1SL9A

Obelin from obelia longissima
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
191
structure length
186
Chain Sequence
YAVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNAGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obelin
publication title Obelin from Obelia longissima
rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 74
structure length 186
sequence length 191
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sl9A00
1DT7B 3SIAA 2LV7A 1YTZC 3I5GB 1CLLA 1S36A 3AAJA 4USLA 2MLEC 3O6BA 2CNPA 1K8UA 2FJUB 2LUXA 2PSRA 1XVJA 2I18A 4WRIA 2JNFA 1VRKA 3FIAA 1S6JA 1V1FA 4HRHA 1B7TY 2HQ8A 2MAZA 1N65A 1WRZA 2K0JA 4NQGA 3KO0A 1XO5A 1YX7A 1DJGA 1RJVA 2CCMA 1BODA 2M0RA 4M2OA 2MLFC 4OCIA 4P5OE 1OOJA 3PM8A 4PCWA 2JTZA 4QJ5B 2E6WA 3PFVA 2F2OA 2GV5A 2JQ6A 4CLNA 3NXAA 1XFUO 1PULA 1OMDA 1SCMC 1X02A 1ZFSA 1Q80A 1SL9A 3HX4A 2OPOA 4ETOA 3GK4X 1KSOA 2H61C 1QVIZ 1K90D 3BOWB 1EXRA 4ORAB 2O60A 5KTYA 2BE4A 4GNKB 4BY4A 4OV2A 4MN0A 3WXAA 2AMIA 2QACA 1NX2A 4XJKB 1JF0A 5I2LA 3C1VA 1Y6WA 2JWWA 2NZ0A 3CLNA 5J3XA 3O78A 1BJFA 1S3PA 3BXKA 4YBHB 3NSKA 1NCXA 2CT9A 2Y5IA 1NIWA 1IWQA 2KQYA 5CSJA 1AK8A 3DF0B 3M0WA 4WQ3A 2HQWA 2KYFA 1K9PA 2BL0C 1M46A 2WCBA 4NDCA 4YI8A 4YGDB 4F0ZB 2JT8A 1B8CA 4MVFA 1V1GA 2NCPA 3VROA 4PHKA 4N1FA 1OMRA 1PSBA 5PALA 5HLVA 1UP5A 1A75B 1FBVA 3VRPA 2I7AA 2M1UA 2Y1MA 2Y4QA 4GUKA 1SMGA 1NX0A 1SCMB 1TIZA 2CBLA 1RECA 1LA3A 3OX6A 2KNEA 2LMUA 1QX2A 1R2UA 3KHEA 2LCPA 1IG5A 1DGUA 2LHIA 2Q91A 3GK2A 1S26D 4PE0A 4U8DA 1XYDA 2JXLA 1CKKA 1E8AA 3PN7C 1K95A 1KK8C 1QX7A 2JT3A 1QLSA 1XFYO 2JNXA 2M29A 2JTTA 2WCEA 4CPVA 4E68A 2JRFA 2HETA 1MXEA 2H61A 1PVAA 1JF2A 1SW8A 1DJYA 1CM1A 3I5IC 1QJTA 1WRLA 1CFFA 1LKJA 2KGRA 4JWQA 1GGWA 5DKRA 2K8MB 1BT6A 2BL0B 2KOTA 1YURA 2KDHA 3CWGA 3JTDB 3JVTC 4M2PA 1CNPA 1IJ5A 2K2AA 4C0JA 4UPGA 1SPYA 1RFJA 4OVNF 1L2OC 5I8NA 1CFCA 1GQMA 3AAKA 2JOJA 1W7IB 1KSMA 4YGAA 2L5XB 2EGDA 1AUIB 1XFVO 1YVLA 3SG2A 3BUNB 2D8NA 4GGFA 1B9AA 1JFKA 1CFPA 1PK0D 1OMVA 3BYAA 2LP2A 1N2DA 2K2FA 2KQ6A 2BECA 3I5FC 2GGZA 3SG4A 5CSNA 1K2HA 4GFTA 3PN7B 4JQ0D 1KK8B 1RROA 1JSAA 2R2IA 1QIWA 1WY9A 2V53A 1C7VA 1DF0A 1IJ6A 2JT0A 1B47A 1SNLA 1Y0VH 1WRKA 4DUQA 1RK9A 1FF1A 1H8BA 2ZN9A 1FW4A 1F70A 2PVBA 3DVMA 1CMGA 1Y1UA 1UURA 1TNXA 1TN4A 1OZSA 1AJ4A 1QVIY 2L4HA 1OZOA 4YGBB 3EK4A 3IQQA 4P2YB 1UHJA 4A4CA 4FQOA 4CFRA 1G8IA 2JPTA 3ZWHA 4FTGA 5TNCA 3OB2B 1YX8A 2KBMA 3BUOB 2ZRTA 1MHOA 1WDCC 2F8PA 2LUCA 5IBWA 2BKIB 4ZCVA 3CS1A 1NPQA 2F3YA 2KFGA 2LMVA 3FWBA 2BBNA 1S6CA 5FYXA 2KI6D 3I5FB 4ZCUA 2KAYA 2AAOA 2K7BA 2PMYA 2ZNDA 2LVIA 4MLWA 1QX5B 5F6TA 4PHJA 1SL7A 4DS7A 4QJ4B 3LLEA 1WLZA 2F33A 1MF8B 4L9MA 4OR9B 2CXJA 1TRFA 2MJWB 3BQ3A 3LL8B 1JUOA 3PSRA 3WHUB 4AQIA 1AVSA 1FPWA 2K7CA 4CIDA 2OTGC 4IL1A 1G33A 3PLFB 1DVIA 2WC8A 2BKHB 1S1EA 3D10A 2FCEA 4CFQA 2M7NA 1J7RA 3D0YA 2SASA 3GOFA 1SR6C 2KFHA 1F8HA 1WDCB 2NCOA 1NWDA 4YGCB 3EVVA 1Y1AA 4AOMA 4D1EA 4ORCB 1ZOTB 4ICBA 1YUUA 1OSAA 4MBEA 1YUSA 1GGZA 2MA2A 3DVJA 2JZIA 1NP8A 3TDIA 2Q4UA 1ALWA 4GGFC 1KQMC 4QJ3B 1BG1A 1EH2A 1QXPA 2CTNA 3NSOA 4AQJA 1B4CA 1ZUZA 1NCZA 1HQVA 3LK0A 3PALA 3SIBA 5KU1A 2NXQA 3NSIA 2JXCA 2L4IA 2LLTA 1CB1A 2E30A 1EL4A 1SL8A 2LM5A 3EKJA 2OTGB 4I5LB 1NX3A 1YRUB 2BCBA 1QV0A 4MZLA 1BR1B 1SBJA 3KEVA 2M8UA 1UHIA 4MZJA 2QPTA 1KCYA 1S5GZ 4HSZA 1DJWA 2COLB 1KWOC 4MZKA 1SR6B 5AANA 2KHNA 3O2PA 2PASA 2LE9B 2KSPA 1DJIA 1K9UA 1SYMA 1G4YR 1M39A 1KFXL 1MR8A 2I2RE 3EVUA 3GK1A 3PATA 1F4OA 1DTLA 1QASA 2LVJA 3CZTX 4ORBB 1CFDA 2L2EA 1QS7A 1KQMB 4MSPA 3BUWB 4PE4A 5AEQA 1CDLA 3VRRA 4DCKA 1AJ5A 1PVBA 3TS5C 4JPZB 1UWOA 2LMTA 3MSEB 1Y1XA 3LK1A 5JJGA 3TZ1A 5B8IB 2LHLA 2EC6C 3OHMB 4A4BA 1PRWA 1DF0B 2B1UA 3AKBA 1QLKA 1CTRA 3OP0A 4GBAA 1IQ3A 1TNQA 2FCDA 2WORA 1J1DA 4M2QA 5D7FA 1BF5A 3TDZA 5DKNA 5HKYA 1KWOB 3CR2A 2LANA 3OB1B 2BBMA 2A4JA 2KI6C 3CTNA 1YUTA 3I5GC 1J7QA 1L7ZA 2AUCA 4I5KA 2OS8C 2ZN8A 3FWCA 1FI5A 1GJYA 1M31A 5AXIA 3SG3A 3RLZA 1DJHA 1TNPA 1AHRA 3I5IB 2F2PA 1DMOA 1EG3A 1TOPA 4XYNA 3I5HC 2SCPA 3ZNIA 5CSIA 1IGVA 1DGVA 3JVTB 2LLUA 3CGAA 2H2KA 2K7DA 4N5XA 2LVKA 1J7PA 2HF5A 1LA0A 1K94A 1J7OA 1EJ3A 1L2OB 1KK7Z 2KAXA 4TNCA 4HREE 5ER5A 4DRWA 3SG5A 1K93D 3TS5B 1QATA 1PALA 1JWDA 3OX5A 1KFUS 4DIRA 4PHMA 2EC6B 1S6IA 2PALA 4C0KA 3RM1A 1F55A 1BU3A 2F3ZA 3O4YA 5BPJA 4MRYA 1FI6A 3CR5X 1M63B 2M97A 3A4UB 4GPLB 4OKHA 4R1EA 5HKZA 2NLNA 1B1GA 1BMOA 1U5IA 2OS8B 1IRJA 4HRGA 4GGNA 1NSHA 3D0YB 3H4SE 5AFPA 1BOCA 1XA5A 2G9BA 2ZFDA 2WNDA 2LVVA 2KGBC 1MXLC 2G2BA 3CR4X 1PSRA 3BUXB 3I5HB 2LAPA 4PE1A 4NDDA 4PDZA 1S5GY 1JFJA 3SG6A 2MRDA 2ZRSA 4GAOA 5CPVA 1IKUA 1H4BA 1CDNA 1C7WA 5JOLA 1ALVA 3EK7A 2M7LA 2ISDA 5AERA 2KFFA 3KPXA 2PRUA 4C0LA 1ODBA 5I2OA 1TCOB 4YRUA 1QTXA 1J55A 1SK6D 1A29A 1XFXO 1DJXA 1UUSA 1XK4C 4I5JA 4MRXA 5HYDA 1ZACA 1MUXA 4I5NB 2LC5A 3E3RA 3A8RA 4PALA 1IQ5A 1J1EA 3EKHA 1CLBA 3VGOA 2KAVA 1XFWO 2DOQA 1SCVA 2LNKA 1CMFA 2K7OA 2BE6A 4PE7A 2BCXA 5CSFA 1BLQA 3VRNA 3BOWA 1NCYA 4N1GA 3DVEA 5HLOA 5HKWA 1A03A 1B7TZ 3QRXA 3VRQA 2JU0A 2M9GA 2WCFA 1F4QA 1TTXA 5G08A 3JTDC 4XJKA 1SKTA 3WHTB 1B8RA 1DJZA 2KI4C 1UHKA 1YVHA 2M1KB 3NSLA 1LVCD 2JULA 1R6PA 5KSZA 1F54A 3DF0A 5I2QA 3SJSA 3F45A 4MEWA 1M45A 2L98A 1WLMA 4WQ2A 1UHNA 1NUBA 1A75A 2VRGA 1MQ1A 3EVRA 2ZNEA 1KK7Y 3IQOA 2BCAA 2EHBA 1XK4A 1MWNA 3TUYC 1N0YA 2I94A 1NYAA 1NX1A 3ICBA 4Q04A 2KYCA 1KFUL 1YRTB 1LXFC 2TN4A 1EG4A 1OE9B 5ER4X 3BUMB 4BY5A 2LP3A 1KQVA 1HT9A 1XFZO 1ZMZA 2KBIA 2M3WA 1TCFA 5DKQA 3WNXB 1AP4A 3AKAA 2MBXA 3SG7A 3FS7A 2M49B 5D69A 2KI4B 1UHHA 1CDPA 1C07A 2L0PA 3HCMA 2O5GA 4YI9A 2IS9A 2HPSA 2ZKMX 3EK8A 1RTP1 1A2XA 2Y1NA 1D1OA 1B8LA 2JC2A 1K96A 1JBAA 4YGEB 1RWYA 1OQPA 3TDUA 2L50A 3K21A 2L51A 1CDMA 1W7JB 1CM4A 1F71A 3DD4A 1K9KA 3TUYB 1CLMA 3DVKA 1TNWA 2MHHA 2P6BB 1KFXS 2RGIA 4NDBA 1QV1A 1YR5A 1A4PA 4PHNA 2K61A 1JC2A 1U5IB 2WOSA 1BR4B 1SY9A 3IF7A 5GQQC 2GGMA 3KF9A 3LCPC 2FOTA 2LLSA 1IH0A 5K89A 1QIVA 1SRAA 1LINA
chains in the Genus database with same CATH superfamily
1DT7B 3SIAA 2LV7A 1YTZC 3I5GB 1TWOA 1CLLA 1S36A 3AAJA 3BJHA 2MLEC 4USLA 3O6BA 2CNPA 1K8UA 2FJUB 2LUXA 2PSRA 1XVJA 2I18A 4INXA 2JNFA 1VRKA 3FIAA 4WRIA 2PQLA 1S6JA 1V1FA 4HRHA 1B7TY 2HQ8A 2MAZA 1N65A 1WRZA 2K0JA 4NQGA 3KO0A 1XO5A 1YX7A 1DJGA 1RJVA 2CCMA 1BODA 2M0RA 4M2OA 3K1EA 2MLFC 4OCIA 4P5OE 1OOJA 3PM8A 5FI2A 4PCWA 2JTZA 4QJ5B 5I94A 2E6WA 3PFVA 2F2OA 2GV5A 2JQ6A 4CLNA 4JKTA 3NXAA 1XFUO 1PULA 1OMDA 1SCMC 3SS5A 1X02A 1ZFSA 1Q80A 1SL9A 3HX4A 2OPOA 4ETOA 3GK4X 2YGUA 3B86A 1KSOA 2H61C 1QVIZ 1K90D 3BOWB 1EXRA 4ORAB 2O60A 5KTYA 2BE4A 4GNKB 2P71A 4OV2A 4BY4A 4MN0A 3WXAA 2AMIA 2QACA 1NX2A 4XJKB 1JF0A 5I2LA 3C1VA 1Y6WA 2JWWA 2NZ0A 3CLNA 5J3XA 3O78A 1BJFA 1S3PA 2QEOA 3BXKA 4YBHB 3SS4A 3NSKA 1NCXA 2CT9A 2Y5IA 1NIWA 1IWQA 2KQYA 2K60A 5CSJA 1AK8A 3DF0B 3M0WA 4WQ3A 2HQWA 2KYFA 1K9PA 2BL0C 1M46A 2WCBA 4NDCA 4YI8A 4YGDB 4F0ZB 2JT8A 1B8CA 4MVFA 1V1GA 2NCPA 2WCJA 3VROA 4PHKA 4N1FA 1OMRA 1PSBA 5PALA 5HLVA 1UP5A 1A75B 1FBVA 3VRPA 2I7AA 2M1UA 2Y1MA 2Y4QA 4GUKA 1SMGA 1NX0A 1SCMB 1TIZA 2CBLA 1RECA 1LA3A 3OX6A 2KNEA 2LMUA 3PM2A 1QX2A 1R2UA 3KHEA 1TUJA 2LCPA 1IG5A 1DGUA 2WC5A 2LHIA 2Q91A 3GK2A 1S26D 4PE0A 4U8DA 1GM0A 1C3ZA 1ORGA 1XYDA 1E8AA 2JXLA 1K95A 1KK8C 3FE8A 3PN7C 1CKKA 1QX7A 2JT3A 5FI6A 3S0DA 1QLSA 1XFYO 2JNXA 2M29A 2JTTA 2WCEA 4CPVA 2P70A 2JRFA 4E68A 2HETA 1MXEA 2H61A 1PVAA 1JF2A 3B7AA 1SW8A 1DJYA 1CM1A 3I5IC 1QJTA 1WRLA 1CFFA 1LKJA 2KGRA 4JWQA 1GGWA 5DKRA 2K8MB 1BT6A 2BL0B 2KOTA 1YURA 2KDHA 3B6XA 3CWGA 3JTDB 3JVTC 4M2PA 1IJ5A 2K2AA 4C0JA 4UPGA 5D3OA 1SPYA 1RFJA 4OVNF 1L2OC 5I8NA 1CFCA 1GQMA 3AAKA 3R72A 2JOJA 1W7IB 1KSMA 4YGAA 2L5XB 2EGDA 1AUIB 4FQTA 1XFVO 1YVLA 1OOGA 3SG2A 3BUNB 2D8NA 4GGFA 1B9AA 1JFKA 1CFPA 5HL1A 1PK0D 1OMVA 3B88A 2LP2A 3BYAA 1N2DA 4OZDA 2K2FA 2KQ6A 2BECA 3I5FC 2GGZA 3SG4A 5CSNA 1K2HA 4GFTA 3PN7B 4JQ0D 1KK8B 3O4XA 1RROA 1JSAA 2R2IA 1QIWA 1DEKA 1WY9A 3PJIA 3Q8IA 2V53A 1DELA 1C7VA 1DF0A 1IJ6A 2JT0A 1B47A 1SNLA 1Y0VH 1WRKA 4DUQA 1RK9A 2QEHA 1FF1A 1H8BA 2ZN9A 1FW4A 1F70A 2PVBA 3DVMA 1CMGA 1Y1UA 1UURA 3NGVA 1TNXA 1TN4A 1OZSA 1AJ4A 1QVIY 2L4HA 1OZOA 4YGBB 3EK4A 3IQQA 4P2YB 1UHJA 4A4CA 4FQOA 3VB1A 4CFRA 3RZSA 1G8IA 2JPTA 3ZWHA 4FTGA 5TNCA 3OB2B 3DXLA 1YX8A 2KBMA 3BUOB 2ZRTA 1MHOA 1WDCC 3IVTA 2F8PA 2LUCA 5IBWA 2BKIB 4ZCVA 3CS1A 2JPOA 3S0AA 3R1PA 1NPQA 2F3YA 2KFGA 2LMVA 3FWBA 2BBNA 1S6CA 5FYXA 2KI6D 3I5FB 4ZCUA 2KAYA 2AAOA 2K7BA 2PMYA 2ZNDA 2LVIA 4MLWA 1QX5B 5F6TA 4PHJA 1SL7A 4DS7A 4QJ4B 3LLEA 1WLZA 2F33A 1MF8B 4L9MA 4OR9B 2CXJA 1TRFA 2MJWB 3BQ3A 3LL8B 1JUOA 2KLEA 3PSRA 3WHUB 4AQIA 2H8VA 3S0EA 1AVSA 2ERBA 1FPWA 2K7CA 1Z4HA 2OTGC 4CIDA 4IL1A 1G33A 3PLFB 1DVIA 2WC8A 2BKHB 2KLDA 1S1EA 3D10A 2FCEA 4CFQA 3SS3A 2M7NA 1J7RA 3D0YA 2SASA 3GOFA 4KYNA 2QEVA 1OOHA 1SR6C 2KFHA 1F8HA 1WDCB 2NCOA 1NWDA 4YGCB 3EVVA 1Y1AA 4AOMA 4D1EA 4ORCB 1ZOTB 4ICBA 1YUUA 1OSAA 4MBEA 3D73A 1YUSA 1GGZA 2MA2A 3DVJA 2JZIA 1NP8A 3TDIA 2Q4UA 1ALWA 3D75A 1KQMC 4GGFC 4QJ3B 1BG1A 1EH2A 1QXPA 2CTNA 1OOFA 3NSOA 4AQJA 1QWVA 1B4CA 1ZUZA 1NCZA 1HQVA 3V2LA 3LK0A 3PALA 3SIBA 3L4LA 5KU1A 2NXQA 3NSIA 2JXCA 2L4IA 2LLTA 1CB1A 2E30A 1EL4A 1SL8A 2LM5A 3EKJA 2OTGB 4I5LB 1NX3A 1YRUB 2BCBA 1QV0A 4MZLA 1BR1B 1SBJA 3KEVA 2WCKA 2M8UA 1UHIA 4MZJA 4INWA 2QPTA 2L5YA 3BFBA 1KCYA 1S5GZ 4HSZA 1DJWA 2COLB 1KWOC 4MZKA 1SR6B 5AANA 2KHNA 3O2PA 2PASA 2LE9B 2KSPA 3EG5B 1DJIA 1K9UA 1SYMA 1G4YR 1M39A 1KFXL 1MR8A 1XFRA 2I2RE 3EVUA 3GK1A 3PATA 1F4OA 3DZTA 1DTLA 1QASA 2LVJA 2WCLA 3CZTX 3NHTA 3D78A 4ORBB 1CFDA 2L2EA 1QS7A 1KQMB 4MSPA 1OOIX 3BUWB 4PE4A 5AEQA 1CDLA 3VRRA 4DCKA 1AJ5A 1PVBA 3R1OA 4JPZB 3TS5C 1UWOA 2LMTA 3MSEB 1Y1XA 3CABA 3LK1A 5JJGA 3TZ1A 5B8IB 2LHLA 3L47A 2EC6C 3OHMB 4A4BA 1PRWA 3CDNA 1DF0B 2B1UA 4JD9A 3BFAA 3AKBA 1QLKA 1CTRA 3OP0A 4GBAA 1IQ3A 1TNQA 2FCDA 2WORA 1J1DA 4M2QA 5D7FA 1BF5A 3TDZA 5DKNA 5HKYA 1KWOB 3CR2A 2LANA 3OB1B 2BBMA 1DC1A 2A4JA 2KI6C 3CTNA 1YUTA 3I5GC 1J7QA 1L7ZA 2AUCA 4I5KA 2OS8C 2ZN8A 3FWCA 1FI5A 1GJYA 1M31A 5AXIA 3SG3A 3D77A 3RLZA 2BNXA 1DJHA 1TNPA 1AHRA 3I5IB 2F2PA 1CNPA 1DMOA 1EG3A 1TOPA 4XYNA 3I5HC 2SCPA 3D74A 3ZNIA 5CSIA 1IGVA 1DGVA 3JVTB 2LLUA 3CGAA 2H2KA 2K7DA 4N5XA 2LVKA 1J7PA 2HF5A 1LA0A 1K94A 1LS8A 2QDIA 1EJ3A 1L2OB 1J7OA 1KK7Z 2KAXA 4TNCA 4HREE 5ER5A 4DRWA 3SG5A 1K93D 3TS5B 1QATA 1PALA 1JWDA 3OX5A 1KFUS 4DIRA 4PHMA 2EC6B 1S6IA 2PALA 4C0KA 1SSEB 3RM1A 1BU3A 1F55A 2F3ZA 3O4YA 5BPJA 4MRYA 1FI6A 3CR5X 3L4AA 3S0BA 1M63B 2M97A 3A4UB 4GPLB 3CZ0A 4OKHA 1DQEA 4R1EA 5HKZA 2NLNA 1B1GA 1BMOA 1U5IA 2OS8B 1IRJA 4HRGA 4GGNA 1NSHA 3D0YB 3H4SE 5AFPA 1BOCA 1XA5A 1P28A 2G9BA 2ZFDA 2WNDA 2LVVA 2KGBC 1MXLC 2G2BA 3CR4X 1PSRA 3BUXB 3D76A 2LAPA 3I5HB 4PE1A 2PYQA 4NDDA 4PDZA 1S5GY 3FE9A 3UNWA 1JFJA 3SG6A 2MRDA 2ZRSA 4GAOA 5CPVA 1IKUA 1H4BA 1CDNA 1C7WA 5JOLA 1ALVA 3EK7A 2M7LA 2ISDA 5AERA 2KFFA 3KPXA 2PRUA 4C0LA 1ODBA 5I2OA 1TCOB 4YRUA 2QEBA 1QTXA 1J55A 1SK6D 3BFHA 1A29A 1XFXO 3CZ2A 1DJXA 1UUSA 1XK4C 4I5JA 4MRXA 3FE6A 1ZACA 5HYDA 1MUXA 4I5NB 2LC5A 3E3RA 2FJYA 3A8RA 4PALA 3S0FA 1IQ5A 1J1EA 3EKHA 1CLBA 3VGOA 2KAVA 1XFWO 2DOQA 1SCVA 2LNKA 1CMFA 1TUZA 2K7OA 2BE6A 4PE7A 2BCXA 5CSFA 1BLQA 3VRNA 5FI7A 3OBVA 2L2CA 1NCYA 3BOWA 4N1GA 3DVEA 5HLOA 5HKWA 1A03A 1B7TZ 3QRXA 3VRQA 2JU0A 2M9GA 2WCFA 5EL2A 1F4QA 1TTXA 5G08A 3JTDC 3S0GA 3CZ1A 4XJKA 1SKTA 3NHIA 3B87A 3WHTB 1B8RA 1DJZA 2KI4C 1UHKA 1YVHA 2M1KB 3OGNA 3NSLA 1LVCD 2JULA 1R6PA 5KSZA 1F54A 3DF0A 5I2QA 3SJSA 2BAPA 3F45A 4MEWA 1M45A 2L98A 1WLMA 4WQ2A 1UHNA 1OW4A 4PT1A 1NUBA 1A75A 2VRGA 1MQ1A 3EVRA 2ZNEA 4IJ7A 1KK7Y 3IQOA 2BCAA 3UO9A 2EHBA 1XK4A 1Z2CB 1MWNA 3TUYC 3DYEA 1N0YA 2I94A 1NYAA 1NX1A 1T14A 3ICBA 3R1VA 4Q04A 2KYCA 1KFUL 1YRTB 2WCMA 3CYZA 1LXFC 2TN4A 1EG4A 1OE9B 5ER4X 3BUMB 4BY5A 2LP3A 1KQVA 1HT9A 1XFZO 1ZMZA 2KBIA 2M3WA 1TCFA 5DKQA 3WNXB 3DY9A 1AP4A 3AKAA 2MBXA 3SG7A 1IIOA 3FS7A 2M49B 5D69A 2WC6A 2KI4B 1UHHA 1CDPA 1C07A 2L0PA 1W9ZA 3HCMA 2O5GA 4YI9A 2IS9A 2HPSA 2ZKMX 3EK8A 1RTP1 2KPHA 1A2XA 2Y1NA 3QMEA 1B8LA 1D1OA 2GTEA 2JC2A 5DICA 1K96A 1JBAA 4YGEB 1RWYA 1OQPA 3TDUA 2L50A 3K21A 2L51A 1CDMA 1W7JB 1C3YA 1CM4A 1F71A 3DD4A 1K9KA 3TUYB 1CLMA 3DVKA 1TNWA 2MHHA 2P6BB 1KFXS 2RGIA 4NDBA 1QV1A 1YR5A 4F7FA 1A4PA 4PHNA 2K61A 1JC2A 1U5IB 3N7HA 2WOSA 1BR4B 1SY9A 3IF7A 5GQQC 2GGMA 3KF9A 3LCPC 2FOTA 2LLSA 1IH0A 5K89A 1QIVA 1SRAA 1LINA 2WCHA
chains in the Genus database with same CATH topology
1DT7B 3SIAA 2LV7A 1YTZC 3I5GB 1CLLA 1S36A 3AAJA 4USLA 2MLEC 3O6BA 2CNPA 1K8UA 2FJUB 2LUXA 2PSRA 1XVJA 2I18A 4WRIA 2JNFA 1VRKA 3FIAA 1S6JA 1V1FA 4HRHA 1B7TY 2HQ8A 2MAZA 1N65A 1WRZA 2K0JA 4NQGA 3KO0A 1XO5A 1YX7A 1DJGA 1RJVA 2CCMA 1BODA 2M0RA 4M2OA 2MLFC 4OCIA 4P5OE 1OOJA 3PM8A 4PCWA 2JTZA 4QJ5B 2E6WA 3PFVA 2F2OA 2GV5A 2JQ6A 4CLNA 3NXAA 1XFUO 1PULA 1OMDA 1SCMC 1X02A 1ZFSA 1Q80A 1SL9A 3HX4A 2OPOA 4ETOA 3GK4X 1KSOA 2H61C 1QVIZ 1K90D 3BOWB 1EXRA 4ORAB 2O60A 5KTYA 2BE4A 4GNKB 4BY4A 4OV2A 4MN0A 3WXAA 2AMIA 2QACA 1NX2A 4XJKB 1JF0A 5I2LA 3C1VA 1Y6WA 2JWWA 2NZ0A 3CLNA 5J3XA 3O78A 1BJFA 1S3PA 3BXKA 4YBHB 3NSKA 1NCXA 2CT9A 2Y5IA 1NIWA 1IWQA 2KQYA 5CSJA 1AK8A 3DF0B 3M0WA 4WQ3A 2HQWA 2KYFA 1K9PA 2BL0C 1M46A 2WCBA 4NDCA 4YI8A 4YGDB 4F0ZB 2JT8A 1B8CA 4MVFA 1V1GA 2NCPA 3VROA 4PHKA 4N1FA 1OMRA 1PSBA 5PALA 5HLVA 1UP5A 1A75B 1FBVA 3VRPA 2I7AA 2M1UA 2Y1MA 2Y4QA 4GUKA 1SMGA 1NX0A 1SCMB 1TIZA 2CBLA 1RECA 1LA3A 3OX6A 2KNEA 2LMUA 1QX2A 1R2UA 3KHEA 2LCPA 1IG5A 1DGUA 2LHIA 2Q91A 3GK2A 1S26D 4PE0A 4U8DA 1XYDA 2JXLA 1CKKA 1E8AA 3PN7C 1K95A 1KK8C 1QX7A 2JT3A 1QLSA 1XFYO 2JNXA 2M29A 2JTTA 2WCEA 4CPVA 4E68A 2JRFA 2HETA 1MXEA 2H61A 1PVAA 1JF2A 1SW8A 1DJYA 1CM1A 3I5IC 1QJTA 1WRLA 1CFFA 1LKJA 2KGRA 4JWQA 1GGWA 5DKRA 2K8MB 1BT6A 2BL0B 2KOTA 1YURA 2KDHA 3CWGA 3JTDB 3JVTC 4M2PA 1CNPA 1IJ5A 2K2AA 4C0JA 4UPGA 1SPYA 1RFJA 4OVNF 1L2OC 5I8NA 1CFCA 1GQMA 3AAKA 2JOJA 1W7IB 1KSMA 4YGAA 2L5XB 2EGDA 1AUIB 1XFVO 1YVLA 3SG2A 3BUNB 2D8NA 4GGFA 1B9AA 1JFKA 1CFPA 1PK0D 1OMVA 3BYAA 2LP2A 1N2DA 2K2FA 2KQ6A 2BECA 3I5FC 2GGZA 3SG4A 5CSNA 1K2HA 4GFTA 3PN7B 4JQ0D 1KK8B 1RROA 1JSAA 2R2IA 1QIWA 1WY9A 2V53A 1C7VA 1DF0A 1IJ6A 2JT0A 1B47A 1SNLA 1Y0VH 1WRKA 4DUQA 1RK9A 1FF1A 1H8BA 2ZN9A 1FW4A 1F70A 2PVBA 3DVMA 1CMGA 1Y1UA 1UURA 1TNXA 1TN4A 1OZSA 1AJ4A 1QVIY 2L4HA 1OZOA 4YGBB 3EK4A 3IQQA 4P2YB 1UHJA 4A4CA 4FQOA 4CFRA 1G8IA 2JPTA 3ZWHA 4FTGA 5TNCA 3OB2B 1YX8A 2KBMA 3BUOB 2ZRTA 1MHOA 1WDCC 2F8PA 2LUCA 5IBWA 2BKIB 4ZCVA 3CS1A 1NPQA 2F3YA 2KFGA 2LMVA 3FWBA 2BBNA 1S6CA 5FYXA 2KI6D 3I5FB 4ZCUA 2KAYA 2AAOA 2K7BA 2PMYA 2ZNDA 2LVIA 4MLWA 1QX5B 5F6TA 4PHJA 1SL7A 4DS7A 4QJ4B 3LLEA 1WLZA 2F33A 1MF8B 4L9MA 4OR9B 2CXJA 1TRFA 2MJWB 3BQ3A 3LL8B 1JUOA 3PSRA 3WHUB 4AQIA 1AVSA 1FPWA 2K7CA 4CIDA 2OTGC 4IL1A 1G33A 3PLFB 1DVIA 2WC8A 2BKHB 1S1EA 3D10A 2FCEA 4CFQA 2M7NA 1J7RA 3D0YA 2SASA 3GOFA 1SR6C 2KFHA 1F8HA 1WDCB 2NCOA 1NWDA 4YGCB 3EVVA 1Y1AA 4AOMA 4D1EA 4ORCB 1ZOTB 4ICBA 1YUUA 1OSAA 4MBEA 1YUSA 1GGZA 2MA2A 3DVJA 2JZIA 1NP8A 3TDIA 2Q4UA 1ALWA 4GGFC 1KQMC 4QJ3B 1BG1A 1EH2A 1QXPA 2CTNA 3NSOA 4AQJA 1B4CA 1ZUZA 1NCZA 1HQVA 3LK0A 3PALA 3SIBA 5KU1A 2NXQA 3NSIA 2JXCA 2L4IA 2LLTA 1CB1A 2E30A 1EL4A 1SL8A 2LM5A 3EKJA 2OTGB 4I5LB 1NX3A 1YRUB 2BCBA 1QV0A 4MZLA 1BR1B 1SBJA 3KEVA 2M8UA 1UHIA 4MZJA 2QPTA 1KCYA 1S5GZ 4HSZA 1DJWA 2COLB 1KWOC 4MZKA 1SR6B 5AANA 2KHNA 3O2PA 2PASA 2LE9B 2KSPA 1DJIA 1K9UA 1SYMA 1G4YR 1M39A 1KFXL 1MR8A 2I2RE 3EVUA 3GK1A 3PATA 1F4OA 1DTLA 1QASA 2LVJA 3CZTX 4ORBB 1CFDA 2L2EA 1QS7A 1KQMB 4MSPA 3BUWB 4PE4A 5AEQA 1CDLA 3VRRA 4DCKA 1AJ5A 1PVBA 3TS5C 4JPZB 1UWOA 2LMTA 3MSEB 1Y1XA 3LK1A 5JJGA 3TZ1A 5B8IB 2LHLA 2EC6C 3OHMB 4A4BA 1PRWA 1DF0B 2B1UA 3AKBA 1QLKA 1CTRA 3OP0A 4GBAA 1IQ3A 1TNQA 2FCDA 2WORA 1J1DA 4M2QA 5D7FA 1BF5A 3TDZA 5DKNA 5HKYA 1KWOB 3CR2A 2LANA 3OB1B 2BBMA 2A4JA 2KI6C 3CTNA 1YUTA 3I5GC 1J7QA 1L7ZA 2AUCA 4I5KA 2OS8C 2ZN8A 3FWCA 1FI5A 1GJYA 1M31A 5AXIA 3SG3A 3RLZA 1DJHA 1TNPA 1AHRA 3I5IB 2F2PA 1DMOA 1EG3A 1TOPA 4XYNA 3I5HC 2SCPA 3ZNIA 5CSIA 1IGVA 1DGVA 3JVTB 2LLUA 3CGAA 2H2KA 2K7DA 4N5XA 2LVKA 1J7PA 2HF5A 1LA0A 1K94A 1J7OA 1EJ3A 1L2OB 1KK7Z 2KAXA 4TNCA 4HREE 5ER5A 4DRWA 3SG5A 1K93D 3TS5B 1QATA 1PALA 1JWDA 3OX5A 1KFUS 4DIRA 4PHMA 2EC6B 1S6IA 2PALA 4C0KA 3RM1A 1F55A 1BU3A 2F3ZA 3O4YA 5BPJA 4MRYA 1FI6A 3CR5X 1M63B 2M97A 3A4UB 4GPLB 4OKHA 4R1EA 5HKZA 2NLNA 1B1GA 1BMOA 1U5IA 2OS8B 1IRJA 4HRGA 4GGNA 1NSHA 3D0YB 3H4SE 5AFPA 1BOCA 1XA5A 2G9BA 2ZFDA 2WNDA 2LVVA 2KGBC 1MXLC 2G2BA 3CR4X 1PSRA 3BUXB 3I5HB 2LAPA 4PE1A 4NDDA 4PDZA 1S5GY 1JFJA 3SG6A 2MRDA 2ZRSA 4GAOA 5CPVA 1IKUA 1H4BA 1CDNA 1C7WA 5JOLA 1ALVA 3EK7A 2M7LA 2ISDA 5AERA 2KFFA 3KPXA 2PRUA 4C0LA 1ODBA 5I2OA 1TCOB 4YRUA 1QTXA 1J55A 1SK6D 1A29A 1XFXO 1DJXA 1UUSA 1XK4C 4I5JA 4MRXA 5HYDA 1ZACA 1MUXA 4I5NB 2LC5A 3E3RA 3A8RA 4PALA 1IQ5A 1J1EA 3EKHA 1CLBA 3VGOA 2KAVA 1XFWO 2DOQA 1SCVA 2LNKA 1CMFA 2K7OA 2BE6A 4PE7A 2BCXA 5CSFA 1BLQA 3VRNA 3BOWA 1NCYA 4N1GA 3DVEA 5HLOA 5HKWA 1A03A 1B7TZ 3QRXA 3VRQA 2JU0A 2M9GA 2WCFA 1F4QA 1TTXA 5G08A 3JTDC 4XJKA 1SKTA 3WHTB 1B8RA 1DJZA 2KI4C 1UHKA 1YVHA 2M1KB 3NSLA 1LVCD 2JULA 1R6PA 5KSZA 1F54A 3DF0A 5I2QA 3SJSA 3F45A 4MEWA 1M45A 2L98A 1WLMA 4WQ2A 1UHNA 1NUBA 1A75A 2VRGA 1MQ1A 3EVRA 2ZNEA 1KK7Y 3IQOA 2BCAA 2EHBA 1XK4A 1MWNA 3TUYC 1N0YA 2I94A 1NYAA 1NX1A 3ICBA 4Q04A 2KYCA 1KFUL 1YRTB 1LXFC 2TN4A 1EG4A 1OE9B 5ER4X 3BUMB 4BY5A 2LP3A 1KQVA 1HT9A 1XFZO 1ZMZA 2KBIA 2M3WA 1TCFA 5DKQA 3WNXB 1AP4A 3AKAA 2MBXA 3SG7A 3FS7A 2M49B 5D69A 2KI4B 1UHHA 1CDPA 1C07A 2L0PA 3HCMA 2O5GA 4YI9A 2IS9A 2HPSA 2ZKMX 3EK8A 1RTP1 1A2XA 2Y1NA 1D1OA 1B8LA 2JC2A 1K96A 1JBAA 4YGEB 1RWYA 1OQPA 3TDUA 2L50A 3K21A 2L51A 1CDMA 1W7JB 1CM4A 1F71A 3DD4A 1K9KA 3TUYB 1CLMA 3DVKA 1TNWA 2MHHA 2P6BB 1KFXS 2RGIA 4NDBA 1QV1A 1YR5A 1A4PA 4PHNA 2K61A 1JC2A 1U5IB 2WOSA 1BR4B 1SY9A 3IF7A 5GQQC 2GGMA 3KF9A 3LCPC 2FOTA 2LLSA 1IH0A 5K89A 1QIVA 1SRAA 1LINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DT7 B;  3SIA A;  2LV7 A;  1YTZ C;  3I5G B;  1CLL A;  1S36 A;  3AAJ A;  4USL A;  2MLE C;  3O6B A;  2CNP A;  1K8U A;  2FJU B;  2LUX A;  2PSR A;  1XVJ A;  2I18 A;  4WRI A;  2JNF A;  1VRK A;  3FIA A;  1S6J A;  1V1F A;  4HRH A;  1B7T Y;  2HQ8 A;  2MAZ A;  1N65 A;  1WRZ A;  2K0J A;  4NQG A;  3KO0 A;  1XO5 A;  1YX7 A;  1DJG A;  1RJV A;  2CCM A;  1BOD A;  2M0R A;  4M2O A;  2MLF C;  4OCI A;  4P5O E;  1OOJ A;  3PM8 A;  4PCW A;  2JTZ A;  4QJ5 B;  2E6W A;  3PFV A;  2F2O A;  2GV5 A;  2JQ6 A;  4CLN A;  3NXA A;  1XFU O;  1PUL A;  1OMD A;  1SCM C;  1X02 A;  1ZFS A;  1Q80 A;  1SL9 A;  3HX4 A;  2OPO A;  4ETO A;  3GK4 X;  1KSO A;  2H61 C;  1QVI Z;  1K90 D;  3BOW B;  1EXR A;  4ORA B;  2O60 A;  5KTY A;  2BE4 A;  4GNK B;  4BY4 A;  4OV2 A;  4MN0 A;  3WXA A;  2AMI A;  2QAC A;  1NX2 A;  4XJK B;  1JF0 A;  5I2L A;  3C1V A;  1Y6W A;  2JWW A;  2NZ0 A;  3CLN A;  5J3X A;  3O78 A;  1BJF A;  1S3P A;  3BXK A;  4YBH B;  3NSK A;  1NCX A;  2CT9 A;  2Y5I A;  1NIW A;  1IWQ A;  2KQY A;  5CSJ A;  1AK8 A;  3DF0 B;  3M0W A;  4WQ3 A;  2HQW A;  2KYF A;  1K9P A;  2BL0 C;  1M46 A;  2WCB A;  4NDC A;  4YI8 A;  4YGD B;  4F0Z B;  2JT8 A;  1B8C A;  4MVF A;  1V1G A;  2NCP A;  3VRO A;  4PHK A;  4N1F A;  1OMR A;  1PSB A;  5PAL A;  5HLV A;  1UP5 A;  1A75 B;  1FBV A;  3VRP A;  2I7A A;  2M1U A;  2Y1M A;  2Y4Q A;  4GUK A;  1SMG A;  1NX0 A;  1SCM B;  1TIZ A;  2CBL A;  1REC A;  1LA3 A;  3OX6 A;  2KNE A;  2LMU A;  1QX2 A;  1R2U A;  3KHE A;  2LCP A;  1IG5 A;  1DGU A;  2LHI A;  2Q91 A;  3GK2 A;  1S26 D;  4PE0 A;  4U8D A;  1XYD A;  2JXL A;  1CKK A;  1E8A A;  3PN7 C;  1K95 A;  1KK8 C;  1QX7 A;  2JT3 A;  1QLS A;  1XFY O;  2JNX A;  2M29 A;  2JTT A;  2WCE A;  4CPV A;  4E68 A;  2JRF A;  2HET A;  1MXE A;  2H61 A;  1PVA A;  1JF2 A;  1SW8 A;  1DJY A;  1CM1 A;  3I5I C;  1QJT A;  1WRL A;  1CFF A;  1LKJ A;  2KGR A;  4JWQ A;  1GGW A;  5DKR A;  2K8M B;  1BT6 A;  2BL0 B;  2KOT A;  1YUR A;  2KDH A;  3CWG A;  3JTD B;  3JVT C;  4M2P A;  1CNP A;  1IJ5 A;  2K2A A;  4C0J A;  4UPG A;  1SPY A;  1RFJ A;  4OVN F;  1L2O C;  5I8N A;  1CFC A;  1GQM A;  3AAK A;  2JOJ A;  1W7I B;  1KSM A;  4YGA A;  2L5X B;  2EGD A;  1AUI B;  1XFV O;  1YVL A;  3SG2 A;  3BUN B;  2D8N A;  4GGF A;  1B9A A;  1JFK A;  1CFP A;  1PK0 D;  1OMV A;  3BYA A;  2LP2 A;  1N2D A;  2K2F A;  2KQ6 A;  2BEC A;  3I5F C;  2GGZ A;  3SG4 A;  5CSN A;  1K2H A;  4GFT A;  3PN7 B;  4JQ0 D;  1KK8 B;  1RRO A;  1JSA A;  2R2I A;  1QIW A;  1WY9 A;  2V53 A;  1C7V A;  1DF0 A;  1IJ6 A;  2JT0 A;  1B47 A;  1SNL A;  1Y0V H;  1WRK A;  4DUQ A;  1RK9 A;  1FF1 A;  1H8B A;  2ZN9 A;  1FW4 A;  1F70 A;  2PVB A;  3DVM A;  1CMG A;  1Y1U A;  1UUR A;  1TNX A;  1TN4 A;  1OZS A;  1AJ4 A;  1QVI Y;  2L4H A;  1OZO A;  4YGB B;  3EK4 A;  3IQQ A;  4P2Y B;  1UHJ A;  4A4C A;  4FQO A;  4CFR A;  1G8I A;  2JPT A;  3ZWH A;  4FTG A;  5TNC A;  3OB2 B;  1YX8 A;  2KBM A;  3BUO B;  2ZRT A;  1MHO A;  1WDC C;  2F8P A;  2LUC A;  5IBW A;  2BKI B;  4ZCV A;  3CS1 A;  1NPQ A;  2F3Y A;  2KFG A;  2LMV A;  3FWB A;  2BBN A;  1S6C A;  5FYX A;  2KI6 D;  3I5F B;  4ZCU A;  2KAY A;  2AAO A;  2K7B A;  2PMY A;  2ZND A;  2LVI A;  4MLW A;  1QX5 B;  5F6T A;  4PHJ A;  1SL7 A;  4DS7 A;  4QJ4 B;  3LLE A;  1WLZ A;  2F33 A;  1MF8 B;  4L9M A;  4OR9 B;  2CXJ A;  1TRF A;  2MJW B;  3BQ3 A;  3LL8 B;  1JUO A;  3PSR A;  3WHU B;  4AQI A;  1AVS A;  1FPW A;  2K7C A;  4CID A;  2OTG C;  4IL1 A;  1G33 A;  3PLF B;  1DVI A;  2WC8 A;  2BKH B;  1S1E A;  3D10 A;  2FCE A;  4CFQ A;  2M7N A;  1J7R A;  3D0Y A;  2SAS A;  3GOF A;  1SR6 C;  2KFH A;  1F8H A;  1WDC B;  2NCO A;  1NWD A;  4YGC B;  3EVV A;  1Y1A A;  4AOM A;  4D1E A;  4ORC B;  1ZOT B;  4ICB A;  1YUU A;  1OSA A;  4MBE A;  1YUS A;  1GGZ A;  2MA2 A;  3DVJ A;  2JZI A;  1NP8 A;  3TDI A;  2Q4U A;  1ALW A;  4GGF C;  1KQM C;  4QJ3 B;  1BG1 A;  1EH2 A;  1QXP A;  2CTN A;  3NSO A;  4AQJ A;  1B4C A;  1ZUZ A;  1NCZ A;  1HQV A;  3LK0 A;  3PAL A;  3SIB A;  5KU1 A;  2NXQ A;  3NSI A;  2JXC A;  2L4I A;  2LLT A;  1CB1 A;  2E30 A;  1EL4 A;  1SL8 A;  2LM5 A;  3EKJ A;  2OTG B;  4I5L B;  1NX3 A;  1YRU B;  2BCB A;  1QV0 A;  4MZL A;  1BR1 B;  1SBJ A;  3KEV A;  2M8U A;  1UHI A;  4MZJ A;  2QPT A;  1KCY A;  1S5G Z;  4HSZ A;  1DJW A;  2COL B;  1KWO C;  4MZK A;  1SR6 B;  5AAN A;  2KHN A;  3O2P A;  2PAS A;  2LE9 B;  2KSP A;  1DJI A;  1K9U A;  1SYM A;  1G4Y R;  1M39 A;  1KFX L;  1MR8 A;  2I2R E;  3EVU A;  3GK1 A;  3PAT A;  1F4O A;  1DTL A;  1QAS A;  2LVJ A;  3CZT X;  4ORB B;  1CFD A;  2L2E A;  1QS7 A;  1KQM B;  4MSP A;  3BUW B;  4PE4 A;  5AEQ A;  1CDL A;  3VRR A;  4DCK A;  1AJ5 A;  1PVB A;  3TS5 C;  4JPZ B;  1UWO A;  2LMT A;  3MSE B;  1Y1X A;  3LK1 A;  5JJG A;  3TZ1 A;  5B8I B;  2LHL A;  2EC6 C;  3OHM B;  4A4B A;  1PRW A;  1DF0 B;  2B1U A;  3AKB A;  1QLK A;  1CTR A;  3OP0 A;  4GBA A;  1IQ3 A;  1TNQ A;  2FCD A;  2WOR A;  1J1D A;  4M2Q A;  5D7F A;  1BF5 A;  3TDZ A;  5DKN A;  5HKY A;  1KWO B;  3CR2 A;  2LAN A;  3OB1 B;  2BBM A;  2A4J A;  2KI6 C;  3CTN A;  1YUT A;  3I5G C;  1J7Q A;  1L7Z A;  2AUC A;  4I5K A;  2OS8 C;  2ZN8 A;  3FWC A;  1FI5 A;  1GJY A;  1M31 A;  5AXI A;  3SG3 A;  3RLZ A;  1DJH A;  1TNP A;  1AHR A;  3I5I B;  2F2P A;  1DMO A;  1EG3 A;  1TOP A;  4XYN A;  3I5H C;  2SCP A;  3ZNI A;  5CSI A;  1IGV A;  1DGV A;  3JVT B;  2LLU A;  3CGA A;  2H2K A;  2K7D A;  4N5X A;  2LVK A;  1J7P A;  2HF5 A;  1LA0 A;  1K94 A;  1J7O A;  1EJ3 A;  1L2O B;  1KK7 Z;  2KAX A;  4TNC A;  4HRE E;  5ER5 A;  4DRW A;  3SG5 A;  1K93 D;  3TS5 B;  1QAT A;  1PAL A;  1JWD A;  3OX5 A;  1KFU S;  4DIR A;  4PHM A;  2EC6 B;  1S6I A;  2PAL A;  4C0K A;  3RM1 A;  1F55 A;  1BU3 A;  2F3Z A;  3O4Y A;  5BPJ A;  4MRY A;  1FI6 A;  3CR5 X;  1M63 B;  2M97 A;  3A4U B;  4GPL B;  4OKH A;  4R1E A;  5HKZ A;  2NLN A;  1B1G A;  1BMO A;  1U5I A;  2OS8 B;  1IRJ A;  4HRG A;  4GGN A;  1NSH A;  3D0Y B;  3H4S E;  5AFP A;  1BOC A;  1XA5 A;  2G9B A;  2ZFD A;  2WND A;  2LVV A;  2KGB C;  1MXL C;  2G2B A;  3CR4 X;  1PSR A;  3BUX B;  3I5H B;  2LAP A;  4PE1 A;  4NDD A;  4PDZ A;  1S5G Y;  1JFJ A;  3SG6 A;  2MRD A;  2ZRS A;  4GAO A;  5CPV A;  1IKU A;  1H4B A;  1CDN A;  1C7W A;  5JOL A;  1ALV A;  3EK7 A;  2M7L A;  2ISD A;  5AER A;  2KFF A;  3KPX A;  2PRU A;  4C0L A;  1ODB A;  5I2O A;  1TCO B;  4YRU A;  1QTX A;  1J55 A;  1SK6 D;  1A29 A;  1XFX O;  1DJX A;  1UUS A;  1XK4 C;  4I5J A;  4MRX A;  5HYD A;  1ZAC A;  1MUX A;  4I5N B;  2LC5 A;  3E3R A;  3A8R A;  4PAL A;  1IQ5 A;  1J1E A;  3EKH A;  1CLB A;  3VGO A;  2KAV A;  1XFW O;  2DOQ A;  1SCV A;  2LNK A;  1CMF A;  2K7O A;  2BE6 A;  4PE7 A;  2BCX A;  5CSF A;  1BLQ A;  3VRN A;  3BOW A;  1NCY A;  4N1G A;  3DVE A;  5HLO A;  5HKW A;  1A03 A;  1B7T Z;  3QRX A;  3VRQ A;  2JU0 A;  2M9G A;  2WCF A;  1F4Q A;  1TTX A;  5G08 A;  3JTD C;  4XJK A;  1SKT A;  3WHT B;  1B8R A;  1DJZ A;  2KI4 C;  1UHK A;  1YVH A;  2M1K B;  3NSL A;  1LVC D;  2JUL A;  1R6P A;  5KSZ A;  1F54 A;  3DF0 A;  5I2Q A;  3SJS A;  3F45 A;  4MEW A;  1M45 A;  2L98 A;  1WLM A;  4WQ2 A;  1UHN A;  1NUB A;  1A75 A;  2VRG A;  1MQ1 A;  3EVR A;  2ZNE A;  1KK7 Y;  3IQO A;  2BCA A;  2EHB A;  1XK4 A;  1MWN A;  3TUY C;  1N0Y A;  2I94 A;  1NYA A;  1NX1 A;  3ICB A;  4Q04 A;  2KYC A;  1KFU L;  1YRT B;  1LXF C;  2TN4 A;  1EG4 A;  1OE9 B;  5ER4 X;  3BUM B;  4BY5 A;  2LP3 A;  1KQV A;  1HT9 A;  1XFZ O;  1ZMZ A;  2KBI A;  2M3W A;  1TCF A;  5DKQ A;  3WNX B;  1AP4 A;  3AKA A;  2MBX A;  3SG7 A;  3FS7 A;  2M49 B;  5D69 A;  2KI4 B;  1UHH A;  1CDP A;  1C07 A;  2L0P A;  3HCM A;  2O5G A;  4YI9 A;  2IS9 A;  2HPS A;  2ZKM X;  3EK8 A;  1RTP 1;  1A2X A;  2Y1N A;  1D1O A;  1B8L A;  2JC2 A;  1K96 A;  1JBA A;  4YGE B;  1RWY A;  1OQP A;  3TDU A;  2L50 A;  3K21 A;  2L51 A;  1CDM A;  1W7J B;  1CM4 A;  1F71 A;  3DD4 A;  1K9K A;  3TUY B;  1CLM A;  3DVK A;  1TNW A;  2MHH A;  2P6B B;  1KFX S;  2RGI A;  4NDB A;  1QV1 A;  1YR5 A;  1A4P A;  4PHN A;  2K61 A;  1JC2 A;  1U5I B;  2WOS A;  1BR4 B;  1SY9 A;  3IF7 A;  5GQQ C;  2GGM A;  3KF9 A;  3LCP C;  2FOT A;  2LLS A;  1IH0 A;  5K89 A;  1QIV A;  1SRA A;  1LIN A; 
#chains in the Genus database with same CATH topology
 1DT7 B;  3SIA A;  2LV7 A;  1YTZ C;  3I5G B;  1TWO A;  1CLL A;  1S36 A;  3AAJ A;  3BJH A;  2MLE C;  4USL A;  3O6B A;  2CNP A;  1K8U A;  2FJU B;  2LUX A;  2PSR A;  1XVJ A;  2I18 A;  4INX A;  2JNF A;  1VRK A;  3FIA A;  4WRI A;  2PQL A;  1S6J A;  1V1F A;  4HRH A;  1B7T Y;  2HQ8 A;  2MAZ A;  1N65 A;  1WRZ A;  2K0J A;  4NQG A;  3KO0 A;  1XO5 A;  1YX7 A;  1DJG A;  1RJV A;  2CCM A;  1BOD A;  2M0R A;  4M2O A;  3K1E A;  2MLF C;  4OCI A;  4P5O E;  1OOJ A;  3PM8 A;  5FI2 A;  4PCW A;  2JTZ A;  4QJ5 B;  5I94 A;  2E6W A;  3PFV A;  2F2O A;  2GV5 A;  2JQ6 A;  4CLN A;  4JKT A;  3NXA A;  1XFU O;  1PUL A;  1OMD A;  1SCM C;  3SS5 A;  1X02 A;  1ZFS A;  1Q80 A;  1SL9 A;  3HX4 A;  2OPO A;  4ETO A;  3GK4 X;  2YGU A;  3B86 A;  1KSO A;  2H61 C;  1QVI Z;  1K90 D;  3BOW B;  1EXR A;  4ORA B;  2O60 A;  5KTY A;  2BE4 A;  4GNK B;  2P71 A;  4OV2 A;  4BY4 A;  4MN0 A;  3WXA A;  2AMI A;  2QAC A;  1NX2 A;  4XJK B;  1JF0 A;  5I2L A;  3C1V A;  1Y6W A;  2JWW A;  2NZ0 A;  3CLN A;  5J3X A;  3O78 A;  1BJF A;  1S3P A;  2QEO A;  3BXK A;  4YBH B;  3SS4 A;  3NSK A;  1NCX A;  2CT9 A;  2Y5I A;  1NIW A;  1IWQ A;  2KQY A;  2K60 A;  5CSJ A;  1AK8 A;  3DF0 B;  3M0W A;  4WQ3 A;  2HQW A;  2KYF A;  1K9P A;  2BL0 C;  1M46 A;  2WCB A;  4NDC A;  4YI8 A;  4YGD B;  4F0Z B;  2JT8 A;  1B8C A;  4MVF A;  1V1G A;  2NCP A;  2WCJ A;  3VRO A;  4PHK A;  4N1F A;  1OMR A;  1PSB A;  5PAL A;  5HLV A;  1UP5 A;  1A75 B;  1FBV A;  3VRP A;  2I7A A;  2M1U A;  2Y1M A;  2Y4Q A;  4GUK A;  1SMG A;  1NX0 A;  1SCM B;  1TIZ A;  2CBL A;  1REC A;  1LA3 A;  3OX6 A;  2KNE A;  2LMU A;  3PM2 A;  1QX2 A;  1R2U A;  3KHE A;  1TUJ A;  2LCP A;  1IG5 A;  1DGU A;  2WC5 A;  2LHI A;  2Q91 A;  3GK2 A;  1S26 D;  4PE0 A;  4U8D A;  1GM0 A;  1C3Z A;  1ORG A;  1XYD A;  1E8A A;  2JXL A;  1K95 A;  1KK8 C;  3FE8 A;  3PN7 C;  1CKK A;  1QX7 A;  2JT3 A;  5FI6 A;  3S0D A;  1QLS A;  1XFY O;  2JNX A;  2M29 A;  2JTT A;  2WCE A;  4CPV A;  2P70 A;  2JRF A;  4E68 A;  2HET A;  1MXE A;  2H61 A;  1PVA A;  1JF2 A;  3B7A A;  1SW8 A;  1DJY A;  1CM1 A;  3I5I C;  1QJT A;  1WRL A;  1CFF A;  1LKJ A;  2KGR A;  4JWQ A;  1GGW A;  5DKR A;  2K8M B;  1BT6 A;  2BL0 B;  2KOT A;  1YUR A;  2KDH A;  3B6X A;  3CWG A;  3JTD B;  3JVT C;  4M2P A;  1IJ5 A;  2K2A A;  4C0J A;  4UPG A;  5D3O A;  1SPY A;  1RFJ A;  4OVN F;  1L2O C;  5I8N A;  1CFC A;  1GQM A;  3AAK A;  3R72 A;  2JOJ A;  1W7I B;  1KSM A;  4YGA A;  2L5X B;  2EGD A;  1AUI B;  4FQT A;  1XFV O;  1YVL A;  1OOG A;  3SG2 A;  3BUN B;  2D8N A;  4GGF A;  1B9A A;  1JFK A;  1CFP A;  5HL1 A;  1PK0 D;  1OMV A;  3B88 A;  2LP2 A;  3BYA A;  1N2D A;  4OZD A;  2K2F A;  2KQ6 A;  2BEC A;  3I5F C;  2GGZ A;  3SG4 A;  5CSN A;  1K2H A;  4GFT A;  3PN7 B;  4JQ0 D;  1KK8 B;  3O4X A;  1RRO A;  1JSA A;  2R2I A;  1QIW A;  1DEK A;  1WY9 A;  3PJI A;  3Q8I A;  2V53 A;  1DEL A;  1C7V A;  1DF0 A;  1IJ6 A;  2JT0 A;  1B47 A;  1SNL A;  1Y0V H;  1WRK A;  4DUQ A;  1RK9 A;  2QEH A;  1FF1 A;  1H8B A;  2ZN9 A;  1FW4 A;  1F70 A;  2PVB A;  3DVM A;  1CMG A;  1Y1U A;  1UUR A;  3NGV A;  1TNX A;  1TN4 A;  1OZS A;  1AJ4 A;  1QVI Y;  2L4H A;  1OZO A;  4YGB B;  3EK4 A;  3IQQ A;  4P2Y B;  1UHJ A;  4A4C A;  4FQO A;  3VB1 A;  4CFR A;  3RZS A;  1G8I A;  2JPT A;  3ZWH A;  4FTG A;  5TNC A;  3OB2 B;  3DXL A;  1YX8 A;  2KBM A;  3BUO B;  2ZRT A;  1MHO A;  1WDC C;  3IVT A;  2F8P A;  2LUC A;  5IBW A;  2BKI B;  4ZCV A;  3CS1 A;  2JPO A;  3S0A A;  3R1P A;  1NPQ A;  2F3Y A;  2KFG A;  2LMV A;  3FWB A;  2BBN A;  1S6C A;  5FYX A;  2KI6 D;  3I5F B;  4ZCU A;  2KAY A;  2AAO A;  2K7B A;  2PMY A;  2ZND A;  2LVI A;  4MLW A;  1QX5 B;  5F6T A;  4PHJ A;  1SL7 A;  4DS7 A;  4QJ4 B;  3LLE A;  1WLZ A;  2F33 A;  1MF8 B;  4L9M A;  4OR9 B;  2CXJ A;  1TRF A;  2MJW B;  3BQ3 A;  3LL8 B;  1JUO A;  2KLE A;  3PSR A;  3WHU B;  4AQI A;  2H8V A;  3S0E A;  1AVS A;  2ERB A;  1FPW A;  2K7C A;  1Z4H A;  2OTG C;  4CID A;  4IL1 A;  1G33 A;  3PLF B;  1DVI A;  2WC8 A;  2BKH B;  2KLD A;  1S1E A;  3D10 A;  2FCE A;  4CFQ A;  3SS3 A;  2M7N A;  1J7R A;  3D0Y A;  2SAS A;  3GOF A;  4KYN A;  2QEV A;  1OOH A;  1SR6 C;  2KFH A;  1F8H A;  1WDC B;  2NCO A;  1NWD A;  4YGC B;  3EVV A;  1Y1A A;  4AOM A;  4D1E A;  4ORC B;  1ZOT B;  4ICB A;  1YUU A;  1OSA A;  4MBE A;  3D73 A;  1YUS A;  1GGZ A;  2MA2 A;  3DVJ A;  2JZI A;  1NP8 A;  3TDI A;  2Q4U A;  1ALW A;  3D75 A;  1KQM C;  4GGF C;  4QJ3 B;  1BG1 A;  1EH2 A;  1QXP A;  2CTN A;  1OOF A;  3NSO A;  4AQJ A;  1QWV A;  1B4C A;  1ZUZ A;  1NCZ A;  1HQV A;  3V2L A;  3LK0 A;  3PAL A;  3SIB A;  3L4L A;  5KU1 A;  2NXQ A;  3NSI A;  2JXC A;  2L4I A;  2LLT A;  1CB1 A;  2E30 A;  1EL4 A;  1SL8 A;  2LM5 A;  3EKJ A;  2OTG B;  4I5L B;  1NX3 A;  1YRU B;  2BCB A;  1QV0 A;  4MZL A;  1BR1 B;  1SBJ A;  3KEV A;  2WCK A;  2M8U A;  1UHI A;  4MZJ A;  4INW A;  2QPT A;  2L5Y A;  3BFB A;  1KCY A;  1S5G Z;  4HSZ A;  1DJW A;  2COL B;  1KWO C;  4MZK A;  1SR6 B;  5AAN A;  2KHN A;  3O2P A;  2PAS A;  2LE9 B;  2KSP A;  3EG5 B;  1DJI A;  1K9U A;  1SYM A;  1G4Y R;  1M39 A;  1KFX L;  1MR8 A;  1XFR A;  2I2R E;  3EVU A;  3GK1 A;  3PAT A;  1F4O A;  3DZT A;  1DTL A;  1QAS A;  2LVJ A;  2WCL A;  3CZT X;  3NHT A;  3D78 A;  4ORB B;  1CFD A;  2L2E A;  1QS7 A;  1KQM B;  4MSP A;  1OOI X;  3BUW B;  4PE4 A;  5AEQ A;  1CDL A;  3VRR A;  4DCK A;  1AJ5 A;  1PVB A;  3R1O A;  4JPZ B;  3TS5 C;  1UWO A;  2LMT A;  3MSE B;  1Y1X A;  3CAB A;  3LK1 A;  5JJG A;  3TZ1 A;  5B8I B;  2LHL A;  3L47 A;  2EC6 C;  3OHM B;  4A4B A;  1PRW A;  3CDN A;  1DF0 B;  2B1U A;  4JD9 A;  3BFA A;  3AKB A;  1QLK A;  1CTR A;  3OP0 A;  4GBA A;  1IQ3 A;  1TNQ A;  2FCD A;  2WOR A;  1J1D A;  4M2Q A;  5D7F A;  1BF5 A;  3TDZ A;  5DKN A;  5HKY A;  1KWO B;  3CR2 A;  2LAN A;  3OB1 B;  2BBM A;  1DC1 A;  2A4J A;  2KI6 C;  3CTN A;  1YUT A;  3I5G C;  1J7Q A;  1L7Z A;  2AUC A;  4I5K A;  2OS8 C;  2ZN8 A;  3FWC A;  1FI5 A;  1GJY A;  1M31 A;  5AXI A;  3SG3 A;  3D77 A;  3RLZ A;  2BNX A;  1DJH A;  1TNP A;  1AHR A;  3I5I B;  2F2P A;  1CNP A;  1DMO A;  1EG3 A;  1TOP A;  4XYN A;  3I5H C;  2SCP A;  3D74 A;  3ZNI A;  5CSI A;  1IGV A;  1DGV A;  3JVT B;  2LLU A;  3CGA A;  2H2K A;  2K7D A;  4N5X A;  2LVK A;  1J7P A;  2HF5 A;  1LA0 A;  1K94 A;  1LS8 A;  2QDI A;  1EJ3 A;  1L2O B;  1J7O A;  1KK7 Z;  2KAX A;  4TNC A;  4HRE E;  5ER5 A;  4DRW A;  3SG5 A;  1K93 D;  3TS5 B;  1QAT A;  1PAL A;  1JWD A;  3OX5 A;  1KFU S;  4DIR A;  4PHM A;  2EC6 B;  1S6I A;  2PAL A;  4C0K A;  1SSE B;  3RM1 A;  1BU3 A;  1F55 A;  2F3Z A;  3O4Y A;  5BPJ A;  4MRY A;  1FI6 A;  3CR5 X;  3L4A A;  3S0B A;  1M63 B;  2M97 A;  3A4U B;  4GPL B;  3CZ0 A;  4OKH A;  1DQE A;  4R1E A;  5HKZ A;  2NLN A;  1B1G A;  1BMO A;  1U5I A;  2OS8 B;  1IRJ A;  4HRG A;  4GGN A;  1NSH A;  3D0Y B;  3H4S E;  5AFP A;  1BOC A;  1XA5 A;  1P28 A;  2G9B A;  2ZFD A;  2WND A;  2LVV A;  2KGB C;  1MXL C;  2G2B A;  3CR4 X;  1PSR A;  3BUX B;  3D76 A;  2LAP A;  3I5H B;  4PE1 A;  2PYQ A;  4NDD A;  4PDZ A;  1S5G Y;  3FE9 A;  3UNW A;  1JFJ A;  3SG6 A;  2MRD A;  2ZRS A;  4GAO A;  5CPV A;  1IKU A;  1H4B A;  1CDN A;  1C7W A;  5JOL A;  1ALV A;  3EK7 A;  2M7L A;  2ISD A;  5AER A;  2KFF A;  3KPX A;  2PRU A;  4C0L A;  1ODB A;  5I2O A;  1TCO B;  4YRU A;  2QEB A;  1QTX A;  1J55 A;  1SK6 D;  3BFH A;  1A29 A;  1XFX O;  3CZ2 A;  1DJX A;  1UUS A;  1XK4 C;  4I5J A;  4MRX A;  3FE6 A;  1ZAC A;  5HYD A;  1MUX A;  4I5N B;  2LC5 A;  3E3R A;  2FJY A;  3A8R A;  4PAL A;  3S0F A;  1IQ5 A;  1J1E A;  3EKH A;  1CLB A;  3VGO A;  2KAV A;  1XFW O;  2DOQ A;  1SCV A;  2LNK A;  1CMF A;  1TUZ A;  2K7O A;  2BE6 A;  4PE7 A;  2BCX A;  5CSF A;  1BLQ A;  3VRN A;  5FI7 A;  3OBV A;  2L2C A;  1NCY A;  3BOW A;  4N1G A;  3DVE A;  5HLO A;  5HKW A;  1A03 A;  1B7T Z;  3QRX A;  3VRQ A;  2JU0 A;  2M9G A;  2WCF A;  5EL2 A;  1F4Q A;  1TTX A;  5G08 A;  3JTD C;  3S0G A;  3CZ1 A;  4XJK A;  1SKT A;  3NHI A;  3B87 A;  3WHT B;  1B8R A;  1DJZ A;  2KI4 C;  1UHK A;  1YVH A;  2M1K B;  3OGN A;  3NSL A;  1LVC D;  2JUL A;  1R6P A;  5KSZ A;  1F54 A;  3DF0 A;  5I2Q A;  3SJS A;  2BAP A;  3F45 A;  4MEW A;  1M45 A;  2L98 A;  1WLM A;  4WQ2 A;  1UHN A;  1OW4 A;  4PT1 A;  1NUB A;  1A75 A;  2VRG A;  1MQ1 A;  3EVR A;  2ZNE A;  4IJ7 A;  1KK7 Y;  3IQO A;  2BCA A;  3UO9 A;  2EHB A;  1XK4 A;  1Z2C B;  1MWN A;  3TUY C;  3DYE A;  1N0Y A;  2I94 A;  1NYA A;  1NX1 A;  1T14 A;  3ICB A;  3R1V A;  4Q04 A;  2KYC A;  1KFU L;  1YRT B;  2WCM A;  3CYZ A;  1LXF C;  2TN4 A;  1EG4 A;  1OE9 B;  5ER4 X;  3BUM B;  4BY5 A;  2LP3 A;  1KQV A;  1HT9 A;  1XFZ O;  1ZMZ A;  2KBI A;  2M3W A;  1TCF A;  5DKQ A;  3WNX B;  3DY9 A;  1AP4 A;  3AKA A;  2MBX A;  3SG7 A;  1IIO A;  3FS7 A;  2M49 B;  5D69 A;  2WC6 A;  2KI4 B;  1UHH A;  1CDP A;  1C07 A;  2L0P A;  1W9Z A;  3HCM A;  2O5G A;  4YI9 A;  2IS9 A;  2HPS A;  2ZKM X;  3EK8 A;  1RTP 1;  2KPH A;  1A2X A;  2Y1N A;  3QME A;  1B8L A;  1D1O A;  2GTE A;  2JC2 A;  5DIC A;  1K96 A;  1JBA A;  4YGE B;  1RWY A;  1OQP A;  3TDU A;  2L50 A;  3K21 A;  2L51 A;  1CDM A;  1W7J B;  1C3Y A;  1CM4 A;  1F71 A;  3DD4 A;  1K9K A;  3TUY B;  1CLM A;  3DVK A;  1TNW A;  2MHH A;  2P6B B;  1KFX S;  2RGI A;  4NDB A;  1QV1 A;  1YR5 A;  4F7F A;  1A4P A;  4PHN A;  2K61 A;  1JC2 A;  1U5I B;  3N7H A;  2WOS A;  1BR4 B;  1SY9 A;  3IF7 A;  5GQQ C;  2GGM A;  3KF9 A;  3LCP C;  2FOT A;  2LLS A;  1IH0 A;  5K89 A;  1QIV A;  1SRA A;  1LIN A;  2WCH A; 
#chains in the Genus database with same CATH homology
 1DT7 B;  3SIA A;  2LV7 A;  1YTZ C;  3I5G B;  1CLL A;  1S36 A;  3AAJ A;  4USL A;  2MLE C;  3O6B A;  2CNP A;  1K8U A;  2FJU B;  2LUX A;  2PSR A;  1XVJ A;  2I18 A;  4WRI A;  2JNF A;  1VRK A;  3FIA A;  1S6J A;  1V1F A;  4HRH A;  1B7T Y;  2HQ8 A;  2MAZ A;  1N65 A;  1WRZ A;  2K0J A;  4NQG A;  3KO0 A;  1XO5 A;  1YX7 A;  1DJG A;  1RJV A;  2CCM A;  1BOD A;  2M0R A;  4M2O A;  2MLF C;  4OCI A;  4P5O E;  1OOJ A;  3PM8 A;  4PCW A;  2JTZ A;  4QJ5 B;  2E6W A;  3PFV A;  2F2O A;  2GV5 A;  2JQ6 A;  4CLN A;  3NXA A;  1XFU O;  1PUL A;  1OMD A;  1SCM C;  1X02 A;  1ZFS A;  1Q80 A;  1SL9 A;  3HX4 A;  2OPO A;  4ETO A;  3GK4 X;  1KSO A;  2H61 C;  1QVI Z;  1K90 D;  3BOW B;  1EXR A;  4ORA B;  2O60 A;  5KTY A;  2BE4 A;  4GNK B;  4BY4 A;  4OV2 A;  4MN0 A;  3WXA A;  2AMI A;  2QAC A;  1NX2 A;  4XJK B;  1JF0 A;  5I2L A;  3C1V A;  1Y6W A;  2JWW A;  2NZ0 A;  3CLN A;  5J3X A;  3O78 A;  1BJF A;  1S3P A;  3BXK A;  4YBH B;  3NSK A;  1NCX A;  2CT9 A;  2Y5I A;  1NIW A;  1IWQ A;  2KQY A;  5CSJ A;  1AK8 A;  3DF0 B;  3M0W A;  4WQ3 A;  2HQW A;  2KYF A;  1K9P A;  2BL0 C;  1M46 A;  2WCB A;  4NDC A;  4YI8 A;  4YGD B;  4F0Z B;  2JT8 A;  1B8C A;  4MVF A;  1V1G A;  2NCP A;  3VRO A;  4PHK A;  4N1F A;  1OMR A;  1PSB A;  5PAL A;  5HLV A;  1UP5 A;  1A75 B;  1FBV A;  3VRP A;  2I7A A;  2M1U A;  2Y1M A;  2Y4Q A;  4GUK A;  1SMG A;  1NX0 A;  1SCM B;  1TIZ A;  2CBL A;  1REC A;  1LA3 A;  3OX6 A;  2KNE A;  2LMU A;  1QX2 A;  1R2U A;  3KHE A;  2LCP A;  1IG5 A;  1DGU A;  2LHI A;  2Q91 A;  3GK2 A;  1S26 D;  4PE0 A;  4U8D A;  1XYD A;  2JXL A;  1CKK A;  1E8A A;  3PN7 C;  1K95 A;  1KK8 C;  1QX7 A;  2JT3 A;  1QLS A;  1XFY O;  2JNX A;  2M29 A;  2JTT A;  2WCE A;  4CPV A;  4E68 A;  2JRF A;  2HET A;  1MXE A;  2H61 A;  1PVA A;  1JF2 A;  1SW8 A;  1DJY A;  1CM1 A;  3I5I C;  1QJT A;  1WRL A;  1CFF A;  1LKJ A;  2KGR A;  4JWQ A;  1GGW A;  5DKR A;  2K8M B;  1BT6 A;  2BL0 B;  2KOT A;  1YUR A;  2KDH A;  3CWG A;  3JTD B;  3JVT C;  4M2P A;  1CNP A;  1IJ5 A;  2K2A A;  4C0J A;  4UPG A;  1SPY A;  1RFJ A;  4OVN F;  1L2O C;  5I8N A;  1CFC A;  1GQM A;  3AAK A;  2JOJ A;  1W7I B;  1KSM A;  4YGA A;  2L5X B;  2EGD A;  1AUI B;  1XFV O;  1YVL A;  3SG2 A;  3BUN B;  2D8N A;  4GGF A;  1B9A A;  1JFK A;  1CFP A;  1PK0 D;  1OMV A;  3BYA A;  2LP2 A;  1N2D A;  2K2F A;  2KQ6 A;  2BEC A;  3I5F C;  2GGZ A;  3SG4 A;  5CSN A;  1K2H A;  4GFT A;  3PN7 B;  4JQ0 D;  1KK8 B;  1RRO A;  1JSA A;  2R2I A;  1QIW A;  1WY9 A;  2V53 A;  1C7V A;  1DF0 A;  1IJ6 A;  2JT0 A;  1B47 A;  1SNL A;  1Y0V H;  1WRK A;  4DUQ A;  1RK9 A;  1FF1 A;  1H8B A;  2ZN9 A;  1FW4 A;  1F70 A;  2PVB A;  3DVM A;  1CMG A;  1Y1U A;  1UUR A;  1TNX A;  1TN4 A;  1OZS A;  1AJ4 A;  1QVI Y;  2L4H A;  1OZO A;  4YGB B;  3EK4 A;  3IQQ A;  4P2Y B;  1UHJ A;  4A4C A;  4FQO A;  4CFR A;  1G8I A;  2JPT A;  3ZWH A;  4FTG A;  5TNC A;  3OB2 B;  1YX8 A;  2KBM A;  3BUO B;  2ZRT A;  1MHO A;  1WDC C;  2F8P A;  2LUC A;  5IBW A;  2BKI B;  4ZCV A;  3CS1 A;  1NPQ A;  2F3Y A;  2KFG A;  2LMV A;  3FWB A;  2BBN A;  1S6C A;  5FYX A;  2KI6 D;  3I5F B;  4ZCU A;  2KAY A;  2AAO A;  2K7B A;  2PMY A;  2ZND A;  2LVI A;  4MLW A;  1QX5 B;  5F6T A;  4PHJ A;  1SL7 A;  4DS7 A;  4QJ4 B;  3LLE A;  1WLZ A;  2F33 A;  1MF8 B;  4L9M A;  4OR9 B;  2CXJ A;  1TRF A;  2MJW B;  3BQ3 A;  3LL8 B;  1JUO A;  3PSR A;  3WHU B;  4AQI A;  1AVS A;  1FPW A;  2K7C A;  4CID A;  2OTG C;  4IL1 A;  1G33 A;  3PLF B;  1DVI A;  2WC8 A;  2BKH B;  1S1E A;  3D10 A;  2FCE A;  4CFQ A;  2M7N A;  1J7R A;  3D0Y A;  2SAS A;  3GOF A;  1SR6 C;  2KFH A;  1F8H A;  1WDC B;  2NCO A;  1NWD A;  4YGC B;  3EVV A;  1Y1A A;  4AOM A;  4D1E A;  4ORC B;  1ZOT B;  4ICB A;  1YUU A;  1OSA A;  4MBE A;  1YUS A;  1GGZ A;  2MA2 A;  3DVJ A;  2JZI A;  1NP8 A;  3TDI A;  2Q4U A;  1ALW A;  4GGF C;  1KQM C;  4QJ3 B;  1BG1 A;  1EH2 A;  1QXP A;  2CTN A;  3NSO A;  4AQJ A;  1B4C A;  1ZUZ A;  1NCZ A;  1HQV A;  3LK0 A;  3PAL A;  3SIB A;  5KU1 A;  2NXQ A;  3NSI A;  2JXC A;  2L4I A;  2LLT A;  1CB1 A;  2E30 A;  1EL4 A;  1SL8 A;  2LM5 A;  3EKJ A;  2OTG B;  4I5L B;  1NX3 A;  1YRU B;  2BCB A;  1QV0 A;  4MZL A;  1BR1 B;  1SBJ A;  3KEV A;  2M8U A;  1UHI A;  4MZJ A;  2QPT A;  1KCY A;  1S5G Z;  4HSZ A;  1DJW A;  2COL B;  1KWO C;  4MZK A;  1SR6 B;  5AAN A;  2KHN A;  3O2P A;  2PAS A;  2LE9 B;  2KSP A;  1DJI A;  1K9U A;  1SYM A;  1G4Y R;  1M39 A;  1KFX L;  1MR8 A;  2I2R E;  3EVU A;  3GK1 A;  3PAT A;  1F4O A;  1DTL A;  1QAS A;  2LVJ A;  3CZT X;  4ORB B;  1CFD A;  2L2E A;  1QS7 A;  1KQM B;  4MSP A;  3BUW B;  4PE4 A;  5AEQ A;  1CDL A;  3VRR A;  4DCK A;  1AJ5 A;  1PVB A;  3TS5 C;  4JPZ B;  1UWO A;  2LMT A;  3MSE B;  1Y1X A;  3LK1 A;  5JJG A;  3TZ1 A;  5B8I B;  2LHL A;  2EC6 C;  3OHM B;  4A4B A;  1PRW A;  1DF0 B;  2B1U A;  3AKB A;  1QLK A;  1CTR A;  3OP0 A;  4GBA A;  1IQ3 A;  1TNQ A;  2FCD A;  2WOR A;  1J1D A;  4M2Q A;  5D7F A;  1BF5 A;  3TDZ A;  5DKN A;  5HKY A;  1KWO B;  3CR2 A;  2LAN A;  3OB1 B;  2BBM A;  2A4J A;  2KI6 C;  3CTN A;  1YUT A;  3I5G C;  1J7Q A;  1L7Z A;  2AUC A;  4I5K A;  2OS8 C;  2ZN8 A;  3FWC A;  1FI5 A;  1GJY A;  1M31 A;  5AXI A;  3SG3 A;  3RLZ A;  1DJH A;  1TNP A;  1AHR A;  3I5I B;  2F2P A;  1DMO A;  1EG3 A;  1TOP A;  4XYN A;  3I5H C;  2SCP A;  3ZNI A;  5CSI A;  1IGV A;  1DGV A;  3JVT B;  2LLU A;  3CGA A;  2H2K A;  2K7D A;  4N5X A;  2LVK A;  1J7P A;  2HF5 A;  1LA0 A;  1K94 A;  1J7O A;  1EJ3 A;  1L2O B;  1KK7 Z;  2KAX A;  4TNC A;  4HRE E;  5ER5 A;  4DRW A;  3SG5 A;  1K93 D;  3TS5 B;  1QAT A;  1PAL A;  1JWD A;  3OX5 A;  1KFU S;  4DIR A;  4PHM A;  2EC6 B;  1S6I A;  2PAL A;  4C0K A;  3RM1 A;  1F55 A;  1BU3 A;  2F3Z A;  3O4Y A;  5BPJ A;  4MRY A;  1FI6 A;  3CR5 X;  1M63 B;  2M97 A;  3A4U B;  4GPL B;  4OKH A;  4R1E A;  5HKZ A;  2NLN A;  1B1G A;  1BMO A;  1U5I A;  2OS8 B;  1IRJ A;  4HRG A;  4GGN A;  1NSH A;  3D0Y B;  3H4S E;  5AFP A;  1BOC A;  1XA5 A;  2G9B A;  2ZFD A;  2WND A;  2LVV A;  2KGB C;  1MXL C;  2G2B A;  3CR4 X;  1PSR A;  3BUX B;  3I5H B;  2LAP A;  4PE1 A;  4NDD A;  4PDZ A;  1S5G Y;  1JFJ A;  3SG6 A;  2MRD A;  2ZRS A;  4GAO A;  5CPV A;  1IKU A;  1H4B A;  1CDN A;  1C7W A;  5JOL A;  1ALV A;  3EK7 A;  2M7L A;  2ISD A;  5AER A;  2KFF A;  3KPX A;  2PRU A;  4C0L A;  1ODB A;  5I2O A;  1TCO B;  4YRU A;  1QTX A;  1J55 A;  1SK6 D;  1A29 A;  1XFX O;  1DJX A;  1UUS A;  1XK4 C;  4I5J A;  4MRX A;  5HYD A;  1ZAC A;  1MUX A;  4I5N B;  2LC5 A;  3E3R A;  3A8R A;  4PAL A;  1IQ5 A;  1J1E A;  3EKH A;  1CLB A;  3VGO A;  2KAV A;  1XFW O;  2DOQ A;  1SCV A;  2LNK A;  1CMF A;  2K7O A;  2BE6 A;  4PE7 A;  2BCX A;  5CSF A;  1BLQ A;  3VRN A;  3BOW A;  1NCY A;  4N1G A;  3DVE A;  5HLO A;  5HKW A;  1A03 A;  1B7T Z;  3QRX A;  3VRQ A;  2JU0 A;  2M9G A;  2WCF A;  1F4Q A;  1TTX A;  5G08 A;  3JTD C;  4XJK A;  1SKT A;  3WHT B;  1B8R A;  1DJZ A;  2KI4 C;  1UHK A;  1YVH A;  2M1K B;  3NSL A;  1LVC D;  2JUL A;  1R6P A;  5KSZ A;  1F54 A;  3DF0 A;  5I2Q A;  3SJS A;  3F45 A;  4MEW A;  1M45 A;  2L98 A;  1WLM A;  4WQ2 A;  1UHN A;  1NUB A;  1A75 A;  2VRG A;  1MQ1 A;  3EVR A;  2ZNE A;  1KK7 Y;  3IQO A;  2BCA A;  2EHB A;  1XK4 A;  1MWN A;  3TUY C;  1N0Y A;  2I94 A;  1NYA A;  1NX1 A;  3ICB A;  4Q04 A;  2KYC A;  1KFU L;  1YRT B;  1LXF C;  2TN4 A;  1EG4 A;  1OE9 B;  5ER4 X;  3BUM B;  4BY5 A;  2LP3 A;  1KQV A;  1HT9 A;  1XFZ O;  1ZMZ A;  2KBI A;  2M3W A;  1TCF A;  5DKQ A;  3WNX B;  1AP4 A;  3AKA A;  2MBX A;  3SG7 A;  3FS7 A;  2M49 B;  5D69 A;  2KI4 B;  1UHH A;  1CDP A;  1C07 A;  2L0P A;  3HCM A;  2O5G A;  4YI9 A;  2IS9 A;  2HPS A;  2ZKM X;  3EK8 A;  1RTP 1;  1A2X A;  2Y1N A;  1D1O A;  1B8L A;  2JC2 A;  1K96 A;  1JBA A;  4YGE B;  1RWY A;  1OQP A;  3TDU A;  2L50 A;  3K21 A;  2L51 A;  1CDM A;  1W7J B;  1CM4 A;  1F71 A;  3DD4 A;  1K9K A;  3TUY B;  1CLM A;  3DVK A;  1TNW A;  2MHH A;  2P6B B;  1KFX S;  2RGI A;  4NDB A;  1QV1 A;  1YR5 A;  1A4P A;  4PHN A;  2K61 A;  1JC2 A;  1U5I B;  2WOS A;  1BR4 B;  1SY9 A;  3IF7 A;  5GQQ C;  2GGM A;  3KF9 A;  3LCP C;  2FOT A;  2LLS A;  1IH0 A;  5K89 A;  1QIV A;  1SRA A;  1LIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...