1SL9A

Obelin from obelia longissima
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
191
structure length
186
Chain Sequence
YAVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNAGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obelin
publication title Obelin from Obelia longissima
rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 74
structure length 186
sequence length 191
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sl9A00
3RLZA 4GNKB 1HT9A 1K90D 3K21A 1SR6B 1F55A 2LLSA 5CSNA 2KBIA 1MUXA 1QIVA 4E68A 2ZNEA 3DF0A 5DKNA 3ICBA 4YRUA 5JOLA 2KAVA 3EVRA 2I18A 2R2IA 3O2PA 1JWDA 1UHNA 4A4CA 2MRDA 3LK0A 1H8BA 2F8PA 4HREE 2LCPA 5FYXA 5B8IB 4YI9A 1OMRA 4I5LB 1UP5A 1DT7B 2M8UA 4OVNF 1QLKA 4MEWA 1KFXL 3WXAA 1YX8A 3IQQA 2OTGB 1R2UA 1RJVA 1XFXO 4DIRA 2K7CA 1SY9A 3WHTB 1DJYA 3EKJA 1DJWA 2KFFA 3BQ3A 1JFKA 1QASA 4C0LA 2FCDA 1BF5A 2JC2A 4YGDB 1N65A 4L9MA 3VROA 1PK0D 1KK8C 2OPOA 3O6BA 2WORA 4YGCB 1V1FA 1JC2A 5D7FA 3TDUA 4MVFA 1YVLA 1B8RA 4MRXA 1SBJA 2Y1NA 1JF2A 1KWOB 1QX2A 4CLNA 2LP3A 1A03A 1DJIA 2L4HA 1FPWA 2GGZA 1NX3A 1BG1A 2BL0C 1A4PA 1NX0A 2BCXA 4PHJA 2KYFA 1NPQA 1SW8A 4MRYA 1S1EA 3BXKA 1SL9A 2F3YA 4NQGA 1MXEA 1ODBA 2JXCA 1DGUA 1YUSA 2I7AA 1F71A 1KK7Z 1LKJA 3SG6A 1Y1AA 5HLOA 2ZN9A 4GUKA 1R6PA 3D10A 1WDCB 1DJHA 4M2OA 1F54A 2ZKMX 1HQVA 2WCFA 1IWQA 1PSBA 1MF8B 1QXPA 2F2PA 3C1VA 2LLTA 1NSHA 4JQ0D 2LANA 5HKYA 3GK1A 1C7WA 1XO5A 2O5GA 2PASA 1ALVA 2LVJA 1MR8A 4YBHB 1IJ5A 2CNPA 1RWYA 2QPTA 3CGAA 3M0WA 3PFVA 2BBMA 4XYNA 3SIAA 4YGBB 1B4CA 4OV2A 2HF5A 1QX7A 1K8UA 3KPXA 1J7RA 1S5GY 2L5XB 3PM8A 4HSZA 4NDDA 4M2PA 3VRNA 4U8DA 2LNKA 1LVCD 5HKZA 4PHNA 1YRTB 2SCPA 1G4YR 3DVJA 1XFWO 2JOJA 1OZSA 2M7NA 4PE7A 3JVTC 1OQPA 1B9AA 2EC6B 4CFRA 1W7JB 2CBLA 1MXLC 1ALWA 3FIAA 4M2QA 4DCKA 2L0PA 3TS5B 4MZKA 4PCWA 2M0RA 1M46A 2JPTA 4OKHA 4WQ2A 5KTYA 1Y6WA 1SL7A 3NSOA 2V53A 1LINA 2K8MB 3H4SE 3LCPC 2GV5A 1AJ4A 4XJKB 4ZCVA 1AP4A 2L2EA 1WRLA 2AAOA 2LP2A 5DKRA 1B1GA 1B7TY 1BU3A 1S3PA 2L51A 1B7TZ 1TNPA 4MBEA 3TZ1A 3DVEA 1MWNA 4PHMA 1QVIZ 2KOTA 3CR5X 2RGIA 3BOWB 1SRAA 4IL1A 2M1KB 1OE9B 1CM1A 1IKUA 1CTRA 1NYAA 3CR2A 1SCMC 2EHBA 2G2BA 1SKTA 4NDCA 1DF0A 1JF0A 3FWBA 2M7LA 2K61A 2LC5A 1A29A 3D0YA 1WY9A 2JTZA 4PALA 2E30A 3EKHA 1NCZA 4YGEB 2COLB 1KQVA 3I5GB 1J55A 1K96A 5D69A 1NCYA 3DVKA 2H61A 1TNXA 1UURA 4DUQA 1S36A 2ISDA 1WLZA 1S6CA 3KO0A 3OB2B 1RFJA 3TUYC 3MSEB 1KK8B 2WC8A 1OSAA 2MHHA 1QLSA 1YR5A 1SPYA 1TIZA 2MLFC 2L98A 2NZ0A 3JTDC 1EJ3A 1TNWA 4N5XA 5AEQA 3I5IC 5HYDA 2WCBA 1XFZO 2ZRTA 4QJ4B 1M31A 4F0ZB 1CLMA 1JSAA 1IG5A 3VRPA 1PALA 1UWOA 2BL0B 5CSFA 2MBXA 2LM5A 3EVVA 4GPLB 4AQIA 1K93D 1XYDA 2K2AA 2PALA 4JPZB 3SIBA 5KSZA 3PATA 1GGZA 1DTLA 3IF7A 3RM1A 1TCOB 1X02A 1LXFC 2LV7A 2KAYA 1FI6A 3BUWB 1CDNA 1MHOA 1UHJA 1XFVO 2MA2A 2BCAA 1F4OA 1OOJA 1KSOA 1SR6C 2LVKA 2LHLA 3NXAA 5HLVA 1A75A 4C0KA 1Y1UA 2JULA 1DJXA 2NCOA 3OHMB 2CTNA 2JTTA 1K9PA 3SG4A 1LA0A 1PRWA 2D8NA 2KYCA 4PE4A 4DS7A 1W7IB 4ETOA 1EL4A 1CLLA 1N0YA 2H2KA 1RTP1 1CKKA 4OR9B 5AXIA 2Y5IA 1PULA 3CZTX 1ZUZA 5F6TA 2NLNA 1BJFA 4N1FA 3GOFA 1XFUO 4I5KA 2EGDA 3DVMA 1FI5A 3CS1A 3BYAA 1G33A 2OTGC 4GFTA 1J1DA 2KNEA 1TNQA 1QV1A 2LUXA 1GGWA 3OX5A 3EK8A 1VRKA 1AVSA 3LLEA 2I2RE 2Q91A 4AOMA 2KI6C 1CDPA 3AKAA 3OX6A 3EVUA 2F33A 1KSMA 1CNPA 4MSPA 1CM4A 1NX2A 3OP0A 4MZJA 4MZLA 2CT9A 2PRUA 1FF1A 2GGMA 2LVVA 3SG5A 2HPSA 1DF0B 1PVBA 3KEVA 1H4BA 3D0YB 1J7PA 1IH0A 5DKQA 1GQMA 3ZNIA 3DF0B 4ZCUA 2PMYA 1BR4B 1S5GZ 1SNLA 2LVIA 2PVBA 1IJ6A 1NX1A 3BUOB 1IGVA 2BKIB 1QV0A 3AAJA 4FQOA 2HQ8A 1DMOA 1TCFA 5ER4X 3IQOA 2BKHB 3I5FC 2BCBA 2JRFA 2JT0A 1F4QA 2VRGA 3O4YA 1B8LA 1YRUB 3NSKA 1CFFA 2JWWA 3PLFB 3KF9A 5CSJA 3QRXA 4PE1A 2OS8C 1G8IA 1FBVA 2LAPA 2F3ZA 1XA5A 1E8AA 1NUBA 1MQ1A 3F45A 3NSLA 2DOQA 2L4IA 5CSIA 2KI6D 3O78A 3SG2A 5I2QA 1TTXA 1KFXS 1YUUA 1L2OC 1KQMC 2P6BB 2H61C 3BUXB 1CMGA 1UUSA 1CLBA 3SG7A 5AANA 4CFQA 1L7ZA 3ZWHA 4GAOA 4OCIA 5AFPA 1B8CA 2LHIA 1K94A 4BY5A 2PSRA 1CFCA 1IRJA 4TNCA 1YURA 3JTDB 3FWCA 3PSRA 4I5JA 5K89A 1A2XA 2Y1MA 2JU0A 1SMGA 1A75B 1N2DA 1NP8A 1S6JA 3FS7A 1UHHA 1EH2A 1Y0VH 1YX7A 1JUOA 4P5OE 2JT8A 4GGNA 2LLUA 1D1OA 2ZN8A 1OZOA 2JNFA 3I5HC 2M3WA 4QJ3B 2KAXA 4WQ3A 1C07A 3WHUB 2AUCA 5I2LA 1JFJA 1TN4A 3LK1A 2M1UA 3HCMA 2WCEA 3CR4X 1PVAA 2HETA 4GGFA 5IBWA 1EG4A 2K0JA 4C0JA 2K7BA 3PN7C 1WRKA 4QJ5B 1BR1B 1YVHA 2FCEA 2KDHA 1SYMA 1U5IA 4WRIA 5J3XA 1Y1XA 2KI4C 2MAZA 2ZNDA 1K95A 1BT6A 4P2YB 1J7OA 4PE0A 1QJTA 5GQQC 2A4JA 1PSRA 2KSPA 3BUNB 1BLQA 3OB1B 2K7DA 2KFHA 3EK4A 1WLMA 1LA3A 1TOPA 3EK7A 2JZIA 5BPJA 4PHKA 4XJKA 2BBNA 1SCVA 1AHRA 2O60A 1UHKA 5CPVA 2M49B 1RK9A 3I5GC 1NCXA 1CDMA 1SK6D 2TN4A 2KFGA 1KCYA 1RECA 4I5NB 1NWDA 1XFYO 3BUMB 3BOWA 2K2FA 2KGBC 4AQJA 1YTZC 5TNCA 2FOTA 1BODA 1K9KA 2ZRSA 4R1EA 1K9UA 1F8HA 1RROA 2LMVA 1FW4A 1KFUS 2BE6A 1S26D 1OMVA 2BE4A 5PALA 1F70A 2E6WA 3JVTB 1WRZA 1QIWA 2JQ6A 3I5FB 2HQWA 1Q80A 4ORBB 2M29A 2ZFDA 5I8NA 1AK8A 2L50A 1ZOTB 3NSIA 2BECA 1DGVA 1B47A 4MN0A 2OS8B 1DJGA 2KQ6A 2LUCA 2WNDA 3AKBA 4YI8A 1IQ5A 3VGOA 1KK7Y 1IQ3A 4NDBA 2Y4QA 1S6IA 1QATA 4CPVA 3LL8B 1L2OB 1KQMB 1OMDA 4JWQA 1GJYA 2MJWB 1TRFA 2QACA 2Q4UA 1V1GA 4A4BA 1JBAA 1KWOC 1XVJA 1CDLA 2KQYA 1BMOA 3SG3A 1M45A 2WOSA 2AMIA 2CCMA 3GK2A 3TDZA 1ZACA 3WNXB 2JT3A 5KU1A 5G08A 4PDZA 4UPGA 2K7OA 3VRRA 1DVIA 2F2OA 1SCMB 3CWGA 3E3RA 4USLA 2NXQA 5I2OA 4N1GA 5JJGA 2JNXA 1ZMZA 4ICBA 2KBMA 1BOCA 4D1EA 4MLWA 3GK4X 1CB1A 2B1UA 1C7VA 5HKWA 1ZFSA 2KGRA 3A4UB 2FJUB 4BY4A 4ORCB 2JXLA 1WDCC 1M39A 1XK4C 1SL8A 2LE9B 3I5HB 2M9GA 3TUYB 1CMFA 3KHEA 4GBAA 1DJZA 1J1EA 1U5IB 1YUTA 3HX4A 2LMUA 4YGAA 1J7QA 1EG3A 3VRQA 1CFDA 3TDIA 1KFUL 2SASA 3DD4A 3AAKA 3PALA 4FTGA 1AUIB 3SJSA 5AERA 3I5IB 1CFPA 1QX5B 1K2HA 2IS9A 2M97A 2G9BA 3A8RA 3CLNA 2NCPA 3PN7B 4GGFC 4ORAB 1AJ5A 2CXJA 5ER5A 1XK4A 3CTNA 2KHNA 1QVIY 2KI4B 1M63B 2I94A 2EC6C 4CIDA 2LMTA 1NIWA 4Q04A 2MLEC 1QTXA 1UHIA 3TS5C 1EXRA 4HRGA 1QS7A 4HRHA 4DRWA
chains in the Genus database with same CATH superfamily
3RLZA 4GNKB 1HT9A 1K90D 3K21A 1SR6B 3RZSA 1F55A 2LLSA 5CSNA 2KBIA 1MUXA 1QIVA 4E68A 2ZNEA 3DF0A 5DKNA 3ICBA 4YRUA 5JOLA 2KAVA 3EVRA 2I18A 2R2IA 3O2PA 1JWDA 1UHNA 4A4CA 2MRDA 3LK0A 1H8BA 2F8PA 2QDIA 4HREE 2LCPA 5FYXA 5B8IB 4YI9A 1OMRA 4I5LB 1UP5A 4IJ7A 1DT7B 2M8UA 4OVNF 4JKTA 3BFBA 1QLKA 4MEWA 1KFXL 3WXAA 1YX8A 2BNXA 3IQQA 2GTEA 2K60A 2OTGB 1R2UA 3S0DA 1RJVA 1XFXO 4DIRA 2K7CA 1SY9A 3WHTB 1DJYA 3EKJA 1DJWA 2KFFA 3BQ3A 1JFKA 1XFRA 3D74A 1QASA 4C0LA 2FCDA 1BF5A 2JC2A 4YGDB 1N65A 4L9MA 3VROA 1PK0D 1KK8C 2OPOA 3B87A 3O6BA 2WORA 4YGCB 1V1FA 1JC2A 5D7FA 3TDUA 4MVFA 1YVLA 1B8RA 4MRXA 3R72A 1SBJA 2Y1NA 1JF2A 1KWOB 1QX2A 4CLNA 2LP3A 1A03A 3BJHA 1DJIA 2L4HA 2H8VA 1FPWA 3V2LA 2GGZA 1NX3A 1BG1A 2BL0C 3VB1A 1A4PA 1NX0A 2BCXA 3PM2A 4PHJA 2KYFA 1NPQA 1SW8A 4MRYA 1S1EA 3BXKA 1SL9A 4KYNA 2F3YA 4NQGA 1MXEA 1ODBA 2JXCA 1DGUA 1YUSA 2I7AA 1F71A 1KK7Z 1LKJA 3SG6A 1Y1AA 5HLOA 2ZN9A 4GUKA 1R6PA 3D10A 1WDCB 1DJHA 4M2OA 1F54A 3R1PA 2ZKMX 1HQVA 2WCFA 1IWQA 1PSBA 1MF8B 1QXPA 2F2PA 3C1VA 2LLTA 1NSHA 4JQ0D 2LANA 5FI2A 5HKYA 3GK1A 1C7WA 1XO5A 2O5GA 2PASA 1ALVA 2LVJA 4JD9A 1MR8A 4YBHB 1IJ5A 2CNPA 1RWYA 2QPTA 3CGAA 3M0WA 3PFVA 2BBMA 4XYNA 3SIAA 4YGBB 1B4CA 4OV2A 1QWVA 2HF5A 1QX7A 1K8UA 3KPXA 2WCMA 3L4AA 3S0FA 1J7RA 1S5GY 2L5XB 3PM8A 4HSZA 4NDDA 4M2PA 3VRNA 4U8DA 2LNKA 1LVCD 5HKZA 4PHNA 1YRTB 2SCPA 1G4YR 3DVJA 1XFWO 2JOJA 1Z4HA 1OZSA 2M7NA 4PE7A 3JVTC 1OQPA 1B9AA 2EC6B 4CFRA 4OZDA 1W7JB 2CBLA 1MXLC 1ALWA 2QEHA 3FIAA 4M2QA 4DCKA 2L0PA 3L4LA 3TS5B 4MZKA 4PCWA 2M0RA 1M46A 2JPTA 4OKHA 4WQ2A 5KTYA 1Y6WA 1SL7A 2PQLA 3S0AA 3NSOA 2V53A 3CDNA 1LINA 2K8MB 3H4SE 3LCPC 2GV5A 1AJ4A 4XJKB 4ZCVA 1AP4A 2L2EA 1WRLA 2AAOA 2LP2A 5DKRA 1B1GA 1B7TY 1BU3A 1S3PA 2L51A 1B7TZ 1ORGA 1TNPA 4MBEA 3TZ1A 3DVEA 1MWNA 4PHMA 1QVIZ 2KOTA 3CR5X 2RGIA 3BOWB 1SRAA 4IL1A 2M1KB 1OE9B 1CM1A 1IKUA 1CTRA 1NYAA 3CR2A 3SS5A 1SCMC 2EHBA 2G2BA 1SKTA 4NDCA 1DF0A 1JF0A 1P28A 3FWBA 2M7LA 2K61A 2LC5A 1A29A 3D0YA 1WY9A 2JTZA 4PALA 2E30A 3EKHA 1NCZA 4YGEB 2COLB 1KQVA 2WC5A 3I5GB 1J55A 1K96A 5D69A 2L2CA 1NCYA 3DVKA 2H61A 1TNXA 1UURA 3D78A 1S36A 4DUQA 2ISDA 1WLZA 1OOFA 1S6CA 2FJYA 3KO0A 3OB2B 1RFJA 3TUYC 3MSEB 1KK8B 2WC8A 1OSAA 2P70A 2MHHA 1QLSA 1YR5A 1SPYA 4HRHA 1TIZA 2MLFC 2L98A 2NZ0A 3JTDC 1EJ3A 1TNWA 4N5XA 5AEQA 1LS8A 3I5IC 5HYDA 2WCBA 1XFZO 2ZRTA 4QJ4B 1M31A 4F0ZB 1CLMA 2WCJA 3OBVA 1IG5A 1JSAA 3VRPA 5HL1A 1PALA 1UWOA 2BL0B 5CSFA 2MBXA 2LM5A 3EVVA 1W9ZA 4GPLB 4AQIA 1K93D 1XYDA 2K2AA 2PALA 4JPZB 3SIBA 5KSZA 3PATA 1GGZA 1DTLA 3IF7A 3RM1A 1TCOB 1X02A 1LXFC 3N7HA 2LV7A 2KAYA 1FI6A 3BUWB 1CDNA 1MHOA 1UHJA 2WCLA 1XFVO 2MA2A 3L47A 2BCAA 1F4OA 1OOJA 1KSOA 1SR6C 2LVKA 2LHLA 3NXAA 5HLVA 1A75A 4C0KA 1Y1UA 2BAPA 2JULA 1DJXA 2NCOA 3OHMB 2WC6A 2CTNA 2JTTA 1K9PA 3SG4A 1LA0A 1PRWA 2D8NA 2KYCA 4PE4A 4DS7A 1W7IB 4ETOA 1EL4A 1CLLA 1N0YA 2H2KA 1DC1A 1RTP1 1CKKA 4OR9B 5AXIA 2Y5IA 1PULA 3CZTX 1ZUZA 5F6TA 2NLNA 1BJFA 4N1FA 3GOFA 1XFUO 4I5KA 2EGDA 3DVMA 1FI5A 3CS1A 3BYAA 1G33A 2OTGC 4GFTA 1J1DA 3DXLA 5DICA 2KNEA 1TNQA 1QV1A 2LUXA 1GGWA 3OX5A 3EK8A 1VRKA 1AVSA 3LLEA 2I2RE 2Q91A 3R1VA 4INWA 4AOMA 2KI6C 2L5YA 1CDPA 1OOIX 3AKAA 3OX6A 5FI6A 3EVUA 2F33A 3Q8IA 1KSMA 1CNPA 4MSPA 1CM4A 1NX2A 3OP0A 4MZJA 4MZLA 1DELA 2CT9A 2PRUA 1FF1A 2GGMA 2LVVA 3SG5A 2HPSA 2QEOA 1DF0B 1PVBA 3KEVA 3FE8A 1H4BA 3D0YB 1J7PA 1IH0A 5DKQA 1OW4A 2KLEA 1GQMA 3ZNIA 3DF0B 4ZCUA 2PMYA 1BR4B 1S5GZ 1SNLA 2LVIA 2PVBA 3R1OA 1IJ6A 1NX1A 3BUOB 1IGVA 2BKIB 1QV0A 3AAJA 4FQOA 2HQ8A 3S0GA 1DMOA 1TCFA 5ER4X 3IQOA 3B6XA 2BKHB 3I5FC 2BCBA 3S0BA 2JRFA 3D73A 2JT0A 1F4QA 2VRGA 3O4YA 1B8LA 1YRUB 3NSKA 1CFFA 2JWWA 3PLFB 3NHTA 3KF9A 5CSJA 3QRXA 4PE1A 2OS8C 1G8IA 1FBVA 2LAPA 2F3ZA 1XA5A 3UNWA 1E8AA 1NUBA 3CABA 4F7FA 1MQ1A 3DZTA 3F45A 3NSLA 2DOQA 1T14A 2L4IA 2KI6D 5CSIA 5FI7A 3O78A 3UO9A 3SG2A 5I2QA 1TTXA 1KFXS 1YUUA 1L2OC 1KQMC 2P6BB 2H61C 3B7AA 3BUXB 1CMGA 1UUSA 1C3YA 1CLBA 3SG7A 5AANA 4CFQA 1L7ZA 3ZWHA 4GAOA 4OCIA 3O4XA 5AFPA 1B8CA 2LHIA 1K94A 5D3OA 4BY5A 2PSRA 1CFCA 1IRJA 4TNCA 1YURA 3JTDB 3FWCA 3PSRA 4I5JA 5K89A 1A2XA 2Y1MA 2JU0A 1SMGA 5I94A 1A75B 1N2DA 1NP8A 1S6JA 3FS7A 2QEBA 1UHHA 3SS4A 3BFAA 1EH2A 1Y0VH 1YX7A 1JUOA 4P5OE 2JT8A 4GGNA 2LLUA 1D1OA 3OGNA 2ZN8A 1OZOA 2JNFA 3I5HC 2M3WA 4QJ3B 2KAXA 4WQ3A 1C07A 3WHUB 2AUCA 5I2LA 1JFJA 1IIOA 1TN4A 3D76A 3LK1A 1Z2CB 2M1UA 3HCMA 2WCEA 3CR4X 1PVAA 2HETA 4GGFA 5IBWA 1EG4A 2K0JA 4C0JA 2K7BA 3PN7C 1WRKA 4QJ5B 1BR1B 1YVHA 2FCEA 2KDHA 1SYMA 1U5IA 4WRIA 5J3XA 1Y1XA 2KI4C 2MAZA 2ZNDA 1K95A 1BT6A 4P2YB 1J7OA 4PE0A 1QJTA 3S0EA 3SS3A 3FE9A 5GQQC 1OOGA 1TUJA 2A4JA 3DY9A 1PSRA 2KSPA 3BUNB 3K1EA 1BLQA 3OB1B 4INXA 2K7DA 2KFHA 3EK4A 1WLMA 1LA3A 1TOPA 3EK7A 2JZIA 5BPJA 4PHKA 4XJKA 2BBNA 1SCVA 1AHRA 2YGUA 2O60A 1UHKA 1DEKA 5CPVA 2M49B 1TUZA 1TWOA 1RK9A 3I5GC 1NCXA 1CDMA 1SK6D 2TN4A 2KFGA 1KCYA 4PT1A 1RECA 4I5NB 3FE6A 1NWDA 1XFYO 3BUMB 3EG5B 2PYQA 3BOWA 2K2FA 2KGBC 4AQJA 1YTZC 5TNCA 2FOTA 1BODA 1K9KA 2ZRSA 3IVTA 1K9UA 4R1EA 1C3ZA 1RROA 2LMVA 1F8HA 1FW4A 1KFUS 2BE6A 1S26D 3B88A 1OMVA 2BE4A 5PALA 2QEVA 1F70A 2E6WA 3JVTB 1WRZA 1QIWA 2JQ6A 3I5FB 2HQWA 1Q80A 3DYEA 2M29A 2ZFDA 4ORBB 5I8NA 1AK8A 2L50A 1ZOTB 3NSIA 2BECA 1DGVA 3CZ1A 1B47A 4FQTA 4MN0A 2OS8B 1DJGA 2KQ6A 2LUCA 2WNDA 3AKBA 4YI8A 1IQ5A 3VGOA 1KK7Y 3QMEA 4NDBA 1IQ3A 2Y4QA 1S6IA 1QATA 4CPVA 3LL8B 3D77A 1L2OB 1KQMB 1OMDA 3CZ2A 1GJYA 4JWQA 2MJWB 1TRFA 5EL2A 1SSEB 2Q4UA 1V1GA 2QACA 2WCKA 4A4BA 1JBAA 1KWOC 1XVJA 1CDLA 2KQYA 1BMOA 3SG3A 1DQEA 1M45A 2WOSA 2AMIA 2CCMA 3GK2A 3TDZA 1ZACA 3WNXB 2JT3A 2ERBA 5KU1A 5G08A 4PDZA 2P71A 4UPGA 2K7OA 3VRRA 1DVIA 2F2OA 1SCMB 3CWGA 3E3RA 4USLA 2NXQA 5I2OA 4N1GA 2KPHA 5JJGA 2JNXA 1ZMZA 4ICBA 2KBMA 3D75A 1BOCA 4D1EA 4MLWA 3GK4X 1CB1A 2B1UA 1C7VA 5HKWA 1GM0A 1ZFSA 2KGRA 2KLDA 3A4UB 2FJUB 4BY4A 3PJIA 4ORCB 2JXLA 1WDCC 1M39A 1XK4C 1SL8A 2LE9B 3I5HB 2M9GA 3TUYB 1CMFA 3KHEA 4GBAA 1DJZA 1J1EA 1U5IB 1YUTA 3HX4A 2LMUA 4YGAA 3NGVA 1J7QA 1EG3A 3VRQA 1CFDA 3TDIA 1KFUL 2SASA 3DD4A 3AAKA 3PALA 4FTGA 1AUIB 3SJSA 5AERA 3I5IB 1CFPA 1QX5B 1K2HA 1OOHA 2IS9A 2M97A 3CYZA 2G9BA 3A8RA 3CLNA 2NCPA 3PN7B 4GGFC 4ORAB 1AJ5A 2CXJA 5ER5A 1XK4A 3CTNA 3B86A 3NHIA 3BFHA 2KHNA 1QVIY 2KI4B 1M63B 2I94A 2EC6C 2JPOA 4CIDA 2WCHA 2LMTA 1NIWA 4Q04A 2MLEC 1QTXA 1UHIA 3TS5C 1EXRA 4HRGA 1QS7A 3CZ0A 4DRWA
chains in the Genus database with same CATH topology
3RLZA 4GNKB 1HT9A 1K90D 3K21A 1SR6B 1F55A 2LLSA 5CSNA 2KBIA 1MUXA 1QIVA 4E68A 2ZNEA 3DF0A 5DKNA 3ICBA 4YRUA 5JOLA 2KAVA 3EVRA 2I18A 2R2IA 3O2PA 1JWDA 1UHNA 4A4CA 2MRDA 3LK0A 1H8BA 2F8PA 4HREE 2LCPA 5FYXA 5B8IB 4YI9A 1OMRA 4I5LB 1UP5A 1DT7B 2M8UA 4OVNF 1QLKA 4MEWA 1KFXL 3WXAA 1YX8A 3IQQA 2OTGB 1R2UA 1RJVA 1XFXO 4DIRA 2K7CA 1SY9A 3WHTB 1DJYA 3EKJA 1DJWA 2KFFA 3BQ3A 1JFKA 1QASA 4C0LA 2FCDA 1BF5A 2JC2A 4YGDB 1N65A 4L9MA 3VROA 1PK0D 1KK8C 2OPOA 3O6BA 2WORA 4YGCB 1V1FA 1JC2A 5D7FA 3TDUA 4MVFA 1YVLA 1B8RA 4MRXA 1SBJA 2Y1NA 1JF2A 1KWOB 1QX2A 4CLNA 2LP3A 1A03A 1DJIA 2L4HA 1FPWA 2GGZA 1NX3A 1BG1A 2BL0C 1A4PA 1NX0A 2BCXA 4PHJA 2KYFA 1NPQA 1SW8A 4MRYA 1S1EA 3BXKA 1SL9A 2F3YA 4NQGA 1MXEA 1ODBA 2JXCA 1DGUA 1YUSA 2I7AA 1F71A 1KK7Z 1LKJA 3SG6A 1Y1AA 5HLOA 2ZN9A 4GUKA 1R6PA 3D10A 1WDCB 1DJHA 4M2OA 1F54A 2ZKMX 1HQVA 2WCFA 1IWQA 1PSBA 1MF8B 1QXPA 2F2PA 3C1VA 2LLTA 1NSHA 4JQ0D 2LANA 5HKYA 3GK1A 1C7WA 1XO5A 2O5GA 2PASA 1ALVA 2LVJA 1MR8A 4YBHB 1IJ5A 2CNPA 1RWYA 2QPTA 3CGAA 3M0WA 3PFVA 2BBMA 4XYNA 3SIAA 4YGBB 1B4CA 4OV2A 2HF5A 1QX7A 1K8UA 3KPXA 1J7RA 1S5GY 2L5XB 3PM8A 4HSZA 4NDDA 4M2PA 3VRNA 4U8DA 2LNKA 1LVCD 5HKZA 4PHNA 1YRTB 2SCPA 1G4YR 3DVJA 1XFWO 2JOJA 1OZSA 2M7NA 4PE7A 3JVTC 1OQPA 1B9AA 2EC6B 4CFRA 1W7JB 2CBLA 1MXLC 1ALWA 3FIAA 4M2QA 4DCKA 2L0PA 3TS5B 4MZKA 4PCWA 2M0RA 1M46A 2JPTA 4OKHA 4WQ2A 5KTYA 1Y6WA 1SL7A 3NSOA 2V53A 1LINA 2K8MB 3H4SE 3LCPC 2GV5A 1AJ4A 4XJKB 4ZCVA 1AP4A 2L2EA 1WRLA 2AAOA 2LP2A 5DKRA 1B1GA 1B7TY 1BU3A 1S3PA 2L51A 1B7TZ 1TNPA 4MBEA 3TZ1A 3DVEA 1MWNA 4PHMA 1QVIZ 2KOTA 3CR5X 2RGIA 3BOWB 1SRAA 4IL1A 2M1KB 1OE9B 1CM1A 1IKUA 1CTRA 1NYAA 3CR2A 1SCMC 2EHBA 2G2BA 1SKTA 4NDCA 1DF0A 1JF0A 3FWBA 2M7LA 2K61A 2LC5A 1A29A 3D0YA 1WY9A 2JTZA 4PALA 2E30A 3EKHA 1NCZA 4YGEB 2COLB 1KQVA 3I5GB 1J55A 1K96A 5D69A 1NCYA 3DVKA 2H61A 1TNXA 1UURA 4DUQA 1S36A 2ISDA 1WLZA 1S6CA 3KO0A 3OB2B 1RFJA 3TUYC 3MSEB 1KK8B 2WC8A 1OSAA 2MHHA 1QLSA 1YR5A 1SPYA 1TIZA 2MLFC 2L98A 2NZ0A 3JTDC 1EJ3A 1TNWA 4N5XA 5AEQA 3I5IC 5HYDA 2WCBA 1XFZO 2ZRTA 4QJ4B 1M31A 4F0ZB 1CLMA 1JSAA 1IG5A 3VRPA 1PALA 1UWOA 2BL0B 5CSFA 2MBXA 2LM5A 3EVVA 4GPLB 4AQIA 1K93D 1XYDA 2K2AA 2PALA 4JPZB 3SIBA 5KSZA 3PATA 1GGZA 1DTLA 3IF7A 3RM1A 1TCOB 1X02A 1LXFC 2LV7A 2KAYA 1FI6A 3BUWB 1CDNA 1MHOA 1UHJA 1XFVO 2MA2A 2BCAA 1F4OA 1OOJA 1KSOA 1SR6C 2LVKA 2LHLA 3NXAA 5HLVA 1A75A 4C0KA 1Y1UA 2JULA 1DJXA 2NCOA 3OHMB 2CTNA 2JTTA 1K9PA 3SG4A 1LA0A 1PRWA 2D8NA 2KYCA 4PE4A 4DS7A 1W7IB 4ETOA 1EL4A 1CLLA 1N0YA 2H2KA 1RTP1 1CKKA 4OR9B 5AXIA 2Y5IA 1PULA 3CZTX 1ZUZA 5F6TA 2NLNA 1BJFA 4N1FA 3GOFA 1XFUO 4I5KA 2EGDA 3DVMA 1FI5A 3CS1A 3BYAA 1G33A 2OTGC 4GFTA 1J1DA 2KNEA 1TNQA 1QV1A 2LUXA 1GGWA 3OX5A 3EK8A 1VRKA 1AVSA 3LLEA 2I2RE 2Q91A 4AOMA 2KI6C 1CDPA 3AKAA 3OX6A 3EVUA 2F33A 1KSMA 1CNPA 4MSPA 1CM4A 1NX2A 3OP0A 4MZJA 4MZLA 2CT9A 2PRUA 1FF1A 2GGMA 2LVVA 3SG5A 2HPSA 1DF0B 1PVBA 3KEVA 1H4BA 3D0YB 1J7PA 1IH0A 5DKQA 1GQMA 3ZNIA 3DF0B 4ZCUA 2PMYA 1BR4B 1S5GZ 1SNLA 2LVIA 2PVBA 1IJ6A 1NX1A 3BUOB 1IGVA 2BKIB 1QV0A 3AAJA 4FQOA 2HQ8A 1DMOA 1TCFA 5ER4X 3IQOA 2BKHB 3I5FC 2BCBA 2JRFA 2JT0A 1F4QA 2VRGA 3O4YA 1B8LA 1YRUB 3NSKA 1CFFA 2JWWA 3PLFB 3KF9A 5CSJA 3QRXA 4PE1A 2OS8C 1G8IA 1FBVA 2LAPA 2F3ZA 1XA5A 1E8AA 1NUBA 1MQ1A 3F45A 3NSLA 2DOQA 2L4IA 5CSIA 2KI6D 3O78A 3SG2A 5I2QA 1TTXA 1KFXS 1YUUA 1L2OC 1KQMC 2P6BB 2H61C 3BUXB 1CMGA 1UUSA 1CLBA 3SG7A 5AANA 4CFQA 1L7ZA 3ZWHA 4GAOA 4OCIA 5AFPA 1B8CA 2LHIA 1K94A 4BY5A 2PSRA 1CFCA 1IRJA 4TNCA 1YURA 3JTDB 3FWCA 3PSRA 4I5JA 5K89A 1A2XA 2Y1MA 2JU0A 1SMGA 1A75B 1N2DA 1NP8A 1S6JA 3FS7A 1UHHA 1EH2A 1Y0VH 1YX7A 1JUOA 4P5OE 2JT8A 4GGNA 2LLUA 1D1OA 2ZN8A 1OZOA 2JNFA 3I5HC 2M3WA 4QJ3B 2KAXA 4WQ3A 1C07A 3WHUB 2AUCA 5I2LA 1JFJA 1TN4A 3LK1A 2M1UA 3HCMA 2WCEA 3CR4X 1PVAA 2HETA 4GGFA 5IBWA 1EG4A 2K0JA 4C0JA 2K7BA 3PN7C 1WRKA 4QJ5B 1BR1B 1YVHA 2FCEA 2KDHA 1SYMA 1U5IA 4WRIA 5J3XA 1Y1XA 2KI4C 2MAZA 2ZNDA 1K95A 1BT6A 4P2YB 1J7OA 4PE0A 1QJTA 5GQQC 2A4JA 1PSRA 2KSPA 3BUNB 1BLQA 3OB1B 2K7DA 2KFHA 3EK4A 1WLMA 1LA3A 1TOPA 3EK7A 2JZIA 5BPJA 4PHKA 4XJKA 2BBNA 1SCVA 1AHRA 2O60A 1UHKA 5CPVA 2M49B 1RK9A 3I5GC 1NCXA 1CDMA 1SK6D 2TN4A 2KFGA 1KCYA 1RECA 4I5NB 1NWDA 1XFYO 3BUMB 3BOWA 2K2FA 2KGBC 4AQJA 1YTZC 5TNCA 2FOTA 1BODA 1K9KA 2ZRSA 4R1EA 1K9UA 1F8HA 1RROA 2LMVA 1FW4A 1KFUS 2BE6A 1S26D 1OMVA 2BE4A 5PALA 1F70A 2E6WA 3JVTB 1WRZA 1QIWA 2JQ6A 3I5FB 2HQWA 1Q80A 4ORBB 2M29A 2ZFDA 5I8NA 1AK8A 2L50A 1ZOTB 3NSIA 2BECA 1DGVA 1B47A 4MN0A 2OS8B 1DJGA 2KQ6A 2LUCA 2WNDA 3AKBA 4YI8A 1IQ5A 3VGOA 1KK7Y 1IQ3A 4NDBA 2Y4QA 1S6IA 1QATA 4CPVA 3LL8B 1L2OB 1KQMB 1OMDA 4JWQA 1GJYA 2MJWB 1TRFA 2QACA 2Q4UA 1V1GA 4A4BA 1JBAA 1KWOC 1XVJA 1CDLA 2KQYA 1BMOA 3SG3A 1M45A 2WOSA 2AMIA 2CCMA 3GK2A 3TDZA 1ZACA 3WNXB 2JT3A 5KU1A 5G08A 4PDZA 4UPGA 2K7OA 3VRRA 1DVIA 2F2OA 1SCMB 3CWGA 3E3RA 4USLA 2NXQA 5I2OA 4N1GA 5JJGA 2JNXA 1ZMZA 4ICBA 2KBMA 1BOCA 4D1EA 4MLWA 3GK4X 1CB1A 2B1UA 1C7VA 5HKWA 1ZFSA 2KGRA 3A4UB 2FJUB 4BY4A 4ORCB 2JXLA 1WDCC 1M39A 1XK4C 1SL8A 2LE9B 3I5HB 2M9GA 3TUYB 1CMFA 3KHEA 4GBAA 1DJZA 1J1EA 1U5IB 1YUTA 3HX4A 2LMUA 4YGAA 1J7QA 1EG3A 3VRQA 1CFDA 3TDIA 1KFUL 2SASA 3DD4A 3AAKA 3PALA 4FTGA 1AUIB 3SJSA 5AERA 3I5IB 1CFPA 1QX5B 1K2HA 2IS9A 2M97A 2G9BA 3A8RA 3CLNA 2NCPA 3PN7B 4GGFC 4ORAB 1AJ5A 2CXJA 5ER5A 1XK4A 3CTNA 2KHNA 1QVIY 2KI4B 1M63B 2I94A 2EC6C 4CIDA 2LMTA 1NIWA 4Q04A 2MLEC 1QTXA 1UHIA 3TS5C 1EXRA 4HRGA 1QS7A 4HRHA 4DRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RLZ A;  4GNK B;  1HT9 A;  1K90 D;  3K21 A;  1SR6 B;  1F55 A;  2LLS A;  5CSN A;  2KBI A;  1MUX A;  1QIV A;  4E68 A;  2ZNE A;  3DF0 A;  5DKN A;  3ICB A;  4YRU A;  5JOL A;  2KAV A;  3EVR A;  2I18 A;  2R2I A;  3O2P A;  1JWD A;  1UHN A;  4A4C A;  2MRD A;  3LK0 A;  1H8B A;  2F8P A;  4HRE E;  2LCP A;  5FYX A;  5B8I B;  4YI9 A;  1OMR A;  4I5L B;  1UP5 A;  1DT7 B;  2M8U A;  4OVN F;  1QLK A;  4MEW A;  1KFX L;  3WXA A;  1YX8 A;  3IQQ A;  2OTG B;  1R2U A;  1RJV A;  1XFX O;  4DIR A;  2K7C A;  1SY9 A;  3WHT B;  1DJY A;  3EKJ A;  1DJW A;  2KFF A;  3BQ3 A;  1JFK A;  1QAS A;  4C0L A;  2FCD A;  1BF5 A;  2JC2 A;  4YGD B;  1N65 A;  4L9M A;  3VRO A;  1PK0 D;  1KK8 C;  2OPO A;  3O6B A;  2WOR A;  4YGC B;  1V1F A;  1JC2 A;  5D7F A;  3TDU A;  4MVF A;  1YVL A;  1B8R A;  4MRX A;  1SBJ A;  2Y1N A;  1JF2 A;  1KWO B;  1QX2 A;  4CLN A;  2LP3 A;  1A03 A;  1DJI A;  2L4H A;  1FPW A;  2GGZ A;  1NX3 A;  1BG1 A;  2BL0 C;  1A4P A;  1NX0 A;  2BCX A;  4PHJ A;  2KYF A;  1NPQ A;  1SW8 A;  4MRY A;  1S1E A;  3BXK A;  1SL9 A;  2F3Y A;  4NQG A;  1MXE A;  1ODB A;  2JXC A;  1DGU A;  1YUS A;  2I7A A;  1F71 A;  1KK7 Z;  1LKJ A;  3SG6 A;  1Y1A A;  5HLO A;  2ZN9 A;  4GUK A;  1R6P A;  3D10 A;  1WDC B;  1DJH A;  4M2O A;  1F54 A;  2ZKM X;  1HQV A;  2WCF A;  1IWQ A;  1PSB A;  1MF8 B;  1QXP A;  2F2P A;  3C1V A;  2LLT A;  1NSH A;  4JQ0 D;  2LAN A;  5HKY A;  3GK1 A;  1C7W A;  1XO5 A;  2O5G A;  2PAS A;  1ALV A;  2LVJ A;  1MR8 A;  4YBH B;  1IJ5 A;  2CNP A;  1RWY A;  2QPT A;  3CGA A;  3M0W A;  3PFV A;  2BBM A;  4XYN A;  3SIA A;  4YGB B;  1B4C A;  4OV2 A;  2HF5 A;  1QX7 A;  1K8U A;  3KPX A;  1J7R A;  1S5G Y;  2L5X B;  3PM8 A;  4HSZ A;  4NDD A;  4M2P A;  3VRN A;  4U8D A;  2LNK A;  1LVC D;  5HKZ A;  4PHN A;  1YRT B;  2SCP A;  1G4Y R;  3DVJ A;  1XFW O;  2JOJ A;  1OZS A;  2M7N A;  4PE7 A;  3JVT C;  1OQP A;  1B9A A;  2EC6 B;  4CFR A;  1W7J B;  2CBL A;  1MXL C;  1ALW A;  3FIA A;  4M2Q A;  4DCK A;  2L0P A;  3TS5 B;  4MZK A;  4PCW A;  2M0R A;  1M46 A;  2JPT A;  4OKH A;  4WQ2 A;  5KTY A;  1Y6W A;  1SL7 A;  3NSO A;  2V53 A;  1LIN A;  2K8M B;  3H4S E;  3LCP C;  2GV5 A;  1AJ4 A;  4XJK B;  4ZCV A;  1AP4 A;  2L2E A;  1WRL A;  2AAO A;  2LP2 A;  5DKR A;  1B1G A;  1B7T Y;  1BU3 A;  1S3P A;  2L51 A;  1B7T Z;  1TNP A;  4MBE A;  3TZ1 A;  3DVE A;  1MWN A;  4PHM A;  1QVI Z;  2KOT A;  3CR5 X;  2RGI A;  3BOW B;  1SRA A;  4IL1 A;  2M1K B;  1OE9 B;  1CM1 A;  1IKU A;  1CTR A;  1NYA A;  3CR2 A;  1SCM C;  2EHB A;  2G2B A;  1SKT A;  4NDC A;  1DF0 A;  1JF0 A;  3FWB A;  2M7L A;  2K61 A;  2LC5 A;  1A29 A;  3D0Y A;  1WY9 A;  2JTZ A;  4PAL A;  2E30 A;  3EKH A;  1NCZ A;  4YGE B;  2COL B;  1KQV A;  3I5G B;  1J55 A;  1K96 A;  5D69 A;  1NCY A;  3DVK A;  2H61 A;  1TNX A;  1UUR A;  4DUQ A;  1S36 A;  2ISD A;  1WLZ A;  1S6C A;  3KO0 A;  3OB2 B;  1RFJ A;  3TUY C;  3MSE B;  1KK8 B;  2WC8 A;  1OSA A;  2MHH A;  1QLS A;  1YR5 A;  1SPY A;  1TIZ A;  2MLF C;  2L98 A;  2NZ0 A;  3JTD C;  1EJ3 A;  1TNW A;  4N5X A;  5AEQ A;  3I5I C;  5HYD A;  2WCB A;  1XFZ O;  2ZRT A;  4QJ4 B;  1M31 A;  4F0Z B;  1CLM A;  1JSA A;  1IG5 A;  3VRP A;  1PAL A;  1UWO A;  2BL0 B;  5CSF A;  2MBX A;  2LM5 A;  3EVV A;  4GPL B;  4AQI A;  1K93 D;  1XYD A;  2K2A A;  2PAL A;  4JPZ B;  3SIB A;  5KSZ A;  3PAT A;  1GGZ A;  1DTL A;  3IF7 A;  3RM1 A;  1TCO B;  1X02 A;  1LXF C;  2LV7 A;  2KAY A;  1FI6 A;  3BUW B;  1CDN A;  1MHO A;  1UHJ A;  1XFV O;  2MA2 A;  2BCA A;  1F4O A;  1OOJ A;  1KSO A;  1SR6 C;  2LVK A;  2LHL A;  3NXA A;  5HLV A;  1A75 A;  4C0K A;  1Y1U A;  2JUL A;  1DJX A;  2NCO A;  3OHM B;  2CTN A;  2JTT A;  1K9P A;  3SG4 A;  1LA0 A;  1PRW A;  2D8N A;  2KYC A;  4PE4 A;  4DS7 A;  1W7I B;  4ETO A;  1EL4 A;  1CLL A;  1N0Y A;  2H2K A;  1RTP 1;  1CKK A;  4OR9 B;  5AXI A;  2Y5I A;  1PUL A;  3CZT X;  1ZUZ A;  5F6T A;  2NLN A;  1BJF A;  4N1F A;  3GOF A;  1XFU O;  4I5K A;  2EGD A;  3DVM A;  1FI5 A;  3CS1 A;  3BYA A;  1G33 A;  2OTG C;  4GFT A;  1J1D A;  2KNE A;  1TNQ A;  1QV1 A;  2LUX A;  1GGW A;  3OX5 A;  3EK8 A;  1VRK A;  1AVS A;  3LLE A;  2I2R E;  2Q91 A;  4AOM A;  2KI6 C;  1CDP A;  3AKA A;  3OX6 A;  3EVU A;  2F33 A;  1KSM A;  1CNP A;  4MSP A;  1CM4 A;  1NX2 A;  3OP0 A;  4MZJ A;  4MZL A;  2CT9 A;  2PRU A;  1FF1 A;  2GGM A;  2LVV A;  3SG5 A;  2HPS A;  1DF0 B;  1PVB A;  3KEV A;  1H4B A;  3D0Y B;  1J7P A;  1IH0 A;  5DKQ A;  1GQM A;  3ZNI A;  3DF0 B;  4ZCU A;  2PMY A;  1BR4 B;  1S5G Z;  1SNL A;  2LVI A;  2PVB A;  1IJ6 A;  1NX1 A;  3BUO B;  1IGV A;  2BKI B;  1QV0 A;  3AAJ A;  4FQO A;  2HQ8 A;  1DMO A;  1TCF A;  5ER4 X;  3IQO A;  2BKH B;  3I5F C;  2BCB A;  2JRF A;  2JT0 A;  1F4Q A;  2VRG A;  3O4Y A;  1B8L A;  1YRU B;  3NSK A;  1CFF A;  2JWW A;  3PLF B;  3KF9 A;  5CSJ A;  3QRX A;  4PE1 A;  2OS8 C;  1G8I A;  1FBV A;  2LAP A;  2F3Z A;  1XA5 A;  1E8A A;  1NUB A;  1MQ1 A;  3F45 A;  3NSL A;  2DOQ A;  2L4I A;  5CSI A;  2KI6 D;  3O78 A;  3SG2 A;  5I2Q A;  1TTX A;  1KFX S;  1YUU A;  1L2O C;  1KQM C;  2P6B B;  2H61 C;  3BUX B;  1CMG A;  1UUS A;  1CLB A;  3SG7 A;  5AAN A;  4CFQ A;  1L7Z A;  3ZWH A;  4GAO A;  4OCI A;  5AFP A;  1B8C A;  2LHI A;  1K94 A;  4BY5 A;  2PSR A;  1CFC A;  1IRJ A;  4TNC A;  1YUR A;  3JTD B;  3FWC A;  3PSR A;  4I5J A;  5K89 A;  1A2X A;  2Y1M A;  2JU0 A;  1SMG A;  1A75 B;  1N2D A;  1NP8 A;  1S6J A;  3FS7 A;  1UHH A;  1EH2 A;  1Y0V H;  1YX7 A;  1JUO A;  4P5O E;  2JT8 A;  4GGN A;  2LLU A;  1D1O A;  2ZN8 A;  1OZO A;  2JNF A;  3I5H C;  2M3W A;  4QJ3 B;  2KAX A;  4WQ3 A;  1C07 A;  3WHU B;  2AUC A;  5I2L A;  1JFJ A;  1TN4 A;  3LK1 A;  2M1U A;  3HCM A;  2WCE A;  3CR4 X;  1PVA A;  2HET A;  4GGF A;  5IBW A;  1EG4 A;  2K0J A;  4C0J A;  2K7B A;  3PN7 C;  1WRK A;  4QJ5 B;  1BR1 B;  1YVH A;  2FCE A;  2KDH A;  1SYM A;  1U5I A;  4WRI A;  5J3X A;  1Y1X A;  2KI4 C;  2MAZ A;  2ZND A;  1K95 A;  1BT6 A;  4P2Y B;  1J7O A;  4PE0 A;  1QJT A;  5GQQ C;  2A4J A;  1PSR A;  2KSP A;  3BUN B;  1BLQ A;  3OB1 B;  2K7D A;  2KFH A;  3EK4 A;  1WLM A;  1LA3 A;  1TOP A;  3EK7 A;  2JZI A;  5BPJ A;  4PHK A;  4XJK A;  2BBN A;  1SCV A;  1AHR A;  2O60 A;  1UHK A;  5CPV A;  2M49 B;  1RK9 A;  3I5G C;  1NCX A;  1CDM A;  1SK6 D;  2TN4 A;  2KFG A;  1KCY A;  1REC A;  4I5N B;  1NWD A;  1XFY O;  3BUM B;  3BOW A;  2K2F A;  2KGB C;  4AQJ A;  1YTZ C;  5TNC A;  2FOT A;  1BOD A;  1K9K A;  2ZRS A;  4R1E A;  1K9U A;  1F8H A;  1RRO A;  2LMV A;  1FW4 A;  1KFU S;  2BE6 A;  1S26 D;  1OMV A;  2BE4 A;  5PAL A;  1F70 A;  2E6W A;  3JVT B;  1WRZ A;  1QIW A;  2JQ6 A;  3I5F B;  2HQW A;  1Q80 A;  4ORB B;  2M29 A;  2ZFD A;  5I8N A;  1AK8 A;  2L50 A;  1ZOT B;  3NSI A;  2BEC A;  1DGV A;  1B47 A;  4MN0 A;  2OS8 B;  1DJG A;  2KQ6 A;  2LUC A;  2WND A;  3AKB A;  4YI8 A;  1IQ5 A;  3VGO A;  1KK7 Y;  1IQ3 A;  4NDB A;  2Y4Q A;  1S6I A;  1QAT A;  4CPV A;  3LL8 B;  1L2O B;  1KQM B;  1OMD A;  4JWQ A;  1GJY A;  2MJW B;  1TRF A;  2QAC A;  2Q4U A;  1V1G A;  4A4B A;  1JBA A;  1KWO C;  1XVJ A;  1CDL A;  2KQY A;  1BMO A;  3SG3 A;  1M45 A;  2WOS A;  2AMI A;  2CCM A;  3GK2 A;  3TDZ A;  1ZAC A;  3WNX B;  2JT3 A;  5KU1 A;  5G08 A;  4PDZ A;  4UPG A;  2K7O A;  3VRR A;  1DVI A;  2F2O A;  1SCM B;  3CWG A;  3E3R A;  4USL A;  2NXQ A;  5I2O A;  4N1G A;  5JJG A;  2JNX A;  1ZMZ A;  4ICB A;  2KBM A;  1BOC A;  4D1E A;  4MLW A;  3GK4 X;  1CB1 A;  2B1U A;  1C7V A;  5HKW A;  1ZFS A;  2KGR A;  3A4U B;  2FJU B;  4BY4 A;  4ORC B;  2JXL A;  1WDC C;  1M39 A;  1XK4 C;  1SL8 A;  2LE9 B;  3I5H B;  2M9G A;  3TUY B;  1CMF A;  3KHE A;  4GBA A;  1DJZ A;  1J1E A;  1U5I B;  1YUT A;  3HX4 A;  2LMU A;  4YGA A;  1J7Q A;  1EG3 A;  3VRQ A;  1CFD A;  3TDI A;  1KFU L;  2SAS A;  3DD4 A;  3AAK A;  3PAL A;  4FTG A;  1AUI B;  3SJS A;  5AER A;  3I5I B;  1CFP A;  1QX5 B;  1K2H A;  2IS9 A;  2M97 A;  2G9B A;  3A8R A;  3CLN A;  2NCP A;  3PN7 B;  4GGF C;  4ORA B;  1AJ5 A;  2CXJ A;  5ER5 A;  1XK4 A;  3CTN A;  2KHN A;  1QVI Y;  2KI4 B;  1M63 B;  2I94 A;  2EC6 C;  4CID A;  2LMT A;  1NIW A;  4Q04 A;  2MLE C;  1QTX A;  1UHI A;  3TS5 C;  1EXR A;  4HRG A;  1QS7 A;  4HRH A;  4DRW A; 
#chains in the Genus database with same CATH topology
 3RLZ A;  4GNK B;  1HT9 A;  1K90 D;  3K21 A;  1SR6 B;  3RZS A;  1F55 A;  2LLS A;  5CSN A;  2KBI A;  1MUX A;  1QIV A;  4E68 A;  2ZNE A;  3DF0 A;  5DKN A;  3ICB A;  4YRU A;  5JOL A;  2KAV A;  3EVR A;  2I18 A;  2R2I A;  3O2P A;  1JWD A;  1UHN A;  4A4C A;  2MRD A;  3LK0 A;  1H8B A;  2F8P A;  2QDI A;  4HRE E;  2LCP A;  5FYX A;  5B8I B;  4YI9 A;  1OMR A;  4I5L B;  1UP5 A;  4IJ7 A;  1DT7 B;  2M8U A;  4OVN F;  4JKT A;  3BFB A;  1QLK A;  4MEW A;  1KFX L;  3WXA A;  1YX8 A;  2BNX A;  3IQQ A;  2GTE A;  2K60 A;  2OTG B;  1R2U A;  3S0D A;  1RJV A;  1XFX O;  4DIR A;  2K7C A;  1SY9 A;  3WHT B;  1DJY A;  3EKJ A;  1DJW A;  2KFF A;  3BQ3 A;  1JFK A;  1XFR A;  3D74 A;  1QAS A;  4C0L A;  2FCD A;  1BF5 A;  2JC2 A;  4YGD B;  1N65 A;  4L9M A;  3VRO A;  1PK0 D;  1KK8 C;  2OPO A;  3B87 A;  3O6B A;  2WOR A;  4YGC B;  1V1F A;  1JC2 A;  5D7F A;  3TDU A;  4MVF A;  1YVL A;  1B8R A;  4MRX A;  3R72 A;  1SBJ A;  2Y1N A;  1JF2 A;  1KWO B;  1QX2 A;  4CLN A;  2LP3 A;  1A03 A;  3BJH A;  1DJI A;  2L4H A;  2H8V A;  1FPW A;  3V2L A;  2GGZ A;  1NX3 A;  1BG1 A;  2BL0 C;  3VB1 A;  1A4P A;  1NX0 A;  2BCX A;  3PM2 A;  4PHJ A;  2KYF A;  1NPQ A;  1SW8 A;  4MRY A;  1S1E A;  3BXK A;  1SL9 A;  4KYN A;  2F3Y A;  4NQG A;  1MXE A;  1ODB A;  2JXC A;  1DGU A;  1YUS A;  2I7A A;  1F71 A;  1KK7 Z;  1LKJ A;  3SG6 A;  1Y1A A;  5HLO A;  2ZN9 A;  4GUK A;  1R6P A;  3D10 A;  1WDC B;  1DJH A;  4M2O A;  1F54 A;  3R1P A;  2ZKM X;  1HQV A;  2WCF A;  1IWQ A;  1PSB A;  1MF8 B;  1QXP A;  2F2P A;  3C1V A;  2LLT A;  1NSH A;  4JQ0 D;  2LAN A;  5FI2 A;  5HKY A;  3GK1 A;  1C7W A;  1XO5 A;  2O5G A;  2PAS A;  1ALV A;  2LVJ A;  4JD9 A;  1MR8 A;  4YBH B;  1IJ5 A;  2CNP A;  1RWY A;  2QPT A;  3CGA A;  3M0W A;  3PFV A;  2BBM A;  4XYN A;  3SIA A;  4YGB B;  1B4C A;  4OV2 A;  1QWV A;  2HF5 A;  1QX7 A;  1K8U A;  3KPX A;  2WCM A;  3L4A A;  3S0F A;  1J7R A;  1S5G Y;  2L5X B;  3PM8 A;  4HSZ A;  4NDD A;  4M2P A;  3VRN A;  4U8D A;  2LNK A;  1LVC D;  5HKZ A;  4PHN A;  1YRT B;  2SCP A;  1G4Y R;  3DVJ A;  1XFW O;  2JOJ A;  1Z4H A;  1OZS A;  2M7N A;  4PE7 A;  3JVT C;  1OQP A;  1B9A A;  2EC6 B;  4CFR A;  4OZD A;  1W7J B;  2CBL A;  1MXL C;  1ALW A;  2QEH A;  3FIA A;  4M2Q A;  4DCK A;  2L0P A;  3L4L A;  3TS5 B;  4MZK A;  4PCW A;  2M0R A;  1M46 A;  2JPT A;  4OKH A;  4WQ2 A;  5KTY A;  1Y6W A;  1SL7 A;  2PQL A;  3S0A A;  3NSO A;  2V53 A;  3CDN A;  1LIN A;  2K8M B;  3H4S E;  3LCP C;  2GV5 A;  1AJ4 A;  4XJK B;  4ZCV A;  1AP4 A;  2L2E A;  1WRL A;  2AAO A;  2LP2 A;  5DKR A;  1B1G A;  1B7T Y;  1BU3 A;  1S3P A;  2L51 A;  1B7T Z;  1ORG A;  1TNP A;  4MBE A;  3TZ1 A;  3DVE A;  1MWN A;  4PHM A;  1QVI Z;  2KOT A;  3CR5 X;  2RGI A;  3BOW B;  1SRA A;  4IL1 A;  2M1K B;  1OE9 B;  1CM1 A;  1IKU A;  1CTR A;  1NYA A;  3CR2 A;  3SS5 A;  1SCM C;  2EHB A;  2G2B A;  1SKT A;  4NDC A;  1DF0 A;  1JF0 A;  1P28 A;  3FWB A;  2M7L A;  2K61 A;  2LC5 A;  1A29 A;  3D0Y A;  1WY9 A;  2JTZ A;  4PAL A;  2E30 A;  3EKH A;  1NCZ A;  4YGE B;  2COL B;  1KQV A;  2WC5 A;  3I5G B;  1J55 A;  1K96 A;  5D69 A;  2L2C A;  1NCY A;  3DVK A;  2H61 A;  1TNX A;  1UUR A;  3D78 A;  1S36 A;  4DUQ A;  2ISD A;  1WLZ A;  1OOF A;  1S6C A;  2FJY A;  3KO0 A;  3OB2 B;  1RFJ A;  3TUY C;  3MSE B;  1KK8 B;  2WC8 A;  1OSA A;  2P70 A;  2MHH A;  1QLS A;  1YR5 A;  1SPY A;  4HRH A;  1TIZ A;  2MLF C;  2L98 A;  2NZ0 A;  3JTD C;  1EJ3 A;  1TNW A;  4N5X A;  5AEQ A;  1LS8 A;  3I5I C;  5HYD A;  2WCB A;  1XFZ O;  2ZRT A;  4QJ4 B;  1M31 A;  4F0Z B;  1CLM A;  2WCJ A;  3OBV A;  1IG5 A;  1JSA A;  3VRP A;  5HL1 A;  1PAL A;  1UWO A;  2BL0 B;  5CSF A;  2MBX A;  2LM5 A;  3EVV A;  1W9Z A;  4GPL B;  4AQI A;  1K93 D;  1XYD A;  2K2A A;  2PAL A;  4JPZ B;  3SIB A;  5KSZ A;  3PAT A;  1GGZ A;  1DTL A;  3IF7 A;  3RM1 A;  1TCO B;  1X02 A;  1LXF C;  3N7H A;  2LV7 A;  2KAY A;  1FI6 A;  3BUW B;  1CDN A;  1MHO A;  1UHJ A;  2WCL A;  1XFV O;  2MA2 A;  3L47 A;  2BCA A;  1F4O A;  1OOJ A;  1KSO A;  1SR6 C;  2LVK A;  2LHL A;  3NXA A;  5HLV A;  1A75 A;  4C0K A;  1Y1U A;  2BAP A;  2JUL A;  1DJX A;  2NCO A;  3OHM B;  2WC6 A;  2CTN A;  2JTT A;  1K9P A;  3SG4 A;  1LA0 A;  1PRW A;  2D8N A;  2KYC A;  4PE4 A;  4DS7 A;  1W7I B;  4ETO A;  1EL4 A;  1CLL A;  1N0Y A;  2H2K A;  1DC1 A;  1RTP 1;  1CKK A;  4OR9 B;  5AXI A;  2Y5I A;  1PUL A;  3CZT X;  1ZUZ A;  5F6T A;  2NLN A;  1BJF A;  4N1F A;  3GOF A;  1XFU O;  4I5K A;  2EGD A;  3DVM A;  1FI5 A;  3CS1 A;  3BYA A;  1G33 A;  2OTG C;  4GFT A;  1J1D A;  3DXL A;  5DIC A;  2KNE A;  1TNQ A;  1QV1 A;  2LUX A;  1GGW A;  3OX5 A;  3EK8 A;  1VRK A;  1AVS A;  3LLE A;  2I2R E;  2Q91 A;  3R1V A;  4INW A;  4AOM A;  2KI6 C;  2L5Y A;  1CDP A;  1OOI X;  3AKA A;  3OX6 A;  5FI6 A;  3EVU A;  2F33 A;  3Q8I A;  1KSM A;  1CNP A;  4MSP A;  1CM4 A;  1NX2 A;  3OP0 A;  4MZJ A;  4MZL A;  1DEL A;  2CT9 A;  2PRU A;  1FF1 A;  2GGM A;  2LVV A;  3SG5 A;  2HPS A;  2QEO A;  1DF0 B;  1PVB A;  3KEV A;  3FE8 A;  1H4B A;  3D0Y B;  1J7P A;  1IH0 A;  5DKQ A;  1OW4 A;  2KLE A;  1GQM A;  3ZNI A;  3DF0 B;  4ZCU A;  2PMY A;  1BR4 B;  1S5G Z;  1SNL A;  2LVI A;  2PVB A;  3R1O A;  1IJ6 A;  1NX1 A;  3BUO B;  1IGV A;  2BKI B;  1QV0 A;  3AAJ A;  4FQO A;  2HQ8 A;  3S0G A;  1DMO A;  1TCF A;  5ER4 X;  3IQO A;  3B6X A;  2BKH B;  3I5F C;  2BCB A;  3S0B A;  2JRF A;  3D73 A;  2JT0 A;  1F4Q A;  2VRG A;  3O4Y A;  1B8L A;  1YRU B;  3NSK A;  1CFF A;  2JWW A;  3PLF B;  3NHT A;  3KF9 A;  5CSJ A;  3QRX A;  4PE1 A;  2OS8 C;  1G8I A;  1FBV A;  2LAP A;  2F3Z A;  1XA5 A;  3UNW A;  1E8A A;  1NUB A;  3CAB A;  4F7F A;  1MQ1 A;  3DZT A;  3F45 A;  3NSL A;  2DOQ A;  1T14 A;  2L4I A;  2KI6 D;  5CSI A;  5FI7 A;  3O78 A;  3UO9 A;  3SG2 A;  5I2Q A;  1TTX A;  1KFX S;  1YUU A;  1L2O C;  1KQM C;  2P6B B;  2H61 C;  3B7A A;  3BUX B;  1CMG A;  1UUS A;  1C3Y A;  1CLB A;  3SG7 A;  5AAN A;  4CFQ A;  1L7Z A;  3ZWH A;  4GAO A;  4OCI A;  3O4X A;  5AFP A;  1B8C A;  2LHI A;  1K94 A;  5D3O A;  4BY5 A;  2PSR A;  1CFC A;  1IRJ A;  4TNC A;  1YUR A;  3JTD B;  3FWC A;  3PSR A;  4I5J A;  5K89 A;  1A2X A;  2Y1M A;  2JU0 A;  1SMG A;  5I94 A;  1A75 B;  1N2D A;  1NP8 A;  1S6J A;  3FS7 A;  2QEB A;  1UHH A;  3SS4 A;  3BFA A;  1EH2 A;  1Y0V H;  1YX7 A;  1JUO A;  4P5O E;  2JT8 A;  4GGN A;  2LLU A;  1D1O A;  3OGN A;  2ZN8 A;  1OZO A;  2JNF A;  3I5H C;  2M3W A;  4QJ3 B;  2KAX A;  4WQ3 A;  1C07 A;  3WHU B;  2AUC A;  5I2L A;  1JFJ A;  1IIO A;  1TN4 A;  3D76 A;  3LK1 A;  1Z2C B;  2M1U A;  3HCM A;  2WCE A;  3CR4 X;  1PVA A;  2HET A;  4GGF A;  5IBW A;  1EG4 A;  2K0J A;  4C0J A;  2K7B A;  3PN7 C;  1WRK A;  4QJ5 B;  1BR1 B;  1YVH A;  2FCE A;  2KDH A;  1SYM A;  1U5I A;  4WRI A;  5J3X A;  1Y1X A;  2KI4 C;  2MAZ A;  2ZND A;  1K95 A;  1BT6 A;  4P2Y B;  1J7O A;  4PE0 A;  1QJT A;  3S0E A;  3SS3 A;  3FE9 A;  5GQQ C;  1OOG A;  1TUJ A;  2A4J A;  3DY9 A;  1PSR A;  2KSP A;  3BUN B;  3K1E A;  1BLQ A;  3OB1 B;  4INX A;  2K7D A;  2KFH A;  3EK4 A;  1WLM A;  1LA3 A;  1TOP A;  3EK7 A;  2JZI A;  5BPJ A;  4PHK A;  4XJK A;  2BBN A;  1SCV A;  1AHR A;  2YGU A;  2O60 A;  1UHK A;  1DEK A;  5CPV A;  2M49 B;  1TUZ A;  1TWO A;  1RK9 A;  3I5G C;  1NCX A;  1CDM A;  1SK6 D;  2TN4 A;  2KFG A;  1KCY A;  4PT1 A;  1REC A;  4I5N B;  3FE6 A;  1NWD A;  1XFY O;  3BUM B;  3EG5 B;  2PYQ A;  3BOW A;  2K2F A;  2KGB C;  4AQJ A;  1YTZ C;  5TNC A;  2FOT A;  1BOD A;  1K9K A;  2ZRS A;  3IVT A;  1K9U A;  4R1E A;  1C3Z A;  1RRO A;  2LMV A;  1F8H A;  1FW4 A;  1KFU S;  2BE6 A;  1S26 D;  3B88 A;  1OMV A;  2BE4 A;  5PAL A;  2QEV A;  1F70 A;  2E6W A;  3JVT B;  1WRZ A;  1QIW A;  2JQ6 A;  3I5F B;  2HQW A;  1Q80 A;  3DYE A;  2M29 A;  2ZFD A;  4ORB B;  5I8N A;  1AK8 A;  2L50 A;  1ZOT B;  3NSI A;  2BEC A;  1DGV A;  3CZ1 A;  1B47 A;  4FQT A;  4MN0 A;  2OS8 B;  1DJG A;  2KQ6 A;  2LUC A;  2WND A;  3AKB A;  4YI8 A;  1IQ5 A;  3VGO A;  1KK7 Y;  3QME A;  4NDB A;  1IQ3 A;  2Y4Q A;  1S6I A;  1QAT A;  4CPV A;  3LL8 B;  3D77 A;  1L2O B;  1KQM B;  1OMD A;  3CZ2 A;  1GJY A;  4JWQ A;  2MJW B;  1TRF A;  5EL2 A;  1SSE B;  2Q4U A;  1V1G A;  2QAC A;  2WCK A;  4A4B A;  1JBA A;  1KWO C;  1XVJ A;  1CDL A;  2KQY A;  1BMO A;  3SG3 A;  1DQE A;  1M45 A;  2WOS A;  2AMI A;  2CCM A;  3GK2 A;  3TDZ A;  1ZAC A;  3WNX B;  2JT3 A;  2ERB A;  5KU1 A;  5G08 A;  4PDZ A;  2P71 A;  4UPG A;  2K7O A;  3VRR A;  1DVI A;  2F2O A;  1SCM B;  3CWG A;  3E3R A;  4USL A;  2NXQ A;  5I2O A;  4N1G A;  2KPH A;  5JJG A;  2JNX A;  1ZMZ A;  4ICB A;  2KBM A;  3D75 A;  1BOC A;  4D1E A;  4MLW A;  3GK4 X;  1CB1 A;  2B1U A;  1C7V A;  5HKW A;  1GM0 A;  1ZFS A;  2KGR A;  2KLD A;  3A4U B;  2FJU B;  4BY4 A;  3PJI A;  4ORC B;  2JXL A;  1WDC C;  1M39 A;  1XK4 C;  1SL8 A;  2LE9 B;  3I5H B;  2M9G A;  3TUY B;  1CMF A;  3KHE A;  4GBA A;  1DJZ A;  1J1E A;  1U5I B;  1YUT A;  3HX4 A;  2LMU A;  4YGA A;  3NGV A;  1J7Q A;  1EG3 A;  3VRQ A;  1CFD A;  3TDI A;  1KFU L;  2SAS A;  3DD4 A;  3AAK A;  3PAL A;  4FTG A;  1AUI B;  3SJS A;  5AER A;  3I5I B;  1CFP A;  1QX5 B;  1K2H A;  1OOH A;  2IS9 A;  2M97 A;  3CYZ A;  2G9B A;  3A8R A;  3CLN A;  2NCP A;  3PN7 B;  4GGF C;  4ORA B;  1AJ5 A;  2CXJ A;  5ER5 A;  1XK4 A;  3CTN A;  3B86 A;  3NHI A;  3BFH A;  2KHN A;  1QVI Y;  2KI4 B;  1M63 B;  2I94 A;  2EC6 C;  2JPO A;  4CID A;  2WCH A;  2LMT A;  1NIW A;  4Q04 A;  2MLE C;  1QTX A;  1UHI A;  3TS5 C;  1EXR A;  4HRG A;  1QS7 A;  3CZ0 A;  4DRW A; 
#chains in the Genus database with same CATH homology
 3RLZ A;  4GNK B;  1HT9 A;  1K90 D;  3K21 A;  1SR6 B;  1F55 A;  2LLS A;  5CSN A;  2KBI A;  1MUX A;  1QIV A;  4E68 A;  2ZNE A;  3DF0 A;  5DKN A;  3ICB A;  4YRU A;  5JOL A;  2KAV A;  3EVR A;  2I18 A;  2R2I A;  3O2P A;  1JWD A;  1UHN A;  4A4C A;  2MRD A;  3LK0 A;  1H8B A;  2F8P A;  4HRE E;  2LCP A;  5FYX A;  5B8I B;  4YI9 A;  1OMR A;  4I5L B;  1UP5 A;  1DT7 B;  2M8U A;  4OVN F;  1QLK A;  4MEW A;  1KFX L;  3WXA A;  1YX8 A;  3IQQ A;  2OTG B;  1R2U A;  1RJV A;  1XFX O;  4DIR A;  2K7C A;  1SY9 A;  3WHT B;  1DJY A;  3EKJ A;  1DJW A;  2KFF A;  3BQ3 A;  1JFK A;  1QAS A;  4C0L A;  2FCD A;  1BF5 A;  2JC2 A;  4YGD B;  1N65 A;  4L9M A;  3VRO A;  1PK0 D;  1KK8 C;  2OPO A;  3O6B A;  2WOR A;  4YGC B;  1V1F A;  1JC2 A;  5D7F A;  3TDU A;  4MVF A;  1YVL A;  1B8R A;  4MRX A;  1SBJ A;  2Y1N A;  1JF2 A;  1KWO B;  1QX2 A;  4CLN A;  2LP3 A;  1A03 A;  1DJI A;  2L4H A;  1FPW A;  2GGZ A;  1NX3 A;  1BG1 A;  2BL0 C;  1A4P A;  1NX0 A;  2BCX A;  4PHJ A;  2KYF A;  1NPQ A;  1SW8 A;  4MRY A;  1S1E A;  3BXK A;  1SL9 A;  2F3Y A;  4NQG A;  1MXE A;  1ODB A;  2JXC A;  1DGU A;  1YUS A;  2I7A A;  1F71 A;  1KK7 Z;  1LKJ A;  3SG6 A;  1Y1A A;  5HLO A;  2ZN9 A;  4GUK A;  1R6P A;  3D10 A;  1WDC B;  1DJH A;  4M2O A;  1F54 A;  2ZKM X;  1HQV A;  2WCF A;  1IWQ A;  1PSB A;  1MF8 B;  1QXP A;  2F2P A;  3C1V A;  2LLT A;  1NSH A;  4JQ0 D;  2LAN A;  5HKY A;  3GK1 A;  1C7W A;  1XO5 A;  2O5G A;  2PAS A;  1ALV A;  2LVJ A;  1MR8 A;  4YBH B;  1IJ5 A;  2CNP A;  1RWY A;  2QPT A;  3CGA A;  3M0W A;  3PFV A;  2BBM A;  4XYN A;  3SIA A;  4YGB B;  1B4C A;  4OV2 A;  2HF5 A;  1QX7 A;  1K8U A;  3KPX A;  1J7R A;  1S5G Y;  2L5X B;  3PM8 A;  4HSZ A;  4NDD A;  4M2P A;  3VRN A;  4U8D A;  2LNK A;  1LVC D;  5HKZ A;  4PHN A;  1YRT B;  2SCP A;  1G4Y R;  3DVJ A;  1XFW O;  2JOJ A;  1OZS A;  2M7N A;  4PE7 A;  3JVT C;  1OQP A;  1B9A A;  2EC6 B;  4CFR A;  1W7J B;  2CBL A;  1MXL C;  1ALW A;  3FIA A;  4M2Q A;  4DCK A;  2L0P A;  3TS5 B;  4MZK A;  4PCW A;  2M0R A;  1M46 A;  2JPT A;  4OKH A;  4WQ2 A;  5KTY A;  1Y6W A;  1SL7 A;  3NSO A;  2V53 A;  1LIN A;  2K8M B;  3H4S E;  3LCP C;  2GV5 A;  1AJ4 A;  4XJK B;  4ZCV A;  1AP4 A;  2L2E A;  1WRL A;  2AAO A;  2LP2 A;  5DKR A;  1B1G A;  1B7T Y;  1BU3 A;  1S3P A;  2L51 A;  1B7T Z;  1TNP A;  4MBE A;  3TZ1 A;  3DVE A;  1MWN A;  4PHM A;  1QVI Z;  2KOT A;  3CR5 X;  2RGI A;  3BOW B;  1SRA A;  4IL1 A;  2M1K B;  1OE9 B;  1CM1 A;  1IKU A;  1CTR A;  1NYA A;  3CR2 A;  1SCM C;  2EHB A;  2G2B A;  1SKT A;  4NDC A;  1DF0 A;  1JF0 A;  3FWB A;  2M7L A;  2K61 A;  2LC5 A;  1A29 A;  3D0Y A;  1WY9 A;  2JTZ A;  4PAL A;  2E30 A;  3EKH A;  1NCZ A;  4YGE B;  2COL B;  1KQV A;  3I5G B;  1J55 A;  1K96 A;  5D69 A;  1NCY A;  3DVK A;  2H61 A;  1TNX A;  1UUR A;  4DUQ A;  1S36 A;  2ISD A;  1WLZ A;  1S6C A;  3KO0 A;  3OB2 B;  1RFJ A;  3TUY C;  3MSE B;  1KK8 B;  2WC8 A;  1OSA A;  2MHH A;  1QLS A;  1YR5 A;  1SPY A;  1TIZ A;  2MLF C;  2L98 A;  2NZ0 A;  3JTD C;  1EJ3 A;  1TNW A;  4N5X A;  5AEQ A;  3I5I C;  5HYD A;  2WCB A;  1XFZ O;  2ZRT A;  4QJ4 B;  1M31 A;  4F0Z B;  1CLM A;  1JSA A;  1IG5 A;  3VRP A;  1PAL A;  1UWO A;  2BL0 B;  5CSF A;  2MBX A;  2LM5 A;  3EVV A;  4GPL B;  4AQI A;  1K93 D;  1XYD A;  2K2A A;  2PAL A;  4JPZ B;  3SIB A;  5KSZ A;  3PAT A;  1GGZ A;  1DTL A;  3IF7 A;  3RM1 A;  1TCO B;  1X02 A;  1LXF C;  2LV7 A;  2KAY A;  1FI6 A;  3BUW B;  1CDN A;  1MHO A;  1UHJ A;  1XFV O;  2MA2 A;  2BCA A;  1F4O A;  1OOJ A;  1KSO A;  1SR6 C;  2LVK A;  2LHL A;  3NXA A;  5HLV A;  1A75 A;  4C0K A;  1Y1U A;  2JUL A;  1DJX A;  2NCO A;  3OHM B;  2CTN A;  2JTT A;  1K9P A;  3SG4 A;  1LA0 A;  1PRW A;  2D8N A;  2KYC A;  4PE4 A;  4DS7 A;  1W7I B;  4ETO A;  1EL4 A;  1CLL A;  1N0Y A;  2H2K A;  1RTP 1;  1CKK A;  4OR9 B;  5AXI A;  2Y5I A;  1PUL A;  3CZT X;  1ZUZ A;  5F6T A;  2NLN A;  1BJF A;  4N1F A;  3GOF A;  1XFU O;  4I5K A;  2EGD A;  3DVM A;  1FI5 A;  3CS1 A;  3BYA A;  1G33 A;  2OTG C;  4GFT A;  1J1D A;  2KNE A;  1TNQ A;  1QV1 A;  2LUX A;  1GGW A;  3OX5 A;  3EK8 A;  1VRK A;  1AVS A;  3LLE A;  2I2R E;  2Q91 A;  4AOM A;  2KI6 C;  1CDP A;  3AKA A;  3OX6 A;  3EVU A;  2F33 A;  1KSM A;  1CNP A;  4MSP A;  1CM4 A;  1NX2 A;  3OP0 A;  4MZJ A;  4MZL A;  2CT9 A;  2PRU A;  1FF1 A;  2GGM A;  2LVV A;  3SG5 A;  2HPS A;  1DF0 B;  1PVB A;  3KEV A;  1H4B A;  3D0Y B;  1J7P A;  1IH0 A;  5DKQ A;  1GQM A;  3ZNI A;  3DF0 B;  4ZCU A;  2PMY A;  1BR4 B;  1S5G Z;  1SNL A;  2LVI A;  2PVB A;  1IJ6 A;  1NX1 A;  3BUO B;  1IGV A;  2BKI B;  1QV0 A;  3AAJ A;  4FQO A;  2HQ8 A;  1DMO A;  1TCF A;  5ER4 X;  3IQO A;  2BKH B;  3I5F C;  2BCB A;  2JRF A;  2JT0 A;  1F4Q A;  2VRG A;  3O4Y A;  1B8L A;  1YRU B;  3NSK A;  1CFF A;  2JWW A;  3PLF B;  3KF9 A;  5CSJ A;  3QRX A;  4PE1 A;  2OS8 C;  1G8I A;  1FBV A;  2LAP A;  2F3Z A;  1XA5 A;  1E8A A;  1NUB A;  1MQ1 A;  3F45 A;  3NSL A;  2DOQ A;  2L4I A;  5CSI A;  2KI6 D;  3O78 A;  3SG2 A;  5I2Q A;  1TTX A;  1KFX S;  1YUU A;  1L2O C;  1KQM C;  2P6B B;  2H61 C;  3BUX B;  1CMG A;  1UUS A;  1CLB A;  3SG7 A;  5AAN A;  4CFQ A;  1L7Z A;  3ZWH A;  4GAO A;  4OCI A;  5AFP A;  1B8C A;  2LHI A;  1K94 A;  4BY5 A;  2PSR A;  1CFC A;  1IRJ A;  4TNC A;  1YUR A;  3JTD B;  3FWC A;  3PSR A;  4I5J A;  5K89 A;  1A2X A;  2Y1M A;  2JU0 A;  1SMG A;  1A75 B;  1N2D A;  1NP8 A;  1S6J A;  3FS7 A;  1UHH A;  1EH2 A;  1Y0V H;  1YX7 A;  1JUO A;  4P5O E;  2JT8 A;  4GGN A;  2LLU A;  1D1O A;  2ZN8 A;  1OZO A;  2JNF A;  3I5H C;  2M3W A;  4QJ3 B;  2KAX A;  4WQ3 A;  1C07 A;  3WHU B;  2AUC A;  5I2L A;  1JFJ A;  1TN4 A;  3LK1 A;  2M1U A;  3HCM A;  2WCE A;  3CR4 X;  1PVA A;  2HET A;  4GGF A;  5IBW A;  1EG4 A;  2K0J A;  4C0J A;  2K7B A;  3PN7 C;  1WRK A;  4QJ5 B;  1BR1 B;  1YVH A;  2FCE A;  2KDH A;  1SYM A;  1U5I A;  4WRI A;  5J3X A;  1Y1X A;  2KI4 C;  2MAZ A;  2ZND A;  1K95 A;  1BT6 A;  4P2Y B;  1J7O A;  4PE0 A;  1QJT A;  5GQQ C;  2A4J A;  1PSR A;  2KSP A;  3BUN B;  1BLQ A;  3OB1 B;  2K7D A;  2KFH A;  3EK4 A;  1WLM A;  1LA3 A;  1TOP A;  3EK7 A;  2JZI A;  5BPJ A;  4PHK A;  4XJK A;  2BBN A;  1SCV A;  1AHR A;  2O60 A;  1UHK A;  5CPV A;  2M49 B;  1RK9 A;  3I5G C;  1NCX A;  1CDM A;  1SK6 D;  2TN4 A;  2KFG A;  1KCY A;  1REC A;  4I5N B;  1NWD A;  1XFY O;  3BUM B;  3BOW A;  2K2F A;  2KGB C;  4AQJ A;  1YTZ C;  5TNC A;  2FOT A;  1BOD A;  1K9K A;  2ZRS A;  4R1E A;  1K9U A;  1F8H A;  1RRO A;  2LMV A;  1FW4 A;  1KFU S;  2BE6 A;  1S26 D;  1OMV A;  2BE4 A;  5PAL A;  1F70 A;  2E6W A;  3JVT B;  1WRZ A;  1QIW A;  2JQ6 A;  3I5F B;  2HQW A;  1Q80 A;  4ORB B;  2M29 A;  2ZFD A;  5I8N A;  1AK8 A;  2L50 A;  1ZOT B;  3NSI A;  2BEC A;  1DGV A;  1B47 A;  4MN0 A;  2OS8 B;  1DJG A;  2KQ6 A;  2LUC A;  2WND A;  3AKB A;  4YI8 A;  1IQ5 A;  3VGO A;  1KK7 Y;  1IQ3 A;  4NDB A;  2Y4Q A;  1S6I A;  1QAT A;  4CPV A;  3LL8 B;  1L2O B;  1KQM B;  1OMD A;  4JWQ A;  1GJY A;  2MJW B;  1TRF A;  2QAC A;  2Q4U A;  1V1G A;  4A4B A;  1JBA A;  1KWO C;  1XVJ A;  1CDL A;  2KQY A;  1BMO A;  3SG3 A;  1M45 A;  2WOS A;  2AMI A;  2CCM A;  3GK2 A;  3TDZ A;  1ZAC A;  3WNX B;  2JT3 A;  5KU1 A;  5G08 A;  4PDZ A;  4UPG A;  2K7O A;  3VRR A;  1DVI A;  2F2O A;  1SCM B;  3CWG A;  3E3R A;  4USL A;  2NXQ A;  5I2O A;  4N1G A;  5JJG A;  2JNX A;  1ZMZ A;  4ICB A;  2KBM A;  1BOC A;  4D1E A;  4MLW A;  3GK4 X;  1CB1 A;  2B1U A;  1C7V A;  5HKW A;  1ZFS A;  2KGR A;  3A4U B;  2FJU B;  4BY4 A;  4ORC B;  2JXL A;  1WDC C;  1M39 A;  1XK4 C;  1SL8 A;  2LE9 B;  3I5H B;  2M9G A;  3TUY B;  1CMF A;  3KHE A;  4GBA A;  1DJZ A;  1J1E A;  1U5I B;  1YUT A;  3HX4 A;  2LMU A;  4YGA A;  1J7Q A;  1EG3 A;  3VRQ A;  1CFD A;  3TDI A;  1KFU L;  2SAS A;  3DD4 A;  3AAK A;  3PAL A;  4FTG A;  1AUI B;  3SJS A;  5AER A;  3I5I B;  1CFP A;  1QX5 B;  1K2H A;  2IS9 A;  2M97 A;  2G9B A;  3A8R A;  3CLN A;  2NCP A;  3PN7 B;  4GGF C;  4ORA B;  1AJ5 A;  2CXJ A;  5ER5 A;  1XK4 A;  3CTN A;  2KHN A;  1QVI Y;  2KI4 B;  1M63 B;  2I94 A;  2EC6 C;  4CID A;  2LMT A;  1NIW A;  4Q04 A;  2MLE C;  1QTX A;  1UHI A;  3TS5 C;  1EXR A;  4HRG A;  1QS7 A;  4HRH A;  4DRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...