 A;  2OTG C;  3FS7 A;  3GOF A;  2KI4 C;  3LL8 B;  3SJS A;  1ODB A;  1B1G A;  2K7B A;  5TNC A;  3AAJ A;  2PAS A;  1C7V A;  2KHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...