1XYDA

Nmr solution structure of rat zinc-calcium-s100b, 20 structures
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
92
structure length
92
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-100 protein, beta chain
publication title Solution Structure of Zinc- and Calcium-Bound Rat S100B as Determined by Nuclear Magnetic Resonance Spectroscopy
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 26
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xydA00
2KGRA 1DJYA 1A2XA 3FWCA 1XFXO 1YRUB 2I94A 1FF1A 1PK0D 4WRIA 1TNQA 3ICBA 1NCXA 1J55A 2I7AA 3OB2B 4M2OA 1IKUA 1KFUL 2LUXA 2M1UA 3BUXB 3NSOA 4HSZA 1Y1XA 1CNPA 1NPQA 2HETA 3CGAA 1SR6B 2HPSA 2D8NA 1Y1AA 1S5GY 4MZKA 3LK1A 1TTXA 1NWDA 1OMVA 1X02A 2O5GA 1R6PA 3D0YB 5JOLA 2I2RE 1DJIA 3EK4A 3SG7A 1PSRA 2EC6B 3PN7C 2WNDA 3TDIA 4QJ5B 1OSAA 2MLFC 2K61A 1DJGA 1DT7B 2KSPA 2BBMA 1BLQA 3PSRA 5I2OA 1S1EA 1J7RA 1BG1A 1DGVA 1XO5A 1PVBA 1QS7A 1Y6WA 1K96A 2KAYA 1JF0A 1A29A 2KBIA 3FWBA 4YGDB 2MLEC 2IS9A 1UHKA 2NXQA 1SBJA 2BCXA 1QX5B 2L4IA 1KWOB 4I5LB 1RECA 2CCMA 1XA5A 1BJFA 1S6CA 1OMDA 2JT0A 3LCPC 3KO0A 1RROA 4MBEA 2LMUA 2KOTA 4NDDA 2BKHB 4CFRA 1J1DA 1CB1A 4QJ4B 1CM4A 1WRKA 5GQQC 2JC2A 2KI6D 3GK2A 1F54A 1DGUA 2M1KB 1FBVA 1PALA 3PATA 3CR2A 4ORCB 1PSBA 1S6JA 4JWQA 1QVIY 2R2IA 5G08A 2M7LA 2COLB 2BECA 1RTP1 3TS5B 2LVJA 1YURA 3JTDC 4CPVA 2M9GA 2G2BA 1F8HA 3VROA 4PHNA 1SRAA 3AAKA 2I18A 2FJUB 1A75A 2FCDA 2LLTA 2Y4QA 2E30A 1TNPA 3BUNB 1KQVA 1SYMA 1HQVA 5HKZA 1LVCD 1CDLA 3CZTX 3DVKA 1NX2A 2MJWB 3I5HC 2AMIA 4MZJA 3OHMB 1B7TY 2P6BB 1JFKA 1F4OA 4PDZA 1QASA 3JTDB 1XFYO 2L50A 2HF5A 1Y1UA 3JVTB 1W7JB 1WY9A 4GGFC 3EK7A 3VGOA 2LHLA 2WCEA 4N1GA 1YVLA 3BUWB 1NCZA 4HRGA 1W7IB 5I8NA 1S36A 1M46A 3E3RA 1QLSA 5DKRA 2KAXA 2PVBA 4DIRA 5IBWA 2K2AA 2ISDA 4M2QA 1YUSA 4GNKB 1B9AA 2JTZA 2EGDA 1E8AA 5JJGA 2GGZA 1C07A 3O78A 2KAVA 1MXEA 4MVFA 1B8LA 2F8PA 1LA3A 4MRXA 3NXAA 1GGZA 2F3ZA 1S5GZ 2JZIA 1K95A 1SK6D 1DTLA 1QJTA 2L98A 4ZCUA 3A8RA 2KHNA 4CLNA 4DRWA 2PALA 4ZCVA 1V1FA 1LINA 1NX1A 1MF8B 1J1EA 5CPVA 4I5KA 4L9MA 2H61C 2KI4C 1F55A 1WRLA 4YI9A 4YBHB 3LLEA 4HREE 4C0LA 3DF0B 2JT3A 5B8IB 5BPJA 1CFCA 1CDNA 1F71A 1AUIB 1NP8A 1H4BA 2BL0B 3VRQA 1J7PA 1SPYA 1UHNA 3CWGA 1IH0A 2PASA 3TUYC 2M0RA 1N65A 2QACA 4XYNA 2M29A 5KU1A 1DF0A 2RGIA 2EHBA 4YGCB 1ALVA 3EKJA 4E68A 3C1VA 1K9KA 1MHOA 3IQQA 4A4CA 2BBNA 1F4QA 1KK7Y 1L2OC 2LNKA 2Y5IA 5F6TA 1WRZA 3PM8A 2JXLA 2OS8C 2JNXA 2LCPA 5HKYA 1F70A 3TZ1A 3KF9A 3VRPA 2NLNA 4ORBB 3GK4X 1SY9A 1SNLA 1CM1A 3OX6A 1MR8A 2LE9B 4OVNF 4PHJA 1DVIA 3EVUA 4BY5A 1S6IA 2B1UA 1AVSA 1XVJA 1J7OA 1SCMC 1Y0VH 1XFVO 2JNFA 1H8BA 3CR5X 2M97A 3AKAA 3DVEA 4I5JA 4PE1A 2L0PA 1MUXA 3FIAA 1BT6A 1IJ5A 3OB1B 3TUYB 1CLLA 4MLWA 2KFHA 1BOCA 1QVIZ 2JRFA 1YRTB 1L2OB 4OR9B 1UP5A 1OQPA 2OS8B 3OX5A 4C0KA 4MN0A 2JQ6A 4NDCA 1B8CA 2WCFA 1U5IA 4TNCA 1IWQA 4F0ZB 1JFJA 2SASA 1Q80A 2ZKMX 3SG3A 2BCBA 2TN4A 1SCMB 1G8IA 4XJKA 1N0YA 1QX2A 3PN7B 5AERA 1K90D 2GV5A 3NSKA 1WLZA 1CLMA 5CSFA 2DOQA 2F2OA 1A03A 1JSAA 5J3XA 3SG5A 2CNPA 1BODA 2JPTA 2Q4UA 5AFPA 1KSOA 1LA0A 3F45A 3CLNA 4MZLA 4N5XA 1CKKA 1MXLC 5AANA 4DCKA 1BMOA 1PVAA 2PRUA 3KEVA 5HYDA 3DD4A 4NDBA 1QV0A 3A4UB 2ZN9A 1N2DA 2LMVA 2KNEA 4MRYA 4AOMA 3I5FC 4P5OE 1RJVA 2KBMA 3K21A 5I2QA 2L5XB 4N1FA 3VRRA 1OZSA 2Y1MA 1EXRA 1KQMC 1SL9A 2KFFA 2V53A 1IQ5A 2K7CA 4OKHA 3O4YA 1KFUS 2LP3A 2M49B 1CFDA 3PALA 4YGBB 1YVHA 5ER5A 4DUQA 1UUSA 5PALA 5KSZA 1WDCC 4HRHA 4WQ2A 1S26D 1KFXL 2OPOA 3CR4X 3DVJA 2MHHA 3BOWA 1SL7A 1SMGA 2NCOA 1LXFC 2Y1NA 3EVRA 2LAPA 1AK8A 4FQOA 2BE4A 1UHHA 1YTZC 1IRJA 1OOJA 4P2YB 3RLZA 1JC2A 3BUOB 3I5HB 4DS7A 1K9UA 1UURA 3IQOA 3I5IC 2OTGC 1CFFA 1QIWA 2KFGA 3KPXA 1EG4A 2ZNEA 5AEQA 1S3PA 1TOPA 1UHIA 1EH2A 1TNWA 1JF2A 2E6WA 4OV2A 1QXPA 3I5GC 4JQ0D 5CSNA 2HQ8A 1PRWA 2MAZA 1M63B 1NX0A 1FI5A 3KHEA 2LUCA 4R1EA 2JTTA 1D1OA 3VRNA 1JUOA 1CTRA 1A4PA 4AQJA 3SG2A 2ZFDA 3TDUA 3WNXB 1IG5A 2O60A 3BUMB 3AAJA 1R2UA 3EKHA 3O6BA 1FPWA 3LK0A 1OMRA 2LV7A 4OCIA 1ODBA 3SG4A 2JULA 5DKNA 4GPLB 2WCBA 4ORAB 1K94A 2QPTA 1J7QA 1QLKA 2KI6C 2LVKA 4GFTA 4QJ3B 2JWWA 2LLUA 1VRKA 1B47A 1WLMA 1YX7A 2WOSA 2KQYA 2LHIA 3DVMA 1EJ3A 1SR6C 2CT9A 2HQWA 2MA2A 3D0YA 3NSIA 1B1GA 1FW4A 3GK1A 4PALA 4YGAA 1M31A 2WC8A 1XYDA 2VRGA 1JBAA 2KI4B 1KK8C 1FI6A 1GGWA 1DJHA 1GJYA 4YI8A 1CMGA 2EC6C 2SCPA 4Q04A 1K93D 1ALWA 3HX4A 1TCFA 1G4YR 1IJ6A 3BXKA 3CTNA 1IQ3A 1KFXS 3TDZA 3CS1A 2ZRTA 4GGNA 1DF0B 3OP0A 5I2LA 1NX3A 1NYAA 2A4JA 2K0JA 3O2PA 2G9BA 2LLSA 2BCAA 2F3YA 5HKWA 1DJZA 2L51A 2LANA 1KK8B 1KWOC 1TN4A 1JWDA 2KYFA 4GBAA 4PE0A 1QIVA 2KQ6A 1DJXA 2KGBC 1EG3A 2MBXA 2M7NA 1ZMZA 1KCYA 4MSPA 2KYCA 2LM5A 1BU3A 1B7TZ 4NQGA 1CDPA 1NSHA 1QTXA 1YX8A 1DJWA 1RK9A 1XFUO 4C0JA 2K7BA 4CFQA 1SKTA 3H4SE 2JOJA 1AJ5A 4A4BA 1K8UA 3TS5C 4U8DA 1XFZO 1TIZA 2JXCA 1C7WA 1B4CA 1AJ4A 2BKIB 1U5IB 1QX7A 2NCPA 1NCYA 1SW8A 2ZRSA 4FTGA 4PE4A 2LVIA 3EVVA 4ETOA 3MSEB 2LMTA 2M8UA 4MEWA 2PSRA 3WXAA 4XJKB 1SL8A 1LKJA 1HT9A 5D7FA 4GUKA 2WORA 4CIDA 1TNXA 3BYAA 2MRDA 3PLFB 1GQMA 1B8RA 1MQ1A 3BQ3A 5CSJA 1ZUZA 2ZNDA 1QV1A 5TNCA 2K7OA 2K8MB 3SJSA 1NIWA 3GOFA 1AHRA 3I5FB 1BR4B 1ZACA 2KDHA 2LC5A 3JVTC 5ER4X 1UHJA 3IF7A 1CLBA 4JPZB 1XFWO 4PHKA 4BY4A 2LP2A 1XK4A 1CDMA 2FOTA 1A75B 2K2FA 4AQIA 3EK8A 3LL8B 3PFVA 4PCWA 1KQMB 4YRUA 1XK4C 4WQ3A 5DKQA 1ZFSA 2ZN8A 3WHTB 1UWOA 1EL4A 1OZOA 3M0WA 2F2PA 1IGVA 3ZNIA 1M45A 1WDCB 2PMYA 4GGFA 3SIBA 2LVVA 2JT8A 3HCMA 2F33A 1KK7Z 3AKBA 1YUTA 2GGMA 5CSIA 3FS7A 1K2HA 2M3WA 1CMFA 1MWNA 1SCVA 2L2EA 1ZOTB 4IL1A 1G33A 4ICBA 3NSLA 3RM1A 1V1GA 4I5NB 3BOWB 1CFPA 1L7ZA 5D69A 4D1EA 5FYXA 2CBLA 1QATA 5HLOA 3DF0A 4M2PA 4YGEB 2BE6A 3I5IB 3ZWHA 1BF5A 1BR1B 2OTGB 1PULA 5AXIA 1AP4A 1OE9B 1TCOB 4PHMA 1YUUA 1TRFA 1RWYA 2AAOA 1NUBA 4UPGA 2BL0C 1KSMA 2NZ0A 5HLVA 3SIAA 3SG6A 3I5GB 1RFJA 2K7DA 3WHUB 3D10A 1K9PA 2Q91A 5K89A 1M39A 4PE7A 4USLA 5KTYA 2CXJA 2FCEA 3QRXA 1DMOA 1YR5A 2AUCA 4GAOA 1C7VA 2H2KA 2H61A 2JU0A 2CTNA 2L4HA
chains in the Genus database with same CATH superfamily
2KGRA 1DJYA 1A2XA 3FWCA 4JKTA 1Z2CB 1XFXO 1YRUB 2I94A 1FF1A 1PK0D 4WRIA 1TNQA 3S0DA 2BAPA 3ICBA 3VB1A 1NCXA 1J55A 2I7AA 3OB2B 3R1VA 4M2OA 1IKUA 1KFUL 2LUXA 2M1UA 3BUXB 3NSOA 4HSZA 1Y1XA 1CNPA 1NPQA 2HETA 3IVTA 3CGAA 1SR6B 2HPSA 2D8NA 1Y1AA 1S5GY 2P70A 4MZKA 3LK1A 4OZDA 2WCLA 1TTXA 3EG5B 1NWDA 1OMVA 1X02A 2O5GA 1R6PA 3RZSA 3D0YB 5JOLA 2I2RE 1DJIA 3D75A 3D74A 2FJYA 3EK4A 3SG7A 1DELA 1PSRA 2EC6B 2QDIA 3PN7C 2WNDA 3TDIA 4QJ5B 1OSAA 2MLFC 2K61A 1DJGA 1DT7B 2KSPA 3FE6A 2BBMA 1BLQA 3PSRA 5I2OA 1S1EA 1J7RA 1BG1A 1DGVA 1XO5A 1PVBA 1QS7A 1Y6WA 3R1PA 3S0AA 1K96A 2KAYA 1JF0A 1A29A 2KBIA 3FWBA 4YGDB 2MLEC 1C3YA 2IS9A 1UHKA 2NXQA 2YGUA 1SBJA 2BCXA 3UNWA 1QX5B 2L4IA 1KWOB 4I5LB 1RECA 2CCMA 1TWOA 1XA5A 1BJFA 2P71A 1S6CA 1OMDA 2JT0A 1OW4A 3LCPC 3KO0A 1RROA 4MBEA 4KYNA 2LMUA 3SS5A 2KOTA 4NDDA 2BKHB 4CFRA 1J1DA 1CB1A 4QJ4B 1CM4A 1WRKA 5GQQC 2JC2A 2KI6D 3FE8A 3GK2A 1F54A 1DGUA 2M1KB 1FBVA 1PALA 3CABA 3CR2A 3N7HA 3PATA 4ORCB 1PSBA 1S6JA 4JWQA 1QVIY 2R2IA 5G08A 2M7LA 2BECA 1RTP1 2COLB 3TS5B 2LVJA 1YURA 3JTDC 1QWVA 2WCMA 3FE9A 2M9GA 4CPVA 2G2BA 1F8HA 3VROA 4PHNA 1SRAA 3AAKA 2I18A 2FJUB 1A75A 2FCDA 2LLTA 2Y4QA 2E30A 1TNPA 3BUNB 1KQVA 1SYMA 1HQVA 5HKZA 1LVCD 1CDLA 3CZTX 3DVKA 1B1GA 1NX2A 2MJWB 3I5HC 2AMIA 4MZJA 3OHMB 1B7TY 2P6BB 1JFKA 1F4OA 4PDZA 1QASA 3JTDB 1XFYO 2JPOA 2L50A 3B7AA 2HF5A 1Y1UA 3JVTB 1W7JB 1WY9A 4GGFC 3EK7A 3VGOA 3DXLA 2LHLA 2WCEA 4N1GA 1YVLA 3BUWB 1NCZA 4HRGA 1W7IB 2QEBA 1S36A 5I8NA 1M46A 3E3RA 1QLSA 2L2CA 5DKRA 2KAXA 2PVBA 4DIRA 5IBWA 2K2AA 2ISDA 4M2QA 1YUSA 4GNKB 3PM2A 1B9AA 2JTZA 2EGDA 1E8AA 3DZTA 5JJGA 2GGZA 1C07A 3O78A 2KAVA 1MXEA 3R72A 4MVFA 1B8LA 2F8PA 1LA3A 4MRXA 3NXAA 1GGZA 2F3ZA 1SSEB 1S5GZ 2JZIA 1K95A 3BFBA 1SK6D 1ORGA 1DTLA 1QJTA 3L47A 2L98A 4ZCUA 3A8RA 2KHNA 4CLNA 4DRWA 2PALA 4ZCVA 1V1FA 1LINA 1NX1A 1MF8B 1J1EA 5CPVA 4I5KA 4L9MA 2H61C 2KI4C 1F55A 1WRLA 4YI9A 4YBHB 3L4AA 3LLEA 4HREE 4C0LA 3DF0B 2JT3A 5B8IB 2K60A 5BPJA 1CDNA 1CFCA 1AUIB 1F71A 1NP8A 1H4BA 1XFRA 2BL0B 3VRQA 1SPYA 1UHNA 3CWGA 1J7PA 2PASA 3TUYC 2M0RA 1N65A 2QACA 4XYNA 2M29A 5KU1A 1DF0A 2RGIA 2EHBA 4YGCB 1ALVA 3EKJA 4E68A 4IJ7A 3C1VA 1K9KA 1MHOA 3IQQA 4A4CA 2BBNA 1F4QA 1KK7Y 1L2OC 2LNKA 2Y5IA 5F6TA 1WRZA 3PM8A 2JXLA 2OS8C 2JNXA 2LCPA 5HKYA 3UO9A 1F70A 3TZ1A 3KF9A 3VRPA 2NLNA 4ORBB 3GK4X 1SY9A 1SNLA 1CM1A 3OX6A 1MR8A 2LE9B 4OVNF 4PHJA 1DVIA 3EVUA 4BY5A 1IIOA 1S6IA 2B1UA 3D77A 1AVSA 1XVJA 1J7OA 1SCMC 1Y0VH 1XFVO 2JNFA 1H8BA 3CR5X 2M97A 3BJHA 3AKAA 3DVEA 4I5JA 4PE1A 2L0PA 1MUXA 3FIAA 1BT6A 1IJ5A 3OB1B 3TUYB 1CLLA 4MLWA 3SS4A 2KFHA 1BOCA 3B86A 1QVIZ 2JRFA 2L5YA 1YRTB 1L2OB 4OR9B 1UP5A 1OQPA 2OS8B 3OX5A 4C0KA 4MN0A 5D3OA 2JQ6A 4NDCA 1B8CA 2WCFA 3BFAA 1U5IA 4TNCA 1IWQA 2KLDA 4F0ZB 1JFJA 2SASA 1Q80A 2ZKMX 3SG3A 2BCBA 4INWA 2TN4A 1SCMB 4FQTA 1G8IA 3B88A 1N0YA 1QX2A 4XJKA 3CZ2A 5I94A 3PN7B 5AERA 1K90D 2GV5A 3OBVA 3NSKA 1WLZA 3S0BA 1CLMA 5CSFA 2DOQA 2F2OA 1A03A 1JSAA 5J3XA 3SG5A 2CNPA 3L4LA 1BODA 2JPTA 2Q4UA 5AFPA 1KSOA 1TUJA 1LA0A 3F45A 3O4XA 3CLNA 4MZLA 4N5XA 2H8VA 1CKKA 1MXLC 5AANA 4DCKA 1BMOA 1PVAA 2PRUA 3CZ1A 3KEVA 5HYDA 3DD4A 4JD9A 4NDBA 1QV0A 3A4UB 5HL1A 2ZN9A 1N2DA 2LMVA 2KNEA 4MRYA 5FI7A 4AOMA 3I5FC 4P5OE 1RJVA 2KBMA 3K21A 5I2QA 2L5XB 3K1EA 4N1FA 3VRRA 1OZSA 2Y1MA 1EXRA 1KQMC 1SL9A 2KFFA 2V53A 1IQ5A 2K7CA 4OKHA 3O4YA 1KFUS 2LP3A 2M49B 1CFDA 3PALA 4YGBB 1YVHA 1OOIX 5ER5A 1UUSA 5PALA 2QEVA 4DUQA 5KSZA 1P28A 1WDCC 3NGVA 4HRHA 4WQ2A 1TUZA 1S26D 5FI2A 1KFXL 2OPOA 2PQLA 3CR4X 3DVJA 2MHHA 3BOWA 1SL7A 1SMGA 3S0EA 2NCOA 1LXFC 2Y1NA 3EVRA 2LAPA 1AK8A 4FQOA 2BE4A 1UHHA 1YTZC 1IRJA 1OOJA 4P2YB 3RLZA 1JC2A 3BUOB 3I5HB 4DS7A 1K9UA 1UURA 3IQOA 3I5IC 2OTGC 1CFFA 1QIWA 2KFGA 3KPXA 1EG4A 2ZNEA 5AEQA 1S3PA 1TOPA 1UHIA 1EH2A 1TNWA 1JF2A 1OOGA 2E6WA 4OV2A 1QXPA 3I5GC 4JQ0D 5CSNA 2HQ8A 1PRWA 2MAZA 1M63B 1NX0A 1FI5A 3KHEA 2LUCA 3Q8IA 4R1EA 2JTTA 1D1OA 3VRNA 1JUOA 1CTRA 1A4PA 4AQJA 3SG2A 2ZFDA 3TDUA 2WCJA 3WNXB 4INXA 1IG5A 2O60A 3CDNA 3BUMB 3AAJA 1R2UA 3EKHA 3O6BA 1GM0A 1FPWA 3LK0A 1OMRA 2LV7A 4OCIA 1ODBA 1DQEA 2JULA 5DKNA 3SG4A 4GPLB 3V2LA 2WCBA 4ORAB 1K94A 2QPTA 4F7FA 1J7QA 1QLKA 2ERBA 2KI6C 2LVKA 4GFTA 4QJ3B 2JWWA 1DEKA 2LLUA 1VRKA 1B47A 1WLMA 1YX7A 2WOSA 2KQYA 2LHIA 3DVMA 1EJ3A 1SR6C 2CT9A 1W9ZA 2HQWA 2MA2A 3D0YA 2GTEA 1FW4A 3GK1A 3NSIA 4PALA 4YGAA 1M31A 2WC8A 1XYDA 2VRGA 1JBAA 2KI4B 1KK8C 1FI6A 1GGWA 1DJHA 1GJYA 3SS3A 2WC6A 4YI8A 1IH0A 3B6XA 2PYQA 1CMGA 2EC6C 3CYZA 2SCPA 4Q04A 1K93D 1ALWA 3HX4A 1TCFA 3DY9A 3OGNA 1G4YR 1IJ6A 3BXKA 3CTNA 1IQ3A 1KFXS 3TDZA 2WC5A 3CS1A 2ZRTA 4GGNA 1DF0B 3OP0A 5I2LA 1NX3A 1NYAA 2A4JA 2K0JA 3O2PA 3D73A 2G9BA 2LLSA 3B87A 2BCAA 1Z4HA 2F3YA 5HKWA 1DJZA 2L51A 2LANA 1KK8B 1KWOC 1TN4A 1JWDA 2KYFA 4GBAA 2WCKA 4PE0A 1QIVA 2KQ6A 1DJXA 2KGBC 1EG3A 2MBXA 5EL2A 2M7NA 1ZMZA 1KCYA 4MSPA 2KYCA 2LM5A 1BU3A 1B7TZ 4NQGA 1CDPA 1NSHA 1QTXA 1YX8A 1DJWA 1RK9A 1XFUO 4C0JA 2K7BA 4CFQA 1SKTA 3H4SE 2JOJA 1AJ5A 4A4BA 1K8UA 3TS5C 4U8DA 1XFZO 1TIZA 2JXCA 2QEHA 1C7WA 1B4CA 1AJ4A 2BKIB 5FI6A 1U5IB 1QX7A 2NCPA 1NCYA 1SW8A 4PT1A 2ZRSA 4FTGA 4PE4A 2LVIA 3EVVA 4ETOA 3MSEB 2LMTA 2M8UA 4MEWA 2PSRA 3WXAA 2WCHA 4XJKB 1SL8A 1LKJA 1HT9A 5D7FA 4GUKA 2WORA 4CIDA 1OOFA 1TNXA 3PJIA 3BYAA 3D76A 2MRDA 2QEOA 3DYEA 3PLFB 1GQMA 1B8RA 1MQ1A 3BQ3A 5CSJA 1ZUZA 2ZNDA 1QV1A 5TNCA 2K7OA 2K8MB 3SJSA 1NIWA 1C3ZA 3GOFA 1AHRA 3I5FB 1BR4B 1ZACA 2KDHA 2LC5A 3JVTC 3BFHA 5ER4X 1UHJA 3IF7A 1CLBA 4JPZB 1XFWO 4PHKA 4BY4A 2LP2A 1XK4A 3S0FA 1CDMA 2FOTA 1A75B 2K2FA 4AQIA 3S0GA 3EK8A 3LL8B 3PFVA 4PCWA 1KQMB 4YRUA 1XK4C 5DICA 4WQ3A 5DKQA 1ZFSA 2ZN8A 3WHTB 1UWOA 1EL4A 1OZOA 3M0WA 2F2PA 1IGVA 3ZNIA 1M45A 1WDCB 2PMYA 4GGFA 2KPHA 3SIBA 2LVVA 3NHIA 3R1OA 2JT8A 3HCMA 2F33A 1KK7Z 3AKBA 1YUTA 2GGMA 5CSIA 3FS7A 1K2HA 2M3WA 1CMFA 1MWNA 1SCVA 2L2EA 1ZOTB 4IL1A 1G33A 4ICBA 3NSLA 3RM1A 1DC1A 1V1GA 4I5NB 3BOWB 1CFPA 1L7ZA 5D69A 3NHTA 4D1EA 1LS8A 2CBLA 5FYXA 1QATA 3CZ0A 5HLOA 3DF0A 4M2PA 4YGEB 3D78A 2BE6A 3I5IB 3ZWHA 1BF5A 1BR1B 2OTGB 1PULA 5AXIA 1AP4A 1OE9B 1TCOB 4PHMA 1YUUA 1TRFA 1RWYA 2AAOA 1OOHA 1NUBA 4UPGA 2BL0C 1KSMA 2NZ0A 5HLVA 3SIAA 3SG6A 3I5GB 1RFJA 2K7DA 3WHUB 3D10A 1K9PA 2Q91A 5K89A 1M39A 2BNXA 4PE7A 4USLA 2CXJA 5KTYA 2FCEA 2KLEA 3QRXA 1DMOA 1YR5A 2AUCA 4GAOA 1T14A 2H2KA 2H61A 1C7VA 2JU0A 2CTNA 3QMEA 2L4HA
chains in the Genus database with same CATH topology
2KGRA 1DJYA 1A2XA 3FWCA 1XFXO 1YRUB 2I94A 1FF1A 1PK0D 4WRIA 1TNQA 3ICBA 1NCXA 1J55A 2I7AA 3OB2B 4M2OA 1IKUA 1KFUL 2LUXA 2M1UA 3BUXB 3NSOA 4HSZA 1Y1XA 1CNPA 1NPQA 2HETA 3CGAA 1SR6B 2HPSA 2D8NA 1Y1AA 1S5GY 4MZKA 3LK1A 1TTXA 1NWDA 1OMVA 1X02A 2O5GA 1R6PA 3D0YB 5JOLA 2I2RE 1DJIA 3EK4A 3SG7A 1PSRA 2EC6B 3PN7C 2WNDA 3TDIA 4QJ5B 1OSAA 2MLFC 2K61A 1DJGA 1DT7B 2KSPA 2BBMA 1BLQA 3PSRA 5I2OA 1S1EA 1J7RA 1BG1A 1DGVA 1XO5A 1PVBA 1QS7A 1Y6WA 1K96A 2KAYA 1JF0A 1A29A 2KBIA 3FWBA 4YGDB 2MLEC 2IS9A 1UHKA 2NXQA 1SBJA 2BCXA 1QX5B 2L4IA 1KWOB 4I5LB 1RECA 2CCMA 1XA5A 1BJFA 1S6CA 1OMDA 2JT0A 3LCPC 3KO0A 1RROA 4MBEA 2LMUA 2KOTA 4NDDA 2BKHB 4CFRA 1J1DA 1CB1A 4QJ4B 1CM4A 1WRKA 5GQQC 2JC2A 2KI6D 3GK2A 1F54A 1DGUA 2M1KB 1FBVA 1PALA 3PATA 3CR2A 4ORCB 1PSBA 1S6JA 4JWQA 1QVIY 2R2IA 5G08A 2M7LA 2COLB 2BECA 1RTP1 3TS5B 2LVJA 1YURA 3JTDC 4CPVA 2M9GA 2G2BA 1F8HA 3VROA 4PHNA 1SRAA 3AAKA 2I18A 2FJUB 1A75A 2FCDA 2LLTA 2Y4QA 2E30A 1TNPA 3BUNB 1KQVA 1SYMA 1HQVA 5HKZA 1LVCD 1CDLA 3CZTX 3DVKA 1NX2A 2MJWB 3I5HC 2AMIA 4MZJA 3OHMB 1B7TY 2P6BB 1JFKA 1F4OA 4PDZA 1QASA 3JTDB 1XFYO 2L50A 2HF5A 1Y1UA 3JVTB 1W7JB 1WY9A 4GGFC 3EK7A 3VGOA 2LHLA 2WCEA 4N1GA 1YVLA 3BUWB 1NCZA 4HRGA 1W7IB 5I8NA 1S36A 1M46A 3E3RA 1QLSA 5DKRA 2KAXA 2PVBA 4DIRA 5IBWA 2K2AA 2ISDA 4M2QA 1YUSA 4GNKB 1B9AA 2JTZA 2EGDA 1E8AA 5JJGA 2GGZA 1C07A 3O78A 2KAVA 1MXEA 4MVFA 1B8LA 2F8PA 1LA3A 4MRXA 3NXAA 1GGZA 2F3ZA 1S5GZ 2JZIA 1K95A 1SK6D 1DTLA 1QJTA 2L98A 4ZCUA 3A8RA 2KHNA 4CLNA 4DRWA 2PALA 4ZCVA 1V1FA 1LINA 1NX1A 1MF8B 1J1EA 5CPVA 4I5KA 4L9MA 2H61C 2KI4C 1F55A 1WRLA 4YI9A 4YBHB 3LLEA 4HREE 4C0LA 3DF0B 2JT3A 5B8IB 5BPJA 1CFCA 1CDNA 1F71A 1AUIB 1NP8A 1H4BA 2BL0B 3VRQA 1J7PA 1SPYA 1UHNA 3CWGA 1IH0A 2PASA 3TUYC 2M0RA 1N65A 2QACA 4XYNA 2M29A 5KU1A 1DF0A 2RGIA 2EHBA 4YGCB 1ALVA 3EKJA 4E68A 3C1VA 1K9KA 1MHOA 3IQQA 4A4CA 2BBNA 1F4QA 1KK7Y 1L2OC 2LNKA 2Y5IA 5F6TA 1WRZA 3PM8A 2JXLA 2OS8C 2JNXA 2LCPA 5HKYA 1F70A 3TZ1A 3KF9A 3VRPA 2NLNA 4ORBB 3GK4X 1SY9A 1SNLA 1CM1A 3OX6A 1MR8A 2LE9B 4OVNF 4PHJA 1DVIA 3EVUA 4BY5A 1S6IA 2B1UA 1AVSA 1XVJA 1J7OA 1SCMC 1Y0VH 1XFVO 2JNFA 1H8BA 3CR5X 2M97A 3AKAA 3DVEA 4I5JA 4PE1A 2L0PA 1MUXA 3FIAA 1BT6A 1IJ5A 3OB1B 3TUYB 1CLLA 4MLWA 2KFHA 1BOCA 1QVIZ 2JRFA 1YRTB 1L2OB 4OR9B 1UP5A 1OQPA 2OS8B 3OX5A 4C0KA 4MN0A 2JQ6A 4NDCA 1B8CA 2WCFA 1U5IA 4TNCA 1IWQA 4F0ZB 1JFJA 2SASA 1Q80A 2ZKMX 3SG3A 2BCBA 2TN4A 1SCMB 1G8IA 4XJKA 1N0YA 1QX2A 3PN7B 5AERA 1K90D 2GV5A 3NSKA 1WLZA 1CLMA 5CSFA 2DOQA 2F2OA 1A03A 1JSAA 5J3XA 3SG5A 2CNPA 1BODA 2JPTA 2Q4UA 5AFPA 1KSOA 1LA0A 3F45A 3CLNA 4MZLA 4N5XA 1CKKA 1MXLC 5AANA 4DCKA 1BMOA 1PVAA 2PRUA 3KEVA 5HYDA 3DD4A 4NDBA 1QV0A 3A4UB 2ZN9A 1N2DA 2LMVA 2KNEA 4MRYA 4AOMA 3I5FC 4P5OE 1RJVA 2KBMA 3K21A 5I2QA 2L5XB 4N1FA 3VRRA 1OZSA 2Y1MA 1EXRA 1KQMC 1SL9A 2KFFA 2V53A 1IQ5A 2K7CA 4OKHA 3O4YA 1KFUS 2LP3A 2M49B 1CFDA 3PALA 4YGBB 1YVHA 5ER5A 4DUQA 1UUSA 5PALA 5KSZA 1WDCC 4HRHA 4WQ2A 1S26D 1KFXL 2OPOA 3CR4X 3DVJA 2MHHA 3BOWA 1SL7A 1SMGA 2NCOA 1LXFC 2Y1NA 3EVRA 2LAPA 1AK8A 4FQOA 2BE4A 1UHHA 1YTZC 1IRJA 1OOJA 4P2YB 3RLZA 1JC2A 3BUOB 3I5HB 4DS7A 1K9UA 1UURA 3IQOA 3I5IC 2OTGC 1CFFA 1QIWA 2KFGA 3KPXA 1EG4A 2ZNEA 5AEQA 1S3PA 1TOPA 1UHIA 1EH2A 1TNWA 1JF2A 2E6WA 4OV2A 1QXPA 3I5GC 4JQ0D 5CSNA 2HQ8A 1PRWA 2MAZA 1M63B 1NX0A 1FI5A 3KHEA 2LUCA 4R1EA 2JTTA 1D1OA 3VRNA 1JUOA 1CTRA 1A4PA 4AQJA 3SG2A 2ZFDA 3TDUA 3WNXB 1IG5A 2O60A 3BUMB 3AAJA 1R2UA 3EKHA 3O6BA 1FPWA 3LK0A 1OMRA 2LV7A 4OCIA 1ODBA 3SG4A 2JULA 5DKNA 4GPLB 2WCBA 4ORAB 1K94A 2QPTA 1J7QA 1QLKA 2KI6C 2LVKA 4GFTA 4QJ3B 2JWWA 2LLUA 1VRKA 1B47A 1WLMA 1YX7A 2WOSA 2KQYA 2LHIA 3DVMA 1EJ3A 1SR6C 2CT9A 2HQWA 2MA2A 3D0YA 3NSIA 1B1GA 1FW4A 3GK1A 4PALA 4YGAA 1M31A 2WC8A 1XYDA 2VRGA 1JBAA 2KI4B 1KK8C 1FI6A 1GGWA 1DJHA 1GJYA 4YI8A 1CMGA 2EC6C 2SCPA 4Q04A 1K93D 1ALWA 3HX4A 1TCFA 1G4YR 1IJ6A 3BXKA 3CTNA 1IQ3A 1KFXS 3TDZA 3CS1A 2ZRTA 4GGNA 1DF0B 3OP0A 5I2LA 1NX3A 1NYAA 2A4JA 2K0JA 3O2PA 2G9BA 2LLSA 2BCAA 2F3YA 5HKWA 1DJZA 2L51A 2LANA 1KK8B 1KWOC 1TN4A 1JWDA 2KYFA 4GBAA 4PE0A 1QIVA 2KQ6A 1DJXA 2KGBC 1EG3A 2MBXA 2M7NA 1ZMZA 1KCYA 4MSPA 2KYCA 2LM5A 1BU3A 1B7TZ 4NQGA 1CDPA 1NSHA 1QTXA 1YX8A 1DJWA 1RK9A 1XFUO 4C0JA 2K7BA 4CFQA 1SKTA 3H4SE 2JOJA 1AJ5A 4A4BA 1K8UA 3TS5C 4U8DA 1XFZO 1TIZA 2JXCA 1C7WA 1B4CA 1AJ4A 2BKIB 1U5IB 1QX7A 2NCPA 1NCYA 1SW8A 2ZRSA 4FTGA 4PE4A 2LVIA 3EVVA 4ETOA 3MSEB 2LMTA 2M8UA 4MEWA 2PSRA 3WXAA 4XJKB 1SL8A 1LKJA 1HT9A 5D7FA 4GUKA 2WORA 4CIDA 1TNXA 3BYAA 2MRDA 3PLFB 1GQMA 1B8RA 1MQ1A 3BQ3A 5CSJA 1ZUZA 2ZNDA 1QV1A 5TNCA 2K7OA 2K8MB 3SJSA 1NIWA 3GOFA 1AHRA 3I5FB 1BR4B 1ZACA 2KDHA 2LC5A 3JVTC 5ER4X 1UHJA 3IF7A 1CLBA 4JPZB 1XFWO 4PHKA 4BY4A 2LP2A 1XK4A 1CDMA 2FOTA 1A75B 2K2FA 4AQIA 3EK8A 3LL8B 3PFVA 4PCWA 1KQMB 4YRUA 1XK4C 4WQ3A 5DKQA 1ZFSA 2ZN8A 3WHTB 1UWOA 1EL4A 1OZOA 3M0WA 2F2PA 1IGVA 3ZNIA 1M45A 1WDCB 2PMYA 4GGFA 3SIBA 2LVVA 2JT8A 3HCMA 2F33A 1KK7Z 3AKBA 1YUTA 2GGMA 5CSIA 3FS7A 1K2HA 2M3WA 1CMFA 1MWNA 1SCVA 2L2EA 1ZOTB 4IL1A 1G33A 4ICBA 3NSLA 3RM1A 1V1GA 4I5NB 3BOWB 1CFPA 1L7ZA 5D69A 4D1EA 5FYXA 2CBLA 1QATA 5HLOA 3DF0A 4M2PA 4YGEB 2BE6A 3I5IB 3ZWHA 1BF5A 1BR1B 2OTGB 1PULA 5AXIA 1AP4A 1OE9B 1TCOB 4PHMA 1YUUA 1TRFA 1RWYA 2AAOA 1NUBA 4UPGA 2BL0C 1KSMA 2NZ0A 5HLVA 3SIAA 3SG6A 3I5GB 1RFJA 2K7DA 3WHUB 3D10A 1K9PA 2Q91A 5K89A 1M39A 4PE7A 4USLA 5KTYA 2CXJA 2FCEA 3QRXA 1DMOA 1YR5A 2AUCA 4GAOA 1C7VA 2H2KA 2H61A 2JU0A 2CTNA 2L4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGR A;  1DJY A;  1A2X A;  3FWC A;  1XFX O;  1YRU B;  2I94 A;  1FF1 A;  1PK0 D;  4WRI A;  1TNQ A;  3ICB A;  1NCX A;  1J55 A;  2I7A A;  3OB2 B;  4M2O A;  1IKU A;  1KFU L;  2LUX A;  2M1U A;  3BUX B;  3NSO A;  4HSZ A;  1Y1X A;  1CNP A;  1NPQ A;  2HET A;  3CGA A;  1SR6 B;  2HPS A;  2D8N A;  1Y1A A;  1S5G Y;  4MZK A;  3LK1 A;  1TTX A;  1NWD A;  1OMV A;  1X02 A;  2O5G A;  1R6P A;  3D0Y B;  5JOL A;  2I2R E;  1DJI A;  3EK4 A;  3SG7 A;  1PSR A;  2EC6 B;  3PN7 C;  2WND A;  3TDI A;  4QJ5 B;  1OSA A;  2MLF C;  2K61 A;  1DJG A;  1DT7 B;  2KSP A;  2BBM A;  1BLQ A;  3PSR A;  5I2O A;  1S1E A;  1J7R A;  1BG1 A;  1DGV A;  1XO5 A;  1PVB A;  1QS7 A;  1Y6W A;  1K96 A;  2KAY A;  1JF0 A;  1A29 A;  2KBI A;  3FWB A;  4YGD B;  2MLE C;  2IS9 A;  1UHK A;  2NXQ A;  1SBJ A;  2BCX A;  1QX5 B;  2L4I A;  1KWO B;  4I5L B;  1REC A;  2CCM A;  1XA5 A;  1BJF A;  1S6C A;  1OMD A;  2JT0 A;  3LCP C;  3KO0 A;  1RRO A;  4MBE A;  2LMU A;  2KOT A;  4NDD A;  2BKH B;  4CFR A;  1J1D A;  1CB1 A;  4QJ4 B;  1CM4 A;  1WRK A;  5GQQ C;  2JC2 A;  2KI6 D;  3GK2 A;  1F54 A;  1DGU A;  2M1K B;  1FBV A;  1PAL A;  3PAT A;  3CR2 A;  4ORC B;  1PSB A;  1S6J A;  4JWQ A;  1QVI Y;  2R2I A;  5G08 A;  2M7L A;  2COL B;  2BEC A;  1RTP 1;  3TS5 B;  2LVJ A;  1YUR A;  3JTD C;  4CPV A;  2M9G A;  2G2B A;  1F8H A;  3VRO A;  4PHN A;  1SRA A;  3AAK A;  2I18 A;  2FJU B;  1A75 A;  2FCD A;  2LLT A;  2Y4Q A;  2E30 A;  1TNP A;  3BUN B;  1KQV A;  1SYM A;  1HQV A;  5HKZ A;  1LVC D;  1CDL A;  3CZT X;  3DVK A;  1NX2 A;  2MJW B;  3I5H C;  2AMI A;  4MZJ A;  3OHM B;  1B7T Y;  2P6B B;  1JFK A;  1F4O A;  4PDZ A;  1QAS A;  3JTD B;  1XFY O;  2L50 A;  2HF5 A;  1Y1U A;  3JVT B;  1W7J B;  1WY9 A;  4GGF C;  3EK7 A;  3VGO A;  2LHL A;  2WCE A;  4N1G A;  1YVL A;  3BUW B;  1NCZ A;  4HRG A;  1W7I B;  5I8N A;  1S36 A;  1M46 A;  3E3R A;  1QLS A;  5DKR A;  2KAX A;  2PVB A;  4DIR A;  5IBW A;  2K2A A;  2ISD A;  4M2Q A;  1YUS A;  4GNK B;  1B9A A;  2JTZ A;  2EGD A;  1E8A A;  5JJG A;  2GGZ A;  1C07 A;  3O78 A;  2KAV A;  1MXE A;  4MVF A;  1B8L A;  2F8P A;  1LA3 A;  4MRX A;  3NXA A;  1GGZ A;  2F3Z A;  1S5G Z;  2JZI A;  1K95 A;  1SK6 D;  1DTL A;  1QJT A;  2L98 A;  4ZCU A;  3A8R A;  2KHN A;  4CLN A;  4DRW A;  2PAL A;  4ZCV A;  1V1F A;  1LIN A;  1NX1 A;  1MF8 B;  1J1E A;  5CPV A;  4I5K A;  4L9M A;  2H61 C;  2KI4 C;  1F55 A;  1WRL A;  4YI9 A;  4YBH B;  3LLE A;  4HRE E;  4C0L A;  3DF0 B;  2JT3 A;  5B8I B;  5BPJ A;  1CFC A;  1CDN A;  1F71 A;  1AUI B;  1NP8 A;  1H4B A;  2BL0 B;  3VRQ A;  1J7P A;  1SPY A;  1UHN A;  3CWG A;  1IH0 A;  2PAS A;  3TUY C;  2M0R A;  1N65 A;  2QAC A;  4XYN A;  2M29 A;  5KU1 A;  1DF0 A;  2RGI A;  2EHB A;  4YGC B;  1ALV A;  3EKJ A;  4E68 A;  3C1V A;  1K9K A;  1MHO A;  3IQQ A;  4A4C A;  2BBN A;  1F4Q A;  1KK7 Y;  1L2O C;  2LNK A;  2Y5I A;  5F6T A;  1WRZ A;  3PM8 A;  2JXL A;  2OS8 C;  2JNX A;  2LCP A;  5HKY A;  1F70 A;  3TZ1 A;  3KF9 A;  3VRP A;  2NLN A;  4ORB B;  3GK4 X;  1SY9 A;  1SNL A;  1CM1 A;  3OX6 A;  1MR8 A;  2LE9 B;  4OVN F;  4PHJ A;  1DVI A;  3EVU A;  4BY5 A;  1S6I A;  2B1U A;  1AVS A;  1XVJ A;  1J7O A;  1SCM C;  1Y0V H;  1XFV O;  2JNF A;  1H8B A;  3CR5 X;  2M97 A;  3AKA A;  3DVE A;  4I5J A;  4PE1 A;  2L0P A;  1MUX A;  3FIA A;  1BT6 A;  1IJ5 A;  3OB1 B;  3TUY B;  1CLL A;  4MLW A;  2KFH A;  1BOC A;  1QVI Z;  2JRF A;  1YRT B;  1L2O B;  4OR9 B;  1UP5 A;  1OQP A;  2OS8 B;  3OX5 A;  4C0K A;  4MN0 A;  2JQ6 A;  4NDC A;  1B8C A;  2WCF A;  1U5I A;  4TNC A;  1IWQ A;  4F0Z B;  1JFJ A;  2SAS A;  1Q80 A;  2ZKM X;  3SG3 A;  2BCB A;  2TN4 A;  1SCM B;  1G8I A;  4XJK A;  1N0Y A;  1QX2 A;  3PN7 B;  5AER A;  1K90 D;  2GV5 A;  3NSK A;  1WLZ A;  1CLM A;  5CSF A;  2DOQ A;  2F2O A;  1A03 A;  1JSA A;  5J3X A;  3SG5 A;  2CNP A;  1BOD A;  2JPT A;  2Q4U A;  5AFP A;  1KSO A;  1LA0 A;  3F45 A;  3CLN A;  4MZL A;  4N5X A;  1CKK A;  1MXL C;  5AAN A;  4DCK A;  1BMO A;  1PVA A;  2PRU A;  3KEV A;  5HYD A;  3DD4 A;  4NDB A;  1QV0 A;  3A4U B;  2ZN9 A;  1N2D A;  2LMV A;  2KNE A;  4MRY A;  4AOM A;  3I5F C;  4P5O E;  1RJV A;  2KBM A;  3K21 A;  5I2Q A;  2L5X B;  4N1F A;  3VRR A;  1OZS A;  2Y1M A;  1EXR A;  1KQM C;  1SL9 A;  2KFF A;  2V53 A;  1IQ5 A;  2K7C A;  4OKH A;  3O4Y A;  1KFU S;  2LP3 A;  2M49 B;  1CFD A;  3PAL A;  4YGB B;  1YVH A;  5ER5 A;  4DUQ A;  1UUS A;  5PAL A;  5KSZ A;  1WDC C;  4HRH A;  4WQ2 A;  1S26 D;  1KFX L;  2OPO A;  3CR4 X;  3DVJ A;  2MHH A;  3BOW A;  1SL7 A;  1SMG A;  2NCO A;  1LXF C;  2Y1N A;  3EVR A;  2LAP A;  1AK8 A;  4FQO A;  2BE4 A;  1UHH A;  1YTZ C;  1IRJ A;  1OOJ A;  4P2Y B;  3RLZ A;  1JC2 A;  3BUO B;  3I5H B;  4DS7 A;  1K9U A;  1UUR A;  3IQO A;  3I5I C;  2OTG C;  1CFF A;  1QIW A;  2KFG A;  3KPX A;  1EG4 A;  2ZNE A;  5AEQ A;  1S3P A;  1TOP A;  1UHI A;  1EH2 A;  1TNW A;  1JF2 A;  2E6W A;  4OV2 A;  1QXP A;  3I5G C;  4JQ0 D;  5CSN A;  2HQ8 A;  1PRW A;  2MAZ A;  1M63 B;  1NX0 A;  1FI5 A;  3KHE A;  2LUC A;  4R1E A;  2JTT A;  1D1O A;  3VRN A;  1JUO A;  1CTR A;  1A4P A;  4AQJ A;  3SG2 A;  2ZFD A;  3TDU A;  3WNX B;  1IG5 A;  2O60 A;  3BUM B;  3AAJ A;  1R2U A;  3EKH A;  3O6B A;  1FPW A;  3LK0 A;  1OMR A;  2LV7 A;  4OCI A;  1ODB A;  3SG4 A;  2JUL A;  5DKN A;  4GPL B;  2WCB A;  4ORA B;  1K94 A;  2QPT A;  1J7Q A;  1QLK A;  2KI6 C;  2LVK A;  4GFT A;  4QJ3 B;  2JWW A;  2LLU A;  1VRK A;  1B47 A;  1WLM A;  1YX7 A;  2WOS A;  2KQY A;  2LHI A;  3DVM A;  1EJ3 A;  1SR6 C;  2CT9 A;  2HQW A;  2MA2 A;  3D0Y A;  3NSI A;  1B1G A;  1FW4 A;  3GK1 A;  4PAL A;  4YGA A;  1M31 A;  2WC8 A;  1XYD A;  2VRG A;  1JBA A;  2KI4 B;  1KK8 C;  1FI6 A;  1GGW A;  1DJH A;  1GJY A;  4YI8 A;  1CMG A;  2EC6 C;  2SCP A;  4Q04 A;  1K93 D;  1ALW A;  3HX4 A;  1TCF A;  1G4Y R;  1IJ6 A;  3BXK A;  3CTN A;  1IQ3 A;  1KFX S;  3TDZ A;  3CS1 A;  2ZRT A;  4GGN A;  1DF0 B;  3OP0 A;  5I2L A;  1NX3 A;  1NYA A;  2A4J A;  2K0J A;  3O2P A;  2G9B A;  2LLS A;  2BCA A;  2F3Y A;  5HKW A;  1DJZ A;  2L51 A;  2LAN A;  1KK8 B;  1KWO C;  1TN4 A;  1JWD A;  2KYF A;  4GBA A;  4PE0 A;  1QIV A;  2KQ6 A;  1DJX A;  2KGB C;  1EG3 A;  2MBX A;  2M7N A;  1ZMZ A;  1KCY A;  4MSP A;  2KYC A;  2LM5 A;  1BU3 A;  1B7T Z;  4NQG A;  1CDP A;  1NSH A;  1QTX A;  1YX8 A;  1DJW A;  1RK9 A;  1XFU O;  4C0J A;  2K7B A;  4CFQ A;  1SKT A;  3H4S E;  2JOJ A;  1AJ5 A;  4A4B A;  1K8U A;  3TS5 C;  4U8D A;  1XFZ O;  1TIZ A;  2JXC A;  1C7W A;  1B4C A;  1AJ4 A;  2BKI B;  1U5I B;  1QX7 A;  2NCP A;  1NCY A;  1SW8 A;  2ZRS A;  4FTG A;  4PE4 A;  2LVI A;  3EVV A;  4ETO A;  3MSE B;  2LMT A;  2M8U A;  4MEW A;  2PSR A;  3WXA A;  4XJK B;  1SL8 A;  1LKJ A;  1HT9 A;  5D7F A;  4GUK A;  2WOR A;  4CID A;  1TNX A;  3BYA A;  2MRD A;  3PLF B;  1GQM A;  1B8R A;  1MQ1 A;  3BQ3 A;  5CSJ A;  1ZUZ A;  2ZND A;  1QV1 A;  5TNC A;  2K7O A;  2K8M B;  3SJS A;  1NIW A;  3GOF A;  1AHR A;  3I5F B;  1BR4 B;  1ZAC A;  2KDH A;  2LC5 A;  3JVT C;  5ER4 X;  1UHJ A;  3IF7 A;  1CLB A;  4JPZ B;  1XFW O;  4PHK A;  4BY4 A;  2LP2 A;  1XK4 A;  1CDM A;  2FOT A;  1A75 B;  2K2F A;  4AQI A;  3EK8 A;  3LL8 B;  3PFV A;  4PCW A;  1KQM B;  4YRU A;  1XK4 C;  4WQ3 A;  5DKQ A;  1ZFS A;  2ZN8 A;  3WHT B;  1UWO A;  1EL4 A;  1OZO A;  3M0W A;  2F2P A;  1IGV A;  3ZNI A;  1M45 A;  1WDC B;  2PMY A;  4GGF A;  3SIB A;  2LVV A;  2JT8 A;  3HCM A;  2F33 A;  1KK7 Z;  3AKB A;  1YUT A;  2GGM A;  5CSI A;  3FS7 A;  1K2H A;  2M3W A;  1CMF A;  1MWN A;  1SCV A;  2L2E A;  1ZOT B;  4IL1 A;  1G33 A;  4ICB A;  3NSL A;  3RM1 A;  1V1G A;  4I5N B;  3BOW B;  1CFP A;  1L7Z A;  5D69 A;  4D1E A;  5FYX A;  2CBL A;  1QAT A;  5HLO A;  3DF0 A;  4M2P A;  4YGE B;  2BE6 A;  3I5I B;  3ZWH A;  1BF5 A;  1BR1 B;  2OTG B;  1PUL A;  5AXI A;  1AP4 A;  1OE9 B;  1TCO B;  4PHM A;  1YUU A;  1TRF A;  1RWY A;  2AAO A;  1NUB A;  4UPG A;  2BL0 C;  1KSM A;  2NZ0 A;  5HLV A;  3SIA A;  3SG6 A;  3I5G B;  1RFJ A;  2K7D A;  3WHU B;  3D10 A;  1K9P A;  2Q91 A;  5K89 A;  1M39 A;  4PE7 A;  4USL A;  5KTY A;  2CXJ A;  2FCE A;  3QRX A;  1DMO A;  1YR5 A;  2AUC A;  4GAO A;  1C7V A;  2H2K A;  2H61 A;  2JU0 A;  2CTN A;  2L4H A; 
#chains in the Genus database with same CATH topology
 2KGR A;  1DJY A;  1A2X A;  3FWC A;  4JKT A;  1Z2C B;  1XFX O;  1YRU B;  2I94 A;  1FF1 A;  1PK0 D;  4WRI A;  1TNQ A;  3S0D A;  2BAP A;  3ICB A;  3VB1 A;  1NCX A;  1J55 A;  2I7A A;  3OB2 B;  3R1V A;  4M2O A;  1IKU A;  1KFU L;  2LUX A;  2M1U A;  3BUX B;  3NSO A;  4HSZ A;  1Y1X A;  1CNP A;  1NPQ A;  2HET A;  3IVT A;  3CGA A;  1SR6 B;  2HPS A;  2D8N A;  1Y1A A;  1S5G Y;  2P70 A;  4MZK A;  3LK1 A;  4OZD A;  2WCL A;  1TTX A;  3EG5 B;  1NWD A;  1OMV A;  1X02 A;  2O5G A;  1R6P A;  3RZS A;  3D0Y B;  5JOL A;  2I2R E;  1DJI A;  3D75 A;  3D74 A;  2FJY A;  3EK4 A;  3SG7 A;  1DEL A;  1PSR A;  2EC6 B;  2QDI A;  3PN7 C;  2WND A;  3TDI A;  4QJ5 B;  1OSA A;  2MLF C;  2K61 A;  1DJG A;  1DT7 B;  2KSP A;  3FE6 A;  2BBM A;  1BLQ A;  3PSR A;  5I2O A;  1S1E A;  1J7R A;  1BG1 A;  1DGV A;  1XO5 A;  1PVB A;  1QS7 A;  1Y6W A;  3R1P A;  3S0A A;  1K96 A;  2KAY A;  1JF0 A;  1A29 A;  2KBI A;  3FWB A;  4YGD B;  2MLE C;  1C3Y A;  2IS9 A;  1UHK A;  2NXQ A;  2YGU A;  1SBJ A;  2BCX A;  3UNW A;  1QX5 B;  2L4I A;  1KWO B;  4I5L B;  1REC A;  2CCM A;  1TWO A;  1XA5 A;  1BJF A;  2P71 A;  1S6C A;  1OMD A;  2JT0 A;  1OW4 A;  3LCP C;  3KO0 A;  1RRO A;  4MBE A;  4KYN A;  2LMU A;  3SS5 A;  2KOT A;  4NDD A;  2BKH B;  4CFR A;  1J1D A;  1CB1 A;  4QJ4 B;  1CM4 A;  1WRK A;  5GQQ C;  2JC2 A;  2KI6 D;  3FE8 A;  3GK2 A;  1F54 A;  1DGU A;  2M1K B;  1FBV A;  1PAL A;  3CAB A;  3CR2 A;  3N7H A;  3PAT A;  4ORC B;  1PSB A;  1S6J A;  4JWQ A;  1QVI Y;  2R2I A;  5G08 A;  2M7L A;  2BEC A;  1RTP 1;  2COL B;  3TS5 B;  2LVJ A;  1YUR A;  3JTD C;  1QWV A;  2WCM A;  3FE9 A;  2M9G A;  4CPV A;  2G2B A;  1F8H A;  3VRO A;  4PHN A;  1SRA A;  3AAK A;  2I18 A;  2FJU B;  1A75 A;  2FCD A;  2LLT A;  2Y4Q A;  2E30 A;  1TNP A;  3BUN B;  1KQV A;  1SYM A;  1HQV A;  5HKZ A;  1LVC D;  1CDL A;  3CZT X;  3DVK A;  1B1G A;  1NX2 A;  2MJW B;  3I5H C;  2AMI A;  4MZJ A;  3OHM B;  1B7T Y;  2P6B B;  1JFK A;  1F4O A;  4PDZ A;  1QAS A;  3JTD B;  1XFY O;  2JPO A;  2L50 A;  3B7A A;  2HF5 A;  1Y1U A;  3JVT B;  1W7J B;  1WY9 A;  4GGF C;  3EK7 A;  3VGO A;  3DXL A;  2LHL A;  2WCE A;  4N1G A;  1YVL A;  3BUW B;  1NCZ A;  4HRG A;  1W7I B;  2QEB A;  1S36 A;  5I8N A;  1M46 A;  3E3R A;  1QLS A;  2L2C A;  5DKR A;  2KAX A;  2PVB A;  4DIR A;  5IBW A;  2K2A A;  2ISD A;  4M2Q A;  1YUS A;  4GNK B;  3PM2 A;  1B9A A;  2JTZ A;  2EGD A;  1E8A A;  3DZT A;  5JJG A;  2GGZ A;  1C07 A;  3O78 A;  2KAV A;  1MXE A;  3R72 A;  4MVF A;  1B8L A;  2F8P A;  1LA3 A;  4MRX A;  3NXA A;  1GGZ A;  2F3Z A;  1SSE B;  1S5G Z;  2JZI A;  1K95 A;  3BFB A;  1SK6 D;  1ORG A;  1DTL A;  1QJT A;  3L47 A;  2L98 A;  4ZCU A;  3A8R A;  2KHN A;  4CLN A;  4DRW A;  2PAL A;  4ZCV A;  1V1F A;  1LIN A;  1NX1 A;  1MF8 B;  1J1E A;  5CPV A;  4I5K A;  4L9M A;  2H61 C;  2KI4 C;  1F55 A;  1WRL A;  4YI9 A;  4YBH B;  3L4A A;  3LLE A;  4HRE E;  4C0L A;  3DF0 B;  2JT3 A;  5B8I B;  2K60 A;  5BPJ A;  1CDN A;  1CFC A;  1AUI B;  1F71 A;  1NP8 A;  1H4B A;  1XFR A;  2BL0 B;  3VRQ A;  1SPY A;  1UHN A;  3CWG A;  1J7P A;  2PAS A;  3TUY C;  2M0R A;  1N65 A;  2QAC A;  4XYN A;  2M29 A;  5KU1 A;  1DF0 A;  2RGI A;  2EHB A;  4YGC B;  1ALV A;  3EKJ A;  4E68 A;  4IJ7 A;  3C1V A;  1K9K A;  1MHO A;  3IQQ A;  4A4C A;  2BBN A;  1F4Q A;  1KK7 Y;  1L2O C;  2LNK A;  2Y5I A;  5F6T A;  1WRZ A;  3PM8 A;  2JXL A;  2OS8 C;  2JNX A;  2LCP A;  5HKY A;  3UO9 A;  1F70 A;  3TZ1 A;  3KF9 A;  3VRP A;  2NLN A;  4ORB B;  3GK4 X;  1SY9 A;  1SNL A;  1CM1 A;  3OX6 A;  1MR8 A;  2LE9 B;  4OVN F;  4PHJ A;  1DVI A;  3EVU A;  4BY5 A;  1IIO A;  1S6I A;  2B1U A;  3D77 A;  1AVS A;  1XVJ A;  1J7O A;  1SCM C;  1Y0V H;  1XFV O;  2JNF A;  1H8B A;  3CR5 X;  2M97 A;  3BJH A;  3AKA A;  3DVE A;  4I5J A;  4PE1 A;  2L0P A;  1MUX A;  3FIA A;  1BT6 A;  1IJ5 A;  3OB1 B;  3TUY B;  1CLL A;  4MLW A;  3SS4 A;  2KFH A;  1BOC A;  3B86 A;  1QVI Z;  2JRF A;  2L5Y A;  1YRT B;  1L2O B;  4OR9 B;  1UP5 A;  1OQP A;  2OS8 B;  3OX5 A;  4C0K A;  4MN0 A;  5D3O A;  2JQ6 A;  4NDC A;  1B8C A;  2WCF A;  3BFA A;  1U5I A;  4TNC A;  1IWQ A;  2KLD A;  4F0Z B;  1JFJ A;  2SAS A;  1Q80 A;  2ZKM X;  3SG3 A;  2BCB A;  4INW A;  2TN4 A;  1SCM B;  4FQT A;  1G8I A;  3B88 A;  1N0Y A;  1QX2 A;  4XJK A;  3CZ2 A;  5I94 A;  3PN7 B;  5AER A;  1K90 D;  2GV5 A;  3OBV A;  3NSK A;  1WLZ A;  3S0B A;  1CLM A;  5CSF A;  2DOQ A;  2F2O A;  1A03 A;  1JSA A;  5J3X A;  3SG5 A;  2CNP A;  3L4L A;  1BOD A;  2JPT A;  2Q4U A;  5AFP A;  1KSO A;  1TUJ A;  1LA0 A;  3F45 A;  3O4X A;  3CLN A;  4MZL A;  4N5X A;  2H8V A;  1CKK A;  1MXL C;  5AAN A;  4DCK A;  1BMO A;  1PVA A;  2PRU A;  3CZ1 A;  3KEV A;  5HYD A;  3DD4 A;  4JD9 A;  4NDB A;  1QV0 A;  3A4U B;  5HL1 A;  2ZN9 A;  1N2D A;  2LMV A;  2KNE A;  4MRY A;  5FI7 A;  4AOM A;  3I5F C;  4P5O E;  1RJV A;  2KBM A;  3K21 A;  5I2Q A;  2L5X B;  3K1E A;  4N1F A;  3VRR A;  1OZS A;  2Y1M A;  1EXR A;  1KQM C;  1SL9 A;  2KFF A;  2V53 A;  1IQ5 A;  2K7C A;  4OKH A;  3O4Y A;  1KFU S;  2LP3 A;  2M49 B;  1CFD A;  3PAL A;  4YGB B;  1YVH A;  1OOI X;  5ER5 A;  1UUS A;  5PAL A;  2QEV A;  4DUQ A;  5KSZ A;  1P28 A;  1WDC C;  3NGV A;  4HRH A;  4WQ2 A;  1TUZ A;  1S26 D;  5FI2 A;  1KFX L;  2OPO A;  2PQL A;  3CR4 X;  3DVJ A;  2MHH A;  3BOW A;  1SL7 A;  1SMG A;  3S0E A;  2NCO A;  1LXF C;  2Y1N A;  3EVR A;  2LAP A;  1AK8 A;  4FQO A;  2BE4 A;  1UHH A;  1YTZ C;  1IRJ A;  1OOJ A;  4P2Y B;  3RLZ A;  1JC2 A;  3BUO B;  3I5H B;  4DS7 A;  1K9U A;  1UUR A;  3IQO A;  3I5I C;  2OTG C;  1CFF A;  1QIW A;  2KFG A;  3KPX A;  1EG4 A;  2ZNE A;  5AEQ A;  1S3P A;  1TOP A;  1UHI A;  1EH2 A;  1TNW A;  1JF2 A;  1OOG A;  2E6W A;  4OV2 A;  1QXP A;  3I5G C;  4JQ0 D;  5CSN A;  2HQ8 A;  1PRW A;  2MAZ A;  1M63 B;  1NX0 A;  1FI5 A;  3KHE A;  2LUC A;  3Q8I A;  4R1E A;  2JTT A;  1D1O A;  3VRN A;  1JUO A;  1CTR A;  1A4P A;  4AQJ A;  3SG2 A;  2ZFD A;  3TDU A;  2WCJ A;  3WNX B;  4INX A;  1IG5 A;  2O60 A;  3CDN A;  3BUM B;  3AAJ A;  1R2U A;  3EKH A;  3O6B A;  1GM0 A;  1FPW A;  3LK0 A;  1OMR A;  2LV7 A;  4OCI A;  1ODB A;  1DQE A;  2JUL A;  5DKN A;  3SG4 A;  4GPL B;  3V2L A;  2WCB A;  4ORA B;  1K94 A;  2QPT A;  4F7F A;  1J7Q A;  1QLK A;  2ERB A;  2KI6 C;  2LVK A;  4GFT A;  4QJ3 B;  2JWW A;  1DEK A;  2LLU A;  1VRK A;  1B47 A;  1WLM A;  1YX7 A;  2WOS A;  2KQY A;  2LHI A;  3DVM A;  1EJ3 A;  1SR6 C;  2CT9 A;  1W9Z A;  2HQW A;  2MA2 A;  3D0Y A;  2GTE A;  1FW4 A;  3GK1 A;  3NSI A;  4PAL A;  4YGA A;  1M31 A;  2WC8 A;  1XYD A;  2VRG A;  1JBA A;  2KI4 B;  1KK8 C;  1FI6 A;  1GGW A;  1DJH A;  1GJY A;  3SS3 A;  2WC6 A;  4YI8 A;  1IH0 A;  3B6X A;  2PYQ A;  1CMG A;  2EC6 C;  3CYZ A;  2SCP A;  4Q04 A;  1K93 D;  1ALW A;  3HX4 A;  1TCF A;  3DY9 A;  3OGN A;  1G4Y R;  1IJ6 A;  3BXK A;  3CTN A;  1IQ3 A;  1KFX S;  3TDZ A;  2WC5 A;  3CS1 A;  2ZRT A;  4GGN A;  1DF0 B;  3OP0 A;  5I2L A;  1NX3 A;  1NYA A;  2A4J A;  2K0J A;  3O2P A;  3D73 A;  2G9B A;  2LLS A;  3B87 A;  2BCA A;  1Z4H A;  2F3Y A;  5HKW A;  1DJZ A;  2L51 A;  2LAN A;  1KK8 B;  1KWO C;  1TN4 A;  1JWD A;  2KYF A;  4GBA A;  2WCK A;  4PE0 A;  1QIV A;  2KQ6 A;  1DJX A;  2KGB C;  1EG3 A;  2MBX A;  5EL2 A;  2M7N A;  1ZMZ A;  1KCY A;  4MSP A;  2KYC A;  2LM5 A;  1BU3 A;  1B7T Z;  4NQG A;  1CDP A;  1NSH A;  1QTX A;  1YX8 A;  1DJW A;  1RK9 A;  1XFU O;  4C0J A;  2K7B A;  4CFQ A;  1SKT A;  3H4S E;  2JOJ A;  1AJ5 A;  4A4B A;  1K8U A;  3TS5 C;  4U8D A;  1XFZ O;  1TIZ A;  2JXC A;  2QEH A;  1C7W A;  1B4C A;  1AJ4 A;  2BKI B;  5FI6 A;  1U5I B;  1QX7 A;  2NCP A;  1NCY A;  1SW8 A;  4PT1 A;  2ZRS A;  4FTG A;  4PE4 A;  2LVI A;  3EVV A;  4ETO A;  3MSE B;  2LMT A;  2M8U A;  4MEW A;  2PSR A;  3WXA A;  2WCH A;  4XJK B;  1SL8 A;  1LKJ A;  1HT9 A;  5D7F A;  4GUK A;  2WOR A;  4CID A;  1OOF A;  1TNX A;  3PJI A;  3BYA A;  3D76 A;  2MRD A;  2QEO A;  3DYE A;  3PLF B;  1GQM A;  1B8R A;  1MQ1 A;  3BQ3 A;  5CSJ A;  1ZUZ A;  2ZND A;  1QV1 A;  5TNC A;  2K7O A;  2K8M B;  3SJS A;  1NIW A;  1C3Z A;  3GOF A;  1AHR A;  3I5F B;  1BR4 B;  1ZAC A;  2KDH A;  2LC5 A;  3JVT C;  3BFH A;  5ER4 X;  1UHJ A;  3IF7 A;  1CLB A;  4JPZ B;  1XFW O;  4PHK A;  4BY4 A;  2LP2 A;  1XK4 A;  3S0F A;  1CDM A;  2FOT A;  1A75 B;  2K2F A;  4AQI A;  3S0G A;  3EK8 A;  3LL8 B;  3PFV A;  4PCW A;  1KQM B;  4YRU A;  1XK4 C;  5DIC A;  4WQ3 A;  5DKQ A;  1ZFS A;  2ZN8 A;  3WHT B;  1UWO A;  1EL4 A;  1OZO A;  3M0W A;  2F2P A;  1IGV A;  3ZNI A;  1M45 A;  1WDC B;  2PMY A;  4GGF A;  2KPH A;  3SIB A;  2LVV A;  3NHI A;  3R1O A;  2JT8 A;  3HCM A;  2F33 A;  1KK7 Z;  3AKB A;  1YUT A;  2GGM A;  5CSI A;  3FS7 A;  1K2H A;  2M3W A;  1CMF A;  1MWN A;  1SCV A;  2L2E A;  1ZOT B;  4IL1 A;  1G33 A;  4ICB A;  3NSL A;  3RM1 A;  1DC1 A;  1V1G A;  4I5N B;  3BOW B;  1CFP A;  1L7Z A;  5D69 A;  3NHT A;  4D1E A;  1LS8 A;  2CBL A;  5FYX A;  1QAT A;  3CZ0 A;  5HLO A;  3DF0 A;  4M2P A;  4YGE B;  3D78 A;  2BE6 A;  3I5I B;  3ZWH A;  1BF5 A;  1BR1 B;  2OTG B;  1PUL A;  5AXI A;  1AP4 A;  1OE9 B;  1TCO B;  4PHM A;  1YUU A;  1TRF A;  1RWY A;  2AAO A;  1OOH A;  1NUB A;  4UPG A;  2BL0 C;  1KSM A;  2NZ0 A;  5HLV A;  3SIA A;  3SG6 A;  3I5G B;  1RFJ A;  2K7D A;  3WHU B;  3D10 A;  1K9P A;  2Q91 A;  5K89 A;  1M39 A;  2BNX A;  4PE7 A;  4USL A;  2CXJ A;  5KTY A;  2FCE A;  2KLE A;  3QRX A;  1DMO A;  1YR5 A;  2AUC A;  4GAO A;  1T14 A;  2H2K A;  2H61 A;  1C7V A;  2JU0 A;  2CTN A;  3QME A;  2L4H A; 
#chains in the Genus database with same CATH homology
 2KGR A;  1DJY A;  1A2X A;  3FWC A;  1XFX O;  1YRU B;  2I94 A;  1FF1 A;  1PK0 D;  4WRI A;  1TNQ A;  3ICB A;  1NCX A;  1J55 A;  2I7A A;  3OB2 B;  4M2O A;  1IKU A;  1KFU L;  2LUX A;  2M1U A;  3BUX B;  3NSO A;  4HSZ A;  1Y1X A;  1CNP A;  1NPQ A;  2HET A;  3CGA A;  1SR6 B;  2HPS A;  2D8N A;  1Y1A A;  1S5G Y;  4MZK A;  3LK1 A;  1TTX A;  1NWD A;  1OMV A;  1X02 A;  2O5G A;  1R6P A;  3D0Y B;  5JOL A;  2I2R E;  1DJI A;  3EK4 A;  3SG7 A;  1PSR A;  2EC6 B;  3PN7 C;  2WND A;  3TDI A;  4QJ5 B;  1OSA A;  2MLF C;  2K61 A;  1DJG A;  1DT7 B;  2KSP A;  2BBM A;  1BLQ A;  3PSR A;  5I2O A;  1S1E A;  1J7R A;  1BG1 A;  1DGV A;  1XO5 A;  1PVB A;  1QS7 A;  1Y6W A;  1K96 A;  2KAY A;  1JF0 A;  1A29 A;  2KBI A;  3FWB A;  4YGD B;  2MLE C;  2IS9 A;  1UHK A;  2NXQ A;  1SBJ A;  2BCX A;  1QX5 B;  2L4I A;  1KWO B;  4I5L B;  1REC A;  2CCM A;  1XA5 A;  1BJF A;  1S6C A;  1OMD A;  2JT0 A;  3LCP C;  3KO0 A;  1RRO A;  4MBE A;  2LMU A;  2KOT A;  4NDD A;  2BKH B;  4CFR A;  1J1D A;  1CB1 A;  4QJ4 B;  1CM4 A;  1WRK A;  5GQQ C;  2JC2 A;  2KI6 D;  3GK2 A;  1F54 A;  1DGU A;  2M1K B;  1FBV A;  1PAL A;  3PAT A;  3CR2 A;  4ORC B;  1PSB A;  1S6J A;  4JWQ A;  1QVI Y;  2R2I A;  5G08 A;  2M7L A;  2COL B;  2BEC A;  1RTP 1;  3TS5 B;  2LVJ A;  1YUR A;  3JTD C;  4CPV A;  2M9G A;  2G2B A;  1F8H A;  3VRO A;  4PHN A;  1SRA A;  3AAK A;  2I18 A;  2FJU B;  1A75 A;  2FCD A;  2LLT A;  2Y4Q A;  2E30 A;  1TNP A;  3BUN B;  1KQV A;  1SYM A;  1HQV A;  5HKZ A;  1LVC D;  1CDL A;  3CZT X;  3DVK A;  1NX2 A;  2MJW B;  3I5H C;  2AMI A;  4MZJ A;  3OHM B;  1B7T Y;  2P6B B;  1JFK A;  1F4O A;  4PDZ A;  1QAS A;  3JTD B;  1XFY O;  2L50 A;  2HF5 A;  1Y1U A;  3JVT B;  1W7J B;  1WY9 A;  4GGF C;  3EK7 A;  3VGO A;  2LHL A;  2WCE A;  4N1G A;  1YVL A;  3BUW B;  1NCZ A;  4HRG A;  1W7I B;  5I8N A;  1S36 A;  1M46 A;  3E3R A;  1QLS A;  5DKR A;  2KAX A;  2PVB A;  4DIR A;  5IBW A;  2K2A A;  2ISD A;  4M2Q A;  1YUS A;  4GNK B;  1B9A A;  2JTZ A;  2EGD A;  1E8A A;  5JJG A;  2GGZ A;  1C07 A;  3O78 A;  2KAV A;  1MXE A;  4MVF A;  1B8L A;  2F8P A;  1LA3 A;  4MRX A;  3NXA A;  1GGZ A;  2F3Z A;  1S5G Z;  2JZI A;  1K95 A;  1SK6 D;  1DTL A;  1QJT A;  2L98 A;  4ZCU A;  3A8R A;  2KHN A;  4CLN A;  4DRW A;  2PAL A;  4ZCV A;  1V1F A;  1LIN A;  1NX1 A;  1MF8 B;  1J1E A;  5CPV A;  4I5K A;  4L9M A;  2H61 C;  2KI4 C;  1F55 A;  1WRL A;  4YI9 A;  4YBH B;  3LLE A;  4HRE E;  4C0L A;  3DF0 B;  2JT3 A;  5B8I B;  5BPJ A;  1CFC A;  1CDN A;  1F71 A;  1AUI B;  1NP8 A;  1H4B A;  2BL0 B;  3VRQ A;  1J7P A;  1SPY A;  1UHN A;  3CWG A;  1IH0 A;  2PAS A;  3TUY C;  2M0R A;  1N65 A;  2QAC A;  4XYN A;  2M29 A;  5KU1 A;  1DF0 A;  2RGI A;  2EHB A;  4YGC B;  1ALV A;  3EKJ A;  4E68 A;  3C1V A;  1K9K A;  1MHO A;  3IQQ A;  4A4C A;  2BBN A;  1F4Q A;  1KK7 Y;  1L2O C;  2LNK A;  2Y5I A;  5F6T A;  1WRZ A;  3PM8 A;  2JXL A;  2OS8 C;  2JNX A;  2LCP A;  5HKY A;  1F70 A;  3TZ1 A;  3KF9 A;  3VRP A;  2NLN A;  4ORB B;  3GK4 X;  1SY9 A;  1SNL A;  1CM1 A;  3OX6 A;  1MR8 A;  2LE9 B;  4OVN F;  4PHJ A;  1DVI A;  3EVU A;  4BY5 A;  1S6I A;  2B1U A;  1AVS A;  1XVJ A;  1J7O A;  1SCM C;  1Y0V H;  1XFV O;  2JNF A;  1H8B A;  3CR5 X;  2M97 A;  3AKA A;  3DVE A;  4I5J A;  4PE1 A;  2L0P A;  1MUX A;  3FIA A;  1BT6 A;  1IJ5 A;  3OB1 B;  3TUY B;  1CLL A;  4MLW A;  2KFH A;  1BOC A;  1QVI Z;  2JRF A;  1YRT B;  1L2O B;  4OR9 B;  1UP5 A;  1OQP A;  2OS8 B;  3OX5 A;  4C0K A;  4MN0 A;  2JQ6 A;  4NDC A;  1B8C A;  2WCF A;  1U5I A;  4TNC A;  1IWQ A;  4F0Z B;  1JFJ A;  2SAS A;  1Q80 A;  2ZKM X;  3SG3 A;  2BCB A;  2TN4 A;  1SCM B;  1G8I A;  4XJK A;  1N0Y A;  1QX2 A;  3PN7 B;  5AER A;  1K90 D;  2GV5 A;  3NSK A;  1WLZ A;  1CLM A;  5CSF A;  2DOQ A;  2F2O A;  1A03 A;  1JSA A;  5J3X A;  3SG5 A;  2CNP A;  1BOD A;  2JPT A;  2Q4U A;  5AFP A;  1KSO A;  1LA0 A;  3F45 A;  3CLN A;  4MZL A;  4N5X A;  1CKK A;  1MXL C;  5AAN A;  4DCK A;  1BMO A;  1PVA A;  2PRU A;  3KEV A;  5HYD A;  3DD4 A;  4NDB A;  1QV0 A;  3A4U B;  2ZN9 A;  1N2D A;  2LMV A;  2KNE A;  4MRY A;  4AOM A;  3I5F C;  4P5O E;  1RJV A;  2KBM A;  3K21 A;  5I2Q A;  2L5X B;  4N1F A;  3VRR A;  1OZS A;  2Y1M A;  1EXR A;  1KQM C;  1SL9 A;  2KFF A;  2V53 A;  1IQ5 A;  2K7C A;  4OKH A;  3O4Y A;  1KFU S;  2LP3 A;  2M49 B;  1CFD A;  3PAL A;  4YGB B;  1YVH A;  5ER5 A;  4DUQ A;  1UUS A;  5PAL A;  5KSZ A;  1WDC C;  4HRH A;  4WQ2 A;  1S26 D;  1KFX L;  2OPO A;  3CR4 X;  3DVJ A;  2MHH A;  3BOW A;  1SL7 A;  1SMG A;  2NCO A;  1LXF C;  2Y1N A;  3EVR A;  2LAP A;  1AK8 A;  4FQO A;  2BE4 A;  1UHH A;  1YTZ C;  1IRJ A;  1OOJ A;  4P2Y B;  3RLZ A;  1JC2 A;  3BUO B;  3I5H B;  4DS7 A;  1K9U A;  1UUR A;  3IQO A;  3I5I C;  2OTG C;  1CFF A;  1QIW A;  2KFG A;  3KPX A;  1EG4 A;  2ZNE A;  5AEQ A;  1S3P A;  1TOP A;  1UHI A;  1EH2 A;  1TNW A;  1JF2 A;  2E6W A;  4OV2 A;  1QXP A;  3I5G C;  4JQ0 D;  5CSN A;  2HQ8 A;  1PRW A;  2MAZ A;  1M63 B;  1NX0 A;  1FI5 A;  3KHE A;  2LUC A;  4R1E A;  2JTT A;  1D1O A;  3VRN A;  1JUO A;  1CTR A;  1A4P A;  4AQJ A;  3SG2 A;  2ZFD A;  3TDU A;  3WNX B;  1IG5 A;  2O60 A;  3BUM B;  3AAJ A;  1R2U A;  3EKH A;  3O6B A;  1FPW A;  3LK0 A;  1OMR A;  2LV7 A;  4OCI A;  1ODB A;  3SG4 A;  2JUL A;  5DKN A;  4GPL B;  2WCB A;  4ORA B;  1K94 A;  2QPT A;  1J7Q A;  1QLK A;  2KI6 C;  2LVK A;  4GFT A;  4QJ3 B;  2JWW A;  2LLU A;  1VRK A;  1B47 A;  1WLM A;  1YX7 A;  2WOS A;  2KQY A;  2LHI A;  3DVM A;  1EJ3 A;  1SR6 C;  2CT9 A;  2HQW A;  2MA2 A;  3D0Y A;  3NSI A;  1B1G A;  1FW4 A;  3GK1 A;  4PAL A;  4YGA A;  1M31 A;  2WC8 A;  1XYD A;  2VRG A;  1JBA A;  2KI4 B;  1KK8 C;  1FI6 A;  1GGW A;  1DJH A;  1GJY A;  4YI8 A;  1CMG A;  2EC6 C;  2SCP A;  4Q04 A;  1K93 D;  1ALW A;  3HX4 A;  1TCF A;  1G4Y R;  1IJ6 A;  3BXK A;  3CTN A;  1IQ3 A;  1KFX S;  3TDZ A;  3CS1 A;  2ZRT A;  4GGN A;  1DF0 B;  3OP0 A;  5I2L A;  1NX3 A;  1NYA A;  2A4J A;  2K0J A;  3O2P A;  2G9B A;  2LLS A;  2BCA A;  2F3Y A;  5HKW A;  1DJZ A;  2L51 A;  2LAN A;  1KK8 B;  1KWO C;  1TN4 A;  1JWD A;  2KYF A;  4GBA A;  4PE0 A;  1QIV A;  2KQ6 A;  1DJX A;  2KGB C;  1EG3 A;  2MBX A;  2M7N A;  1ZMZ A;  1KCY A;  4MSP A;  2KYC A;  2LM5 A;  1BU3 A;  1B7T Z;  4NQG A;  1CDP A;  1NSH A;  1QTX A;  1YX8 A;  1DJW A;  1RK9 A;  1XFU O;  4C0J A;  2K7B A;  4CFQ A;  1SKT A;  3H4S E;  2JOJ A;  1AJ5 A;  4A4B A;  1K8U A;  3TS5 C;  4U8D A;  1XFZ O;  1TIZ A;  2JXC A;  1C7W A;  1B4C A;  1AJ4 A;  2BKI B;  1U5I B;  1QX7 A;  2NCP A;  1NCY A;  1SW8 A;  2ZRS A;  4FTG A;  4PE4 A;  2LVI A;  3EVV A;  4ETO A;  3MSE B;  2LMT A;  2M8U A;  4MEW A;  2PSR A;  3WXA A;  4XJK B;  1SL8 A;  1LKJ A;  1HT9 A;  5D7F A;  4GUK A;  2WOR A;  4CID A;  1TNX A;  3BYA A;  2MRD A;  3PLF B;  1GQM A;  1B8R A;  1MQ1 A;  3BQ3 A;  5CSJ A;  1ZUZ A;  2ZND A;  1QV1 A;  5TNC A;  2K7O A;  2K8M B;  3SJS A;  1NIW A;  3GOF A;  1AHR A;  3I5F B;  1BR4 B;  1ZAC A;  2KDH A;  2LC5 A;  3JVT C;  5ER4 X;  1UHJ A;  3IF7 A;  1CLB A;  4JPZ B;  1XFW O;  4PHK A;  4BY4 A;  2LP2 A;  1XK4 A;  1CDM A;  2FOT A;  1A75 B;  2K2F A;  4AQI A;  3EK8 A;  3LL8 B;  3PFV A;  4PCW A;  1KQM B;  4YRU A;  1XK4 C;  4WQ3 A;  5DKQ A;  1ZFS A;  2ZN8 A;  3WHT B;  1UWO A;  1EL4 A;  1OZO A;  3M0W A;  2F2P A;  1IGV A;  3ZNI A;  1M45 A;  1WDC B;  2PMY A;  4GGF A;  3SIB A;  2LVV A;  2JT8 A;  3HCM A;  2F33 A;  1KK7 Z;  3AKB A;  1YUT A;  2GGM A;  5CSI A;  3FS7 A;  1K2H A;  2M3W A;  1CMF A;  1MWN A;  1SCV A;  2L2E A;  1ZOT B;  4IL1 A;  1G33 A;  4ICB A;  3NSL A;  3RM1 A;  1V1G A;  4I5N B;  3BOW B;  1CFP A;  1L7Z A;  5D69 A;  4D1E A;  5FYX A;  2CBL A;  1QAT A;  5HLO A;  3DF0 A;  4M2P A;  4YGE B;  2BE6 A;  3I5I B;  3ZWH A;  1BF5 A;  1BR1 B;  2OTG B;  1PUL A;  5AXI A;  1AP4 A;  1OE9 B;  1TCO B;  4PHM A;  1YUU A;  1TRF A;  1RWY A;  2AAO A;  1NUB A;  4UPG A;  2BL0 C;  1KSM A;  2NZ0 A;  5HLV A;  3SIA A;  3SG6 A;  3I5G B;  1RFJ A;  2K7D A;  3WHU B;  3D10 A;  1K9P A;  2Q91 A;  5K89 A;  1M39 A;  4PE7 A;  4USL A;  5KTY A;  2CXJ A;  2FCE A;  3QRX A;  1DMO A;  1YR5 A;  2AUC A;  4GAO A;  1C7V A;  2H2K A;  2H61 A;  2JU0 A;  2CTN A;  2L4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...