1XYDA

Nmr solution structure of rat zinc-calcium-s100b, 20 structures
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
92
structure length
92
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Zinc- and Calcium-Bound Rat S100B as Determined by Nuclear Magnetic Resonance Spectroscopy
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
molecule keywords S-100 protein, beta chain
total genus 26
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xydA00
1IKUA 1KSOA 1ODBA 2KGBC 3OX5A 5I8NA 1QX7A 4NDBA 1B8RA 1XO5A 2BL0B 3CR2A 4M2QA 1N2DA 2K0JA 3I5HB 4DS7A 2WOSA 1EH2A 4NDCA 3BOWB 1XFZO 1KK8B 1DJIA 1TNWA 4USLA 1GQMA 4GBAA 2JULA 4A4BA 3A4UB 4N1GA 2Q91A 3OHMB 2Y1NA 2BCXA 1WLMA 2LV7A 1G8IA 1QJTA 2JU0A 1NWDA 2Q4UA 4AQJA 2KYCA 4E68A 1B7TZ 3JTDB 1JFKA 1YUTA 3LCPC 1UHKA 1YRUB 2NLNA 1W7IB 1RFJA 5HKWA 1IQ3A 5I2QA 2L50A 1CM4A 1F4OA 2GV5A 1HQVA 5IBWA 2KSPA 4YGCB 1LA3A 4YGBB 4C0KA 2DOQA 1QIVA 1SW8A 1H8BA 1NX2A 3VROA 1BJFA 2G9BA 1DF0A 4YI8A 1OZOA 2H2KA 4PHMA 3ZNIA 4CLNA 1DGUA 4MLWA 3ZWHA 1A75A 1J55A 4GUKA 4Q04A 1UHIA 2OPOA 1A4PA 1ALWA 2GGMA 3ICBA 3I5HC 3BQ3A 2KHNA 1NP8A 3EKHA 4ORAB 2ZFDA 3IQQA 3LL8B 1MUXA 3PN7B 2CXJA 5CSJA 2F3YA 3M0WA 1CFDA 5DKQA 1SCMC 1A2XA 1S6CA 2M1UA 1BOCA 2AAOA 1SL9A 2LUCA 2LHLA 1KWOC 1FI5A 2BBNA 2BCAA 2EHBA 1WY9A 2KFFA 3SG4A 3O6BA 4YGAA 1CLLA 5K89A 1ALVA 1QLSA 2HQ8A 1WRLA 4QJ3B 2BE6A 1YR5A 2FOTA 3CGAA 4FTGA 1A03A 2KAXA 2JT8A 4PE0A 1LA0A 1RK9A 2Y5IA 1CB1A 1RWYA 2PSRA 2JXLA 4GGFC 4AOMA 1CMGA 2NCOA 4GGNA 2K61A 3D10A 2MBXA 2LP3A 2WORA 4JPZB 4JWQA 3FWBA 5CSIA 1Y1XA 2JOJA 4GFTA 2R2IA 3OP0A 1B9AA 2JRFA 2ZRSA 1TIZA 3H4SE 3NSIA 4F0ZB 1KK7Y 2K7DA 3DF0B 2KOTA 1RECA 3CLNA 5I2OA 3AAKA 3DVKA 1NUBA 1CFFA 2JZIA 1OZSA 2ZNDA 3SG5A 1TNXA 1QS7A 2LNKA 1J7RA 4GGFA 4OKHA 1FW4A 3I5GB 1IH0A 2EGDA 3DF0A 3VRRA 1JF2A 2KI4B 1BF5A 4U8DA 1K96A 3KHEA 1C7WA 2SCPA 1K93D 1G33A 3BUWB 3KO0A 3QRXA 1JF0A 5F6TA 5AFPA 3SG2A 3CS1A 2M97A 1NCXA 1A29A 4FQOA 4NQGA 2KNEA 1ZOTB 4PCWA 1JBAA 2LM5A 1CM1A 1B1GA 1S6JA 3SG7A 2HPSA 2JPTA 3PATA 1DJXA 1XYDA 2MA2A 1K9KA 1CDLA 1OSAA 5HYDA 4MRYA 2LLUA 4HSZA 1NCYA 1IJ6A 5KSZA 1SBJA 2I18A 2O60A 1L2OB 1BLQA 3BOWA 1ZUZA 1M63B 3TS5B 2EC6C 1L7ZA 1PRWA 1SCMB 1V1FA 2WCBA 4WQ2A 3I5FB 1IRJA 3TS5C 3I5GC 2M7LA 1EG4A 4MVFA 1QV1A 1MXEA 1KQMB 1FPWA 3HX4A 1KK7Z 1TN4A 5KTYA 1OMDA 2LMTA 1CLBA 2KFGA 2F2OA 2IS9A 3OX6A 1KCYA 3O2PA 1SKTA 1KFXS 1OE9B 1KK8C 4YGEB 1Y6WA 2LVKA 1C07A 3GK4X 5HLOA 4PDZA 5ER5A 3DVJA 1AVSA 1QVIZ 1DF0B 1QTXA 1K95A 1PK0D 2FJUB 2KI6D 2OTGC 4OCIA 4PHNA 3EK4A 3KEVA 1NPQA 2JNFA 2M49B 2PMYA 5FYXA 1FI6A 4D1EA 2KAVA 2RGIA 4MBEA 2LANA 2L4HA 3FS7A 3RM1A 2H61C 2LE9B 1J7PA 2MLFC 3MSEB 1YX7A 1J7QA 3C1VA 1UHHA 1SCVA 3IF7A 3NSKA 1EJ3A 1DJGA 1U5IB 2K7BA 3RLZA 1YUSA 1RROA 1TCOB 2AMIA 2COLB 1XFXO 4MSPA 1S5GZ 1YVHA 5G08A 4PALA 5DKNA 5CSNA 1XK4C 2AUCA 4MEWA 4QJ5B 2KI6C 3I5FC 3AKBA 4BY4A 1U5IA 3CR4X 1A75B 1MF8B 5D69A 2EC6B 1DJZA 3TUYB 1IWQA 3FWCA 2LVIA 2WCFA 3JTDC 4ETOA 2JTTA 1B8LA 4C0LA 1Q80A 1W7JB 1RJVA 3BUOB 2LMUA 1TNQA 1LINA 2ZN9A 1SL8A 3WXAA 1M46A 4CFRA 1ZACA 1XK4A 2PRUA 2K2AA 4PE7A 1CDPA 4P2YB 5AEQA 4DUQA 3LK1A 1C7VA 3GOFA 2KYFA 1VRKA 2HF5A 1SK6D 2M8UA 4GAOA 3VRPA 2JWWA 1Y1AA 3TDUA 3GK2A 2BKIB 1F8HA 1WDCC 2KQ6A 3BUXB 2NXQA 2MRDA 1DJWA 2WC8A 2KBIA 1WDCB 2LVJA 1M45A 1SY9A 3EVVA 3BXKA 5D7FA 4ZCVA 2LHIA 2H61A 1OMRA 3DD4A 4ORBB 1M39A 1YRTB 1CMFA 3PALA 3OB1B 2ZNEA 1FF1A 3A8RA 2LCPA 2CCMA 2GGZA 2F3ZA 1GGZA 4CFQA 1CDNA 2M29A 4CPVA 2MHHA 3KPXA 4DIRA 1WRKA 2ZKMX 3EK8A 4ORCB 2G2BA 3I5IB 1BODA 1EL4A 4OVNF 5ER4X 3DVMA 1TTXA 1TOPA 4MZLA 1QX5B 1YVLA 2KDHA 2OS8B 3OB2B 2BKHB 2A4JA 1B8CA 1JUOA 1K90D 3D0YB 1NIWA 4DRWA 1GJYA 5AXIA 1B4CA 4BY5A 1K9UA 1IGVA 1CNPA 4HREE 4C0JA 2L51A 3AAJA 2M3WA 1UURA 1KFUL 5J3XA 4XYNA 1K2HA 1QATA 1CDMA 2NCPA 5GQQC 3FIAA 2KQYA 4OR9B 1DGVA 1BU3A 2Y4QA 1KWOB 1KQVA 2F2PA 1KFXL 2M7NA 1FBVA 1SPYA 2JT3A 3AKAA 2MAZA 4YRUA 4JQ0D 5B8IB 3JVTC 1Y0VH 2ZN8A 1CKKA 1EG3A 1ZMZA 1XFUO 1EXRA 5I2LA 1NX1A 1N65A 1HT9A 1NX0A 2K2FA 1TCFA 1H4BA 1R2UA 4WQ3A 3CWGA 3PFVA 2CT9A 2L0PA 1JSAA 3SJSA 2HETA 1UP5A 2BCBA 2SASA 4NDDA 4ZCUA 3VGOA 1AJ5A 2LVVA 5HLVA 2L98A 1WRZA 1WLZA 3PN7C 1QVIY 3D0YA 1BR1B 2B1UA 1J7OA 1PSRA 1V1GA 2F8PA 2NZ0A 3VRNA 3EVRA 1LVCD 1XFYO 4XJKA 4YGDB 2K7CA 3VRQA 1NX3A 4P5OE 2VRGA 3SG6A 1SYMA 4YBHB 4N5XA 2LUXA 1L2OC 3PLFB 4I5JA 4A4CA 1GGWA 2WCEA 1S36A 1B7TY 2PASA 1XFWO 1TRFA 4XJKB 2K8MB 3NXAA 1MHOA 4TNCA 3BUMB 1DT7B 1UWOA 1NCZA 1KQMC 1PALA 2Y1MA 4PE1A 1JC2A 1CFCA 1F55A 1S5GY 2FCDA 1UUSA 4WRIA 2K7OA 1JWDA 3IQOA 2LP2A 3NSLA 1F54A 3O4YA 2L4IA 1NYAA 4N1FA 1AP4A 1F71A 1LXFC 4PE4A 3BYAA 5AERA 1QASA 1DVIA 4MRXA 1CLMA 1S1EA 2JXCA 5CPVA 3O78A 5JOLA 2JTZA 2F33A 3EVUA 3WHTB 1SL7A 2L5XB 1MXLC 5CSFA 3SG3A 2LLTA 1IJ5A 2QPTA 2CTNA 3DVEA 2MLEC 2BE4A 1AHRA 2I7AA 1IG5A 3TZ1A 4GPLB 1AJ4A 1BT6A 1BR4B 1QIWA 2V53A 1F70A 3CZTX 4QJ4B 2LC5A 1AUIB 1PULA 2OS8C 1SR6C 1DJHA 2PVBA 2ISDA 1K8UA 2LLSA 1YURA 2WNDA 4I5KA 1SR6B 3EK7A 2MJWB 2OTGB 4MN0A 1KFUS 1MR8A 1DMOA 2O5GA 1QXPA 4UPGA 2ZRTA 1OOJA 1SRAA 1J1DA 5HKZA 1XVJA 5AANA 3SIAA 1R6PA 2FCEA 2JNXA 1MQ1A 4GNKB 1ZFSA 4HRGA 3TDIA 1X02A 2JQ6A 1N0YA 3KF9A 2CNPA 1S6IA 1AK8A 3TDZA 4I5LB 1DTLA 1S26D 1TNPA 1F4QA 2LMVA 1J1EA 1OMVA 2P6BB 2TN4A 3I5IC 3SIBA 3CR5X 1MWNA 2CBLA 1K94A 4M2PA 5JJGA 4R1EA 4I5NB 3BUNB 4PHKA 1RTP1 1B47A 1UHJA 2QACA 4MZJA 4M2OA 1YX8A 4L9MA 2M0RA 2D8NA 1K9PA 2BBMA 2E6WA 3GK1A 4DCKA 1OQPA 3NSOA 5PALA 1G4YR 1PSBA 1XA5A 3F45A 2I2RE 2KGRA 4HRHA 3WNXB 3CTNA 3HCMA 1S3PA 2HQWA 1D1OA 1QLKA 4YI9A 2BL0C 4AQIA 2E30A 5TNCA 1IQ5A 3EKJA 3LLEA 5KU1A 3PM8A 2JC2A 2KI4C 1PVBA 1JFJA 3JVTB 1KSMA 2L2EA 1BG1A 1YUUA 2KBMA 2I94A 2M9GA 1SNLA 4OV2A 1CFPA 2BECA 1QV0A 5BPJA 4CIDA 1E8AA 3LK0A 1CTRA 2KFHA 1QX2A 1LKJA 4PHJA 3PSRA 1NSHA 5DKRA 4MZKA 1SMGA 1XFVO 2KAYA 3K21A 3WHUB 2LAPA 1UHNA 1M31A 2M1KB 2PALA 4ICBA 1YTZC 1BMOA 5HKYA 1Y1UA 3TUYC 1DJYA 1PVAA 2JT0A 4IL1A 3E3RA
chains in the Genus database with same CATH superfamily
1IKUA 1KSOA 1ODBA 2KGBC 3S0AA 3OX5A 3PM2A 2P70A 5I8NA 1QX7A 2PQLA 1B8RA 1XO5A 2BL0B 2QEBA 3CR2A 4M2QA 1N2DA 2K0JA 3I5HB 4DS7A 2WOSA 1EH2A 4NDCA 3BOWB 1XFZO 1KK8B 1DJIA 1TNWA 4USLA 1GQMA 4GBAA 2JULA 4A4BA 3A4UB 4N1GA 2Q91A 3OHMB 2Y1NA 2BCXA 1WLMA 2LV7A 1G8IA 2K60A 1QJTA 2JU0A 1NWDA 2Q4UA 4AQJA 2KYCA 4E68A 1B7TZ 3JTDB 2WCHA 1JFKA 1YUTA 3LCPC 1UHKA 1YRUB 2NLNA 1W7IB 1RFJA 5HKWA 1IQ3A 5I2QA 2L50A 1CM4A 2QEVA 1F4OA 2GV5A 1HQVA 5IBWA 1OOIX 2KSPA 4YGCB 1LA3A 4YGBB 4C0KA 2DOQA 1QIVA 1SW8A 1H8BA 1NX2A 3D74A 3VROA 1BJFA 2G9BA 1DF0A 3L4AA 4YI8A 1OZOA 2H2KA 4PHMA 3ZNIA 4CLNA 3S0FA 1DGUA 4MLWA 3ZWHA 1A75A 1J55A 4GUKA 4Q04A 1UHIA 2OPOA 1A4PA 1ALWA 2GGMA 3ICBA 3I5HC 3BQ3A 2KHNA 1NP8A 1DEKA 3EKHA 4ORAB 2ZFDA 2KLDA 3IQQA 3LL8B 1MUXA 3PN7B 2CXJA 5CSJA 2F3YA 3M0WA 1CFDA 5DKQA 1SCMC 1A2XA 1S6CA 2M1UA 1BOCA 2AAOA 1SL9A 2LUCA 2LHLA 1KWOC 1FI5A 2BBNA 2BCAA 2EHBA 1WY9A 2KFFA 3DZTA 3SG4A 3O6BA 4YGAA 1CLLA 5K89A 1ALVA 1QLSA 1WRLA 2HQ8A 4QJ3B 2BE6A 1YR5A 2FOTA 3CGAA 4FTGA 1DC1A 1A03A 2KAXA 2JT8A 4INXA 4PE0A 1LA0A 1RK9A 2Y5IA 1CB1A 1RWYA 2PSRA 2JXLA 4GGFC 4AOMA 1CMGA 2NCOA 4GGNA 2K61A 3D10A 3D78A 2LP3A 2MBXA 2WORA 4JPZB 2JPOA 4JWQA 3V2LA 3FWBA 5CSIA 1TUJA 1Y1XA 2JOJA 4GFTA 2R2IA 3OP0A 1B9AA 3NHTA 2JRFA 2ZRSA 1TIZA 3H4SE 3NSIA 4F0ZB 1KK7Y 2K7DA 3DF0B 2KOTA 1RECA 3CLNA 5I2OA 3AAKA 3DVKA 1NUBA 1CFFA 2JZIA 1OOGA 1OZSA 2ZNDA 1TNXA 3SG5A 1QS7A 2LNKA 1J7RA 4GGFA 4OKHA 1FW4A 3B6XA 3I5GB 1IH0A 2EGDA 3DF0A 3VRRA 1IIOA 3L47A 1JF2A 2KI4B 3S0GA 1BF5A 4U8DA 1K96A 3UNWA 3KHEA 1C7WA 2SCPA 1K93D 1G33A 3BUWB 3KO0A 3QRXA 1JF0A 5F6TA 5AFPA 3SG2A 3CS1A 3FE9A 2BAPA 2M97A 1NCXA 1A29A 3R72A 4FQOA 4NQGA 2KNEA 1ZOTB 4PCWA 2WCJA 5FI7A 1JBAA 4NDBA 2LM5A 4KYNA 4F7FA 1CM1A 4INWA 1S6JA 3SG7A 1B1GA 2HPSA 2JPTA 3PATA 1DJXA 1XYDA 2GTEA 2MA2A 1K9KA 1CDLA 1OSAA 3SS5A 4MRYA 1QWVA 2LLUA 2YGUA 4HSZA 5HYDA 1NCYA 4OZDA 1IJ6A 5KSZA 3DY9A 2WCLA 1SBJA 2I18A 2O60A 1L2OB 2WC5A 3BOWA 1ZUZA 1M63B 3D75A 1BLQA 3TS5B 2EC6C 1L7ZA 1PRWA 1SCMB 1V1FA 2WCBA 4WQ2A 3I5FB 1C3ZA 1IRJA 3TS5C 3I5GC 2M7LA 1EG4A 4MVFA 1QV1A 1MXEA 1KQMB 1FPWA 2P71A 3HX4A 1KK7Z 1TN4A 5KTYA 1OMDA 2LMTA 1CLBA 2KFGA 2F2OA 2IS9A 3OX6A 1KCYA 3O2PA 1SKTA 1KFXS 1OE9B 1KK8C 4YGEB 1Y6WA 2LVKA 1C07A 3GK4X 5HLOA 5EL2A 4PDZA 5ER5A 3DVJA 1AVSA 1QVIZ 1DF0B 1QTXA 1K95A 1PK0D 2FJUB 2KI6D 2OTGC 4OCIA 3FE6A 3EK4A 4FQTA 3KEVA 1NPQA 4PHNA 2JNFA 2M49B 2PMYA 4PT1A 5FYXA 1FI6A 4D1EA 2KAVA 2RGIA 4MBEA 2QEOA 2LANA 2L4HA 3FS7A 3RM1A 2H61C 3BJHA 2LE9B 1J7PA 2MLFC 3MSEB 1YX7A 1J7QA 3C1VA 1UHHA 5FI6A 1SCVA 3IF7A 3NSKA 1EJ3A 1DJGA 1U5IB 2K7BA 3RLZA 1YUSA 1RROA 1TCOB 2AMIA 2COLB 4IJ7A 1XFXO 3B86A 4MSPA 1S5GZ 1YVHA 5G08A 4PALA 5DKNA 3CDNA 3D73A 2QDIA 1XK4C 5CSNA 2AUCA 3DXLA 4MEWA 4QJ5B 2KI6C 3I5FC 3AKBA 4BY4A 1U5IA 3RZSA 3CR4X 3DYEA 1A75B 1MF8B 5D69A 5HL1A 1GM0A 2EC6B 1DJZA 3TUYB 1IWQA 3FWCA 2LVIA 2WCFA 3JTDC 4ETOA 2JTTA 1B8LA 4C0LA 1Q80A 3O4XA 1W7JB 1RJVA 3BUOB 2LMUA 1TNQA 1LINA 2ZN9A 1SL8A 3OGNA 1M46A 3WXAA 4CFRA 1ORGA 1ZACA 1XK4A 2PRUA 5DICA 2K2AA 3B87A 1DQEA 1CDPA 2WC6A 4P2YB 4PE7A 5AEQA 4DUQA 3LK1A 1C7VA 3GOFA 2KYFA 1VRKA 1SK6D 2HF5A 2M8UA 4GAOA 3VRPA 3BFHA 2JWWA 1Y1AA 3TDUA 3GK2A 2BKIB 1P28A 1F8HA 1WDCC 2KQ6A 3BUXB 2NXQA 2MRDA 1DJWA 2WC8A 3L4LA 2KBIA 1WDCB 2LVJA 1M45A 1SY9A 3EVVA 3BXKA 5D7FA 4ZCVA 2LHIA 3D77A 2H61A 1OMRA 3DD4A 3B88A 4ORBB 1M39A 1YRTB 1CMFA 3PALA 3OB1B 2ZNEA 1C3YA 1FF1A 3A8RA 2LCPA 2CCMA 1T14A 2GGZA 2F3ZA 1GGZA 4CFQA 1CDNA 2M29A 4CPVA 2MHHA 3KPXA 4DIRA 1WRKA 2ZKMX 3EK8A 4ORCB 2G2BA 3I5IB 1BODA 2KPHA 1EL4A 4OVNF 5ER4X 3K1EA 3DVMA 3CABA 1TTXA 3CZ2A 1TOPA 4MZLA 1QX5B 1YVLA 2KDHA 2OS8B 3OB2B 3S0BA 2BKHB 2A4JA 1B8CA 1JUOA 1K90D 3D0YB 1NIWA 3R1PA 4DRWA 1GJYA 5AXIA 1B4CA 4BY5A 1K9UA 1IGVA 1CNPA 4HREE 4C0JA 2L51A 3AAJA 2M3WA 1UURA 1KFUL 3NHIA 4XYNA 5J3XA 1K2HA 1QATA 1CDMA 2NCPA 5GQQC 3FIAA 2KQYA 4OR9B 1DGVA 1BU3A 2Y4QA 1KWOB 1KQVA 2F2PA 1KFXL 2M7NA 1FBVA 3OBVA 2WCMA 3CZ0A 1SPYA 5D3OA 2JT3A 3AKAA 2MAZA 4YRUA 3EG5B 4JQ0D 5B8IB 3JVTC 1Y0VH 2ZN8A 1CKKA 1EG3A 1ZMZA 1XFUO 1EXRA 5I2LA 1NX1A 3CYZA 1N65A 1HT9A 1NX0A 2K2FA 1TCFA 1H4BA 1R2UA 4WQ3A 3CWGA 4JD9A 3PFVA 2CT9A 2L0PA 1JSAA 3SJSA 2HETA 1UP5A 2BCBA 2SASA 4NDDA 4ZCUA 3VGOA 1AJ5A 2LVVA 5HLVA 2L98A 1WRZA 1WLZA 3PN7C 1QVIY 3D0YA 1BR1B 2B1UA 1J7OA 1PSRA 1V1GA 2F8PA 2NZ0A 3VRNA 3EVRA 1LVCD 3SS3A 2BNXA 1XFYO 4XJKA 4YGDB 2K7CA 3VRQA 1NX3A 4P5OE 2L5YA 2VRGA 3SG6A 1OOFA 1SYMA 4YBHB 4N5XA 2LUXA 1L2OC 3PLFB 4I5JA 4A4CA 1GGWA 2WCEA 1S36A 1B7TY 2PASA 1XFWO 1DELA 1TRFA 4XJKB 2K8MB 3NXAA 1MHOA 3BFBA 4TNCA 3BUMB 5I94A 1DT7B 1UWOA 1NCZA 1KQMC 1PALA 2Y1MA 2KLEA 4PE1A 1JC2A 3PJIA 1CFCA 1F55A 1S5GY 2FCDA 1OOHA 1UUSA 1OW4A 2K7OA 4WRIA 1JWDA 3IQOA 2LP2A 3NSLA 1F54A 3O4YA 2L4IA 1NYAA 1XFRA 4N1FA 1AP4A 1LXFC 1F71A 4PE4A 3BYAA 5AERA 1QASA 1DVIA 4MRXA 1CLMA 1S1EA 2JXCA 5CPVA 3O78A 5JOLA 2JTZA 2F33A 3EVUA 3WHTB 1W9ZA 1SL7A 3S0DA 2L2CA 2L5XB 1MXLC 5CSFA 3Q8IA 3SG3A 2LLTA 1IJ5A 2QPTA 2CTNA 3DVEA 2MLEC 2BE4A 1AHRA 5FI2A 2I7AA 1IG5A 3TZ1A 4GPLB 1AJ4A 1BT6A 1BR4B 1QIWA 2V53A 1F70A 3CZTX 4QJ4B 2LC5A 1AUIB 1PULA 2OS8C 1SR6C 1DJHA 2PVBA 2ISDA 3NGVA 1K8UA 2LLSA 1YURA 2WNDA 4I5KA 1SR6B 3EK7A 2MJWB 2OTGB 4MN0A 1KFUS 1MR8A 1DMOA 2O5GA 3QMEA 1QXPA 4UPGA 2ZRTA 3UO9A 1OOJA 1SRAA 1J1DA 3D76A 5HKZA 3SS4A 1XVJA 5AANA 3SIAA 1R6PA 2FCEA 4JKTA 2JNXA 1MQ1A 4GNKB 1ZFSA 4HRGA 3TDIA 1X02A 2JQ6A 1N0YA 3KF9A 2CNPA 1S6IA 1AK8A 3TDZA 4I5LB 1DTLA 1S26D 1TNPA 1F4QA 2LMVA 1J1EA 1OMVA 2P6BB 2TN4A 3I5IC 3SIBA 3CR5X 1MWNA 2CBLA 1K94A 1SSEB 2FJYA 4M2PA 5JJGA 4R1EA 4I5NB 3BUNB 4PHKA 1RTP1 3FE8A 1B47A 3IVTA 1UHJA 2QACA 4MZJA 4M2OA 1YX8A 4L9MA 2M0RA 2D8NA 1K9PA 2BBMA 2E6WA 3GK1A 4DCKA 1OQPA 3NSOA 5PALA 1G4YR 1PSBA 1XA5A 3F45A 2I2RE 2KGRA 2QEHA 4HRHA 3WNXB 3CTNA 3HCMA 1S3PA 2HQWA 3VB1A 1TWOA 2PYQA 3R1VA 1D1OA 1QLKA 4YI9A 2BL0C 4AQIA 2E30A 5TNCA 3R1OA 1IQ5A 3EKJA 3LLEA 3N7HA 5KU1A 3PM8A 2JC2A 2KI4C 1PVBA 1JFJA 3JVTB 1KSMA 1Z4HA 2L2EA 1BG1A 1YUUA 2KBMA 2I94A 2M9GA 1SNLA 4OV2A 1CFPA 2BECA 1QV0A 5BPJA 4CIDA 1E8AA 3LK0A 1TUZA 1CTRA 2KFHA 1QX2A 3S0EA 1LKJA 4PHJA 3PSRA 3BFAA 1NSHA 3B7AA 4MZKA 1SMGA 1XFVO 2KAYA 2H8VA 3K21A 5DKRA 3CZ1A 2LAPA 3WHUB 1UHNA 1M31A 2M1KB 2PALA 4ICBA 2ERBA 1YTZC 1BMOA 1Z2CB 2WCKA 1Y1UA 5HKYA 3TUYC 1DJYA 1PVAA 1LS8A 2JT0A 4IL1A 3E3RA
chains in the Genus database with same CATH topology
1IKUA 1KSOA 1ODBA 2KGBC 3OX5A 5I8NA 1QX7A 4NDBA 1B8RA 1XO5A 2BL0B 3CR2A 4M2QA 1N2DA 2K0JA 3I5HB 4DS7A 2WOSA 1EH2A 4NDCA 3BOWB 1XFZO 1KK8B 1DJIA 1TNWA 4USLA 1GQMA 4GBAA 2JULA 4A4BA 3A4UB 4N1GA 2Q91A 3OHMB 2Y1NA 2BCXA 1WLMA 2LV7A 1G8IA 1QJTA 2JU0A 1NWDA 2Q4UA 4AQJA 2KYCA 4E68A 1B7TZ 3JTDB 1JFKA 1YUTA 3LCPC 1UHKA 1YRUB 2NLNA 1W7IB 1RFJA 5HKWA 1IQ3A 5I2QA 2L50A 1CM4A 1F4OA 2GV5A 1HQVA 5IBWA 2KSPA 4YGCB 1LA3A 4YGBB 4C0KA 2DOQA 1QIVA 1SW8A 1H8BA 1NX2A 3VROA 1BJFA 2G9BA 1DF0A 4YI8A 1OZOA 2H2KA 4PHMA 3ZNIA 4CLNA 1DGUA 4MLWA 3ZWHA 1A75A 1J55A 4GUKA 4Q04A 1UHIA 2OPOA 1A4PA 1ALWA 2GGMA 3ICBA 3I5HC 3BQ3A 2KHNA 1NP8A 3EKHA 4ORAB 2ZFDA 3IQQA 3LL8B 1MUXA 3PN7B 2CXJA 5CSJA 2F3YA 3M0WA 1CFDA 5DKQA 1SCMC 1A2XA 1S6CA 2M1UA 1BOCA 2AAOA 1SL9A 2LUCA 2LHLA 1KWOC 1FI5A 2BBNA 2BCAA 2EHBA 1WY9A 2KFFA 3SG4A 3O6BA 4YGAA 1CLLA 5K89A 1ALVA 1QLSA 2HQ8A 1WRLA 4QJ3B 2BE6A 1YR5A 2FOTA 3CGAA 4FTGA 1A03A 2KAXA 2JT8A 4PE0A 1LA0A 1RK9A 2Y5IA 1CB1A 1RWYA 2PSRA 2JXLA 4GGFC 4AOMA 1CMGA 2NCOA 4GGNA 2K61A 3D10A 2MBXA 2LP3A 2WORA 4JPZB 4JWQA 3FWBA 5CSIA 1Y1XA 2JOJA 4GFTA 2R2IA 3OP0A 1B9AA 2JRFA 2ZRSA 1TIZA 3H4SE 3NSIA 4F0ZB 1KK7Y 2K7DA 3DF0B 2KOTA 1RECA 3CLNA 5I2OA 3AAKA 3DVKA 1NUBA 1CFFA 2JZIA 1OZSA 2ZNDA 3SG5A 1TNXA 1QS7A 2LNKA 1J7RA 4GGFA 4OKHA 1FW4A 3I5GB 1IH0A 2EGDA 3DF0A 3VRRA 1JF2A 2KI4B 1BF5A 4U8DA 1K96A 3KHEA 1C7WA 2SCPA 1K93D 1G33A 3BUWB 3KO0A 3QRXA 1JF0A 5F6TA 5AFPA 3SG2A 3CS1A 2M97A 1NCXA 1A29A 4FQOA 4NQGA 2KNEA 1ZOTB 4PCWA 1JBAA 2LM5A 1CM1A 1B1GA 1S6JA 3SG7A 2HPSA 2JPTA 3PATA 1DJXA 1XYDA 2MA2A 1K9KA 1CDLA 1OSAA 5HYDA 4MRYA 2LLUA 4HSZA 1NCYA 1IJ6A 5KSZA 1SBJA 2I18A 2O60A 1L2OB 1BLQA 3BOWA 1ZUZA 1M63B 3TS5B 2EC6C 1L7ZA 1PRWA 1SCMB 1V1FA 2WCBA 4WQ2A 3I5FB 1IRJA 3TS5C 3I5GC 2M7LA 1EG4A 4MVFA 1QV1A 1MXEA 1KQMB 1FPWA 3HX4A 1KK7Z 1TN4A 5KTYA 1OMDA 2LMTA 1CLBA 2KFGA 2F2OA 2IS9A 3OX6A 1KCYA 3O2PA 1SKTA 1KFXS 1OE9B 1KK8C 4YGEB 1Y6WA 2LVKA 1C07A 3GK4X 5HLOA 4PDZA 5ER5A 3DVJA 1AVSA 1QVIZ 1DF0B 1QTXA 1K95A 1PK0D 2FJUB 2KI6D 2OTGC 4OCIA 4PHNA 3EK4A 3KEVA 1NPQA 2JNFA 2M49B 2PMYA 5FYXA 1FI6A 4D1EA 2KAVA 2RGIA 4MBEA 2LANA 2L4HA 3FS7A 3RM1A 2H61C 2LE9B 1J7PA 2MLFC 3MSEB 1YX7A 1J7QA 3C1VA 1UHHA 1SCVA 3IF7A 3NSKA 1EJ3A 1DJGA 1U5IB 2K7BA 3RLZA 1YUSA 1RROA 1TCOB 2AMIA 2COLB 1XFXO 4MSPA 1S5GZ 1YVHA 5G08A 4PALA 5DKNA 5CSNA 1XK4C 2AUCA 4MEWA 4QJ5B 2KI6C 3I5FC 3AKBA 4BY4A 1U5IA 3CR4X 1A75B 1MF8B 5D69A 2EC6B 1DJZA 3TUYB 1IWQA 3FWCA 2LVIA 2WCFA 3JTDC 4ETOA 2JTTA 1B8LA 4C0LA 1Q80A 1W7JB 1RJVA 3BUOB 2LMUA 1TNQA 1LINA 2ZN9A 1SL8A 3WXAA 1M46A 4CFRA 1ZACA 1XK4A 2PRUA 2K2AA 4PE7A 1CDPA 4P2YB 5AEQA 4DUQA 3LK1A 1C7VA 3GOFA 2KYFA 1VRKA 2HF5A 1SK6D 2M8UA 4GAOA 3VRPA 2JWWA 1Y1AA 3TDUA 3GK2A 2BKIB 1F8HA 1WDCC 2KQ6A 3BUXB 2NXQA 2MRDA 1DJWA 2WC8A 2KBIA 1WDCB 2LVJA 1M45A 1SY9A 3EVVA 3BXKA 5D7FA 4ZCVA 2LHIA 2H61A 1OMRA 3DD4A 4ORBB 1M39A 1YRTB 1CMFA 3PALA 3OB1B 2ZNEA 1FF1A 3A8RA 2LCPA 2CCMA 2GGZA 2F3ZA 1GGZA 4CFQA 1CDNA 2M29A 4CPVA 2MHHA 3KPXA 4DIRA 1WRKA 2ZKMX 3EK8A 4ORCB 2G2BA 3I5IB 1BODA 1EL4A 4OVNF 5ER4X 3DVMA 1TTXA 1TOPA 4MZLA 1QX5B 1YVLA 2KDHA 2OS8B 3OB2B 2BKHB 2A4JA 1B8CA 1JUOA 1K90D 3D0YB 1NIWA 4DRWA 1GJYA 5AXIA 1B4CA 4BY5A 1K9UA 1IGVA 1CNPA 4HREE 4C0JA 2L51A 3AAJA 2M3WA 1UURA 1KFUL 5J3XA 4XYNA 1K2HA 1QATA 1CDMA 2NCPA 5GQQC 3FIAA 2KQYA 4OR9B 1DGVA 1BU3A 2Y4QA 1KWOB 1KQVA 2F2PA 1KFXL 2M7NA 1FBVA 1SPYA 2JT3A 3AKAA 2MAZA 4YRUA 4JQ0D 5B8IB 3JVTC 1Y0VH 2ZN8A 1CKKA 1EG3A 1ZMZA 1XFUO 1EXRA 5I2LA 1NX1A 1N65A 1HT9A 1NX0A 2K2FA 1TCFA 1H4BA 1R2UA 4WQ3A 3CWGA 3PFVA 2CT9A 2L0PA 1JSAA 3SJSA 2HETA 1UP5A 2BCBA 2SASA 4NDDA 4ZCUA 3VGOA 1AJ5A 2LVVA 5HLVA 2L98A 1WRZA 1WLZA 3PN7C 1QVIY 3D0YA 1BR1B 2B1UA 1J7OA 1PSRA 1V1GA 2F8PA 2NZ0A 3VRNA 3EVRA 1LVCD 1XFYO 4XJKA 4YGDB 2K7CA 3VRQA 1NX3A 4P5OE 2VRGA 3SG6A 1SYMA 4YBHB 4N5XA 2LUXA 1L2OC 3PLFB 4I5JA 4A4CA 1GGWA 2WCEA 1S36A 1B7TY 2PASA 1XFWO 1TRFA 4XJKB 2K8MB 3NXAA 1MHOA 4TNCA 3BUMB 1DT7B 1UWOA 1NCZA 1KQMC 1PALA 2Y1MA 4PE1A 1JC2A 1CFCA 1F55A 1S5GY 2FCDA 1UUSA 4WRIA 2K7OA 1JWDA 3IQOA 2LP2A 3NSLA 1F54A 3O4YA 2L4IA 1NYAA 4N1FA 1AP4A 1F71A 1LXFC 4PE4A 3BYAA 5AERA 1QASA 1DVIA 4MRXA 1CLMA 1S1EA 2JXCA 5CPVA 3O78A 5JOLA 2JTZA 2F33A 3EVUA 3WHTB 1SL7A 2L5XB 1MXLC 5CSFA 3SG3A 2LLTA 1IJ5A 2QPTA 2CTNA 3DVEA 2MLEC 2BE4A 1AHRA 2I7AA 1IG5A 3TZ1A 4GPLB 1AJ4A 1BT6A 1BR4B 1QIWA 2V53A 1F70A 3CZTX 4QJ4B 2LC5A 1AUIB 1PULA 2OS8C 1SR6C 1DJHA 2PVBA 2ISDA 1K8UA 2LLSA 1YURA 2WNDA 4I5KA 1SR6B 3EK7A 2MJWB 2OTGB 4MN0A 1KFUS 1MR8A 1DMOA 2O5GA 1QXPA 4UPGA 2ZRTA 1OOJA 1SRAA 1J1DA 5HKZA 1XVJA 5AANA 3SIAA 1R6PA 2FCEA 2JNXA 1MQ1A 4GNKB 1ZFSA 4HRGA 3TDIA 1X02A 2JQ6A 1N0YA 3KF9A 2CNPA 1S6IA 1AK8A 3TDZA 4I5LB 1DTLA 1S26D 1TNPA 1F4QA 2LMVA 1J1EA 1OMVA 2P6BB 2TN4A 3I5IC 3SIBA 3CR5X 1MWNA 2CBLA 1K94A 4M2PA 5JJGA 4R1EA 4I5NB 3BUNB 4PHKA 1RTP1 1B47A 1UHJA 2QACA 4MZJA 4M2OA 1YX8A 4L9MA 2M0RA 2D8NA 1K9PA 2BBMA 2E6WA 3GK1A 4DCKA 1OQPA 3NSOA 5PALA 1G4YR 1PSBA 1XA5A 3F45A 2I2RE 2KGRA 4HRHA 3WNXB 3CTNA 3HCMA 1S3PA 2HQWA 1D1OA 1QLKA 4YI9A 2BL0C 4AQIA 2E30A 5TNCA 1IQ5A 3EKJA 3LLEA 5KU1A 3PM8A 2JC2A 2KI4C 1PVBA 1JFJA 3JVTB 1KSMA 2L2EA 1BG1A 1YUUA 2KBMA 2I94A 2M9GA 1SNLA 4OV2A 1CFPA 2BECA 1QV0A 5BPJA 4CIDA 1E8AA 3LK0A 1CTRA 2KFHA 1QX2A 1LKJA 4PHJA 3PSRA 1NSHA 5DKRA 4MZKA 1SMGA 1XFVO 2KAYA 3K21A 3WHUB 2LAPA 1UHNA 1M31A 2M1KB 2PALA 4ICBA 1YTZC 1BMOA 5HKYA 1Y1UA 3TUYC 1DJYA 1PVAA 2JT0A 4IL1A 3E3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IKU A;  1KSO A;  1ODB A;  2KGB C;  3OX5 A;  5I8N A;  1QX7 A;  4NDB A;  1B8R A;  1XO5 A;  2BL0 B;  3CR2 A;  4M2Q A;  1N2D A;  2K0J A;  3I5H B;  4DS7 A;  2WOS A;  1EH2 A;  4NDC A;  3BOW B;  1XFZ O;  1KK8 B;  1DJI A;  1TNW A;  4USL A;  1GQM A;  4GBA A;  2JUL A;  4A4B A;  3A4U B;  4N1G A;  2Q91 A;  3OHM B;  2Y1N A;  2BCX A;  1WLM A;  2LV7 A;  1G8I A;  1QJT A;  2JU0 A;  1NWD A;  2Q4U A;  4AQJ A;  2KYC A;  4E68 A;  1B7T Z;  3JTD B;  1JFK A;  1YUT A;  3LCP C;  1UHK A;  1YRU B;  2NLN A;  1W7I B;  1RFJ A;  5HKW A;  1IQ3 A;  5I2Q A;  2L50 A;  1CM4 A;  1F4O A;  2GV5 A;  1HQV A;  5IBW A;  2KSP A;  4YGC B;  1LA3 A;  4YGB B;  4C0K A;  2DOQ A;  1QIV A;  1SW8 A;  1H8B A;  1NX2 A;  3VRO A;  1BJF A;  2G9B A;  1DF0 A;  4YI8 A;  1OZO A;  2H2K A;  4PHM A;  3ZNI A;  4CLN A;  1DGU A;  4MLW A;  3ZWH A;  1A75 A;  1J55 A;  4GUK A;  4Q04 A;  1UHI A;  2OPO A;  1A4P A;  1ALW A;  2GGM A;  3ICB A;  3I5H C;  3BQ3 A;  2KHN A;  1NP8 A;  3EKH A;  4ORA B;  2ZFD A;  3IQQ A;  3LL8 B;  1MUX A;  3PN7 B;  2CXJ A;  5CSJ A;  2F3Y A;  3M0W A;  1CFD A;  5DKQ A;  1SCM C;  1A2X A;  1S6C A;  2M1U A;  1BOC A;  2AAO A;  1SL9 A;  2LUC A;  2LHL A;  1KWO C;  1FI5 A;  2BBN A;  2BCA A;  2EHB A;  1WY9 A;  2KFF A;  3SG4 A;  3O6B A;  4YGA A;  1CLL A;  5K89 A;  1ALV A;  1QLS A;  2HQ8 A;  1WRL A;  4QJ3 B;  2BE6 A;  1YR5 A;  2FOT A;  3CGA A;  4FTG A;  1A03 A;  2KAX A;  2JT8 A;  4PE0 A;  1LA0 A;  1RK9 A;  2Y5I A;  1CB1 A;  1RWY A;  2PSR A;  2JXL A;  4GGF C;  4AOM A;  1CMG A;  2NCO A;  4GGN A;  2K61 A;  3D10 A;  2MBX A;  2LP3 A;  2WOR A;  4JPZ B;  4JWQ A;  3FWB A;  5CSI A;  1Y1X A;  2JOJ A;  4GFT A;  2R2I A;  3OP0 A;  1B9A A;  2JRF A;  2ZRS A;  1TIZ A;  3H4S E;  3NSI A;  4F0Z B;  1KK7 Y;  2K7D A;  3DF0 B;  2KOT A;  1REC A;  3CLN A;  5I2O A;  3AAK A;  3DVK A;  1NUB A;  1CFF A;  2JZI A;  1OZS A;  2ZND A;  3SG5 A;  1TNX A;  1QS7 A;  2LNK A;  1J7R A;  4GGF A;  4OKH A;  1FW4 A;  3I5G B;  1IH0 A;  2EGD A;  3DF0 A;  3VRR A;  1JF2 A;  2KI4 B;  1BF5 A;  4U8D A;  1K96 A;  3KHE A;  1C7W A;  2SCP A;  1K93 D;  1G33 A;  3BUW B;  3KO0 A;  3QRX A;  1JF0 A;  5F6T A;  5AFP A;  3SG2 A;  3CS1 A;  2M97 A;  1NCX A;  1A29 A;  4FQO A;  4NQG A;  2KNE A;  1ZOT B;  4PCW A;  1JBA A;  2LM5 A;  1CM1 A;  1B1G A;  1S6J A;  3SG7 A;  2HPS A;  2JPT A;  3PAT A;  1DJX A;  1XYD A;  2MA2 A;  1K9K A;  1CDL A;  1OSA A;  5HYD A;  4MRY A;  2LLU A;  4HSZ A;  1NCY A;  1IJ6 A;  5KSZ A;  1SBJ A;  2I18 A;  2O60 A;  1L2O B;  1BLQ A;  3BOW A;  1ZUZ A;  1M63 B;  3TS5 B;  2EC6 C;  1L7Z A;  1PRW A;  1SCM B;  1V1F A;  2WCB A;  4WQ2 A;  3I5F B;  1IRJ A;  3TS5 C;  3I5G C;  2M7L A;  1EG4 A;  4MVF A;  1QV1 A;  1MXE A;  1KQM B;  1FPW A;  3HX4 A;  1KK7 Z;  1TN4 A;  5KTY A;  1OMD A;  2LMT A;  1CLB A;  2KFG A;  2F2O A;  2IS9 A;  3OX6 A;  1KCY A;  3O2P A;  1SKT A;  1KFX S;  1OE9 B;  1KK8 C;  4YGE B;  1Y6W A;  2LVK A;  1C07 A;  3GK4 X;  5HLO A;  4PDZ A;  5ER5 A;  3DVJ A;  1AVS A;  1QVI Z;  1DF0 B;  1QTX A;  1K95 A;  1PK0 D;  2FJU B;  2KI6 D;  2OTG C;  4OCI A;  4PHN A;  3EK4 A;  3KEV A;  1NPQ A;  2JNF A;  2M49 B;  2PMY A;  5FYX A;  1FI6 A;  4D1E A;  2KAV A;  2RGI A;  4MBE A;  2LAN A;  2L4H A;  3FS7 A;  3RM1 A;  2H61 C;  2LE9 B;  1J7P A;  2MLF C;  3MSE B;  1YX7 A;  1J7Q A;  3C1V A;  1UHH A;  1SCV A;  3IF7 A;  3NSK A;  1EJ3 A;  1DJG A;  1U5I B;  2K7B A;  3RLZ A;  1YUS A;  1RRO A;  1TCO B;  2AMI A;  2COL B;  1XFX O;  4MSP A;  1S5G Z;  1YVH A;  5G08 A;  4PAL A;  5DKN A;  5CSN A;  1XK4 C;  2AUC A;  4MEW A;  4QJ5 B;  2KI6 C;  3I5F C;  3AKB A;  4BY4 A;  1U5I A;  3CR4 X;  1A75 B;  1MF8 B;  5D69 A;  2EC6 B;  1DJZ A;  3TUY B;  1IWQ A;  3FWC A;  2LVI A;  2WCF A;  3JTD C;  4ETO A;  2JTT A;  1B8L A;  4C0L A;  1Q80 A;  1W7J B;  1RJV A;  3BUO B;  2LMU A;  1TNQ A;  1LIN A;  2ZN9 A;  1SL8 A;  3WXA A;  1M46 A;  4CFR A;  1ZAC A;  1XK4 A;  2PRU A;  2K2A A;  4PE7 A;  1CDP A;  4P2Y B;  5AEQ A;  4DUQ A;  3LK1 A;  1C7V A;  3GOF A;  2KYF A;  1VRK A;  2HF5 A;  1SK6 D;  2M8U A;  4GAO A;  3VRP A;  2JWW A;  1Y1A A;  3TDU A;  3GK2 A;  2BKI B;  1F8H A;  1WDC C;  2KQ6 A;  3BUX B;  2NXQ A;  2MRD A;  1DJW A;  2WC8 A;  2KBI A;  1WDC B;  2LVJ A;  1M45 A;  1SY9 A;  3EVV A;  3BXK A;  5D7F A;  4ZCV A;  2LHI A;  2H61 A;  1OMR A;  3DD4 A;  4ORB B;  1M39 A;  1YRT B;  1CMF A;  3PAL A;  3OB1 B;  2ZNE A;  1FF1 A;  3A8R A;  2LCP A;  2CCM A;  2GGZ A;  2F3Z A;  1GGZ A;  4CFQ A;  1CDN A;  2M29 A;  4CPV A;  2MHH A;  3KPX A;  4DIR A;  1WRK A;  2ZKM X;  3EK8 A;  4ORC B;  2G2B A;  3I5I B;  1BOD A;  1EL4 A;  4OVN F;  5ER4 X;  3DVM A;  1TTX A;  1TOP A;  4MZL A;  1QX5 B;  1YVL A;  2KDH A;  2OS8 B;  3OB2 B;  2BKH B;  2A4J A;  1B8C A;  1JUO A;  1K90 D;  3D0Y B;  1NIW A;  4DRW A;  1GJY A;  5AXI A;  1B4C A;  4BY5 A;  1K9U A;  1IGV A;  1CNP A;  4HRE E;  4C0J A;  2L51 A;  3AAJ A;  2M3W A;  1UUR A;  1KFU L;  5J3X A;  4XYN A;  1K2H A;  1QAT A;  1CDM A;  2NCP A;  5GQQ C;  3FIA A;  2KQY A;  4OR9 B;  1DGV A;  1BU3 A;  2Y4Q A;  1KWO B;  1KQV A;  2F2P A;  1KFX L;  2M7N A;  1FBV A;  1SPY A;  2JT3 A;  3AKA A;  2MAZ A;  4YRU A;  4JQ0 D;  5B8I B;  3JVT C;  1Y0V H;  2ZN8 A;  1CKK A;  1EG3 A;  1ZMZ A;  1XFU O;  1EXR A;  5I2L A;  1NX1 A;  1N65 A;  1HT9 A;  1NX0 A;  2K2F A;  1TCF A;  1H4B A;  1R2U A;  4WQ3 A;  3CWG A;  3PFV A;  2CT9 A;  2L0P A;  1JSA A;  3SJS A;  2HET A;  1UP5 A;  2BCB A;  2SAS A;  4NDD A;  4ZCU A;  3VGO A;  1AJ5 A;  2LVV A;  5HLV A;  2L98 A;  1WRZ A;  1WLZ A;  3PN7 C;  1QVI Y;  3D0Y A;  1BR1 B;  2B1U A;  1J7O A;  1PSR A;  1V1G A;  2F8P A;  2NZ0 A;  3VRN A;  3EVR A;  1LVC D;  1XFY O;  4XJK A;  4YGD B;  2K7C A;  3VRQ A;  1NX3 A;  4P5O E;  2VRG A;  3SG6 A;  1SYM A;  4YBH B;  4N5X A;  2LUX A;  1L2O C;  3PLF B;  4I5J A;  4A4C A;  1GGW A;  2WCE A;  1S36 A;  1B7T Y;  2PAS A;  1XFW O;  1TRF A;  4XJK B;  2K8M B;  3NXA A;  1MHO A;  4TNC A;  3BUM B;  1DT7 B;  1UWO A;  1NCZ A;  1KQM C;  1PAL A;  2Y1M A;  4PE1 A;  1JC2 A;  1CFC A;  1F55 A;  1S5G Y;  2FCD A;  1UUS A;  4WRI A;  2K7O A;  1JWD A;  3IQO A;  2LP2 A;  3NSL A;  1F54 A;  3O4Y A;  2L4I A;  1NYA A;  4N1F A;  1AP4 A;  1F71 A;  1LXF C;  4PE4 A;  3BYA A;  5AER A;  1QAS A;  1DVI A;  4MRX A;  1CLM A;  1S1E A;  2JXC A;  5CPV A;  3O78 A;  5JOL A;  2JTZ A;  2F33 A;  3EVU A;  3WHT B;  1SL7 A;  2L5X B;  1MXL C;  5CSF A;  3SG3 A;  2LLT A;  1IJ5 A;  2QPT A;  2CTN A;  3DVE A;  2MLE C;  2BE4 A;  1AHR A;  2I7A A;  1IG5 A;  3TZ1 A;  4GPL B;  1AJ4 A;  1BT6 A;  1BR4 B;  1QIW A;  2V53 A;  1F70 A;  3CZT X;  4QJ4 B;  2LC5 A;  1AUI B;  1PUL A;  2OS8 C;  1SR6 C;  1DJH A;  2PVB A;  2ISD A;  1K8U A;  2LLS A;  1YUR A;  2WND A;  4I5K A;  1SR6 B;  3EK7 A;  2MJW B;  2OTG B;  4MN0 A;  1KFU S;  1MR8 A;  1DMO A;  2O5G A;  1QXP A;  4UPG A;  2ZRT A;  1OOJ A;  1SRA A;  1J1D A;  5HKZ A;  1XVJ A;  5AAN A;  3SIA A;  1R6P A;  2FCE A;  2JNX A;  1MQ1 A;  4GNK B;  1ZFS A;  4HRG A;  3TDI A;  1X02 A;  2JQ6 A;  1N0Y A;  3KF9 A;  2CNP A;  1S6I A;  1AK8 A;  3TDZ A;  4I5L B;  1DTL A;  1S26 D;  1TNP A;  1F4Q A;  2LMV A;  1J1E A;  1OMV A;  2P6B B;  2TN4 A;  3I5I C;  3SIB A;  3CR5 X;  1MWN A;  2CBL A;  1K94 A;  4M2P A;  5JJG A;  4R1E A;  4I5N B;  3BUN B;  4PHK A;  1RTP 1;  1B47 A;  1UHJ A;  2QAC A;  4MZJ A;  4M2O A;  1YX8 A;  4L9M A;  2M0R A;  2D8N A;  1K9P A;  2BBM A;  2E6W A;  3GK1 A;  4DCK A;  1OQP A;  3NSO A;  5PAL A;  1G4Y R;  1PSB A;  1XA5 A;  3F45 A;  2I2R E;  2KGR A;  4HRH A;  3WNX B;  3CTN A;  3HCM A;  1S3P A;  2HQW A;  1D1O A;  1QLK A;  4YI9 A;  2BL0 C;  4AQI A;  2E30 A;  5TNC A;  1IQ5 A;  3EKJ A;  3LLE A;  5KU1 A;  3PM8 A;  2JC2 A;  2KI4 C;  1PVB A;  1JFJ A;  3JVT B;  1KSM A;  2L2E A;  1BG1 A;  1YUU A;  2KBM A;  2I94 A;  2M9G A;  1SNL A;  4OV2 A;  1CFP A;  2BEC A;  1QV0 A;  5BPJ A;  4CID A;  1E8A A;  3LK0 A;  1CTR A;  2KFH A;  1QX2 A;  1LKJ A;  4PHJ A;  3PSR A;  1NSH A;  5DKR A;  4MZK A;  1SMG A;  1XFV O;  2KAY A;  3K21 A;  3WHU B;  2LAP A;  1UHN A;  1M31 A;  2M1K B;  2PAL A;  4ICB A;  1YTZ C;  1BMO A;  5HKY A;  1Y1U A;  3TUY C;  1DJY A;  1PVA A;  2JT0 A;  4IL1 A;  3E3R A; 
#chains in the Genus database with same CATH topology
 1IKU A;  1KSO A;  1ODB A;  2KGB C;  3S0A A;  3OX5 A;  3PM2 A;  2P70 A;  5I8N A;  1QX7 A;  2PQL A;  1B8R A;  1XO5 A;  2BL0 B;  2QEB A;  3CR2 A;  4M2Q A;  1N2D A;  2K0J A;  3I5H B;  4DS7 A;  2WOS A;  1EH2 A;  4NDC A;  3BOW B;  1XFZ O;  1KK8 B;  1DJI A;  1TNW A;  4USL A;  1GQM A;  4GBA A;  2JUL A;  4A4B A;  3A4U B;  4N1G A;  2Q91 A;  3OHM B;  2Y1N A;  2BCX A;  1WLM A;  2LV7 A;  1G8I A;  2K60 A;  1QJT A;  2JU0 A;  1NWD A;  2Q4U A;  4AQJ A;  2KYC A;  4E68 A;  1B7T Z;  3JTD B;  2WCH A;  1JFK A;  1YUT A;  3LCP C;  1UHK A;  1YRU B;  2NLN A;  1W7I B;  1RFJ A;  5HKW A;  1IQ3 A;  5I2Q A;  2L50 A;  1CM4 A;  2QEV A;  1F4O A;  2GV5 A;  1HQV A;  5IBW A;  1OOI X;  2KSP A;  4YGC B;  1LA3 A;  4YGB B;  4C0K A;  2DOQ A;  1QIV A;  1SW8 A;  1H8B A;  1NX2 A;  3D74 A;  3VRO A;  1BJF A;  2G9B A;  1DF0 A;  3L4A A;  4YI8 A;  1OZO A;  2H2K A;  4PHM A;  3ZNI A;  4CLN A;  3S0F A;  1DGU A;  4MLW A;  3ZWH A;  1A75 A;  1J55 A;  4GUK A;  4Q04 A;  1UHI A;  2OPO A;  1A4P A;  1ALW A;  2GGM A;  3ICB A;  3I5H C;  3BQ3 A;  2KHN A;  1NP8 A;  1DEK A;  3EKH A;  4ORA B;  2ZFD A;  2KLD A;  3IQQ A;  3LL8 B;  1MUX A;  3PN7 B;  2CXJ A;  5CSJ A;  2F3Y A;  3M0W A;  1CFD A;  5DKQ A;  1SCM C;  1A2X A;  1S6C A;  2M1U A;  1BOC A;  2AAO A;  1SL9 A;  2LUC A;  2LHL A;  1KWO C;  1FI5 A;  2BBN A;  2BCA A;  2EHB A;  1WY9 A;  2KFF A;  3DZT A;  3SG4 A;  3O6B A;  4YGA A;  1CLL A;  5K89 A;  1ALV A;  1QLS A;  1WRL A;  2HQ8 A;  4QJ3 B;  2BE6 A;  1YR5 A;  2FOT A;  3CGA A;  4FTG A;  1DC1 A;  1A03 A;  2KAX A;  2JT8 A;  4INX A;  4PE0 A;  1LA0 A;  1RK9 A;  2Y5I A;  1CB1 A;  1RWY A;  2PSR A;  2JXL A;  4GGF C;  4AOM A;  1CMG A;  2NCO A;  4GGN A;  2K61 A;  3D10 A;  3D78 A;  2LP3 A;  2MBX A;  2WOR A;  4JPZ B;  2JPO A;  4JWQ A;  3V2L A;  3FWB A;  5CSI A;  1TUJ A;  1Y1X A;  2JOJ A;  4GFT A;  2R2I A;  3OP0 A;  1B9A A;  3NHT A;  2JRF A;  2ZRS A;  1TIZ A;  3H4S E;  3NSI A;  4F0Z B;  1KK7 Y;  2K7D A;  3DF0 B;  2KOT A;  1REC A;  3CLN A;  5I2O A;  3AAK A;  3DVK A;  1NUB A;  1CFF A;  2JZI A;  1OOG A;  1OZS A;  2ZND A;  1TNX A;  3SG5 A;  1QS7 A;  2LNK A;  1J7R A;  4GGF A;  4OKH A;  1FW4 A;  3B6X A;  3I5G B;  1IH0 A;  2EGD A;  3DF0 A;  3VRR A;  1IIO A;  3L47 A;  1JF2 A;  2KI4 B;  3S0G A;  1BF5 A;  4U8D A;  1K96 A;  3UNW A;  3KHE A;  1C7W A;  2SCP A;  1K93 D;  1G33 A;  3BUW B;  3KO0 A;  3QRX A;  1JF0 A;  5F6T A;  5AFP A;  3SG2 A;  3CS1 A;  3FE9 A;  2BAP A;  2M97 A;  1NCX A;  1A29 A;  3R72 A;  4FQO A;  4NQG A;  2KNE A;  1ZOT B;  4PCW A;  2WCJ A;  5FI7 A;  1JBA A;  4NDB A;  2LM5 A;  4KYN A;  4F7F A;  1CM1 A;  4INW A;  1S6J A;  3SG7 A;  1B1G A;  2HPS A;  2JPT A;  3PAT A;  1DJX A;  1XYD A;  2GTE A;  2MA2 A;  1K9K A;  1CDL A;  1OSA A;  3SS5 A;  4MRY A;  1QWV A;  2LLU A;  2YGU A;  4HSZ A;  5HYD A;  1NCY A;  4OZD A;  1IJ6 A;  5KSZ A;  3DY9 A;  2WCL A;  1SBJ A;  2I18 A;  2O60 A;  1L2O B;  2WC5 A;  3BOW A;  1ZUZ A;  1M63 B;  3D75 A;  1BLQ A;  3TS5 B;  2EC6 C;  1L7Z A;  1PRW A;  1SCM B;  1V1F A;  2WCB A;  4WQ2 A;  3I5F B;  1C3Z A;  1IRJ A;  3TS5 C;  3I5G C;  2M7L A;  1EG4 A;  4MVF A;  1QV1 A;  1MXE A;  1KQM B;  1FPW A;  2P71 A;  3HX4 A;  1KK7 Z;  1TN4 A;  5KTY A;  1OMD A;  2LMT A;  1CLB A;  2KFG A;  2F2O A;  2IS9 A;  3OX6 A;  1KCY A;  3O2P A;  1SKT A;  1KFX S;  1OE9 B;  1KK8 C;  4YGE B;  1Y6W A;  2LVK A;  1C07 A;  3GK4 X;  5HLO A;  5EL2 A;  4PDZ A;  5ER5 A;  3DVJ A;  1AVS A;  1QVI Z;  1DF0 B;  1QTX A;  1K95 A;  1PK0 D;  2FJU B;  2KI6 D;  2OTG C;  4OCI A;  3FE6 A;  3EK4 A;  4FQT A;  3KEV A;  1NPQ A;  4PHN A;  2JNF A;  2M49 B;  2PMY A;  4PT1 A;  5FYX A;  1FI6 A;  4D1E A;  2KAV A;  2RGI A;  4MBE A;  2QEO A;  2LAN A;  2L4H A;  3FS7 A;  3RM1 A;  2H61 C;  3BJH A;  2LE9 B;  1J7P A;  2MLF C;  3MSE B;  1YX7 A;  1J7Q A;  3C1V A;  1UHH A;  5FI6 A;  1SCV A;  3IF7 A;  3NSK A;  1EJ3 A;  1DJG A;  1U5I B;  2K7B A;  3RLZ A;  1YUS A;  1RRO A;  1TCO B;  2AMI A;  2COL B;  4IJ7 A;  1XFX O;  3B86 A;  4MSP A;  1S5G Z;  1YVH A;  5G08 A;  4PAL A;  5DKN A;  3CDN A;  3D73 A;  2QDI A;  1XK4 C;  5CSN A;  2AUC A;  3DXL A;  4MEW A;  4QJ5 B;  2KI6 C;  3I5F C;  3AKB A;  4BY4 A;  1U5I A;  3RZS A;  3CR4 X;  3DYE A;  1A75 B;  1MF8 B;  5D69 A;  5HL1 A;  1GM0 A;  2EC6 B;  1DJZ A;  3TUY B;  1IWQ A;  3FWC A;  2LVI A;  2WCF A;  3JTD C;  4ETO A;  2JTT A;  1B8L A;  4C0L A;  1Q80 A;  3O4X A;  1W7J B;  1RJV A;  3BUO B;  2LMU A;  1TNQ A;  1LIN A;  2ZN9 A;  1SL8 A;  3OGN A;  1M46 A;  3WXA A;  4CFR A;  1ORG A;  1ZAC A;  1XK4 A;  2PRU A;  5DIC A;  2K2A A;  3B87 A;  1DQE A;  1CDP A;  2WC6 A;  4P2Y B;  4PE7 A;  5AEQ A;  4DUQ A;  3LK1 A;  1C7V A;  3GOF A;  2KYF A;  1VRK A;  1SK6 D;  2HF5 A;  2M8U A;  4GAO A;  3VRP A;  3BFH A;  2JWW A;  1Y1A A;  3TDU A;  3GK2 A;  2BKI B;  1P28 A;  1F8H A;  1WDC C;  2KQ6 A;  3BUX B;  2NXQ A;  2MRD A;  1DJW A;  2WC8 A;  3L4L A;  2KBI A;  1WDC B;  2LVJ A;  1M45 A;  1SY9 A;  3EVV A;  3BXK A;  5D7F A;  4ZCV A;  2LHI A;  3D77 A;  2H61 A;  1OMR A;  3DD4 A;  3B88 A;  4ORB B;  1M39 A;  1YRT B;  1CMF A;  3PAL A;  3OB1 B;  2ZNE A;  1C3Y A;  1FF1 A;  3A8R A;  2LCP A;  2CCM A;  1T14 A;  2GGZ A;  2F3Z A;  1GGZ A;  4CFQ A;  1CDN A;  2M29 A;  4CPV A;  2MHH A;  3KPX A;  4DIR A;  1WRK A;  2ZKM X;  3EK8 A;  4ORC B;  2G2B A;  3I5I B;  1BOD A;  2KPH A;  1EL4 A;  4OVN F;  5ER4 X;  3K1E A;  3DVM A;  3CAB A;  1TTX A;  3CZ2 A;  1TOP A;  4MZL A;  1QX5 B;  1YVL A;  2KDH A;  2OS8 B;  3OB2 B;  3S0B A;  2BKH B;  2A4J A;  1B8C A;  1JUO A;  1K90 D;  3D0Y B;  1NIW A;  3R1P A;  4DRW A;  1GJY A;  5AXI A;  1B4C A;  4BY5 A;  1K9U A;  1IGV A;  1CNP A;  4HRE E;  4C0J A;  2L51 A;  3AAJ A;  2M3W A;  1UUR A;  1KFU L;  3NHI A;  4XYN A;  5J3X A;  1K2H A;  1QAT A;  1CDM A;  2NCP A;  5GQQ C;  3FIA A;  2KQY A;  4OR9 B;  1DGV A;  1BU3 A;  2Y4Q A;  1KWO B;  1KQV A;  2F2P A;  1KFX L;  2M7N A;  1FBV A;  3OBV A;  2WCM A;  3CZ0 A;  1SPY A;  5D3O A;  2JT3 A;  3AKA A;  2MAZ A;  4YRU A;  3EG5 B;  4JQ0 D;  5B8I B;  3JVT C;  1Y0V H;  2ZN8 A;  1CKK A;  1EG3 A;  1ZMZ A;  1XFU O;  1EXR A;  5I2L A;  1NX1 A;  3CYZ A;  1N65 A;  1HT9 A;  1NX0 A;  2K2F A;  1TCF A;  1H4B A;  1R2U A;  4WQ3 A;  3CWG A;  4JD9 A;  3PFV A;  2CT9 A;  2L0P A;  1JSA A;  3SJS A;  2HET A;  1UP5 A;  2BCB A;  2SAS A;  4NDD A;  4ZCU A;  3VGO A;  1AJ5 A;  2LVV A;  5HLV A;  2L98 A;  1WRZ A;  1WLZ A;  3PN7 C;  1QVI Y;  3D0Y A;  1BR1 B;  2B1U A;  1J7O A;  1PSR A;  1V1G A;  2F8P A;  2NZ0 A;  3VRN A;  3EVR A;  1LVC D;  3SS3 A;  2BNX A;  1XFY O;  4XJK A;  4YGD B;  2K7C A;  3VRQ A;  1NX3 A;  4P5O E;  2L5Y A;  2VRG A;  3SG6 A;  1OOF A;  1SYM A;  4YBH B;  4N5X A;  2LUX A;  1L2O C;  3PLF B;  4I5J A;  4A4C A;  1GGW A;  2WCE A;  1S36 A;  1B7T Y;  2PAS A;  1XFW O;  1DEL A;  1TRF A;  4XJK B;  2K8M B;  3NXA A;  1MHO A;  3BFB A;  4TNC A;  3BUM B;  5I94 A;  1DT7 B;  1UWO A;  1NCZ A;  1KQM C;  1PAL A;  2Y1M A;  2KLE A;  4PE1 A;  1JC2 A;  3PJI A;  1CFC A;  1F55 A;  1S5G Y;  2FCD A;  1OOH A;  1UUS A;  1OW4 A;  2K7O A;  4WRI A;  1JWD A;  3IQO A;  2LP2 A;  3NSL A;  1F54 A;  3O4Y A;  2L4I A;  1NYA A;  1XFR A;  4N1F A;  1AP4 A;  1LXF C;  1F71 A;  4PE4 A;  3BYA A;  5AER A;  1QAS A;  1DVI A;  4MRX A;  1CLM A;  1S1E A;  2JXC A;  5CPV A;  3O78 A;  5JOL A;  2JTZ A;  2F33 A;  3EVU A;  3WHT B;  1W9Z A;  1SL7 A;  3S0D A;  2L2C A;  2L5X B;  1MXL C;  5CSF A;  3Q8I A;  3SG3 A;  2LLT A;  1IJ5 A;  2QPT A;  2CTN A;  3DVE A;  2MLE C;  2BE4 A;  1AHR A;  5FI2 A;  2I7A A;  1IG5 A;  3TZ1 A;  4GPL B;  1AJ4 A;  1BT6 A;  1BR4 B;  1QIW A;  2V53 A;  1F70 A;  3CZT X;  4QJ4 B;  2LC5 A;  1AUI B;  1PUL A;  2OS8 C;  1SR6 C;  1DJH A;  2PVB A;  2ISD A;  3NGV A;  1K8U A;  2LLS A;  1YUR A;  2WND A;  4I5K A;  1SR6 B;  3EK7 A;  2MJW B;  2OTG B;  4MN0 A;  1KFU S;  1MR8 A;  1DMO A;  2O5G A;  3QME A;  1QXP A;  4UPG A;  2ZRT A;  3UO9 A;  1OOJ A;  1SRA A;  1J1D A;  3D76 A;  5HKZ A;  3SS4 A;  1XVJ A;  5AAN A;  3SIA A;  1R6P A;  2FCE A;  4JKT A;  2JNX A;  1MQ1 A;  4GNK B;  1ZFS A;  4HRG A;  3TDI A;  1X02 A;  2JQ6 A;  1N0Y A;  3KF9 A;  2CNP A;  1S6I A;  1AK8 A;  3TDZ A;  4I5L B;  1DTL A;  1S26 D;  1TNP A;  1F4Q A;  2LMV A;  1J1E A;  1OMV A;  2P6B B;  2TN4 A;  3I5I C;  3SIB A;  3CR5 X;  1MWN A;  2CBL A;  1K94 A;  1SSE B;  2FJY A;  4M2P A;  5JJG A;  4R1E A;  4I5N B;  3BUN B;  4PHK A;  1RTP 1;  3FE8 A;  1B47 A;  3IVT A;  1UHJ A;  2QAC A;  4MZJ A;  4M2O A;  1YX8 A;  4L9M A;  2M0R A;  2D8N A;  1K9P A;  2BBM A;  2E6W A;  3GK1 A;  4DCK A;  1OQP A;  3NSO A;  5PAL A;  1G4Y R;  1PSB A;  1XA5 A;  3F45 A;  2I2R E;  2KGR A;  2QEH A;  4HRH A;  3WNX B;  3CTN A;  3HCM A;  1S3P A;  2HQW A;  3VB1 A;  1TWO A;  2PYQ A;  3R1V A;  1D1O A;  1QLK A;  4YI9 A;  2BL0 C;  4AQI A;  2E30 A;  5TNC A;  3R1O A;  1IQ5 A;  3EKJ A;  3LLE A;  3N7H A;  5KU1 A;  3PM8 A;  2JC2 A;  2KI4 C;  1PVB A;  1JFJ A;  3JVT B;  1KSM A;  1Z4H A;  2L2E A;  1BG1 A;  1YUU A;  2KBM A;  2I94 A;  2M9G A;  1SNL A;  4OV2 A;  1CFP A;  2BEC A;  1QV0 A;  5BPJ A;  4CID A;  1E8A A;  3LK0 A;  1TUZ A;  1CTR A;  2KFH A;  1QX2 A;  3S0E A;  1LKJ A;  4PHJ A;  3PSR A;  3BFA A;  1NSH A;  3B7A A;  4MZK A;  1SMG A;  1XFV O;  2KAY A;  2H8V A;  3K21 A;  5DKR A;  3CZ1 A;  2LAP A;  3WHU B;  1UHN A;  1M31 A;  2M1K B;  2PAL A;  4ICB A;  2ERB A;  1YTZ C;  1BMO A;  1Z2C B;  2WCK A;  1Y1U A;  5HKY A;  3TUY C;  1DJY A;  1PVA A;  1LS8 A;  2JT0 A;  4IL1 A;  3E3R A; 
#chains in the Genus database with same CATH homology
 1IKU A;  1KSO A;  1ODB A;  2KGB C;  3OX5 A;  5I8N A;  1QX7 A;  4NDB A;  1B8R A;  1XO5 A;  2BL0 B;  3CR2 A;  4M2Q A;  1N2D A;  2K0J A;  3I5H B;  4DS7 A;  2WOS A;  1EH2 A;  4NDC A;  3BOW B;  1XFZ O;  1KK8 B;  1DJI A;  1TNW A;  4USL A;  1GQM A;  4GBA A;  2JUL A;  4A4B A;  3A4U B;  4N1G A;  2Q91 A;  3OHM B;  2Y1N A;  2BCX A;  1WLM A;  2LV7 A;  1G8I A;  1QJT A;  2JU0 A;  1NWD A;  2Q4U A;  4AQJ A;  2KYC A;  4E68 A;  1B7T Z;  3JTD B;  1JFK A;  1YUT A;  3LCP C;  1UHK A;  1YRU B;  2NLN A;  1W7I B;  1RFJ A;  5HKW A;  1IQ3 A;  5I2Q A;  2L50 A;  1CM4 A;  1F4O A;  2GV5 A;  1HQV A;  5IBW A;  2KSP A;  4YGC B;  1LA3 A;  4YGB B;  4C0K A;  2DOQ A;  1QIV A;  1SW8 A;  1H8B A;  1NX2 A;  3VRO A;  1BJF A;  2G9B A;  1DF0 A;  4YI8 A;  1OZO A;  2H2K A;  4PHM A;  3ZNI A;  4CLN A;  1DGU A;  4MLW A;  3ZWH A;  1A75 A;  1J55 A;  4GUK A;  4Q04 A;  1UHI A;  2OPO A;  1A4P A;  1ALW A;  2GGM A;  3ICB A;  3I5H C;  3BQ3 A;  2KHN A;  1NP8 A;  3EKH A;  4ORA B;  2ZFD A;  3IQQ A;  3LL8 B;  1MUX A;  3PN7 B;  2CXJ A;  5CSJ A;  2F3Y A;  3M0W A;  1CFD A;  5DKQ A;  1SCM C;  1A2X A;  1S6C A;  2M1U A;  1BOC A;  2AAO A;  1SL9 A;  2LUC A;  2LHL A;  1KWO C;  1FI5 A;  2BBN A;  2BCA A;  2EHB A;  1WY9 A;  2KFF A;  3SG4 A;  3O6B A;  4YGA A;  1CLL A;  5K89 A;  1ALV A;  1QLS A;  2HQ8 A;  1WRL A;  4QJ3 B;  2BE6 A;  1YR5 A;  2FOT A;  3CGA A;  4FTG A;  1A03 A;  2KAX A;  2JT8 A;  4PE0 A;  1LA0 A;  1RK9 A;  2Y5I A;  1CB1 A;  1RWY A;  2PSR A;  2JXL A;  4GGF C;  4AOM A;  1CMG A;  2NCO A;  4GGN A;  2K61 A;  3D10 A;  2MBX A;  2LP3 A;  2WOR A;  4JPZ B;  4JWQ A;  3FWB A;  5CSI A;  1Y1X A;  2JOJ A;  4GFT A;  2R2I A;  3OP0 A;  1B9A A;  2JRF A;  2ZRS A;  1TIZ A;  3H4S E;  3NSI A;  4F0Z B;  1KK7 Y;  2K7D A;  3DF0 B;  2KOT A;  1REC A;  3CLN A;  5I2O A;  3AAK A;  3DVK A;  1NUB A;  1CFF A;  2JZI A;  1OZS A;  2ZND A;  3SG5 A;  1TNX A;  1QS7 A;  2LNK A;  1J7R A;  4GGF A;  4OKH A;  1FW4 A;  3I5G B;  1IH0 A;  2EGD A;  3DF0 A;  3VRR A;  1JF2 A;  2KI4 B;  1BF5 A;  4U8D A;  1K96 A;  3KHE A;  1C7W A;  2SCP A;  1K93 D;  1G33 A;  3BUW B;  3KO0 A;  3QRX A;  1JF0 A;  5F6T A;  5AFP A;  3SG2 A;  3CS1 A;  2M97 A;  1NCX A;  1A29 A;  4FQO A;  4NQG A;  2KNE A;  1ZOT B;  4PCW A;  1JBA A;  2LM5 A;  1CM1 A;  1B1G A;  1S6J A;  3SG7 A;  2HPS A;  2JPT A;  3PAT A;  1DJX A;  1XYD A;  2MA2 A;  1K9K A;  1CDL A;  1OSA A;  5HYD A;  4MRY A;  2LLU A;  4HSZ A;  1NCY A;  1IJ6 A;  5KSZ A;  1SBJ A;  2I18 A;  2O60 A;  1L2O B;  1BLQ A;  3BOW A;  1ZUZ A;  1M63 B;  3TS5 B;  2EC6 C;  1L7Z A;  1PRW A;  1SCM B;  1V1F A;  2WCB A;  4WQ2 A;  3I5F B;  1IRJ A;  3TS5 C;  3I5G C;  2M7L A;  1EG4 A;  4MVF A;  1QV1 A;  1MXE A;  1KQM B;  1FPW A;  3HX4 A;  1KK7 Z;  1TN4 A;  5KTY A;  1OMD A;  2LMT A;  1CLB A;  2KFG A;  2F2O A;  2IS9 A;  3OX6 A;  1KCY A;  3O2P A;  1SKT A;  1KFX S;  1OE9 B;  1KK8 C;  4YGE B;  1Y6W A;  2LVK A;  1C07 A;  3GK4 X;  5HLO A;  4PDZ A;  5ER5 A;  3DVJ A;  1AVS A;  1QVI Z;  1DF0 B;  1QTX A;  1K95 A;  1PK0 D;  2FJU B;  2KI6 D;  2OTG C;  4OCI A;  4PHN A;  3EK4 A;  3KEV A;  1NPQ A;  2JNF A;  2M49 B;  2PMY A;  5FYX A;  1FI6 A;  4D1E A;  2KAV A;  2RGI A;  4MBE A;  2LAN A;  2L4H A;  3FS7 A;  3RM1 A;  2H61 C;  2LE9 B;  1J7P A;  2MLF C;  3MSE B;  1YX7 A;  1J7Q A;  3C1V A;  1UHH A;  1SCV A;  3IF7 A;  3NSK A;  1EJ3 A;  1DJG A;  1U5I B;  2K7B A;  3RLZ A;  1YUS A;  1RRO A;  1TCO B;  2AMI A;  2COL B;  1XFX O;  4MSP A;  1S5G Z;  1YVH A;  5G08 A;  4PAL A;  5DKN A;  5CSN A;  1XK4 C;  2AUC A;  4MEW A;  4QJ5 B;  2KI6 C;  3I5F C;  3AKB A;  4BY4 A;  1U5I A;  3CR4 X;  1A75 B;  1MF8 B;  5D69 A;  2EC6 B;  1DJZ A;  3TUY B;  1IWQ A;  3FWC A;  2LVI A;  2WCF A;  3JTD C;  4ETO A;  2JTT A;  1B8L A;  4C0L A;  1Q80 A;  1W7J B;  1RJV A;  3BUO B;  2LMU A;  1TNQ A;  1LIN A;  2ZN9 A;  1SL8 A;  3WXA A;  1M46 A;  4CFR A;  1ZAC A;  1XK4 A;  2PRU A;  2K2A A;  4PE7 A;  1CDP A;  4P2Y B;  5AEQ A;  4DUQ A;  3LK1 A;  1C7V A;  3GOF A;  2KYF A;  1VRK A;  2HF5 A;  1SK6 D;  2M8U A;  4GAO A;  3VRP A;  2JWW A;  1Y1A A;  3TDU A;  3GK2 A;  2BKI B;  1F8H A;  1WDC C;  2KQ6 A;  3BUX B;  2NXQ A;  2MRD A;  1DJW A;  2WC8 A;  2KBI A;  1WDC B;  2LVJ A;  1M45 A;  1SY9 A;  3EVV A;  3BXK A;  5D7F A;  4ZCV A;  2LHI A;  2H61 A;  1OMR A;  3DD4 A;  4ORB B;  1M39 A;  1YRT B;  1CMF A;  3PAL A;  3OB1 B;  2ZNE A;  1FF1 A;  3A8R A;  2LCP A;  2CCM A;  2GGZ A;  2F3Z A;  1GGZ A;  4CFQ A;  1CDN A;  2M29 A;  4CPV A;  2MHH A;  3KPX A;  4DIR A;  1WRK A;  2ZKM X;  3EK8 A;  4ORC B;  2G2B A;  3I5I B;  1BOD A;  1EL4 A;  4OVN F;  5ER4 X;  3DVM A;  1TTX A;  1TOP A;  4MZL A;  1QX5 B;  1YVL A;  2KDH A;  2OS8 B;  3OB2 B;  2BKH B;  2A4J A;  1B8C A;  1JUO A;  1K90 D;  3D0Y B;  1NIW A;  4DRW A;  1GJY A;  5AXI A;  1B4C A;  4BY5 A;  1K9U A;  1IGV A;  1CNP A;  4HRE E;  4C0J A;  2L51 A;  3AAJ A;  2M3W A;  1UUR A;  1KFU L;  5J3X A;  4XYN A;  1K2H A;  1QAT A;  1CDM A;  2NCP A;  5GQQ C;  3FIA A;  2KQY A;  4OR9 B;  1DGV A;  1BU3 A;  2Y4Q A;  1KWO B;  1KQV A;  2F2P A;  1KFX L;  2M7N A;  1FBV A;  1SPY A;  2JT3 A;  3AKA A;  2MAZ A;  4YRU A;  4JQ0 D;  5B8I B;  3JVT C;  1Y0V H;  2ZN8 A;  1CKK A;  1EG3 A;  1ZMZ A;  1XFU O;  1EXR A;  5I2L A;  1NX1 A;  1N65 A;  1HT9 A;  1NX0 A;  2K2F A;  1TCF A;  1H4B A;  1R2U A;  4WQ3 A;  3CWG A;  3PFV A;  2CT9 A;  2L0P A;  1JSA A;  3SJS A;  2HET A;  1UP5 A;  2BCB A;  2SAS A;  4NDD A;  4ZCU A;  3VGO A;  1AJ5 A;  2LVV A;  5HLV A;  2L98 A;  1WRZ A;  1WLZ A;  3PN7 C;  1QVI Y;  3D0Y A;  1BR1 B;  2B1U A;  1J7O A;  1PSR A;  1V1G A;  2F8P A;  2NZ0 A;  3VRN A;  3EVR A;  1LVC D;  1XFY O;  4XJK A;  4YGD B;  2K7C A;  3VRQ A;  1NX3 A;  4P5O E;  2VRG A;  3SG6 A;  1SYM A;  4YBH B;  4N5X A;  2LUX A;  1L2O C;  3PLF B;  4I5J A;  4A4C A;  1GGW A;  2WCE A;  1S36 A;  1B7T Y;  2PAS A;  1XFW O;  1TRF A;  4XJK B;  2K8M B;  3NXA A;  1MHO A;  4TNC A;  3BUM B;  1DT7 B;  1UWO A;  1NCZ A;  1KQM C;  1PAL A;  2Y1M A;  4PE1 A;  1JC2 A;  1CFC A;  1F55 A;  1S5G Y;  2FCD A;  1UUS A;  4WRI A;  2K7O A;  1JWD A;  3IQO A;  2LP2 A;  3NSL A;  1F54 A;  3O4Y A;  2L4I A;  1NYA A;  4N1F A;  1AP4 A;  1F71 A;  1LXF C;  4PE4 A;  3BYA A;  5AER A;  1QAS A;  1DVI A;  4MRX A;  1CLM A;  1S1E A;  2JXC A;  5CPV A;  3O78 A;  5JOL A;  2JTZ A;  2F33 A;  3EVU A;  3WHT B;  1SL7 A;  2L5X B;  1MXL C;  5CSF A;  3SG3 A;  2LLT A;  1IJ5 A;  2QPT A;  2CTN A;  3DVE A;  2MLE C;  2BE4 A;  1AHR A;  2I7A A;  1IG5 A;  3TZ1 A;  4GPL B;  1AJ4 A;  1BT6 A;  1BR4 B;  1QIW A;  2V53 A;  1F70 A;  3CZT X;  4QJ4 B;  2LC5 A;  1AUI B;  1PUL A;  2OS8 C;  1SR6 C;  1DJH A;  2PVB A;  2ISD A;  1K8U A;  2LLS A;  1YUR A;  2WND A;  4I5K A;  1SR6 B;  3EK7 A;  2MJW B;  2OTG B;  4MN0 A;  1KFU S;  1MR8 A;  1DMO A;  2O5G A;  1QXP A;  4UPG A;  2ZRT A;  1OOJ A;  1SRA A;  1J1D A;  5HKZ A;  1XVJ A;  5AAN A;  3SIA A;  1R6P A;  2FCE A;  2JNX A;  1MQ1 A;  4GNK B;  1ZFS A;  4HRG A;  3TDI A;  1X02 A;  2JQ6 A;  1N0Y A;  3KF9 A;  2CNP A;  1S6I A;  1AK8 A;  3TDZ A;  4I5L B;  1DTL A;  1S26 D;  1TNP A;  1F4Q A;  2LMV A;  1J1E A;  1OMV A;  2P6B B;  2TN4 A;  3I5I C;  3SIB A;  3CR5 X;  1MWN A;  2CBL A;  1K94 A;  4M2P A;  5JJG A;  4R1E A;  4I5N B;  3BUN B;  4PHK A;  1RTP 1;  1B47 A;  1UHJ A;  2QAC A;  4MZJ A;  4M2O A;  1YX8 A;  4L9M A;  2M0R A;  2D8N A;  1K9P A;  2BBM A;  2E6W A;  3GK1 A;  4DCK A;  1OQP A;  3NSO A;  5PAL A;  1G4Y R;  1PSB A;  1XA5 A;  3F45 A;  2I2R E;  2KGR A;  4HRH A;  3WNX B;  3CTN A;  3HCM A;  1S3P A;  2HQW A;  1D1O A;  1QLK A;  4YI9 A;  2BL0 C;  4AQI A;  2E30 A;  5TNC A;  1IQ5 A;  3EKJ A;  3LLE A;  5KU1 A;  3PM8 A;  2JC2 A;  2KI4 C;  1PVB A;  1JFJ A;  3JVT B;  1KSM A;  2L2E A;  1BG1 A;  1YUU A;  2KBM A;  2I94 A;  2M9G A;  1SNL A;  4OV2 A;  1CFP A;  2BEC A;  1QV0 A;  5BPJ A;  4CID A;  1E8A A;  3LK0 A;  1CTR A;  2KFH A;  1QX2 A;  1LKJ A;  4PHJ A;  3PSR A;  1NSH A;  5DKR A;  4MZK A;  1SMG A;  1XFV O;  2KAY A;  3K21 A;  3WHU B;  2LAP A;  1UHN A;  1M31 A;  2M1K B;  2PAL A;  4ICB A;  1YTZ C;  1BMO A;  5HKY A;  1Y1U A;  3TUY C;  1DJY A;  1PVA A;  2JT0 A;  4IL1 A;  3E3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...