1SL9A

Obelin from obelia longissima
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
191
structure length
186
Chain Sequence
YAVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNAGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Obelin
publication title Obelin from Obelia longissima
rcsb
source organism Obelia longissima
total genus 74
structure length 186
sequence length 191
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sl9A00
3EVVA 3SIAA 2CTNA 1Y0VH 4PDZA 3BQ3A 1YX7A 2M29A 1QV0A 1TNPA 4ICBA 3SJSA 5I2QA 2BE6A 2M1KB 3BOWA 3CR5X 1AJ4A 1QX2A 2F2PA 2M8UA 5I2OA 2GGZA 2HPSA 5HKWA 2PRUA 1BLQA 1KCYA 2SASA 1ODBA 2FOTA 3DF0B 4OKHA 1S5GZ 2CBLA 2JXCA 3BYAA 4USLA 3RLZA 4N5XA 1SL9A 2M7LA 3WHUB 4AQJA 3AAKA 3A4UB 1LA0A 5K89A 1LVCD 2KGRA 5HKZA 4M2OA 3WNXB 5HLOA 4HSZA 1SW8A 2LMVA 4I5JA 2H61C 4JPZB 2M0RA 1JSAA 5ER5A 3NSKA 4NDCA 3DF0A 4YI8A 4A4BA 2KI4C 5HKYA 2GGMA 3D0YB 2JU0A 3KHEA 3SG3A 1YURA 5TNCA 3DVMA 2ZFDA 3LK1A 1IG5A 2IS9A 5CSJA 1NX0A 2WOSA 1G33A 3PLFB 2CXJA 2VRGA 3PATA 3EK4A 2NCPA 1TNWA 3I5FC 2LHIA 3D0YA 2LCPA 1DT7B 1M46A 2KAYA 4D1EA 1PSBA 1Y1XA 1Y1UA 2JQ6A 1SL8A 2K2FA 2JC2A 5CSIA 1XFWO 4ORAB 1IJ6A 1SY9A 2CNPA 1PULA 3AKBA 3SG6A 1NX1A 2KI6C 2QACA 1S36A 5J3XA 2L51A 1A4PA 3VRQA 1BR4B 4IL1A 2AMIA 1LINA 1SRAA 1DMOA 3TS5B 3EKHA 5D69A 1KWOB 2PMYA 1KFUL 2L0PA 3FS7A 2ISDA 3PN7B 1K9PA 1S3PA 2MLFC 4L9MA 2HETA 1KK8C 4GGFC 3KPXA 3IQQA 2BKIB 2Y1MA 1RTP1 4CPVA 1PRWA 2I7AA 4WQ3A 5GQQC 1DVIA 3GK2A 1A75B 1QLSA 1SCMC 3CGAA 4GNKB 1XVJA 3RM1A 5BPJA 1KQMC 1DJWA 4TNCA 1QX7A 1KFXS 1QIWA 2PASA 1IH0A 1AK8A 4QJ4B 1WDCB 4C0LA 1PVAA 2EC6B 3SG5A 2ZKMX 2LLTA 2G9BA 1MQ1A 1TNQA 1N65A 1N0YA 1GGZA 2KYCA 2L2EA 2Q91A 3O4YA 4MSPA 4PE4A 1SMGA 1EJ3A 2EHBA 5CPVA 5CSFA 2F3YA 4BY4A 5D7FA 4QJ3B 1S1EA 2RGIA 2M97A 2K7DA 2K61A 5I2LA 4ORBB 2WCFA 3EK7A 3GK1A 1K90D 3D10A 1QATA 1UP5A 1YVHA 1QS7A 3EK8A 1PVBA 1G8IA 3CZTX 4WRIA 1ZMZA 2TN4A 2KOTA 3O78A 5AXIA 1ZOTB 2L50A 2ZRTA 1IWQA 1L2OB 4Q04A 1F70A 1S26D 3CWGA 3F45A 1LA3A 2B1UA 2BBNA 2E30A 1E8AA 1Y1AA 1DJGA 2QPTA 1DJZA 4U8DA 1GJYA 1M31A 1CDPA 1MUXA 3C1VA 5AANA 2Y1NA 1YUSA 2H2KA 3VGOA 1S6JA 2JNXA 2JULA 3I5GB 3ICBA 2K8MB 3LL8B 2F3ZA 1F4OA 4DCKA 1NX2A 2ZN9A 1ALVA 1SNLA 2F8PA 4PCWA 1EH2A 1SR6C 2CT9A 2JPTA 2E6WA 2OTGB 1G4YR 1DJIA 1MXEA 5HYDA 2BCXA 2V53A 2HQ8A 2JTZA 4UPGA 1PK0D 1A03A 1RJVA 4XYNA 1S6CA 1TIZA 4MVFA 2LAPA 1SL7A 2LVVA 1XFYO 4CLNA 1K95A 1YUUA 1V1FA 1PSRA 1K8UA 3E3RA 3I5IC 3EVUA 4ZCUA 1BG1A 5AEQA 2LC5A 1JF2A 4YRUA 3NXAA 1QX5B 3CTNA 2G2BA 2WNDA 3OX6A 1WLZA 4ORCB 4NQGA 2CCMA 1J7OA 2KAXA 1TN4A 1UUSA 3LK0A 1J7PA 4OV2A 1BODA 2LE9B 2LLSA 1CFDA 1BOCA 1XO5A 4OVNF 1UHNA 3TZ1A 2D8NA 1QXPA 3BUXB 1M45A 1OSAA 1NSHA 1XFVO 2HF5A 5G08A 1RROA 1AHRA 2ZNDA 1YR5A 4MZJA 4I5KA 3M0WA 1MHOA 3EKJA 1S6IA 1L7ZA 5KU1A 1B7TZ 1EG3A 1TRFA 4FQOA 3CS1A 2BCAA 3PM8A 1XA5A 3A8RA 4MRXA 1IGVA 3JTDB 1FW4A 4PE1A 1NYAA 1W7JB 2JT0A 1RWYA 2LVJA 2K2AA 3O2PA 1ZACA 2OS8C 1KFUS 1RECA 2KI4B 2KSPA 4P5OE 1DF0A 1CLBA 3ZWHA 3WHTB 1WLMA 1MXLC 1B8LA 5AERA 2LV7A 3DD4A 1C07A 4GPLB 4GUKA 2L98A 1KSMA 2KBIA 1ZUZA 2H61A 3NSOA 2GV5A 4MN0A 1OMRA 1AP4A 1DJYA 4PALA 3TDUA 1B8RA 2LMTA 3GOFA 3AKAA 2MHHA 5I8NA 3I5FB 1UHIA 2PVBA 4DRWA 1FPWA 1EG4A 5FYXA 1MF8B 2MAZA 1WDCC 1BJFA 2WORA 1CKKA 1UHJA 1AJ5A 3DVKA 1YRTB 1XK4C 5AFPA 2Y4QA 2P6BB 4WQ2A 1JWDA 1OZSA 1QLKA 2KQYA 1JBAA 5JJGA 1J1EA 4MZLA 4MEWA 2MA2A 4AQIA 1WRZA 4C0KA 1B7TY 2KI6D 1YUTA 4YGBB 4MBEA 1B1GA 2LVIA 3JVTC 4P2YB 1K93D 2JT3A 1ALWA 1FF1A 1FBVA 4PE7A 4PHMA 1L2OC 4CFQA 3DVJA 1QASA 3IF7A 1B47A 1YTZC 2LHLA 2LUCA 3TUYC 1F54A 1B8CA 2KFFA 4N1FA 2JXLA 4M2PA 1F71A 1JF0A 1K94A 2Q4UA 3LLEA 1LXFC 4MZKA 4PHNA 2BE4A 3SG4A 3QRXA 3MSEB 4GGFA 2BL0B 3DVEA 2JTTA 3OB2B 4ETOA 1H8BA 2I94A 3BUWB 1NUBA 1TCOB 2A4JA 4PHKA 1X02A 2KBMA 4PHJA 3VRPA 2K7BA 3TDIA 1CB1A 5PALA 2M9GA 1D1OA 1SKTA 1N2DA 4JQ0D 4NDBA 2MRDA 2OTGC 1DTLA 3SIBA 2NZ0A 2KAVA 2NLNA 4BY5A 1J7QA 4N1GA 1JFJA 2AAOA 2M3WA 1K96A 3I5HB 3KO0A 3EVRA 4GGNA 4DIRA 1YX8A 4YGEB 2I2RE 1OQPA 1M39A 1WY9A 3BUMB 1TOPA 5F6TA 2I18A 1BU3A 1DGUA 3KF9A 3FIAA 4MLWA 1CFFA 1SK6D 1JC2A 2L4IA 1B4CA 2KFHA 1VRKA 2LMUA 2KYFA 5KSZA 1TCFA 2FCDA 2K0JA 1KQVA 1QVIY 1NPQA 3LCPC 1CTRA 1IRJA 1Y6WA 1DJXA 2M49B 1M63B 1A2XA 1NCYA 2PALA 1XFXO 5KTYA 5ER4X 2Y5IA 2KDHA 1OMDA 2NXQA 3PSRA 2DOQA 2BECA 1AUIB 2HQWA 2SCPA 1R2UA 1SR6B 4F0ZB 2OPOA 1XFZO 5JOLA 2JWWA 1OMVA 2LANA 1HT9A 2EGDA 1Q80A 5HLVA 1EXRA 3JTDC 1BT6A 3BUOB 4JWQA 4CIDA 1CFCA 3SG2A 1DJHA 1GQMA 3TDZA 4YBHB 4GFTA 1TTXA 3I5IB 1DF0B 3WXAA 1J7RA 2L4HA 2BKHB 3FWCA 1F4QA 2JNFA 1XYDA 3TS5C 1AVSA 1KWOC 1IQ5A 3PN7C 5CSNA 1FI6A 1GGWA 1J55A 1CMFA 3H4SE 1IJ5A 2LM5A 1BF5A 4MRYA 2F2OA 1KSOA 2O60A 1CDMA 1FI5A 4AOMA 4OR9B 1CDLA 4M2QA 1TNXA 2LUXA 4DUQA 2M7NA 2MJWB 4PE0A 4E68A 1DGVA 1CLMA 1QIVA 3K21A 2KFGA 2JRFA 4FTGA 1QJTA 4NDDA 1U5IB 3PALA 1PALA 3VRNA 1NCXA 2EC6C 1WRKA 2O5GA 2WC8A 4GAOA 1F55A 3KEVA 3SG7A 1S5GY 2ZN8A 3CR4X 4GBAA 2ZRSA 3VROA 1W7IB 1WRLA 4QJ5B 3IQOA 3VRRA 2LP2A 1BR1B 1KK7Z 1QV1A 3HX4A 2OS8B 1JFKA 2JZIA 2FJUB 4HRHA 2MLEC 1HQVA 3AAJA 1UHHA 1A29A 1U5IA 2COLB 1NX3A 1QTXA 1UURA 1YVLA 2ZNEA 3OB1B 4YGDB 1NP8A 2KGBC 4ZCVA 4A4CA 2K7OA 3FWBA 2NCOA 1EL4A 1J1DA 1V1GA 4HREE 1SPYA 1KK8B 4HRGA 1CMGA 3BXKA 1K9KA 1H4BA 1QVIZ 2BL0C 4R1EA 1RFJA 1K9UA 4OCIA 3GK4X 4YI9A 1MR8A 3OHMB 2AUCA 2BCBA 4YGAA 1SCMB 2L5XB 1KFXL 2MBXA 1OZOA 1C7VA 1KQMB 1R6PA 1A75A 1CM1A 5DKQA 1NCZA 1SBJA 3I5GC 1K2HA 2F33A 1CDNA 3BUNB 4I5NB 2LP3A 1CM4A 3OX5A 1JUOA 1YRUB 1SCVA 3I5HC 2JOJA 4CFRA 3ZNIA 2KHNA 1OE9B 1RK9A 2WCEA 1SYMA 1UHKA 4XJKB 1XFUO 5DKRA 1LKJA 1XK4A 3JVTB 3CLNA 3HCMA 5DKNA 1C7WA 1B9AA 1MWNA 2LVKA 2KNEA 1OOJA 3PFVA 1KK7Y 1CNPA 5B8IB 1F8HA 1CFPA 3NSLA 3CR2A 3TUYB 1BMOA 4XJKA 1UWOA 2FCEA 2R2IA 3OP0A 4YGCB 2PSRA 1NIWA 2BBMA 2LNKA 1IKUA 2WCBA 4I5LB 2KQ6A 2LLUA 2M1UA 3O6BA 1NWDA 3BOWB 4DS7A 1IQ3A 5IBWA 2JT8A 1CLLA 1ZFSA 3NSIA 4C0JA 2K7CA
chains in the Genus database with same CATH superfamily
3EVVA 3SIAA 2CTNA 1Y0VH 4PDZA 3BQ3A 1YX7A 2M29A 1QV0A 1TNPA 3S0DA 4ICBA 2QEVA 3SJSA 3IVTA 5I2QA 2BE6A 2M1KB 3BOWA 1DC1A 3CR5X 1AJ4A 1QX2A 2F2PA 2M8UA 2QEBA 5I2OA 2GGZA 2HPSA 3QMEA 2BAPA 2PRUA 5HKWA 1BLQA 1KCYA 2SASA 1ODBA 4INXA 2FOTA 3CZ0A 3DF0B 1S5GZ 2CBLA 2JXCA 3BYAA 4OKHA 4USLA 4N5XA 1SL9A 2M7LA 3RLZA 3WHUB 3AAKA 4AQJA 3A4UB 1LA0A 5K89A 1LVCD 2KGRA 3CDNA 5HKZA 4M2OA 3WNXB 5HLOA 4HSZA 1SW8A 2LMVA 4FQTA 3S0FA 4I5JA 2H61C 4JPZB 2M0RA 1JSAA 5ER5A 3NSKA 4NDCA 3DF0A 4YI8A 4A4BA 2KI4C 3SS3A 3S0AA 5HKYA 2GGMA 3D0YB 2JU0A 3KHEA 3SG3A 1YURA 5TNCA 3DVMA 2ZFDA 3LK1A 1IG5A 2IS9A 5CSJA 1NX0A 2WOSA 1G33A 3PLFB 2CXJA 4U8DA 2VRGA 3PATA 3EK4A 2NCPA 1TNWA 3I5FC 2LHIA 3D0YA 2LCPA 1DT7B 1M46A 2KAYA 4KYNA 5FI2A 1PSBA 4D1EA 1C3ZA 1Y1XA 3L4AA 1Y1UA 2JQ6A 1SL8A 2K2FA 2JC2A 5CSIA 1XFWO 4ORAB 1IJ6A 1SY9A 2CNPA 1PULA 3AKBA 3SG6A 1NX1A 2KI6C 2QACA 1S36A 5J3XA 2L51A 1A4PA 3VRQA 1BR4B 3CZ2A 4IL1A 2AMIA 1LINA 1SRAA 1DMOA 3TS5B 3EKHA 5D69A 1KWOB 2PMYA 1KFUL 2L0PA 3FS7A 2ISDA 3PN7B 1K9PA 1S3PA 2MLFC 4L9MA 3V2LA 2HETA 1KK8C 4GGFC 3KPXA 3NSIA 3IQQA 2BKIB 2Y1MA 1RTP1 4CPVA 1PRWA 2I7AA 4WQ3A 5GQQC 1DVIA 3GK2A 3FE8A 1A75B 1QLSA 1SCMC 3CGAA 3OBVA 1XVJA 4GNKB 3RM1A 5BPJA 1KQMC 1DJWA 4TNCA 1QX7A 1KFXS 1QIWA 2PASA 1IH0A 1AK8A 4QJ4B 1WDCB 2JPOA 4C0LA 1PVAA 2EC6B 3SG5A 2YGUA 2ZKMX 2LLTA 2G9BA 1MQ1A 1TNQA 1N65A 1N0YA 1GGZA 2KYCA 2L2EA 2BNXA 2Q91A 3O4YA 4MSPA 1SMGA 1EJ3A 2EHBA 2WC6A 4PE4A 5CPVA 5CSFA 2F3YA 4BY4A 5D7FA 1T14A 4QJ3B 2P71A 1ORGA 1S1EA 2RGIA 2M97A 2K7DA 2K61A 5I2LA 4ORBB 2WCFA 3EK7A 3GK1A 1K90D 3D10A 1QATA 1UP5A 1YVHA 1QS7A 3EK8A 1PVBA 1G8IA 3CZTX 4WRIA 1ZMZA 2TN4A 2KOTA 3O78A 5AXIA 1ZOTB 2L50A 2ZRTA 1IWQA 1L2OB 3PJIA 4Q04A 2QEOA 1F70A 1S26D 3CWGA 3F45A 1LA3A 3PM2A 2B1UA 2BBNA 2E30A 1E8AA 1Y1AA 1DJGA 2QPTA 1DJZA 3DZTA 1GJYA 1M31A 1CDPA 1MUXA 2K60A 3C1VA 2Y1NA 1YUSA 2H2KA 5AANA 3VGOA 1GM0A 1S6JA 4PT1A 2JNXA 2JULA 3I5GB 3ICBA 5HL1A 2K8MB 3LL8B 2F3ZA 1F4OA 4DCKA 1NX2A 2ZN9A 1ALVA 1SNLA 2F8PA 4PCWA 1EH2A 1SR6C 2CT9A 3CABA 2JPTA 2E6WA 2OTGB 1G4YR 1DJIA 1MXEA 3K1EA 2L5YA 5HYDA 2BCXA 1TUJA 2V53A 2HQ8A 2KPHA 2JTZA 4UPGA 1PK0D 1A03A 1QWVA 1RJVA 1OOIX 4XYNA 1S6CA 1TIZA 4MVFA 2LAPA 1SL7A 2LVVA 1XFYO 4CLNA 2WCJA 1K95A 1YUUA 1V1FA 1PSRA 1K8UA 3E3RA 3I5IC 3EVUA 4ZCUA 1BG1A 5AEQA 2LC5A 1JF2A 2L2CA 4YRUA 3NXAA 1QX5B 3CTNA 2G2BA 5FI6A 2P70A 2WNDA 3OX6A 1WLZA 3B86A 4ORCB 2PQLA 4NQGA 2CCMA 1J7OA 2KAXA 1TN4A 1UUSA 3LK0A 1J7PA 4OV2A 1BODA 2LE9B 2LLSA 1CFDA 3R1VA 1BOCA 1XO5A 4OVNF 3R72A 1UHNA 3TZ1A 1TUZA 2D8NA 1QXPA 3BUXB 1M45A 1OSAA 4OZDA 1NSHA 1XFVO 2HF5A 5G08A 3L47A 5EL2A 1RROA 1AHRA 2ZNDA 1YR5A 3SS5A 4MZJA 4I5KA 3M0WA 1MHOA 3EKJA 1S6IA 1L7ZA 5KU1A 1B7TZ 1EG3A 1TRFA 4FQOA 3CS1A 2BCAA 3PM8A 1XA5A 3A8RA 4MRXA 1IGVA 1OOGA 3JTDB 1FW4A 1SSEB 4PE1A 3DY9A 1NYAA 1W7JB 2JT0A 1RWYA 2LVJA 2K2AA 3O2PA 1ZACA 2OS8C 1KFUS 1RECA 2KI4B 2KSPA 4P5OE 1DF0A 1CLBA 2GTEA 3ZWHA 3WHTB 3BFHA 1WLMA 1MXLC 1B8LA 5AERA 2LV7A 3DD4A 1C07A 4GPLB 4GUKA 2L98A 1KSMA 2KBIA 1ZUZA 2H61A 3D73A 2GV5A 3NSOA 4MN0A 1OMRA 1AP4A 1DJYA 4PALA 3TDUA 1B8RA 2LMTA 3GOFA 3AKAA 2MHHA 5I8NA 3I5FB 3BJHA 2PYQA 1UHIA 2PVBA 4DRWA 1FPWA 1EG4A 5FYXA 1MF8B 2MAZA 1WDCC 1BJFA 2WORA 1CKKA 1UHJA 1AJ5A 3CYZA 3N7HA 3DVKA 1YRTB 1XK4C 5AFPA 2Y4QA 3B6XA 2P6BB 4WQ2A 5I94A 1JWDA 3DYEA 1OZSA 1QLKA 2KQYA 1JBAA 5JJGA 1J1EA 4MZLA 4MEWA 2MA2A 4AQIA 1WRZA 3NGVA 4C0KA 1B7TY 2KI6D 1YUTA 2WCMA 4YGBB 4MBEA 1B1GA 2LVIA 3JVTC 4P2YB 1K93D 2JT3A 5FI7A 1ALWA 3NHIA 1FF1A 1FBVA 4PE7A 4PHMA 3B88A 1L2OC 2WCHA 3DVJA 1QASA 3IF7A 1B47A 1YTZC 2LHLA 2LUCA 3S0GA 4CFQA 3TUYC 1F54A 1B8CA 2KFFA 1LS8A 2JXLA 4M2PA 4N1FA 1F71A 1JF0A 1K94A 2Q4UA 3LLEA 1LXFC 4MZKA 4PHNA 2BE4A 3SG4A 3QRXA 3MSEB 3BFBA 4GGFA 2BL0B 3DVEA 2JTTA 3OB2B 4ETOA 1H8BA 2I94A 3BUWB 1NUBA 1TCOB 2A4JA 4PHKA 1X02A 2KBMA 4PHJA 3VRPA 2K7BA 3TDIA 1CB1A 5PALA 2M9GA 1D1OA 1SKTA 1N2DA 4JQ0D 4NDBA 2MRDA 2OTGC 1DTLA 3SIBA 2NZ0A 2KAVA 2NLNA 4BY5A 1J7QA 4N1GA 1JFJA 2AAOA 2M3WA 1K96A 3I5HB 3KO0A 1OOFA 3EVRA 4GGNA 4DIRA 1YX8A 4YGEB 2I2RE 1OQPA 1M39A 1WY9A 3BUMB 2FJYA 1TOPA 5F6TA 2I18A 1BU3A 1DGUA 3FE6A 3KF9A 3S0BA 3FIAA 4MLWA 3UNWA 1CFFA 1SK6D 1JC2A 2KLDA 2L4IA 1B4CA 2KFHA 1VRKA 2LMUA 2KYFA 5KSZA 4JD9A 1TCFA 2WC5A 3R1OA 2FCDA 2K0JA 1KQVA 1QVIY 3D76A 1NPQA 3LCPC 1CTRA 3D75A 1IRJA 1Y6WA 1DJXA 1Z2CB 2M49B 1M63B 1A2XA 1NCYA 2PALA 1XFXO 5KTYA 5ER4X 1P28A 2Y5IA 5DICA 2KDHA 1OMDA 2NXQA 3PSRA 2DOQA 2BECA 1AUIB 2HQWA 3D77A 2SCPA 1R2UA 1SR6B 4F0ZB 2OPOA 1XFZO 2WCKA 5JOLA 2JWWA 1C3YA 1OMVA 2LANA 1HT9A 2EGDA 1Q80A 1IIOA 5HLVA 1EXRA 3JTDC 1BT6A 3BUOB 4JWQA 4CIDA 1CFCA 3SG2A 1DJHA 1GQMA 3TDZA 4YBHB 4GFTA 1TTXA 3I5IB 1DF0B 3FE9A 1J7RA 2L4HA 3WXAA 4IJ7A 2BKHB 3FWCA 1F4QA 2JNFA 1XYDA 3TS5C 2QEHA 1AVSA 4JKTA 1KWOC 3Q8IA 1IQ5A 3PN7C 4F7FA 5CSNA 1FI6A 1GGWA 1J55A 1DELA 1CMFA 3H4SE 1W9ZA 1IJ5A 1Z4HA 2LM5A 1BF5A 4MRYA 2F2OA 1KSOA 2KLEA 2O60A 1CDMA 3VB1A 1FI5A 3R1PA 4AOMA 4OR9B 1CDLA 4M2QA 1TNXA 2LUXA 4DUQA 2M7NA 2MJWB 4PE0A 4E68A 1DGVA 1CLMA 1QIVA 3K21A 2KFGA 2JRFA 4FTGA 1DQEA 1QJTA 4NDDA 1U5IB 3PALA 1PALA 3VRNA 1NCXA 2EC6C 1WRKA 2O5GA 2WC8A 4GAOA 1F55A 3KEVA 3SG7A 1S5GY 2ZN8A 3CR4X 3D78A 4GBAA 3UO9A 2ZRSA 3VROA 1W7IB 1WRLA 4QJ5B 3IQOA 3VRRA 3RZSA 2LP2A 1BR1B 1KK7Z 1QV1A 3CZ1A 2OS8B 3HX4A 1TWOA 1JFKA 2JZIA 2FJUB 4HRHA 2MLEC 1HQVA 3AAJA 1UHHA 1A29A 1U5IA 2COLB 1NX3A 1QTXA 1UURA 1YVLA 2ZNEA 3OB1B 4YGDB 1NP8A 2KGBC 4ZCVA 4A4CA 2K7OA 3FWBA 2NCOA 1EL4A 3OGNA 1J1DA 1V1GA 4HREE 1SPYA 1KK8B 4HRGA 1CMGA 3BXKA 1K9KA 1H4BA 1QVIZ 2BL0C 3DXLA 4R1EA 1RFJA 1K9UA 4OCIA 3GK4X 4YI9A 1MR8A 3OHMB 2QDIA 5D3OA 2AUCA 2H8VA 2BCBA 4YGAA 4INWA 1SCMB 2L5XB 1KFXL 1OOHA 2MBXA 1OZOA 3SS4A 1KQMB 1C7VA 1R6PA 1A75A 1CM1A 5DKQA 1NCZA 1SBJA 3I5GC 1K2HA 2F33A 1CDNA 3BUNB 4I5NB 2LP3A 1CM4A 3OX5A 1JUOA 3S0EA 1YRUB 1SCVA 3I5HC 2JOJA 4CFRA 3ZNIA 2KHNA 1OE9B 1RK9A 2WCEA 1SYMA 1UHKA 4XJKB 1XFUO 5DKRA 1LKJA 1XK4A 2WCLA 3JVTB 3CLNA 1OW4A 3HCMA 5DKNA 1C7WA 1B9AA 1MWNA 2LVKA 2KNEA 1OOJA 1XFRA 3PFVA 1KK7Y 1CNPA 5B8IB 1F8HA 3D74A 1CFPA 3NSLA 3CR2A 3TUYB 1BMOA 4XJKA 1UWOA 2FCEA 2R2IA 3B87A 3OP0A 2ERBA 2PSRA 4YGCB 1NIWA 2BBMA 3B7AA 2LNKA 3EG5B 3L4LA 1IKUA 2WCBA 4I5LB 2KQ6A 2LLUA 3O4XA 3BFAA 2M1UA 3O6BA 1NWDA 3BOWB 4DS7A 1IQ3A 3NHTA 5IBWA 2JT8A 1CLLA 1ZFSA 1DEKA 4C0JA 2K7CA
chains in the Genus database with same CATH topology
3EVVA 3SIAA 2CTNA 1Y0VH 4PDZA 3BQ3A 1YX7A 2M29A 1QV0A 1TNPA 4ICBA 3SJSA 5I2QA 2BE6A 2M1KB 3BOWA 3CR5X 1AJ4A 1QX2A 2F2PA 2M8UA 5I2OA 2GGZA 2HPSA 5HKWA 2PRUA 1BLQA 1KCYA 2SASA 1ODBA 2FOTA 3DF0B 4OKHA 1S5GZ 2CBLA 2JXCA 3BYAA 4USLA 3RLZA 4N5XA 1SL9A 2M7LA 3WHUB 4AQJA 3AAKA 3A4UB 1LA0A 5K89A 1LVCD 2KGRA 5HKZA 4M2OA 3WNXB 5HLOA 4HSZA 1SW8A 2LMVA 4I5JA 2H61C 4JPZB 2M0RA 1JSAA 5ER5A 3NSKA 4NDCA 3DF0A 4YI8A 4A4BA 2KI4C 5HKYA 2GGMA 3D0YB 2JU0A 3KHEA 3SG3A 1YURA 5TNCA 3DVMA 2ZFDA 3LK1A 1IG5A 2IS9A 5CSJA 1NX0A 2WOSA 1G33A 3PLFB 2CXJA 2VRGA 3PATA 3EK4A 2NCPA 1TNWA 3I5FC 2LHIA 3D0YA 2LCPA 1DT7B 1M46A 2KAYA 4D1EA 1PSBA 1Y1XA 1Y1UA 2JQ6A 1SL8A 2K2FA 2JC2A 5CSIA 1XFWO 4ORAB 1IJ6A 1SY9A 2CNPA 1PULA 3AKBA 3SG6A 1NX1A 2KI6C 2QACA 1S36A 5J3XA 2L51A 1A4PA 3VRQA 1BR4B 4IL1A 2AMIA 1LINA 1SRAA 1DMOA 3TS5B 3EKHA 5D69A 1KWOB 2PMYA 1KFUL 2L0PA 3FS7A 2ISDA 3PN7B 1K9PA 1S3PA 2MLFC 4L9MA 2HETA 1KK8C 4GGFC 3KPXA 3IQQA 2BKIB 2Y1MA 1RTP1 4CPVA 1PRWA 2I7AA 4WQ3A 5GQQC 1DVIA 3GK2A 1A75B 1QLSA 1SCMC 3CGAA 4GNKB 1XVJA 3RM1A 5BPJA 1KQMC 1DJWA 4TNCA 1QX7A 1KFXS 1QIWA 2PASA 1IH0A 1AK8A 4QJ4B 1WDCB 4C0LA 1PVAA 2EC6B 3SG5A 2ZKMX 2LLTA 2G9BA 1MQ1A 1TNQA 1N65A 1N0YA 1GGZA 2KYCA 2L2EA 2Q91A 3O4YA 4MSPA 4PE4A 1SMGA 1EJ3A 2EHBA 5CPVA 5CSFA 2F3YA 4BY4A 5D7FA 4QJ3B 1S1EA 2RGIA 2M97A 2K7DA 2K61A 5I2LA 4ORBB 2WCFA 3EK7A 3GK1A 1K90D 3D10A 1QATA 1UP5A 1YVHA 1QS7A 3EK8A 1PVBA 1G8IA 3CZTX 4WRIA 1ZMZA 2TN4A 2KOTA 3O78A 5AXIA 1ZOTB 2L50A 2ZRTA 1IWQA 1L2OB 4Q04A 1F70A 1S26D 3CWGA 3F45A 1LA3A 2B1UA 2BBNA 2E30A 1E8AA 1Y1AA 1DJGA 2QPTA 1DJZA 4U8DA 1GJYA 1M31A 1CDPA 1MUXA 3C1VA 5AANA 2Y1NA 1YUSA 2H2KA 3VGOA 1S6JA 2JNXA 2JULA 3I5GB 3ICBA 2K8MB 3LL8B 2F3ZA 1F4OA 4DCKA 1NX2A 2ZN9A 1ALVA 1SNLA 2F8PA 4PCWA 1EH2A 1SR6C 2CT9A 2JPTA 2E6WA 2OTGB 1G4YR 1DJIA 1MXEA 5HYDA 2BCXA 2V53A 2HQ8A 2JTZA 4UPGA 1PK0D 1A03A 1RJVA 4XYNA 1S6CA 1TIZA 4MVFA 2LAPA 1SL7A 2LVVA 1XFYO 4CLNA 1K95A 1YUUA 1V1FA 1PSRA 1K8UA 3E3RA 3I5IC 3EVUA 4ZCUA 1BG1A 5AEQA 2LC5A 1JF2A 4YRUA 3NXAA 1QX5B 3CTNA 2G2BA 2WNDA 3OX6A 1WLZA 4ORCB 4NQGA 2CCMA 1J7OA 2KAXA 1TN4A 1UUSA 3LK0A 1J7PA 4OV2A 1BODA 2LE9B 2LLSA 1CFDA 1BOCA 1XO5A 4OVNF 1UHNA 3TZ1A 2D8NA 1QXPA 3BUXB 1M45A 1OSAA 1NSHA 1XFVO 2HF5A 5G08A 1RROA 1AHRA 2ZNDA 1YR5A 4MZJA 4I5KA 3M0WA 1MHOA 3EKJA 1S6IA 1L7ZA 5KU1A 1B7TZ 1EG3A 1TRFA 4FQOA 3CS1A 2BCAA 3PM8A 1XA5A 3A8RA 4MRXA 1IGVA 3JTDB 1FW4A 4PE1A 1NYAA 1W7JB 2JT0A 1RWYA 2LVJA 2K2AA 3O2PA 1ZACA 2OS8C 1KFUS 1RECA 2KI4B 2KSPA 4P5OE 1DF0A 1CLBA 3ZWHA 3WHTB 1WLMA 1MXLC 1B8LA 5AERA 2LV7A 3DD4A 1C07A 4GPLB 4GUKA 2L98A 1KSMA 2KBIA 1ZUZA 2H61A 3NSOA 2GV5A 4MN0A 1OMRA 1AP4A 1DJYA 4PALA 3TDUA 1B8RA 2LMTA 3GOFA 3AKAA 2MHHA 5I8NA 3I5FB 1UHIA 2PVBA 4DRWA 1FPWA 1EG4A 5FYXA 1MF8B 2MAZA 1WDCC 1BJFA 2WORA 1CKKA 1UHJA 1AJ5A 3DVKA 1YRTB 1XK4C 5AFPA 2Y4QA 2P6BB 4WQ2A 1JWDA 1OZSA 1QLKA 2KQYA 1JBAA 5JJGA 1J1EA 4MZLA 4MEWA 2MA2A 4AQIA 1WRZA 4C0KA 1B7TY 2KI6D 1YUTA 4YGBB 4MBEA 1B1GA 2LVIA 3JVTC 4P2YB 1K93D 2JT3A 1ALWA 1FF1A 1FBVA 4PE7A 4PHMA 1L2OC 4CFQA 3DVJA 1QASA 3IF7A 1B47A 1YTZC 2LHLA 2LUCA 3TUYC 1F54A 1B8CA 2KFFA 4N1FA 2JXLA 4M2PA 1F71A 1JF0A 1K94A 2Q4UA 3LLEA 1LXFC 4MZKA 4PHNA 2BE4A 3SG4A 3QRXA 3MSEB 4GGFA 2BL0B 3DVEA 2JTTA 3OB2B 4ETOA 1H8BA 2I94A 3BUWB 1NUBA 1TCOB 2A4JA 4PHKA 1X02A 2KBMA 4PHJA 3VRPA 2K7BA 3TDIA 1CB1A 5PALA 2M9GA 1D1OA 1SKTA 1N2DA 4JQ0D 4NDBA 2MRDA 2OTGC 1DTLA 3SIBA 2NZ0A 2KAVA 2NLNA 4BY5A 1J7QA 4N1GA 1JFJA 2AAOA 2M3WA 1K96A 3I5HB 3KO0A 3EVRA 4GGNA 4DIRA 1YX8A 4YGEB 2I2RE 1OQPA 1M39A 1WY9A 3BUMB 1TOPA 5F6TA 2I18A 1BU3A 1DGUA 3KF9A 3FIAA 4MLWA 1CFFA 1SK6D 1JC2A 2L4IA 1B4CA 2KFHA 1VRKA 2LMUA 2KYFA 5KSZA 1TCFA 2FCDA 2K0JA 1KQVA 1QVIY 1NPQA 3LCPC 1CTRA 1IRJA 1Y6WA 1DJXA 2M49B 1M63B 1A2XA 1NCYA 2PALA 1XFXO 5KTYA 5ER4X 2Y5IA 2KDHA 1OMDA 2NXQA 3PSRA 2DOQA 2BECA 1AUIB 2HQWA 2SCPA 1R2UA 1SR6B 4F0ZB 2OPOA 1XFZO 5JOLA 2JWWA 1OMVA 2LANA 1HT9A 2EGDA 1Q80A 5HLVA 1EXRA 3JTDC 1BT6A 3BUOB 4JWQA 4CIDA 1CFCA 3SG2A 1DJHA 1GQMA 3TDZA 4YBHB 4GFTA 1TTXA 3I5IB 1DF0B 3WXAA 1J7RA 2L4HA 2BKHB 3FWCA 1F4QA 2JNFA 1XYDA 3TS5C 1AVSA 1KWOC 1IQ5A 3PN7C 5CSNA 1FI6A 1GGWA 1J55A 1CMFA 3H4SE 1IJ5A 2LM5A 1BF5A 4MRYA 2F2OA 1KSOA 2O60A 1CDMA 1FI5A 4AOMA 4OR9B 1CDLA 4M2QA 1TNXA 2LUXA 4DUQA 2M7NA 2MJWB 4PE0A 4E68A 1DGVA 1CLMA 1QIVA 3K21A 2KFGA 2JRFA 4FTGA 1QJTA 4NDDA 1U5IB 3PALA 1PALA 3VRNA 1NCXA 2EC6C 1WRKA 2O5GA 2WC8A 4GAOA 1F55A 3KEVA 3SG7A 1S5GY 2ZN8A 3CR4X 4GBAA 2ZRSA 3VROA 1W7IB 1WRLA 4QJ5B 3IQOA 3VRRA 2LP2A 1BR1B 1KK7Z 1QV1A 3HX4A 2OS8B 1JFKA 2JZIA 2FJUB 4HRHA 2MLEC 1HQVA 3AAJA 1UHHA 1A29A 1U5IA 2COLB 1NX3A 1QTXA 1UURA 1YVLA 2ZNEA 3OB1B 4YGDB 1NP8A 2KGBC 4ZCVA 4A4CA 2K7OA 3FWBA 2NCOA 1EL4A 1J1DA 1V1GA 4HREE 1SPYA 1KK8B 4HRGA 1CMGA 3BXKA 1K9KA 1H4BA 1QVIZ 2BL0C 4R1EA 1RFJA 1K9UA 4OCIA 3GK4X 4YI9A 1MR8A 3OHMB 2AUCA 2BCBA 4YGAA 1SCMB 2L5XB 1KFXL 2MBXA 1OZOA 1C7VA 1KQMB 1R6PA 1A75A 1CM1A 5DKQA 1NCZA 1SBJA 3I5GC 1K2HA 2F33A 1CDNA 3BUNB 4I5NB 2LP3A 1CM4A 3OX5A 1JUOA 1YRUB 1SCVA 3I5HC 2JOJA 4CFRA 3ZNIA 2KHNA 1OE9B 1RK9A 2WCEA 1SYMA 1UHKA 4XJKB 1XFUO 5DKRA 1LKJA 1XK4A 3JVTB 3CLNA 3HCMA 5DKNA 1C7WA 1B9AA 1MWNA 2LVKA 2KNEA 1OOJA 3PFVA 1KK7Y 1CNPA 5B8IB 1F8HA 1CFPA 3NSLA 3CR2A 3TUYB 1BMOA 4XJKA 1UWOA 2FCEA 2R2IA 3OP0A 4YGCB 2PSRA 1NIWA 2BBMA 2LNKA 1IKUA 2WCBA 4I5LB 2KQ6A 2LLUA 2M1UA 3O6BA 1NWDA 3BOWB 4DS7A 1IQ3A 5IBWA 2JT8A 1CLLA 1ZFSA 3NSIA 4C0JA 2K7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVV A;  3SIA A;  2CTN A;  1Y0V H;  4PDZ A;  3BQ3 A;  1YX7 A;  2M29 A;  1QV0 A;  1TNP A;  4ICB A;  3SJS A;  5I2Q A;  2BE6 A;  2M1K B;  3BOW A;  3CR5 X;  1AJ4 A;  1QX2 A;  2F2P A;  2M8U A;  5I2O A;  2GGZ A;  2HPS A;  5HKW A;  2PRU A;  1BLQ A;  1KCY A;  2SAS A;  1ODB A;  2FOT A;  3DF0 B;  4OKH A;  1S5G Z;  2CBL A;  2JXC A;  3BYA A;  4USL A;  3RLZ A;  4N5X A;  1SL9 A;  2M7L A;  3WHU B;  4AQJ A;  3AAK A;  3A4U B;  1LA0 A;  5K89 A;  1LVC D;  2KGR A;  5HKZ A;  4M2O A;  3WNX B;  5HLO A;  4HSZ A;  1SW8 A;  2LMV A;  4I5J A;  2H61 C;  4JPZ B;  2M0R A;  1JSA A;  5ER5 A;  3NSK A;  4NDC A;  3DF0 A;  4YI8 A;  4A4B A;  2KI4 C;  5HKY A;  2GGM A;  3D0Y B;  2JU0 A;  3KHE A;  3SG3 A;  1YUR A;  5TNC A;  3DVM A;  2ZFD A;  3LK1 A;  1IG5 A;  2IS9 A;  5CSJ A;  1NX0 A;  2WOS A;  1G33 A;  3PLF B;  2CXJ A;  2VRG A;  3PAT A;  3EK4 A;  2NCP A;  1TNW A;  3I5F C;  2LHI A;  3D0Y A;  2LCP A;  1DT7 B;  1M46 A;  2KAY A;  4D1E A;  1PSB A;  1Y1X A;  1Y1U A;  2JQ6 A;  1SL8 A;  2K2F A;  2JC2 A;  5CSI A;  1XFW O;  4ORA B;  1IJ6 A;  1SY9 A;  2CNP A;  1PUL A;  3AKB A;  3SG6 A;  1NX1 A;  2KI6 C;  2QAC A;  1S36 A;  5J3X A;  2L51 A;  1A4P A;  3VRQ A;  1BR4 B;  4IL1 A;  2AMI A;  1LIN A;  1SRA A;  1DMO A;  3TS5 B;  3EKH A;  5D69 A;  1KWO B;  2PMY A;  1KFU L;  2L0P A;  3FS7 A;  2ISD A;  3PN7 B;  1K9P A;  1S3P A;  2MLF C;  4L9M A;  2HET A;  1KK8 C;  4GGF C;  3KPX A;  3IQQ A;  2BKI B;  2Y1M A;  1RTP 1;  4CPV A;  1PRW A;  2I7A A;  4WQ3 A;  5GQQ C;  1DVI A;  3GK2 A;  1A75 B;  1QLS A;  1SCM C;  3CGA A;  4GNK B;  1XVJ A;  3RM1 A;  5BPJ A;  1KQM C;  1DJW A;  4TNC A;  1QX7 A;  1KFX S;  1QIW A;  2PAS A;  1IH0 A;  1AK8 A;  4QJ4 B;  1WDC B;  4C0L A;  1PVA A;  2EC6 B;  3SG5 A;  2ZKM X;  2LLT A;  2G9B A;  1MQ1 A;  1TNQ A;  1N65 A;  1N0Y A;  1GGZ A;  2KYC A;  2L2E A;  2Q91 A;  3O4Y A;  4MSP A;  4PE4 A;  1SMG A;  1EJ3 A;  2EHB A;  5CPV A;  5CSF A;  2F3Y A;  4BY4 A;  5D7F A;  4QJ3 B;  1S1E A;  2RGI A;  2M97 A;  2K7D A;  2K61 A;  5I2L A;  4ORB B;  2WCF A;  3EK7 A;  3GK1 A;  1K90 D;  3D10 A;  1QAT A;  1UP5 A;  1YVH A;  1QS7 A;  3EK8 A;  1PVB A;  1G8I A;  3CZT X;  4WRI A;  1ZMZ A;  2TN4 A;  2KOT A;  3O78 A;  5AXI A;  1ZOT B;  2L50 A;  2ZRT A;  1IWQ A;  1L2O B;  4Q04 A;  1F70 A;  1S26 D;  3CWG A;  3F45 A;  1LA3 A;  2B1U A;  2BBN A;  2E30 A;  1E8A A;  1Y1A A;  1DJG A;  2QPT A;  1DJZ A;  4U8D A;  1GJY A;  1M31 A;  1CDP A;  1MUX A;  3C1V A;  5AAN A;  2Y1N A;  1YUS A;  2H2K A;  3VGO A;  1S6J A;  2JNX A;  2JUL A;  3I5G B;  3ICB A;  2K8M B;  3LL8 B;  2F3Z A;  1F4O A;  4DCK A;  1NX2 A;  2ZN9 A;  1ALV A;  1SNL A;  2F8P A;  4PCW A;  1EH2 A;  1SR6 C;  2CT9 A;  2JPT A;  2E6W A;  2OTG B;  1G4Y R;  1DJI A;  1MXE A;  5HYD A;  2BCX A;  2V53 A;  2HQ8 A;  2JTZ A;  4UPG A;  1PK0 D;  1A03 A;  1RJV A;  4XYN A;  1S6C A;  1TIZ A;  4MVF A;  2LAP A;  1SL7 A;  2LVV A;  1XFY O;  4CLN A;  1K95 A;  1YUU A;  1V1F A;  1PSR A;  1K8U A;  3E3R A;  3I5I C;  3EVU A;  4ZCU A;  1BG1 A;  5AEQ A;  2LC5 A;  1JF2 A;  4YRU A;  3NXA A;  1QX5 B;  3CTN A;  2G2B A;  2WND A;  3OX6 A;  1WLZ A;  4ORC B;  4NQG A;  2CCM A;  1J7O A;  2KAX A;  1TN4 A;  1UUS A;  3LK0 A;  1J7P A;  4OV2 A;  1BOD A;  2LE9 B;  2LLS A;  1CFD A;  1BOC A;  1XO5 A;  4OVN F;  1UHN A;  3TZ1 A;  2D8N A;  1QXP A;  3BUX B;  1M45 A;  1OSA A;  1NSH A;  1XFV O;  2HF5 A;  5G08 A;  1RRO A;  1AHR A;  2ZND A;  1YR5 A;  4MZJ A;  4I5K A;  3M0W A;  1MHO A;  3EKJ A;  1S6I A;  1L7Z A;  5KU1 A;  1B7T Z;  1EG3 A;  1TRF A;  4FQO A;  3CS1 A;  2BCA A;  3PM8 A;  1XA5 A;  3A8R A;  4MRX A;  1IGV A;  3JTD B;  1FW4 A;  4PE1 A;  1NYA A;  1W7J B;  2JT0 A;  1RWY A;  2LVJ A;  2K2A A;  3O2P A;  1ZAC A;  2OS8 C;  1KFU S;  1REC A;  2KI4 B;  2KSP A;  4P5O E;  1DF0 A;  1CLB A;  3ZWH A;  3WHT B;  1WLM A;  1MXL C;  1B8L A;  5AER A;  2LV7 A;  3DD4 A;  1C07 A;  4GPL B;  4GUK A;  2L98 A;  1KSM A;  2KBI A;  1ZUZ A;  2H61 A;  3NSO A;  2GV5 A;  4MN0 A;  1OMR A;  1AP4 A;  1DJY A;  4PAL A;  3TDU A;  1B8R A;  2LMT A;  3GOF A;  3AKA A;  2MHH A;  5I8N A;  3I5F B;  1UHI A;  2PVB A;  4DRW A;  1FPW A;  1EG4 A;  5FYX A;  1MF8 B;  2MAZ A;  1WDC C;  1BJF A;  2WOR A;  1CKK A;  1UHJ A;  1AJ5 A;  3DVK A;  1YRT B;  1XK4 C;  5AFP A;  2Y4Q A;  2P6B B;  4WQ2 A;  1JWD A;  1OZS A;  1QLK A;  2KQY A;  1JBA A;  5JJG A;  1J1E A;  4MZL A;  4MEW A;  2MA2 A;  4AQI A;  1WRZ A;  4C0K A;  1B7T Y;  2KI6 D;  1YUT A;  4YGB B;  4MBE A;  1B1G A;  2LVI A;  3JVT C;  4P2Y B;  1K93 D;  2JT3 A;  1ALW A;  1FF1 A;  1FBV A;  4PE7 A;  4PHM A;  1L2O C;  4CFQ A;  3DVJ A;  1QAS A;  3IF7 A;  1B47 A;  1YTZ C;  2LHL A;  2LUC A;  3TUY C;  1F54 A;  1B8C A;  2KFF A;  4N1F A;  2JXL A;  4M2P A;  1F71 A;  1JF0 A;  1K94 A;  2Q4U A;  3LLE A;  1LXF C;  4MZK A;  4PHN A;  2BE4 A;  3SG4 A;  3QRX A;  3MSE B;  4GGF A;  2BL0 B;  3DVE A;  2JTT A;  3OB2 B;  4ETO A;  1H8B A;  2I94 A;  3BUW B;  1NUB A;  1TCO B;  2A4J A;  4PHK A;  1X02 A;  2KBM A;  4PHJ A;  3VRP A;  2K7B A;  3TDI A;  1CB1 A;  5PAL A;  2M9G A;  1D1O A;  1SKT A;  1N2D A;  4JQ0 D;  4NDB A;  2MRD A;  2OTG C;  1DTL A;  3SIB A;  2NZ0 A;  2KAV A;  2NLN A;  4BY5 A;  1J7Q A;  4N1G A;  1JFJ A;  2AAO A;  2M3W A;  1K96 A;  3I5H B;  3KO0 A;  3EVR A;  4GGN A;  4DIR A;  1YX8 A;  4YGE B;  2I2R E;  1OQP A;  1M39 A;  1WY9 A;  3BUM B;  1TOP A;  5F6T A;  2I18 A;  1BU3 A;  1DGU A;  3KF9 A;  3FIA A;  4MLW A;  1CFF A;  1SK6 D;  1JC2 A;  2L4I A;  1B4C A;  2KFH A;  1VRK A;  2LMU A;  2KYF A;  5KSZ A;  1TCF A;  2FCD A;  2K0J A;  1KQV A;  1QVI Y;  1NPQ A;  3LCP C;  1CTR A;  1IRJ A;  1Y6W A;  1DJX A;  2M49 B;  1M63 B;  1A2X A;  1NCY A;  2PAL A;  1XFX O;  5KTY A;  5ER4 X;  2Y5I A;  2KDH A;  1OMD A;  2NXQ A;  3PSR A;  2DOQ A;  2BEC A;  1AUI B;  2HQW A;  2SCP A;  1R2U A;  1SR6 B;  4F0Z B;  2OPO A;  1XFZ O;  5JOL A;  2JWW A;  1OMV A;  2LAN A;  1HT9 A;  2EGD A;  1Q80 A;  5HLV A;  1EXR A;  3JTD C;  1BT6 A;  3BUO B;  4JWQ A;  4CID A;  1CFC A;  3SG2 A;  1DJH A;  1GQM A;  3TDZ A;  4YBH B;  4GFT A;  1TTX A;  3I5I B;  1DF0 B;  3WXA A;  1J7R A;  2L4H A;  2BKH B;  3FWC A;  1F4Q A;  2JNF A;  1XYD A;  3TS5 C;  1AVS A;  1KWO C;  1IQ5 A;  3PN7 C;  5CSN A;  1FI6 A;  1GGW A;  1J55 A;  1CMF A;  3H4S E;  1IJ5 A;  2LM5 A;  1BF5 A;  4MRY A;  2F2O A;  1KSO A;  2O60 A;  1CDM A;  1FI5 A;  4AOM A;  4OR9 B;  1CDL A;  4M2Q A;  1TNX A;  2LUX A;  4DUQ A;  2M7N A;  2MJW B;  4PE0 A;  4E68 A;  1DGV A;  1CLM A;  1QIV A;  3K21 A;  2KFG A;  2JRF A;  4FTG A;  1QJT A;  4NDD A;  1U5I B;  3PAL A;  1PAL A;  3VRN A;  1NCX A;  2EC6 C;  1WRK A;  2O5G A;  2WC8 A;  4GAO A;  1F55 A;  3KEV A;  3SG7 A;  1S5G Y;  2ZN8 A;  3CR4 X;  4GBA A;  2ZRS A;  3VRO A;  1W7I B;  1WRL A;  4QJ5 B;  3IQO A;  3VRR A;  2LP2 A;  1BR1 B;  1KK7 Z;  1QV1 A;  3HX4 A;  2OS8 B;  1JFK A;  2JZI A;  2FJU B;  4HRH A;  2MLE C;  1HQV A;  3AAJ A;  1UHH A;  1A29 A;  1U5I A;  2COL B;  1NX3 A;  1QTX A;  1UUR A;  1YVL A;  2ZNE A;  3OB1 B;  4YGD B;  1NP8 A;  2KGB C;  4ZCV A;  4A4C A;  2K7O A;  3FWB A;  2NCO A;  1EL4 A;  1J1D A;  1V1G A;  4HRE E;  1SPY A;  1KK8 B;  4HRG A;  1CMG A;  3BXK A;  1K9K A;  1H4B A;  1QVI Z;  2BL0 C;  4R1E A;  1RFJ A;  1K9U A;  4OCI A;  3GK4 X;  4YI9 A;  1MR8 A;  3OHM B;  2AUC A;  2BCB A;  4YGA A;  1SCM B;  2L5X B;  1KFX L;  2MBX A;  1OZO A;  1C7V A;  1KQM B;  1R6P A;  1A75 A;  1CM1 A;  5DKQ A;  1NCZ A;  1SBJ A;  3I5G C;  1K2H A;  2F33 A;  1CDN A;  3BUN B;  4I5N B;  2LP3 A;  1CM4 A;  3OX5 A;  1JUO A;  1YRU B;  1SCV A;  3I5H C;  2JOJ A;  4CFR A;  3ZNI A;  2KHN A;  1OE9 B;  1RK9 A;  2WCE A;  1SYM A;  1UHK A;  4XJK B;  1XFU O;  5DKR A;  1LKJ A;  1XK4 A;  3JVT B;  3CLN A;  3HCM A;  5DKN A;  1C7W A;  1B9A A;  1MWN A;  2LVK A;  2KNE A;  1OOJ A;  3PFV A;  1KK7 Y;  1CNP A;  5B8I B;  1F8H A;  1CFP A;  3NSL A;  3CR2 A;  3TUY B;  1BMO A;  4XJK A;  1UWO A;  2FCE A;  2R2I A;  3OP0 A;  4YGC B;  2PSR A;  1NIW A;  2BBM A;  2LNK A;  1IKU A;  2WCB A;  4I5L B;  2KQ6 A;  2LLU A;  2M1U A;  3O6B A;  1NWD A;  3BOW B;  4DS7 A;  1IQ3 A;  5IBW A;  2JT8 A;  1CLL A;  1ZFS A;  3NSI A;  4C0J A;  2K7C A; 
#chains in the Genus database with same CATH topology
 3EVV A;  3SIA A;  2CTN A;  1Y0V H;  4PDZ A;  3BQ3 A;  1YX7 A;  2M29 A;  1QV0 A;  1TNP A;  3S0D A;  4ICB A;  2QEV A;  3SJS A;  3IVT A;  5I2Q A;  2BE6 A;  2M1K B;  3BOW A;  1DC1 A;  3CR5 X;  1AJ4 A;  1QX2 A;  2F2P A;  2M8U A;  2QEB A;  5I2O A;  2GGZ A;  2HPS A;  3QME A;  2BAP A;  2PRU A;  5HKW A;  1BLQ A;  1KCY A;  2SAS A;  1ODB A;  4INX A;  2FOT A;  3CZ0 A;  3DF0 B;  1S5G Z;  2CBL A;  2JXC A;  3BYA A;  4OKH A;  4USL A;  4N5X A;  1SL9 A;  2M7L A;  3RLZ A;  3WHU B;  3AAK A;  4AQJ A;  3A4U B;  1LA0 A;  5K89 A;  1LVC D;  2KGR A;  3CDN A;  5HKZ A;  4M2O A;  3WNX B;  5HLO A;  4HSZ A;  1SW8 A;  2LMV A;  4FQT A;  3S0F A;  4I5J A;  2H61 C;  4JPZ B;  2M0R A;  1JSA A;  5ER5 A;  3NSK A;  4NDC A;  3DF0 A;  4YI8 A;  4A4B A;  2KI4 C;  3SS3 A;  3S0A A;  5HKY A;  2GGM A;  3D0Y B;  2JU0 A;  3KHE A;  3SG3 A;  1YUR A;  5TNC A;  3DVM A;  2ZFD A;  3LK1 A;  1IG5 A;  2IS9 A;  5CSJ A;  1NX0 A;  2WOS A;  1G33 A;  3PLF B;  2CXJ A;  4U8D A;  2VRG A;  3PAT A;  3EK4 A;  2NCP A;  1TNW A;  3I5F C;  2LHI A;  3D0Y A;  2LCP A;  1DT7 B;  1M46 A;  2KAY A;  4KYN A;  5FI2 A;  1PSB A;  4D1E A;  1C3Z A;  1Y1X A;  3L4A A;  1Y1U A;  2JQ6 A;  1SL8 A;  2K2F A;  2JC2 A;  5CSI A;  1XFW O;  4ORA B;  1IJ6 A;  1SY9 A;  2CNP A;  1PUL A;  3AKB A;  3SG6 A;  1NX1 A;  2KI6 C;  2QAC A;  1S36 A;  5J3X A;  2L51 A;  1A4P A;  3VRQ A;  1BR4 B;  3CZ2 A;  4IL1 A;  2AMI A;  1LIN A;  1SRA A;  1DMO A;  3TS5 B;  3EKH A;  5D69 A;  1KWO B;  2PMY A;  1KFU L;  2L0P A;  3FS7 A;  2ISD A;  3PN7 B;  1K9P A;  1S3P A;  2MLF C;  4L9M A;  3V2L A;  2HET A;  1KK8 C;  4GGF C;  3KPX A;  3NSI A;  3IQQ A;  2BKI B;  2Y1M A;  1RTP 1;  4CPV A;  1PRW A;  2I7A A;  4WQ3 A;  5GQQ C;  1DVI A;  3GK2 A;  3FE8 A;  1A75 B;  1QLS A;  1SCM C;  3CGA A;  3OBV A;  1XVJ A;  4GNK B;  3RM1 A;  5BPJ A;  1KQM C;  1DJW A;  4TNC A;  1QX7 A;  1KFX S;  1QIW A;  2PAS A;  1IH0 A;  1AK8 A;  4QJ4 B;  1WDC B;  2JPO A;  4C0L A;  1PVA A;  2EC6 B;  3SG5 A;  2YGU A;  2ZKM X;  2LLT A;  2G9B A;  1MQ1 A;  1TNQ A;  1N65 A;  1N0Y A;  1GGZ A;  2KYC A;  2L2E A;  2BNX A;  2Q91 A;  3O4Y A;  4MSP A;  1SMG A;  1EJ3 A;  2EHB A;  2WC6 A;  4PE4 A;  5CPV A;  5CSF A;  2F3Y A;  4BY4 A;  5D7F A;  1T14 A;  4QJ3 B;  2P71 A;  1ORG A;  1S1E A;  2RGI A;  2M97 A;  2K7D A;  2K61 A;  5I2L A;  4ORB B;  2WCF A;  3EK7 A;  3GK1 A;  1K90 D;  3D10 A;  1QAT A;  1UP5 A;  1YVH A;  1QS7 A;  3EK8 A;  1PVB A;  1G8I A;  3CZT X;  4WRI A;  1ZMZ A;  2TN4 A;  2KOT A;  3O78 A;  5AXI A;  1ZOT B;  2L50 A;  2ZRT A;  1IWQ A;  1L2O B;  3PJI A;  4Q04 A;  2QEO A;  1F70 A;  1S26 D;  3CWG A;  3F45 A;  1LA3 A;  3PM2 A;  2B1U A;  2BBN A;  2E30 A;  1E8A A;  1Y1A A;  1DJG A;  2QPT A;  1DJZ A;  3DZT A;  1GJY A;  1M31 A;  1CDP A;  1MUX A;  2K60 A;  3C1V A;  2Y1N A;  1YUS A;  2H2K A;  5AAN A;  3VGO A;  1GM0 A;  1S6J A;  4PT1 A;  2JNX A;  2JUL A;  3I5G B;  3ICB A;  5HL1 A;  2K8M B;  3LL8 B;  2F3Z A;  1F4O A;  4DCK A;  1NX2 A;  2ZN9 A;  1ALV A;  1SNL A;  2F8P A;  4PCW A;  1EH2 A;  1SR6 C;  2CT9 A;  3CAB A;  2JPT A;  2E6W A;  2OTG B;  1G4Y R;  1DJI A;  1MXE A;  3K1E A;  2L5Y A;  5HYD A;  2BCX A;  1TUJ A;  2V53 A;  2HQ8 A;  2KPH A;  2JTZ A;  4UPG A;  1PK0 D;  1A03 A;  1QWV A;  1RJV A;  1OOI X;  4XYN A;  1S6C A;  1TIZ A;  4MVF A;  2LAP A;  1SL7 A;  2LVV A;  1XFY O;  4CLN A;  2WCJ A;  1K95 A;  1YUU A;  1V1F A;  1PSR A;  1K8U A;  3E3R A;  3I5I C;  3EVU A;  4ZCU A;  1BG1 A;  5AEQ A;  2LC5 A;  1JF2 A;  2L2C A;  4YRU A;  3NXA A;  1QX5 B;  3CTN A;  2G2B A;  5FI6 A;  2P70 A;  2WND A;  3OX6 A;  1WLZ A;  3B86 A;  4ORC B;  2PQL A;  4NQG A;  2CCM A;  1J7O A;  2KAX A;  1TN4 A;  1UUS A;  3LK0 A;  1J7P A;  4OV2 A;  1BOD A;  2LE9 B;  2LLS A;  1CFD A;  3R1V A;  1BOC A;  1XO5 A;  4OVN F;  3R72 A;  1UHN A;  3TZ1 A;  1TUZ A;  2D8N A;  1QXP A;  3BUX B;  1M45 A;  1OSA A;  4OZD A;  1NSH A;  1XFV O;  2HF5 A;  5G08 A;  3L47 A;  5EL2 A;  1RRO A;  1AHR A;  2ZND A;  1YR5 A;  3SS5 A;  4MZJ A;  4I5K A;  3M0W A;  1MHO A;  3EKJ A;  1S6I A;  1L7Z A;  5KU1 A;  1B7T Z;  1EG3 A;  1TRF A;  4FQO A;  3CS1 A;  2BCA A;  3PM8 A;  1XA5 A;  3A8R A;  4MRX A;  1IGV A;  1OOG A;  3JTD B;  1FW4 A;  1SSE B;  4PE1 A;  3DY9 A;  1NYA A;  1W7J B;  2JT0 A;  1RWY A;  2LVJ A;  2K2A A;  3O2P A;  1ZAC A;  2OS8 C;  1KFU S;  1REC A;  2KI4 B;  2KSP A;  4P5O E;  1DF0 A;  1CLB A;  2GTE A;  3ZWH A;  3WHT B;  3BFH A;  1WLM A;  1MXL C;  1B8L A;  5AER A;  2LV7 A;  3DD4 A;  1C07 A;  4GPL B;  4GUK A;  2L98 A;  1KSM A;  2KBI A;  1ZUZ A;  2H61 A;  3D73 A;  2GV5 A;  3NSO A;  4MN0 A;  1OMR A;  1AP4 A;  1DJY A;  4PAL A;  3TDU A;  1B8R A;  2LMT A;  3GOF A;  3AKA A;  2MHH A;  5I8N A;  3I5F B;  3BJH A;  2PYQ A;  1UHI A;  2PVB A;  4DRW A;  1FPW A;  1EG4 A;  5FYX A;  1MF8 B;  2MAZ A;  1WDC C;  1BJF A;  2WOR A;  1CKK A;  1UHJ A;  1AJ5 A;  3CYZ A;  3N7H A;  3DVK A;  1YRT B;  1XK4 C;  5AFP A;  2Y4Q A;  3B6X A;  2P6B B;  4WQ2 A;  5I94 A;  1JWD A;  3DYE A;  1OZS A;  1QLK A;  2KQY A;  1JBA A;  5JJG A;  1J1E A;  4MZL A;  4MEW A;  2MA2 A;  4AQI A;  1WRZ A;  3NGV A;  4C0K A;  1B7T Y;  2KI6 D;  1YUT A;  2WCM A;  4YGB B;  4MBE A;  1B1G A;  2LVI A;  3JVT C;  4P2Y B;  1K93 D;  2JT3 A;  5FI7 A;  1ALW A;  3NHI A;  1FF1 A;  1FBV A;  4PE7 A;  4PHM A;  3B88 A;  1L2O C;  2WCH A;  3DVJ A;  1QAS A;  3IF7 A;  1B47 A;  1YTZ C;  2LHL A;  2LUC A;  3S0G A;  4CFQ A;  3TUY C;  1F54 A;  1B8C A;  2KFF A;  1LS8 A;  2JXL A;  4M2P A;  4N1F A;  1F71 A;  1JF0 A;  1K94 A;  2Q4U A;  3LLE A;  1LXF C;  4MZK A;  4PHN A;  2BE4 A;  3SG4 A;  3QRX A;  3MSE B;  3BFB A;  4GGF A;  2BL0 B;  3DVE A;  2JTT A;  3OB2 B;  4ETO A;  1H8B A;  2I94 A;  3BUW B;  1NUB A;  1TCO B;  2A4J A;  4PHK A;  1X02 A;  2KBM A;  4PHJ A;  3VRP A;  2K7B A;  3TDI A;  1CB1 A;  5PAL A;  2M9G A;  1D1O A;  1SKT A;  1N2D A;  4JQ0 D;  4NDB A;  2MRD A;  2OTG C;  1DTL A;  3SIB A;  2NZ0 A;  2KAV A;  2NLN A;  4BY5 A;  1J7Q A;  4N1G A;  1JFJ A;  2AAO A;  2M3W A;  1K96 A;  3I5H B;  3KO0 A;  1OOF A;  3EVR A;  4GGN A;  4DIR A;  1YX8 A;  4YGE B;  2I2R E;  1OQP A;  1M39 A;  1WY9 A;  3BUM B;  2FJY A;  1TOP A;  5F6T A;  2I18 A;  1BU3 A;  1DGU A;  3FE6 A;  3KF9 A;  3S0B A;  3FIA A;  4MLW A;  3UNW A;  1CFF A;  1SK6 D;  1JC2 A;  2KLD A;  2L4I A;  1B4C A;  2KFH A;  1VRK A;  2LMU A;  2KYF A;  5KSZ A;  4JD9 A;  1TCF A;  2WC5 A;  3R1O A;  2FCD A;  2K0J A;  1KQV A;  1QVI Y;  3D76 A;  1NPQ A;  3LCP C;  1CTR A;  3D75 A;  1IRJ A;  1Y6W A;  1DJX A;  1Z2C B;  2M49 B;  1M63 B;  1A2X A;  1NCY A;  2PAL A;  1XFX O;  5KTY A;  5ER4 X;  1P28 A;  2Y5I A;  5DIC A;  2KDH A;  1OMD A;  2NXQ A;  3PSR A;  2DOQ A;  2BEC A;  1AUI B;  2HQW A;  3D77 A;  2SCP A;  1R2U A;  1SR6 B;  4F0Z B;  2OPO A;  1XFZ O;  2WCK A;  5JOL A;  2JWW A;  1C3Y A;  1OMV A;  2LAN A;  1HT9 A;  2EGD A;  1Q80 A;  1IIO A;  5HLV A;  1EXR A;  3JTD C;  1BT6 A;  3BUO B;  4JWQ A;  4CID A;  1CFC A;  3SG2 A;  1DJH A;  1GQM A;  3TDZ A;  4YBH B;  4GFT A;  1TTX A;  3I5I B;  1DF0 B;  3FE9 A;  1J7R A;  2L4H A;  3WXA A;  4IJ7 A;  2BKH B;  3FWC A;  1F4Q A;  2JNF A;  1XYD A;  3TS5 C;  2QEH A;  1AVS A;  4JKT A;  1KWO C;  3Q8I A;  1IQ5 A;  3PN7 C;  4F7F A;  5CSN A;  1FI6 A;  1GGW A;  1J55 A;  1DEL A;  1CMF A;  3H4S E;  1W9Z A;  1IJ5 A;  1Z4H A;  2LM5 A;  1BF5 A;  4MRY A;  2F2O A;  1KSO A;  2KLE A;  2O60 A;  1CDM A;  3VB1 A;  1FI5 A;  3R1P A;  4AOM A;  4OR9 B;  1CDL A;  4M2Q A;  1TNX A;  2LUX A;  4DUQ A;  2M7N A;  2MJW B;  4PE0 A;  4E68 A;  1DGV A;  1CLM A;  1QIV A;  3K21 A;  2KFG A;  2JRF A;  4FTG A;  1DQE A;  1QJT A;  4NDD A;  1U5I B;  3PAL A;  1PAL A;  3VRN A;  1NCX A;  2EC6 C;  1WRK A;  2O5G A;  2WC8 A;  4GAO A;  1F55 A;  3KEV A;  3SG7 A;  1S5G Y;  2ZN8 A;  3CR4 X;  3D78 A;  4GBA A;  3UO9 A;  2ZRS A;  3VRO A;  1W7I B;  1WRL A;  4QJ5 B;  3IQO A;  3VRR A;  3RZS A;  2LP2 A;  1BR1 B;  1KK7 Z;  1QV1 A;  3CZ1 A;  2OS8 B;  3HX4 A;  1TWO A;  1JFK A;  2JZI A;  2FJU B;  4HRH A;  2MLE C;  1HQV A;  3AAJ A;  1UHH A;  1A29 A;  1U5I A;  2COL B;  1NX3 A;  1QTX A;  1UUR A;  1YVL A;  2ZNE A;  3OB1 B;  4YGD B;  1NP8 A;  2KGB C;  4ZCV A;  4A4C A;  2K7O A;  3FWB A;  2NCO A;  1EL4 A;  3OGN A;  1J1D A;  1V1G A;  4HRE E;  1SPY A;  1KK8 B;  4HRG A;  1CMG A;  3BXK A;  1K9K A;  1H4B A;  1QVI Z;  2BL0 C;  3DXL A;  4R1E A;  1RFJ A;  1K9U A;  4OCI A;  3GK4 X;  4YI9 A;  1MR8 A;  3OHM B;  2QDI A;  5D3O A;  2AUC A;  2H8V A;  2BCB A;  4YGA A;  4INW A;  1SCM B;  2L5X B;  1KFX L;  1OOH A;  2MBX A;  1OZO A;  3SS4 A;  1KQM B;  1C7V A;  1R6P A;  1A75 A;  1CM1 A;  5DKQ A;  1NCZ A;  1SBJ A;  3I5G C;  1K2H A;  2F33 A;  1CDN A;  3BUN B;  4I5N B;  2LP3 A;  1CM4 A;  3OX5 A;  1JUO A;  3S0E A;  1YRU B;  1SCV A;  3I5H C;  2JOJ A;  4CFR A;  3ZNI A;  2KHN A;  1OE9 B;  1RK9 A;  2WCE A;  1SYM A;  1UHK A;  4XJK B;  1XFU O;  5DKR A;  1LKJ A;  1XK4 A;  2WCL A;  3JVT B;  3CLN A;  1OW4 A;  3HCM A;  5DKN A;  1C7W A;  1B9A A;  1MWN A;  2LVK A;  2KNE A;  1OOJ A;  1XFR A;  3PFV A;  1KK7 Y;  1CNP A;  5B8I B;  1F8H A;  3D74 A;  1CFP A;  3NSL A;  3CR2 A;  3TUY B;  1BMO A;  4XJK A;  1UWO A;  2FCE A;  2R2I A;  3B87 A;  3OP0 A;  2ERB A;  2PSR A;  4YGC B;  1NIW A;  2BBM A;  3B7A A;  2LNK A;  3EG5 B;  3L4L A;  1IKU A;  2WCB A;  4I5L B;  2KQ6 A;  2LLU A;  3O4X A;  3BFA A;  2M1U A;  3O6B A;  1NWD A;  3BOW B;  4DS7 A;  1IQ3 A;  3NHT A;  5IBW A;  2JT8 A;  1CLL A;  1ZFS A;  1DEK A;  4C0J A;  2K7C A; 
#chains in the Genus database with same CATH homology
 3EVV A;  3SIA A;  2CTN A;  1Y0V H;  4PDZ A;  3BQ3 A;  1YX7 A;  2M29 A;  1QV0 A;  1TNP A;  4ICB A;  3SJS A;  5I2Q A;  2BE6 A;  2M1K B;  3BOW A;  3CR5 X;  1AJ4 A;  1QX2 A;  2F2P A;  2M8U A;  5I2O A;  2GGZ A;  2HPS A;  5HKW A;  2PRU A;  1BLQ A;  1KCY A;  2SAS A;  1ODB A;  2FOT A;  3DF0 B;  4OKH A;  1S5G Z;  2CBL A;  2JXC A;  3BYA A;  4USL A;  3RLZ A;  4N5X A;  1SL9 A;  2M7L A;  3WHU B;  4AQJ A;  3AAK A;  3A4U B;  1LA0 A;  5K89 A;  1LVC D;  2KGR A;  5HKZ A;  4M2O A;  3WNX B;  5HLO A;  4HSZ A;  1SW8 A;  2LMV A;  4I5J A;  2H61 C;  4JPZ B;  2M0R A;  1JSA A;  5ER5 A;  3NSK A;  4NDC A;  3DF0 A;  4YI8 A;  4A4B A;  2KI4 C;  5HKY A;  2GGM A;  3D0Y B;  2JU0 A;  3KHE A;  3SG3 A;  1YUR A;  5TNC A;  3DVM A;  2ZFD A;  3LK1 A;  1IG5 A;  2IS9 A;  5CSJ A;  1NX0 A;  2WOS A;  1G33 A;  3PLF B;  2CXJ A;  2VRG A;  3PAT A;  3EK4 A;  2NCP A;  1TNW A;  3I5F C;  2LHI A;  3D0Y A;  2LCP A;  1DT7 B;  1M46 A;  2KAY A;  4D1E A;  1PSB A;  1Y1X A;  1Y1U A;  2JQ6 A;  1SL8 A;  2K2F A;  2JC2 A;  5CSI A;  1XFW O;  4ORA B;  1IJ6 A;  1SY9 A;  2CNP A;  1PUL A;  3AKB A;  3SG6 A;  1NX1 A;  2KI6 C;  2QAC A;  1S36 A;  5J3X A;  2L51 A;  1A4P A;  3VRQ A;  1BR4 B;  4IL1 A;  2AMI A;  1LIN A;  1SRA A;  1DMO A;  3TS5 B;  3EKH A;  5D69 A;  1KWO B;  2PMY A;  1KFU L;  2L0P A;  3FS7 A;  2ISD A;  3PN7 B;  1K9P A;  1S3P A;  2MLF C;  4L9M A;  2HET A;  1KK8 C;  4GGF C;  3KPX A;  3IQQ A;  2BKI B;  2Y1M A;  1RTP 1;  4CPV A;  1PRW A;  2I7A A;  4WQ3 A;  5GQQ C;  1DVI A;  3GK2 A;  1A75 B;  1QLS A;  1SCM C;  3CGA A;  4GNK B;  1XVJ A;  3RM1 A;  5BPJ A;  1KQM C;  1DJW A;  4TNC A;  1QX7 A;  1KFX S;  1QIW A;  2PAS A;  1IH0 A;  1AK8 A;  4QJ4 B;  1WDC B;  4C0L A;  1PVA A;  2EC6 B;  3SG5 A;  2ZKM X;  2LLT A;  2G9B A;  1MQ1 A;  1TNQ A;  1N65 A;  1N0Y A;  1GGZ A;  2KYC A;  2L2E A;  2Q91 A;  3O4Y A;  4MSP A;  4PE4 A;  1SMG A;  1EJ3 A;  2EHB A;  5CPV A;  5CSF A;  2F3Y A;  4BY4 A;  5D7F A;  4QJ3 B;  1S1E A;  2RGI A;  2M97 A;  2K7D A;  2K61 A;  5I2L A;  4ORB B;  2WCF A;  3EK7 A;  3GK1 A;  1K90 D;  3D10 A;  1QAT A;  1UP5 A;  1YVH A;  1QS7 A;  3EK8 A;  1PVB A;  1G8I A;  3CZT X;  4WRI A;  1ZMZ A;  2TN4 A;  2KOT A;  3O78 A;  5AXI A;  1ZOT B;  2L50 A;  2ZRT A;  1IWQ A;  1L2O B;  4Q04 A;  1F70 A;  1S26 D;  3CWG A;  3F45 A;  1LA3 A;  2B1U A;  2BBN A;  2E30 A;  1E8A A;  1Y1A A;  1DJG A;  2QPT A;  1DJZ A;  4U8D A;  1GJY A;  1M31 A;  1CDP A;  1MUX A;  3C1V A;  5AAN A;  2Y1N A;  1YUS A;  2H2K A;  3VGO A;  1S6J A;  2JNX A;  2JUL A;  3I5G B;  3ICB A;  2K8M B;  3LL8 B;  2F3Z A;  1F4O A;  4DCK A;  1NX2 A;  2ZN9 A;  1ALV A;  1SNL A;  2F8P A;  4PCW A;  1EH2 A;  1SR6 C;  2CT9 A;  2JPT A;  2E6W A;  2OTG B;  1G4Y R;  1DJI A;  1MXE A;  5HYD A;  2BCX A;  2V53 A;  2HQ8 A;  2JTZ A;  4UPG A;  1PK0 D;  1A03 A;  1RJV A;  4XYN A;  1S6C A;  1TIZ A;  4MVF A;  2LAP A;  1SL7 A;  2LVV A;  1XFY O;  4CLN A;  1K95 A;  1YUU A;  1V1F A;  1PSR A;  1K8U A;  3E3R A;  3I5I C;  3EVU A;  4ZCU A;  1BG1 A;  5AEQ A;  2LC5 A;  1JF2 A;  4YRU A;  3NXA A;  1QX5 B;  3CTN A;  2G2B A;  2WND A;  3OX6 A;  1WLZ A;  4ORC B;  4NQG A;  2CCM A;  1J7O A;  2KAX A;  1TN4 A;  1UUS A;  3LK0 A;  1J7P A;  4OV2 A;  1BOD A;  2LE9 B;  2LLS A;  1CFD A;  1BOC A;  1XO5 A;  4OVN F;  1UHN A;  3TZ1 A;  2D8N A;  1QXP A;  3BUX B;  1M45 A;  1OSA A;  1NSH A;  1XFV O;  2HF5 A;  5G08 A;  1RRO A;  1AHR A;  2ZND A;  1YR5 A;  4MZJ A;  4I5K A;  3M0W A;  1MHO A;  3EKJ A;  1S6I A;  1L7Z A;  5KU1 A;  1B7T Z;  1EG3 A;  1TRF A;  4FQO A;  3CS1 A;  2BCA A;  3PM8 A;  1XA5 A;  3A8R A;  4MRX A;  1IGV A;  3JTD B;  1FW4 A;  4PE1 A;  1NYA A;  1W7J B;  2JT0 A;  1RWY A;  2LVJ A;  2K2A A;  3O2P A;  1ZAC A;  2OS8 C;  1KFU S;  1REC A;  2KI4 B;  2KSP A;  4P5O E;  1DF0 A;  1CLB A;  3ZWH A;  3WHT B;  1WLM A;  1MXL C;  1B8L A;  5AER A;  2LV7 A;  3DD4 A;  1C07 A;  4GPL B;  4GUK A;  2L98 A;  1KSM A;  2KBI A;  1ZUZ A;  2H61 A;  3NSO A;  2GV5 A;  4MN0 A;  1OMR A;  1AP4 A;  1DJY A;  4PAL A;  3TDU A;  1B8R A;  2LMT A;  3GOF A;  3AKA A;  2MHH A;  5I8N A;  3I5F B;  1UHI A;  2PVB A;  4DRW A;  1FPW A;  1EG4 A;  5FYX A;  1MF8 B;  2MAZ A;  1WDC C;  1BJF A;  2WOR A;  1CKK A;  1UHJ A;  1AJ5 A;  3DVK A;  1YRT B;  1XK4 C;  5AFP A;  2Y4Q A;  2P6B B;  4WQ2 A;  1JWD A;  1OZS A;  1QLK A;  2KQY A;  1JBA A;  5JJG A;  1J1E A;  4MZL A;  4MEW A;  2MA2 A;  4AQI A;  1WRZ A;  4C0K A;  1B7T Y;  2KI6 D;  1YUT A;  4YGB B;  4MBE A;  1B1G A;  2LVI A;  3JVT C;  4P2Y B;  1K93 D;  2JT3 A;  1ALW A;  1FF1 A;  1FBV A;  4PE7 A;  4PHM A;  1L2O C;  4CFQ A;  3DVJ A;  1QAS A;  3IF7 A;  1B47 A;  1YTZ C;  2LHL A;  2LUC A;  3TUY C;  1F54 A;  1B8C A;  2KFF A;  4N1F A;  2JXL A;  4M2P A;  1F71 A;  1JF0 A;  1K94 A;  2Q4U A;  3LLE A;  1LXF C;  4MZK A;  4PHN A;  2BE4 A;  3SG4 A;  3QRX A;  3MSE B;  4GGF A;  2BL0 B;  3DVE A;  2JTT A;  3OB2 B;  4ETO A;  1H8B A;  2I94 A;  3BUW B;  1NUB A;  1TCO B;  2A4J A;  4PHK A;  1X02 A;  2KBM A;  4PHJ A;  3VRP A;  2K7B A;  3TDI A;  1CB1 A;  5PAL A;  2M9G A;  1D1O A;  1SKT A;  1N2D A;  4JQ0 D;  4NDB A;  2MRD A;  2OTG C;  1DTL A;  3SIB A;  2NZ0 A;  2KAV A;  2NLN A;  4BY5 A;  1J7Q A;  4N1G A;  1JFJ A;  2AAO A;  2M3W A;  1K96 A;  3I5H B;  3KO0 A;  3EVR A;  4GGN A;  4DIR A;  1YX8 A;  4YGE B;  2I2R E;  1OQP A;  1M39 A;  1WY9 A;  3BUM B;  1TOP A;  5F6T A;  2I18 A;  1BU3 A;  1DGU A;  3KF9 A;  3FIA A;  4MLW A;  1CFF A;  1SK6 D;  1JC2 A;  2L4I A;  1B4C A;  2KFH A;  1VRK A;  2LMU A;  2KYF A;  5KSZ A;  1TCF A;  2FCD A;  2K0J A;  1KQV A;  1QVI Y;  1NPQ A;  3LCP C;  1CTR A;  1IRJ A;  1Y6W A;  1DJX A;  2M49 B;  1M63 B;  1A2X A;  1NCY A;  2PAL A;  1XFX O;  5KTY A;  5ER4 X;  2Y5I A;  2KDH A;  1OMD A;  2NXQ A;  3PSR A;  2DOQ A;  2BEC A;  1AUI B;  2HQW A;  2SCP A;  1R2U A;  1SR6 B;  4F0Z B;  2OPO A;  1XFZ O;  5JOL A;  2JWW A;  1OMV A;  2LAN A;  1HT9 A;  2EGD A;  1Q80 A;  5HLV A;  1EXR A;  3JTD C;  1BT6 A;  3BUO B;  4JWQ A;  4CID A;  1CFC A;  3SG2 A;  1DJH A;  1GQM A;  3TDZ A;  4YBH B;  4GFT A;  1TTX A;  3I5I B;  1DF0 B;  3WXA A;  1J7R A;  2L4H A;  2BKH B;  3FWC A;  1F4Q A;  2JNF A;  1XYD A;  3TS5 C;  1AVS A;  1KWO C;  1IQ5 A;  3PN7 C;  5CSN A;  1FI6 A;  1GGW A;  1J55 A;  1CMF A;  3H4S E;  1IJ5 A;  2LM5 A;  1BF5 A;  4MRY A;  2F2O A;  1KSO A;  2O60 A;  1CDM A;  1FI5 A;  4AOM A;  4OR9 B;  1CDL A;  4M2Q A;  1TNX A;  2LUX A;  4DUQ A;  2M7N A;  2MJW B;  4PE0 A;  4E68 A;  1DGV A;  1CLM A;  1QIV A;  3K21 A;  2KFG A;  2JRF A;  4FTG A;  1QJT A;  4NDD A;  1U5I B;  3PAL A;  1PAL A;  3VRN A;  1NCX A;  2EC6 C;  1WRK A;  2O5G A;  2WC8 A;  4GAO A;  1F55 A;  3KEV A;  3SG7 A;  1S5G Y;  2ZN8 A;  3CR4 X;  4GBA A;  2ZRS A;  3VRO A;  1W7I B;  1WRL A;  4QJ5 B;  3IQO A;  3VRR A;  2LP2 A;  1BR1 B;  1KK7 Z;  1QV1 A;  3HX4 A;  2OS8 B;  1JFK A;  2JZI A;  2FJU B;  4HRH A;  2MLE C;  1HQV A;  3AAJ A;  1UHH A;  1A29 A;  1U5I A;  2COL B;  1NX3 A;  1QTX A;  1UUR A;  1YVL A;  2ZNE A;  3OB1 B;  4YGD B;  1NP8 A;  2KGB C;  4ZCV A;  4A4C A;  2K7O A;  3FWB A;  2NCO A;  1EL4 A;  1J1D A;  1V1G A;  4HRE E;  1SPY A;  1KK8 B;  4HRG A;  1CMG A;  3BXK A;  1K9K A;  1H4B A;  1QVI Z;  2BL0 C;  4R1E A;  1RFJ A;  1K9U A;  4OCI A;  3GK4 X;  4YI9 A;  1MR8 A;  3OHM B;  2AUC A;  2BCB A;  4YGA A;  1SCM B;  2L5X B;  1KFX L;  2MBX A;  1OZO A;  1C7V A;  1KQM B;  1R6P A;  1A75 A;  1CM1 A;  5DKQ A;  1NCZ A;  1SBJ A;  3I5G C;  1K2H A;  2F33 A;  1CDN A;  3BUN B;  4I5N B;  2LP3 A;  1CM4 A;  3OX5 A;  1JUO A;  1YRU B;  1SCV A;  3I5H C;  2JOJ A;  4CFR A;  3ZNI A;  2KHN A;  1OE9 B;  1RK9 A;  2WCE A;  1SYM A;  1UHK A;  4XJK B;  1XFU O;  5DKR A;  1LKJ A;  1XK4 A;  3JVT B;  3CLN A;  3HCM A;  5DKN A;  1C7W A;  1B9A A;  1MWN A;  2LVK A;  2KNE A;  1OOJ A;  3PFV A;  1KK7 Y;  1CNP A;  5B8I B;  1F8H A;  1CFP A;  3NSL A;  3CR2 A;  3TUY B;  1BMO A;  4XJK A;  1UWO A;  2FCE A;  2R2I A;  3OP0 A;  4YGC B;  2PSR A;  1NIW A;  2BBM A;  2LNK A;  1IKU A;  2WCB A;  4I5L B;  2KQ6 A;  2LLU A;  2M1U A;  3O6B A;  1NWD A;  3BOW B;  4DS7 A;  1IQ3 A;  5IBW A;  2JT8 A;  1CLL A;  1ZFS A;  3NSI A;  4C0J A;  2K7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...