5CSIA

S100b-rsk1 crystal structure a'
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
GSHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 31
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5csiA00
1NX3A 4P5OE 1G8IA 1YX7A 2JNXA 2L98A 4PDZA 1PSRA 1QJTA 2KFHA 2R2IA 3I5GC 1CFFA 1BODA 5KU1A 2K2FA 2BCAA 2BL0C 4PE0A 2CTNA 1YRUB 2PASA 2V53A 1RECA 1ZOTB 2O5GA 4N1GA 4MSPA 1F4OA 4I5KA 3GOFA 1SL8A 1CMGA 2OS8B 3EK4A 1UURA 2BBMA 3EVUA 3NXAA 3RLZA 1CMFA 2AMIA 3PM8A 1PULA 2LUXA 2PMYA 3FS7A 2WOSA 2G9BA 2Y1MA 3EKHA 5DKRA 1SCMB 1C7WA 2M9GA 1J7RA 1S36A 2JOJA 5TNCA 2FCDA 3D10A 2M1UA 3BYAA 4WQ3A 3EKJA 1KFXL 2I18A 4C0LA 2Q4UA 1SRAA 2FJUB 4WQ2A 5HKYA 1N65A 2SCPA 2MBXA 4QJ4B 1MR8A 1F55A 1YRTB 2K7CA 1J1DA 2HETA 2KI4C 3KHEA 1UHIA 1JFKA 2L2EA 2JT8A 1S3PA 5KSZA 3BUMB 1U5IB 1H8BA 4YGEB 3PFVA 4YGDB 4GUKA 2JWWA 3SG7A 1Y0VH 2H61C 4MBEA 3SG6A 3WHTB 4MVFA 4DS7A 2PALA 1B7TY 1K90D 1LINA 1XFZO 1QX2A 1IJ5A 3CR4X 3JTDB 2F33A 1OMVA 2WCEA 2ZFDA 1B8RA 1K94A 3PN7C 1SPYA 4C0KA 2BCBA 1TNPA 1YUUA 2KAXA 4MRYA 5J3XA 3CWGA 2KGBC 4CIDA 3TUYC 5D7FA 1CDNA 1SY9A 2HF5A 2B1UA 1CTRA 2BE4A 1A29A 3I5GB 4OR9B 2L51A 2A4JA 3HX4A 1B8CA 1AP4A 3TDZA 3SIBA 1K93D 1V1FA 1A4PA 1IQ3A 3EVRA 1CDMA 2WNDA 1JWDA 2SASA 1HQVA 1S5GY 2AUCA 4TNCA 1F8HA 3RM1A 5CPVA 4F0ZB 2K8MB 3NSOA 3AAKA 4GGFC 2K0JA 1F70A 1UP5A 2O60A 1K9PA 1JUOA 1SL7A 1RROA 1UHHA 4MEWA 3VRNA 2I7AA 1TCFA 4MN0A 1F71A 5K89A 2KYFA 3F45A 1W7JB 4MZJA 1FI5A 2I94A 2Y4QA 2TN4A 3LCPC 1W7IB 1TNQA 5AERA 2K2AA 1XA5A 2NCPA 4BY4A 2CT9A 1KFUS 4PHMA 1CM1A 5PALA 1CDLA 1YVLA 4XJKA 3CGAA 1QV1A 3EVVA 4I5NB 4E68A 5AANA 4PE7A 1B8LA 1J7OA 2LHIA 2BKIB 1NX2A 1AVSA 1OQPA 3VROA 1Y1AA 1BMOA 1KFXS 2Q91A 3BUXB 3I5IB 3GK4X 5HKWA 1OOJA 4QJ3B 5ER4X 2LM5A 4MZKA 1WRLA 3I5FC 4HRGA 4GAOA 1QX5B 1VRKA 4FQOA 1AUIB 1FBVA 1YUSA 1H4BA 3JTDC 3TUYB 2L5XB 3PATA 4DCKA 2NZ0A 5CSNA 2KI6C 3DVMA 1N0YA 3BUNB 2LHLA 1QASA 2F3ZA 4PHJA 1A03A 1Y1XA 3D0YA 5D69A 4YGAA 2LVKA 3NSKA 1DJXA 1DF0A 2H2KA 3EK8A 1M39A 3MSEB 1J7QA 1NSHA 4DUQA 3LLEA 2COLB 2PRUA 1KQMB 1PSBA 1MXEA 1KSOA 4PHKA 2LLSA 2HPSA 1S5GZ 1MF8B 4N1FA 1SW8A 2LUCA 4ICBA 4M2OA 5AXIA 2LMUA 1BR1B 4IL1A 2LMTA 5HYDA 1CDPA 1UHNA 1CFPA 1B4CA 1SBJA 2LLUA 3WNXB 1DGVA 1NPQA 2GV5A 5I8NA 1F54A 1EG3A 1V1GA 2MLEC 1XK4A 3CTNA 3WXAA 1TOPA 1SL9A 3IQQA 2L50A 2E6WA 2M49B 1IRJA 2KFGA 2FCEA 1BF5A 1RTP1 4YBHB 3TZ1A 1F4QA 2LC5A 1G33A 3ZNIA 2LE9B 1NCYA 2LP3A 4U8DA 2D8NA 3FWCA 1OZSA 3JVTB 3VRPA 1QTXA 2KI6D 1XO5A 4YRUA 1DT7B 3I5FB 2DOQA 4MLWA 1AK8A 5ER5A 1NX1A 3I5IC 3PLFB 2MA2A 4HSZA 1TIZA 2LVIA 3LL8B 1BU3A 4L9MA 3DVKA 1UHJA 1YR5A 5G08A 1R6PA 4YGBB 2LNKA 2EC6B 4ORBB 1MQ1A 2KSPA 2LCPA 2ZRTA 2KNEA 5HLVA 4CFRA 5CSJA 1M31A 3KO0A 1SCVA 1C7VA 4GPLB 3PSRA 2HQWA 2M0RA 3SG5A 1NCXA 1UWOA 1DJGA 5HKZA 1CFDA 1YURA 3BOWB 3KPXA 3M0WA 2CCMA 4ZCUA 1DMOA 2MLFC 3VRRA 1KQMC 2F8PA 2ZN9A 3TDUA 2KAVA 1HT9A 1TN4A 1QLKA 1S26D 2WCFA 4GGNA 4N5XA 4NDDA 3OP0A 5DKQA 1PRWA 4UPGA 1EH2A 1Y1UA 5AFPA 4P2YB 1FW4A 3A8RA 1SNLA 1NIWA 1NYAA 2MAZA 3O4YA 1SR6C 3OX5A 1M45A 2KBIA 4ORAB 1YUTA 4QJ5B 1KK7Y 1ZMZA 4PE4A 1OMRA 1FF1A 3ICBA 2GGZA 4USLA 2OPOA 4CLNA 1UUSA 4FTGA 1L2OC 4NDCA 1PALA 4R1EA 1RK9A 1IJ6A 1AJ5A 3WHUB 1B1GA 3GK1A 1NWDA 3CLNA 2KQ6A 1UHKA 1IQ5A 1KK8B 2JXCA 1RFJA 4XYNA 2LANA 1K8UA 1BR4B 1KWOB 1SKTA 1WDCC 1CKKA 3OB2B 3O6BA 1QIWA 3O78A 3AKBA 1OSAA 3VRQA 1QS7A 4NDBA 1J55A 1DJZA 3JVTC 4MZLA 4A4CA 3DF0A 1YVHA 1QLSA 2JULA 2AAOA 2K7DA 1M46A 3D0YB 3TS5C 1N2DA 3SG2A 3VGOA 1OMDA 1YX8A 4C0JA 2JRFA 1DJYA 2ISDA 2JQ6A 2FOTA 1ZUZA 1QVIY 5JOLA 4ETOA 1DJIA 2L0PA 2M97A 2LVVA 4JQ0D 2LLTA 2Y5IA 2EC6C 2HQ8A 2BKHB 4ZCVA 2WORA 3SG3A 1QV0A 2ZKMX 3A4UB 2WC8A 2MRDA 1D1OA 1XFUO 4AOMA 1WLMA 4GBAA 4YI8A 4M2QA 1GJYA 1K9UA 2KFFA 1GGZA 1SYMA 5I2LA 1JF0A 2JU0A 1MWNA 4GFTA 3DVJA 5JJGA 1A75A 2G2BA 3TDIA 1SK6D 1K2HA 2OTGB 1QIVA 1XFYO 2H61A 3K21A 4PCWA 3SJSA 3CS1A 1NP8A 1SR6B 3BUWB 2K7OA 1MXLC 4OKHA 1FI6A 2M7NA 3FWBA 1ODBA 4M2PA 3FIAA 2F2OA 1KK7Z 1TNWA 1ALWA 2KYCA 1QX7A 1LVCD 1CB1A 1DTLA 1L2OB 2KBMA 4NQGA 1FPWA 2BCXA 3NSLA 4AQJA 2ZNDA 2CBLA 4I5LB 2KAYA 5FYXA 1JC2A 2M3WA 2BECA 1CLLA 2QACA 1BOCA 1IGVA 1XFVO 3AAJA 2ZRSA 1WDCB 1GGWA 1S6JA 3IF7A 5IBWA 3OHMB 1C07A 3CZTX 4OVNF 2JC2A 3CR5X 5B8IB 1KK8C 1ALVA 1TRFA 2KQYA 1KFUL 1TTXA 1K95A 1KWOC 1EJ3A 2JNFA 2M1KB 3EK7A 1KSMA 1NX0A 4A4BA 1BG1A 1RWYA 4GGFA 3TS5B 1RJVA 3LK1A 1LKJA 1GQMA 1BLQA 3I5HC 2JZIA 3H4SE 2MJWB 3HCMA 3BUOB 1JF2A 1K9KA 3IQOA 2LV7A 1QVIZ 1WLZA 5BPJA 1E8AA 1JSAA 1AHRA 2JPTA 1B9AA 5AEQA 1X02A 2RGIA 2CNPA 2I2RE 2LMVA 2LAPA 3E3RA 1J1EA 1SMGA 1IKUA 1IH0A 1CNPA 3ZWHA 4GNKB 2KOTA 4WRIA 1PK0D 2PSRA 4OCIA 1WY9A 2M8UA 4PE1A 4PHNA 3BXKA 1S6CA 1JBAA 3C1VA 1CLMA 5KTYA 1BJFA 1B47A 1U5IA 3DD4A 3OB1B 4DRWA 1Q80A 2OTGC 4D1EA 1WRZA 2NXQA 1XK4C 2NCOA 5F6TA 1DJHA 4HRHA 1L7ZA 5I2QA 1KQVA 4CFQA 1R2UA 2JT3A 4XJKB 3OX6A 2LP2A 1XVJA 2BL0B 3SG4A 2GGMA 4Q04A 1DJWA 1G4YR 1CFCA 2ZNEA 1AJ4A 1EXRA 2BBNA 4OV2A 4PALA 2PVBA 2QPTA 2E30A 2CXJA 4BY5A 3DF0B 3DVEA 1MHOA 1MUXA 2K61A 2L4IA 2L4HA 3NSIA 1OE9B 2M7LA 2MHHA 3BOWA 4JWQA 2KGRA 2OS8C 1YTZC 2IS9A 1ZACA 1JFJA 5HLOA 1A2XA 1SCMC 2Y1NA 1BT6A 3BQ3A 5DKNA 4YI9A 5CSFA 1CM4A 3I5HB 1NUBA 2EHBA 1PVBA 2NLNA 1IWQA 3CR2A 1EG4A 1QXPA 5CSIA 5GQQC 1DF0B 1J7PA 4I5JA 2JTZA 2P6BB 3KF9A 1TCOB 4HREE 1K96A 2EGDA 2JT0A 2M29A 3AKAA 4CPVA 1XYDA 4MRXA 1NCZA 3SIAA 1WRKA 4JPZB 2KI4B 3LK0A 4AQIA 1A75B 1QATA 1LXFC 3PALA 1TNXA 4YGCB 1LA3A 1KCYA 2JTTA 1XFWO 5I2OA 2JXLA 1CLBA 4DIRA 2VRGA 4ORCB 1M63B 2WCBA 1B7TZ 2LVJA 3PN7B 2F3YA 1S6IA 1XFXO 3O2PA 1OZOA 2F2PA 1PVAA 2ZN8A 1DVIA 2KDHA 3GK2A 1LA0A 1Y6WA 1DGUA 1S1EA 3QRXA 1EL4A 2K7BA 1ZFSA 2KHNA 3KEVA 2BE6A 1IG5A
chains in the Genus database with same CATH superfamily
1NX3A 4P5OE 1G8IA 2PYQA 1YX7A 2JNXA 2L98A 4PDZA 1PSRA 1QJTA 1Z2CB 2KFHA 2R2IA 3I5GC 1CFFA 1BODA 2QEOA 5KU1A 2K2FA 2BCAA 2BL0C 2QEVA 4PE0A 2CTNA 1YRUB 2PASA 2V53A 3D75A 1RECA 1ZOTB 2O5GA 4N1GA 4MSPA 3CZ2A 1F4OA 4I5KA 3GOFA 1SL8A 1CMGA 2OS8B 3EK4A 1UURA 2BBMA 3EVUA 3NXAA 3RLZA 1CMFA 2AMIA 3PM8A 1PULA 2LUXA 2PMYA 3FS7A 2WOSA 2G9BA 2Y1MA 3EKHA 5DKRA 1SCMB 1C7WA 2M9GA 1J7RA 1S36A 2JOJA 5TNCA 2FCDA 3D10A 2M1UA 3BYAA 4WQ3A 3EKJA 1OOGA 1KFXL 2I18A 4C0LA 2Q4UA 1SRAA 2FJUB 4WQ2A 5HKYA 1N65A 2SCPA 2MBXA 4QJ4B 1MR8A 1F55A 1YRTB 2K7CA 3SS5A 1J1DA 2HETA 4JD9A 2WCHA 2KI4C 2L5YA 3KHEA 1UHIA 3S0AA 1JFKA 3B88A 2L2EA 2JT8A 1OOFA 1S3PA 2QDIA 5KSZA 3BUMB 1U5IB 4FQTA 1H8BA 4YGEB 3DZTA 3PFVA 4YGDB 4GUKA 2JWWA 3SG7A 1Y0VH 2H61C 4MBEA 3SG6A 3WHTB 3PJIA 4MVFA 3S0GA 2PALA 1B7TY 1K90D 1LINA 1XFZO 3BFAA 1QX2A 1IJ5A 3CR4X 3JTDB 2F33A 1OMVA 2WCEA 2ZFDA 1B8RA 1K94A 3PN7C 1SPYA 4C0KA 2BCBA 1TNPA 1YUUA 2KAXA 4MRYA 5J3XA 3CWGA 2KGBC 3SS3A 4CIDA 2BE6A 3TUYC 5D7FA 3R72A 1CDNA 1SY9A 2HF5A 2B1UA 1CTRA 2P70A 2BE4A 5FI2A 1A29A 3I5GB 4OR9B 2L51A 2A4JA 3HX4A 1B8CA 1AP4A 3TDZA 1IIOA 3SIBA 1K93D 2L2CA 1V1FA 1A4PA 3RZSA 1IQ3A 3EVRA 1CDMA 3L4LA 2WNDA 1JWDA 4KYNA 2SASA 1HQVA 1S5GY 2AUCA 4TNCA 3D78A 1F8HA 3B87A 3RM1A 5CPVA 4F0ZB 2K8MB 3NSOA 3AAKA 4IJ7A 4GGFC 2K0JA 1F70A 1UP5A 2O60A 1K9PA 3K1EA 1JUOA 1SL7A 1RROA 1UHHA 3BFHA 4MEWA 3VRNA 2I7AA 3EG5B 2H8VA 1TCFA 4MN0A 1F71A 5K89A 2KYFA 3F45A 1DEKA 2WCLA 1W7JB 4MZJA 1FI5A 2I94A 4INWA 2Y4QA 4INXA 2TN4A 3LCPC 1W7IB 3S0DA 1TNQA 5AERA 2K2AA 1XA5A 2NCPA 4BY4A 2CT9A 1TWOA 1KFUS 4PHMA 1CM1A 5PALA 1CDLA 1YVLA 4XJKA 3CGAA 1QV1A 3EVVA 4I5NB 4E68A 5AANA 4PE7A 1B8LA 1J7OA 2LHIA 2BKIB 1NX2A 1AVSA 1OQPA 3VROA 1Y1AA 1BMOA 1KFXS 2Q91A 3BUXB 3I5IB 3GK4X 5HKWA 1OOJA 3R1OA 4QJ3B 5ER4X 2LM5A 4MZKA 1WRLA 3I5FC 4HRGA 4GAOA 1QX5B 1VRKA 4FQOA 5FI6A 1AUIB 1FBVA 1YUSA 1H4BA 3JTDC 3TUYB 2L5XB 3PATA 4DCKA 3CZ1A 1DC1A 2NZ0A 5CSNA 2KI6C 3DVMA 4DS7A 1N0YA 3BJHA 3BUNB 2LHLA 1QASA 2F3ZA 4PHJA 2KLDA 1A03A 1Y1XA 3D0YA 5D69A 4YGAA 2LVKA 3NSKA 1DJXA 1DF0A 2H2KA 3EK8A 1M39A 3MSEB 1J7QA 1NSHA 4DUQA 3LLEA 2COLB 2PRUA 1KQMB 1PSBA 1MXEA 1KSOA 3BFBA 4PHKA 2LLSA 1Z4HA 2FJYA 2HPSA 1S5GZ 1MF8B 4N1FA 1SW8A 2LUCA 4ICBA 4M2OA 5AXIA 2LMUA 1BR1B 4IL1A 2LMTA 5HYDA 1CDPA 1UHNA 1CFPA 1B4CA 1SBJA 2LLUA 3WNXB 1DGVA 1OW4A 2KLEA 1NPQA 2GV5A 5I8NA 1F54A 1EG3A 1V1GA 2MLEC 1XK4A 3V2LA 3CTNA 3WXAA 1TOPA 1SL9A 3IQQA 2L50A 2E6WA 2M49B 1IRJA 2KFGA 2FCEA 1BF5A 1RTP1 4YBHB 3TZ1A 1F4QA 2LC5A 1G33A 3ZNIA 2LE9B 1NCYA 1P28A 2LP3A 4U8DA 3UNWA 2D8NA 3FWCA 1OZSA 3JVTB 3VRPA 1QTXA 2KI6D 3PM2A 4YRUA 1DT7B 3I5FB 2DOQA 3O4XA 4MLWA 1AK8A 5ER5A 1NX1A 3I5IC 3PLFB 2MA2A 4HSZA 1TIZA 2LVIA 3LL8B 1BU3A 4L9MA 3DVKA 3D74A 1UHJA 1YR5A 5G08A 1R6PA 4YGBB 2LNKA 5FI7A 2EC6B 4ORBB 3DY9A 2WCJA 1MQ1A 2KSPA 2LCPA 2ZRTA 2KNEA 5HLVA 4CFRA 5CSJA 1M31A 3KO0A 1SCVA 1C7VA 4GPLB 3PSRA 2HQWA 2M0RA 3NHIA 1LS8A 3SG5A 1NCXA 1UWOA 1DJGA 5HKZA 3SS4A 1CFDA 1YURA 3BOWB 3KPXA 3M0WA 2CCMA 4ZCUA 1DMOA 2MLFC 3VRRA 1KQMC 2F8PA 2ZN9A 3TDUA 2KAVA 1HT9A 1TN4A 2QEHA 1QLKA 1S26D 3VB1A 3B6XA 2WCFA 4GGNA 4N5XA 4NDDA 3OP0A 5DKQA 1PRWA 4UPGA 1EH2A 1Y1UA 5AFPA 4P2YB 1FW4A 3A8RA 1SNLA 1NIWA 1NYAA 2MAZA 3O4YA 1SR6C 3OX5A 1M45A 2KBIA 4ORAB 1YUTA 4QJ5B 1KK7Y 1ZMZA 4PE4A 1OMRA 1FF1A 3ICBA 2GGZA 4USLA 2OPOA 4CLNA 1UUSA 4FTGA 1L2OC 4NDCA 1PALA 4R1EA 1RK9A 1IJ6A 1AJ5A 5EL2A 3WHUB 1B1GA 3GK1A 1NWDA 3CLNA 2KQ6A 1UHKA 1IQ5A 1KK8B 2JXCA 1RFJA 4XYNA 2LANA 1K8UA 1BR4B 1KWOB 1SKTA 1WDCC 1CKKA 3OB2B 3O6BA 1QIWA 3O78A 3AKBA 1OSAA 3VRQA 1QS7A 4NDBA 1J55A 1DJZA 3JVTC 4MZLA 4A4CA 2WC6A 3DF0A 1YVHA 3IVTA 2WCMA 3D77A 1QLSA 3N7HA 3DXLA 2JULA 2AAOA 2K7DA 1M46A 3D0YB 5DICA 1N2DA 3TS5C 3SG2A 3VGOA 1OMDA 1YX8A 1T14A 2JRFA 4C0JA 1DJYA 2ISDA 2JQ6A 3S0EA 2FOTA 1ZUZA 1QVIY 1W9ZA 5JOLA 4ETOA 3CABA 1DJIA 2L0PA 2M97A 2LVVA 4JQ0D 2WC5A 2LLTA 2Y5IA 2EC6C 2HQ8A 2BKHB 4ZCVA 4OZDA 2WORA 3SG3A 1QV0A 2ZKMX 3A4UB 2WC8A 2MRDA 3S0FA 1D1OA 1XFUO 4AOMA 1WLMA 4GBAA 4YI8A 4M2QA 1GJYA 1K9UA 2KFFA 1GGZA 1SYMA 4JKTA 5I2LA 1JF0A 2JU0A 1MWNA 3CYZA 4GFTA 3DVJA 5JJGA 1A75A 2G2BA 3TDIA 1SK6D 1K2HA 2OTGB 1QIVA 1XFYO 2H61A 3K21A 4PCWA 3SJSA 3CS1A 1NP8A 3FE6A 3L47A 1SR6B 3BUWB 2K7OA 5I94A 1MXLC 4OKHA 1FI6A 2M7NA 3FWBA 1ODBA 4M2PA 3FIAA 2F2OA 1KK7Z 1TNWA 1ALWA 2KYCA 1QX7A 1LVCD 1CB1A 1DTLA 1L2OB 2KBMA 4NQGA 1FPWA 2BCXA 3NSLA 2WCKA 2YGUA 2ZNDA 2CBLA 4I5LB 4AQJA 2KAYA 5FYXA 1JC2A 2M3WA 2BECA 1CLLA 2QACA 1BOCA 1IGVA 1XFVO 3AAJA 2ZRSA 1WDCB 1GGWA 1S6JA 3IF7A 5IBWA 3OHMB 1C07A 2P71A 3CZTX 2JC2A 3CR5X 3FE8A 1KK8C 1ALVA 1TRFA 2KQYA 1KFUL 1TTXA 1K95A 1KWOC 1EJ3A 2JNFA 2M1KB 3D73A 3EK7A 1KSMA 1C3YA 1NX0A 4PT1A 1OOHA 4A4BA 1BG1A 1RWYA 4GGFA 3TS5B 1RJVA 5HL1A 3LK1A 1LKJA 1GQMA 1BLQA 3I5HC 2JZIA 3H4SE 2MJWB 3HCMA 3BUOB 1JF2A 1K9KA 3IQOA 2LV7A 1QVIZ 1WLZA 2QEBA 5BPJA 1E8AA 2BAPA 1JSAA 1AHRA 2JPTA 1B9AA 5AEQA 1X02A 2RGIA 2CNPA 2I2RE 2PQLA 5B8IB 2LMVA 3S0BA 3CDNA 2K60A 2LAPA 3E3RA 1J1EA 1SMGA 1IKUA 1IH0A 1CNPA 3ZWHA 4GNKB 2KOTA 1TUZA 4WRIA 1PK0D 2PSRA 4OCIA 1WY9A 2M8UA 4PE1A 4PHNA 3BXKA 1S6CA 1JBAA 3C1VA 1CLMA 5KTYA 1BJFA 1B47A 1U5IA 2KPHA 3DD4A 3OB1B 1Q80A 2OTGC 4DRWA 1WRZA 2NXQA 4D1EA 1XK4C 2NCOA 5F6TA 1DJHA 4HRHA 1L7ZA 5I2QA 1KQVA 4CFQA 1R2UA 2JT3A 4XJKB 3OX6A 2LP2A 1XVJA 2BL0B 3SG4A 3QMEA 2GGMA 4Q04A 1DJWA 1G4YR 1CFCA 2ZNEA 1AJ4A 1EXRA 2BBNA 2ERBA 4OV2A 1OOIX 4PALA 2PVBA 3NHTA 1SSEB 2E30A 2CXJA 2QPTA 3DF0B 4BY5A 3CZ0A 3DVEA 1MHOA 3R1PA 1MUXA 2K61A 2L4IA 2L4HA 3B7AA 3NSIA 1OE9B 3L4AA 2M7LA 1C3ZA 2MHHA 3BOWA 2BNXA 3B86A 4JWQA 2KGRA 2OS8C 1YTZC 1QWVA 2IS9A 1ZACA 1JFJA 1DQEA 5HLOA 3R1VA 1A2XA 1SCMC 2Y1NA 1BT6A 1TUJA 3BQ3A 4YI9A 5CSFA 1CM4A 5DKNA 4F7FA 3I5HB 2JPOA 1NUBA 2EHBA 1PVBA 2NLNA 1IWQA 3CR2A 1EG4A 4OVNF 1QXPA 5CSIA 5GQQC 1DF0B 1DELA 4I5JA 1J7PA 2JTZA 2P6BB 3KF9A 1TCOB 4HREE 1K96A 2EGDA 2JT0A 2M29A 3AKAA 4CPVA 1XYDA 4MRXA 3D76A 1NCZA 3FE9A 1WRKA 3NGVA 3Q8IA 4JPZB 3SIAA 2KI4B 3LK0A 3OGNA 4AQIA 2GTEA 1A75B 1QATA 1GM0A 1LXFC 3PALA 1TNXA 1XFRA 1LA3A 4YGCB 5D3OA 1KCYA 2JTTA 1XFWO 5I2OA 3DYEA 2JXLA 1ORGA 1CLBA 4DIRA 2VRGA 4ORCB 1M63B 2WCBA 1B7TZ 2LVJA 3PN7B 2F3YA 1S6IA 1XFXO 3O2PA 1OZOA 2F2PA 3UO9A 1PVAA 2ZN8A 3OBVA 1DVIA 2KDHA 3GK2A 1LA0A 1Y6WA 1DGUA 1S1EA 3QRXA 1EL4A 2K7BA 1ZFSA 2KHNA 3KEVA 1XO5A 1IG5A
chains in the Genus database with same CATH topology
1NX3A 4P5OE 1G8IA 1YX7A 2JNXA 2L98A 4PDZA 1PSRA 1QJTA 2KFHA 2R2IA 3I5GC 1CFFA 1BODA 5KU1A 2K2FA 2BCAA 2BL0C 4PE0A 2CTNA 1YRUB 2PASA 2V53A 1RECA 1ZOTB 2O5GA 4N1GA 4MSPA 1F4OA 4I5KA 3GOFA 1SL8A 1CMGA 2OS8B 3EK4A 1UURA 2BBMA 3EVUA 3NXAA 3RLZA 1CMFA 2AMIA 3PM8A 1PULA 2LUXA 2PMYA 3FS7A 2WOSA 2G9BA 2Y1MA 3EKHA 5DKRA 1SCMB 1C7WA 2M9GA 1J7RA 1S36A 2JOJA 5TNCA 2FCDA 3D10A 2M1UA 3BYAA 4WQ3A 3EKJA 1KFXL 2I18A 4C0LA 2Q4UA 1SRAA 2FJUB 4WQ2A 5HKYA 1N65A 2SCPA 2MBXA 4QJ4B 1MR8A 1F55A 1YRTB 2K7CA 1J1DA 2HETA 2KI4C 3KHEA 1UHIA 1JFKA 2L2EA 2JT8A 1S3PA 5KSZA 3BUMB 1U5IB 1H8BA 4YGEB 3PFVA 4YGDB 4GUKA 2JWWA 3SG7A 1Y0VH 2H61C 4MBEA 3SG6A 3WHTB 4MVFA 4DS7A 2PALA 1B7TY 1K90D 1LINA 1XFZO 1QX2A 1IJ5A 3CR4X 3JTDB 2F33A 1OMVA 2WCEA 2ZFDA 1B8RA 1K94A 3PN7C 1SPYA 4C0KA 2BCBA 1TNPA 1YUUA 2KAXA 4MRYA 5J3XA 3CWGA 2KGBC 4CIDA 3TUYC 5D7FA 1CDNA 1SY9A 2HF5A 2B1UA 1CTRA 2BE4A 1A29A 3I5GB 4OR9B 2L51A 2A4JA 3HX4A 1B8CA 1AP4A 3TDZA 3SIBA 1K93D 1V1FA 1A4PA 1IQ3A 3EVRA 1CDMA 2WNDA 1JWDA 2SASA 1HQVA 1S5GY 2AUCA 4TNCA 1F8HA 3RM1A 5CPVA 4F0ZB 2K8MB 3NSOA 3AAKA 4GGFC 2K0JA 1F70A 1UP5A 2O60A 1K9PA 1JUOA 1SL7A 1RROA 1UHHA 4MEWA 3VRNA 2I7AA 1TCFA 4MN0A 1F71A 5K89A 2KYFA 3F45A 1W7JB 4MZJA 1FI5A 2I94A 2Y4QA 2TN4A 3LCPC 1W7IB 1TNQA 5AERA 2K2AA 1XA5A 2NCPA 4BY4A 2CT9A 1KFUS 4PHMA 1CM1A 5PALA 1CDLA 1YVLA 4XJKA 3CGAA 1QV1A 3EVVA 4I5NB 4E68A 5AANA 4PE7A 1B8LA 1J7OA 2LHIA 2BKIB 1NX2A 1AVSA 1OQPA 3VROA 1Y1AA 1BMOA 1KFXS 2Q91A 3BUXB 3I5IB 3GK4X 5HKWA 1OOJA 4QJ3B 5ER4X 2LM5A 4MZKA 1WRLA 3I5FC 4HRGA 4GAOA 1QX5B 1VRKA 4FQOA 1AUIB 1FBVA 1YUSA 1H4BA 3JTDC 3TUYB 2L5XB 3PATA 4DCKA 2NZ0A 5CSNA 2KI6C 3DVMA 1N0YA 3BUNB 2LHLA 1QASA 2F3ZA 4PHJA 1A03A 1Y1XA 3D0YA 5D69A 4YGAA 2LVKA 3NSKA 1DJXA 1DF0A 2H2KA 3EK8A 1M39A 3MSEB 1J7QA 1NSHA 4DUQA 3LLEA 2COLB 2PRUA 1KQMB 1PSBA 1MXEA 1KSOA 4PHKA 2LLSA 2HPSA 1S5GZ 1MF8B 4N1FA 1SW8A 2LUCA 4ICBA 4M2OA 5AXIA 2LMUA 1BR1B 4IL1A 2LMTA 5HYDA 1CDPA 1UHNA 1CFPA 1B4CA 1SBJA 2LLUA 3WNXB 1DGVA 1NPQA 2GV5A 5I8NA 1F54A 1EG3A 1V1GA 2MLEC 1XK4A 3CTNA 3WXAA 1TOPA 1SL9A 3IQQA 2L50A 2E6WA 2M49B 1IRJA 2KFGA 2FCEA 1BF5A 1RTP1 4YBHB 3TZ1A 1F4QA 2LC5A 1G33A 3ZNIA 2LE9B 1NCYA 2LP3A 4U8DA 2D8NA 3FWCA 1OZSA 3JVTB 3VRPA 1QTXA 2KI6D 1XO5A 4YRUA 1DT7B 3I5FB 2DOQA 4MLWA 1AK8A 5ER5A 1NX1A 3I5IC 3PLFB 2MA2A 4HSZA 1TIZA 2LVIA 3LL8B 1BU3A 4L9MA 3DVKA 1UHJA 1YR5A 5G08A 1R6PA 4YGBB 2LNKA 2EC6B 4ORBB 1MQ1A 2KSPA 2LCPA 2ZRTA 2KNEA 5HLVA 4CFRA 5CSJA 1M31A 3KO0A 1SCVA 1C7VA 4GPLB 3PSRA 2HQWA 2M0RA 3SG5A 1NCXA 1UWOA 1DJGA 5HKZA 1CFDA 1YURA 3BOWB 3KPXA 3M0WA 2CCMA 4ZCUA 1DMOA 2MLFC 3VRRA 1KQMC 2F8PA 2ZN9A 3TDUA 2KAVA 1HT9A 1TN4A 1QLKA 1S26D 2WCFA 4GGNA 4N5XA 4NDDA 3OP0A 5DKQA 1PRWA 4UPGA 1EH2A 1Y1UA 5AFPA 4P2YB 1FW4A 3A8RA 1SNLA 1NIWA 1NYAA 2MAZA 3O4YA 1SR6C 3OX5A 1M45A 2KBIA 4ORAB 1YUTA 4QJ5B 1KK7Y 1ZMZA 4PE4A 1OMRA 1FF1A 3ICBA 2GGZA 4USLA 2OPOA 4CLNA 1UUSA 4FTGA 1L2OC 4NDCA 1PALA 4R1EA 1RK9A 1IJ6A 1AJ5A 3WHUB 1B1GA 3GK1A 1NWDA 3CLNA 2KQ6A 1UHKA 1IQ5A 1KK8B 2JXCA 1RFJA 4XYNA 2LANA 1K8UA 1BR4B 1KWOB 1SKTA 1WDCC 1CKKA 3OB2B 3O6BA 1QIWA 3O78A 3AKBA 1OSAA 3VRQA 1QS7A 4NDBA 1J55A 1DJZA 3JVTC 4MZLA 4A4CA 3DF0A 1YVHA 1QLSA 2JULA 2AAOA 2K7DA 1M46A 3D0YB 3TS5C 1N2DA 3SG2A 3VGOA 1OMDA 1YX8A 4C0JA 2JRFA 1DJYA 2ISDA 2JQ6A 2FOTA 1ZUZA 1QVIY 5JOLA 4ETOA 1DJIA 2L0PA 2M97A 2LVVA 4JQ0D 2LLTA 2Y5IA 2EC6C 2HQ8A 2BKHB 4ZCVA 2WORA 3SG3A 1QV0A 2ZKMX 3A4UB 2WC8A 2MRDA 1D1OA 1XFUO 4AOMA 1WLMA 4GBAA 4YI8A 4M2QA 1GJYA 1K9UA 2KFFA 1GGZA 1SYMA 5I2LA 1JF0A 2JU0A 1MWNA 4GFTA 3DVJA 5JJGA 1A75A 2G2BA 3TDIA 1SK6D 1K2HA 2OTGB 1QIVA 1XFYO 2H61A 3K21A 4PCWA 3SJSA 3CS1A 1NP8A 1SR6B 3BUWB 2K7OA 1MXLC 4OKHA 1FI6A 2M7NA 3FWBA 1ODBA 4M2PA 3FIAA 2F2OA 1KK7Z 1TNWA 1ALWA 2KYCA 1QX7A 1LVCD 1CB1A 1DTLA 1L2OB 2KBMA 4NQGA 1FPWA 2BCXA 3NSLA 4AQJA 2ZNDA 2CBLA 4I5LB 2KAYA 5FYXA 1JC2A 2M3WA 2BECA 1CLLA 2QACA 1BOCA 1IGVA 1XFVO 3AAJA 2ZRSA 1WDCB 1GGWA 1S6JA 3IF7A 5IBWA 3OHMB 1C07A 3CZTX 4OVNF 2JC2A 3CR5X 5B8IB 1KK8C 1ALVA 1TRFA 2KQYA 1KFUL 1TTXA 1K95A 1KWOC 1EJ3A 2JNFA 2M1KB 3EK7A 1KSMA 1NX0A 4A4BA 1BG1A 1RWYA 4GGFA 3TS5B 1RJVA 3LK1A 1LKJA 1GQMA 1BLQA 3I5HC 2JZIA 3H4SE 2MJWB 3HCMA 3BUOB 1JF2A 1K9KA 3IQOA 2LV7A 1QVIZ 1WLZA 5BPJA 1E8AA 1JSAA 1AHRA 2JPTA 1B9AA 5AEQA 1X02A 2RGIA 2CNPA 2I2RE 2LMVA 2LAPA 3E3RA 1J1EA 1SMGA 1IKUA 1IH0A 1CNPA 3ZWHA 4GNKB 2KOTA 4WRIA 1PK0D 2PSRA 4OCIA 1WY9A 2M8UA 4PE1A 4PHNA 3BXKA 1S6CA 1JBAA 3C1VA 1CLMA 5KTYA 1BJFA 1B47A 1U5IA 3DD4A 3OB1B 4DRWA 1Q80A 2OTGC 4D1EA 1WRZA 2NXQA 1XK4C 2NCOA 5F6TA 1DJHA 4HRHA 1L7ZA 5I2QA 1KQVA 4CFQA 1R2UA 2JT3A 4XJKB 3OX6A 2LP2A 1XVJA 2BL0B 3SG4A 2GGMA 4Q04A 1DJWA 1G4YR 1CFCA 2ZNEA 1AJ4A 1EXRA 2BBNA 4OV2A 4PALA 2PVBA 2QPTA 2E30A 2CXJA 4BY5A 3DF0B 3DVEA 1MHOA 1MUXA 2K61A 2L4IA 2L4HA 3NSIA 1OE9B 2M7LA 2MHHA 3BOWA 4JWQA 2KGRA 2OS8C 1YTZC 2IS9A 1ZACA 1JFJA 5HLOA 1A2XA 1SCMC 2Y1NA 1BT6A 3BQ3A 5DKNA 4YI9A 5CSFA 1CM4A 3I5HB 1NUBA 2EHBA 1PVBA 2NLNA 1IWQA 3CR2A 1EG4A 1QXPA 5CSIA 5GQQC 1DF0B 1J7PA 4I5JA 2JTZA 2P6BB 3KF9A 1TCOB 4HREE 1K96A 2EGDA 2JT0A 2M29A 3AKAA 4CPVA 1XYDA 4MRXA 1NCZA 3SIAA 1WRKA 4JPZB 2KI4B 3LK0A 4AQIA 1A75B 1QATA 1LXFC 3PALA 1TNXA 4YGCB 1LA3A 1KCYA 2JTTA 1XFWO 5I2OA 2JXLA 1CLBA 4DIRA 2VRGA 4ORCB 1M63B 2WCBA 1B7TZ 2LVJA 3PN7B 2F3YA 1S6IA 1XFXO 3O2PA 1OZOA 2F2PA 1PVAA 2ZN8A 1DVIA 2KDHA 3GK2A 1LA0A 1Y6WA 1DGUA 1S1EA 3QRXA 1EL4A 2K7BA 1ZFSA 2KHNA 3KEVA 2BE6A 1IG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NX3 A;  4P5O E;  1G8I A;  1YX7 A;  2JNX A;  2L98 A;  4PDZ A;  1PSR A;  1QJT A;  2KFH A;  2R2I A;  3I5G C;  1CFF A;  1BOD A;  5KU1 A;  2K2F A;  2BCA A;  2BL0 C;  4PE0 A;  2CTN A;  1YRU B;  2PAS A;  2V53 A;  1REC A;  1ZOT B;  2O5G A;  4N1G A;  4MSP A;  1F4O A;  4I5K A;  3GOF A;  1SL8 A;  1CMG A;  2OS8 B;  3EK4 A;  1UUR A;  2BBM A;  3EVU A;  3NXA A;  3RLZ A;  1CMF A;  2AMI A;  3PM8 A;  1PUL A;  2LUX A;  2PMY A;  3FS7 A;  2WOS A;  2G9B A;  2Y1M A;  3EKH A;  5DKR A;  1SCM B;  1C7W A;  2M9G A;  1J7R A;  1S36 A;  2JOJ A;  5TNC A;  2FCD A;  3D10 A;  2M1U A;  3BYA A;  4WQ3 A;  3EKJ A;  1KFX L;  2I18 A;  4C0L A;  2Q4U A;  1SRA A;  2FJU B;  4WQ2 A;  5HKY A;  1N65 A;  2SCP A;  2MBX A;  4QJ4 B;  1MR8 A;  1F55 A;  1YRT B;  2K7C A;  1J1D A;  2HET A;  2KI4 C;  3KHE A;  1UHI A;  1JFK A;  2L2E A;  2JT8 A;  1S3P A;  5KSZ A;  3BUM B;  1U5I B;  1H8B A;  4YGE B;  3PFV A;  4YGD B;  4GUK A;  2JWW A;  3SG7 A;  1Y0V H;  2H61 C;  4MBE A;  3SG6 A;  3WHT B;  4MVF A;  4DS7 A;  2PAL A;  1B7T Y;  1K90 D;  1LIN A;  1XFZ O;  1QX2 A;  1IJ5 A;  3CR4 X;  3JTD B;  2F33 A;  1OMV A;  2WCE A;  2ZFD A;  1B8R A;  1K94 A;  3PN7 C;  1SPY A;  4C0K A;  2BCB A;  1TNP A;  1YUU A;  2KAX A;  4MRY A;  5J3X A;  3CWG A;  2KGB C;  4CID A;  3TUY C;  5D7F A;  1CDN A;  1SY9 A;  2HF5 A;  2B1U A;  1CTR A;  2BE4 A;  1A29 A;  3I5G B;  4OR9 B;  2L51 A;  2A4J A;  3HX4 A;  1B8C A;  1AP4 A;  3TDZ A;  3SIB A;  1K93 D;  1V1F A;  1A4P A;  1IQ3 A;  3EVR A;  1CDM A;  2WND A;  1JWD A;  2SAS A;  1HQV A;  1S5G Y;  2AUC A;  4TNC A;  1F8H A;  3RM1 A;  5CPV A;  4F0Z B;  2K8M B;  3NSO A;  3AAK A;  4GGF C;  2K0J A;  1F70 A;  1UP5 A;  2O60 A;  1K9P A;  1JUO A;  1SL7 A;  1RRO A;  1UHH A;  4MEW A;  3VRN A;  2I7A A;  1TCF A;  4MN0 A;  1F71 A;  5K89 A;  2KYF A;  3F45 A;  1W7J B;  4MZJ A;  1FI5 A;  2I94 A;  2Y4Q A;  2TN4 A;  3LCP C;  1W7I B;  1TNQ A;  5AER A;  2K2A A;  1XA5 A;  2NCP A;  4BY4 A;  2CT9 A;  1KFU S;  4PHM A;  1CM1 A;  5PAL A;  1CDL A;  1YVL A;  4XJK A;  3CGA A;  1QV1 A;  3EVV A;  4I5N B;  4E68 A;  5AAN A;  4PE7 A;  1B8L A;  1J7O A;  2LHI A;  2BKI B;  1NX2 A;  1AVS A;  1OQP A;  3VRO A;  1Y1A A;  1BMO A;  1KFX S;  2Q91 A;  3BUX B;  3I5I B;  3GK4 X;  5HKW A;  1OOJ A;  4QJ3 B;  5ER4 X;  2LM5 A;  4MZK A;  1WRL A;  3I5F C;  4HRG A;  4GAO A;  1QX5 B;  1VRK A;  4FQO A;  1AUI B;  1FBV A;  1YUS A;  1H4B A;  3JTD C;  3TUY B;  2L5X B;  3PAT A;  4DCK A;  2NZ0 A;  5CSN A;  2KI6 C;  3DVM A;  1N0Y A;  3BUN B;  2LHL A;  1QAS A;  2F3Z A;  4PHJ A;  1A03 A;  1Y1X A;  3D0Y A;  5D69 A;  4YGA A;  2LVK A;  3NSK A;  1DJX A;  1DF0 A;  2H2K A;  3EK8 A;  1M39 A;  3MSE B;  1J7Q A;  1NSH A;  4DUQ A;  3LLE A;  2COL B;  2PRU A;  1KQM B;  1PSB A;  1MXE A;  1KSO A;  4PHK A;  2LLS A;  2HPS A;  1S5G Z;  1MF8 B;  4N1F A;  1SW8 A;  2LUC A;  4ICB A;  4M2O A;  5AXI A;  2LMU A;  1BR1 B;  4IL1 A;  2LMT A;  5HYD A;  1CDP A;  1UHN A;  1CFP A;  1B4C A;  1SBJ A;  2LLU A;  3WNX B;  1DGV A;  1NPQ A;  2GV5 A;  5I8N A;  1F54 A;  1EG3 A;  1V1G A;  2MLE C;  1XK4 A;  3CTN A;  3WXA A;  1TOP A;  1SL9 A;  3IQQ A;  2L50 A;  2E6W A;  2M49 B;  1IRJ A;  2KFG A;  2FCE A;  1BF5 A;  1RTP 1;  4YBH B;  3TZ1 A;  1F4Q A;  2LC5 A;  1G33 A;  3ZNI A;  2LE9 B;  1NCY A;  2LP3 A;  4U8D A;  2D8N A;  3FWC A;  1OZS A;  3JVT B;  3VRP A;  1QTX A;  2KI6 D;  1XO5 A;  4YRU A;  1DT7 B;  3I5F B;  2DOQ A;  4MLW A;  1AK8 A;  5ER5 A;  1NX1 A;  3I5I C;  3PLF B;  2MA2 A;  4HSZ A;  1TIZ A;  2LVI A;  3LL8 B;  1BU3 A;  4L9M A;  3DVK A;  1UHJ A;  1YR5 A;  5G08 A;  1R6P A;  4YGB B;  2LNK A;  2EC6 B;  4ORB B;  1MQ1 A;  2KSP A;  2LCP A;  2ZRT A;  2KNE A;  5HLV A;  4CFR A;  5CSJ A;  1M31 A;  3KO0 A;  1SCV A;  1C7V A;  4GPL B;  3PSR A;  2HQW A;  2M0R A;  3SG5 A;  1NCX A;  1UWO A;  1DJG A;  5HKZ A;  1CFD A;  1YUR A;  3BOW B;  3KPX A;  3M0W A;  2CCM A;  4ZCU A;  1DMO A;  2MLF C;  3VRR A;  1KQM C;  2F8P A;  2ZN9 A;  3TDU A;  2KAV A;  1HT9 A;  1TN4 A;  1QLK A;  1S26 D;  2WCF A;  4GGN A;  4N5X A;  4NDD A;  3OP0 A;  5DKQ A;  1PRW A;  4UPG A;  1EH2 A;  1Y1U A;  5AFP A;  4P2Y B;  1FW4 A;  3A8R A;  1SNL A;  1NIW A;  1NYA A;  2MAZ A;  3O4Y A;  1SR6 C;  3OX5 A;  1M45 A;  2KBI A;  4ORA B;  1YUT A;  4QJ5 B;  1KK7 Y;  1ZMZ A;  4PE4 A;  1OMR A;  1FF1 A;  3ICB A;  2GGZ A;  4USL A;  2OPO A;  4CLN A;  1UUS A;  4FTG A;  1L2O C;  4NDC A;  1PAL A;  4R1E A;  1RK9 A;  1IJ6 A;  1AJ5 A;  3WHU B;  1B1G A;  3GK1 A;  1NWD A;  3CLN A;  2KQ6 A;  1UHK A;  1IQ5 A;  1KK8 B;  2JXC A;  1RFJ A;  4XYN A;  2LAN A;  1K8U A;  1BR4 B;  1KWO B;  1SKT A;  1WDC C;  1CKK A;  3OB2 B;  3O6B A;  1QIW A;  3O78 A;  3AKB A;  1OSA A;  3VRQ A;  1QS7 A;  4NDB A;  1J55 A;  1DJZ A;  3JVT C;  4MZL A;  4A4C A;  3DF0 A;  1YVH A;  1QLS A;  2JUL A;  2AAO A;  2K7D A;  1M46 A;  3D0Y B;  3TS5 C;  1N2D A;  3SG2 A;  3VGO A;  1OMD A;  1YX8 A;  4C0J A;  2JRF A;  1DJY A;  2ISD A;  2JQ6 A;  2FOT A;  1ZUZ A;  1QVI Y;  5JOL A;  4ETO A;  1DJI A;  2L0P A;  2M97 A;  2LVV A;  4JQ0 D;  2LLT A;  2Y5I A;  2EC6 C;  2HQ8 A;  2BKH B;  4ZCV A;  2WOR A;  3SG3 A;  1QV0 A;  2ZKM X;  3A4U B;  2WC8 A;  2MRD A;  1D1O A;  1XFU O;  4AOM A;  1WLM A;  4GBA A;  4YI8 A;  4M2Q A;  1GJY A;  1K9U A;  2KFF A;  1GGZ A;  1SYM A;  5I2L A;  1JF0 A;  2JU0 A;  1MWN A;  4GFT A;  3DVJ A;  5JJG A;  1A75 A;  2G2B A;  3TDI A;  1SK6 D;  1K2H A;  2OTG B;  1QIV A;  1XFY O;  2H61 A;  3K21 A;  4PCW A;  3SJS A;  3CS1 A;  1NP8 A;  1SR6 B;  3BUW B;  2K7O A;  1MXL C;  4OKH A;  1FI6 A;  2M7N A;  3FWB A;  1ODB A;  4M2P A;  3FIA A;  2F2O A;  1KK7 Z;  1TNW A;  1ALW A;  2KYC A;  1QX7 A;  1LVC D;  1CB1 A;  1DTL A;  1L2O B;  2KBM A;  4NQG A;  1FPW A;  2BCX A;  3NSL A;  4AQJ A;  2ZND A;  2CBL A;  4I5L B;  2KAY A;  5FYX A;  1JC2 A;  2M3W A;  2BEC A;  1CLL A;  2QAC A;  1BOC A;  1IGV A;  1XFV O;  3AAJ A;  2ZRS A;  1WDC B;  1GGW A;  1S6J A;  3IF7 A;  5IBW A;  3OHM B;  1C07 A;  3CZT X;  4OVN F;  2JC2 A;  3CR5 X;  5B8I B;  1KK8 C;  1ALV A;  1TRF A;  2KQY A;  1KFU L;  1TTX A;  1K95 A;  1KWO C;  1EJ3 A;  2JNF A;  2M1K B;  3EK7 A;  1KSM A;  1NX0 A;  4A4B A;  1BG1 A;  1RWY A;  4GGF A;  3TS5 B;  1RJV A;  3LK1 A;  1LKJ A;  1GQM A;  1BLQ A;  3I5H C;  2JZI A;  3H4S E;  2MJW B;  3HCM A;  3BUO B;  1JF2 A;  1K9K A;  3IQO A;  2LV7 A;  1QVI Z;  1WLZ A;  5BPJ A;  1E8A A;  1JSA A;  1AHR A;  2JPT A;  1B9A A;  5AEQ A;  1X02 A;  2RGI A;  2CNP A;  2I2R E;  2LMV A;  2LAP A;  3E3R A;  1J1E A;  1SMG A;  1IKU A;  1IH0 A;  1CNP A;  3ZWH A;  4GNK B;  2KOT A;  4WRI A;  1PK0 D;  2PSR A;  4OCI A;  1WY9 A;  2M8U A;  4PE1 A;  4PHN A;  3BXK A;  1S6C A;  1JBA A;  3C1V A;  1CLM A;  5KTY A;  1BJF A;  1B47 A;  1U5I A;  3DD4 A;  3OB1 B;  4DRW A;  1Q80 A;  2OTG C;  4D1E A;  1WRZ A;  2NXQ A;  1XK4 C;  2NCO A;  5F6T A;  1DJH A;  4HRH A;  1L7Z A;  5I2Q A;  1KQV A;  4CFQ A;  1R2U A;  2JT3 A;  4XJK B;  3OX6 A;  2LP2 A;  1XVJ A;  2BL0 B;  3SG4 A;  2GGM A;  4Q04 A;  1DJW A;  1G4Y R;  1CFC A;  2ZNE A;  1AJ4 A;  1EXR A;  2BBN A;  4OV2 A;  4PAL A;  2PVB A;  2QPT A;  2E30 A;  2CXJ A;  4BY5 A;  3DF0 B;  3DVE A;  1MHO A;  1MUX A;  2K61 A;  2L4I A;  2L4H A;  3NSI A;  1OE9 B;  2M7L A;  2MHH A;  3BOW A;  4JWQ A;  2KGR A;  2OS8 C;  1YTZ C;  2IS9 A;  1ZAC A;  1JFJ A;  5HLO A;  1A2X A;  1SCM C;  2Y1N A;  1BT6 A;  3BQ3 A;  5DKN A;  4YI9 A;  5CSF A;  1CM4 A;  3I5H B;  1NUB A;  2EHB A;  1PVB A;  2NLN A;  1IWQ A;  3CR2 A;  1EG4 A;  1QXP A;  5CSI A;  5GQQ C;  1DF0 B;  1J7P A;  4I5J A;  2JTZ A;  2P6B B;  3KF9 A;  1TCO B;  4HRE E;  1K96 A;  2EGD A;  2JT0 A;  2M29 A;  3AKA A;  4CPV A;  1XYD A;  4MRX A;  1NCZ A;  3SIA A;  1WRK A;  4JPZ B;  2KI4 B;  3LK0 A;  4AQI A;  1A75 B;  1QAT A;  1LXF C;  3PAL A;  1TNX A;  4YGC B;  1LA3 A;  1KCY A;  2JTT A;  1XFW O;  5I2O A;  2JXL A;  1CLB A;  4DIR A;  2VRG A;  4ORC B;  1M63 B;  2WCB A;  1B7T Z;  2LVJ A;  3PN7 B;  2F3Y A;  1S6I A;  1XFX O;  3O2P A;  1OZO A;  2F2P A;  1PVA A;  2ZN8 A;  1DVI A;  2KDH A;  3GK2 A;  1LA0 A;  1Y6W A;  1DGU A;  1S1E A;  3QRX A;  1EL4 A;  2K7B A;  1ZFS A;  2KHN A;  3KEV A;  2BE6 A;  1IG5 A; 
#chains in the Genus database with same CATH topology
 1NX3 A;  4P5O E;  1G8I A;  2PYQ A;  1YX7 A;  2JNX A;  2L98 A;  4PDZ A;  1PSR A;  1QJT A;  1Z2C B;  2KFH A;  2R2I A;  3I5G C;  1CFF A;  1BOD A;  2QEO A;  5KU1 A;  2K2F A;  2BCA A;  2BL0 C;  2QEV A;  4PE0 A;  2CTN A;  1YRU B;  2PAS A;  2V53 A;  3D75 A;  1REC A;  1ZOT B;  2O5G A;  4N1G A;  4MSP A;  3CZ2 A;  1F4O A;  4I5K A;  3GOF A;  1SL8 A;  1CMG A;  2OS8 B;  3EK4 A;  1UUR A;  2BBM A;  3EVU A;  3NXA A;  3RLZ A;  1CMF A;  2AMI A;  3PM8 A;  1PUL A;  2LUX A;  2PMY A;  3FS7 A;  2WOS A;  2G9B A;  2Y1M A;  3EKH A;  5DKR A;  1SCM B;  1C7W A;  2M9G A;  1J7R A;  1S36 A;  2JOJ A;  5TNC A;  2FCD A;  3D10 A;  2M1U A;  3BYA A;  4WQ3 A;  3EKJ A;  1OOG A;  1KFX L;  2I18 A;  4C0L A;  2Q4U A;  1SRA A;  2FJU B;  4WQ2 A;  5HKY A;  1N65 A;  2SCP A;  2MBX A;  4QJ4 B;  1MR8 A;  1F55 A;  1YRT B;  2K7C A;  3SS5 A;  1J1D A;  2HET A;  4JD9 A;  2WCH A;  2KI4 C;  2L5Y A;  3KHE A;  1UHI A;  3S0A A;  1JFK A;  3B88 A;  2L2E A;  2JT8 A;  1OOF A;  1S3P A;  2QDI A;  5KSZ A;  3BUM B;  1U5I B;  4FQT A;  1H8B A;  4YGE B;  3DZT A;  3PFV A;  4YGD B;  4GUK A;  2JWW A;  3SG7 A;  1Y0V H;  2H61 C;  4MBE A;  3SG6 A;  3WHT B;  3PJI A;  4MVF A;  3S0G A;  2PAL A;  1B7T Y;  1K90 D;  1LIN A;  1XFZ O;  3BFA A;  1QX2 A;  1IJ5 A;  3CR4 X;  3JTD B;  2F33 A;  1OMV A;  2WCE A;  2ZFD A;  1B8R A;  1K94 A;  3PN7 C;  1SPY A;  4C0K A;  2BCB A;  1TNP A;  1YUU A;  2KAX A;  4MRY A;  5J3X A;  3CWG A;  2KGB C;  3SS3 A;  4CID A;  2BE6 A;  3TUY C;  5D7F A;  3R72 A;  1CDN A;  1SY9 A;  2HF5 A;  2B1U A;  1CTR A;  2P70 A;  2BE4 A;  5FI2 A;  1A29 A;  3I5G B;  4OR9 B;  2L51 A;  2A4J A;  3HX4 A;  1B8C A;  1AP4 A;  3TDZ A;  1IIO A;  3SIB A;  1K93 D;  2L2C A;  1V1F A;  1A4P A;  3RZS A;  1IQ3 A;  3EVR A;  1CDM A;  3L4L A;  2WND A;  1JWD A;  4KYN A;  2SAS A;  1HQV A;  1S5G Y;  2AUC A;  4TNC A;  3D78 A;  1F8H A;  3B87 A;  3RM1 A;  5CPV A;  4F0Z B;  2K8M B;  3NSO A;  3AAK A;  4IJ7 A;  4GGF C;  2K0J A;  1F70 A;  1UP5 A;  2O60 A;  1K9P A;  3K1E A;  1JUO A;  1SL7 A;  1RRO A;  1UHH A;  3BFH A;  4MEW A;  3VRN A;  2I7A A;  3EG5 B;  2H8V A;  1TCF A;  4MN0 A;  1F71 A;  5K89 A;  2KYF A;  3F45 A;  1DEK A;  2WCL A;  1W7J B;  4MZJ A;  1FI5 A;  2I94 A;  4INW A;  2Y4Q A;  4INX A;  2TN4 A;  3LCP C;  1W7I B;  3S0D A;  1TNQ A;  5AER A;  2K2A A;  1XA5 A;  2NCP A;  4BY4 A;  2CT9 A;  1TWO A;  1KFU S;  4PHM A;  1CM1 A;  5PAL A;  1CDL A;  1YVL A;  4XJK A;  3CGA A;  1QV1 A;  3EVV A;  4I5N B;  4E68 A;  5AAN A;  4PE7 A;  1B8L A;  1J7O A;  2LHI A;  2BKI B;  1NX2 A;  1AVS A;  1OQP A;  3VRO A;  1Y1A A;  1BMO A;  1KFX S;  2Q91 A;  3BUX B;  3I5I B;  3GK4 X;  5HKW A;  1OOJ A;  3R1O A;  4QJ3 B;  5ER4 X;  2LM5 A;  4MZK A;  1WRL A;  3I5F C;  4HRG A;  4GAO A;  1QX5 B;  1VRK A;  4FQO A;  5FI6 A;  1AUI B;  1FBV A;  1YUS A;  1H4B A;  3JTD C;  3TUY B;  2L5X B;  3PAT A;  4DCK A;  3CZ1 A;  1DC1 A;  2NZ0 A;  5CSN A;  2KI6 C;  3DVM A;  4DS7 A;  1N0Y A;  3BJH A;  3BUN B;  2LHL A;  1QAS A;  2F3Z A;  4PHJ A;  2KLD A;  1A03 A;  1Y1X A;  3D0Y A;  5D69 A;  4YGA A;  2LVK A;  3NSK A;  1DJX A;  1DF0 A;  2H2K A;  3EK8 A;  1M39 A;  3MSE B;  1J7Q A;  1NSH A;  4DUQ A;  3LLE A;  2COL B;  2PRU A;  1KQM B;  1PSB A;  1MXE A;  1KSO A;  3BFB A;  4PHK A;  2LLS A;  1Z4H A;  2FJY A;  2HPS A;  1S5G Z;  1MF8 B;  4N1F A;  1SW8 A;  2LUC A;  4ICB A;  4M2O A;  5AXI A;  2LMU A;  1BR1 B;  4IL1 A;  2LMT A;  5HYD A;  1CDP A;  1UHN A;  1CFP A;  1B4C A;  1SBJ A;  2LLU A;  3WNX B;  1DGV A;  1OW4 A;  2KLE A;  1NPQ A;  2GV5 A;  5I8N A;  1F54 A;  1EG3 A;  1V1G A;  2MLE C;  1XK4 A;  3V2L A;  3CTN A;  3WXA A;  1TOP A;  1SL9 A;  3IQQ A;  2L50 A;  2E6W A;  2M49 B;  1IRJ A;  2KFG A;  2FCE A;  1BF5 A;  1RTP 1;  4YBH B;  3TZ1 A;  1F4Q A;  2LC5 A;  1G33 A;  3ZNI A;  2LE9 B;  1NCY A;  1P28 A;  2LP3 A;  4U8D A;  3UNW A;  2D8N A;  3FWC A;  1OZS A;  3JVT B;  3VRP A;  1QTX A;  2KI6 D;  3PM2 A;  4YRU A;  1DT7 B;  3I5F B;  2DOQ A;  3O4X A;  4MLW A;  1AK8 A;  5ER5 A;  1NX1 A;  3I5I C;  3PLF B;  2MA2 A;  4HSZ A;  1TIZ A;  2LVI A;  3LL8 B;  1BU3 A;  4L9M A;  3DVK A;  3D74 A;  1UHJ A;  1YR5 A;  5G08 A;  1R6P A;  4YGB B;  2LNK A;  5FI7 A;  2EC6 B;  4ORB B;  3DY9 A;  2WCJ A;  1MQ1 A;  2KSP A;  2LCP A;  2ZRT A;  2KNE A;  5HLV A;  4CFR A;  5CSJ A;  1M31 A;  3KO0 A;  1SCV A;  1C7V A;  4GPL B;  3PSR A;  2HQW A;  2M0R A;  3NHI A;  1LS8 A;  3SG5 A;  1NCX A;  1UWO A;  1DJG A;  5HKZ A;  3SS4 A;  1CFD A;  1YUR A;  3BOW B;  3KPX A;  3M0W A;  2CCM A;  4ZCU A;  1DMO A;  2MLF C;  3VRR A;  1KQM C;  2F8P A;  2ZN9 A;  3TDU A;  2KAV A;  1HT9 A;  1TN4 A;  2QEH A;  1QLK A;  1S26 D;  3VB1 A;  3B6X A;  2WCF A;  4GGN A;  4N5X A;  4NDD A;  3OP0 A;  5DKQ A;  1PRW A;  4UPG A;  1EH2 A;  1Y1U A;  5AFP A;  4P2Y B;  1FW4 A;  3A8R A;  1SNL A;  1NIW A;  1NYA A;  2MAZ A;  3O4Y A;  1SR6 C;  3OX5 A;  1M45 A;  2KBI A;  4ORA B;  1YUT A;  4QJ5 B;  1KK7 Y;  1ZMZ A;  4PE4 A;  1OMR A;  1FF1 A;  3ICB A;  2GGZ A;  4USL A;  2OPO A;  4CLN A;  1UUS A;  4FTG A;  1L2O C;  4NDC A;  1PAL A;  4R1E A;  1RK9 A;  1IJ6 A;  1AJ5 A;  5EL2 A;  3WHU B;  1B1G A;  3GK1 A;  1NWD A;  3CLN A;  2KQ6 A;  1UHK A;  1IQ5 A;  1KK8 B;  2JXC A;  1RFJ A;  4XYN A;  2LAN A;  1K8U A;  1BR4 B;  1KWO B;  1SKT A;  1WDC C;  1CKK A;  3OB2 B;  3O6B A;  1QIW A;  3O78 A;  3AKB A;  1OSA A;  3VRQ A;  1QS7 A;  4NDB A;  1J55 A;  1DJZ A;  3JVT C;  4MZL A;  4A4C A;  2WC6 A;  3DF0 A;  1YVH A;  3IVT A;  2WCM A;  3D77 A;  1QLS A;  3N7H A;  3DXL A;  2JUL A;  2AAO A;  2K7D A;  1M46 A;  3D0Y B;  5DIC A;  1N2D A;  3TS5 C;  3SG2 A;  3VGO A;  1OMD A;  1YX8 A;  1T14 A;  2JRF A;  4C0J A;  1DJY A;  2ISD A;  2JQ6 A;  3S0E A;  2FOT A;  1ZUZ A;  1QVI Y;  1W9Z A;  5JOL A;  4ETO A;  3CAB A;  1DJI A;  2L0P A;  2M97 A;  2LVV A;  4JQ0 D;  2WC5 A;  2LLT A;  2Y5I A;  2EC6 C;  2HQ8 A;  2BKH B;  4ZCV A;  4OZD A;  2WOR A;  3SG3 A;  1QV0 A;  2ZKM X;  3A4U B;  2WC8 A;  2MRD A;  3S0F A;  1D1O A;  1XFU O;  4AOM A;  1WLM A;  4GBA A;  4YI8 A;  4M2Q A;  1GJY A;  1K9U A;  2KFF A;  1GGZ A;  1SYM A;  4JKT A;  5I2L A;  1JF0 A;  2JU0 A;  1MWN A;  3CYZ A;  4GFT A;  3DVJ A;  5JJG A;  1A75 A;  2G2B A;  3TDI A;  1SK6 D;  1K2H A;  2OTG B;  1QIV A;  1XFY O;  2H61 A;  3K21 A;  4PCW A;  3SJS A;  3CS1 A;  1NP8 A;  3FE6 A;  3L47 A;  1SR6 B;  3BUW B;  2K7O A;  5I94 A;  1MXL C;  4OKH A;  1FI6 A;  2M7N A;  3FWB A;  1ODB A;  4M2P A;  3FIA A;  2F2O A;  1KK7 Z;  1TNW A;  1ALW A;  2KYC A;  1QX7 A;  1LVC D;  1CB1 A;  1DTL A;  1L2O B;  2KBM A;  4NQG A;  1FPW A;  2BCX A;  3NSL A;  2WCK A;  2YGU A;  2ZND A;  2CBL A;  4I5L B;  4AQJ A;  2KAY A;  5FYX A;  1JC2 A;  2M3W A;  2BEC A;  1CLL A;  2QAC A;  1BOC A;  1IGV A;  1XFV O;  3AAJ A;  2ZRS A;  1WDC B;  1GGW A;  1S6J A;  3IF7 A;  5IBW A;  3OHM B;  1C07 A;  2P71 A;  3CZT X;  2JC2 A;  3CR5 X;  3FE8 A;  1KK8 C;  1ALV A;  1TRF A;  2KQY A;  1KFU L;  1TTX A;  1K95 A;  1KWO C;  1EJ3 A;  2JNF A;  2M1K B;  3D73 A;  3EK7 A;  1KSM A;  1C3Y A;  1NX0 A;  4PT1 A;  1OOH A;  4A4B A;  1BG1 A;  1RWY A;  4GGF A;  3TS5 B;  1RJV A;  5HL1 A;  3LK1 A;  1LKJ A;  1GQM A;  1BLQ A;  3I5H C;  2JZI A;  3H4S E;  2MJW B;  3HCM A;  3BUO B;  1JF2 A;  1K9K A;  3IQO A;  2LV7 A;  1QVI Z;  1WLZ A;  2QEB A;  5BPJ A;  1E8A A;  2BAP A;  1JSA A;  1AHR A;  2JPT A;  1B9A A;  5AEQ A;  1X02 A;  2RGI A;  2CNP A;  2I2R E;  2PQL A;  5B8I B;  2LMV A;  3S0B A;  3CDN A;  2K60 A;  2LAP A;  3E3R A;  1J1E A;  1SMG A;  1IKU A;  1IH0 A;  1CNP A;  3ZWH A;  4GNK B;  2KOT A;  1TUZ A;  4WRI A;  1PK0 D;  2PSR A;  4OCI A;  1WY9 A;  2M8U A;  4PE1 A;  4PHN A;  3BXK A;  1S6C A;  1JBA A;  3C1V A;  1CLM A;  5KTY A;  1BJF A;  1B47 A;  1U5I A;  2KPH A;  3DD4 A;  3OB1 B;  1Q80 A;  2OTG C;  4DRW A;  1WRZ A;  2NXQ A;  4D1E A;  1XK4 C;  2NCO A;  5F6T A;  1DJH A;  4HRH A;  1L7Z A;  5I2Q A;  1KQV A;  4CFQ A;  1R2U A;  2JT3 A;  4XJK B;  3OX6 A;  2LP2 A;  1XVJ A;  2BL0 B;  3SG4 A;  3QME A;  2GGM A;  4Q04 A;  1DJW A;  1G4Y R;  1CFC A;  2ZNE A;  1AJ4 A;  1EXR A;  2BBN A;  2ERB A;  4OV2 A;  1OOI X;  4PAL A;  2PVB A;  3NHT A;  1SSE B;  2E30 A;  2CXJ A;  2QPT A;  3DF0 B;  4BY5 A;  3CZ0 A;  3DVE A;  1MHO A;  3R1P A;  1MUX A;  2K61 A;  2L4I A;  2L4H A;  3B7A A;  3NSI A;  1OE9 B;  3L4A A;  2M7L A;  1C3Z A;  2MHH A;  3BOW A;  2BNX A;  3B86 A;  4JWQ A;  2KGR A;  2OS8 C;  1YTZ C;  1QWV A;  2IS9 A;  1ZAC A;  1JFJ A;  1DQE A;  5HLO A;  3R1V A;  1A2X A;  1SCM C;  2Y1N A;  1BT6 A;  1TUJ A;  3BQ3 A;  4YI9 A;  5CSF A;  1CM4 A;  5DKN A;  4F7F A;  3I5H B;  2JPO A;  1NUB A;  2EHB A;  1PVB A;  2NLN A;  1IWQ A;  3CR2 A;  1EG4 A;  4OVN F;  1QXP A;  5CSI A;  5GQQ C;  1DF0 B;  1DEL A;  4I5J A;  1J7P A;  2JTZ A;  2P6B B;  3KF9 A;  1TCO B;  4HRE E;  1K96 A;  2EGD A;  2JT0 A;  2M29 A;  3AKA A;  4CPV A;  1XYD A;  4MRX A;  3D76 A;  1NCZ A;  3FE9 A;  1WRK A;  3NGV A;  3Q8I A;  4JPZ B;  3SIA A;  2KI4 B;  3LK0 A;  3OGN A;  4AQI A;  2GTE A;  1A75 B;  1QAT A;  1GM0 A;  1LXF C;  3PAL A;  1TNX A;  1XFR A;  1LA3 A;  4YGC B;  5D3O A;  1KCY A;  2JTT A;  1XFW O;  5I2O A;  3DYE A;  2JXL A;  1ORG A;  1CLB A;  4DIR A;  2VRG A;  4ORC B;  1M63 B;  2WCB A;  1B7T Z;  2LVJ A;  3PN7 B;  2F3Y A;  1S6I A;  1XFX O;  3O2P A;  1OZO A;  2F2P A;  3UO9 A;  1PVA A;  2ZN8 A;  3OBV A;  1DVI A;  2KDH A;  3GK2 A;  1LA0 A;  1Y6W A;  1DGU A;  1S1E A;  3QRX A;  1EL4 A;  2K7B A;  1ZFS A;  2KHN A;  3KEV A;  1XO5 A;  1IG5 A; 
#chains in the Genus database with same CATH homology
 1NX3 A;  4P5O E;  1G8I A;  1YX7 A;  2JNX A;  2L98 A;  4PDZ A;  1PSR A;  1QJT A;  2KFH A;  2R2I A;  3I5G C;  1CFF A;  1BOD A;  5KU1 A;  2K2F A;  2BCA A;  2BL0 C;  4PE0 A;  2CTN A;  1YRU B;  2PAS A;  2V53 A;  1REC A;  1ZOT B;  2O5G A;  4N1G A;  4MSP A;  1F4O A;  4I5K A;  3GOF A;  1SL8 A;  1CMG A;  2OS8 B;  3EK4 A;  1UUR A;  2BBM A;  3EVU A;  3NXA A;  3RLZ A;  1CMF A;  2AMI A;  3PM8 A;  1PUL A;  2LUX A;  2PMY A;  3FS7 A;  2WOS A;  2G9B A;  2Y1M A;  3EKH A;  5DKR A;  1SCM B;  1C7W A;  2M9G A;  1J7R A;  1S36 A;  2JOJ A;  5TNC A;  2FCD A;  3D10 A;  2M1U A;  3BYA A;  4WQ3 A;  3EKJ A;  1KFX L;  2I18 A;  4C0L A;  2Q4U A;  1SRA A;  2FJU B;  4WQ2 A;  5HKY A;  1N65 A;  2SCP A;  2MBX A;  4QJ4 B;  1MR8 A;  1F55 A;  1YRT B;  2K7C A;  1J1D A;  2HET A;  2KI4 C;  3KHE A;  1UHI A;  1JFK A;  2L2E A;  2JT8 A;  1S3P A;  5KSZ A;  3BUM B;  1U5I B;  1H8B A;  4YGE B;  3PFV A;  4YGD B;  4GUK A;  2JWW A;  3SG7 A;  1Y0V H;  2H61 C;  4MBE A;  3SG6 A;  3WHT B;  4MVF A;  4DS7 A;  2PAL A;  1B7T Y;  1K90 D;  1LIN A;  1XFZ O;  1QX2 A;  1IJ5 A;  3CR4 X;  3JTD B;  2F33 A;  1OMV A;  2WCE A;  2ZFD A;  1B8R A;  1K94 A;  3PN7 C;  1SPY A;  4C0K A;  2BCB A;  1TNP A;  1YUU A;  2KAX A;  4MRY A;  5J3X A;  3CWG A;  2KGB C;  4CID A;  3TUY C;  5D7F A;  1CDN A;  1SY9 A;  2HF5 A;  2B1U A;  1CTR A;  2BE4 A;  1A29 A;  3I5G B;  4OR9 B;  2L51 A;  2A4J A;  3HX4 A;  1B8C A;  1AP4 A;  3TDZ A;  3SIB A;  1K93 D;  1V1F A;  1A4P A;  1IQ3 A;  3EVR A;  1CDM A;  2WND A;  1JWD A;  2SAS A;  1HQV A;  1S5G Y;  2AUC A;  4TNC A;  1F8H A;  3RM1 A;  5CPV A;  4F0Z B;  2K8M B;  3NSO A;  3AAK A;  4GGF C;  2K0J A;  1F70 A;  1UP5 A;  2O60 A;  1K9P A;  1JUO A;  1SL7 A;  1RRO A;  1UHH A;  4MEW A;  3VRN A;  2I7A A;  1TCF A;  4MN0 A;  1F71 A;  5K89 A;  2KYF A;  3F45 A;  1W7J B;  4MZJ A;  1FI5 A;  2I94 A;  2Y4Q A;  2TN4 A;  3LCP C;  1W7I B;  1TNQ A;  5AER A;  2K2A A;  1XA5 A;  2NCP A;  4BY4 A;  2CT9 A;  1KFU S;  4PHM A;  1CM1 A;  5PAL A;  1CDL A;  1YVL A;  4XJK A;  3CGA A;  1QV1 A;  3EVV A;  4I5N B;  4E68 A;  5AAN A;  4PE7 A;  1B8L A;  1J7O A;  2LHI A;  2BKI B;  1NX2 A;  1AVS A;  1OQP A;  3VRO A;  1Y1A A;  1BMO A;  1KFX S;  2Q91 A;  3BUX B;  3I5I B;  3GK4 X;  5HKW A;  1OOJ A;  4QJ3 B;  5ER4 X;  2LM5 A;  4MZK A;  1WRL A;  3I5F C;  4HRG A;  4GAO A;  1QX5 B;  1VRK A;  4FQO A;  1AUI B;  1FBV A;  1YUS A;  1H4B A;  3JTD C;  3TUY B;  2L5X B;  3PAT A;  4DCK A;  2NZ0 A;  5CSN A;  2KI6 C;  3DVM A;  1N0Y A;  3BUN B;  2LHL A;  1QAS A;  2F3Z A;  4PHJ A;  1A03 A;  1Y1X A;  3D0Y A;  5D69 A;  4YGA A;  2LVK A;  3NSK A;  1DJX A;  1DF0 A;  2H2K A;  3EK8 A;  1M39 A;  3MSE B;  1J7Q A;  1NSH A;  4DUQ A;  3LLE A;  2COL B;  2PRU A;  1KQM B;  1PSB A;  1MXE A;  1KSO A;  4PHK A;  2LLS A;  2HPS A;  1S5G Z;  1MF8 B;  4N1F A;  1SW8 A;  2LUC A;  4ICB A;  4M2O A;  5AXI A;  2LMU A;  1BR1 B;  4IL1 A;  2LMT A;  5HYD A;  1CDP A;  1UHN A;  1CFP A;  1B4C A;  1SBJ A;  2LLU A;  3WNX B;  1DGV A;  1NPQ A;  2GV5 A;  5I8N A;  1F54 A;  1EG3 A;  1V1G A;  2MLE C;  1XK4 A;  3CTN A;  3WXA A;  1TOP A;  1SL9 A;  3IQQ A;  2L50 A;  2E6W A;  2M49 B;  1IRJ A;  2KFG A;  2FCE A;  1BF5 A;  1RTP 1;  4YBH B;  3TZ1 A;  1F4Q A;  2LC5 A;  1G33 A;  3ZNI A;  2LE9 B;  1NCY A;  2LP3 A;  4U8D A;  2D8N A;  3FWC A;  1OZS A;  3JVT B;  3VRP A;  1QTX A;  2KI6 D;  1XO5 A;  4YRU A;  1DT7 B;  3I5F B;  2DOQ A;  4MLW A;  1AK8 A;  5ER5 A;  1NX1 A;  3I5I C;  3PLF B;  2MA2 A;  4HSZ A;  1TIZ A;  2LVI A;  3LL8 B;  1BU3 A;  4L9M A;  3DVK A;  1UHJ A;  1YR5 A;  5G08 A;  1R6P A;  4YGB B;  2LNK A;  2EC6 B;  4ORB B;  1MQ1 A;  2KSP A;  2LCP A;  2ZRT A;  2KNE A;  5HLV A;  4CFR A;  5CSJ A;  1M31 A;  3KO0 A;  1SCV A;  1C7V A;  4GPL B;  3PSR A;  2HQW A;  2M0R A;  3SG5 A;  1NCX A;  1UWO A;  1DJG A;  5HKZ A;  1CFD A;  1YUR A;  3BOW B;  3KPX A;  3M0W A;  2CCM A;  4ZCU A;  1DMO A;  2MLF C;  3VRR A;  1KQM C;  2F8P A;  2ZN9 A;  3TDU A;  2KAV A;  1HT9 A;  1TN4 A;  1QLK A;  1S26 D;  2WCF A;  4GGN A;  4N5X A;  4NDD A;  3OP0 A;  5DKQ A;  1PRW A;  4UPG A;  1EH2 A;  1Y1U A;  5AFP A;  4P2Y B;  1FW4 A;  3A8R A;  1SNL A;  1NIW A;  1NYA A;  2MAZ A;  3O4Y A;  1SR6 C;  3OX5 A;  1M45 A;  2KBI A;  4ORA B;  1YUT A;  4QJ5 B;  1KK7 Y;  1ZMZ A;  4PE4 A;  1OMR A;  1FF1 A;  3ICB A;  2GGZ A;  4USL A;  2OPO A;  4CLN A;  1UUS A;  4FTG A;  1L2O C;  4NDC A;  1PAL A;  4R1E A;  1RK9 A;  1IJ6 A;  1AJ5 A;  3WHU B;  1B1G A;  3GK1 A;  1NWD A;  3CLN A;  2KQ6 A;  1UHK A;  1IQ5 A;  1KK8 B;  2JXC A;  1RFJ A;  4XYN A;  2LAN A;  1K8U A;  1BR4 B;  1KWO B;  1SKT A;  1WDC C;  1CKK A;  3OB2 B;  3O6B A;  1QIW A;  3O78 A;  3AKB A;  1OSA A;  3VRQ A;  1QS7 A;  4NDB A;  1J55 A;  1DJZ A;  3JVT C;  4MZL A;  4A4C A;  3DF0 A;  1YVH A;  1QLS A;  2JUL A;  2AAO A;  2K7D A;  1M46 A;  3D0Y B;  3TS5 C;  1N2D A;  3SG2 A;  3VGO A;  1OMD A;  1YX8 A;  4C0J A;  2JRF A;  1DJY A;  2ISD A;  2JQ6 A;  2FOT A;  1ZUZ A;  1QVI Y;  5JOL A;  4ETO A;  1DJI A;  2L0P A;  2M97 A;  2LVV A;  4JQ0 D;  2LLT A;  2Y5I A;  2EC6 C;  2HQ8 A;  2BKH B;  4ZCV A;  2WOR A;  3SG3 A;  1QV0 A;  2ZKM X;  3A4U B;  2WC8 A;  2MRD A;  1D1O A;  1XFU O;  4AOM A;  1WLM A;  4GBA A;  4YI8 A;  4M2Q A;  1GJY A;  1K9U A;  2KFF A;  1GGZ A;  1SYM A;  5I2L A;  1JF0 A;  2JU0 A;  1MWN A;  4GFT A;  3DVJ A;  5JJG A;  1A75 A;  2G2B A;  3TDI A;  1SK6 D;  1K2H A;  2OTG B;  1QIV A;  1XFY O;  2H61 A;  3K21 A;  4PCW A;  3SJS A;  3CS1 A;  1NP8 A;  1SR6 B;  3BUW B;  2K7O A;  1MXL C;  4OKH A;  1FI6 A;  2M7N A;  3FWB A;  1ODB A;  4M2P A;  3FIA A;  2F2O A;  1KK7 Z;  1TNW A;  1ALW A;  2KYC A;  1QX7 A;  1LVC D;  1CB1 A;  1DTL A;  1L2O B;  2KBM A;  4NQG A;  1FPW A;  2BCX A;  3NSL A;  4AQJ A;  2ZND A;  2CBL A;  4I5L B;  2KAY A;  5FYX A;  1JC2 A;  2M3W A;  2BEC A;  1CLL A;  2QAC A;  1BOC A;  1IGV A;  1XFV O;  3AAJ A;  2ZRS A;  1WDC B;  1GGW A;  1S6J A;  3IF7 A;  5IBW A;  3OHM B;  1C07 A;  3CZT X;  4OVN F;  2JC2 A;  3CR5 X;  5B8I B;  1KK8 C;  1ALV A;  1TRF A;  2KQY A;  1KFU L;  1TTX A;  1K95 A;  1KWO C;  1EJ3 A;  2JNF A;  2M1K B;  3EK7 A;  1KSM A;  1NX0 A;  4A4B A;  1BG1 A;  1RWY A;  4GGF A;  3TS5 B;  1RJV A;  3LK1 A;  1LKJ A;  1GQM A;  1BLQ A;  3I5H C;  2JZI A;  3H4S E;  2MJW B;  3HCM A;  3BUO B;  1JF2 A;  1K9K A;  3IQO A;  2LV7 A;  1QVI Z;  1WLZ A;  5BPJ A;  1E8A A;  1JSA A;  1AHR A;  2JPT A;  1B9A A;  5AEQ A;  1X02 A;  2RGI A;  2CNP A;  2I2R E;  2LMV A;  2LAP A;  3E3R A;  1J1E A;  1SMG A;  1IKU A;  1IH0 A;  1CNP A;  3ZWH A;  4GNK B;  2KOT A;  4WRI A;  1PK0 D;  2PSR A;  4OCI A;  1WY9 A;  2M8U A;  4PE1 A;  4PHN A;  3BXK A;  1S6C A;  1JBA A;  3C1V A;  1CLM A;  5KTY A;  1BJF A;  1B47 A;  1U5I A;  3DD4 A;  3OB1 B;  4DRW A;  1Q80 A;  2OTG C;  4D1E A;  1WRZ A;  2NXQ A;  1XK4 C;  2NCO A;  5F6T A;  1DJH A;  4HRH A;  1L7Z A;  5I2Q A;  1KQV A;  4CFQ A;  1R2U A;  2JT3 A;  4XJK B;  3OX6 A;  2LP2 A;  1XVJ A;  2BL0 B;  3SG4 A;  2GGM A;  4Q04 A;  1DJW A;  1G4Y R;  1CFC A;  2ZNE A;  1AJ4 A;  1EXR A;  2BBN A;  4OV2 A;  4PAL A;  2PVB A;  2QPT A;  2E30 A;  2CXJ A;  4BY5 A;  3DF0 B;  3DVE A;  1MHO A;  1MUX A;  2K61 A;  2L4I A;  2L4H A;  3NSI A;  1OE9 B;  2M7L A;  2MHH A;  3BOW A;  4JWQ A;  2KGR A;  2OS8 C;  1YTZ C;  2IS9 A;  1ZAC A;  1JFJ A;  5HLO A;  1A2X A;  1SCM C;  2Y1N A;  1BT6 A;  3BQ3 A;  5DKN A;  4YI9 A;  5CSF A;  1CM4 A;  3I5H B;  1NUB A;  2EHB A;  1PVB A;  2NLN A;  1IWQ A;  3CR2 A;  1EG4 A;  1QXP A;  5CSI A;  5GQQ C;  1DF0 B;  1J7P A;  4I5J A;  2JTZ A;  2P6B B;  3KF9 A;  1TCO B;  4HRE E;  1K96 A;  2EGD A;  2JT0 A;  2M29 A;  3AKA A;  4CPV A;  1XYD A;  4MRX A;  1NCZ A;  3SIA A;  1WRK A;  4JPZ B;  2KI4 B;  3LK0 A;  4AQI A;  1A75 B;  1QAT A;  1LXF C;  3PAL A;  1TNX A;  4YGC B;  1LA3 A;  1KCY A;  2JTT A;  1XFW O;  5I2O A;  2JXL A;  1CLB A;  4DIR A;  2VRG A;  4ORC B;  1M63 B;  2WCB A;  1B7T Z;  2LVJ A;  3PN7 B;  2F3Y A;  1S6I A;  1XFX O;  3O2P A;  1OZO A;  2F2P A;  1PVA A;  2ZN8 A;  1DVI A;  2KDH A;  3GK2 A;  1LA0 A;  1Y6W A;  1DGU A;  1S1E A;  3QRX A;  1EL4 A;  2K7B A;  1ZFS A;  2KHN A;  3KEV A;  2BE6 A;  1IG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...