1OOHA

Complex of drosophila odorant binding protein lush with butanol
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
126
structure length
126
Chain Sequence
SHMTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords odorant binding protein LUSH
publication title Structure of a specific alcohol-binding site defined by the odorant binding protein LUSH from Drosophila melanogaster
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 48
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1oohA00
3NHIA 3S0BA 3L4LA 2P70A 3B87A 3S0FA 1OW4A 3NHTA 1OOGA 3BJHA 4FQTA 3L4AA 3B7AA 1XFRA 3PJIA 3R1PA 4OZDA 2KPHA 2JPOA 3R72A 3D75A 3N7HA 1C3YA 2L2CA 4F7FA 2WCLA 3B6XA 3CZ0A 3S0DA 3DY9A 4INWA 2FJYA 3CZ1A 3R1OA 3D73A 3RZSA 1C3ZA 2ERBA 3QMEA 3B86A 3B88A 3L47A 1QWVA 1LS8A 3CDNA 2QEBA 3FE8A 3S0AA 3Q8IA 1ORGA 3D76A 1OOHA 2H8VA 3VB1A 4INXA 3CZ2A 2PQLA 3BFBA 1TUJA 3K1EA 1OOIX 3V2LA 1DQEA 3BFAA 2WCMA 3NGVA 3D74A 3D77A 4PT1A 2GTEA 1T14A 3S0EA 3OGNA 3FE6A 3DXLA 2QEOA 3D78A 3R1VA 1P28A 1TWOA 3DZTA 2WC5A 2WCHA 4JD9A 5EL2A 3BFHA 2WCKA 2P71A 3S0GA 5DICA 2QEVA 3FE9A 2WC6A 2QDIA 1GM0A 1OOFA 2WCJA 2QEHA 3CABA 3CYZA 3DYEA
chains in the Genus database with same CATH superfamily
3PM8A 2JT0A 1IJ5A 1K93D 1VRKA 4DIRA 2YGUA 1NSHA 3NHIA 3UNWA 1WRZA 1Z2CB 2P70A 3B87A 2H61C 4M2PA 4YI8A 2MLEC 3GK1A 1QLKA 2F3YA 5AXIA 1DMOA 1OW4A 1V1FA 1X02A 2BCAA 3NHTA 4GFTA 2M49B 3WHTB 1AK8A 3BJHA 2ZNEA 1ZACA 2ZN8A 1YRTB 4FQTA 3AAJA 3L4AA 3CS1A 1H4BA 2WCFA 1ALVA 4OR9B 3O78A 1Y1UA 3B7AA 1XFRA 5F6TA 1Q80A 2OTGB 1B8RA 1S5GZ 3DD4A 4IL1A 2KAYA 2JNXA 5CSFA 3JTDB 5I2OA 3WXAA 1NPQA 2PASA 1FBVA 3EVUA 1B8LA 1BJFA 2KFGA 1KFXS 1ZUZA 3D0YA 3OP0A 4PHJA 3TS5B 5HKYA 2JU0A 1M45A 1KWOC 2PYQA 2L2CA 4MN0A 2JRFA 4F7FA 2WCLA 3B6XA 4ORCB 1TOPA 2HF5A 4INWA 1IQ5A 1FW4A 3CZ1A 1M63B 1XFYO 2NXQA 1TCFA 1SR6B 3O6BA 1CFDA 3DVEA 3GK4X 4N1FA 2H2KA 3PATA 2Q91A 3B88A 2JWWA 1OMRA 4GUKA 4OCIA 5PALA 3PN7B 1QWVA 1G33A 2H61A 1QLSA 3SIBA 1U5IA 1DTLA 1NCYA 2QEBA 3EVVA 1B47A 1PVAA 2L5XB 3Q8IA 1UWOA 3BUMB 1ORGA 1QX5B 3HX4A 1DJYA 3E3RA 1A2XA 3GK2A 3PSRA 4ICBA 3BFBA 3EKHA 1BR1B 1J55A 1K9KA 2WC8A 3K1EA 1OSAA 1DQEA 3BYAA 2WORA 2F3ZA 1CLMA 4YGCB 5GQQC 2WCMA 1YURA 4PE1A 4OV2A 1KFUL 1UUSA 1YX7A 4USLA 2KAXA 1XYDA 1XVJA 4I5KA 2K61A 1XFUO 1DJHA 4CFRA 2L4IA 1IIOA 1XFXO 5DKRA 3WNXB 3VRRA 2LVIA 1YR5A 1XFVO 4UPGA 1CFFA 1K8UA 1MR8A 2ZFDA 2M3WA 3KEVA 1T14A 2LNKA 4TNCA 1B1GA 3JVTC 1SBJA 3H4SE 1WY9A 1U5IB 2KBMA 3AKAA 3FE6A 2Q4UA 1DGUA 1NX0A 3OX6A 2QEOA 3RM1A 4C0JA 3CR5X 4E68A 1K96A 2MA2A 4R1EA 3DZTA 2K7CA 1QVIY 2M29A 3HCMA 3OX5A 1TNPA 2G9BA 2KYCA 1QV0A 1SKTA 2K7DA 1CDMA 1MUXA 1QASA 1ZFSA 3CTNA 1OOJA 4YGAA 5AERA 5FI7A 3CABA 5CPVA 2LUXA 4DS7A 1SRAA 1OOFA 2WCJA 1KWOB 1NWDA 2F8PA 2ZKMX 2JXLA 3CR4X 1CFPA 2WNDA 2HQ8A 2KOTA 1JUOA 2LLUA 3OB1B 1SNLA 1DEKA 1CMGA 1N65A 1WRKA 2WCBA 1JFKA 4I5JA 2BKHB 2CNPA 3A4UB 1GGZA 1DJGA 1OOGA 2LC5A 1QS7A 2LE9B 4JWQA 2Y1NA 2DOQA 2K7BA 1AVSA 1QTXA 2MBXA 2HETA 2JULA 2PVBA 3NSIA 4ORAB 1F55A 1QX2A 1JC2A 1RJVA 2FCDA 5D3OA 2BKIB 1RFJA 4JPZB 1NX1A 5CSIA 4BY4A 3IVTA 2CTNA 4KYNA 2WCEA 3KF9A 5IBWA 2LLTA 1MXLC 1NYAA 1CB1A 2KPHA 1OMDA 1XK4C 3R72A 2LCPA 3CGAA 2K60A 3AAKA 1CFCA 2JT8A 2Y4QA 3D75A 3N7HA 1SL7A 3FWCA 4BY5A 3S0DA 2F33A 2CBLA 2ZRTA 1QATA 2OPOA 4PHMA 1AUIB 2BE6A 4ORBB 5B8IB 3LK0A 3O4XA 1EG3A 2E6WA 1MF8B 1TUZA 3CR2A 3MSEB 1A29A 1C3ZA 1XFZO 3SG6A 1TNQA 1CLBA 3JVTB 3I5GC 1ALWA 1KK7Z 2MRDA 1S6CA 1JFJA 2M97A 2NCOA 1JF2A 2KI4C 1DGVA 2LHLA 3S0AA 1B4CA 3LLEA 5KSZA 4QJ3B 3K21A 4CIDA 4PE4A 3D76A 1LXFC 2LVKA 3VB1A 2ZN9A 1DF0B 2LVJA 3CZ2A 4INXA 4L9MA 4CLNA 1R2UA 1TUJA 4MZLA 1C3YA 1Y6WA 1OOIX 5HKWA 3V2LA 2Y1MA 1MXEA 2F2OA 3BFAA 5FI2A 1AP4A 2JZIA 2BCBA 2LAPA 1UHKA 2P6BB 4M2OA 1TCOB 4Q04A 2LMTA 3IF7A 1XK4A 4ZCVA 3TUYC 1G8IA 2MHHA 1ZOTB 5JOLA 1EH2A 3BOWA 2G2BA 4WQ2A 2BE4A 3LCPC 2NLNA 2EC6C 1PULA 1CTRA 2NZ0A 1GGWA 5DKNA 2KLEA 4YGDB 1LKJA 1M31A 3BXKA 1DJIA 1K9UA 4NDCA 3OGNA 4DUQA 4PCWA 5I8NA 3AKBA 1TN4A 1BF5A 1K90D 2LANA 1CMFA 4MZJA 1S26D 1W7IB 3CLNA 3D78A 1L2OC 3TDUA 4YRUA 1H8BA 2L98A 4YGEB 1FF1A 2AAOA 1XO5A 1L7ZA 3D0YB 1Y1XA 1QXPA 1BLQA 1NX3A 1RK9A 4JD9A 2MLFC 2KAVA 1NCZA 1QJTA 3BFHA 1K95A 3EK4A 2JXCA 2LM5A 1PK0D 1F8HA 2CXJA 1A75A 2OS8C 1S36A 2WOSA 4GGFC 2SCPA 3PM2A 2WC6A 2M1UA 1OQPA 1GQMA 2EGDA 3BOWB 3SG5A 1RWYA 1B7TY 1BOCA 4PE0A 3DYEA 3UO9A 4N5XA 4AQJA 2KSPA 5ER4X 2L4HA 2L2EA 3SG3A 2KBIA 1FI6A 2K8MB 2LLSA 4HRGA 1NIWA 1F54A 5CSJA 1CDNA 1IRJA 3I5GB 4P5OE 3VRQA 1SYMA 3GOFA 1BU3A 1M39A 2KI4B 1PVBA 1K94A 3DVJA 1R6PA 4JKTA 3EG5B 3TDIA 1CM4A 1OE9B 1LVCD 3PJIA 1OZOA 1SW8A 1SCMC 2M7NA 2RGIA 4A4BA 1IJ6A 1A75B 1A4PA 1DJXA 1W7JB 2LMUA 3DF0A 3SG4A 3R1PA 3EK7A 4OZDA 1S5GY 2AUCA 3VRNA 1E8AA 2JPOA 4MBEA 1K2HA 3F45A 1KSMA 4JQ0D 1S6IA 1SY9A 1UURA 2KI6D 2L5YA 1MQ1A 2ZNDA 3EK8A 3OBVA 4GGFA 3TUYB 3CZ0A 1CDPA 3PALA 4HREE 2FOTA 1QIVA 1IKUA 2JTZA 3R1OA 1IH0A 2BNXA 3D73A 1RTP1 3RZSA 3ICBA 1ZMZA 2MAZA 2EC6B 3BQ3A 5G08A 2K2AA 2PRUA 3I5IC 1IG5A 2ERBA 2KQYA 2PSRA 1CM1A 4HSZA 5D69A 3L47A 3I5HC 1C7VA 1SSEB 1BODA 1JWDA 1WDCC 2GGMA 1LS8A 3NSLA 1Z4HA 4MVFA 4P2YB 1J7PA 4AOMA 2GV5A 1L2OB 1OMVA 2L51A 1HQVA 3C1VA 2COLB 2FJUB 1Y1AA 4FQOA 2PQLA 3SG7A 5HLOA 2PMYA 3DF0B 4MSPA 3KHEA 1MHOA 2BL0C 3FS7A 2E30A 2KHNA 5HLVA 1TNWA 1UHIA 2ISDA 3VROA 1DELA 2KYFA 2OS8B 4ETOA 2K2FA 4YBHB 5I94A 3SG2A 4PE7A 4PHNA 2I18A 3CZTX 1CDLA 4M2QA 1SL8A 2B1UA 2JQ6A 1YVHA 2KDHA 3D74A 1F71A 2O5GA 5CSNA 3RLZA 4NDDA 1PALA 2F2PA 1N2DA 4NQGA 4PDZA 3A8RA 3ZWHA 1GJYA 1FI5A 3ZNIA 3DXLA 4PHKA 1QVIZ 2LVVA 1S6JA 2CT9A 2SASA 5TNCA 4CPVA 1NX2A 1KK8C 1P28A 1TWOA 2O60A 2V53A 2VRGA 4GNKB 2WCHA 4YGBB 1UHJA 5EL2A 3PLFB 5FYXA 2MJWB 2WCKA 2P71A 1K9PA 1MWNA 1SCMB 3S0GA 2AMIA 2HQWA 1ODBA 2KLDA 1A03A 5DICA 1S1EA 2KQ6A 3QRXA 5J3XA 3VGOA 2M1KB 2BAPA 3NXAA 3SS5A 1JF0A 2L0PA 3FE9A 1UHNA 3LL8B 2QDIA 4QJ5B 1QIWA 1TIZA 2BECA 1G4YR 2QEHA 3BUOB 3SJSA 4MEWA 3CYZA 5DKQA 1Y0VH 4MLWA 5D7FA 2KGRA 1V1GA 3SIAA 1D1OA 1DVIA 3S0BA 2TN4A 3I5IB 3L4LA 5FI6A 1M46A 3I5FC 3S0FA 3LK1A 2L50A 3I5HB 2ZRSA 1F70A 1JSAA 1RECA 1PSBA 1KQMC 1WDCB 1WLZA 3DVMA 4ZCUA 1EL4A 2JTTA 2JNFA 5HL1A 1IQ3A 1WRLA 2LUCA 1YUSA 4WRIA 5AEQA 1C07A 1JBAA 2A4JA 2QPTA 3WHUB 3PFVA 2LP2A 3FWBA 3TZ1A 1CLLA 5HKZA 5BPJA 1TNXA 2JC2A 4MRYA 4OKHA 4NDBA 2QACA 1QX7A 2BL0B 1KCYA 2K0JA 2KI6C 1DT7B 2JOJA 2I7AA 2M8UA 1LA0A 2FCEA 2JPTA 1SPYA 3DY9A 4WQ3A 1PRWA 2FJYA 3BUNB 1LA3A 1AJ4A 1N0YA 1NUBA 1WLMA 3O4YA 4GPLB 3FIAA 5ER5A 1BG1A 1YX8A 3IQOA 1LINA 2LV7A 5AFPA 3M0WA 3NSKA 2LHIA 1IGVA 4XJKA 3QMEA 3B86A 1CNPA 4QJ4B 2BBMA 2LP3A 2BCXA 3VRPA 2BBNA 2PALA 3CDNA 4GBAA 1IWQA 1DJWA 1J7RA 1YTZC 2IS9A 3FE8A 5K89A 5HYDA 1BT6A 1RROA 2KFHA 2R2IA 1KK7Y 1OOHA 1YVLA 3KO0A 1XFWO 1DJZA 2H8VA 3OHMB 2GGZA 1C7WA 1KK8B 2KNEA 2M0RA 2OTGC 5AANA 2M7LA 3SS4A 3SS3A 1HT9A 3JTDC 4FTGA 1B9AA 2KGBC 1SK6D 4GGNA 3EVRA 4N1GA 1J7OA 3TS5C 3DVKA 1SL9A 5KTYA 1J7QA 3NGVA 5KU1A 1SCVA 4C0LA 1F4OA 1DC1A 2JT3A 1AHRA 4IJ7A 1BMOA 3TDZA 3D77A 1AJ5A 2NCPA 2HPSA 1EXRA 1KFXL 2D8NA 2I94A 1UHHA 4PT1A 2GTEA 4GAOA 1SR6C 3EKJA 2M9GA 1OZSA 4XJKB 4D1EA 1PSRA 1SMGA 2CCMA 1EG4A 4MZKA 3S0EA 2EHBA 4A4CA 4C0KA 1YUTA 4U8DA 3I5FB 3PN7C 1QV1A 1YRUB 4I5NB 5I2QA 1B8CA 4OVNF 3OB2B 4AQIA 1KQMB 2I2RE 3BUWB 4XYNA 4DCKA 1YUUA 3NSOA 1KQVA 1KSOA 3CWGA 3R1VA 1NP8A 2Y5IA 4DRWA 2WC5A 2KFFA 1NCXA 4YI9A 2LMVA 4HRHA 5I2LA 1FPWA 4F0ZB 3D10A 1J1EA 1J1DA 2K7OA 2QEVA 3O2PA 3IQQA 4MRXA 1B7TZ 1W9ZA 1F4QA 1XA5A 1GM0A 1DF0A 1KFUS 3KPXA 4CFQA 5JJGA 1BR4B 1S3PA 1TTXA 1CKKA 4I5LB 3BUXB 1EJ3A 1TRFA 1UP5A 4PALA
chains in the Genus database with same CATH topology
3NHIA 3S0BA 3L4LA 2P70A 3B87A 3S0FA 1OW4A 3NHTA 1OOGA 3BJHA 4FQTA 3L4AA 3B7AA 1XFRA 3PJIA 3R1PA 4OZDA 2KPHA 2JPOA 3R72A 3D75A 3N7HA 1C3YA 2L2CA 4F7FA 2WCLA 3B6XA 3CZ0A 3S0DA 3DY9A 4INWA 2FJYA 3CZ1A 3R1OA 3D73A 3RZSA 1C3ZA 2ERBA 3QMEA 3B86A 3B88A 3L47A 1QWVA 1LS8A 3CDNA 2QEBA 3FE8A 3S0AA 3Q8IA 1ORGA 3D76A 1OOHA 2H8VA 3VB1A 4INXA 3CZ2A 2PQLA 3BFBA 1TUJA 3K1EA 1OOIX 3V2LA 1DQEA 3BFAA 2WCMA 3NGVA 3D74A 3D77A 4PT1A 2GTEA 1T14A 3S0EA 3OGNA 3FE6A 3DXLA 2QEOA 3D78A 3R1VA 1P28A 1TWOA 3DZTA 2WC5A 2WCHA 4JD9A 5EL2A 3BFHA 2WCKA 2P71A 3S0GA 5DICA 2QEVA 3FE9A 2WC6A 2QDIA 1GM0A 1OOFA 2WCJA 2QEHA 3CABA 3CYZA 3DYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHI A;  3S0B A;  3L4L A;  2P70 A;  3B87 A;  3S0F A;  1OW4 A;  3NHT A;  1OOG A;  3BJH A;  4FQT A;  3L4A A;  3B7A A;  1XFR A;  3PJI A;  3R1P A;  4OZD A;  2KPH A;  2JPO A;  3R72 A;  3D75 A;  3N7H A;  1C3Y A;  2L2C A;  4F7F A;  2WCL A;  3B6X A;  3CZ0 A;  3S0D A;  3DY9 A;  4INW A;  2FJY A;  3CZ1 A;  3R1O A;  3D73 A;  3RZS A;  1C3Z A;  2ERB A;  3QME A;  3B86 A;  3B88 A;  3L47 A;  1QWV A;  1LS8 A;  3CDN A;  2QEB A;  3FE8 A;  3S0A A;  3Q8I A;  1ORG A;  3D76 A;  1OOH A;  2H8V A;  3VB1 A;  4INX A;  3CZ2 A;  2PQL A;  3BFB A;  1TUJ A;  3K1E A;  1OOI X;  3V2L A;  1DQE A;  3BFA A;  2WCM A;  3NGV A;  3D74 A;  3D77 A;  4PT1 A;  2GTE A;  1T14 A;  3S0E A;  3OGN A;  3FE6 A;  3DXL A;  2QEO A;  3D78 A;  3R1V A;  1P28 A;  1TWO A;  3DZT A;  2WC5 A;  2WCH A;  4JD9 A;  5EL2 A;  3BFH A;  2WCK A;  2P71 A;  3S0G A;  5DIC A;  2QEV A;  3FE9 A;  2WC6 A;  2QDI A;  1GM0 A;  1OOF A;  2WCJ A;  2QEH A;  3CAB A;  3CYZ A;  3DYE A; 
#chains in the Genus database with same CATH topology
 3PM8 A;  2JT0 A;  1IJ5 A;  1K93 D;  1VRK A;  4DIR A;  2YGU A;  1NSH A;  3NHI A;  3UNW A;  1WRZ A;  1Z2C B;  2P70 A;  3B87 A;  2H61 C;  4M2P A;  4YI8 A;  2MLE C;  3GK1 A;  1QLK A;  2F3Y A;  5AXI A;  1DMO A;  1OW4 A;  1V1F A;  1X02 A;  2BCA A;  3NHT A;  4GFT A;  2M49 B;  3WHT B;  1AK8 A;  3BJH A;  2ZNE A;  1ZAC A;  2ZN8 A;  1YRT B;  4FQT A;  3AAJ A;  3L4A A;  3CS1 A;  1H4B A;  2WCF A;  1ALV A;  4OR9 B;  3O78 A;  1Y1U A;  3B7A A;  1XFR A;  5F6T A;  1Q80 A;  2OTG B;  1B8R A;  1S5G Z;  3DD4 A;  4IL1 A;  2KAY A;  2JNX A;  5CSF A;  3JTD B;  5I2O A;  3WXA A;  1NPQ A;  2PAS A;  1FBV A;  3EVU A;  1B8L A;  1BJF A;  2KFG A;  1KFX S;  1ZUZ A;  3D0Y A;  3OP0 A;  4PHJ A;  3TS5 B;  5HKY A;  2JU0 A;  1M45 A;  1KWO C;  2PYQ A;  2L2C A;  4MN0 A;  2JRF A;  4F7F A;  2WCL A;  3B6X A;  4ORC B;  1TOP A;  2HF5 A;  4INW A;  1IQ5 A;  1FW4 A;  3CZ1 A;  1M63 B;  1XFY O;  2NXQ A;  1TCF A;  1SR6 B;  3O6B A;  1CFD A;  3DVE A;  3GK4 X;  4N1F A;  2H2K A;  3PAT A;  2Q91 A;  3B88 A;  2JWW A;  1OMR A;  4GUK A;  4OCI A;  5PAL A;  3PN7 B;  1QWV A;  1G33 A;  2H61 A;  1QLS A;  3SIB A;  1U5I A;  1DTL A;  1NCY A;  2QEB A;  3EVV A;  1B47 A;  1PVA A;  2L5X B;  3Q8I A;  1UWO A;  3BUM B;  1ORG A;  1QX5 B;  3HX4 A;  1DJY A;  3E3R A;  1A2X A;  3GK2 A;  3PSR A;  4ICB A;  3BFB A;  3EKH A;  1BR1 B;  1J55 A;  1K9K A;  2WC8 A;  3K1E A;  1OSA A;  1DQE A;  3BYA A;  2WOR A;  2F3Z A;  1CLM A;  4YGC B;  5GQQ C;  2WCM A;  1YUR A;  4PE1 A;  4OV2 A;  1KFU L;  1UUS A;  1YX7 A;  4USL A;  2KAX A;  1XYD A;  1XVJ A;  4I5K A;  2K61 A;  1XFU O;  1DJH A;  4CFR A;  2L4I A;  1IIO A;  1XFX O;  5DKR A;  3WNX B;  3VRR A;  2LVI A;  1YR5 A;  1XFV O;  4UPG A;  1CFF A;  1K8U A;  1MR8 A;  2ZFD A;  2M3W A;  3KEV A;  1T14 A;  2LNK A;  4TNC A;  1B1G A;  3JVT C;  1SBJ A;  3H4S E;  1WY9 A;  1U5I B;  2KBM A;  3AKA A;  3FE6 A;  2Q4U A;  1DGU A;  1NX0 A;  3OX6 A;  2QEO A;  3RM1 A;  4C0J A;  3CR5 X;  4E68 A;  1K96 A;  2MA2 A;  4R1E A;  3DZT A;  2K7C A;  1QVI Y;  2M29 A;  3HCM A;  3OX5 A;  1TNP A;  2G9B A;  2KYC A;  1QV0 A;  1SKT A;  2K7D A;  1CDM A;  1MUX A;  1QAS A;  1ZFS A;  3CTN A;  1OOJ A;  4YGA A;  5AER A;  5FI7 A;  3CAB A;  5CPV A;  2LUX A;  4DS7 A;  1SRA A;  1OOF A;  2WCJ A;  1KWO B;  1NWD A;  2F8P A;  2ZKM X;  2JXL A;  3CR4 X;  1CFP A;  2WND A;  2HQ8 A;  2KOT A;  1JUO A;  2LLU A;  3OB1 B;  1SNL A;  1DEK A;  1CMG A;  1N65 A;  1WRK A;  2WCB A;  1JFK A;  4I5J A;  2BKH B;  2CNP A;  3A4U B;  1GGZ A;  1DJG A;  1OOG A;  2LC5 A;  1QS7 A;  2LE9 B;  4JWQ A;  2Y1N A;  2DOQ A;  2K7B A;  1AVS A;  1QTX A;  2MBX A;  2HET A;  2JUL A;  2PVB A;  3NSI A;  4ORA B;  1F55 A;  1QX2 A;  1JC2 A;  1RJV A;  2FCD A;  5D3O A;  2BKI B;  1RFJ A;  4JPZ B;  1NX1 A;  5CSI A;  4BY4 A;  3IVT A;  2CTN A;  4KYN A;  2WCE A;  3KF9 A;  5IBW A;  2LLT A;  1MXL C;  1NYA A;  1CB1 A;  2KPH A;  1OMD A;  1XK4 C;  3R72 A;  2LCP A;  3CGA A;  2K60 A;  3AAK A;  1CFC A;  2JT8 A;  2Y4Q A;  3D75 A;  3N7H A;  1SL7 A;  3FWC A;  4BY5 A;  3S0D A;  2F33 A;  2CBL A;  2ZRT A;  1QAT A;  2OPO A;  4PHM A;  1AUI B;  2BE6 A;  4ORB B;  5B8I B;  3LK0 A;  3O4X A;  1EG3 A;  2E6W A;  1MF8 B;  1TUZ A;  3CR2 A;  3MSE B;  1A29 A;  1C3Z A;  1XFZ O;  3SG6 A;  1TNQ A;  1CLB A;  3JVT B;  3I5G C;  1ALW A;  1KK7 Z;  2MRD A;  1S6C A;  1JFJ A;  2M97 A;  2NCO A;  1JF2 A;  2KI4 C;  1DGV A;  2LHL A;  3S0A A;  1B4C A;  3LLE A;  5KSZ A;  4QJ3 B;  3K21 A;  4CID A;  4PE4 A;  3D76 A;  1LXF C;  2LVK A;  3VB1 A;  2ZN9 A;  1DF0 B;  2LVJ A;  3CZ2 A;  4INX A;  4L9M A;  4CLN A;  1R2U A;  1TUJ A;  4MZL A;  1C3Y A;  1Y6W A;  1OOI X;  5HKW A;  3V2L A;  2Y1M A;  1MXE A;  2F2O A;  3BFA A;  5FI2 A;  1AP4 A;  2JZI A;  2BCB A;  2LAP A;  1UHK A;  2P6B B;  4M2O A;  1TCO B;  4Q04 A;  2LMT A;  3IF7 A;  1XK4 A;  4ZCV A;  3TUY C;  1G8I A;  2MHH A;  1ZOT B;  5JOL A;  1EH2 A;  3BOW A;  2G2B A;  4WQ2 A;  2BE4 A;  3LCP C;  2NLN A;  2EC6 C;  1PUL A;  1CTR A;  2NZ0 A;  1GGW A;  5DKN A;  2KLE A;  4YGD B;  1LKJ A;  1M31 A;  3BXK A;  1DJI A;  1K9U A;  4NDC A;  3OGN A;  4DUQ A;  4PCW A;  5I8N A;  3AKB A;  1TN4 A;  1BF5 A;  1K90 D;  2LAN A;  1CMF A;  4MZJ A;  1S26 D;  1W7I B;  3CLN A;  3D78 A;  1L2O C;  3TDU A;  4YRU A;  1H8B A;  2L98 A;  4YGE B;  1FF1 A;  2AAO A;  1XO5 A;  1L7Z A;  3D0Y B;  1Y1X A;  1QXP A;  1BLQ A;  1NX3 A;  1RK9 A;  4JD9 A;  2MLF C;  2KAV A;  1NCZ A;  1QJT A;  3BFH A;  1K95 A;  3EK4 A;  2JXC A;  2LM5 A;  1PK0 D;  1F8H A;  2CXJ A;  1A75 A;  2OS8 C;  1S36 A;  2WOS A;  4GGF C;  2SCP A;  3PM2 A;  2WC6 A;  2M1U A;  1OQP A;  1GQM A;  2EGD A;  3BOW B;  3SG5 A;  1RWY A;  1B7T Y;  1BOC A;  4PE0 A;  3DYE A;  3UO9 A;  4N5X A;  4AQJ A;  2KSP A;  5ER4 X;  2L4H A;  2L2E A;  3SG3 A;  2KBI A;  1FI6 A;  2K8M B;  2LLS A;  4HRG A;  1NIW A;  1F54 A;  5CSJ A;  1CDN A;  1IRJ A;  3I5G B;  4P5O E;  3VRQ A;  1SYM A;  3GOF A;  1BU3 A;  1M39 A;  2KI4 B;  1PVB A;  1K94 A;  3DVJ A;  1R6P A;  4JKT A;  3EG5 B;  3TDI A;  1CM4 A;  1OE9 B;  1LVC D;  3PJI A;  1OZO A;  1SW8 A;  1SCM C;  2M7N A;  2RGI A;  4A4B A;  1IJ6 A;  1A75 B;  1A4P A;  1DJX A;  1W7J B;  2LMU A;  3DF0 A;  3SG4 A;  3R1P A;  3EK7 A;  4OZD A;  1S5G Y;  2AUC A;  3VRN A;  1E8A A;  2JPO A;  4MBE A;  1K2H A;  3F45 A;  1KSM A;  4JQ0 D;  1S6I A;  1SY9 A;  1UUR A;  2KI6 D;  2L5Y A;  1MQ1 A;  2ZND A;  3EK8 A;  3OBV A;  4GGF A;  3TUY B;  3CZ0 A;  1CDP A;  3PAL A;  4HRE E;  2FOT A;  1QIV A;  1IKU A;  2JTZ A;  3R1O A;  1IH0 A;  2BNX A;  3D73 A;  1RTP 1;  3RZS A;  3ICB A;  1ZMZ A;  2MAZ A;  2EC6 B;  3BQ3 A;  5G08 A;  2K2A A;  2PRU A;  3I5I C;  1IG5 A;  2ERB A;  2KQY A;  2PSR A;  1CM1 A;  4HSZ A;  5D69 A;  3L47 A;  3I5H C;  1C7V A;  1SSE B;  1BOD A;  1JWD A;  1WDC C;  2GGM A;  1LS8 A;  3NSL A;  1Z4H A;  4MVF A;  4P2Y B;  1J7P A;  4AOM A;  2GV5 A;  1L2O B;  1OMV A;  2L51 A;  1HQV A;  3C1V A;  2COL B;  2FJU B;  1Y1A A;  4FQO A;  2PQL A;  3SG7 A;  5HLO A;  2PMY A;  3DF0 B;  4MSP A;  3KHE A;  1MHO A;  2BL0 C;  3FS7 A;  2E30 A;  2KHN A;  5HLV A;  1TNW A;  1UHI A;  2ISD A;  3VRO A;  1DEL A;  2KYF A;  2OS8 B;  4ETO A;  2K2F A;  4YBH B;  5I94 A;  3SG2 A;  4PE7 A;  4PHN A;  2I18 A;  3CZT X;  1CDL A;  4M2Q A;  1SL8 A;  2B1U A;  2JQ6 A;  1YVH A;  2KDH A;  3D74 A;  1F71 A;  2O5G A;  5CSN A;  3RLZ A;  4NDD A;  1PAL A;  2F2P A;  1N2D A;  4NQG A;  4PDZ A;  3A8R A;  3ZWH A;  1GJY A;  1FI5 A;  3ZNI A;  3DXL A;  4PHK A;  1QVI Z;  2LVV A;  1S6J A;  2CT9 A;  2SAS A;  5TNC A;  4CPV A;  1NX2 A;  1KK8 C;  1P28 A;  1TWO A;  2O60 A;  2V53 A;  2VRG A;  4GNK B;  2WCH A;  4YGB B;  1UHJ A;  5EL2 A;  3PLF B;  5FYX A;  2MJW B;  2WCK A;  2P71 A;  1K9P A;  1MWN A;  1SCM B;  3S0G A;  2AMI A;  2HQW A;  1ODB A;  2KLD A;  1A03 A;  5DIC A;  1S1E A;  2KQ6 A;  3QRX A;  5J3X A;  3VGO A;  2M1K B;  2BAP A;  3NXA A;  3SS5 A;  1JF0 A;  2L0P A;  3FE9 A;  1UHN A;  3LL8 B;  2QDI A;  4QJ5 B;  1QIW A;  1TIZ A;  2BEC A;  1G4Y R;  2QEH A;  3BUO B;  3SJS A;  4MEW A;  3CYZ A;  5DKQ A;  1Y0V H;  4MLW A;  5D7F A;  2KGR A;  1V1G A;  3SIA A;  1D1O A;  1DVI A;  3S0B A;  2TN4 A;  3I5I B;  3L4L A;  5FI6 A;  1M46 A;  3I5F C;  3S0F A;  3LK1 A;  2L50 A;  3I5H B;  2ZRS A;  1F70 A;  1JSA A;  1REC A;  1PSB A;  1KQM C;  1WDC B;  1WLZ A;  3DVM A;  4ZCU A;  1EL4 A;  2JTT A;  2JNF A;  5HL1 A;  1IQ3 A;  1WRL A;  2LUC A;  1YUS A;  4WRI A;  5AEQ A;  1C07 A;  1JBA A;  2A4J A;  2QPT A;  3WHU B;  3PFV A;  2LP2 A;  3FWB A;  3TZ1 A;  1CLL A;  5HKZ A;  5BPJ A;  1TNX A;  2JC2 A;  4MRY A;  4OKH A;  4NDB A;  2QAC A;  1QX7 A;  2BL0 B;  1KCY A;  2K0J A;  2KI6 C;  1DT7 B;  2JOJ A;  2I7A A;  2M8U A;  1LA0 A;  2FCE A;  2JPT A;  1SPY A;  3DY9 A;  4WQ3 A;  1PRW A;  2FJY A;  3BUN B;  1LA3 A;  1AJ4 A;  1N0Y A;  1NUB A;  1WLM A;  3O4Y A;  4GPL B;  3FIA A;  5ER5 A;  1BG1 A;  1YX8 A;  3IQO A;  1LIN A;  2LV7 A;  5AFP A;  3M0W A;  3NSK A;  2LHI A;  1IGV A;  4XJK A;  3QME A;  3B86 A;  1CNP A;  4QJ4 B;  2BBM A;  2LP3 A;  2BCX A;  3VRP A;  2BBN A;  2PAL A;  3CDN A;  4GBA A;  1IWQ A;  1DJW A;  1J7R A;  1YTZ C;  2IS9 A;  3FE8 A;  5K89 A;  5HYD A;  1BT6 A;  1RRO A;  2KFH A;  2R2I A;  1KK7 Y;  1OOH A;  1YVL A;  3KO0 A;  1XFW O;  1DJZ A;  2H8V A;  3OHM B;  2GGZ A;  1C7W A;  1KK8 B;  2KNE A;  2M0R A;  2OTG C;  5AAN A;  2M7L A;  3SS4 A;  3SS3 A;  1HT9 A;  3JTD C;  4FTG A;  1B9A A;  2KGB C;  1SK6 D;  4GGN A;  3EVR A;  4N1G A;  1J7O A;  3TS5 C;  3DVK A;  1SL9 A;  5KTY A;  1J7Q A;  3NGV A;  5KU1 A;  1SCV A;  4C0L A;  1F4O A;  1DC1 A;  2JT3 A;  1AHR A;  4IJ7 A;  1BMO A;  3TDZ A;  3D77 A;  1AJ5 A;  2NCP A;  2HPS A;  1EXR A;  1KFX L;  2D8N A;  2I94 A;  1UHH A;  4PT1 A;  2GTE A;  4GAO A;  1SR6 C;  3EKJ A;  2M9G A;  1OZS A;  4XJK B;  4D1E A;  1PSR A;  1SMG A;  2CCM A;  1EG4 A;  4MZK A;  3S0E A;  2EHB A;  4A4C A;  4C0K A;  1YUT A;  4U8D A;  3I5F B;  3PN7 C;  1QV1 A;  1YRU B;  4I5N B;  5I2Q A;  1B8C A;  4OVN F;  3OB2 B;  4AQI A;  1KQM B;  2I2R E;  3BUW B;  4XYN A;  4DCK A;  1YUU A;  3NSO A;  1KQV A;  1KSO A;  3CWG A;  3R1V A;  1NP8 A;  2Y5I A;  4DRW A;  2WC5 A;  2KFF A;  1NCX A;  4YI9 A;  2LMV A;  4HRH A;  5I2L A;  1FPW A;  4F0Z B;  3D10 A;  1J1E A;  1J1D A;  2K7O A;  2QEV A;  3O2P A;  3IQQ A;  4MRX A;  1B7T Z;  1W9Z A;  1F4Q A;  1XA5 A;  1GM0 A;  1DF0 A;  1KFU S;  3KPX A;  4CFQ A;  5JJG A;  1BR4 B;  1S3P A;  1TTX A;  1CKK A;  4I5L B;  3BUX B;  1EJ3 A;  1TRF A;  1UP5 A;  4PAL A; 
#chains in the Genus database with same CATH homology
 3NHI A;  3S0B A;  3L4L A;  2P70 A;  3B87 A;  3S0F A;  1OW4 A;  3NHT A;  1OOG A;  3BJH A;  4FQT A;  3L4A A;  3B7A A;  1XFR A;  3PJI A;  3R1P A;  4OZD A;  2KPH A;  2JPO A;  3R72 A;  3D75 A;  3N7H A;  1C3Y A;  2L2C A;  4F7F A;  2WCL A;  3B6X A;  3CZ0 A;  3S0D A;  3DY9 A;  4INW A;  2FJY A;  3CZ1 A;  3R1O A;  3D73 A;  3RZS A;  1C3Z A;  2ERB A;  3QME A;  3B86 A;  3B88 A;  3L47 A;  1QWV A;  1LS8 A;  3CDN A;  2QEB A;  3FE8 A;  3S0A A;  3Q8I A;  1ORG A;  3D76 A;  1OOH A;  2H8V A;  3VB1 A;  4INX A;  3CZ2 A;  2PQL A;  3BFB A;  1TUJ A;  3K1E A;  1OOI X;  3V2L A;  1DQE A;  3BFA A;  2WCM A;  3NGV A;  3D74 A;  3D77 A;  4PT1 A;  2GTE A;  1T14 A;  3S0E A;  3OGN A;  3FE6 A;  3DXL A;  2QEO A;  3D78 A;  3R1V A;  1P28 A;  1TWO A;  3DZT A;  2WC5 A;  2WCH A;  4JD9 A;  5EL2 A;  3BFH A;  2WCK A;  2P71 A;  3S0G A;  5DIC A;  2QEV A;  3FE9 A;  2WC6 A;  2QDI A;  1GM0 A;  1OOF A;  2WCJ A;  2QEH A;  3CAB A;  3CYZ A;  3DYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...