1XYDA

Nmr solution structure of rat zinc-calcium-s100b, 20 structures
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
92
structure length
92
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords S-100 protein, beta chain
publication title Solution Structure of Zinc- and Calcium-Bound Rat S100B as Determined by Nuclear Magnetic Resonance Spectroscopy
pubmed doi rcsb
source organism Rattus norvegicus
total genus 26
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xydA00
1NP8A 3E3RA 3PN7B 1TN4A 2I18A 1AK8A 2H61A 3AKBA 2R2IA 2KYFA 1WLZA 4GBAA 4A4BA 1UHJA 1ZUZA 2LLSA 2EC6B 1KFUS 2KNEA 2HF5A 2LHIA 1XK4C 3PATA 3PN7C 1TTXA 2JULA 1EJ3A 1L7ZA 1BLQA 1NX0A 2NXQA 5CSIA 2BBNA 1K93D 2BE4A 2H61C 3WHUB 2BECA 2V53A 1F54A 2JT8A 1M63B 4CPVA 2EC6C 1LVCD 2KFFA 1TNWA 1F8HA 1Y0VH 2LMVA 4E68A 1A2XA 1B47A 3HCMA 2WCFA 3BUXB 4DCKA 1CLBA 4P2YB 1IJ6A 1F70A 4HREE 4YGEB 5AXIA 2KFHA 2A4JA 4HSZA 3LCPC 1SNLA 3JTDC 3A4UB 2WORA 2BKHB 1QLKA 2ZKMX 1IH0A 3EK7A 1U5IA 2LVIA 1FW4A 1IQ5A 3M0WA 1UURA 3PM8A 1D1OA 1TRFA 5I2LA 1U5IB 3O6BA 1KCYA 1SCMB 4MZKA 3BUOB 2Y1MA 4HRHA 4C0KA 1J1DA 1IWQA 1PSBA 1EL4A 4FTGA 4UPGA 1BG1A 4L9MA 2M8UA 4R1EA 2KI4B 3I5HB 3SJSA 5HKZA 1QX5B 4C0LA 2HPSA 2I94A 3ICBA 1QIVA 1SCMC 1IGVA 4PCWA 2L4IA 4U8DA 1M31A 3CS1A 3IQQA 4USLA 5J3XA 3TDUA 1OMVA 1C7VA 1QXPA 2M49B 1FI6A 2JTZA 2KQ6A 2KI4C 3I5HC 5DKNA 1WRZA 3TDIA 3VROA 2IS9A 4PE7A 4PHJA 1QLSA 1UHKA 2OPOA 2MRDA 1K9KA 3O2PA 2BE6A 1YUUA 3SG2A 2M1KB 1NCXA 2M0RA 1BMOA 4WQ2A 1Y1AA 2OTGB 1GJYA 4OVNF 3TS5B 2E6WA 1B8CA 5HKYA 1W7IB 2AMIA 4GUKA 1FBVA 4N1GA 4PE0A 1IKUA 3CR2A 1XVJA 3VRRA 2PVBA 1B9AA 2JTTA 3OP0A 4F0ZB 1ODBA 4MZLA 3IF7A 1XYDA 1H4BA 3TS5C 3NSLA 3KPXA 2L4HA 1N0YA 2NLNA 4ZCUA 2KSPA 1XA5A 1A29A 1B8LA 4MSPA 1E8AA 3AAKA 3BXKA 3BUWB 5KU1A 4BY5A 2KBIA 5I8NA 2K61A 1KFXS 1K9PA 5I2OA 1K94A 1MQ1A 1KSMA 2LE9B 1RWYA 2MJWB 4PDZA 1LXFC 1BOCA 4TNCA 2KAVA 2M9GA 1QJTA 1AJ5A 3LLEA 3OHMB 3TDZA 4GGFA 1S36A 1S6CA 1UP5A 1DJGA 2WCBA 1SL9A 1KSOA 2K0JA 3KEVA 5GQQC 4P5OE 1G8IA 4ZCVA 1K90D 4DS7A 1OOJA 2F3YA 1SCVA 1TNQA 1NUBA 1BF5A 5IBWA 5ER4X 2BKIB 5KTYA 4CLNA 2TN4A 4NDCA 4GGFC 3BOWA 2FJUB 1TOPA 1J7RA 3FWBA 4ICBA 3LK1A 3BOWB 1S6JA 1RROA 1UHHA 1XO5A 5CSFA 4BY4A 1F4QA 1QIWA 1ZMZA 1JC2A 1QX7A 1C7WA 2WNDA 3CGAA 5AANA 3WNXB 4DRWA 2JU0A 2LVVA 4YGDB 1TNXA 1BODA 2GGMA 2OS8B 2K8MB 1YUSA 1K95A 2LP3A 1WRKA 2K7BA 2NZ0A 1CNPA 2F8PA 4WQ3A 3DD4A 4I5LB 1CDMA 1KQMB 4NDBA 1IG5A 2LM5A 4NDDA 5KSZA 2JXCA 2M1UA 1NPQA 1S5GZ 2OS8C 2VRGA 5B8IB 1C07A 1JBAA 1IRJA 2ZNEA 3JTDB 5HKWA 2JZIA 2M7NA 3I5IB 3O78A 1DT7B 4IL1A 4M2OA 1S3PA 1LINA 1KQMC 1DJXA 2LUCA 4PALA 1KK7Z 4YGCB 3KO0A 3CR4X 3TZ1A 5FYXA 1SW8A 1YUTA 1ZFSA 1UUSA 4XJKA 3I5IC 1V1GA 3OX6A 2ZN9A 2PRUA 2LHLA 2DOQA 1JUOA 2AAOA 4XJKB 2LVKA 2Y5IA 3K21A 2JT0A 1SL8A 2BCBA 1Q80A 1EH2A 1FF1A 1NSHA 1JWDA 3CLNA 4D1EA 4JPZB 2JNFA 5AEQA 3D0YA 4GAOA 4GFTA 3D10A 1KFUL 1NX1A 1R6PA 2MAZA 1XFXO 1YX8A 4GPLB 5BPJA 1NX3A 1QVIZ 3CZTX 2NCOA 3D0YB 3I5FB 2L98A 3O4YA 4JWQA 1OMDA 1L2OC 1KQVA 1NCZA 1VRKA 4ORCB 1QS7A 1CFDA 3SG7A 4N1FA 4PE1A 3EK8A 3QRXA 1NIWA 1YX7A 3I5FC 1SYMA 1WY9A 3PFVA 4DUQA 1XFVO 3I5GC 2KI6C 3H4SE 2PSRA 3VRQA 2MA2A 1LA3A 2JRFA 4PE4A 1JFJA 1TCFA 2ZN8A 2HQ8A 3DF0A 1A03A 3PSRA 2F33A 1ZACA 4PHNA 2KGRA 2QACA 3LK0A 1BJFA 1CLLA 1TNPA 3DF0B 1DJYA 1UWOA 1MXLC 1KK8B 2F2OA 2FCEA 2JXLA 1DF0A 2ZRTA 2HQWA 1M39A 4OR9B 1GGWA 2E30A 3KF9A 4HRGA 2O5GA 1DF0B 1NX2A 4OV2A 2LMUA 1CFCA 2K7OA 2G9BA 4M2PA 1KK8C 2D8NA 2LCPA 4YI8A 1CM4A 5ER5A 1M46A 1DGVA 1OQPA 3TUYC 2M7LA 1PULA 1RK9A 1A75A 1HQVA 2ISDA 3EVRA 3SG4A 5CPVA 3JVTB 1A75B 4AQIA 2M3WA 1CFFA 2KAYA 5PALA 2HETA 4AQJA 2MLFC 2JNXA 3NSOA 1HT9A 1MXEA 1N2DA 1YVHA 1B7TY 2L0PA 3KHEA 1QV0A 4NQGA 1G33A 2L2EA 5F6TA 2PALA 4ORAB 1RFJA 3JVTC 5CSNA 1SPYA 3DVJA 2BL0B 3CTNA 2Q91A 5AFPA 2ZNDA 4QJ5B 3FIAA 3VGOA 2K2FA 5G08A 2B1UA 1YRUB 1F71A 1H8BA 1J7QA 3DVMA 1BR1B 2NCPA 2Y4QA 1XFUO 3GOFA 2BL0C 2BCXA 3IQOA 2JT3A 1IJ5A 1CDLA 2LAPA 1QASA 2CXJA 2I2RE 1NYAA 2LV7A 1N65A 2K7DA 5JOLA 2KBMA 2M97A 4YBHB 1DGUA 1A4PA 3EK4A 5DKQA 3GK4X 1BT6A 1PK0D 2CTNA 2BCAA 1YURA 3AAJA 3F45A 2BBMA 5HLVA 3BQ3A 5HYDA 1TCOB 1DJWA 4PHMA 1CB1A 2K2AA 3OB1B 1K8UA 4C0JA 1KK7Y 1SR6C 1PVBA 4YGBB 1CDPA 2AUCA 1J7OA 1GQMA 1MF8B 1W7JB 2JQ6A 4CIDA 1NWDA 3MSEB 2WC8A 5K89A 1UHIA 3NSIA 1K96A 3FS7A 4ETOA 2F3ZA 2G2BA 2LUXA 3ZWHA 3GK1A 1B4CA 1DJZA 2EGDA 1EG3A 2LVJA 3GK2A 1PVAA 3DVKA 2KFGA 1IQ3A 1ALWA 1MHOA 1J1EA 1SY9A 1FI5A 1J55A 3BUNB 4MBEA 1PSRA 2KYCA 2JOJA 1QVIY 1L2OB 1WRLA 1YR5A 3SIBA 1WLMA 4MEWA 1JFKA 3SG5A 4QJ3B 3VRNA 1LKJA 1AP4A 3BYAA 4YRUA 1AHRA 5HLOA 2L50A 2CBLA 2P6BB 3NXAA 4MN0A 4OKHA 2Y1NA 3I5GB 4Q04A 2LC5A 5DKRA 1Y1UA 1S1EA 2LMTA 3DVEA 1B1GA 1QATA 4I5JA 1GGZA 2COLB 5JJGA 1AUIB 4DIRA 2QPTA 2MHHA 2M29A 4OCIA 1DTLA 2EHBA 1CLMA 2LLTA 1UHNA 5I2QA 1S6IA 1YTZC 2JWWA 3AKAA 3NSKA 4XYNA 1CFPA 3SG6A 2CCMA 3CWGA 4MVFA 1QTXA 4MLWA 3FWCA 1CMFA 1OE9B 1MWNA 1NCYA 2ZFDA 2FCDA 1F4OA 2CT9A 3EKJA 1G4YR 3TUYB 1F55A 1XFZO 2F2PA 1M45A 2LP2A 1XFYO 2GV5A 1DJHA 1MUXA 5D7FA 1JF2A 4GNKB 2LNKA 4YI9A 1OSAA 1EG4A 1KWOB 3EVUA 1R2UA 1DJIA 1PALA 2PMYA 1LA0A 1CDNA 3SG3A 1OZOA 1J7PA 1SBJA 4I5KA 2I7AA 1QV1A 3BUMB 3ZNIA 2KHNA 2WCEA 3PLFB 3RM1A 1KWOC 3EKHA 4FQOA 1PRWA 1X02A 2SASA 2WOSA 3WHTB 1DVIA 4ORBB 1EXRA 2GGZA 2ZRSA 2OTGC 3EVVA 1MR8A 1CMGA 1RTP1 2JPTA 4QJ4B 1AJ4A 1JSAA 1S26D 1SL7A 2CNPA 1XFWO 2JC2A 2KI6D 3VRPA 1Y6WA 4YGAA 1WDCB 1CM1A 1K2HA 1OZSA 1JF0A 2KDHA 1B8RA 3A8RA 5D69A 2K7CA 5TNCA 2MBXA 2KGBC 1CTRA 1BU3A 1RJVA 1V1FA 4GGNA 1BR4B 4MRYA 5CSJA 3WXAA 1SKTA 2SCPA 1CKKA 1WDCC 1SRAA 4M2QA 4CFRA 1QX2A 4CFQA 5AERA 1RECA 2RGIA 4JQ0D 1AVSA 1YVLA 4I5NB 4WRIA 2PASA 2H2KA 2FOTA 3RLZA 2MLEC 1FPWA 1B7TZ 1KFXL 2LANA 3LL8B 1ZOTB 1SK6D 1OMRA 1SR6B 2KOTA 1Y1XA 4MZJA 4AOMA 2LLUA 2KAXA 4N5XA 3OB2B 2O60A 1S5GY 1DMOA 3HX4A 4A4CA 1YRTB 3OX5A 1K9UA 3SIAA 3CR5X 1SMGA 4MRXA 2KQYA 1XK4A 1TIZA 2L5XB 2Q4UA 3C1VA 3PALA 1ALVA 2L51A 4PHKA
chains in the Genus database with same CATH superfamily
1NP8A 3E3RA 3PN7B 1TN4A 2I18A 1AK8A 2H61A 3AKBA 2R2IA 2KYFA 1WLZA 4GBAA 4A4BA 2KLDA 2QEVA 1UHJA 1ZUZA 2LLSA 3D76A 2EC6B 1KFUS 2KNEA 2HF5A 2LHIA 1XK4C 3PATA 3PN7C 1TTXA 2JULA 1EJ3A 1L7ZA 2BAPA 1BLQA 1NX0A 2NXQA 5CSIA 3NGVA 2BBNA 1K93D 2BE4A 2H61C 3WHUB 2BECA 2V53A 1F54A 2WCLA 2JT8A 1M63B 4CPVA 2EC6C 1LVCD 2KFFA 1TNWA 1F8HA 1Y0VH 2QDIA 1DEKA 2LMVA 4E68A 1A2XA 1B47A 3HCMA 2WCFA 3BUXB 4DCKA 1OOIX 1CLBA 2P70A 4P2YB 1IJ6A 1F70A 3S0GA 4HREE 4YGEB 5AXIA 2KFHA 3CDNA 2A4JA 4HSZA 3LCPC 1SNLA 3JTDC 1OOGA 3A4UB 2WORA 2BKHB 3BJHA 1QLKA 2ZKMX 1IH0A 3EK7A 1U5IA 2LVIA 1C3YA 3R1OA 1FW4A 1IQ5A 3M0WA 1UURA 3PM8A 5EL2A 1D1OA 1TRFA 5I2LA 1GM0A 1U5IB 3O6BA 1KCYA 1SCMB 4MZKA 3BUOB 2Y1MA 4HRHA 4C0KA 1J1DA 1IWQA 1PSBA 1EL4A 4FTGA 4UPGA 1BG1A 1ORGA 4L9MA 2M8UA 3DXLA 4R1EA 2KI4B 3I5HB 3SJSA 5HKZA 1DQEA 1QX5B 4C0LA 5HL1A 2HPSA 2I94A 3D77A 3ICBA 1QIVA 1SCMC 1IGVA 3IVTA 4PCWA 2L4IA 4U8DA 1M31A 3L4LA 3CS1A 3N7HA 3IQQA 4USLA 5J3XA 3TDUA 1OMVA 1C7VA 1QXPA 2M49B 1FI6A 2JTZA 2KQ6A 2KI4C 3DY9A 3I5HC 1WRZA 5DKNA 3TDIA 3VROA 2WC6A 2IS9A 4PE7A 4PHJA 1QLSA 1UHKA 2OPOA 3SS5A 2MRDA 1K9KA 3O2PA 2BE6A 1YUUA 3SG2A 2M1KB 1NCXA 2M0RA 1BMOA 4WQ2A 2H8VA 1Y1AA 2OTGB 1GJYA 4OVNF 3TS5B 3S0AA 2E6WA 1B8CA 5HKYA 1W7IB 3DYEA 2AMIA 4GUKA 1FBVA 4N1GA 4PE0A 1IKUA 3CR2A 1XVJA 4F7FA 3VRRA 2PVBA 1B9AA 2JTTA 2WCJA 3OP0A 4F0ZB 1ODBA 4MZLA 3IF7A 1XYDA 1H4BA 3TS5C 3NSLA 3KPXA 2L4HA 1N0YA 2NLNA 4ZCUA 2KSPA 1XA5A 1A29A 1B8LA 4MSPA 1E8AA 5FI6A 3AAKA 3BXKA 3BUWB 3EG5B 2BNXA 5KU1A 3DZTA 4BY5A 2KBIA 5I8NA 2YGUA 2K61A 1KFXS 1K9PA 5I2OA 1K94A 1MQ1A 1KSMA 2LE9B 1RWYA 2MJWB 2WC5A 4PDZA 1LXFC 4INXA 4TNCA 2KAVA 3D78A 1BOCA 2M9GA 1QJTA 3UNWA 1AJ5A 3LLEA 1W9ZA 3OHMB 1XFRA 3TDZA 4GGFA 1S36A 1S6CA 1UP5A 1DJGA 2WCBA 1SL9A 1KSOA 2K0JA 1TUJA 3KEVA 5GQQC 4P5OE 1G8IA 4ZCVA 1K90D 4DS7A 1OOJA 2F3YA 1SCVA 1TNQA 2PQLA 2KLEA 1NUBA 1BF5A 5IBWA 3SS4A 5ER4X 2BKIB 5KTYA 4CLNA 2TN4A 4NDCA 4GGFC 2P71A 3BOWA 3B7AA 2WCKA 2FJUB 1TOPA 3OGNA 1J7RA 1OOFA 3B6XA 3FWBA 3LK1A 4ICBA 3BOWB 1S6JA 1RROA 1LS8A 1XO5A 1UHHA 5CSFA 4BY4A 1F4QA 1QIWA 3B88A 1ZMZA 1JC2A 1QX7A 1C7WA 2WNDA 3CGAA 5AANA 3WNXB 4DRWA 2JU0A 2LVVA 4YGDB 1TNXA 3BFAA 2GGMA 1BODA 2OS8B 2QEBA 2K8MB 1YUSA 1K95A 2LP3A 1WRKA 2K7BA 2NZ0A 1CNPA 3UO9A 2F8PA 4WQ3A 3DD4A 4I5LB 1CDMA 1KQMB 4NDBA 1IG5A 2KPHA 2LM5A 4INWA 3V2LA 3CZ1A 4NDDA 5KSZA 3S0BA 2JXCA 2M1UA 1NPQA 1S5GZ 2OS8C 2VRGA 5B8IB 1C07A 1JBAA 1IRJA 2ZNEA 3JTDB 5HKWA 2JZIA 2M7NA 3I5IB 3O78A 1DT7B 4IL1A 4M2OA 1S3PA 1LINA 1KQMC 1DJXA 2LUCA 4PALA 1KK7Z 4YGCB 3KO0A 3CR4X 3TZ1A 5FYXA 1SW8A 1YUTA 1T14A 1Z2CB 1ZFSA 1UUSA 4XJKA 3I5IC 1V1GA 3OX6A 3FE6A 2ZN9A 2PRUA 2LHLA 2DOQA 1JUOA 2AAOA 4XJKB 2LVKA 3CZ0A 3R1PA 2Y5IA 3K21A 2JT0A 1SL8A 2BCBA 1Q80A 1EH2A 1FF1A 1NSHA 1JWDA 3CLNA 4D1EA 2FJYA 4JPZB 2JNFA 5AEQA 3D0YA 4GAOA 4GFTA 3D10A 1KFUL 1NX1A 1R6PA 2MAZA 3PJIA 1XFXO 1YX8A 1Z4HA 4GPLB 5BPJA 1NX3A 1QVIZ 3CZTX 2NCOA 3D0YB 3I5FB 2L98A 3O4YA 4JWQA 1OMDA 1L2OC 1KQVA 1NCZA 1VRKA 1SSEB 4ORCB 1QS7A 1CFDA 3SG7A 4N1FA 3S0FA 4PE1A 2QEOA 3EK8A 3QRXA 1NIWA 4OZDA 3Q8IA 1QWVA 1YX7A 3I5FC 1SYMA 1WY9A 3NHIA 3PFVA 4DUQA 3OBVA 1XFVO 3I5GC 2KI6C 3H4SE 2PSRA 3VRQA 2MA2A 1LA3A 2JRFA 4PE4A 1JFJA 1TCFA 2ZN8A 2HQ8A 3DF0A 1A03A 3PSRA 2F33A 1ZACA 4PHNA 2KGRA 2QACA 3LK0A 1BJFA 1CLLA 1TNPA 3DF0B 1DJYA 1UWOA 1MXLC 1KK8B 2F2OA 2FCEA 4PT1A 2JXLA 1DF0A 2ZRTA 2HQWA 1M39A 4OR9B 1GGWA 2E30A 3KF9A 4HRGA 2O5GA 1DF0B 1NX2A 4OV2A 2LMUA 1CFCA 2K7OA 2G9BA 4M2PA 1KK8C 2D8NA 2LCPA 3PM2A 1CM4A 4YI8A 5ER5A 1M46A 1DGVA 1OQPA 5D3OA 3TUYC 2PYQA 1PULA 1RK9A 4FQTA 2M7LA 1A75A 1HQVA 2ISDA 2JPOA 3EVRA 3SG4A 5CPVA 3JVTB 1A75B 4AQIA 2M3WA 1CFFA 2KAYA 5PALA 2HETA 1TUZA 4AQJA 2MLFC 3QMEA 2JNXA 3NSOA 1HT9A 1MXEA 3L47A 1N2DA 1YVHA 1B7TY 2L0PA 3KHEA 1QV0A 4NQGA 1G33A 2L2EA 5F6TA 2PALA 4ORAB 1RFJA 3JVTC 5CSNA 1SPYA 3DVJA 2BL0B 3CTNA 2Q91A 5AFPA 2ZNDA 4QJ5B 3FIAA 3VGOA 2K2FA 5G08A 4IJ7A 2B1UA 3L4AA 1YRUB 1F71A 1H8BA 1J7QA 3K1EA 3DVMA 1BR1B 2NCPA 2Y4QA 1XFUO 3GOFA 2BL0C 2BCXA 3IQOA 2JT3A 1IJ5A 3FE8A 1CDLA 2LAPA 1QASA 2CXJA 2I2RE 1NYAA 2LV7A 1N65A 2K7DA 5JOLA 2KBMA 2M97A 4YBHB 1DGUA 1A4PA 3D73A 3EK4A 5DKQA 3GK4X 5FI2A 1BT6A 1PK0D 2CTNA 2BCAA 3CABA 1YURA 3AAJA 3S0EA 3F45A 2BBMA 3NHTA 5HLVA 3BQ3A 5HYDA 1TCOB 1DJWA 4PHMA 1CB1A 2K2AA 3BFHA 3OB1B 1K8UA 4C0JA 1KK7Y 1SR6C 1PVBA 4YGBB 1CDPA 1DELA 2AUCA 4JD9A 1J7OA 1GQMA 1MF8B 1W7JB 2JQ6A 2QEHA 1NWDA 3MSEB 4CIDA 2WC8A 5K89A 1UHIA 3NSIA 1K96A 3FS7A 4ETOA 3D75A 2F3ZA 2G2BA 2LUXA 3ZWHA 3GK1A 1B4CA 1DJZA 2EGDA 1EG3A 2LVJA 3GK2A 1PVAA 3BFBA 3DVKA 2KFGA 1IQ3A 1ALWA 1MHOA 1J1EA 1SY9A 5I94A 1FI5A 1J55A 3BUNB 4MBEA 5DICA 1PSRA 2KYCA 2JOJA 1QVIY 1L2OB 1WRLA 1YR5A 3SIBA 1WLMA 4MEWA 1JFKA 3SG5A 4QJ3B 3VRNA 1LKJA 1AP4A 3BYAA 4YRUA 1AHRA 5HLOA 2GTEA 2CBLA 2L50A 2P6BB 3NXAA 4MN0A 4OKHA 2Y1NA 3I5GB 4Q04A 2LC5A 5DKRA 1Y1UA 1S1EA 2LMTA 3DVEA 1B1GA 1QATA 4I5JA 1GGZA 2COLB 5JJGA 5FI7A 1AUIB 4JKTA 4DIRA 2QPTA 2MHHA 2M29A 4OCIA 1DTLA 2EHBA 1P28A 1CLMA 2LLTA 1UHNA 5I2QA 1S6IA 1YTZC 2JWWA 3AKAA 3NSKA 4XYNA 1CFPA 3SG6A 2CCMA 3CWGA 4MVFA 1OW4A 1QTXA 4MLWA 3FWCA 1OOHA 1CMFA 1OE9B 1MWNA 1NCYA 2ZFDA 2FCDA 1F4OA 2CT9A 3O4XA 3EKJA 1G4YR 3TUYB 1F55A 3R1VA 1XFZO 2F2PA 1M45A 2LP2A 1XFYO 2GV5A 1DJHA 3R72A 1MUXA 5D7FA 3B87A 2L5YA 1JF2A 4GNKB 3CYZA 2LNKA 4YI9A 1OSAA 1EG4A 1KWOB 3EVUA 1R2UA 1DJIA 1PALA 2PMYA 1LA0A 1CDNA 3SG3A 1OZOA 1J7PA 1SBJA 4I5KA 2I7AA 1QV1A 3BUMB 3ZNIA 2KHNA 2WCEA 3VB1A 3PLFB 3RM1A 1KWOC 3EKHA 4FQOA 1PRWA 1X02A 2SASA 2WOSA 3WHTB 1DVIA 4ORBB 1EXRA 2GGZA 2ZRSA 2OTGC 3EVVA 1MR8A 1CMGA 1RTP1 2JPTA 4QJ4B 1AJ4A 1JSAA 1S26D 1SL7A 2CNPA 1XFWO 2JC2A 2KI6D 3VRPA 1Y6WA 4YGAA 3B86A 1WDCB 1CM1A 1K2HA 1OZSA 1JF0A 2KDHA 1B8RA 3A8RA 5D69A 2K7CA 5TNCA 2MBXA 2KGBC 3D74A 1CTRA 1BU3A 1RJVA 1V1FA 2K60A 4GGNA 1BR4B 4MRYA 1IIOA 5CSJA 3SS3A 3WXAA 1SKTA 2SCPA 1CKKA 1WDCC 1SRAA 4M2QA 4CFRA 4KYNA 1QX2A 4CFQA 5AERA 1RECA 3CZ2A 2RGIA 3FE9A 4JQ0D 1AVSA 1YVLA 4I5NB 4WRIA 3S0DA 2PASA 2H2KA 2FOTA 2WCHA 3RLZA 2MLEC 1FPWA 1B7TZ 1KFXL 2LANA 3LL8B 1DC1A 1ZOTB 2ERBA 1SK6D 1OMRA 1SR6B 2KOTA 1Y1XA 4MZJA 4AOMA 2LLUA 2KAXA 4N5XA 3OB2B 2O60A 1S5GY 1DMOA 3HX4A 2WCMA 4A4CA 1YRTB 3OX5A 1K9UA 1C3ZA 1TWOA 3RZSA 3SIAA 3CR5X 1SMGA 2L2CA 4MRXA 2KQYA 1XK4A 1TIZA 2L5XB 2Q4UA 3C1VA 3PALA 1ALVA 2L51A 4PHKA
chains in the Genus database with same CATH topology
1NP8A 3E3RA 3PN7B 1TN4A 2I18A 1AK8A 2H61A 3AKBA 2R2IA 2KYFA 1WLZA 4GBAA 4A4BA 1UHJA 1ZUZA 2LLSA 2EC6B 1KFUS 2KNEA 2HF5A 2LHIA 1XK4C 3PATA 3PN7C 1TTXA 2JULA 1EJ3A 1L7ZA 1BLQA 1NX0A 2NXQA 5CSIA 2BBNA 1K93D 2BE4A 2H61C 3WHUB 2BECA 2V53A 1F54A 2JT8A 1M63B 4CPVA 2EC6C 1LVCD 2KFFA 1TNWA 1F8HA 1Y0VH 2LMVA 4E68A 1A2XA 1B47A 3HCMA 2WCFA 3BUXB 4DCKA 1CLBA 4P2YB 1IJ6A 1F70A 4HREE 4YGEB 5AXIA 2KFHA 2A4JA 4HSZA 3LCPC 1SNLA 3JTDC 3A4UB 2WORA 2BKHB 1QLKA 2ZKMX 1IH0A 3EK7A 1U5IA 2LVIA 1FW4A 1IQ5A 3M0WA 1UURA 3PM8A 1D1OA 1TRFA 5I2LA 1U5IB 3O6BA 1KCYA 1SCMB 4MZKA 3BUOB 2Y1MA 4HRHA 4C0KA 1J1DA 1IWQA 1PSBA 1EL4A 4FTGA 4UPGA 1BG1A 4L9MA 2M8UA 4R1EA 2KI4B 3I5HB 3SJSA 5HKZA 1QX5B 4C0LA 2HPSA 2I94A 3ICBA 1QIVA 1SCMC 1IGVA 4PCWA 2L4IA 4U8DA 1M31A 3CS1A 3IQQA 4USLA 5J3XA 3TDUA 1OMVA 1C7VA 1QXPA 2M49B 1FI6A 2JTZA 2KQ6A 2KI4C 3I5HC 5DKNA 1WRZA 3TDIA 3VROA 2IS9A 4PE7A 4PHJA 1QLSA 1UHKA 2OPOA 2MRDA 1K9KA 3O2PA 2BE6A 1YUUA 3SG2A 2M1KB 1NCXA 2M0RA 1BMOA 4WQ2A 1Y1AA 2OTGB 1GJYA 4OVNF 3TS5B 2E6WA 1B8CA 5HKYA 1W7IB 2AMIA 4GUKA 1FBVA 4N1GA 4PE0A 1IKUA 3CR2A 1XVJA 3VRRA 2PVBA 1B9AA 2JTTA 3OP0A 4F0ZB 1ODBA 4MZLA 3IF7A 1XYDA 1H4BA 3TS5C 3NSLA 3KPXA 2L4HA 1N0YA 2NLNA 4ZCUA 2KSPA 1XA5A 1A29A 1B8LA 4MSPA 1E8AA 3AAKA 3BXKA 3BUWB 5KU1A 4BY5A 2KBIA 5I8NA 2K61A 1KFXS 1K9PA 5I2OA 1K94A 1MQ1A 1KSMA 2LE9B 1RWYA 2MJWB 4PDZA 1LXFC 1BOCA 4TNCA 2KAVA 2M9GA 1QJTA 1AJ5A 3LLEA 3OHMB 3TDZA 4GGFA 1S36A 1S6CA 1UP5A 1DJGA 2WCBA 1SL9A 1KSOA 2K0JA 3KEVA 5GQQC 4P5OE 1G8IA 4ZCVA 1K90D 4DS7A 1OOJA 2F3YA 1SCVA 1TNQA 1NUBA 1BF5A 5IBWA 5ER4X 2BKIB 5KTYA 4CLNA 2TN4A 4NDCA 4GGFC 3BOWA 2FJUB 1TOPA 1J7RA 3FWBA 4ICBA 3LK1A 3BOWB 1S6JA 1RROA 1UHHA 1XO5A 5CSFA 4BY4A 1F4QA 1QIWA 1ZMZA 1JC2A 1QX7A 1C7WA 2WNDA 3CGAA 5AANA 3WNXB 4DRWA 2JU0A 2LVVA 4YGDB 1TNXA 1BODA 2GGMA 2OS8B 2K8MB 1YUSA 1K95A 2LP3A 1WRKA 2K7BA 2NZ0A 1CNPA 2F8PA 4WQ3A 3DD4A 4I5LB 1CDMA 1KQMB 4NDBA 1IG5A 2LM5A 4NDDA 5KSZA 2JXCA 2M1UA 1NPQA 1S5GZ 2OS8C 2VRGA 5B8IB 1C07A 1JBAA 1IRJA 2ZNEA 3JTDB 5HKWA 2JZIA 2M7NA 3I5IB 3O78A 1DT7B 4IL1A 4M2OA 1S3PA 1LINA 1KQMC 1DJXA 2LUCA 4PALA 1KK7Z 4YGCB 3KO0A 3CR4X 3TZ1A 5FYXA 1SW8A 1YUTA 1ZFSA 1UUSA 4XJKA 3I5IC 1V1GA 3OX6A 2ZN9A 2PRUA 2LHLA 2DOQA 1JUOA 2AAOA 4XJKB 2LVKA 2Y5IA 3K21A 2JT0A 1SL8A 2BCBA 1Q80A 1EH2A 1FF1A 1NSHA 1JWDA 3CLNA 4D1EA 4JPZB 2JNFA 5AEQA 3D0YA 4GAOA 4GFTA 3D10A 1KFUL 1NX1A 1R6PA 2MAZA 1XFXO 1YX8A 4GPLB 5BPJA 1NX3A 1QVIZ 3CZTX 2NCOA 3D0YB 3I5FB 2L98A 3O4YA 4JWQA 1OMDA 1L2OC 1KQVA 1NCZA 1VRKA 4ORCB 1QS7A 1CFDA 3SG7A 4N1FA 4PE1A 3EK8A 3QRXA 1NIWA 1YX7A 3I5FC 1SYMA 1WY9A 3PFVA 4DUQA 1XFVO 3I5GC 2KI6C 3H4SE 2PSRA 3VRQA 2MA2A 1LA3A 2JRFA 4PE4A 1JFJA 1TCFA 2ZN8A 2HQ8A 3DF0A 1A03A 3PSRA 2F33A 1ZACA 4PHNA 2KGRA 2QACA 3LK0A 1BJFA 1CLLA 1TNPA 3DF0B 1DJYA 1UWOA 1MXLC 1KK8B 2F2OA 2FCEA 2JXLA 1DF0A 2ZRTA 2HQWA 1M39A 4OR9B 1GGWA 2E30A 3KF9A 4HRGA 2O5GA 1DF0B 1NX2A 4OV2A 2LMUA 1CFCA 2K7OA 2G9BA 4M2PA 1KK8C 2D8NA 2LCPA 4YI8A 1CM4A 5ER5A 1M46A 1DGVA 1OQPA 3TUYC 2M7LA 1PULA 1RK9A 1A75A 1HQVA 2ISDA 3EVRA 3SG4A 5CPVA 3JVTB 1A75B 4AQIA 2M3WA 1CFFA 2KAYA 5PALA 2HETA 4AQJA 2MLFC 2JNXA 3NSOA 1HT9A 1MXEA 1N2DA 1YVHA 1B7TY 2L0PA 3KHEA 1QV0A 4NQGA 1G33A 2L2EA 5F6TA 2PALA 4ORAB 1RFJA 3JVTC 5CSNA 1SPYA 3DVJA 2BL0B 3CTNA 2Q91A 5AFPA 2ZNDA 4QJ5B 3FIAA 3VGOA 2K2FA 5G08A 2B1UA 1YRUB 1F71A 1H8BA 1J7QA 3DVMA 1BR1B 2NCPA 2Y4QA 1XFUO 3GOFA 2BL0C 2BCXA 3IQOA 2JT3A 1IJ5A 1CDLA 2LAPA 1QASA 2CXJA 2I2RE 1NYAA 2LV7A 1N65A 2K7DA 5JOLA 2KBMA 2M97A 4YBHB 1DGUA 1A4PA 3EK4A 5DKQA 3GK4X 1BT6A 1PK0D 2CTNA 2BCAA 1YURA 3AAJA 3F45A 2BBMA 5HLVA 3BQ3A 5HYDA 1TCOB 1DJWA 4PHMA 1CB1A 2K2AA 3OB1B 1K8UA 4C0JA 1KK7Y 1SR6C 1PVBA 4YGBB 1CDPA 2AUCA 1J7OA 1GQMA 1MF8B 1W7JB 2JQ6A 4CIDA 1NWDA 3MSEB 2WC8A 5K89A 1UHIA 3NSIA 1K96A 3FS7A 4ETOA 2F3ZA 2G2BA 2LUXA 3ZWHA 3GK1A 1B4CA 1DJZA 2EGDA 1EG3A 2LVJA 3GK2A 1PVAA 3DVKA 2KFGA 1IQ3A 1ALWA 1MHOA 1J1EA 1SY9A 1FI5A 1J55A 3BUNB 4MBEA 1PSRA 2KYCA 2JOJA 1QVIY 1L2OB 1WRLA 1YR5A 3SIBA 1WLMA 4MEWA 1JFKA 3SG5A 4QJ3B 3VRNA 1LKJA 1AP4A 3BYAA 4YRUA 1AHRA 5HLOA 2L50A 2CBLA 2P6BB 3NXAA 4MN0A 4OKHA 2Y1NA 3I5GB 4Q04A 2LC5A 5DKRA 1Y1UA 1S1EA 2LMTA 3DVEA 1B1GA 1QATA 4I5JA 1GGZA 2COLB 5JJGA 1AUIB 4DIRA 2QPTA 2MHHA 2M29A 4OCIA 1DTLA 2EHBA 1CLMA 2LLTA 1UHNA 5I2QA 1S6IA 1YTZC 2JWWA 3AKAA 3NSKA 4XYNA 1CFPA 3SG6A 2CCMA 3CWGA 4MVFA 1QTXA 4MLWA 3FWCA 1CMFA 1OE9B 1MWNA 1NCYA 2ZFDA 2FCDA 1F4OA 2CT9A 3EKJA 1G4YR 3TUYB 1F55A 1XFZO 2F2PA 1M45A 2LP2A 1XFYO 2GV5A 1DJHA 1MUXA 5D7FA 1JF2A 4GNKB 2LNKA 4YI9A 1OSAA 1EG4A 1KWOB 3EVUA 1R2UA 1DJIA 1PALA 2PMYA 1LA0A 1CDNA 3SG3A 1OZOA 1J7PA 1SBJA 4I5KA 2I7AA 1QV1A 3BUMB 3ZNIA 2KHNA 2WCEA 3PLFB 3RM1A 1KWOC 3EKHA 4FQOA 1PRWA 1X02A 2SASA 2WOSA 3WHTB 1DVIA 4ORBB 1EXRA 2GGZA 2ZRSA 2OTGC 3EVVA 1MR8A 1CMGA 1RTP1 2JPTA 4QJ4B 1AJ4A 1JSAA 1S26D 1SL7A 2CNPA 1XFWO 2JC2A 2KI6D 3VRPA 1Y6WA 4YGAA 1WDCB 1CM1A 1K2HA 1OZSA 1JF0A 2KDHA 1B8RA 3A8RA 5D69A 2K7CA 5TNCA 2MBXA 2KGBC 1CTRA 1BU3A 1RJVA 1V1FA 4GGNA 1BR4B 4MRYA 5CSJA 3WXAA 1SKTA 2SCPA 1CKKA 1WDCC 1SRAA 4M2QA 4CFRA 1QX2A 4CFQA 5AERA 1RECA 2RGIA 4JQ0D 1AVSA 1YVLA 4I5NB 4WRIA 2PASA 2H2KA 2FOTA 3RLZA 2MLEC 1FPWA 1B7TZ 1KFXL 2LANA 3LL8B 1ZOTB 1SK6D 1OMRA 1SR6B 2KOTA 1Y1XA 4MZJA 4AOMA 2LLUA 2KAXA 4N5XA 3OB2B 2O60A 1S5GY 1DMOA 3HX4A 4A4CA 1YRTB 3OX5A 1K9UA 3SIAA 3CR5X 1SMGA 4MRXA 2KQYA 1XK4A 1TIZA 2L5XB 2Q4UA 3C1VA 3PALA 1ALVA 2L51A 4PHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NP8 A;  3E3R A;  3PN7 B;  1TN4 A;  2I18 A;  1AK8 A;  2H61 A;  3AKB A;  2R2I A;  2KYF A;  1WLZ A;  4GBA A;  4A4B A;  1UHJ A;  1ZUZ A;  2LLS A;  2EC6 B;  1KFU S;  2KNE A;  2HF5 A;  2LHI A;  1XK4 C;  3PAT A;  3PN7 C;  1TTX A;  2JUL A;  1EJ3 A;  1L7Z A;  1BLQ A;  1NX0 A;  2NXQ A;  5CSI A;  2BBN A;  1K93 D;  2BE4 A;  2H61 C;  3WHU B;  2BEC A;  2V53 A;  1F54 A;  2JT8 A;  1M63 B;  4CPV A;  2EC6 C;  1LVC D;  2KFF A;  1TNW A;  1F8H A;  1Y0V H;  2LMV A;  4E68 A;  1A2X A;  1B47 A;  3HCM A;  2WCF A;  3BUX B;  4DCK A;  1CLB A;  4P2Y B;  1IJ6 A;  1F70 A;  4HRE E;  4YGE B;  5AXI A;  2KFH A;  2A4J A;  4HSZ A;  3LCP C;  1SNL A;  3JTD C;  3A4U B;  2WOR A;  2BKH B;  1QLK A;  2ZKM X;  1IH0 A;  3EK7 A;  1U5I A;  2LVI A;  1FW4 A;  1IQ5 A;  3M0W A;  1UUR A;  3PM8 A;  1D1O A;  1TRF A;  5I2L A;  1U5I B;  3O6B A;  1KCY A;  1SCM B;  4MZK A;  3BUO B;  2Y1M A;  4HRH A;  4C0K A;  1J1D A;  1IWQ A;  1PSB A;  1EL4 A;  4FTG A;  4UPG A;  1BG1 A;  4L9M A;  2M8U A;  4R1E A;  2KI4 B;  3I5H B;  3SJS A;  5HKZ A;  1QX5 B;  4C0L A;  2HPS A;  2I94 A;  3ICB A;  1QIV A;  1SCM C;  1IGV A;  4PCW A;  2L4I A;  4U8D A;  1M31 A;  3CS1 A;  3IQQ A;  4USL A;  5J3X A;  3TDU A;  1OMV A;  1C7V A;  1QXP A;  2M49 B;  1FI6 A;  2JTZ A;  2KQ6 A;  2KI4 C;  3I5H C;  5DKN A;  1WRZ A;  3TDI A;  3VRO A;  2IS9 A;  4PE7 A;  4PHJ A;  1QLS A;  1UHK A;  2OPO A;  2MRD A;  1K9K A;  3O2P A;  2BE6 A;  1YUU A;  3SG2 A;  2M1K B;  1NCX A;  2M0R A;  1BMO A;  4WQ2 A;  1Y1A A;  2OTG B;  1GJY A;  4OVN F;  3TS5 B;  2E6W A;  1B8C A;  5HKY A;  1W7I B;  2AMI A;  4GUK A;  1FBV A;  4N1G A;  4PE0 A;  1IKU A;  3CR2 A;  1XVJ A;  3VRR A;  2PVB A;  1B9A A;  2JTT A;  3OP0 A;  4F0Z B;  1ODB A;  4MZL A;  3IF7 A;  1XYD A;  1H4B A;  3TS5 C;  3NSL A;  3KPX A;  2L4H A;  1N0Y A;  2NLN A;  4ZCU A;  2KSP A;  1XA5 A;  1A29 A;  1B8L A;  4MSP A;  1E8A A;  3AAK A;  3BXK A;  3BUW B;  5KU1 A;  4BY5 A;  2KBI A;  5I8N A;  2K61 A;  1KFX S;  1K9P A;  5I2O A;  1K94 A;  1MQ1 A;  1KSM A;  2LE9 B;  1RWY A;  2MJW B;  4PDZ A;  1LXF C;  1BOC A;  4TNC A;  2KAV A;  2M9G A;  1QJT A;  1AJ5 A;  3LLE A;  3OHM B;  3TDZ A;  4GGF A;  1S36 A;  1S6C A;  1UP5 A;  1DJG A;  2WCB A;  1SL9 A;  1KSO A;  2K0J A;  3KEV A;  5GQQ C;  4P5O E;  1G8I A;  4ZCV A;  1K90 D;  4DS7 A;  1OOJ A;  2F3Y A;  1SCV A;  1TNQ A;  1NUB A;  1BF5 A;  5IBW A;  5ER4 X;  2BKI B;  5KTY A;  4CLN A;  2TN4 A;  4NDC A;  4GGF C;  3BOW A;  2FJU B;  1TOP A;  1J7R A;  3FWB A;  4ICB A;  3LK1 A;  3BOW B;  1S6J A;  1RRO A;  1UHH A;  1XO5 A;  5CSF A;  4BY4 A;  1F4Q A;  1QIW A;  1ZMZ A;  1JC2 A;  1QX7 A;  1C7W A;  2WND A;  3CGA A;  5AAN A;  3WNX B;  4DRW A;  2JU0 A;  2LVV A;  4YGD B;  1TNX A;  1BOD A;  2GGM A;  2OS8 B;  2K8M B;  1YUS A;  1K95 A;  2LP3 A;  1WRK A;  2K7B A;  2NZ0 A;  1CNP A;  2F8P A;  4WQ3 A;  3DD4 A;  4I5L B;  1CDM A;  1KQM B;  4NDB A;  1IG5 A;  2LM5 A;  4NDD A;  5KSZ A;  2JXC A;  2M1U A;  1NPQ A;  1S5G Z;  2OS8 C;  2VRG A;  5B8I B;  1C07 A;  1JBA A;  1IRJ A;  2ZNE A;  3JTD B;  5HKW A;  2JZI A;  2M7N A;  3I5I B;  3O78 A;  1DT7 B;  4IL1 A;  4M2O A;  1S3P A;  1LIN A;  1KQM C;  1DJX A;  2LUC A;  4PAL A;  1KK7 Z;  4YGC B;  3KO0 A;  3CR4 X;  3TZ1 A;  5FYX A;  1SW8 A;  1YUT A;  1ZFS A;  1UUS A;  4XJK A;  3I5I C;  1V1G A;  3OX6 A;  2ZN9 A;  2PRU A;  2LHL A;  2DOQ A;  1JUO A;  2AAO A;  4XJK B;  2LVK A;  2Y5I A;  3K21 A;  2JT0 A;  1SL8 A;  2BCB A;  1Q80 A;  1EH2 A;  1FF1 A;  1NSH A;  1JWD A;  3CLN A;  4D1E A;  4JPZ B;  2JNF A;  5AEQ A;  3D0Y A;  4GAO A;  4GFT A;  3D10 A;  1KFU L;  1NX1 A;  1R6P A;  2MAZ A;  1XFX O;  1YX8 A;  4GPL B;  5BPJ A;  1NX3 A;  1QVI Z;  3CZT X;  2NCO A;  3D0Y B;  3I5F B;  2L98 A;  3O4Y A;  4JWQ A;  1OMD A;  1L2O C;  1KQV A;  1NCZ A;  1VRK A;  4ORC B;  1QS7 A;  1CFD A;  3SG7 A;  4N1F A;  4PE1 A;  3EK8 A;  3QRX A;  1NIW A;  1YX7 A;  3I5F C;  1SYM A;  1WY9 A;  3PFV A;  4DUQ A;  1XFV O;  3I5G C;  2KI6 C;  3H4S E;  2PSR A;  3VRQ A;  2MA2 A;  1LA3 A;  2JRF A;  4PE4 A;  1JFJ A;  1TCF A;  2ZN8 A;  2HQ8 A;  3DF0 A;  1A03 A;  3PSR A;  2F33 A;  1ZAC A;  4PHN A;  2KGR A;  2QAC A;  3LK0 A;  1BJF A;  1CLL A;  1TNP A;  3DF0 B;  1DJY A;  1UWO A;  1MXL C;  1KK8 B;  2F2O A;  2FCE A;  2JXL A;  1DF0 A;  2ZRT A;  2HQW A;  1M39 A;  4OR9 B;  1GGW A;  2E30 A;  3KF9 A;  4HRG A;  2O5G A;  1DF0 B;  1NX2 A;  4OV2 A;  2LMU A;  1CFC A;  2K7O A;  2G9B A;  4M2P A;  1KK8 C;  2D8N A;  2LCP A;  4YI8 A;  1CM4 A;  5ER5 A;  1M46 A;  1DGV A;  1OQP A;  3TUY C;  2M7L A;  1PUL A;  1RK9 A;  1A75 A;  1HQV A;  2ISD A;  3EVR A;  3SG4 A;  5CPV A;  3JVT B;  1A75 B;  4AQI A;  2M3W A;  1CFF A;  2KAY A;  5PAL A;  2HET A;  4AQJ A;  2MLF C;  2JNX A;  3NSO A;  1HT9 A;  1MXE A;  1N2D A;  1YVH A;  1B7T Y;  2L0P A;  3KHE A;  1QV0 A;  4NQG A;  1G33 A;  2L2E A;  5F6T A;  2PAL A;  4ORA B;  1RFJ A;  3JVT C;  5CSN A;  1SPY A;  3DVJ A;  2BL0 B;  3CTN A;  2Q91 A;  5AFP A;  2ZND A;  4QJ5 B;  3FIA A;  3VGO A;  2K2F A;  5G08 A;  2B1U A;  1YRU B;  1F71 A;  1H8B A;  1J7Q A;  3DVM A;  1BR1 B;  2NCP A;  2Y4Q A;  1XFU O;  3GOF A;  2BL0 C;  2BCX A;  3IQO A;  2JT3 A;  1IJ5 A;  1CDL A;  2LAP A;  1QAS A;  2CXJ A;  2I2R E;  1NYA A;  2LV7 A;  1N65 A;  2K7D A;  5JOL A;  2KBM A;  2M97 A;  4YBH B;  1DGU A;  1A4P A;  3EK4 A;  5DKQ A;  3GK4 X;  1BT6 A;  1PK0 D;  2CTN A;  2BCA A;  1YUR A;  3AAJ A;  3F45 A;  2BBM A;  5HLV A;  3BQ3 A;  5HYD A;  1TCO B;  1DJW A;  4PHM A;  1CB1 A;  2K2A A;  3OB1 B;  1K8U A;  4C0J A;  1KK7 Y;  1SR6 C;  1PVB A;  4YGB B;  1CDP A;  2AUC A;  1J7O A;  1GQM A;  1MF8 B;  1W7J B;  2JQ6 A;  4CID A;  1NWD A;  3MSE B;  2WC8 A;  5K89 A;  1UHI A;  3NSI A;  1K96 A;  3FS7 A;  4ETO A;  2F3Z A;  2G2B A;  2LUX A;  3ZWH A;  3GK1 A;  1B4C A;  1DJZ A;  2EGD A;  1EG3 A;  2LVJ A;  3GK2 A;  1PVA A;  3DVK A;  2KFG A;  1IQ3 A;  1ALW A;  1MHO A;  1J1E A;  1SY9 A;  1FI5 A;  1J55 A;  3BUN B;  4MBE A;  1PSR A;  2KYC A;  2JOJ A;  1QVI Y;  1L2O B;  1WRL A;  1YR5 A;  3SIB A;  1WLM A;  4MEW A;  1JFK A;  3SG5 A;  4QJ3 B;  3VRN A;  1LKJ A;  1AP4 A;  3BYA A;  4YRU A;  1AHR A;  5HLO A;  2L50 A;  2CBL A;  2P6B B;  3NXA A;  4MN0 A;  4OKH A;  2Y1N A;  3I5G B;  4Q04 A;  2LC5 A;  5DKR A;  1Y1U A;  1S1E A;  2LMT A;  3DVE A;  1B1G A;  1QAT A;  4I5J A;  1GGZ A;  2COL B;  5JJG A;  1AUI B;  4DIR A;  2QPT A;  2MHH A;  2M29 A;  4OCI A;  1DTL A;  2EHB A;  1CLM A;  2LLT A;  1UHN A;  5I2Q A;  1S6I A;  1YTZ C;  2JWW A;  3AKA A;  3NSK A;  4XYN A;  1CFP A;  3SG6 A;  2CCM A;  3CWG A;  4MVF A;  1QTX A;  4MLW A;  3FWC A;  1CMF A;  1OE9 B;  1MWN A;  1NCY A;  2ZFD A;  2FCD A;  1F4O A;  2CT9 A;  3EKJ A;  1G4Y R;  3TUY B;  1F55 A;  1XFZ O;  2F2P A;  1M45 A;  2LP2 A;  1XFY O;  2GV5 A;  1DJH A;  1MUX A;  5D7F A;  1JF2 A;  4GNK B;  2LNK A;  4YI9 A;  1OSA A;  1EG4 A;  1KWO B;  3EVU A;  1R2U A;  1DJI A;  1PAL A;  2PMY A;  1LA0 A;  1CDN A;  3SG3 A;  1OZO A;  1J7P A;  1SBJ A;  4I5K A;  2I7A A;  1QV1 A;  3BUM B;  3ZNI A;  2KHN A;  2WCE A;  3PLF B;  3RM1 A;  1KWO C;  3EKH A;  4FQO A;  1PRW A;  1X02 A;  2SAS A;  2WOS A;  3WHT B;  1DVI A;  4ORB B;  1EXR A;  2GGZ A;  2ZRS A;  2OTG C;  3EVV A;  1MR8 A;  1CMG A;  1RTP 1;  2JPT A;  4QJ4 B;  1AJ4 A;  1JSA A;  1S26 D;  1SL7 A;  2CNP A;  1XFW O;  2JC2 A;  2KI6 D;  3VRP A;  1Y6W A;  4YGA A;  1WDC B;  1CM1 A;  1K2H A;  1OZS A;  1JF0 A;  2KDH A;  1B8R A;  3A8R A;  5D69 A;  2K7C A;  5TNC A;  2MBX A;  2KGB C;  1CTR A;  1BU3 A;  1RJV A;  1V1F A;  4GGN A;  1BR4 B;  4MRY A;  5CSJ A;  3WXA A;  1SKT A;  2SCP A;  1CKK A;  1WDC C;  1SRA A;  4M2Q A;  4CFR A;  1QX2 A;  4CFQ A;  5AER A;  1REC A;  2RGI A;  4JQ0 D;  1AVS A;  1YVL A;  4I5N B;  4WRI A;  2PAS A;  2H2K A;  2FOT A;  3RLZ A;  2MLE C;  1FPW A;  1B7T Z;  1KFX L;  2LAN A;  3LL8 B;  1ZOT B;  1SK6 D;  1OMR A;  1SR6 B;  2KOT A;  1Y1X A;  4MZJ A;  4AOM A;  2LLU A;  2KAX A;  4N5X A;  3OB2 B;  2O60 A;  1S5G Y;  1DMO A;  3HX4 A;  4A4C A;  1YRT B;  3OX5 A;  1K9U A;  3SIA A;  3CR5 X;  1SMG A;  4MRX A;  2KQY A;  1XK4 A;  1TIZ A;  2L5X B;  2Q4U A;  3C1V A;  3PAL A;  1ALV A;  2L51 A;  4PHK A; 
#chains in the Genus database with same CATH topology
 1NP8 A;  3E3R A;  3PN7 B;  1TN4 A;  2I18 A;  1AK8 A;  2H61 A;  3AKB A;  2R2I A;  2KYF A;  1WLZ A;  4GBA A;  4A4B A;  2KLD A;  2QEV A;  1UHJ A;  1ZUZ A;  2LLS A;  3D76 A;  2EC6 B;  1KFU S;  2KNE A;  2HF5 A;  2LHI A;  1XK4 C;  3PAT A;  3PN7 C;  1TTX A;  2JUL A;  1EJ3 A;  1L7Z A;  2BAP A;  1BLQ A;  1NX0 A;  2NXQ A;  5CSI A;  3NGV A;  2BBN A;  1K93 D;  2BE4 A;  2H61 C;  3WHU B;  2BEC A;  2V53 A;  1F54 A;  2WCL A;  2JT8 A;  1M63 B;  4CPV A;  2EC6 C;  1LVC D;  2KFF A;  1TNW A;  1F8H A;  1Y0V H;  2QDI A;  1DEK A;  2LMV A;  4E68 A;  1A2X A;  1B47 A;  3HCM A;  2WCF A;  3BUX B;  4DCK A;  1OOI X;  1CLB A;  2P70 A;  4P2Y B;  1IJ6 A;  1F70 A;  3S0G A;  4HRE E;  4YGE B;  5AXI A;  2KFH A;  3CDN A;  2A4J A;  4HSZ A;  3LCP C;  1SNL A;  3JTD C;  1OOG A;  3A4U B;  2WOR A;  2BKH B;  3BJH A;  1QLK A;  2ZKM X;  1IH0 A;  3EK7 A;  1U5I A;  2LVI A;  1C3Y A;  3R1O A;  1FW4 A;  1IQ5 A;  3M0W A;  1UUR A;  3PM8 A;  5EL2 A;  1D1O A;  1TRF A;  5I2L A;  1GM0 A;  1U5I B;  3O6B A;  1KCY A;  1SCM B;  4MZK A;  3BUO B;  2Y1M A;  4HRH A;  4C0K A;  1J1D A;  1IWQ A;  1PSB A;  1EL4 A;  4FTG A;  4UPG A;  1BG1 A;  1ORG A;  4L9M A;  2M8U A;  3DXL A;  4R1E A;  2KI4 B;  3I5H B;  3SJS A;  5HKZ A;  1DQE A;  1QX5 B;  4C0L A;  5HL1 A;  2HPS A;  2I94 A;  3D77 A;  3ICB A;  1QIV A;  1SCM C;  1IGV A;  3IVT A;  4PCW A;  2L4I A;  4U8D A;  1M31 A;  3L4L A;  3CS1 A;  3N7H A;  3IQQ A;  4USL A;  5J3X A;  3TDU A;  1OMV A;  1C7V A;  1QXP A;  2M49 B;  1FI6 A;  2JTZ A;  2KQ6 A;  2KI4 C;  3DY9 A;  3I5H C;  1WRZ A;  5DKN A;  3TDI A;  3VRO A;  2WC6 A;  2IS9 A;  4PE7 A;  4PHJ A;  1QLS A;  1UHK A;  2OPO A;  3SS5 A;  2MRD A;  1K9K A;  3O2P A;  2BE6 A;  1YUU A;  3SG2 A;  2M1K B;  1NCX A;  2M0R A;  1BMO A;  4WQ2 A;  2H8V A;  1Y1A A;  2OTG B;  1GJY A;  4OVN F;  3TS5 B;  3S0A A;  2E6W A;  1B8C A;  5HKY A;  1W7I B;  3DYE A;  2AMI A;  4GUK A;  1FBV A;  4N1G A;  4PE0 A;  1IKU A;  3CR2 A;  1XVJ A;  4F7F A;  3VRR A;  2PVB A;  1B9A A;  2JTT A;  2WCJ A;  3OP0 A;  4F0Z B;  1ODB A;  4MZL A;  3IF7 A;  1XYD A;  1H4B A;  3TS5 C;  3NSL A;  3KPX A;  2L4H A;  1N0Y A;  2NLN A;  4ZCU A;  2KSP A;  1XA5 A;  1A29 A;  1B8L A;  4MSP A;  1E8A A;  5FI6 A;  3AAK A;  3BXK A;  3BUW B;  3EG5 B;  2BNX A;  5KU1 A;  3DZT A;  4BY5 A;  2KBI A;  5I8N A;  2YGU A;  2K61 A;  1KFX S;  1K9P A;  5I2O A;  1K94 A;  1MQ1 A;  1KSM A;  2LE9 B;  1RWY A;  2MJW B;  2WC5 A;  4PDZ A;  1LXF C;  4INX A;  4TNC A;  2KAV A;  3D78 A;  1BOC A;  2M9G A;  1QJT A;  3UNW A;  1AJ5 A;  3LLE A;  1W9Z A;  3OHM B;  1XFR A;  3TDZ A;  4GGF A;  1S36 A;  1S6C A;  1UP5 A;  1DJG A;  2WCB A;  1SL9 A;  1KSO A;  2K0J A;  1TUJ A;  3KEV A;  5GQQ C;  4P5O E;  1G8I A;  4ZCV A;  1K90 D;  4DS7 A;  1OOJ A;  2F3Y A;  1SCV A;  1TNQ A;  2PQL A;  2KLE A;  1NUB A;  1BF5 A;  5IBW A;  3SS4 A;  5ER4 X;  2BKI B;  5KTY A;  4CLN A;  2TN4 A;  4NDC A;  4GGF C;  2P71 A;  3BOW A;  3B7A A;  2WCK A;  2FJU B;  1TOP A;  3OGN A;  1J7R A;  1OOF A;  3B6X A;  3FWB A;  3LK1 A;  4ICB A;  3BOW B;  1S6J A;  1RRO A;  1LS8 A;  1XO5 A;  1UHH A;  5CSF A;  4BY4 A;  1F4Q A;  1QIW A;  3B88 A;  1ZMZ A;  1JC2 A;  1QX7 A;  1C7W A;  2WND A;  3CGA A;  5AAN A;  3WNX B;  4DRW A;  2JU0 A;  2LVV A;  4YGD B;  1TNX A;  3BFA A;  2GGM A;  1BOD A;  2OS8 B;  2QEB A;  2K8M B;  1YUS A;  1K95 A;  2LP3 A;  1WRK A;  2K7B A;  2NZ0 A;  1CNP A;  3UO9 A;  2F8P A;  4WQ3 A;  3DD4 A;  4I5L B;  1CDM A;  1KQM B;  4NDB A;  1IG5 A;  2KPH A;  2LM5 A;  4INW A;  3V2L A;  3CZ1 A;  4NDD A;  5KSZ A;  3S0B A;  2JXC A;  2M1U A;  1NPQ A;  1S5G Z;  2OS8 C;  2VRG A;  5B8I B;  1C07 A;  1JBA A;  1IRJ A;  2ZNE A;  3JTD B;  5HKW A;  2JZI A;  2M7N A;  3I5I B;  3O78 A;  1DT7 B;  4IL1 A;  4M2O A;  1S3P A;  1LIN A;  1KQM C;  1DJX A;  2LUC A;  4PAL A;  1KK7 Z;  4YGC B;  3KO0 A;  3CR4 X;  3TZ1 A;  5FYX A;  1SW8 A;  1YUT A;  1T14 A;  1Z2C B;  1ZFS A;  1UUS A;  4XJK A;  3I5I C;  1V1G A;  3OX6 A;  3FE6 A;  2ZN9 A;  2PRU A;  2LHL A;  2DOQ A;  1JUO A;  2AAO A;  4XJK B;  2LVK A;  3CZ0 A;  3R1P A;  2Y5I A;  3K21 A;  2JT0 A;  1SL8 A;  2BCB A;  1Q80 A;  1EH2 A;  1FF1 A;  1NSH A;  1JWD A;  3CLN A;  4D1E A;  2FJY A;  4JPZ B;  2JNF A;  5AEQ A;  3D0Y A;  4GAO A;  4GFT A;  3D10 A;  1KFU L;  1NX1 A;  1R6P A;  2MAZ A;  3PJI A;  1XFX O;  1YX8 A;  1Z4H A;  4GPL B;  5BPJ A;  1NX3 A;  1QVI Z;  3CZT X;  2NCO A;  3D0Y B;  3I5F B;  2L98 A;  3O4Y A;  4JWQ A;  1OMD A;  1L2O C;  1KQV A;  1NCZ A;  1VRK A;  1SSE B;  4ORC B;  1QS7 A;  1CFD A;  3SG7 A;  4N1F A;  3S0F A;  4PE1 A;  2QEO A;  3EK8 A;  3QRX A;  1NIW A;  4OZD A;  3Q8I A;  1QWV A;  1YX7 A;  3I5F C;  1SYM A;  1WY9 A;  3NHI A;  3PFV A;  4DUQ A;  3OBV A;  1XFV O;  3I5G C;  2KI6 C;  3H4S E;  2PSR A;  3VRQ A;  2MA2 A;  1LA3 A;  2JRF A;  4PE4 A;  1JFJ A;  1TCF A;  2ZN8 A;  2HQ8 A;  3DF0 A;  1A03 A;  3PSR A;  2F33 A;  1ZAC A;  4PHN A;  2KGR A;  2QAC A;  3LK0 A;  1BJF A;  1CLL A;  1TNP A;  3DF0 B;  1DJY A;  1UWO A;  1MXL C;  1KK8 B;  2F2O A;  2FCE A;  4PT1 A;  2JXL A;  1DF0 A;  2ZRT A;  2HQW A;  1M39 A;  4OR9 B;  1GGW A;  2E30 A;  3KF9 A;  4HRG A;  2O5G A;  1DF0 B;  1NX2 A;  4OV2 A;  2LMU A;  1CFC A;  2K7O A;  2G9B A;  4M2P A;  1KK8 C;  2D8N A;  2LCP A;  3PM2 A;  1CM4 A;  4YI8 A;  5ER5 A;  1M46 A;  1DGV A;  1OQP A;  5D3O A;  3TUY C;  2PYQ A;  1PUL A;  1RK9 A;  4FQT A;  2M7L A;  1A75 A;  1HQV A;  2ISD A;  2JPO A;  3EVR A;  3SG4 A;  5CPV A;  3JVT B;  1A75 B;  4AQI A;  2M3W A;  1CFF A;  2KAY A;  5PAL A;  2HET A;  1TUZ A;  4AQJ A;  2MLF C;  3QME A;  2JNX A;  3NSO A;  1HT9 A;  1MXE A;  3L47 A;  1N2D A;  1YVH A;  1B7T Y;  2L0P A;  3KHE A;  1QV0 A;  4NQG A;  1G33 A;  2L2E A;  5F6T A;  2PAL A;  4ORA B;  1RFJ A;  3JVT C;  5CSN A;  1SPY A;  3DVJ A;  2BL0 B;  3CTN A;  2Q91 A;  5AFP A;  2ZND A;  4QJ5 B;  3FIA A;  3VGO A;  2K2F A;  5G08 A;  4IJ7 A;  2B1U A;  3L4A A;  1YRU B;  1F71 A;  1H8B A;  1J7Q A;  3K1E A;  3DVM A;  1BR1 B;  2NCP A;  2Y4Q A;  1XFU O;  3GOF A;  2BL0 C;  2BCX A;  3IQO A;  2JT3 A;  1IJ5 A;  3FE8 A;  1CDL A;  2LAP A;  1QAS A;  2CXJ A;  2I2R E;  1NYA A;  2LV7 A;  1N65 A;  2K7D A;  5JOL A;  2KBM A;  2M97 A;  4YBH B;  1DGU A;  1A4P A;  3D73 A;  3EK4 A;  5DKQ A;  3GK4 X;  5FI2 A;  1BT6 A;  1PK0 D;  2CTN A;  2BCA A;  3CAB A;  1YUR A;  3AAJ A;  3S0E A;  3F45 A;  2BBM A;  3NHT A;  5HLV A;  3BQ3 A;  5HYD A;  1TCO B;  1DJW A;  4PHM A;  1CB1 A;  2K2A A;  3BFH A;  3OB1 B;  1K8U A;  4C0J A;  1KK7 Y;  1SR6 C;  1PVB A;  4YGB B;  1CDP A;  1DEL A;  2AUC A;  4JD9 A;  1J7O A;  1GQM A;  1MF8 B;  1W7J B;  2JQ6 A;  2QEH A;  1NWD A;  3MSE B;  4CID A;  2WC8 A;  5K89 A;  1UHI A;  3NSI A;  1K96 A;  3FS7 A;  4ETO A;  3D75 A;  2F3Z A;  2G2B A;  2LUX A;  3ZWH A;  3GK1 A;  1B4C A;  1DJZ A;  2EGD A;  1EG3 A;  2LVJ A;  3GK2 A;  1PVA A;  3BFB A;  3DVK A;  2KFG A;  1IQ3 A;  1ALW A;  1MHO A;  1J1E A;  1SY9 A;  5I94 A;  1FI5 A;  1J55 A;  3BUN B;  4MBE A;  5DIC A;  1PSR A;  2KYC A;  2JOJ A;  1QVI Y;  1L2O B;  1WRL A;  1YR5 A;  3SIB A;  1WLM A;  4MEW A;  1JFK A;  3SG5 A;  4QJ3 B;  3VRN A;  1LKJ A;  1AP4 A;  3BYA A;  4YRU A;  1AHR A;  5HLO A;  2GTE A;  2CBL A;  2L50 A;  2P6B B;  3NXA A;  4MN0 A;  4OKH A;  2Y1N A;  3I5G B;  4Q04 A;  2LC5 A;  5DKR A;  1Y1U A;  1S1E A;  2LMT A;  3DVE A;  1B1G A;  1QAT A;  4I5J A;  1GGZ A;  2COL B;  5JJG A;  5FI7 A;  1AUI B;  4JKT A;  4DIR A;  2QPT A;  2MHH A;  2M29 A;  4OCI A;  1DTL A;  2EHB A;  1P28 A;  1CLM A;  2LLT A;  1UHN A;  5I2Q A;  1S6I A;  1YTZ C;  2JWW A;  3AKA A;  3NSK A;  4XYN A;  1CFP A;  3SG6 A;  2CCM A;  3CWG A;  4MVF A;  1OW4 A;  1QTX A;  4MLW A;  3FWC A;  1OOH A;  1CMF A;  1OE9 B;  1MWN A;  1NCY A;  2ZFD A;  2FCD A;  1F4O A;  2CT9 A;  3O4X A;  3EKJ A;  1G4Y R;  3TUY B;  1F55 A;  3R1V A;  1XFZ O;  2F2P A;  1M45 A;  2LP2 A;  1XFY O;  2GV5 A;  1DJH A;  3R72 A;  1MUX A;  5D7F A;  3B87 A;  2L5Y A;  1JF2 A;  4GNK B;  3CYZ A;  2LNK A;  4YI9 A;  1OSA A;  1EG4 A;  1KWO B;  3EVU A;  1R2U A;  1DJI A;  1PAL A;  2PMY A;  1LA0 A;  1CDN A;  3SG3 A;  1OZO A;  1J7P A;  1SBJ A;  4I5K A;  2I7A A;  1QV1 A;  3BUM B;  3ZNI A;  2KHN A;  2WCE A;  3VB1 A;  3PLF B;  3RM1 A;  1KWO C;  3EKH A;  4FQO A;  1PRW A;  1X02 A;  2SAS A;  2WOS A;  3WHT B;  1DVI A;  4ORB B;  1EXR A;  2GGZ A;  2ZRS A;  2OTG C;  3EVV A;  1MR8 A;  1CMG A;  1RTP 1;  2JPT A;  4QJ4 B;  1AJ4 A;  1JSA A;  1S26 D;  1SL7 A;  2CNP A;  1XFW O;  2JC2 A;  2KI6 D;  3VRP A;  1Y6W A;  4YGA A;  3B86 A;  1WDC B;  1CM1 A;  1K2H A;  1OZS A;  1JF0 A;  2KDH A;  1B8R A;  3A8R A;  5D69 A;  2K7C A;  5TNC A;  2MBX A;  2KGB C;  3D74 A;  1CTR A;  1BU3 A;  1RJV A;  1V1F A;  2K60 A;  4GGN A;  1BR4 B;  4MRY A;  1IIO A;  5CSJ A;  3SS3 A;  3WXA A;  1SKT A;  2SCP A;  1CKK A;  1WDC C;  1SRA A;  4M2Q A;  4CFR A;  4KYN A;  1QX2 A;  4CFQ A;  5AER A;  1REC A;  3CZ2 A;  2RGI A;  3FE9 A;  4JQ0 D;  1AVS A;  1YVL A;  4I5N B;  4WRI A;  3S0D A;  2PAS A;  2H2K A;  2FOT A;  2WCH A;  3RLZ A;  2MLE C;  1FPW A;  1B7T Z;  1KFX L;  2LAN A;  3LL8 B;  1DC1 A;  1ZOT B;  2ERB A;  1SK6 D;  1OMR A;  1SR6 B;  2KOT A;  1Y1X A;  4MZJ A;  4AOM A;  2LLU A;  2KAX A;  4N5X A;  3OB2 B;  2O60 A;  1S5G Y;  1DMO A;  3HX4 A;  2WCM A;  4A4C A;  1YRT B;  3OX5 A;  1K9U A;  1C3Z A;  1TWO A;  3RZS A;  3SIA A;  3CR5 X;  1SMG A;  2L2C A;  4MRX A;  2KQY A;  1XK4 A;  1TIZ A;  2L5X B;  2Q4U A;  3C1V A;  3PAL A;  1ALV A;  2L51 A;  4PHK A; 
#chains in the Genus database with same CATH homology
 1NP8 A;  3E3R A;  3PN7 B;  1TN4 A;  2I18 A;  1AK8 A;  2H61 A;  3AKB A;  2R2I A;  2KYF A;  1WLZ A;  4GBA A;  4A4B A;  1UHJ A;  1ZUZ A;  2LLS A;  2EC6 B;  1KFU S;  2KNE A;  2HF5 A;  2LHI A;  1XK4 C;  3PAT A;  3PN7 C;  1TTX A;  2JUL A;  1EJ3 A;  1L7Z A;  1BLQ A;  1NX0 A;  2NXQ A;  5CSI A;  2BBN A;  1K93 D;  2BE4 A;  2H61 C;  3WHU B;  2BEC A;  2V53 A;  1F54 A;  2JT8 A;  1M63 B;  4CPV A;  2EC6 C;  1LVC D;  2KFF A;  1TNW A;  1F8H A;  1Y0V H;  2LMV A;  4E68 A;  1A2X A;  1B47 A;  3HCM A;  2WCF A;  3BUX B;  4DCK A;  1CLB A;  4P2Y B;  1IJ6 A;  1F70 A;  4HRE E;  4YGE B;  5AXI A;  2KFH A;  2A4J A;  4HSZ A;  3LCP C;  1SNL A;  3JTD C;  3A4U B;  2WOR A;  2BKH B;  1QLK A;  2ZKM X;  1IH0 A;  3EK7 A;  1U5I A;  2LVI A;  1FW4 A;  1IQ5 A;  3M0W A;  1UUR A;  3PM8 A;  1D1O A;  1TRF A;  5I2L A;  1U5I B;  3O6B A;  1KCY A;  1SCM B;  4MZK A;  3BUO B;  2Y1M A;  4HRH A;  4C0K A;  1J1D A;  1IWQ A;  1PSB A;  1EL4 A;  4FTG A;  4UPG A;  1BG1 A;  4L9M A;  2M8U A;  4R1E A;  2KI4 B;  3I5H B;  3SJS A;  5HKZ A;  1QX5 B;  4C0L A;  2HPS A;  2I94 A;  3ICB A;  1QIV A;  1SCM C;  1IGV A;  4PCW A;  2L4I A;  4U8D A;  1M31 A;  3CS1 A;  3IQQ A;  4USL A;  5J3X A;  3TDU A;  1OMV A;  1C7V A;  1QXP A;  2M49 B;  1FI6 A;  2JTZ A;  2KQ6 A;  2KI4 C;  3I5H C;  5DKN A;  1WRZ A;  3TDI A;  3VRO A;  2IS9 A;  4PE7 A;  4PHJ A;  1QLS A;  1UHK A;  2OPO A;  2MRD A;  1K9K A;  3O2P A;  2BE6 A;  1YUU A;  3SG2 A;  2M1K B;  1NCX A;  2M0R A;  1BMO A;  4WQ2 A;  1Y1A A;  2OTG B;  1GJY A;  4OVN F;  3TS5 B;  2E6W A;  1B8C A;  5HKY A;  1W7I B;  2AMI A;  4GUK A;  1FBV A;  4N1G A;  4PE0 A;  1IKU A;  3CR2 A;  1XVJ A;  3VRR A;  2PVB A;  1B9A A;  2JTT A;  3OP0 A;  4F0Z B;  1ODB A;  4MZL A;  3IF7 A;  1XYD A;  1H4B A;  3TS5 C;  3NSL A;  3KPX A;  2L4H A;  1N0Y A;  2NLN A;  4ZCU A;  2KSP A;  1XA5 A;  1A29 A;  1B8L A;  4MSP A;  1E8A A;  3AAK A;  3BXK A;  3BUW B;  5KU1 A;  4BY5 A;  2KBI A;  5I8N A;  2K61 A;  1KFX S;  1K9P A;  5I2O A;  1K94 A;  1MQ1 A;  1KSM A;  2LE9 B;  1RWY A;  2MJW B;  4PDZ A;  1LXF C;  1BOC A;  4TNC A;  2KAV A;  2M9G A;  1QJT A;  1AJ5 A;  3LLE A;  3OHM B;  3TDZ A;  4GGF A;  1S36 A;  1S6C A;  1UP5 A;  1DJG A;  2WCB A;  1SL9 A;  1KSO A;  2K0J A;  3KEV A;  5GQQ C;  4P5O E;  1G8I A;  4ZCV A;  1K90 D;  4DS7 A;  1OOJ A;  2F3Y A;  1SCV A;  1TNQ A;  1NUB A;  1BF5 A;  5IBW A;  5ER4 X;  2BKI B;  5KTY A;  4CLN A;  2TN4 A;  4NDC A;  4GGF C;  3BOW A;  2FJU B;  1TOP A;  1J7R A;  3FWB A;  4ICB A;  3LK1 A;  3BOW B;  1S6J A;  1RRO A;  1UHH A;  1XO5 A;  5CSF A;  4BY4 A;  1F4Q A;  1QIW A;  1ZMZ A;  1JC2 A;  1QX7 A;  1C7W A;  2WND A;  3CGA A;  5AAN A;  3WNX B;  4DRW A;  2JU0 A;  2LVV A;  4YGD B;  1TNX A;  1BOD A;  2GGM A;  2OS8 B;  2K8M B;  1YUS A;  1K95 A;  2LP3 A;  1WRK A;  2K7B A;  2NZ0 A;  1CNP A;  2F8P A;  4WQ3 A;  3DD4 A;  4I5L B;  1CDM A;  1KQM B;  4NDB A;  1IG5 A;  2LM5 A;  4NDD A;  5KSZ A;  2JXC A;  2M1U A;  1NPQ A;  1S5G Z;  2OS8 C;  2VRG A;  5B8I B;  1C07 A;  1JBA A;  1IRJ A;  2ZNE A;  3JTD B;  5HKW A;  2JZI A;  2M7N A;  3I5I B;  3O78 A;  1DT7 B;  4IL1 A;  4M2O A;  1S3P A;  1LIN A;  1KQM C;  1DJX A;  2LUC A;  4PAL A;  1KK7 Z;  4YGC B;  3KO0 A;  3CR4 X;  3TZ1 A;  5FYX A;  1SW8 A;  1YUT A;  1ZFS A;  1UUS A;  4XJK A;  3I5I C;  1V1G A;  3OX6 A;  2ZN9 A;  2PRU A;  2LHL A;  2DOQ A;  1JUO A;  2AAO A;  4XJK B;  2LVK A;  2Y5I A;  3K21 A;  2JT0 A;  1SL8 A;  2BCB A;  1Q80 A;  1EH2 A;  1FF1 A;  1NSH A;  1JWD A;  3CLN A;  4D1E A;  4JPZ B;  2JNF A;  5AEQ A;  3D0Y A;  4GAO A;  4GFT A;  3D10 A;  1KFU L;  1NX1 A;  1R6P A;  2MAZ A;  1XFX O;  1YX8 A;  4GPL B;  5BPJ A;  1NX3 A;  1QVI Z;  3CZT X;  2NCO A;  3D0Y B;  3I5F B;  2L98 A;  3O4Y A;  4JWQ A;  1OMD A;  1L2O C;  1KQV A;  1NCZ A;  1VRK A;  4ORC B;  1QS7 A;  1CFD A;  3SG7 A;  4N1F A;  4PE1 A;  3EK8 A;  3QRX A;  1NIW A;  1YX7 A;  3I5F C;  1SYM A;  1WY9 A;  3PFV A;  4DUQ A;  1XFV O;  3I5G C;  2KI6 C;  3H4S E;  2PSR A;  3VRQ A;  2MA2 A;  1LA3 A;  2JRF A;  4PE4 A;  1JFJ A;  1TCF A;  2ZN8 A;  2HQ8 A;  3DF0 A;  1A03 A;  3PSR A;  2F33 A;  1ZAC A;  4PHN A;  2KGR A;  2QAC A;  3LK0 A;  1BJF A;  1CLL A;  1TNP A;  3DF0 B;  1DJY A;  1UWO A;  1MXL C;  1KK8 B;  2F2O A;  2FCE A;  2JXL A;  1DF0 A;  2ZRT A;  2HQW A;  1M39 A;  4OR9 B;  1GGW A;  2E30 A;  3KF9 A;  4HRG A;  2O5G A;  1DF0 B;  1NX2 A;  4OV2 A;  2LMU A;  1CFC A;  2K7O A;  2G9B A;  4M2P A;  1KK8 C;  2D8N A;  2LCP A;  4YI8 A;  1CM4 A;  5ER5 A;  1M46 A;  1DGV A;  1OQP A;  3TUY C;  2M7L A;  1PUL A;  1RK9 A;  1A75 A;  1HQV A;  2ISD A;  3EVR A;  3SG4 A;  5CPV A;  3JVT B;  1A75 B;  4AQI A;  2M3W A;  1CFF A;  2KAY A;  5PAL A;  2HET A;  4AQJ A;  2MLF C;  2JNX A;  3NSO A;  1HT9 A;  1MXE A;  1N2D A;  1YVH A;  1B7T Y;  2L0P A;  3KHE A;  1QV0 A;  4NQG A;  1G33 A;  2L2E A;  5F6T A;  2PAL A;  4ORA B;  1RFJ A;  3JVT C;  5CSN A;  1SPY A;  3DVJ A;  2BL0 B;  3CTN A;  2Q91 A;  5AFP A;  2ZND A;  4QJ5 B;  3FIA A;  3VGO A;  2K2F A;  5G08 A;  2B1U A;  1YRU B;  1F71 A;  1H8B A;  1J7Q A;  3DVM A;  1BR1 B;  2NCP A;  2Y4Q A;  1XFU O;  3GOF A;  2BL0 C;  2BCX A;  3IQO A;  2JT3 A;  1IJ5 A;  1CDL A;  2LAP A;  1QAS A;  2CXJ A;  2I2R E;  1NYA A;  2LV7 A;  1N65 A;  2K7D A;  5JOL A;  2KBM A;  2M97 A;  4YBH B;  1DGU A;  1A4P A;  3EK4 A;  5DKQ A;  3GK4 X;  1BT6 A;  1PK0 D;  2CTN A;  2BCA A;  1YUR A;  3AAJ A;  3F45 A;  2BBM A;  5HLV A;  3BQ3 A;  5HYD A;  1TCO B;  1DJW A;  4PHM A;  1CB1 A;  2K2A A;  3OB1 B;  1K8U A;  4C0J A;  1KK7 Y;  1SR6 C;  1PVB A;  4YGB B;  1CDP A;  2AUC A;  1J7O A;  1GQM A;  1MF8 B;  1W7J B;  2JQ6 A;  4CID A;  1NWD A;  3MSE B;  2WC8 A;  5K89 A;  1UHI A;  3NSI A;  1K96 A;  3FS7 A;  4ETO A;  2F3Z A;  2G2B A;  2LUX A;  3ZWH A;  3GK1 A;  1B4C A;  1DJZ A;  2EGD A;  1EG3 A;  2LVJ A;  3GK2 A;  1PVA A;  3DVK A;  2KFG A;  1IQ3 A;  1ALW A;  1MHO A;  1J1E A;  1SY9 A;  1FI5 A;  1J55 A;  3BUN B;  4MBE A;  1PSR A;  2KYC A;  2JOJ A;  1QVI Y;  1L2O B;  1WRL A;  1YR5 A;  3SIB A;  1WLM A;  4MEW A;  1JFK A;  3SG5 A;  4QJ3 B;  3VRN A;  1LKJ A;  1AP4 A;  3BYA A;  4YRU A;  1AHR A;  5HLO A;  2L50 A;  2CBL A;  2P6B B;  3NXA A;  4MN0 A;  4OKH A;  2Y1N A;  3I5G B;  4Q04 A;  2LC5 A;  5DKR A;  1Y1U A;  1S1E A;  2LMT A;  3DVE A;  1B1G A;  1QAT A;  4I5J A;  1GGZ A;  2COL B;  5JJG A;  1AUI B;  4DIR A;  2QPT A;  2MHH A;  2M29 A;  4OCI A;  1DTL A;  2EHB A;  1CLM A;  2LLT A;  1UHN A;  5I2Q A;  1S6I A;  1YTZ C;  2JWW A;  3AKA A;  3NSK A;  4XYN A;  1CFP A;  3SG6 A;  2CCM A;  3CWG A;  4MVF A;  1QTX A;  4MLW A;  3FWC A;  1CMF A;  1OE9 B;  1MWN A;  1NCY A;  2ZFD A;  2FCD A;  1F4O A;  2CT9 A;  3EKJ A;  1G4Y R;  3TUY B;  1F55 A;  1XFZ O;  2F2P A;  1M45 A;  2LP2 A;  1XFY O;  2GV5 A;  1DJH A;  1MUX A;  5D7F A;  1JF2 A;  4GNK B;  2LNK A;  4YI9 A;  1OSA A;  1EG4 A;  1KWO B;  3EVU A;  1R2U A;  1DJI A;  1PAL A;  2PMY A;  1LA0 A;  1CDN A;  3SG3 A;  1OZO A;  1J7P A;  1SBJ A;  4I5K A;  2I7A A;  1QV1 A;  3BUM B;  3ZNI A;  2KHN A;  2WCE A;  3PLF B;  3RM1 A;  1KWO C;  3EKH A;  4FQO A;  1PRW A;  1X02 A;  2SAS A;  2WOS A;  3WHT B;  1DVI A;  4ORB B;  1EXR A;  2GGZ A;  2ZRS A;  2OTG C;  3EVV A;  1MR8 A;  1CMG A;  1RTP 1;  2JPT A;  4QJ4 B;  1AJ4 A;  1JSA A;  1S26 D;  1SL7 A;  2CNP A;  1XFW O;  2JC2 A;  2KI6 D;  3VRP A;  1Y6W A;  4YGA A;  1WDC B;  1CM1 A;  1K2H A;  1OZS A;  1JF0 A;  2KDH A;  1B8R A;  3A8R A;  5D69 A;  2K7C A;  5TNC A;  2MBX A;  2KGB C;  1CTR A;  1BU3 A;  1RJV A;  1V1F A;  4GGN A;  1BR4 B;  4MRY A;  5CSJ A;  3WXA A;  1SKT A;  2SCP A;  1CKK A;  1WDC C;  1SRA A;  4M2Q A;  4CFR A;  1QX2 A;  4CFQ A;  5AER A;  1REC A;  2RGI A;  4JQ0 D;  1AVS A;  1YVL A;  4I5N B;  4WRI A;  2PAS A;  2H2K A;  2FOT A;  3RLZ A;  2MLE C;  1FPW A;  1B7T Z;  1KFX L;  2LAN A;  3LL8 B;  1ZOT B;  1SK6 D;  1OMR A;  1SR6 B;  2KOT A;  1Y1X A;  4MZJ A;  4AOM A;  2LLU A;  2KAX A;  4N5X A;  3OB2 B;  2O60 A;  1S5G Y;  1DMO A;  3HX4 A;  4A4C A;  1YRT B;  3OX5 A;  1K9U A;  3SIA A;  3CR5 X;  1SMG A;  4MRX A;  2KQY A;  1XK4 A;  1TIZ A;  2L5X B;  2Q4U A;  3C1V A;  3PAL A;  1ALV A;  2L51 A;  4PHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...