5CSIA

S100b-rsk1 crystal structure a'
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
GSHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein S100-B
publication title Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5csiA00
1U5IB 4MRXA 1TIZA 2JOJA 3SG4A 3ZWHA 2M29A 4FQOA 2PMYA 3NSOA 2CXJA 1TOPA 1Y0VH 4A4CA 2ZRTA 1XFZO 2H61C 2F2OA 1DF0A 1K93D 2HETA 4NDDA 4N1GA 2FOTA 1B9AA 4PHNA 1FF1A 1J7OA 1AJ5A 5TNCA 2PASA 5AERA 2WCEA 4Q04A 4F0ZB 1JFKA 1KFXS 3GK1A 1HT9A 3DF0B 4OR9B 1BF5A 1IQ3A 3E3RA 1EJ3A 2AAOA 1TTXA 3D10A 4YGAA 2KGRA 3OHMB 3TS5B 3TS5C 1LVCD 2E30A 3EKJA 2KBIA 1PSBA 2CBLA 1GQMA 5DKRA 1LXFC 1W7IB 3DVJA 1MF8B 1J7QA 2HQWA 1PRWA 1QJTA 5CSIA 3NSIA 5IBWA 4GAOA 2L98A 1JWDA 1KFUL 1NCXA 1S6JA 4PE1A 3VRQA 3SJSA 4MZJA 5K89A 4MBEA 1CMGA 2L4HA 1AUIB 5BPJA 1TN4A 2F3ZA 3OB2B 4HREE 3LK0A 1NX3A 5CSFA 1R2UA 1NX1A 3C1VA 5CSJA 4M2OA 1G33A 2JRFA 4PDZA 2KI4B 2KI4C 3VRRA 1K9UA 1CM4A 1M39A 2BE6A 1LINA 2KBMA 1DJXA 1YRTB 2LVKA 5FYXA 1S26D 1ALVA 1S36A 2V53A 4PE0A 2WORA 1OQPA 5B8IB 1A03A 4JPZB 1HQVA 1QVIZ 3CZTX 2BE4A 2LHIA 1RWYA 1DJIA 1NWDA 1XVJA 2BBNA 2R2IA 3AKBA 4WQ3A 1S1EA 2M97A 4XYNA 3PLFB 1WY9A 2PALA 2LP2A 1ODBA 1OZOA 1QIWA 1KK7Z 3A8RA 1A4PA 3EK7A 1NPQA 4OKHA 4D1EA 1W7JB 1OMRA 5J3XA 2VRGA 4BY4A 3I5IB 3I5IC 1UHJA 4PHJA 2K7BA 2P6BB 1CFCA 3JTDC 4L9MA 2K7CA 1RK9A 4GFTA 1KSOA 4ORCB 1CLBA 3KO0A 1K9KA 4R1EA 2OPOA 1JC2A 1BJFA 1E8AA 2F3YA 4MZKA 4ICBA 2JU0A 2OTGC 2L5XB 3IQQA 1K95A 2KAXA 1AJ4A 2BBMA 2LHLA 4YGDB 1XYDA 1EG3A 2PRUA 1GGWA 1K94A 2MRDA 1J1EA 4I5LB 1DVIA 3BUWB 4YGBB 1SYMA 1SR6C 4QJ5B 2LLUA 1IH0A 3CGAA 1ALWA 1BR4B 3AAKA 3SG7A 1XK4C 4WRIA 2QPTA 2LC5A 4YI8A 4CIDA 2NZ0A 2JULA 1WRZA 2SASA 1A75B 1CDPA 3KF9A 3O4YA 1DGVA 2JTTA 2K2FA 3HX4A 3SG2A 1YTZC 2CT9A 3WNXB 2D8NA 2LV7A 1UHHA 5AANA 3FS7A 2PSRA 2EC6C 1AHRA 1ZOTB 1WRLA 1KWOB 3D0YB 1KWOC 1TNWA 1V1FA 2KI6D 3TUYB 5I2OA 1NX0A 1DJZA 1S5GZ 2HF5A 5HKYA 1L2OC 1YUTA 1QLKA 5KSZA 4HRGA 3DVMA 4JQ0D 2COLB 5D69A 1M46A 2ZNDA 1NIWA 5I8NA 1X02A 5ER5A 1JSAA 1UHIA 2KFGA 1CLLA 3BUNB 1AK8A 1R6PA 1CFPA 2JWWA 2M49B 1YX7A 2ZKMX 1BR1B 1M45A 4N5XA 2LAPA 4GNKB 2G9BA 2ZN8A 3VRNA 1LKJA 2SCPA 2CCMA 3EVUA 1EL4A 1RJVA 2L51A 2PVBA 1CM1A 3JVTB 4N1FA 1QVIY 2F8PA 2I7AA 2L50A 5ER4X 3RM1A 1IGVA 5KTYA 2LANA 1UHKA 4QJ4B 3CS1A 4OVNF 5AFPA 4NDBA 1DJGA 4CFQA 4YGEB 1SBJA 3BOWA 1KK7Y 1YUSA 4AQJA 2KQYA 4QJ3B 1RECA 4GGFA 2M1UA 4ZCUA 2F33A 1Y1XA 2CTNA 2WC8A 3GOFA 2L2EA 5GQQC 1F71A 1CFFA 4UPGA 2BKHB 2KFHA 4GPLB 1TNPA 2F2PA 1ZMZA 5DKQA 2K8MB 3DVKA 4FTGA 2LMUA 3HCMA 2KOTA 1BODA 1BG1A 1ZACA 2LE9B 1N2DA 1U5IA 1DT7B 1SNLA 1CDMA 4GGNA 2NXQA 4U8DA 2JT8A 4XJKB 3EK8A 2K61A 1OOJA 2H61A 1RROA 3TDIA 4I5KA 3EVVA 4ETOA 3KPXA 2LMVA 1M63B 1SK6D 1XFVO 2KNEA 2MJWB 1BLQA 3GK2A 3I5FB 3I5FC 3DF0A 4MSPA 1PULA 1S6IA 1SW8A 4PE7A 3VRPA 2G2BA 1H4BA 2JC2A 2ZRSA 4DUQA 1RTP1 2BCXA 2EHBA 2ISDA 1YVLA 4ZCVA 2BCAA 1K96A 1YURA 4YGCB 2M1KB 1YR5A 1CTRA 2L4IA 4MLWA 1CDNA 1PVAA 1QS7A 3SG5A 1CKKA 1S5GY 1Y1UA 2KAVA 4DCKA 2WCBA 3NSLA 1JF0A 2M3WA 4MVFA 2JXLA 1SRAA 3FWBA 1V1GA 2LMTA 1KFXL 1SKTA 4DS7A 1VRKA 3SG3A 1XFYO 1JUOA 2I18A 1MUXA 1BT6A 2LNKA 1GJYA 3LLEA 1WLMA 1EG4A 2AMIA 2O5GA 2AUCA 1F55A 1SCMB 2ZFDA 1SCMC 3WHTB 4TNCA 1XFWO 3OB1B 1C7WA 3OX6A 2GGZA 1YVHA 1K8UA 1WDCB 1WDCC 4I5JA 5AEQA 1OMVA 1CNPA 2LM5A 4OCIA 1OMDA 1OE9B 4PALA 2TN4A 1PK0D 2K7DA 3LL8B 2JT0A 1DJWA 1Y6WA 3M0WA 2FJUB 5G08A 1BOCA 1KQVA 2BL0B 1OZSA 1IQ5A 3AAJA 1A29A 3O78A 2LUXA 1CLMA 1MWNA 1DF0B 3VROA 1BU3A 1J7PA 1B1GA 1KFUS 1J55A 2Q4UA 2LLSA 1ZUZA 2WNDA 3TUYC 1QXPA 2NCPA 3TDZA 3H4SE 3PN7B 3PN7C 2WCFA 3AKAA 1XO5A 4ORBB 1KK8B 1KK8C 2M8UA 4YRUA 5F6TA 5CPVA 1MXLC 4USLA 4JWQA 1EXRA 4IL1A 1QX7A 1SL7A 1K90D 1QV0A 1SCVA 2RGIA 3CTNA 3PM8A 4NDCA 3BUOB 5HLOA 1LA0A 2JNXA 1TNQA 5HLVA 1TNXA 5D7FA 4GBAA 4MRYA 2JNFA 4E68A 2OS8B 2ZN9A 2OS8C 3FWCA 5KU1A 2M0RA 2L0PA 4AOMA 2ZNEA 1MXEA 2KYFA 4NQGA 3JVTC 3PFVA 3CWGA 1H8BA 2JTZA 1NCZA 5JJGA 3MSEB 1C7VA 1CMFA 2KYCA 1XK4A 1B8RA 1PALA 1YUUA 3SIBA 3BUXB 3CR5X 1S6CA 1PVBA 1A75A 3TDUA 3IF7A 2WOSA 1NYAA 1MR8A 2LVIA 1D1OA 3K21A 3O6BA 2A4JA 3D0YA 2MAZA 4YI9A 1J1DA 2BECA 4DRWA 3F45A 2Y5IA 2M7NA 3SG6A 3NSKA 1DJHA 3PSRA 1N0YA 1B8CA 1UHNA 3A4UB 1QV1A 2BCBA 3OX5A 4AQIA 3GK4X 3TZ1A 4C0LA 2IS9A 4C0KA 4CFRA 5HYDA 1IG5A 4PHMA 1FBVA 1FPWA 1AP4A 1JF2A 3DVEA 1B7TZ 1IJ6A 3SIAA 1QATA 1XFXO 4CPVA 1B4CA 1TRFA 3PATA 1UWOA 3LK1A 2LVVA 2K0JA 3KEVA 3BXKA 3CR4X 2KFFA 2Y4QA 1MQ1A 1B8LA 1CDLA 1QASA 3WXAA 1QTXA 2K7OA 2JT3A 1L7ZA 4C0JA 1KCYA 2B1UA 2Q91A 3QRXA 1K9PA 2QACA 1DTLA 3EK4A 3OP0A 5HKZA 1QIVA 1Q80A 2FCEA 1OSAA 1TCFA 1XFUO 3EKHA 3I5GB 3I5GC 4M2PA 1RFJA 1YRUB 2MLFC 4BY5A 2LP3A 1B47A 4WQ2A 5I2QA 4I5NB 2M7LA 1LA3A 2JPTA 1G8IA 1DMOA 4HSZA 5PALA 4OV2A 1A2XA 2JZIA 2KGBC 1DJYA 1ZFSA 2NCOA 1J7RA 1Y1AA 2MHHA 2EGDA 3CLNA 1BMOA 1SY9A 1EH2A 1QX2A 4P2YB 1AVSA 3RLZA 1IWQA 1NP8A 1KSMA 1QX5B 2FCDA 2NLNA 1IRJA 2O60A 2KI6C 3ICBA 3JTDB 1KQMB 1C07A 1KQMC 2Y1MA 1DGUA 4PE4A 1NX2A 2GV5A 4P5OE 4MEWA 4XJKA 2DOQA 1YX8A 2JXCA 3VGOA 2KHNA 3KHEA 5AXIA 3BYAA 1NUBA 2LLTA 2OTGB 2GGMA 4A4BA 1F4OA 2CNPA 1IKUA 2BL0C 1SPYA 3EVRA 5I2LA 1SMGA 2I2RE 3O2PA 1IJ5A 1JFJA 1F4QA 5DKNA 2HPSA 4MN0A 2KDHA 3NXAA 1QLSA 1JBAA 1F70A 5HKWA 2JQ6A 1NSHA 1PSRA 1SR6B 1XA5A 2K2AA 4DIRA 1CFDA 4MZLA 2H2KA 1S3PA 1SL9A 2BKIB 1WRKA 2I94A 2KSPA 1UUSA 4CLNA 3DD4A 1MHOA 3BOWB 3BUMB 3I5HB 3I5HC 2HQ8A 1SL8A 2LCPA 2LVJA 1NCYA 4PHKA 1N65A 4GGFC 4ORAB 3IQOA 1FW4A 2M9GA 2KQ6A 1UP5A 1TCOB 4GUKA 1M31A 2EC6B 2Y1NA 5CSNA 1K2HA 5JOLA 3PALA 3WHUB 1G4YR 1WLZA 3ZNIA 2KAYA 1B7TY 4YBHB 2MLEC 4HRHA 1CB1A 1FI5A 3LCPC 1F54A 1L2OB 1UURA 2MBXA 1FI6A 1F8HA 4M2QA 2E6WA 3CR2A 3BQ3A 4PCWA 1GGZA 2MA2A 3FIAA 2LUCA
chains in the Genus database with same CATH superfamily
1U5IB 4JKTA 4MRXA 1TIZA 2JOJA 3SG4A 3ZWHA 2M29A 4FQOA 2PMYA 1TUJA 3NSOA 2CXJA 1TOPA 1Y0VH 4A4CA 1Z2CB 2ZRTA 1XFZO 2H61C 2F2OA 1DF0A 1K93D 2HETA 4NDDA 1XFRA 4N1GA 2FOTA 1B9AA 4PHNA 1FF1A 1J7OA 1AJ5A 5TNCA 2PASA 5AERA 2WCEA 4Q04A 4F0ZB 1JFKA 1KFXS 3GK1A 1HT9A 3DF0B 4OR9B 1BF5A 1IQ3A 3D76A 3E3RA 1EJ3A 4INXA 2AAOA 1TTXA 3D10A 4YGAA 2KGRA 3OHMB 3TS5B 3TS5C 3SS5A 1LVCD 2E30A 3EKJA 2KBIA 1PSBA 2CBLA 1GQMA 5DKRA 1LXFC 1W7IB 3PM2A 3DVJA 1MF8B 1J7QA 2HQWA 1PRWA 1QJTA 5CSIA 3NSIA 5IBWA 4GAOA 2K60A 2L98A 1JWDA 1KFUL 1NCXA 1S6JA 4PE1A 3VRQA 3S0GA 4MZJA 3SJSA 4MBEA 5K89A 1CMGA 2L4HA 1AUIB 5BPJA 1TN4A 2F3ZA 2JPOA 3DY9A 3OB2B 4HREE 3LK0A 1NX3A 5CSFA 1R2UA 1NX1A 3C1VA 3RZSA 5CSJA 1ORGA 4M2OA 1G33A 2JRFA 4PDZA 2KI4B 2KI4C 3VRRA 1K9UA 1CM4A 1M39A 2BE6A 1LINA 2KBMA 1DJXA 1YRTB 2LVKA 5FYXA 1S26D 1ALVA 1S36A 2V53A 2GTEA 2WORA 1OQPA 4PE0A 5B8IB 4JPZB 1A03A 1HQVA 1QVIZ 3CZTX 2BE4A 2LHIA 1RWYA 1DJIA 1NWDA 1XVJA 2BBNA 2R2IA 3AKBA 3L47A 4WQ3A 1S1EA 2M97A 4XYNA 3PLFB 1WY9A 2PALA 2LP2A 1ODBA 1OZOA 1QIWA 1KK7Z 3A8RA 1A4PA 3EK7A 1NPQA 4OKHA 4JD9A 4D1EA 1DC1A 1W7JB 1OMRA 5J3XA 2VRGA 4BY4A 3I5IB 3I5IC 1UHJA 4PHJA 2K7BA 3S0FA 2P6BB 1CFCA 3D78A 1T14A 3B86A 3JTDC 4L9MA 2K7CA 1RK9A 4GFTA 1KSOA 4ORCB 1CLBA 3KO0A 1K9KA 4R1EA 2OPOA 4OZDA 1BJFA 1JC2A 2P70A 3S0BA 1E8AA 2F3YA 4MZKA 4ICBA 2JU0A 2OTGC 2L5XB 3IQQA 1K95A 3D77A 3NHTA 3IVTA 2KAXA 1AJ4A 1DQEA 3QMEA 2BBMA 2LHLA 4YGDB 1XYDA 1EG3A 2PRUA 5D3OA 1GGWA 1K94A 2MRDA 1J1EA 4I5LB 1DVIA 3BUWB 4YGBB 1SYMA 1SR6C 4QJ5B 2LLUA 1IH0A 3CGAA 1ALWA 1BR4B 2QEVA 3AAKA 3SG7A 1XK4C 4WRIA 2QPTA 2LC5A 4YI8A 4CIDA 2NZ0A 2JULA 1WRZA 2SASA 5FI7A 1A75B 1CDPA 3KF9A 3O4YA 1DGVA 2JTTA 2K2FA 3HX4A 3SG2A 1YTZC 2CT9A 3WNXB 2D8NA 1LS8A 1UHHA 2LV7A 5AANA 3FS7A 2PSRA 2EC6C 2WCJA 1AHRA 1ZOTB 1WRLA 1KWOB 3D0YB 1KWOC 1TNWA 1V1FA 2KI6D 3TUYB 5I2OA 1NX0A 1DJZA 1S5GZ 2PQLA 2HF5A 5HKYA 2KLEA 1L2OC 1YUTA 1QLKA 5KSZA 4HRGA 3DVMA 4JQ0D 2COLB 5D69A 1C3YA 1M46A 2ZNDA 1NIWA 5I8NA 1X02A 5ER5A 1JSAA 1UHIA 2KFGA 1CLLA 3BUNB 1AK8A 4F7FA 1R6PA 1CFPA 5FI2A 2JWWA 2M49B 1YX7A 2ZKMX 3CZ2A 1BR1B 1M45A 4N5XA 2LAPA 4GNKB 2G9BA 2ZN8A 3FE6A 1LKJA 2SCPA 2CCMA 3BJHA 3EVUA 3PJIA 3VRNA 1EL4A 1RJVA 2L51A 2PVBA 1CM1A 3JVTB 4N1FA 1QVIY 2F8PA 2I7AA 2L50A 3R1OA 5ER4X 1IGVA 3RM1A 2LANA 5KTYA 1UHKA 4QJ4B 3CS1A 4OVNF 5AFPA 4NDBA 1DJGA 4CFQA 4YGEB 1SBJA 3BOWA 1KK7Y 1YUSA 4AQJA 2KQYA 3BFBA 4QJ3B 1RECA 4GGFA 2M1UA 2QDIA 4ZCUA 3Q8IA 2F33A 1Y1XA 2CTNA 2WC8A 3GOFA 2L2EA 1QWVA 5GQQC 2WCLA 2PYQA 1F71A 1CFFA 1OOIX 4UPGA 2BKHB 2KFHA 4GPLB 1TNPA 1SSEB 1ZMZA 2F2PA 2K8MB 3CZ0A 5DKQA 3DVKA 4FTGA 2LMUA 3HCMA 2KOTA 1BODA 1BG1A 3OGNA 1ZACA 2LE9B 1N2DA 1U5IA 1DT7B 1SNLA 1CDMA 4GGNA 1P28A 2KPHA 2NXQA 4U8DA 2JT8A 3S0EA 4XJKB 3EK8A 2K61A 2KLDA 3V2LA 1OOJA 2H61A 1RROA 3TDIA 4I5KA 3EVVA 4ETOA 3KPXA 3O4XA 2LMVA 1M63B 1SK6D 1XFVO 2KNEA 2MJWB 1BLQA 2L2CA 3GK2A 3I5FB 3I5FC 3DF0A 4MSPA 1PULA 1S6IA 1SW8A 4PE7A 3VRPA 2G2BA 1H4BA 2JC2A 2ZRSA 4DUQA 4INWA 1RTP1 2BCXA 2EHBA 2ISDA 1YVLA 4ZCVA 5DICA 2BCAA 1K96A 1YURA 4PT1A 4YGCB 2M1KB 1YR5A 2P71A 3B87A 1CTRA 2L4IA 4MLWA 2QEOA 1PVAA 1QS7A 3SG5A 1CDNA 1CKKA 1S5GY 1Y1UA 2KAVA 4DCKA 1Z4HA 2WCBA 3NSLA 1JF0A 2M3WA 4MVFA 2JXLA 1SRAA 3FWBA 3K1EA 1V1GA 2LMTA 1KFXL 5HL1A 1SKTA 4DS7A 1VRKA 3SG3A 1XFYO 1JUOA 2I18A 3BFHA 1MUXA 1BT6A 2LNKA 1GJYA 3LLEA 1WLMA 1EG4A 2AMIA 2O5GA 2AUCA 1F55A 1SCMB 2ZFDA 1SCMC 3WHTB 4TNCA 1XFWO 3B6XA 3OB1B 1C7WA 1OOGA 2WCHA 2GGZA 1YVHA 1K8UA 1WDCB 3OX6A 1WDCC 4I5JA 5AEQA 1OMVA 2H8VA 2LM5A 2WC6A 1OMDA 1OE9B 2BNXA 4OCIA 2TN4A 1PK0D 4PALA 2K7DA 3LL8B 2JT0A 1DJWA 1Y6WA 2QEHA 2FJUB 3M0WA 5G08A 1BOCA 1KQVA 2BL0B 1OZSA 1IQ5A 3AAJA 1A29A 3O78A 2LUXA 1CLMA 1MWNA 1DF0B 3B7AA 1BU3A 3B88A 3VROA 1J7PA 1B1GA 1OW4A 1KFUS 1J55A 2Q4UA 2LLSA 1ZUZA 2WNDA 3TUYC 1QXPA 2NCPA 3TDZA 3H4SE 3PN7B 3PN7C 3R72A 2WCFA 3AKAA 1XO5A 4ORBB 1KK8B 1KK8C 2M8UA 4YRUA 5F6TA 5CPVA 3UO9A 1MXLC 4USLA 4JWQA 1EXRA 3SS4A 4IL1A 1QX7A 1SL7A 1K90D 1QV0A 1SCVA 2RGIA 3CTNA 3PM8A 4NDCA 3BUOB 5HLOA 1LA0A 2JNXA 1TNQA 5HLVA 1TNXA 5D7FA 3R1VA 4GBAA 4MRYA 2JNFA 3CDNA 4IJ7A 4E68A 2OS8B 2ZN9A 2OS8C 3FWCA 3NGVA 5KU1A 2M0RA 2L0PA 4AOMA 1DEKA 2FJYA 2ZNEA 3DXLA 1MXEA 2KYFA 3D75A 4NQGA 3JVTC 3PFVA 3CWGA 1H8BA 2JTZA 3SS3A 1NCZA 5JJGA 3S0AA 4KYNA 3MSEB 1C7VA 1CMFA 2KYCA 1XK4A 1B8RA 1YUUA 1OOFA 1PALA 3SIBA 3BUXB 3CR5X 1S6CA 1PVBA 1A75A 3TDUA 3IF7A 2WOSA 1NYAA 1MR8A 2YGUA 2LVIA 1D1OA 5FI6A 3K21A 1DELA 3O6BA 2A4JA 3D0YA 2MAZA 4YI9A 1J1DA 2BECA 4DRWA 3EG5B 3F45A 2Y5IA 2M7NA 3SG6A 3NSKA 1DJHA 3PSRA 1N0YA 3VB1A 1B8CA 1UHNA 3A4UB 1QV1A 2BCBA 3OX5A 4AQIA 3GK4X 3TZ1A 4C0LA 2IS9A 4C0KA 4CFRA 5HYDA 1IG5A 4PHMA 1FBVA 1FPWA 1AP4A 1OOHA 1JF2A 3DVEA 3S0DA 1B7TZ 1IJ6A 3L4LA 3SIAA 2WCKA 1QATA 1XFXO 4CPVA 3R1PA 1TRFA 5EL2A 4FQTA 1B4CA 3FE8A 2QEBA 3PATA 1UWOA 3LK1A 2LVVA 2K0JA 3KEVA 3BXKA 3CR4X 2KFFA 1IIOA 2Y4QA 1MQ1A 3L4AA 1B8LA 1CDLA 1QASA 3WXAA 1CNPA 1QTXA 2K7OA 2JT3A 3CYZA 1L7ZA 3FE9A 4C0JA 1KCYA 2B1UA 2Q91A 3QRXA 1K9PA 2QACA 1DTLA 3CABA 3EK4A 3OP0A 5HKZA 1QIVA 1Q80A 2FCEA 1OSAA 1TCFA 1XFUO 3EKHA 3I5GB 3I5GC 4M2PA 1RFJA 1YRUB 2MLFC 4BY5A 2LP3A 1B47A 3CZ1A 4WQ2A 5I2QA 1TUZA 4I5NB 2M7LA 1LA3A 2JPTA 1G8IA 1DMOA 4HSZA 5PALA 3BFAA 1C3ZA 4OV2A 1A2XA 2JZIA 2KGBC 2ERBA 1DJYA 1ZFSA 2NCOA 1J7RA 1Y1AA 2MHHA 2EGDA 3CLNA 1BMOA 1SY9A 5I94A 1QX2A 1EH2A 4P2YB 1AVSA 3RLZA 1IWQA 1NP8A 1KSMA 1QX5B 2FCDA 2NLNA 2WCMA 1IRJA 2O60A 2KI6C 3ICBA 3JTDB 1KQMB 1C07A 1KQMC 2Y1MA 1DGUA 4PE4A 1NX2A 3DZTA 2GV5A 4P5OE 4MEWA 4XJKA 2DOQA 1YX8A 2JXCA 3VGOA 2KHNA 3KHEA 5AXIA 3BYAA 1NUBA 2LLTA 2OTGB 2GGMA 4A4BA 1F4OA 2CNPA 1IKUA 2BL0C 1SPYA 3EVRA 5I2LA 1SMGA 2I2RE 3O2PA 1IJ5A 1JFJA 1F4QA 5DKNA 2HPSA 4MN0A 2KDHA 3NHIA 3NXAA 1QLSA 1JBAA 1F70A 5HKWA 2JQ6A 1NSHA 3OBVA 1PSRA 1SR6B 1XA5A 1W9ZA 2K2AA 4DIRA 1CFDA 4MZLA 2H2KA 3D73A 3D74A 1S3PA 1SL9A 2BKIB 1WRKA 2I94A 2KSPA 1UUSA 2BAPA 4CLNA 3DD4A 1MHOA 3BOWB 3BUMB 3I5HB 3I5HC 2HQ8A 1SL8A 2LCPA 2LVJA 3UNWA 1NCYA 4PHKA 1N65A 4GGFC 4ORAB 3IQOA 2L5YA 1FW4A 2M9GA 3DYEA 2KQ6A 1UP5A 1TCOB 4GUKA 1M31A 2EC6B 2Y1NA 1GM0A 5CSNA 1K2HA 5JOLA 3PALA 3WHUB 1G4YR 1WLZA 3ZNIA 2KAYA 1B7TY 4YBHB 2MLEC 4HRHA 3N7HA 1CB1A 1FI5A 3LCPC 1F54A 1L2OB 1TWOA 1UURA 2MBXA 1FI6A 2WC5A 1F8HA 4M2QA 2E6WA 3CR2A 3BQ3A 4PCWA 1GGZA 2MA2A 3FIAA 2LUCA
chains in the Genus database with same CATH topology
1U5IB 4MRXA 1TIZA 2JOJA 3SG4A 3ZWHA 2M29A 4FQOA 2PMYA 3NSOA 2CXJA 1TOPA 1Y0VH 4A4CA 2ZRTA 1XFZO 2H61C 2F2OA 1DF0A 1K93D 2HETA 4NDDA 4N1GA 2FOTA 1B9AA 4PHNA 1FF1A 1J7OA 1AJ5A 5TNCA 2PASA 5AERA 2WCEA 4Q04A 4F0ZB 1JFKA 1KFXS 3GK1A 1HT9A 3DF0B 4OR9B 1BF5A 1IQ3A 3E3RA 1EJ3A 2AAOA 1TTXA 3D10A 4YGAA 2KGRA 3OHMB 3TS5B 3TS5C 1LVCD 2E30A 3EKJA 2KBIA 1PSBA 2CBLA 1GQMA 5DKRA 1LXFC 1W7IB 3DVJA 1MF8B 1J7QA 2HQWA 1PRWA 1QJTA 5CSIA 3NSIA 5IBWA 4GAOA 2L98A 1JWDA 1KFUL 1NCXA 1S6JA 4PE1A 3VRQA 3SJSA 4MZJA 5K89A 4MBEA 1CMGA 2L4HA 1AUIB 5BPJA 1TN4A 2F3ZA 3OB2B 4HREE 3LK0A 1NX3A 5CSFA 1R2UA 1NX1A 3C1VA 5CSJA 4M2OA 1G33A 2JRFA 4PDZA 2KI4B 2KI4C 3VRRA 1K9UA 1CM4A 1M39A 2BE6A 1LINA 2KBMA 1DJXA 1YRTB 2LVKA 5FYXA 1S26D 1ALVA 1S36A 2V53A 4PE0A 2WORA 1OQPA 5B8IB 1A03A 4JPZB 1HQVA 1QVIZ 3CZTX 2BE4A 2LHIA 1RWYA 1DJIA 1NWDA 1XVJA 2BBNA 2R2IA 3AKBA 4WQ3A 1S1EA 2M97A 4XYNA 3PLFB 1WY9A 2PALA 2LP2A 1ODBA 1OZOA 1QIWA 1KK7Z 3A8RA 1A4PA 3EK7A 1NPQA 4OKHA 4D1EA 1W7JB 1OMRA 5J3XA 2VRGA 4BY4A 3I5IB 3I5IC 1UHJA 4PHJA 2K7BA 2P6BB 1CFCA 3JTDC 4L9MA 2K7CA 1RK9A 4GFTA 1KSOA 4ORCB 1CLBA 3KO0A 1K9KA 4R1EA 2OPOA 1JC2A 1BJFA 1E8AA 2F3YA 4MZKA 4ICBA 2JU0A 2OTGC 2L5XB 3IQQA 1K95A 2KAXA 1AJ4A 2BBMA 2LHLA 4YGDB 1XYDA 1EG3A 2PRUA 1GGWA 1K94A 2MRDA 1J1EA 4I5LB 1DVIA 3BUWB 4YGBB 1SYMA 1SR6C 4QJ5B 2LLUA 1IH0A 3CGAA 1ALWA 1BR4B 3AAKA 3SG7A 1XK4C 4WRIA 2QPTA 2LC5A 4YI8A 4CIDA 2NZ0A 2JULA 1WRZA 2SASA 1A75B 1CDPA 3KF9A 3O4YA 1DGVA 2JTTA 2K2FA 3HX4A 3SG2A 1YTZC 2CT9A 3WNXB 2D8NA 2LV7A 1UHHA 5AANA 3FS7A 2PSRA 2EC6C 1AHRA 1ZOTB 1WRLA 1KWOB 3D0YB 1KWOC 1TNWA 1V1FA 2KI6D 3TUYB 5I2OA 1NX0A 1DJZA 1S5GZ 2HF5A 5HKYA 1L2OC 1YUTA 1QLKA 5KSZA 4HRGA 3DVMA 4JQ0D 2COLB 5D69A 1M46A 2ZNDA 1NIWA 5I8NA 1X02A 5ER5A 1JSAA 1UHIA 2KFGA 1CLLA 3BUNB 1AK8A 1R6PA 1CFPA 2JWWA 2M49B 1YX7A 2ZKMX 1BR1B 1M45A 4N5XA 2LAPA 4GNKB 2G9BA 2ZN8A 3VRNA 1LKJA 2SCPA 2CCMA 3EVUA 1EL4A 1RJVA 2L51A 2PVBA 1CM1A 3JVTB 4N1FA 1QVIY 2F8PA 2I7AA 2L50A 5ER4X 3RM1A 1IGVA 5KTYA 2LANA 1UHKA 4QJ4B 3CS1A 4OVNF 5AFPA 4NDBA 1DJGA 4CFQA 4YGEB 1SBJA 3BOWA 1KK7Y 1YUSA 4AQJA 2KQYA 4QJ3B 1RECA 4GGFA 2M1UA 4ZCUA 2F33A 1Y1XA 2CTNA 2WC8A 3GOFA 2L2EA 5GQQC 1F71A 1CFFA 4UPGA 2BKHB 2KFHA 4GPLB 1TNPA 2F2PA 1ZMZA 5DKQA 2K8MB 3DVKA 4FTGA 2LMUA 3HCMA 2KOTA 1BODA 1BG1A 1ZACA 2LE9B 1N2DA 1U5IA 1DT7B 1SNLA 1CDMA 4GGNA 2NXQA 4U8DA 2JT8A 4XJKB 3EK8A 2K61A 1OOJA 2H61A 1RROA 3TDIA 4I5KA 3EVVA 4ETOA 3KPXA 2LMVA 1M63B 1SK6D 1XFVO 2KNEA 2MJWB 1BLQA 3GK2A 3I5FB 3I5FC 3DF0A 4MSPA 1PULA 1S6IA 1SW8A 4PE7A 3VRPA 2G2BA 1H4BA 2JC2A 2ZRSA 4DUQA 1RTP1 2BCXA 2EHBA 2ISDA 1YVLA 4ZCVA 2BCAA 1K96A 1YURA 4YGCB 2M1KB 1YR5A 1CTRA 2L4IA 4MLWA 1CDNA 1PVAA 1QS7A 3SG5A 1CKKA 1S5GY 1Y1UA 2KAVA 4DCKA 2WCBA 3NSLA 1JF0A 2M3WA 4MVFA 2JXLA 1SRAA 3FWBA 1V1GA 2LMTA 1KFXL 1SKTA 4DS7A 1VRKA 3SG3A 1XFYO 1JUOA 2I18A 1MUXA 1BT6A 2LNKA 1GJYA 3LLEA 1WLMA 1EG4A 2AMIA 2O5GA 2AUCA 1F55A 1SCMB 2ZFDA 1SCMC 3WHTB 4TNCA 1XFWO 3OB1B 1C7WA 3OX6A 2GGZA 1YVHA 1K8UA 1WDCB 1WDCC 4I5JA 5AEQA 1OMVA 1CNPA 2LM5A 4OCIA 1OMDA 1OE9B 4PALA 2TN4A 1PK0D 2K7DA 3LL8B 2JT0A 1DJWA 1Y6WA 3M0WA 2FJUB 5G08A 1BOCA 1KQVA 2BL0B 1OZSA 1IQ5A 3AAJA 1A29A 3O78A 2LUXA 1CLMA 1MWNA 1DF0B 3VROA 1BU3A 1J7PA 1B1GA 1KFUS 1J55A 2Q4UA 2LLSA 1ZUZA 2WNDA 3TUYC 1QXPA 2NCPA 3TDZA 3H4SE 3PN7B 3PN7C 2WCFA 3AKAA 1XO5A 4ORBB 1KK8B 1KK8C 2M8UA 4YRUA 5F6TA 5CPVA 1MXLC 4USLA 4JWQA 1EXRA 4IL1A 1QX7A 1SL7A 1K90D 1QV0A 1SCVA 2RGIA 3CTNA 3PM8A 4NDCA 3BUOB 5HLOA 1LA0A 2JNXA 1TNQA 5HLVA 1TNXA 5D7FA 4GBAA 4MRYA 2JNFA 4E68A 2OS8B 2ZN9A 2OS8C 3FWCA 5KU1A 2M0RA 2L0PA 4AOMA 2ZNEA 1MXEA 2KYFA 4NQGA 3JVTC 3PFVA 3CWGA 1H8BA 2JTZA 1NCZA 5JJGA 3MSEB 1C7VA 1CMFA 2KYCA 1XK4A 1B8RA 1PALA 1YUUA 3SIBA 3BUXB 3CR5X 1S6CA 1PVBA 1A75A 3TDUA 3IF7A 2WOSA 1NYAA 1MR8A 2LVIA 1D1OA 3K21A 3O6BA 2A4JA 3D0YA 2MAZA 4YI9A 1J1DA 2BECA 4DRWA 3F45A 2Y5IA 2M7NA 3SG6A 3NSKA 1DJHA 3PSRA 1N0YA 1B8CA 1UHNA 3A4UB 1QV1A 2BCBA 3OX5A 4AQIA 3GK4X 3TZ1A 4C0LA 2IS9A 4C0KA 4CFRA 5HYDA 1IG5A 4PHMA 1FBVA 1FPWA 1AP4A 1JF2A 3DVEA 1B7TZ 1IJ6A 3SIAA 1QATA 1XFXO 4CPVA 1B4CA 1TRFA 3PATA 1UWOA 3LK1A 2LVVA 2K0JA 3KEVA 3BXKA 3CR4X 2KFFA 2Y4QA 1MQ1A 1B8LA 1CDLA 1QASA 3WXAA 1QTXA 2K7OA 2JT3A 1L7ZA 4C0JA 1KCYA 2B1UA 2Q91A 3QRXA 1K9PA 2QACA 1DTLA 3EK4A 3OP0A 5HKZA 1QIVA 1Q80A 2FCEA 1OSAA 1TCFA 1XFUO 3EKHA 3I5GB 3I5GC 4M2PA 1RFJA 1YRUB 2MLFC 4BY5A 2LP3A 1B47A 4WQ2A 5I2QA 4I5NB 2M7LA 1LA3A 2JPTA 1G8IA 1DMOA 4HSZA 5PALA 4OV2A 1A2XA 2JZIA 2KGBC 1DJYA 1ZFSA 2NCOA 1J7RA 1Y1AA 2MHHA 2EGDA 3CLNA 1BMOA 1SY9A 1EH2A 1QX2A 4P2YB 1AVSA 3RLZA 1IWQA 1NP8A 1KSMA 1QX5B 2FCDA 2NLNA 1IRJA 2O60A 2KI6C 3ICBA 3JTDB 1KQMB 1C07A 1KQMC 2Y1MA 1DGUA 4PE4A 1NX2A 2GV5A 4P5OE 4MEWA 4XJKA 2DOQA 1YX8A 2JXCA 3VGOA 2KHNA 3KHEA 5AXIA 3BYAA 1NUBA 2LLTA 2OTGB 2GGMA 4A4BA 1F4OA 2CNPA 1IKUA 2BL0C 1SPYA 3EVRA 5I2LA 1SMGA 2I2RE 3O2PA 1IJ5A 1JFJA 1F4QA 5DKNA 2HPSA 4MN0A 2KDHA 3NXAA 1QLSA 1JBAA 1F70A 5HKWA 2JQ6A 1NSHA 1PSRA 1SR6B 1XA5A 2K2AA 4DIRA 1CFDA 4MZLA 2H2KA 1S3PA 1SL9A 2BKIB 1WRKA 2I94A 2KSPA 1UUSA 4CLNA 3DD4A 1MHOA 3BOWB 3BUMB 3I5HB 3I5HC 2HQ8A 1SL8A 2LCPA 2LVJA 1NCYA 4PHKA 1N65A 4GGFC 4ORAB 3IQOA 1FW4A 2M9GA 2KQ6A 1UP5A 1TCOB 4GUKA 1M31A 2EC6B 2Y1NA 5CSNA 1K2HA 5JOLA 3PALA 3WHUB 1G4YR 1WLZA 3ZNIA 2KAYA 1B7TY 4YBHB 2MLEC 4HRHA 1CB1A 1FI5A 3LCPC 1F54A 1L2OB 1UURA 2MBXA 1FI6A 1F8HA 4M2QA 2E6WA 3CR2A 3BQ3A 4PCWA 1GGZA 2MA2A 3FIAA 2LUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5I B;  4MRX A;  1TIZ A;  2JOJ A;  3SG4 A;  3ZWH A;  2M29 A;  4FQO A;  2PMY A;  3NSO A;  2CXJ A;  1TOP A;  1Y0V H;  4A4C A;  2ZRT A;  1XFZ O;  2H61 C;  2F2O A;  1DF0 A;  1K93 D;  2HET A;  4NDD A;  4N1G A;  2FOT A;  1B9A A;  4PHN A;  1FF1 A;  1J7O A;  1AJ5 A;  5TNC A;  2PAS A;  5AER A;  2WCE A;  4Q04 A;  4F0Z B;  1JFK A;  1KFX S;  3GK1 A;  1HT9 A;  3DF0 B;  4OR9 B;  1BF5 A;  1IQ3 A;  3E3R A;  1EJ3 A;  2AAO A;  1TTX A;  3D10 A;  4YGA A;  2KGR A;  3OHM B;  3TS5 B;  3TS5 C;  1LVC D;  2E30 A;  3EKJ A;  2KBI A;  1PSB A;  2CBL A;  1GQM A;  5DKR A;  1LXF C;  1W7I B;  3DVJ A;  1MF8 B;  1J7Q A;  2HQW A;  1PRW A;  1QJT A;  5CSI A;  3NSI A;  5IBW A;  4GAO A;  2L98 A;  1JWD A;  1KFU L;  1NCX A;  1S6J A;  4PE1 A;  3VRQ A;  3SJS A;  4MZJ A;  5K89 A;  4MBE A;  1CMG A;  2L4H A;  1AUI B;  5BPJ A;  1TN4 A;  2F3Z A;  3OB2 B;  4HRE E;  3LK0 A;  1NX3 A;  5CSF A;  1R2U A;  1NX1 A;  3C1V A;  5CSJ A;  4M2O A;  1G33 A;  2JRF A;  4PDZ A;  2KI4 B;  2KI4 C;  3VRR A;  1K9U A;  1CM4 A;  1M39 A;  2BE6 A;  1LIN A;  2KBM A;  1DJX A;  1YRT B;  2LVK A;  5FYX A;  1S26 D;  1ALV A;  1S36 A;  2V53 A;  4PE0 A;  2WOR A;  1OQP A;  5B8I B;  1A03 A;  4JPZ B;  1HQV A;  1QVI Z;  3CZT X;  2BE4 A;  2LHI A;  1RWY A;  1DJI A;  1NWD A;  1XVJ A;  2BBN A;  2R2I A;  3AKB A;  4WQ3 A;  1S1E A;  2M97 A;  4XYN A;  3PLF B;  1WY9 A;  2PAL A;  2LP2 A;  1ODB A;  1OZO A;  1QIW A;  1KK7 Z;  3A8R A;  1A4P A;  3EK7 A;  1NPQ A;  4OKH A;  4D1E A;  1W7J B;  1OMR A;  5J3X A;  2VRG A;  4BY4 A;  3I5I B;  3I5I C;  1UHJ A;  4PHJ A;  2K7B A;  2P6B B;  1CFC A;  3JTD C;  4L9M A;  2K7C A;  1RK9 A;  4GFT A;  1KSO A;  4ORC B;  1CLB A;  3KO0 A;  1K9K A;  4R1E A;  2OPO A;  1JC2 A;  1BJF A;  1E8A A;  2F3Y A;  4MZK A;  4ICB A;  2JU0 A;  2OTG C;  2L5X B;  3IQQ A;  1K95 A;  2KAX A;  1AJ4 A;  2BBM A;  2LHL A;  4YGD B;  1XYD A;  1EG3 A;  2PRU A;  1GGW A;  1K94 A;  2MRD A;  1J1E A;  4I5L B;  1DVI A;  3BUW B;  4YGB B;  1SYM A;  1SR6 C;  4QJ5 B;  2LLU A;  1IH0 A;  3CGA A;  1ALW A;  1BR4 B;  3AAK A;  3SG7 A;  1XK4 C;  4WRI A;  2QPT A;  2LC5 A;  4YI8 A;  4CID A;  2NZ0 A;  2JUL A;  1WRZ A;  2SAS A;  1A75 B;  1CDP A;  3KF9 A;  3O4Y A;  1DGV A;  2JTT A;  2K2F A;  3HX4 A;  3SG2 A;  1YTZ C;  2CT9 A;  3WNX B;  2D8N A;  2LV7 A;  1UHH A;  5AAN A;  3FS7 A;  2PSR A;  2EC6 C;  1AHR A;  1ZOT B;  1WRL A;  1KWO B;  3D0Y B;  1KWO C;  1TNW A;  1V1F A;  2KI6 D;  3TUY B;  5I2O A;  1NX0 A;  1DJZ A;  1S5G Z;  2HF5 A;  5HKY A;  1L2O C;  1YUT A;  1QLK A;  5KSZ A;  4HRG A;  3DVM A;  4JQ0 D;  2COL B;  5D69 A;  1M46 A;  2ZND A;  1NIW A;  5I8N A;  1X02 A;  5ER5 A;  1JSA A;  1UHI A;  2KFG A;  1CLL A;  3BUN B;  1AK8 A;  1R6P A;  1CFP A;  2JWW A;  2M49 B;  1YX7 A;  2ZKM X;  1BR1 B;  1M45 A;  4N5X A;  2LAP A;  4GNK B;  2G9B A;  2ZN8 A;  3VRN A;  1LKJ A;  2SCP A;  2CCM A;  3EVU A;  1EL4 A;  1RJV A;  2L51 A;  2PVB A;  1CM1 A;  3JVT B;  4N1F A;  1QVI Y;  2F8P A;  2I7A A;  2L50 A;  5ER4 X;  3RM1 A;  1IGV A;  5KTY A;  2LAN A;  1UHK A;  4QJ4 B;  3CS1 A;  4OVN F;  5AFP A;  4NDB A;  1DJG A;  4CFQ A;  4YGE B;  1SBJ A;  3BOW A;  1KK7 Y;  1YUS A;  4AQJ A;  2KQY A;  4QJ3 B;  1REC A;  4GGF A;  2M1U A;  4ZCU A;  2F33 A;  1Y1X A;  2CTN A;  2WC8 A;  3GOF A;  2L2E A;  5GQQ C;  1F71 A;  1CFF A;  4UPG A;  2BKH B;  2KFH A;  4GPL B;  1TNP A;  2F2P A;  1ZMZ A;  5DKQ A;  2K8M B;  3DVK A;  4FTG A;  2LMU A;  3HCM A;  2KOT A;  1BOD A;  1BG1 A;  1ZAC A;  2LE9 B;  1N2D A;  1U5I A;  1DT7 B;  1SNL A;  1CDM A;  4GGN A;  2NXQ A;  4U8D A;  2JT8 A;  4XJK B;  3EK8 A;  2K61 A;  1OOJ A;  2H61 A;  1RRO A;  3TDI A;  4I5K A;  3EVV A;  4ETO A;  3KPX A;  2LMV A;  1M63 B;  1SK6 D;  1XFV O;  2KNE A;  2MJW B;  1BLQ A;  3GK2 A;  3I5F B;  3I5F C;  3DF0 A;  4MSP A;  1PUL A;  1S6I A;  1SW8 A;  4PE7 A;  3VRP A;  2G2B A;  1H4B A;  2JC2 A;  2ZRS A;  4DUQ A;  1RTP 1;  2BCX A;  2EHB A;  2ISD A;  1YVL A;  4ZCV A;  2BCA A;  1K96 A;  1YUR A;  4YGC B;  2M1K B;  1YR5 A;  1CTR A;  2L4I A;  4MLW A;  1CDN A;  1PVA A;  1QS7 A;  3SG5 A;  1CKK A;  1S5G Y;  1Y1U A;  2KAV A;  4DCK A;  2WCB A;  3NSL A;  1JF0 A;  2M3W A;  4MVF A;  2JXL A;  1SRA A;  3FWB A;  1V1G A;  2LMT A;  1KFX L;  1SKT A;  4DS7 A;  1VRK A;  3SG3 A;  1XFY O;  1JUO A;  2I18 A;  1MUX A;  1BT6 A;  2LNK A;  1GJY A;  3LLE A;  1WLM A;  1EG4 A;  2AMI A;  2O5G A;  2AUC A;  1F55 A;  1SCM B;  2ZFD A;  1SCM C;  3WHT B;  4TNC A;  1XFW O;  3OB1 B;  1C7W A;  3OX6 A;  2GGZ A;  1YVH A;  1K8U A;  1WDC B;  1WDC C;  4I5J A;  5AEQ A;  1OMV A;  1CNP A;  2LM5 A;  4OCI A;  1OMD A;  1OE9 B;  4PAL A;  2TN4 A;  1PK0 D;  2K7D A;  3LL8 B;  2JT0 A;  1DJW A;  1Y6W A;  3M0W A;  2FJU B;  5G08 A;  1BOC A;  1KQV A;  2BL0 B;  1OZS A;  1IQ5 A;  3AAJ A;  1A29 A;  3O78 A;  2LUX A;  1CLM A;  1MWN A;  1DF0 B;  3VRO A;  1BU3 A;  1J7P A;  1B1G A;  1KFU S;  1J55 A;  2Q4U A;  2LLS A;  1ZUZ A;  2WND A;  3TUY C;  1QXP A;  2NCP A;  3TDZ A;  3H4S E;  3PN7 B;  3PN7 C;  2WCF A;  3AKA A;  1XO5 A;  4ORB B;  1KK8 B;  1KK8 C;  2M8U A;  4YRU A;  5F6T A;  5CPV A;  1MXL C;  4USL A;  4JWQ A;  1EXR A;  4IL1 A;  1QX7 A;  1SL7 A;  1K90 D;  1QV0 A;  1SCV A;  2RGI A;  3CTN A;  3PM8 A;  4NDC A;  3BUO B;  5HLO A;  1LA0 A;  2JNX A;  1TNQ A;  5HLV A;  1TNX A;  5D7F A;  4GBA A;  4MRY A;  2JNF A;  4E68 A;  2OS8 B;  2ZN9 A;  2OS8 C;  3FWC A;  5KU1 A;  2M0R A;  2L0P A;  4AOM A;  2ZNE A;  1MXE A;  2KYF A;  4NQG A;  3JVT C;  3PFV A;  3CWG A;  1H8B A;  2JTZ A;  1NCZ A;  5JJG A;  3MSE B;  1C7V A;  1CMF A;  2KYC A;  1XK4 A;  1B8R A;  1PAL A;  1YUU A;  3SIB A;  3BUX B;  3CR5 X;  1S6C A;  1PVB A;  1A75 A;  3TDU A;  3IF7 A;  2WOS A;  1NYA A;  1MR8 A;  2LVI A;  1D1O A;  3K21 A;  3O6B A;  2A4J A;  3D0Y A;  2MAZ A;  4YI9 A;  1J1D A;  2BEC A;  4DRW A;  3F45 A;  2Y5I A;  2M7N A;  3SG6 A;  3NSK A;  1DJH A;  3PSR A;  1N0Y A;  1B8C A;  1UHN A;  3A4U B;  1QV1 A;  2BCB A;  3OX5 A;  4AQI A;  3GK4 X;  3TZ1 A;  4C0L A;  2IS9 A;  4C0K A;  4CFR A;  5HYD A;  1IG5 A;  4PHM A;  1FBV A;  1FPW A;  1AP4 A;  1JF2 A;  3DVE A;  1B7T Z;  1IJ6 A;  3SIA A;  1QAT A;  1XFX O;  4CPV A;  1B4C A;  1TRF A;  3PAT A;  1UWO A;  3LK1 A;  2LVV A;  2K0J A;  3KEV A;  3BXK A;  3CR4 X;  2KFF A;  2Y4Q A;  1MQ1 A;  1B8L A;  1CDL A;  1QAS A;  3WXA A;  1QTX A;  2K7O A;  2JT3 A;  1L7Z A;  4C0J A;  1KCY A;  2B1U A;  2Q91 A;  3QRX A;  1K9P A;  2QAC A;  1DTL A;  3EK4 A;  3OP0 A;  5HKZ A;  1QIV A;  1Q80 A;  2FCE A;  1OSA A;  1TCF A;  1XFU O;  3EKH A;  3I5G B;  3I5G C;  4M2P A;  1RFJ A;  1YRU B;  2MLF C;  4BY5 A;  2LP3 A;  1B47 A;  4WQ2 A;  5I2Q A;  4I5N B;  2M7L A;  1LA3 A;  2JPT A;  1G8I A;  1DMO A;  4HSZ A;  5PAL A;  4OV2 A;  1A2X A;  2JZI A;  2KGB C;  1DJY A;  1ZFS A;  2NCO A;  1J7R A;  1Y1A A;  2MHH A;  2EGD A;  3CLN A;  1BMO A;  1SY9 A;  1EH2 A;  1QX2 A;  4P2Y B;  1AVS A;  3RLZ A;  1IWQ A;  1NP8 A;  1KSM A;  1QX5 B;  2FCD A;  2NLN A;  1IRJ A;  2O60 A;  2KI6 C;  3ICB A;  3JTD B;  1KQM B;  1C07 A;  1KQM C;  2Y1M A;  1DGU A;  4PE4 A;  1NX2 A;  2GV5 A;  4P5O E;  4MEW A;  4XJK A;  2DOQ A;  1YX8 A;  2JXC A;  3VGO A;  2KHN A;  3KHE A;  5AXI A;  3BYA A;  1NUB A;  2LLT A;  2OTG B;  2GGM A;  4A4B A;  1F4O A;  2CNP A;  1IKU A;  2BL0 C;  1SPY A;  3EVR A;  5I2L A;  1SMG A;  2I2R E;  3O2P A;  1IJ5 A;  1JFJ A;  1F4Q A;  5DKN A;  2HPS A;  4MN0 A;  2KDH A;  3NXA A;  1QLS A;  1JBA A;  1F70 A;  5HKW A;  2JQ6 A;  1NSH A;  1PSR A;  1SR6 B;  1XA5 A;  2K2A A;  4DIR A;  1CFD A;  4MZL A;  2H2K A;  1S3P A;  1SL9 A;  2BKI B;  1WRK A;  2I94 A;  2KSP A;  1UUS A;  4CLN A;  3DD4 A;  1MHO A;  3BOW B;  3BUM B;  3I5H B;  3I5H C;  2HQ8 A;  1SL8 A;  2LCP A;  2LVJ A;  1NCY A;  4PHK A;  1N65 A;  4GGF C;  4ORA B;  3IQO A;  1FW4 A;  2M9G A;  2KQ6 A;  1UP5 A;  1TCO B;  4GUK A;  1M31 A;  2EC6 B;  2Y1N A;  5CSN A;  1K2H A;  5JOL A;  3PAL A;  3WHU B;  1G4Y R;  1WLZ A;  3ZNI A;  2KAY A;  1B7T Y;  4YBH B;  2MLE C;  4HRH A;  1CB1 A;  1FI5 A;  3LCP C;  1F54 A;  1L2O B;  1UUR A;  2MBX A;  1FI6 A;  1F8H A;  4M2Q A;  2E6W A;  3CR2 A;  3BQ3 A;  4PCW A;  1GGZ A;  2MA2 A;  3FIA A;  2LUC A; 
#chains in the Genus database with same CATH topology
 1U5I B;  4JKT A;  4MRX A;  1TIZ A;  2JOJ A;  3SG4 A;  3ZWH A;  2M29 A;  4FQO A;  2PMY A;  1TUJ A;  3NSO A;  2CXJ A;  1TOP A;  1Y0V H;  4A4C A;  1Z2C B;  2ZRT A;  1XFZ O;  2H61 C;  2F2O A;  1DF0 A;  1K93 D;  2HET A;  4NDD A;  1XFR A;  4N1G A;  2FOT A;  1B9A A;  4PHN A;  1FF1 A;  1J7O A;  1AJ5 A;  5TNC A;  2PAS A;  5AER A;  2WCE A;  4Q04 A;  4F0Z B;  1JFK A;  1KFX S;  3GK1 A;  1HT9 A;  3DF0 B;  4OR9 B;  1BF5 A;  1IQ3 A;  3D76 A;  3E3R A;  1EJ3 A;  4INX A;  2AAO A;  1TTX A;  3D10 A;  4YGA A;  2KGR A;  3OHM B;  3TS5 B;  3TS5 C;  3SS5 A;  1LVC D;  2E30 A;  3EKJ A;  2KBI A;  1PSB A;  2CBL A;  1GQM A;  5DKR A;  1LXF C;  1W7I B;  3PM2 A;  3DVJ A;  1MF8 B;  1J7Q A;  2HQW A;  1PRW A;  1QJT A;  5CSI A;  3NSI A;  5IBW A;  4GAO A;  2K60 A;  2L98 A;  1JWD A;  1KFU L;  1NCX A;  1S6J A;  4PE1 A;  3VRQ A;  3S0G A;  4MZJ A;  3SJS A;  4MBE A;  5K89 A;  1CMG A;  2L4H A;  1AUI B;  5BPJ A;  1TN4 A;  2F3Z A;  2JPO A;  3DY9 A;  3OB2 B;  4HRE E;  3LK0 A;  1NX3 A;  5CSF A;  1R2U A;  1NX1 A;  3C1V A;  3RZS A;  5CSJ A;  1ORG A;  4M2O A;  1G33 A;  2JRF A;  4PDZ A;  2KI4 B;  2KI4 C;  3VRR A;  1K9U A;  1CM4 A;  1M39 A;  2BE6 A;  1LIN A;  2KBM A;  1DJX A;  1YRT B;  2LVK A;  5FYX A;  1S26 D;  1ALV A;  1S36 A;  2V53 A;  2GTE A;  2WOR A;  1OQP A;  4PE0 A;  5B8I B;  4JPZ B;  1A03 A;  1HQV A;  1QVI Z;  3CZT X;  2BE4 A;  2LHI A;  1RWY A;  1DJI A;  1NWD A;  1XVJ A;  2BBN A;  2R2I A;  3AKB A;  3L47 A;  4WQ3 A;  1S1E A;  2M97 A;  4XYN A;  3PLF B;  1WY9 A;  2PAL A;  2LP2 A;  1ODB A;  1OZO A;  1QIW A;  1KK7 Z;  3A8R A;  1A4P A;  3EK7 A;  1NPQ A;  4OKH A;  4JD9 A;  4D1E A;  1DC1 A;  1W7J B;  1OMR A;  5J3X A;  2VRG A;  4BY4 A;  3I5I B;  3I5I C;  1UHJ A;  4PHJ A;  2K7B A;  3S0F A;  2P6B B;  1CFC A;  3D78 A;  1T14 A;  3B86 A;  3JTD C;  4L9M A;  2K7C A;  1RK9 A;  4GFT A;  1KSO A;  4ORC B;  1CLB A;  3KO0 A;  1K9K A;  4R1E A;  2OPO A;  4OZD A;  1BJF A;  1JC2 A;  2P70 A;  3S0B A;  1E8A A;  2F3Y A;  4MZK A;  4ICB A;  2JU0 A;  2OTG C;  2L5X B;  3IQQ A;  1K95 A;  3D77 A;  3NHT A;  3IVT A;  2KAX A;  1AJ4 A;  1DQE A;  3QME A;  2BBM A;  2LHL A;  4YGD B;  1XYD A;  1EG3 A;  2PRU A;  5D3O A;  1GGW A;  1K94 A;  2MRD A;  1J1E A;  4I5L B;  1DVI A;  3BUW B;  4YGB B;  1SYM A;  1SR6 C;  4QJ5 B;  2LLU A;  1IH0 A;  3CGA A;  1ALW A;  1BR4 B;  2QEV A;  3AAK A;  3SG7 A;  1XK4 C;  4WRI A;  2QPT A;  2LC5 A;  4YI8 A;  4CID A;  2NZ0 A;  2JUL A;  1WRZ A;  2SAS A;  5FI7 A;  1A75 B;  1CDP A;  3KF9 A;  3O4Y A;  1DGV A;  2JTT A;  2K2F A;  3HX4 A;  3SG2 A;  1YTZ C;  2CT9 A;  3WNX B;  2D8N A;  1LS8 A;  1UHH A;  2LV7 A;  5AAN A;  3FS7 A;  2PSR A;  2EC6 C;  2WCJ A;  1AHR A;  1ZOT B;  1WRL A;  1KWO B;  3D0Y B;  1KWO C;  1TNW A;  1V1F A;  2KI6 D;  3TUY B;  5I2O A;  1NX0 A;  1DJZ A;  1S5G Z;  2PQL A;  2HF5 A;  5HKY A;  2KLE A;  1L2O C;  1YUT A;  1QLK A;  5KSZ A;  4HRG A;  3DVM A;  4JQ0 D;  2COL B;  5D69 A;  1C3Y A;  1M46 A;  2ZND A;  1NIW A;  5I8N A;  1X02 A;  5ER5 A;  1JSA A;  1UHI A;  2KFG A;  1CLL A;  3BUN B;  1AK8 A;  4F7F A;  1R6P A;  1CFP A;  5FI2 A;  2JWW A;  2M49 B;  1YX7 A;  2ZKM X;  3CZ2 A;  1BR1 B;  1M45 A;  4N5X A;  2LAP A;  4GNK B;  2G9B A;  2ZN8 A;  3FE6 A;  1LKJ A;  2SCP A;  2CCM A;  3BJH A;  3EVU A;  3PJI A;  3VRN A;  1EL4 A;  1RJV A;  2L51 A;  2PVB A;  1CM1 A;  3JVT B;  4N1F A;  1QVI Y;  2F8P A;  2I7A A;  2L50 A;  3R1O A;  5ER4 X;  1IGV A;  3RM1 A;  2LAN A;  5KTY A;  1UHK A;  4QJ4 B;  3CS1 A;  4OVN F;  5AFP A;  4NDB A;  1DJG A;  4CFQ A;  4YGE B;  1SBJ A;  3BOW A;  1KK7 Y;  1YUS A;  4AQJ A;  2KQY A;  3BFB A;  4QJ3 B;  1REC A;  4GGF A;  2M1U A;  2QDI A;  4ZCU A;  3Q8I A;  2F33 A;  1Y1X A;  2CTN A;  2WC8 A;  3GOF A;  2L2E A;  1QWV A;  5GQQ C;  2WCL A;  2PYQ A;  1F71 A;  1CFF A;  1OOI X;  4UPG A;  2BKH B;  2KFH A;  4GPL B;  1TNP A;  1SSE B;  1ZMZ A;  2F2P A;  2K8M B;  3CZ0 A;  5DKQ A;  3DVK A;  4FTG A;  2LMU A;  3HCM A;  2KOT A;  1BOD A;  1BG1 A;  3OGN A;  1ZAC A;  2LE9 B;  1N2D A;  1U5I A;  1DT7 B;  1SNL A;  1CDM A;  4GGN A;  1P28 A;  2KPH A;  2NXQ A;  4U8D A;  2JT8 A;  3S0E A;  4XJK B;  3EK8 A;  2K61 A;  2KLD A;  3V2L A;  1OOJ A;  2H61 A;  1RRO A;  3TDI A;  4I5K A;  3EVV A;  4ETO A;  3KPX A;  3O4X A;  2LMV A;  1M63 B;  1SK6 D;  1XFV O;  2KNE A;  2MJW B;  1BLQ A;  2L2C A;  3GK2 A;  3I5F B;  3I5F C;  3DF0 A;  4MSP A;  1PUL A;  1S6I A;  1SW8 A;  4PE7 A;  3VRP A;  2G2B A;  1H4B A;  2JC2 A;  2ZRS A;  4DUQ A;  4INW A;  1RTP 1;  2BCX A;  2EHB A;  2ISD A;  1YVL A;  4ZCV A;  5DIC A;  2BCA A;  1K96 A;  1YUR A;  4PT1 A;  4YGC B;  2M1K B;  1YR5 A;  2P71 A;  3B87 A;  1CTR A;  2L4I A;  4MLW A;  2QEO A;  1PVA A;  1QS7 A;  3SG5 A;  1CDN A;  1CKK A;  1S5G Y;  1Y1U A;  2KAV A;  4DCK A;  1Z4H A;  2WCB A;  3NSL A;  1JF0 A;  2M3W A;  4MVF A;  2JXL A;  1SRA A;  3FWB A;  3K1E A;  1V1G A;  2LMT A;  1KFX L;  5HL1 A;  1SKT A;  4DS7 A;  1VRK A;  3SG3 A;  1XFY O;  1JUO A;  2I18 A;  3BFH A;  1MUX A;  1BT6 A;  2LNK A;  1GJY A;  3LLE A;  1WLM A;  1EG4 A;  2AMI A;  2O5G A;  2AUC A;  1F55 A;  1SCM B;  2ZFD A;  1SCM C;  3WHT B;  4TNC A;  1XFW O;  3B6X A;  3OB1 B;  1C7W A;  1OOG A;  2WCH A;  2GGZ A;  1YVH A;  1K8U A;  1WDC B;  3OX6 A;  1WDC C;  4I5J A;  5AEQ A;  1OMV A;  2H8V A;  2LM5 A;  2WC6 A;  1OMD A;  1OE9 B;  2BNX A;  4OCI A;  2TN4 A;  1PK0 D;  4PAL A;  2K7D A;  3LL8 B;  2JT0 A;  1DJW A;  1Y6W A;  2QEH A;  2FJU B;  3M0W A;  5G08 A;  1BOC A;  1KQV A;  2BL0 B;  1OZS A;  1IQ5 A;  3AAJ A;  1A29 A;  3O78 A;  2LUX A;  1CLM A;  1MWN A;  1DF0 B;  3B7A A;  1BU3 A;  3B88 A;  3VRO A;  1J7P A;  1B1G A;  1OW4 A;  1KFU S;  1J55 A;  2Q4U A;  2LLS A;  1ZUZ A;  2WND A;  3TUY C;  1QXP A;  2NCP A;  3TDZ A;  3H4S E;  3PN7 B;  3PN7 C;  3R72 A;  2WCF A;  3AKA A;  1XO5 A;  4ORB B;  1KK8 B;  1KK8 C;  2M8U A;  4YRU A;  5F6T A;  5CPV A;  3UO9 A;  1MXL C;  4USL A;  4JWQ A;  1EXR A;  3SS4 A;  4IL1 A;  1QX7 A;  1SL7 A;  1K90 D;  1QV0 A;  1SCV A;  2RGI A;  3CTN A;  3PM8 A;  4NDC A;  3BUO B;  5HLO A;  1LA0 A;  2JNX A;  1TNQ A;  5HLV A;  1TNX A;  5D7F A;  3R1V A;  4GBA A;  4MRY A;  2JNF A;  3CDN A;  4IJ7 A;  4E68 A;  2OS8 B;  2ZN9 A;  2OS8 C;  3FWC A;  3NGV A;  5KU1 A;  2M0R A;  2L0P A;  4AOM A;  1DEK A;  2FJY A;  2ZNE A;  3DXL A;  1MXE A;  2KYF A;  3D75 A;  4NQG A;  3JVT C;  3PFV A;  3CWG A;  1H8B A;  2JTZ A;  3SS3 A;  1NCZ A;  5JJG A;  3S0A A;  4KYN A;  3MSE B;  1C7V A;  1CMF A;  2KYC A;  1XK4 A;  1B8R A;  1YUU A;  1OOF A;  1PAL A;  3SIB A;  3BUX B;  3CR5 X;  1S6C A;  1PVB A;  1A75 A;  3TDU A;  3IF7 A;  2WOS A;  1NYA A;  1MR8 A;  2YGU A;  2LVI A;  1D1O A;  5FI6 A;  3K21 A;  1DEL A;  3O6B A;  2A4J A;  3D0Y A;  2MAZ A;  4YI9 A;  1J1D A;  2BEC A;  4DRW A;  3EG5 B;  3F45 A;  2Y5I A;  2M7N A;  3SG6 A;  3NSK A;  1DJH A;  3PSR A;  1N0Y A;  3VB1 A;  1B8C A;  1UHN A;  3A4U B;  1QV1 A;  2BCB A;  3OX5 A;  4AQI A;  3GK4 X;  3TZ1 A;  4C0L A;  2IS9 A;  4C0K A;  4CFR A;  5HYD A;  1IG5 A;  4PHM A;  1FBV A;  1FPW A;  1AP4 A;  1OOH A;  1JF2 A;  3DVE A;  3S0D A;  1B7T Z;  1IJ6 A;  3L4L A;  3SIA A;  2WCK A;  1QAT A;  1XFX O;  4CPV A;  3R1P A;  1TRF A;  5EL2 A;  4FQT A;  1B4C A;  3FE8 A;  2QEB A;  3PAT A;  1UWO A;  3LK1 A;  2LVV A;  2K0J A;  3KEV A;  3BXK A;  3CR4 X;  2KFF A;  1IIO A;  2Y4Q A;  1MQ1 A;  3L4A A;  1B8L A;  1CDL A;  1QAS A;  3WXA A;  1CNP A;  1QTX A;  2K7O A;  2JT3 A;  3CYZ A;  1L7Z A;  3FE9 A;  4C0J A;  1KCY A;  2B1U A;  2Q91 A;  3QRX A;  1K9P A;  2QAC A;  1DTL A;  3CAB A;  3EK4 A;  3OP0 A;  5HKZ A;  1QIV A;  1Q80 A;  2FCE A;  1OSA A;  1TCF A;  1XFU O;  3EKH A;  3I5G B;  3I5G C;  4M2P A;  1RFJ A;  1YRU B;  2MLF C;  4BY5 A;  2LP3 A;  1B47 A;  3CZ1 A;  4WQ2 A;  5I2Q A;  1TUZ A;  4I5N B;  2M7L A;  1LA3 A;  2JPT A;  1G8I A;  1DMO A;  4HSZ A;  5PAL A;  3BFA A;  1C3Z A;  4OV2 A;  1A2X A;  2JZI A;  2KGB C;  2ERB A;  1DJY A;  1ZFS A;  2NCO A;  1J7R A;  1Y1A A;  2MHH A;  2EGD A;  3CLN A;  1BMO A;  1SY9 A;  5I94 A;  1QX2 A;  1EH2 A;  4P2Y B;  1AVS A;  3RLZ A;  1IWQ A;  1NP8 A;  1KSM A;  1QX5 B;  2FCD A;  2NLN A;  2WCM A;  1IRJ A;  2O60 A;  2KI6 C;  3ICB A;  3JTD B;  1KQM B;  1C07 A;  1KQM C;  2Y1M A;  1DGU A;  4PE4 A;  1NX2 A;  3DZT A;  2GV5 A;  4P5O E;  4MEW A;  4XJK A;  2DOQ A;  1YX8 A;  2JXC A;  3VGO A;  2KHN A;  3KHE A;  5AXI A;  3BYA A;  1NUB A;  2LLT A;  2OTG B;  2GGM A;  4A4B A;  1F4O A;  2CNP A;  1IKU A;  2BL0 C;  1SPY A;  3EVR A;  5I2L A;  1SMG A;  2I2R E;  3O2P A;  1IJ5 A;  1JFJ A;  1F4Q A;  5DKN A;  2HPS A;  4MN0 A;  2KDH A;  3NHI A;  3NXA A;  1QLS A;  1JBA A;  1F70 A;  5HKW A;  2JQ6 A;  1NSH A;  3OBV A;  1PSR A;  1SR6 B;  1XA5 A;  1W9Z A;  2K2A A;  4DIR A;  1CFD A;  4MZL A;  2H2K A;  3D73 A;  3D74 A;  1S3P A;  1SL9 A;  2BKI B;  1WRK A;  2I94 A;  2KSP A;  1UUS A;  2BAP A;  4CLN A;  3DD4 A;  1MHO A;  3BOW B;  3BUM B;  3I5H B;  3I5H C;  2HQ8 A;  1SL8 A;  2LCP A;  2LVJ A;  3UNW A;  1NCY A;  4PHK A;  1N65 A;  4GGF C;  4ORA B;  3IQO A;  2L5Y A;  1FW4 A;  2M9G A;  3DYE A;  2KQ6 A;  1UP5 A;  1TCO B;  4GUK A;  1M31 A;  2EC6 B;  2Y1N A;  1GM0 A;  5CSN A;  1K2H A;  5JOL A;  3PAL A;  3WHU B;  1G4Y R;  1WLZ A;  3ZNI A;  2KAY A;  1B7T Y;  4YBH B;  2MLE C;  4HRH A;  3N7H A;  1CB1 A;  1FI5 A;  3LCP C;  1F54 A;  1L2O B;  1TWO A;  1UUR A;  2MBX A;  1FI6 A;  2WC5 A;  1F8H A;  4M2Q A;  2E6W A;  3CR2 A;  3BQ3 A;  4PCW A;  1GGZ A;  2MA2 A;  3FIA A;  2LUC A; 
#chains in the Genus database with same CATH homology
 1U5I B;  4MRX A;  1TIZ A;  2JOJ A;  3SG4 A;  3ZWH A;  2M29 A;  4FQO A;  2PMY A;  3NSO A;  2CXJ A;  1TOP A;  1Y0V H;  4A4C A;  2ZRT A;  1XFZ O;  2H61 C;  2F2O A;  1DF0 A;  1K93 D;  2HET A;  4NDD A;  4N1G A;  2FOT A;  1B9A A;  4PHN A;  1FF1 A;  1J7O A;  1AJ5 A;  5TNC A;  2PAS A;  5AER A;  2WCE A;  4Q04 A;  4F0Z B;  1JFK A;  1KFX S;  3GK1 A;  1HT9 A;  3DF0 B;  4OR9 B;  1BF5 A;  1IQ3 A;  3E3R A;  1EJ3 A;  2AAO A;  1TTX A;  3D10 A;  4YGA A;  2KGR A;  3OHM B;  3TS5 B;  3TS5 C;  1LVC D;  2E30 A;  3EKJ A;  2KBI A;  1PSB A;  2CBL A;  1GQM A;  5DKR A;  1LXF C;  1W7I B;  3DVJ A;  1MF8 B;  1J7Q A;  2HQW A;  1PRW A;  1QJT A;  5CSI A;  3NSI A;  5IBW A;  4GAO A;  2L98 A;  1JWD A;  1KFU L;  1NCX A;  1S6J A;  4PE1 A;  3VRQ A;  3SJS A;  4MZJ A;  5K89 A;  4MBE A;  1CMG A;  2L4H A;  1AUI B;  5BPJ A;  1TN4 A;  2F3Z A;  3OB2 B;  4HRE E;  3LK0 A;  1NX3 A;  5CSF A;  1R2U A;  1NX1 A;  3C1V A;  5CSJ A;  4M2O A;  1G33 A;  2JRF A;  4PDZ A;  2KI4 B;  2KI4 C;  3VRR A;  1K9U A;  1CM4 A;  1M39 A;  2BE6 A;  1LIN A;  2KBM A;  1DJX A;  1YRT B;  2LVK A;  5FYX A;  1S26 D;  1ALV A;  1S36 A;  2V53 A;  4PE0 A;  2WOR A;  1OQP A;  5B8I B;  1A03 A;  4JPZ B;  1HQV A;  1QVI Z;  3CZT X;  2BE4 A;  2LHI A;  1RWY A;  1DJI A;  1NWD A;  1XVJ A;  2BBN A;  2R2I A;  3AKB A;  4WQ3 A;  1S1E A;  2M97 A;  4XYN A;  3PLF B;  1WY9 A;  2PAL A;  2LP2 A;  1ODB A;  1OZO A;  1QIW A;  1KK7 Z;  3A8R A;  1A4P A;  3EK7 A;  1NPQ A;  4OKH A;  4D1E A;  1W7J B;  1OMR A;  5J3X A;  2VRG A;  4BY4 A;  3I5I B;  3I5I C;  1UHJ A;  4PHJ A;  2K7B A;  2P6B B;  1CFC A;  3JTD C;  4L9M A;  2K7C A;  1RK9 A;  4GFT A;  1KSO A;  4ORC B;  1CLB A;  3KO0 A;  1K9K A;  4R1E A;  2OPO A;  1JC2 A;  1BJF A;  1E8A A;  2F3Y A;  4MZK A;  4ICB A;  2JU0 A;  2OTG C;  2L5X B;  3IQQ A;  1K95 A;  2KAX A;  1AJ4 A;  2BBM A;  2LHL A;  4YGD B;  1XYD A;  1EG3 A;  2PRU A;  1GGW A;  1K94 A;  2MRD A;  1J1E A;  4I5L B;  1DVI A;  3BUW B;  4YGB B;  1SYM A;  1SR6 C;  4QJ5 B;  2LLU A;  1IH0 A;  3CGA A;  1ALW A;  1BR4 B;  3AAK A;  3SG7 A;  1XK4 C;  4WRI A;  2QPT A;  2LC5 A;  4YI8 A;  4CID A;  2NZ0 A;  2JUL A;  1WRZ A;  2SAS A;  1A75 B;  1CDP A;  3KF9 A;  3O4Y A;  1DGV A;  2JTT A;  2K2F A;  3HX4 A;  3SG2 A;  1YTZ C;  2CT9 A;  3WNX B;  2D8N A;  2LV7 A;  1UHH A;  5AAN A;  3FS7 A;  2PSR A;  2EC6 C;  1AHR A;  1ZOT B;  1WRL A;  1KWO B;  3D0Y B;  1KWO C;  1TNW A;  1V1F A;  2KI6 D;  3TUY B;  5I2O A;  1NX0 A;  1DJZ A;  1S5G Z;  2HF5 A;  5HKY A;  1L2O C;  1YUT A;  1QLK A;  5KSZ A;  4HRG A;  3DVM A;  4JQ0 D;  2COL B;  5D69 A;  1M46 A;  2ZND A;  1NIW A;  5I8N A;  1X02 A;  5ER5 A;  1JSA A;  1UHI A;  2KFG A;  1CLL A;  3BUN B;  1AK8 A;  1R6P A;  1CFP A;  2JWW A;  2M49 B;  1YX7 A;  2ZKM X;  1BR1 B;  1M45 A;  4N5X A;  2LAP A;  4GNK B;  2G9B A;  2ZN8 A;  3VRN A;  1LKJ A;  2SCP A;  2CCM A;  3EVU A;  1EL4 A;  1RJV A;  2L51 A;  2PVB A;  1CM1 A;  3JVT B;  4N1F A;  1QVI Y;  2F8P A;  2I7A A;  2L50 A;  5ER4 X;  3RM1 A;  1IGV A;  5KTY A;  2LAN A;  1UHK A;  4QJ4 B;  3CS1 A;  4OVN F;  5AFP A;  4NDB A;  1DJG A;  4CFQ A;  4YGE B;  1SBJ A;  3BOW A;  1KK7 Y;  1YUS A;  4AQJ A;  2KQY A;  4QJ3 B;  1REC A;  4GGF A;  2M1U A;  4ZCU A;  2F33 A;  1Y1X A;  2CTN A;  2WC8 A;  3GOF A;  2L2E A;  5GQQ C;  1F71 A;  1CFF A;  4UPG A;  2BKH B;  2KFH A;  4GPL B;  1TNP A;  2F2P A;  1ZMZ A;  5DKQ A;  2K8M B;  3DVK A;  4FTG A;  2LMU A;  3HCM A;  2KOT A;  1BOD A;  1BG1 A;  1ZAC A;  2LE9 B;  1N2D A;  1U5I A;  1DT7 B;  1SNL A;  1CDM A;  4GGN A;  2NXQ A;  4U8D A;  2JT8 A;  4XJK B;  3EK8 A;  2K61 A;  1OOJ A;  2H61 A;  1RRO A;  3TDI A;  4I5K A;  3EVV A;  4ETO A;  3KPX A;  2LMV A;  1M63 B;  1SK6 D;  1XFV O;  2KNE A;  2MJW B;  1BLQ A;  3GK2 A;  3I5F B;  3I5F C;  3DF0 A;  4MSP A;  1PUL A;  1S6I A;  1SW8 A;  4PE7 A;  3VRP A;  2G2B A;  1H4B A;  2JC2 A;  2ZRS A;  4DUQ A;  1RTP 1;  2BCX A;  2EHB A;  2ISD A;  1YVL A;  4ZCV A;  2BCA A;  1K96 A;  1YUR A;  4YGC B;  2M1K B;  1YR5 A;  1CTR A;  2L4I A;  4MLW A;  1CDN A;  1PVA A;  1QS7 A;  3SG5 A;  1CKK A;  1S5G Y;  1Y1U A;  2KAV A;  4DCK A;  2WCB A;  3NSL A;  1JF0 A;  2M3W A;  4MVF A;  2JXL A;  1SRA A;  3FWB A;  1V1G A;  2LMT A;  1KFX L;  1SKT A;  4DS7 A;  1VRK A;  3SG3 A;  1XFY O;  1JUO A;  2I18 A;  1MUX A;  1BT6 A;  2LNK A;  1GJY A;  3LLE A;  1WLM A;  1EG4 A;  2AMI A;  2O5G A;  2AUC A;  1F55 A;  1SCM B;  2ZFD A;  1SCM C;  3WHT B;  4TNC A;  1XFW O;  3OB1 B;  1C7W A;  3OX6 A;  2GGZ A;  1YVH A;  1K8U A;  1WDC B;  1WDC C;  4I5J A;  5AEQ A;  1OMV A;  1CNP A;  2LM5 A;  4OCI A;  1OMD A;  1OE9 B;  4PAL A;  2TN4 A;  1PK0 D;  2K7D A;  3LL8 B;  2JT0 A;  1DJW A;  1Y6W A;  3M0W A;  2FJU B;  5G08 A;  1BOC A;  1KQV A;  2BL0 B;  1OZS A;  1IQ5 A;  3AAJ A;  1A29 A;  3O78 A;  2LUX A;  1CLM A;  1MWN A;  1DF0 B;  3VRO A;  1BU3 A;  1J7P A;  1B1G A;  1KFU S;  1J55 A;  2Q4U A;  2LLS A;  1ZUZ A;  2WND A;  3TUY C;  1QXP A;  2NCP A;  3TDZ A;  3H4S E;  3PN7 B;  3PN7 C;  2WCF A;  3AKA A;  1XO5 A;  4ORB B;  1KK8 B;  1KK8 C;  2M8U A;  4YRU A;  5F6T A;  5CPV A;  1MXL C;  4USL A;  4JWQ A;  1EXR A;  4IL1 A;  1QX7 A;  1SL7 A;  1K90 D;  1QV0 A;  1SCV A;  2RGI A;  3CTN A;  3PM8 A;  4NDC A;  3BUO B;  5HLO A;  1LA0 A;  2JNX A;  1TNQ A;  5HLV A;  1TNX A;  5D7F A;  4GBA A;  4MRY A;  2JNF A;  4E68 A;  2OS8 B;  2ZN9 A;  2OS8 C;  3FWC A;  5KU1 A;  2M0R A;  2L0P A;  4AOM A;  2ZNE A;  1MXE A;  2KYF A;  4NQG A;  3JVT C;  3PFV A;  3CWG A;  1H8B A;  2JTZ A;  1NCZ A;  5JJG A;  3MSE B;  1C7V A;  1CMF A;  2KYC A;  1XK4 A;  1B8R A;  1PAL A;  1YUU A;  3SIB A;  3BUX B;  3CR5 X;  1S6C A;  1PVB A;  1A75 A;  3TDU A;  3IF7 A;  2WOS A;  1NYA A;  1MR8 A;  2LVI A;  1D1O A;  3K21 A;  3O6B A;  2A4J A;  3D0Y A;  2MAZ A;  4YI9 A;  1J1D A;  2BEC A;  4DRW A;  3F45 A;  2Y5I A;  2M7N A;  3SG6 A;  3NSK A;  1DJH A;  3PSR A;  1N0Y A;  1B8C A;  1UHN A;  3A4U B;  1QV1 A;  2BCB A;  3OX5 A;  4AQI A;  3GK4 X;  3TZ1 A;  4C0L A;  2IS9 A;  4C0K A;  4CFR A;  5HYD A;  1IG5 A;  4PHM A;  1FBV A;  1FPW A;  1AP4 A;  1JF2 A;  3DVE A;  1B7T Z;  1IJ6 A;  3SIA A;  1QAT A;  1XFX O;  4CPV A;  1B4C A;  1TRF A;  3PAT A;  1UWO A;  3LK1 A;  2LVV A;  2K0J A;  3KEV A;  3BXK A;  3CR4 X;  2KFF A;  2Y4Q A;  1MQ1 A;  1B8L A;  1CDL A;  1QAS A;  3WXA A;  1QTX A;  2K7O A;  2JT3 A;  1L7Z A;  4C0J A;  1KCY A;  2B1U A;  2Q91 A;  3QRX A;  1K9P A;  2QAC A;  1DTL A;  3EK4 A;  3OP0 A;  5HKZ A;  1QIV A;  1Q80 A;  2FCE A;  1OSA A;  1TCF A;  1XFU O;  3EKH A;  3I5G B;  3I5G C;  4M2P A;  1RFJ A;  1YRU B;  2MLF C;  4BY5 A;  2LP3 A;  1B47 A;  4WQ2 A;  5I2Q A;  4I5N B;  2M7L A;  1LA3 A;  2JPT A;  1G8I A;  1DMO A;  4HSZ A;  5PAL A;  4OV2 A;  1A2X A;  2JZI A;  2KGB C;  1DJY A;  1ZFS A;  2NCO A;  1J7R A;  1Y1A A;  2MHH A;  2EGD A;  3CLN A;  1BMO A;  1SY9 A;  1EH2 A;  1QX2 A;  4P2Y B;  1AVS A;  3RLZ A;  1IWQ A;  1NP8 A;  1KSM A;  1QX5 B;  2FCD A;  2NLN A;  1IRJ A;  2O60 A;  2KI6 C;  3ICB A;  3JTD B;  1KQM B;  1C07 A;  1KQM C;  2Y1M A;  1DGU A;  4PE4 A;  1NX2 A;  2GV5 A;  4P5O E;  4MEW A;  4XJK A;  2DOQ A;  1YX8 A;  2JXC A;  3VGO A;  2KHN A;  3KHE A;  5AXI A;  3BYA A;  1NUB A;  2LLT A;  2OTG B;  2GGM A;  4A4B A;  1F4O A;  2CNP A;  1IKU A;  2BL0 C;  1SPY A;  3EVR A;  5I2L A;  1SMG A;  2I2R E;  3O2P A;  1IJ5 A;  1JFJ A;  1F4Q A;  5DKN A;  2HPS A;  4MN0 A;  2KDH A;  3NXA A;  1QLS A;  1JBA A;  1F70 A;  5HKW A;  2JQ6 A;  1NSH A;  1PSR A;  1SR6 B;  1XA5 A;  2K2A A;  4DIR A;  1CFD A;  4MZL A;  2H2K A;  1S3P A;  1SL9 A;  2BKI B;  1WRK A;  2I94 A;  2KSP A;  1UUS A;  4CLN A;  3DD4 A;  1MHO A;  3BOW B;  3BUM B;  3I5H B;  3I5H C;  2HQ8 A;  1SL8 A;  2LCP A;  2LVJ A;  1NCY A;  4PHK A;  1N65 A;  4GGF C;  4ORA B;  3IQO A;  1FW4 A;  2M9G A;  2KQ6 A;  1UP5 A;  1TCO B;  4GUK A;  1M31 A;  2EC6 B;  2Y1N A;  5CSN A;  1K2H A;  5JOL A;  3PAL A;  3WHU B;  1G4Y R;  1WLZ A;  3ZNI A;  2KAY A;  1B7T Y;  4YBH B;  2MLE C;  4HRH A;  1CB1 A;  1FI5 A;  3LCP C;  1F54 A;  1L2O B;  1UUR A;  2MBX A;  1FI6 A;  1F8H A;  4M2Q A;  2E6W A;  3CR2 A;  3BQ3 A;  4PCW A;  1GGZ A;  2MA2 A;  3FIA A;  2LUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...