3HCMA

Crystal structure of human s100b in complex with s45
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragmenting the S100B-p53 Interaction: Combined Virtual/Biophysical Screening Approaches to Identify Ligands
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Protein S100-B
total genus 31
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3hcmA00
3A8RA 1NSHA 3VROA 1OQPA 1MHOA 1MQ1A 3O4YA 1JF0A 1CMFA 2IS9A 1DF0A 4MZLA 1Y1UA 3TS5C 2HPSA 1JUOA 2PALA 2F2PA 1E8AA 1F55A 2L4IA 1TRFA 3KHEA 1J7RA 3BUNB 1SCMB 3GK2A 3BUMB 1GGZA 1BOCA 1PK0D 1CFDA 1DJHA 1NX2A 2MAZA 3BOWA 5CSFA 3KEVA 3NSLA 3PATA 1KSMA 3OB1B 5KSZA 3PM8A 3SG4A 1ZFSA 1IRJA 2JZIA 1KWOB 4USLA 3OX6A 5AXIA 3VRPA 1NX0A 1B8CA 2MA2A 2SASA 1QLKA 5I8NA 2BCBA 1OE9B 3DVKA 2JNXA 1NCZA 1TCFA 2LVKA 3FWBA 4YGEB 1TOPA 2M8UA 1RECA 1JBAA 5CSIA 4L9MA 2WNDA 2A4JA 4A4BA 2LMVA 1S1EA 1DTLA 2AMIA 4U8DA 5BPJA 1DJWA 2JNFA 1C7WA 1B8RA 2O60A 2ISDA 3I5HC 4FTGA 1A03A 1XFUO 1DGVA 2KFGA 4ZCVA 5K89A 3LLEA 4DS7A 3IQOA 2WC8A 1YX8A 4M2PA 4MLWA 1CM4A 2LM5A 1UHNA 1IWQA 1SCVA 2L4HA 2Y1NA 1CLLA 1ZUZA 3DVJA 5KU1A 2Y4QA 3I5IC 1LA3A 2ZFDA 1OMRA 1AJ4A 4N5XA 3TZ1A 4JWQA 2JC2A 4E68A 1OMDA 3A4UB 1QATA 3TS5B 2K2FA 4YGCB 3TDUA 4NDDA 3AKAA 5CPVA 1NYAA 1AK8A 1IQ3A 1GQMA 2OPOA 3KO0A 4P5OE 2LMUA 2KFHA 3DF0B 1QX2A 1QX5B 4N1FA 1TCOB 1TNWA 4GBAA 1YRTB 2WCFA 4YBHB 3I5GB 1U5IB 4XYNA 4A4CA 1G4YR 2M1KB 4C0KA 2BECA 1R6PA 1TNXA 3CLNA 3GK1A 1HT9A 4QJ5B 1QXPA 3BUWB 2M0RA 1YURA 2K7CA 1S6JA 2NLNA 1XYDA 1K95A 1CDMA 1XFWO 2NCPA 3OHMB 4PHNA 3GK4X 4YRUA 1XVJA 3EK4A 2L51A 1J7PA 1MXLC 2I7AA 2KGBC 1J55A 3LCPC 3BYAA 4P2YB 4QJ3B 2HQ8A 3E3RA 2QPTA 5CSJA 3OP0A 4XJKB 3BUOB 1G8IA 3IF7A 1CLMA 4I5NB 3JTDC 4C0JA 1YUUA 3HX4A 2MLEC 5ER4X 1PULA 3D0YA 3PFVA 4GPLB 1XK4A 4HRHA 2BE6A 4DUQA 1TN4A 2L50A 2ZN9A 2CBLA 1BMOA 1B9AA 1ZOTB 2CCMA 1KQMB 1BLQA 1K9KA 2LCPA 5GQQC 1CTRA 4R1EA 4JQ0D 1OSAA 2F3YA 3QRXA 2L2EA 4CIDA 2JT3A 1SRAA 2B1UA 4PCWA 1JSAA 1FI5A 1S5GY 2K61A 4ZCUA 1XFVO 1BT6A 4WRIA 2Q4UA 5B8IB 4GFTA 4AQJA 1IQ5A 1BJFA 3BQ3A 1ALWA 2KYFA 2LMTA 3O78A 1SR6B 1V1GA 2KI6C 4NDBA 5J3XA 2KSPA 4PE4A 4WQ3A 1WRLA 1D1OA 1RWYA 2M29A 1S3PA 2P6BB 3WXAA 4PHMA 4MN0A 3ICBA 3EVRA 4GAOA 3WHUB 1MXEA 1YUSA 3KPXA 3OX5A 2BBNA 3CR4X 4YGBB 3VRNA 3RM1A 1GGWA 2NCOA 2OS8B 3TUYC 2EGDA 2Q91A 3CTNA 1F70A 2KAVA 1OOJA 2BE4A 4YGAA 2JOJA 3TUYB 2G2BA 3WHTB 1K90D 3LK1A 2KNEA 4M2OA 1UHJA 4F0ZB 1XA5A 1M31A 1QX7A 3O2PA 2K7OA 1DJZA 1AUIB 4I5JA 2JXCA 1KFXL 4ICBA 1Y1AA 2F8PA 2EC6B 2V53A 3PN7C 1RROA 3JVTB 1A4PA 1FBVA 1KFUL 3F45A 1MWNA 4HREE 3SJSA 2CT9A 1CKKA 3EVVA 1F8HA 4PE7A 1OMVA 2L98A 3FIAA 1SK6D 3FWCA 3NSKA 1CB1A 5HYDA 1EH2A 1S6CA 4UPGA 2I2RE 1J1EA 1MF8B 1B4CA 1V1FA 1W7IB 2D8NA 3VRQA 1NX3A 4C0LA 1SBJA 3BXKA 3PLFB 1KK8B 4ORCB 1RTP1 1CFPA 2K8MB 1JFKA 3K21A 2PSRA 2HF5A 2M97A 4GUKA 4OVNF 4HRGA 4MZJA 3AAJA 4YI8A 3SIBA 1LINA 1EG3A 1F71A 1QJTA 1AVSA 2CXJA 2GGZA 1J7OA 4GGNA 5HLVA 3AAKA 1PVBA 1SL7A 1CFCA 1IJ6A 1SW8A 2OS8C 4I5KA 2LVIA 1KSOA 4QJ4B 4M2QA 3D0YB 3D10A 4CFRA 2JRFA 1KK7Z 1WLZA 5HKWA 5KTYA 2ZNEA 1UURA 5TNCA 1LKJA 1MUXA 1EL4A 1S5GZ 2K2AA 4XJKA 1EXRA 2KQYA 1NCYA 1S26D 5ER5A 2JQ6A 2M7LA 4BY5A 1N2DA 4IL1A 1B7TZ 1DF0B 2AUCA 2LP2A 5FYXA 1AJ5A 1X02A 3C1VA 1K9PA 5IBWA 1QIWA 1Q80A 2WCEA 4N1GA 1K96A 2JTTA 2H61C 3NXAA 1M39A 4OKHA 2GGMA 1IKUA 2ZRSA 2OTGB 1UWOA 4PE1A 3I5HB 4DIRA 4ETOA 1DJYA 5JJGA 3CZTX 1CLBA 2E6WA 2K0JA 5DKNA 2KDHA 1K93D 1K8UA 1OZOA 1U5IA 2FCEA 3GOFA 2OTGC 1SL8A 2PMYA 5CSNA 4ORBB 1KFXS 2E30A 1QVIY 3CS1A 1MR8A 3WNXB 3DF0A 3EK8A 2KBIA 1C07A 1TNQA 1YX7A 1QASA 1ZACA 2LUXA 3I5GC 4NDCA 1BR4B 1BG1A 1SNLA 2F2OA 4GGFA 1KWOC 3CWGA 4PHKA 4DCKA 1UHKA 1ODBA 2K7DA 1C7VA 1N0YA 1CFFA 1Y0VH 5G08A 1B8LA 1UUSA 4GGFC 3SG7A 1CDNA 1WLMA 2JT8A 5F6TA 2M3WA 1SCMC 3PN7B 3IQQA 5D7FA 2LVVA 1SPYA 2EC6C 2PVBA 4HSZA 1BU3A 2KYCA 1LA0A 2I94A 5AEQA 1N65A 1R2UA 1F4OA 2NXQA 2WORA 4OR9B 4MBEA 1KK7Y 4DRWA 2ZNDA 1WDCC 1CDLA 2JTZA 1QS7A 3I5FB 1RK9A 1LVCD 4TNCA 1CM1A 1IGVA 3MSEB 3LK0A 4I5LB 4OCIA 2BKIB 1B7TY 1A2XA 1YUTA 3NSIA 2KOTA 5PALA 1KK8C 3SG3A 2LV7A 1H4BA 1AHRA 1DVIA 2F33A 2LP3A 1KQVA 4YGDB 2SCPA 1NCXA 4BY4A 3ZNIA 2RGIA 4CLNA 2MRDA 3PSRA 2MLFC 2JXLA 2EHBA 1UHIA 2K7BA 4Q04A 4GNKB 1SMGA 2ZRTA 1VRKA 1DT7B 1Y6WA 4MVFA 1PVAA 4NQGA 2M49B 3EKHA 2QACA 1SR6C 3JVTC 3BOWB 5D69A 5AERA 1YRUB 2G9BA 1M45A 2M9GA 1FI6A 2BCXA 1TNPA 2CNPA 1K2HA 1SL9A 4CFQA 1H8BA 1PSBA 1FF1A 2KI4C 1HQVA 2BL0C 3RLZA 5HKZA 2KBMA 3O6BA 2PRUA 3PALA 1UHHA 2DOQA 1A75B 1XK4C 1Y1XA 1WY9A 1QV1A 1A75A 4ORAB 1TIZA 2KAYA 2KI4B 1L2OC 2JT0A 1SY9A 2BKHB 2JWWA 1PALA 4D1EA 1QLSA 1IG5A 1GJYA 3H4SE 1SYMA 3TDIA 3KF9A 1B47A 1M46A 2LUCA 1YR5A 1NP8A 1F4QA 1M63B 4OV2A 3DVEA 1JF2A 5DKRA 3I5IB 3SG6A 1NPQA 2O5GA 3EVUA 5I2LA 3JTDB 1LXFC 1S36A 1FW4A 3DD4A 3SG5A 1YVHA 2LLUA 2L0PA 1BR1B 1J1DA 1KCYA 2JU0A 1XFZO 1QV0A 4FQOA 1QVIZ 1PSRA 2Y1MA 4AOMA 2JULA 1TTXA 2M7NA 3EK7A 1RJVA 5HKYA 1YTZC 3EKJA 1EJ3A 3SIAA 1DJIA 1A29A 1G33A 2JPTA 3SG2A 1L7ZA 2AAOA 2H2KA 4PHJA 4CPVA 1B1GA 1JFJA 4WQ2A 2R2IA 4MRYA 1BODA 1CDPA 1NUBA 2LHLA 2M1UA 1AP4A 2LLTA 1IH0A 3TDZA 4JPZB 2HETA 2Y5IA 2PASA 5I2OA 3CR2A 3DVMA 5HLOA 1J7QA 1OZSA 2LAPA 1XFXO 3HCMA 1L2OB 1DGUA 1KQMC 2ZN8A 1ZMZA 4PDZA 2CTNA 4MEWA 2F3ZA 5AFPA 1WDCB 5DKQA 3CR5X 3BUXB 2BL0B 1BF5A 3OB2B 3LL8B 2KI6D 1F54A 2LNKA 1NWDA 1K94A 1K9UA 1WRKA 2BBMA 2VRGA 1JC2A 1YVLA 2KAXA 2LLSA 4MSPA 1QIVA 3VRRA 2FJUB 2KQ6A 1W7JB 1WRZA 4YI9A 5JOLA 1PRWA 2L5XB 2WOSA 4MZKA 2FCDA 2KGRA 1RFJA 2KFFA 3M0WA 1CMGA 1NIWA 3ZWHA 2ZKMX 1DMOA 2WCBA 4MRXA 4PALA 2MHHA 1CNPA 2H61A 1UP5A 1ALVA 3FS7A 2LC5A 5AANA 2LHIA 2BCAA 1DJXA 1XFYO 2LVJA 2HQWA 1S6IA 2FOTA 2I18A 2TN4A 1IJ5A 2GV5A 2KHNA 2NZ0A 1FPWA 1EG4A 1JWDA 1NX1A 2MJWB 3CGAA 3AKBA 3I5FC 2LE9B 2COLB 3VGOA 3NSOA 5I2QA 2MBXA 4PE0A 1DJGA 4AQIA 1KFUS 1SKTA 1XO5A 2LANA 1QTXA
chains in the Genus database with same CATH superfamily
3A8RA 1NSHA 3VROA 1OQPA 1MHOA 1MQ1A 3O4YA 1JF0A 1CMFA 2IS9A 1DF0A 4MZLA 1Y1UA 3TS5C 2HPSA 1JUOA 2PALA 2F2PA 1OOGA 1E8AA 1F55A 2L4IA 1TRFA 3KHEA 1J7RA 3BUNB 1SCMB 3GK2A 3BUMB 1GGZA 1BOCA 1PK0D 1QWVA 3OGNA 1CFDA 1DJHA 1NX2A 2MAZA 3BOWA 5CSFA 3KEVA 3NSLA 3PATA 1KSMA 2QEBA 3OB1B 5KSZA 1JFJA 3PM8A 3SG4A 1ZFSA 1IRJA 2JZIA 1KWOB 1W9ZA 4USLA 3OX6A 5AXIA 3VRPA 1Z4HA 1NX0A 1B8CA 2MA2A 2SASA 1QLKA 5I8NA 2BCBA 1OE9B 3DVKA 2JNXA 1NCZA 1TCFA 2LVKA 3FWBA 4YGEB 1TOPA 1T14A 2M8UA 1RECA 1JBAA 5CSIA 4L9MA 2WNDA 2A4JA 4A4BA 2LMVA 1S1EA 1DTLA 2AMIA 4U8DA 5BPJA 1DJWA 2JNFA 4F7FA 1C7WA 1B8RA 2O60A 3D76A 2ISDA 3I5HC 4FTGA 3QMEA 1A03A 1XFUO 1DGVA 2KFGA 4ZCVA 5K89A 3LLEA 3PJIA 4DS7A 2WCKA 3IQOA 2WC8A 1YX8A 4M2PA 4MLWA 1CM4A 3R72A 2LM5A 1UHNA 1IWQA 1SCVA 2L4HA 2Y1NA 1CLLA 1ZUZA 3DVJA 5KU1A 2Y4QA 3I5IC 1LA3A 2ZFDA 1OMRA 1AJ4A 4N5XA 3TZ1A 4JWQA 2JC2A 4E68A 1OMDA 3A4UB 2FJYA 1QATA 3TS5B 2K2FA 4YGCB 3TDUA 4NDDA 3AKAA 5CPVA 1NYAA 1AK8A 3CZ1A 1GQMA 3CZ0A 3D73A 2OPOA 3KO0A 4P5OE 3S0FA 1IQ3A 2LMUA 2WCLA 2KFHA 3DF0B 1XFRA 1QX2A 1QX5B 3OBVA 4N1FA 1TCOB 1TNWA 4GBAA 1YRTB 2WCFA 4YBHB 4INXA 3I5GB 1U5IB 4XYNA 4A4CA 1G4YR 2M1KB 4C0KA 2BECA 1R6PA 1TNXA 3CLNA 3GK1A 1HT9A 4QJ5B 1QXPA 2ERBA 3BUWB 2M0RA 1YURA 2WCMA 2K7CA 3FE9A 1S6JA 2NLNA 1XYDA 1K95A 1CDMA 1XFWO 2NCPA 3OHMB 4PHNA 3GK4X 4YRUA 1XVJA 2QEOA 3EK4A 2L51A 1J7PA 1MXLC 2I7AA 2KGBC 1J55A 3LCPC 3BYAA 4P2YB 4QJ3B 2HQ8A 3E3RA 2QPTA 5CSJA 3CZ2A 3OP0A 4XJKB 3BUOB 1G8IA 3IF7A 1CLMA 4I5NB 2K60A 3JTDC 4C0JA 1YUUA 3HX4A 2MLEC 5ER4X 1PULA 3NHTA 3D0YA 3PFVA 4GPLB 1XK4A 4HRHA 2BE6A 4DUQA 1TN4A 2L50A 2ZN9A 2CBLA 1BMOA 2QDIA 3S0DA 1B9AA 3DYEA 1ZOTB 2CCMA 1KQMB 1BLQA 1K9KA 2LCPA 5GQQC 3SS4A 1CTRA 4FQTA 4R1EA 4JQ0D 1OSAA 2F3YA 3QRXA 2L2EA 4CIDA 3D74A 2JT3A 1SRAA 2B1UA 2KLEA 4PCWA 1FI5A 1JSAA 1S5GY 5EL2A 2K61A 4ZCUA 1XFVO 1LS8A 2WCHA 1BT6A 4WRIA 2Q4UA 3BJHA 5B8IB 4GFTA 2KLDA 4AQJA 1IQ5A 1BJFA 1DC1A 3BQ3A 1ALWA 2KYFA 2LMTA 3O78A 1SR6B 1V1GA 2KI6C 3DZTA 4NDBA 5J3XA 2KSPA 4PE4A 4WQ3A 1WRLA 1D1OA 1RWYA 1C3ZA 2M29A 1S3PA 2P6BB 3WXAA 4PHMA 4MN0A 3ICBA 3EVRA 4GAOA 3WHUB 1MXEA 1YUSA 3KPXA 3OX5A 2BBNA 3CR4X 4YGBB 3VRNA 3RM1A 3RZSA 1GGWA 2NCOA 2OS8B 3TUYC 2EGDA 2Q91A 3CTNA 1F70A 2KAVA 1OOJA 2BE4A 4YGAA 2JOJA 3TUYB 2G2BA 3R1VA 3WHTB 1K90D 3LK1A 2KNEA 4M2OA 2PQLA 1UHJA 4F0ZB 1XA5A 1M31A 1QX7A 3O2PA 2K7OA 1DJZA 1AUIB 2BNXA 3D75A 4I5JA 2JXCA 1KFXL 4ICBA 1Y1AA 2F8PA 2EC6B 2V53A 3L4AA 3BFAA 3PN7C 1RROA 2QEHA 3JVTB 2QEVA 1A4PA 1FBVA 1KFUL 3F45A 1MWNA 4HREE 3SJSA 2CT9A 1CKKA 3EVVA 1F8HA 4PE7A 1OMVA 2L98A 3FIAA 1SK6D 3FWCA 3NSKA 1CB1A 5HYDA 1EH2A 1S6CA 4UPGA 2I2RE 3Q8IA 1J1EA 1MF8B 1B4CA 1V1FA 1W7IB 2D8NA 3VRQA 1NX3A 4C0LA 1SBJA 3BXKA 3PLFB 1KK8B 4ORCB 1RTP1 1CFPA 2K8MB 1JFKA 3K21A 3S0AA 2PSRA 2HF5A 2M97A 4GUKA 4OVNF 4HRGA 4MZJA 3AAJA 4YI8A 3SIBA 1LINA 1EG3A 1SSEB 1QJTA 1F71A 1AVSA 3DY9A 2CXJA 2GGZA 3BFHA 1IIOA 1J7OA 4GGNA 5HLVA 3AAKA 5HL1A 1PVBA 1SL7A 1CFCA 1IJ6A 1SW8A 2OS8C 4I5KA 2LVIA 1KSOA 4QJ4B 4M2QA 2JPOA 3CYZA 3D10A 3D0YB 4CFRA 1TWOA 2JRFA 1KK7Z 1WLZA 4PT1A 5HKWA 5KTYA 2ZNEA 1UURA 5TNCA 3K1EA 1DQEA 1LKJA 1MUXA 1EL4A 1S5GZ 2K2AA 4XJKA 1EXRA 3SS3A 2KQYA 1NCYA 1S26D 5ER5A 2JQ6A 2M7LA 2P70A 4BY5A 1N2DA 4IL1A 1B7TZ 1DF0B 2AUCA 2LP2A 3IVTA 5FYXA 1AJ5A 1X02A 3C1VA 1K9PA 5D3OA 5IBWA 1QIWA 1Q80A 2WCEA 3EG5B 4N1GA 1K96A 2JTTA 2H61C 3NXAA 1M39A 4OKHA 3L4LA 2GGMA 1IKUA 2ZRSA 2OTGB 1UWOA 4PE1A 3I5HB 4DIRA 1DEKA 3B86A 4ETOA 1DJYA 5JJGA 3CZTX 3S0EA 1CLBA 2E6WA 2K0JA 5DKNA 2KDHA 1K93D 1K8UA 1OZOA 1U5IA 2FCEA 3GOFA 2OTGC 1SL8A 2PMYA 5CSNA 4ORBB 1KFXS 2E30A 1QVIY 3CS1A 1MR8A 3WNXB 3DF0A 3EK8A 2KBIA 3SS5A 1C07A 1TNQA 1YX7A 1QASA 1ZACA 2LUXA 2P71A 3I5GC 4NDCA 1BR4B 1BG1A 1SNLA 2F2OA 4GGFA 1KWOC 3CWGA 2L2CA 2H8VA 4PHKA 4DCKA 1UHKA 3CDNA 1ODBA 2K7DA 1C7VA 3BFBA 1N0YA 1CFFA 1Y0VH 5G08A 1B8LA 1UUSA 4GGFC 3SG7A 1CDNA 1GM0A 1WLMA 3S0BA 2JT8A 5F6TA 2M3WA 1SCMC 3PN7B 3IQQA 5D7FA 2LVVA 1SPYA 2EC6C 2PVBA 1ORGA 4HSZA 1BU3A 2KYCA 1LA0A 2KPHA 2I94A 1TUZA 1N65A 5AEQA 3B87A 1R2UA 1F4OA 2NXQA 2WORA 4OR9B 1TUJA 4MBEA 1KK7Y 4DRWA 2ZNDA 1WDCC 1CDLA 3UO9A 2JTZA 1QS7A 3I5FB 1RK9A 1LVCD 4TNCA 1CM1A 1IGVA 3MSEB 3LK0A 4I5LB 4OCIA 2BKIB 1B7TY 1A2XA 1YUTA 4JKTA 3UNWA 3NSIA 2KOTA 5PALA 1KK8C 3SG3A 2BAPA 2LV7A 3DXLA 1H4BA 1AHRA 1DVIA 2F33A 2LP3A 1KQVA 3R1PA 4YGDB 2SCPA 1NCXA 4BY4A 3ZNIA 3S0GA 3O4XA 2RGIA 4CLNA 2MRDA 2WC6A 2MLFC 2JXLA 2EHBA 3N7HA 3PSRA 1UHIA 2K7BA 4Q04A 3L47A 4GNKB 4JD9A 1SMGA 2ZRTA 2PYQA 1VRKA 1DT7B 1Y6WA 4MVFA 1PVAA 4NQGA 2M49B 3B6XA 2QACA 1SR6C 3EKHA 3BOWB 3JVTC 5D69A 1YRUB 5AERA 1M45A 2G9BA 2M9GA 1FI6A 2BCXA 1TNPA 2CNPA 1K2HA 1SL9A 1OOFA 4CFQA 1H8BA 1PSBA 1Z2CB 1FF1A 2KI4C 1HQVA 2BL0C 3RLZA 5HKZA 2KBMA 3O6BA 3CABA 2PRUA 3PALA 1UHHA 2DOQA 1A75B 1XK4C 1Y1XA 1WY9A 1QV1A 1A75A 4ORAB 1TIZA 2KAYA 2KI4B 1L2OC 2JT0A 1SY9A 2BKHB 2JWWA 1PALA 4D1EA 1QLSA 1IG5A 1GJYA 3H4SE 5I94A 1SYMA 3TDIA 3KF9A 1B47A 1M46A 1OOIX 2LUCA 1YR5A 1NP8A 1F4QA 1M63B 1C3YA 4OV2A 3DVEA 1JF2A 5DKRA 3I5IB 3SG6A 1OOHA 1NPQA 2O5GA 3EVUA 5I2LA 2WCJA 3JTDB 1LXFC 1S36A 1FW4A 3DD4A 3SG5A 1YVHA 2LLUA 2L0PA 1BR1B 2YGUA 1J1DA 3FE6A 1KCYA 5FI7A 2JU0A 1XFZO 2GTEA 1QV0A 3NHIA 1QVIZ 1PSRA 2Y1MA 4FQOA 4AOMA 2JULA 2WC5A 1TTXA 2M7NA 3EK7A 1RJVA 5HKYA 1YTZC 3EKJA 1EJ3A 3SIAA 1DJIA 1A29A 1G33A 2JPTA 3SG2A 1L7ZA 2AAOA 2H2KA 3B7AA 4PHJA 4CPVA 1B1GA 1DELA 2R2IA 4WQ2A 4MRYA 1BODA 1CDPA 1NUBA 2LHLA 2M1UA 1AP4A 4OZDA 2LLTA 1IH0A 3TDZA 4JPZB 2HETA 4KYNA 2Y5IA 2PASA 5I2OA 3CR2A 3DVMA 5HLOA 1J7QA 1OZSA 2LAPA 1XFXO 3HCMA 1L2OB 1DGUA 1KQMC 2ZN8A 1ZMZA 3PM2A 4PDZA 2CTNA 4MEWA 2F3ZA 5AFPA 1WDCB 5DKQA 3CR5X 3BUXB 2BL0B 1BF5A 3OB2B 3LL8B 2KI6D 1OW4A 1F54A 2LNKA 1NWDA 1K94A 1K9UA 1WRKA 2BBMA 2VRGA 1JC2A 1YVLA 2KAXA 5FI2A 2LLSA 4MSPA 3V2LA 1QIVA 3VRRA 2FJUB 2KQ6A 1W7JB 1WRZA 4YI9A 5JOLA 1PRWA 2L5XB 2WOSA 4MZKA 2FCDA 2KGRA 4IJ7A 5FI6A 1RFJA 2KFFA 3M0WA 1CMGA 1P28A 1NIWA 3ZWHA 2ZKMX 1DMOA 4INWA 2WCBA 4MRXA 4PALA 2MHHA 1CNPA 2H61A 1UP5A 1ALVA 3B88A 2L5YA 3FS7A 3VB1A 2LC5A 5AANA 2LHIA 2BCAA 1DJXA 1XFYO 2LVJA 3R1OA 2HQWA 1S6IA 2FOTA 2I18A 2TN4A 5DICA 1IJ5A 2GV5A 2KHNA 2NZ0A 1FPWA 1EG4A 1JWDA 1NX1A 2MJWB 3NGVA 3CGAA 3AKBA 3I5FC 2LE9B 2COLB 3VGOA 3NSOA 5I2QA 3FE8A 2MBXA 4PE0A 1DJGA 4AQIA 1KFUS 3D77A 1SKTA 1XO5A 3D78A 2LANA 1QTXA
chains in the Genus database with same CATH topology
3A8RA 1NSHA 3VROA 1OQPA 1MHOA 1MQ1A 3O4YA 1JF0A 1CMFA 2IS9A 1DF0A 4MZLA 1Y1UA 3TS5C 2HPSA 1JUOA 2PALA 2F2PA 1E8AA 1F55A 2L4IA 1TRFA 3KHEA 1J7RA 3BUNB 1SCMB 3GK2A 3BUMB 1GGZA 1BOCA 1PK0D 1CFDA 1DJHA 1NX2A 2MAZA 3BOWA 5CSFA 3KEVA 3NSLA 3PATA 1KSMA 3OB1B 5KSZA 3PM8A 3SG4A 1ZFSA 1IRJA 2JZIA 1KWOB 4USLA 3OX6A 5AXIA 3VRPA 1NX0A 1B8CA 2MA2A 2SASA 1QLKA 5I8NA 2BCBA 1OE9B 3DVKA 2JNXA 1NCZA 1TCFA 2LVKA 3FWBA 4YGEB 1TOPA 2M8UA 1RECA 1JBAA 5CSIA 4L9MA 2WNDA 2A4JA 4A4BA 2LMVA 1S1EA 1DTLA 2AMIA 4U8DA 5BPJA 1DJWA 2JNFA 1C7WA 1B8RA 2O60A 2ISDA 3I5HC 4FTGA 1A03A 1XFUO 1DGVA 2KFGA 4ZCVA 5K89A 3LLEA 4DS7A 3IQOA 2WC8A 1YX8A 4M2PA 4MLWA 1CM4A 2LM5A 1UHNA 1IWQA 1SCVA 2L4HA 2Y1NA 1CLLA 1ZUZA 3DVJA 5KU1A 2Y4QA 3I5IC 1LA3A 2ZFDA 1OMRA 1AJ4A 4N5XA 3TZ1A 4JWQA 2JC2A 4E68A 1OMDA 3A4UB 1QATA 3TS5B 2K2FA 4YGCB 3TDUA 4NDDA 3AKAA 5CPVA 1NYAA 1AK8A 1IQ3A 1GQMA 2OPOA 3KO0A 4P5OE 2LMUA 2KFHA 3DF0B 1QX2A 1QX5B 4N1FA 1TCOB 1TNWA 4GBAA 1YRTB 2WCFA 4YBHB 3I5GB 1U5IB 4XYNA 4A4CA 1G4YR 2M1KB 4C0KA 2BECA 1R6PA 1TNXA 3CLNA 3GK1A 1HT9A 4QJ5B 1QXPA 3BUWB 2M0RA 1YURA 2K7CA 1S6JA 2NLNA 1XYDA 1K95A 1CDMA 1XFWO 2NCPA 3OHMB 4PHNA 3GK4X 4YRUA 1XVJA 3EK4A 2L51A 1J7PA 1MXLC 2I7AA 2KGBC 1J55A 3LCPC 3BYAA 4P2YB 4QJ3B 2HQ8A 3E3RA 2QPTA 5CSJA 3OP0A 4XJKB 3BUOB 1G8IA 3IF7A 1CLMA 4I5NB 3JTDC 4C0JA 1YUUA 3HX4A 2MLEC 5ER4X 1PULA 3D0YA 3PFVA 4GPLB 1XK4A 4HRHA 2BE6A 4DUQA 1TN4A 2L50A 2ZN9A 2CBLA 1BMOA 1B9AA 1ZOTB 2CCMA 1KQMB 1BLQA 1K9KA 2LCPA 5GQQC 1CTRA 4R1EA 4JQ0D 1OSAA 2F3YA 3QRXA 2L2EA 4CIDA 2JT3A 1SRAA 2B1UA 4PCWA 1JSAA 1FI5A 1S5GY 2K61A 4ZCUA 1XFVO 1BT6A 4WRIA 2Q4UA 5B8IB 4GFTA 4AQJA 1IQ5A 1BJFA 3BQ3A 1ALWA 2KYFA 2LMTA 3O78A 1SR6B 1V1GA 2KI6C 4NDBA 5J3XA 2KSPA 4PE4A 4WQ3A 1WRLA 1D1OA 1RWYA 2M29A 1S3PA 2P6BB 3WXAA 4PHMA 4MN0A 3ICBA 3EVRA 4GAOA 3WHUB 1MXEA 1YUSA 3KPXA 3OX5A 2BBNA 3CR4X 4YGBB 3VRNA 3RM1A 1GGWA 2NCOA 2OS8B 3TUYC 2EGDA 2Q91A 3CTNA 1F70A 2KAVA 1OOJA 2BE4A 4YGAA 2JOJA 3TUYB 2G2BA 3WHTB 1K90D 3LK1A 2KNEA 4M2OA 1UHJA 4F0ZB 1XA5A 1M31A 1QX7A 3O2PA 2K7OA 1DJZA 1AUIB 4I5JA 2JXCA 1KFXL 4ICBA 1Y1AA 2F8PA 2EC6B 2V53A 3PN7C 1RROA 3JVTB 1A4PA 1FBVA 1KFUL 3F45A 1MWNA 4HREE 3SJSA 2CT9A 1CKKA 3EVVA 1F8HA 4PE7A 1OMVA 2L98A 3FIAA 1SK6D 3FWCA 3NSKA 1CB1A 5HYDA 1EH2A 1S6CA 4UPGA 2I2RE 1J1EA 1MF8B 1B4CA 1V1FA 1W7IB 2D8NA 3VRQA 1NX3A 4C0LA 1SBJA 3BXKA 3PLFB 1KK8B 4ORCB 1RTP1 1CFPA 2K8MB 1JFKA 3K21A 2PSRA 2HF5A 2M97A 4GUKA 4OVNF 4HRGA 4MZJA 3AAJA 4YI8A 3SIBA 1LINA 1EG3A 1F71A 1QJTA 1AVSA 2CXJA 2GGZA 1J7OA 4GGNA 5HLVA 3AAKA 1PVBA 1SL7A 1CFCA 1IJ6A 1SW8A 2OS8C 4I5KA 2LVIA 1KSOA 4QJ4B 4M2QA 3D0YB 3D10A 4CFRA 2JRFA 1KK7Z 1WLZA 5HKWA 5KTYA 2ZNEA 1UURA 5TNCA 1LKJA 1MUXA 1EL4A 1S5GZ 2K2AA 4XJKA 1EXRA 2KQYA 1NCYA 1S26D 5ER5A 2JQ6A 2M7LA 4BY5A 1N2DA 4IL1A 1B7TZ 1DF0B 2AUCA 2LP2A 5FYXA 1AJ5A 1X02A 3C1VA 1K9PA 5IBWA 1QIWA 1Q80A 2WCEA 4N1GA 1K96A 2JTTA 2H61C 3NXAA 1M39A 4OKHA 2GGMA 1IKUA 2ZRSA 2OTGB 1UWOA 4PE1A 3I5HB 4DIRA 4ETOA 1DJYA 5JJGA 3CZTX 1CLBA 2E6WA 2K0JA 5DKNA 2KDHA 1K93D 1K8UA 1OZOA 1U5IA 2FCEA 3GOFA 2OTGC 1SL8A 2PMYA 5CSNA 4ORBB 1KFXS 2E30A 1QVIY 3CS1A 1MR8A 3WNXB 3DF0A 3EK8A 2KBIA 1C07A 1TNQA 1YX7A 1QASA 1ZACA 2LUXA 3I5GC 4NDCA 1BR4B 1BG1A 1SNLA 2F2OA 4GGFA 1KWOC 3CWGA 4PHKA 4DCKA 1UHKA 1ODBA 2K7DA 1C7VA 1N0YA 1CFFA 1Y0VH 5G08A 1B8LA 1UUSA 4GGFC 3SG7A 1CDNA 1WLMA 2JT8A 5F6TA 2M3WA 1SCMC 3PN7B 3IQQA 5D7FA 2LVVA 1SPYA 2EC6C 2PVBA 4HSZA 1BU3A 2KYCA 1LA0A 2I94A 5AEQA 1N65A 1R2UA 1F4OA 2NXQA 2WORA 4OR9B 4MBEA 1KK7Y 4DRWA 2ZNDA 1WDCC 1CDLA 2JTZA 1QS7A 3I5FB 1RK9A 1LVCD 4TNCA 1CM1A 1IGVA 3MSEB 3LK0A 4I5LB 4OCIA 2BKIB 1B7TY 1A2XA 1YUTA 3NSIA 2KOTA 5PALA 1KK8C 3SG3A 2LV7A 1H4BA 1AHRA 1DVIA 2F33A 2LP3A 1KQVA 4YGDB 2SCPA 1NCXA 4BY4A 3ZNIA 2RGIA 4CLNA 2MRDA 3PSRA 2MLFC 2JXLA 2EHBA 1UHIA 2K7BA 4Q04A 4GNKB 1SMGA 2ZRTA 1VRKA 1DT7B 1Y6WA 4MVFA 1PVAA 4NQGA 2M49B 3EKHA 2QACA 1SR6C 3JVTC 3BOWB 5D69A 5AERA 1YRUB 2G9BA 1M45A 2M9GA 1FI6A 2BCXA 1TNPA 2CNPA 1K2HA 1SL9A 4CFQA 1H8BA 1PSBA 1FF1A 2KI4C 1HQVA 2BL0C 3RLZA 5HKZA 2KBMA 3O6BA 2PRUA 3PALA 1UHHA 2DOQA 1A75B 1XK4C 1Y1XA 1WY9A 1QV1A 1A75A 4ORAB 1TIZA 2KAYA 2KI4B 1L2OC 2JT0A 1SY9A 2BKHB 2JWWA 1PALA 4D1EA 1QLSA 1IG5A 1GJYA 3H4SE 1SYMA 3TDIA 3KF9A 1B47A 1M46A 2LUCA 1YR5A 1NP8A 1F4QA 1M63B 4OV2A 3DVEA 1JF2A 5DKRA 3I5IB 3SG6A 1NPQA 2O5GA 3EVUA 5I2LA 3JTDB 1LXFC 1S36A 1FW4A 3DD4A 3SG5A 1YVHA 2LLUA 2L0PA 1BR1B 1J1DA 1KCYA 2JU0A 1XFZO 1QV0A 4FQOA 1QVIZ 1PSRA 2Y1MA 4AOMA 2JULA 1TTXA 2M7NA 3EK7A 1RJVA 5HKYA 1YTZC 3EKJA 1EJ3A 3SIAA 1DJIA 1A29A 1G33A 2JPTA 3SG2A 1L7ZA 2AAOA 2H2KA 4PHJA 4CPVA 1B1GA 1JFJA 4WQ2A 2R2IA 4MRYA 1BODA 1CDPA 1NUBA 2LHLA 2M1UA 1AP4A 2LLTA 1IH0A 3TDZA 4JPZB 2HETA 2Y5IA 2PASA 5I2OA 3CR2A 3DVMA 5HLOA 1J7QA 1OZSA 2LAPA 1XFXO 3HCMA 1L2OB 1DGUA 1KQMC 2ZN8A 1ZMZA 4PDZA 2CTNA 4MEWA 2F3ZA 5AFPA 1WDCB 5DKQA 3CR5X 3BUXB 2BL0B 1BF5A 3OB2B 3LL8B 2KI6D 1F54A 2LNKA 1NWDA 1K94A 1K9UA 1WRKA 2BBMA 2VRGA 1JC2A 1YVLA 2KAXA 2LLSA 4MSPA 1QIVA 3VRRA 2FJUB 2KQ6A 1W7JB 1WRZA 4YI9A 5JOLA 1PRWA 2L5XB 2WOSA 4MZKA 2FCDA 2KGRA 1RFJA 2KFFA 3M0WA 1CMGA 1NIWA 3ZWHA 2ZKMX 1DMOA 2WCBA 4MRXA 4PALA 2MHHA 1CNPA 2H61A 1UP5A 1ALVA 3FS7A 2LC5A 5AANA 2LHIA 2BCAA 1DJXA 1XFYO 2LVJA 2HQWA 1S6IA 2FOTA 2I18A 2TN4A 1IJ5A 2GV5A 2KHNA 2NZ0A 1FPWA 1EG4A 1JWDA 1NX1A 2MJWB 3CGAA 3AKBA 3I5FC 2LE9B 2COLB 3VGOA 3NSOA 5I2QA 2MBXA 4PE0A 1DJGA 4AQIA 1KFUS 1SKTA 1XO5A 2LANA 1QTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8R A;  1NSH A;  3VRO A;  1OQP A;  1MHO A;  1MQ1 A;  3O4Y A;  1JF0 A;  1CMF A;  2IS9 A;  1DF0 A;  4MZL A;  1Y1U A;  3TS5 C;  2HPS A;  1JUO A;  2PAL A;  2F2P A;  1E8A A;  1F55 A;  2L4I A;  1TRF A;  3KHE A;  1J7R A;  3BUN B;  1SCM B;  3GK2 A;  3BUM B;  1GGZ A;  1BOC A;  1PK0 D;  1CFD A;  1DJH A;  1NX2 A;  2MAZ A;  3BOW A;  5CSF A;  3KEV A;  3NSL A;  3PAT A;  1KSM A;  3OB1 B;  5KSZ A;  3PM8 A;  3SG4 A;  1ZFS A;  1IRJ A;  2JZI A;  1KWO B;  4USL A;  3OX6 A;  5AXI A;  3VRP A;  1NX0 A;  1B8C A;  2MA2 A;  2SAS A;  1QLK A;  5I8N A;  2BCB A;  1OE9 B;  3DVK A;  2JNX A;  1NCZ A;  1TCF A;  2LVK A;  3FWB A;  4YGE B;  1TOP A;  2M8U A;  1REC A;  1JBA A;  5CSI A;  4L9M A;  2WND A;  2A4J A;  4A4B A;  2LMV A;  1S1E A;  1DTL A;  2AMI A;  4U8D A;  5BPJ A;  1DJW A;  2JNF A;  1C7W A;  1B8R A;  2O60 A;  2ISD A;  3I5H C;  4FTG A;  1A03 A;  1XFU O;  1DGV A;  2KFG A;  4ZCV A;  5K89 A;  3LLE A;  4DS7 A;  3IQO A;  2WC8 A;  1YX8 A;  4M2P A;  4MLW A;  1CM4 A;  2LM5 A;  1UHN A;  1IWQ A;  1SCV A;  2L4H A;  2Y1N A;  1CLL A;  1ZUZ A;  3DVJ A;  5KU1 A;  2Y4Q A;  3I5I C;  1LA3 A;  2ZFD A;  1OMR A;  1AJ4 A;  4N5X A;  3TZ1 A;  4JWQ A;  2JC2 A;  4E68 A;  1OMD A;  3A4U B;  1QAT A;  3TS5 B;  2K2F A;  4YGC B;  3TDU A;  4NDD A;  3AKA A;  5CPV A;  1NYA A;  1AK8 A;  1IQ3 A;  1GQM A;  2OPO A;  3KO0 A;  4P5O E;  2LMU A;  2KFH A;  3DF0 B;  1QX2 A;  1QX5 B;  4N1F A;  1TCO B;  1TNW A;  4GBA A;  1YRT B;  2WCF A;  4YBH B;  3I5G B;  1U5I B;  4XYN A;  4A4C A;  1G4Y R;  2M1K B;  4C0K A;  2BEC A;  1R6P A;  1TNX A;  3CLN A;  3GK1 A;  1HT9 A;  4QJ5 B;  1QXP A;  3BUW B;  2M0R A;  1YUR A;  2K7C A;  1S6J A;  2NLN A;  1XYD A;  1K95 A;  1CDM A;  1XFW O;  2NCP A;  3OHM B;  4PHN A;  3GK4 X;  4YRU A;  1XVJ A;  3EK4 A;  2L51 A;  1J7P A;  1MXL C;  2I7A A;  2KGB C;  1J55 A;  3LCP C;  3BYA A;  4P2Y B;  4QJ3 B;  2HQ8 A;  3E3R A;  2QPT A;  5CSJ A;  3OP0 A;  4XJK B;  3BUO B;  1G8I A;  3IF7 A;  1CLM A;  4I5N B;  3JTD C;  4C0J A;  1YUU A;  3HX4 A;  2MLE C;  5ER4 X;  1PUL A;  3D0Y A;  3PFV A;  4GPL B;  1XK4 A;  4HRH A;  2BE6 A;  4DUQ A;  1TN4 A;  2L50 A;  2ZN9 A;  2CBL A;  1BMO A;  1B9A A;  1ZOT B;  2CCM A;  1KQM B;  1BLQ A;  1K9K A;  2LCP A;  5GQQ C;  1CTR A;  4R1E A;  4JQ0 D;  1OSA A;  2F3Y A;  3QRX A;  2L2E A;  4CID A;  2JT3 A;  1SRA A;  2B1U A;  4PCW A;  1JSA A;  1FI5 A;  1S5G Y;  2K61 A;  4ZCU A;  1XFV O;  1BT6 A;  4WRI A;  2Q4U A;  5B8I B;  4GFT A;  4AQJ A;  1IQ5 A;  1BJF A;  3BQ3 A;  1ALW A;  2KYF A;  2LMT A;  3O78 A;  1SR6 B;  1V1G A;  2KI6 C;  4NDB A;  5J3X A;  2KSP A;  4PE4 A;  4WQ3 A;  1WRL A;  1D1O A;  1RWY A;  2M29 A;  1S3P A;  2P6B B;  3WXA A;  4PHM A;  4MN0 A;  3ICB A;  3EVR A;  4GAO A;  3WHU B;  1MXE A;  1YUS A;  3KPX A;  3OX5 A;  2BBN A;  3CR4 X;  4YGB B;  3VRN A;  3RM1 A;  1GGW A;  2NCO A;  2OS8 B;  3TUY C;  2EGD A;  2Q91 A;  3CTN A;  1F70 A;  2KAV A;  1OOJ A;  2BE4 A;  4YGA A;  2JOJ A;  3TUY B;  2G2B A;  3WHT B;  1K90 D;  3LK1 A;  2KNE A;  4M2O A;  1UHJ A;  4F0Z B;  1XA5 A;  1M31 A;  1QX7 A;  3O2P A;  2K7O A;  1DJZ A;  1AUI B;  4I5J A;  2JXC A;  1KFX L;  4ICB A;  1Y1A A;  2F8P A;  2EC6 B;  2V53 A;  3PN7 C;  1RRO A;  3JVT B;  1A4P A;  1FBV A;  1KFU L;  3F45 A;  1MWN A;  4HRE E;  3SJS A;  2CT9 A;  1CKK A;  3EVV A;  1F8H A;  4PE7 A;  1OMV A;  2L98 A;  3FIA A;  1SK6 D;  3FWC A;  3NSK A;  1CB1 A;  5HYD A;  1EH2 A;  1S6C A;  4UPG A;  2I2R E;  1J1E A;  1MF8 B;  1B4C A;  1V1F A;  1W7I B;  2D8N A;  3VRQ A;  1NX3 A;  4C0L A;  1SBJ A;  3BXK A;  3PLF B;  1KK8 B;  4ORC B;  1RTP 1;  1CFP A;  2K8M B;  1JFK A;  3K21 A;  2PSR A;  2HF5 A;  2M97 A;  4GUK A;  4OVN F;  4HRG A;  4MZJ A;  3AAJ A;  4YI8 A;  3SIB A;  1LIN A;  1EG3 A;  1F71 A;  1QJT A;  1AVS A;  2CXJ A;  2GGZ A;  1J7O A;  4GGN A;  5HLV A;  3AAK A;  1PVB A;  1SL7 A;  1CFC A;  1IJ6 A;  1SW8 A;  2OS8 C;  4I5K A;  2LVI A;  1KSO A;  4QJ4 B;  4M2Q A;  3D0Y B;  3D10 A;  4CFR A;  2JRF A;  1KK7 Z;  1WLZ A;  5HKW A;  5KTY A;  2ZNE A;  1UUR A;  5TNC A;  1LKJ A;  1MUX A;  1EL4 A;  1S5G Z;  2K2A A;  4XJK A;  1EXR A;  2KQY A;  1NCY A;  1S26 D;  5ER5 A;  2JQ6 A;  2M7L A;  4BY5 A;  1N2D A;  4IL1 A;  1B7T Z;  1DF0 B;  2AUC A;  2LP2 A;  5FYX A;  1AJ5 A;  1X02 A;  3C1V A;  1K9P A;  5IBW A;  1QIW A;  1Q80 A;  2WCE A;  4N1G A;  1K96 A;  2JTT A;  2H61 C;  3NXA A;  1M39 A;  4OKH A;  2GGM A;  1IKU A;  2ZRS A;  2OTG B;  1UWO A;  4PE1 A;  3I5H B;  4DIR A;  4ETO A;  1DJY A;  5JJG A;  3CZT X;  1CLB A;  2E6W A;  2K0J A;  5DKN A;  2KDH A;  1K93 D;  1K8U A;  1OZO A;  1U5I A;  2FCE A;  3GOF A;  2OTG C;  1SL8 A;  2PMY A;  5CSN A;  4ORB B;  1KFX S;  2E30 A;  1QVI Y;  3CS1 A;  1MR8 A;  3WNX B;  3DF0 A;  3EK8 A;  2KBI A;  1C07 A;  1TNQ A;  1YX7 A;  1QAS A;  1ZAC A;  2LUX A;  3I5G C;  4NDC A;  1BR4 B;  1BG1 A;  1SNL A;  2F2O A;  4GGF A;  1KWO C;  3CWG A;  4PHK A;  4DCK A;  1UHK A;  1ODB A;  2K7D A;  1C7V A;  1N0Y A;  1CFF A;  1Y0V H;  5G08 A;  1B8L A;  1UUS A;  4GGF C;  3SG7 A;  1CDN A;  1WLM A;  2JT8 A;  5F6T A;  2M3W A;  1SCM C;  3PN7 B;  3IQQ A;  5D7F A;  2LVV A;  1SPY A;  2EC6 C;  2PVB A;  4HSZ A;  1BU3 A;  2KYC A;  1LA0 A;  2I94 A;  5AEQ A;  1N65 A;  1R2U A;  1F4O A;  2NXQ A;  2WOR A;  4OR9 B;  4MBE A;  1KK7 Y;  4DRW A;  2ZND A;  1WDC C;  1CDL A;  2JTZ A;  1QS7 A;  3I5F B;  1RK9 A;  1LVC D;  4TNC A;  1CM1 A;  1IGV A;  3MSE B;  3LK0 A;  4I5L B;  4OCI A;  2BKI B;  1B7T Y;  1A2X A;  1YUT A;  3NSI A;  2KOT A;  5PAL A;  1KK8 C;  3SG3 A;  2LV7 A;  1H4B A;  1AHR A;  1DVI A;  2F33 A;  2LP3 A;  1KQV A;  4YGD B;  2SCP A;  1NCX A;  4BY4 A;  3ZNI A;  2RGI A;  4CLN A;  2MRD A;  3PSR A;  2MLF C;  2JXL A;  2EHB A;  1UHI A;  2K7B A;  4Q04 A;  4GNK B;  1SMG A;  2ZRT A;  1VRK A;  1DT7 B;  1Y6W A;  4MVF A;  1PVA A;  4NQG A;  2M49 B;  3EKH A;  2QAC A;  1SR6 C;  3JVT C;  3BOW B;  5D69 A;  5AER A;  1YRU B;  2G9B A;  1M45 A;  2M9G A;  1FI6 A;  2BCX A;  1TNP A;  2CNP A;  1K2H A;  1SL9 A;  4CFQ A;  1H8B A;  1PSB A;  1FF1 A;  2KI4 C;  1HQV A;  2BL0 C;  3RLZ A;  5HKZ A;  2KBM A;  3O6B A;  2PRU A;  3PAL A;  1UHH A;  2DOQ A;  1A75 B;  1XK4 C;  1Y1X A;  1WY9 A;  1QV1 A;  1A75 A;  4ORA B;  1TIZ A;  2KAY A;  2KI4 B;  1L2O C;  2JT0 A;  1SY9 A;  2BKH B;  2JWW A;  1PAL A;  4D1E A;  1QLS A;  1IG5 A;  1GJY A;  3H4S E;  1SYM A;  3TDI A;  3KF9 A;  1B47 A;  1M46 A;  2LUC A;  1YR5 A;  1NP8 A;  1F4Q A;  1M63 B;  4OV2 A;  3DVE A;  1JF2 A;  5DKR A;  3I5I B;  3SG6 A;  1NPQ A;  2O5G A;  3EVU A;  5I2L A;  3JTD B;  1LXF C;  1S36 A;  1FW4 A;  3DD4 A;  3SG5 A;  1YVH A;  2LLU A;  2L0P A;  1BR1 B;  1J1D A;  1KCY A;  2JU0 A;  1XFZ O;  1QV0 A;  4FQO A;  1QVI Z;  1PSR A;  2Y1M A;  4AOM A;  2JUL A;  1TTX A;  2M7N A;  3EK7 A;  1RJV A;  5HKY A;  1YTZ C;  3EKJ A;  1EJ3 A;  3SIA A;  1DJI A;  1A29 A;  1G33 A;  2JPT A;  3SG2 A;  1L7Z A;  2AAO A;  2H2K A;  4PHJ A;  4CPV A;  1B1G A;  1JFJ A;  4WQ2 A;  2R2I A;  4MRY A;  1BOD A;  1CDP A;  1NUB A;  2LHL A;  2M1U A;  1AP4 A;  2LLT A;  1IH0 A;  3TDZ A;  4JPZ B;  2HET A;  2Y5I A;  2PAS A;  5I2O A;  3CR2 A;  3DVM A;  5HLO A;  1J7Q A;  1OZS A;  2LAP A;  1XFX O;  3HCM A;  1L2O B;  1DGU A;  1KQM C;  2ZN8 A;  1ZMZ A;  4PDZ A;  2CTN A;  4MEW A;  2F3Z A;  5AFP A;  1WDC B;  5DKQ A;  3CR5 X;  3BUX B;  2BL0 B;  1BF5 A;  3OB2 B;  3LL8 B;  2KI6 D;  1F54 A;  2LNK A;  1NWD A;  1K94 A;  1K9U A;  1WRK A;  2BBM A;  2VRG A;  1JC2 A;  1YVL A;  2KAX A;  2LLS A;  4MSP A;  1QIV A;  3VRR A;  2FJU B;  2KQ6 A;  1W7J B;  1WRZ A;  4YI9 A;  5JOL A;  1PRW A;  2L5X B;  2WOS A;  4MZK A;  2FCD A;  2KGR A;  1RFJ A;  2KFF A;  3M0W A;  1CMG A;  1NIW A;  3ZWH A;  2ZKM X;  1DMO A;  2WCB A;  4MRX A;  4PAL A;  2MHH A;  1CNP A;  2H61 A;  1UP5 A;  1ALV A;  3FS7 A;  2LC5 A;  5AAN A;  2LHI A;  2BCA A;  1DJX A;  1XFY O;  2LVJ A;  2HQW A;  1S6I A;  2FOT A;  2I18 A;  2TN4 A;  1IJ5 A;  2GV5 A;  2KHN A;  2NZ0 A;  1FPW A;  1EG4 A;  1JWD A;  1NX1 A;  2MJW B;  3CGA A;  3AKB A;  3I5F C;  2LE9 B;  2COL B;  3VGO A;  3NSO A;  5I2Q A;  2MBX A;  4PE0 A;  1DJG A;  4AQI A;  1KFU S;  1SKT A;  1XO5 A;  2LAN A;  1QTX A; 
#chains in the Genus database with same CATH topology
 3A8R A;  1NSH A;  3VRO A;  1OQP A;  1MHO A;  1MQ1 A;  3O4Y A;  1JF0 A;  1CMF A;  2IS9 A;  1DF0 A;  4MZL A;  1Y1U A;  3TS5 C;  2HPS A;  1JUO A;  2PAL A;  2F2P A;  1OOG A;  1E8A A;  1F55 A;  2L4I A;  1TRF A;  3KHE A;  1J7R A;  3BUN B;  1SCM B;  3GK2 A;  3BUM B;  1GGZ A;  1BOC A;  1PK0 D;  1QWV A;  3OGN A;  1CFD A;  1DJH A;  1NX2 A;  2MAZ A;  3BOW A;  5CSF A;  3KEV A;  3NSL A;  3PAT A;  1KSM A;  2QEB A;  3OB1 B;  5KSZ A;  1JFJ A;  3PM8 A;  3SG4 A;  1ZFS A;  1IRJ A;  2JZI A;  1KWO B;  1W9Z A;  4USL A;  3OX6 A;  5AXI A;  3VRP A;  1Z4H A;  1NX0 A;  1B8C A;  2MA2 A;  2SAS A;  1QLK A;  5I8N A;  2BCB A;  1OE9 B;  3DVK A;  2JNX A;  1NCZ A;  1TCF A;  2LVK A;  3FWB A;  4YGE B;  1TOP A;  1T14 A;  2M8U A;  1REC A;  1JBA A;  5CSI A;  4L9M A;  2WND A;  2A4J A;  4A4B A;  2LMV A;  1S1E A;  1DTL A;  2AMI A;  4U8D A;  5BPJ A;  1DJW A;  2JNF A;  4F7F A;  1C7W A;  1B8R A;  2O60 A;  3D76 A;  2ISD A;  3I5H C;  4FTG A;  3QME A;  1A03 A;  1XFU O;  1DGV A;  2KFG A;  4ZCV A;  5K89 A;  3LLE A;  3PJI A;  4DS7 A;  2WCK A;  3IQO A;  2WC8 A;  1YX8 A;  4M2P A;  4MLW A;  1CM4 A;  3R72 A;  2LM5 A;  1UHN A;  1IWQ A;  1SCV A;  2L4H A;  2Y1N A;  1CLL A;  1ZUZ A;  3DVJ A;  5KU1 A;  2Y4Q A;  3I5I C;  1LA3 A;  2ZFD A;  1OMR A;  1AJ4 A;  4N5X A;  3TZ1 A;  4JWQ A;  2JC2 A;  4E68 A;  1OMD A;  3A4U B;  2FJY A;  1QAT A;  3TS5 B;  2K2F A;  4YGC B;  3TDU A;  4NDD A;  3AKA A;  5CPV A;  1NYA A;  1AK8 A;  3CZ1 A;  1GQM A;  3CZ0 A;  3D73 A;  2OPO A;  3KO0 A;  4P5O E;  3S0F A;  1IQ3 A;  2LMU A;  2WCL A;  2KFH A;  3DF0 B;  1XFR A;  1QX2 A;  1QX5 B;  3OBV A;  4N1F A;  1TCO B;  1TNW A;  4GBA A;  1YRT B;  2WCF A;  4YBH B;  4INX A;  3I5G B;  1U5I B;  4XYN A;  4A4C A;  1G4Y R;  2M1K B;  4C0K A;  2BEC A;  1R6P A;  1TNX A;  3CLN A;  3GK1 A;  1HT9 A;  4QJ5 B;  1QXP A;  2ERB A;  3BUW B;  2M0R A;  1YUR A;  2WCM A;  2K7C A;  3FE9 A;  1S6J A;  2NLN A;  1XYD A;  1K95 A;  1CDM A;  1XFW O;  2NCP A;  3OHM B;  4PHN A;  3GK4 X;  4YRU A;  1XVJ A;  2QEO A;  3EK4 A;  2L51 A;  1J7P A;  1MXL C;  2I7A A;  2KGB C;  1J55 A;  3LCP C;  3BYA A;  4P2Y B;  4QJ3 B;  2HQ8 A;  3E3R A;  2QPT A;  5CSJ A;  3CZ2 A;  3OP0 A;  4XJK B;  3BUO B;  1G8I A;  3IF7 A;  1CLM A;  4I5N B;  2K60 A;  3JTD C;  4C0J A;  1YUU A;  3HX4 A;  2MLE C;  5ER4 X;  1PUL A;  3NHT A;  3D0Y A;  3PFV A;  4GPL B;  1XK4 A;  4HRH A;  2BE6 A;  4DUQ A;  1TN4 A;  2L50 A;  2ZN9 A;  2CBL A;  1BMO A;  2QDI A;  3S0D A;  1B9A A;  3DYE A;  1ZOT B;  2CCM A;  1KQM B;  1BLQ A;  1K9K A;  2LCP A;  5GQQ C;  3SS4 A;  1CTR A;  4FQT A;  4R1E A;  4JQ0 D;  1OSA A;  2F3Y A;  3QRX A;  2L2E A;  4CID A;  3D74 A;  2JT3 A;  1SRA A;  2B1U A;  2KLE A;  4PCW A;  1FI5 A;  1JSA A;  1S5G Y;  5EL2 A;  2K61 A;  4ZCU A;  1XFV O;  1LS8 A;  2WCH A;  1BT6 A;  4WRI A;  2Q4U A;  3BJH A;  5B8I B;  4GFT A;  2KLD A;  4AQJ A;  1IQ5 A;  1BJF A;  1DC1 A;  3BQ3 A;  1ALW A;  2KYF A;  2LMT A;  3O78 A;  1SR6 B;  1V1G A;  2KI6 C;  3DZT A;  4NDB A;  5J3X A;  2KSP A;  4PE4 A;  4WQ3 A;  1WRL A;  1D1O A;  1RWY A;  1C3Z A;  2M29 A;  1S3P A;  2P6B B;  3WXA A;  4PHM A;  4MN0 A;  3ICB A;  3EVR A;  4GAO A;  3WHU B;  1MXE A;  1YUS A;  3KPX A;  3OX5 A;  2BBN A;  3CR4 X;  4YGB B;  3VRN A;  3RM1 A;  3RZS A;  1GGW A;  2NCO A;  2OS8 B;  3TUY C;  2EGD A;  2Q91 A;  3CTN A;  1F70 A;  2KAV A;  1OOJ A;  2BE4 A;  4YGA A;  2JOJ A;  3TUY B;  2G2B A;  3R1V A;  3WHT B;  1K90 D;  3LK1 A;  2KNE A;  4M2O A;  2PQL A;  1UHJ A;  4F0Z B;  1XA5 A;  1M31 A;  1QX7 A;  3O2P A;  2K7O A;  1DJZ A;  1AUI B;  2BNX A;  3D75 A;  4I5J A;  2JXC A;  1KFX L;  4ICB A;  1Y1A A;  2F8P A;  2EC6 B;  2V53 A;  3L4A A;  3BFA A;  3PN7 C;  1RRO A;  2QEH A;  3JVT B;  2QEV A;  1A4P A;  1FBV A;  1KFU L;  3F45 A;  1MWN A;  4HRE E;  3SJS A;  2CT9 A;  1CKK A;  3EVV A;  1F8H A;  4PE7 A;  1OMV A;  2L98 A;  3FIA A;  1SK6 D;  3FWC A;  3NSK A;  1CB1 A;  5HYD A;  1EH2 A;  1S6C A;  4UPG A;  2I2R E;  3Q8I A;  1J1E A;  1MF8 B;  1B4C A;  1V1F A;  1W7I B;  2D8N A;  3VRQ A;  1NX3 A;  4C0L A;  1SBJ A;  3BXK A;  3PLF B;  1KK8 B;  4ORC B;  1RTP 1;  1CFP A;  2K8M B;  1JFK A;  3K21 A;  3S0A A;  2PSR A;  2HF5 A;  2M97 A;  4GUK A;  4OVN F;  4HRG A;  4MZJ A;  3AAJ A;  4YI8 A;  3SIB A;  1LIN A;  1EG3 A;  1SSE B;  1QJT A;  1F71 A;  1AVS A;  3DY9 A;  2CXJ A;  2GGZ A;  3BFH A;  1IIO A;  1J7O A;  4GGN A;  5HLV A;  3AAK A;  5HL1 A;  1PVB A;  1SL7 A;  1CFC A;  1IJ6 A;  1SW8 A;  2OS8 C;  4I5K A;  2LVI A;  1KSO A;  4QJ4 B;  4M2Q A;  2JPO A;  3CYZ A;  3D10 A;  3D0Y B;  4CFR A;  1TWO A;  2JRF A;  1KK7 Z;  1WLZ A;  4PT1 A;  5HKW A;  5KTY A;  2ZNE A;  1UUR A;  5TNC A;  3K1E A;  1DQE A;  1LKJ A;  1MUX A;  1EL4 A;  1S5G Z;  2K2A A;  4XJK A;  1EXR A;  3SS3 A;  2KQY A;  1NCY A;  1S26 D;  5ER5 A;  2JQ6 A;  2M7L A;  2P70 A;  4BY5 A;  1N2D A;  4IL1 A;  1B7T Z;  1DF0 B;  2AUC A;  2LP2 A;  3IVT A;  5FYX A;  1AJ5 A;  1X02 A;  3C1V A;  1K9P A;  5D3O A;  5IBW A;  1QIW A;  1Q80 A;  2WCE A;  3EG5 B;  4N1G A;  1K96 A;  2JTT A;  2H61 C;  3NXA A;  1M39 A;  4OKH A;  3L4L A;  2GGM A;  1IKU A;  2ZRS A;  2OTG B;  1UWO A;  4PE1 A;  3I5H B;  4DIR A;  1DEK A;  3B86 A;  4ETO A;  1DJY A;  5JJG A;  3CZT X;  3S0E A;  1CLB A;  2E6W A;  2K0J A;  5DKN A;  2KDH A;  1K93 D;  1K8U A;  1OZO A;  1U5I A;  2FCE A;  3GOF A;  2OTG C;  1SL8 A;  2PMY A;  5CSN A;  4ORB B;  1KFX S;  2E30 A;  1QVI Y;  3CS1 A;  1MR8 A;  3WNX B;  3DF0 A;  3EK8 A;  2KBI A;  3SS5 A;  1C07 A;  1TNQ A;  1YX7 A;  1QAS A;  1ZAC A;  2LUX A;  2P71 A;  3I5G C;  4NDC A;  1BR4 B;  1BG1 A;  1SNL A;  2F2O A;  4GGF A;  1KWO C;  3CWG A;  2L2C A;  2H8V A;  4PHK A;  4DCK A;  1UHK A;  3CDN A;  1ODB A;  2K7D A;  1C7V A;  3BFB A;  1N0Y A;  1CFF A;  1Y0V H;  5G08 A;  1B8L A;  1UUS A;  4GGF C;  3SG7 A;  1CDN A;  1GM0 A;  1WLM A;  3S0B A;  2JT8 A;  5F6T A;  2M3W A;  1SCM C;  3PN7 B;  3IQQ A;  5D7F A;  2LVV A;  1SPY A;  2EC6 C;  2PVB A;  1ORG A;  4HSZ A;  1BU3 A;  2KYC A;  1LA0 A;  2KPH A;  2I94 A;  1TUZ A;  1N65 A;  5AEQ A;  3B87 A;  1R2U A;  1F4O A;  2NXQ A;  2WOR A;  4OR9 B;  1TUJ A;  4MBE A;  1KK7 Y;  4DRW A;  2ZND A;  1WDC C;  1CDL A;  3UO9 A;  2JTZ A;  1QS7 A;  3I5F B;  1RK9 A;  1LVC D;  4TNC A;  1CM1 A;  1IGV A;  3MSE B;  3LK0 A;  4I5L B;  4OCI A;  2BKI B;  1B7T Y;  1A2X A;  1YUT A;  4JKT A;  3UNW A;  3NSI A;  2KOT A;  5PAL A;  1KK8 C;  3SG3 A;  2BAP A;  2LV7 A;  3DXL A;  1H4B A;  1AHR A;  1DVI A;  2F33 A;  2LP3 A;  1KQV A;  3R1P A;  4YGD B;  2SCP A;  1NCX A;  4BY4 A;  3ZNI A;  3S0G A;  3O4X A;  2RGI A;  4CLN A;  2MRD A;  2WC6 A;  2MLF C;  2JXL A;  2EHB A;  3N7H A;  3PSR A;  1UHI A;  2K7B A;  4Q04 A;  3L47 A;  4GNK B;  4JD9 A;  1SMG A;  2ZRT A;  2PYQ A;  1VRK A;  1DT7 B;  1Y6W A;  4MVF A;  1PVA A;  4NQG A;  2M49 B;  3B6X A;  2QAC A;  1SR6 C;  3EKH A;  3BOW B;  3JVT C;  5D69 A;  1YRU B;  5AER A;  1M45 A;  2G9B A;  2M9G A;  1FI6 A;  2BCX A;  1TNP A;  2CNP A;  1K2H A;  1SL9 A;  1OOF A;  4CFQ A;  1H8B A;  1PSB A;  1Z2C B;  1FF1 A;  2KI4 C;  1HQV A;  2BL0 C;  3RLZ A;  5HKZ A;  2KBM A;  3O6B A;  3CAB A;  2PRU A;  3PAL A;  1UHH A;  2DOQ A;  1A75 B;  1XK4 C;  1Y1X A;  1WY9 A;  1QV1 A;  1A75 A;  4ORA B;  1TIZ A;  2KAY A;  2KI4 B;  1L2O C;  2JT0 A;  1SY9 A;  2BKH B;  2JWW A;  1PAL A;  4D1E A;  1QLS A;  1IG5 A;  1GJY A;  3H4S E;  5I94 A;  1SYM A;  3TDI A;  3KF9 A;  1B47 A;  1M46 A;  1OOI X;  2LUC A;  1YR5 A;  1NP8 A;  1F4Q A;  1M63 B;  1C3Y A;  4OV2 A;  3DVE A;  1JF2 A;  5DKR A;  3I5I B;  3SG6 A;  1OOH A;  1NPQ A;  2O5G A;  3EVU A;  5I2L A;  2WCJ A;  3JTD B;  1LXF C;  1S36 A;  1FW4 A;  3DD4 A;  3SG5 A;  1YVH A;  2LLU A;  2L0P A;  1BR1 B;  2YGU A;  1J1D A;  3FE6 A;  1KCY A;  5FI7 A;  2JU0 A;  1XFZ O;  2GTE A;  1QV0 A;  3NHI A;  1QVI Z;  1PSR A;  2Y1M A;  4FQO A;  4AOM A;  2JUL A;  2WC5 A;  1TTX A;  2M7N A;  3EK7 A;  1RJV A;  5HKY A;  1YTZ C;  3EKJ A;  1EJ3 A;  3SIA A;  1DJI A;  1A29 A;  1G33 A;  2JPT A;  3SG2 A;  1L7Z A;  2AAO A;  2H2K A;  3B7A A;  4PHJ A;  4CPV A;  1B1G A;  1DEL A;  2R2I A;  4WQ2 A;  4MRY A;  1BOD A;  1CDP A;  1NUB A;  2LHL A;  2M1U A;  1AP4 A;  4OZD A;  2LLT A;  1IH0 A;  3TDZ A;  4JPZ B;  2HET A;  4KYN A;  2Y5I A;  2PAS A;  5I2O A;  3CR2 A;  3DVM A;  5HLO A;  1J7Q A;  1OZS A;  2LAP A;  1XFX O;  3HCM A;  1L2O B;  1DGU A;  1KQM C;  2ZN8 A;  1ZMZ A;  3PM2 A;  4PDZ A;  2CTN A;  4MEW A;  2F3Z A;  5AFP A;  1WDC B;  5DKQ A;  3CR5 X;  3BUX B;  2BL0 B;  1BF5 A;  3OB2 B;  3LL8 B;  2KI6 D;  1OW4 A;  1F54 A;  2LNK A;  1NWD A;  1K94 A;  1K9U A;  1WRK A;  2BBM A;  2VRG A;  1JC2 A;  1YVL A;  2KAX A;  5FI2 A;  2LLS A;  4MSP A;  3V2L A;  1QIV A;  3VRR A;  2FJU B;  2KQ6 A;  1W7J B;  1WRZ A;  4YI9 A;  5JOL A;  1PRW A;  2L5X B;  2WOS A;  4MZK A;  2FCD A;  2KGR A;  4IJ7 A;  5FI6 A;  1RFJ A;  2KFF A;  3M0W A;  1CMG A;  1P28 A;  1NIW A;  3ZWH A;  2ZKM X;  1DMO A;  4INW A;  2WCB A;  4MRX A;  4PAL A;  2MHH A;  1CNP A;  2H61 A;  1UP5 A;  1ALV A;  3B88 A;  2L5Y A;  3FS7 A;  3VB1 A;  2LC5 A;  5AAN A;  2LHI A;  2BCA A;  1DJX A;  1XFY O;  2LVJ A;  3R1O A;  2HQW A;  1S6I A;  2FOT A;  2I18 A;  2TN4 A;  5DIC A;  1IJ5 A;  2GV5 A;  2KHN A;  2NZ0 A;  1FPW A;  1EG4 A;  1JWD A;  1NX1 A;  2MJW B;  3NGV A;  3CGA A;  3AKB A;  3I5F C;  2LE9 B;  2COL B;  3VGO A;  3NSO A;  5I2Q A;  3FE8 A;  2MBX A;  4PE0 A;  1DJG A;  4AQI A;  1KFU S;  3D77 A;  1SKT A;  1XO5 A;  3D78 A;  2LAN A;  1QTX A; 
#chains in the Genus database with same CATH homology
 3A8R A;  1NSH A;  3VRO A;  1OQP A;  1MHO A;  1MQ1 A;  3O4Y A;  1JF0 A;  1CMF A;  2IS9 A;  1DF0 A;  4MZL A;  1Y1U A;  3TS5 C;  2HPS A;  1JUO A;  2PAL A;  2F2P A;  1E8A A;  1F55 A;  2L4I A;  1TRF A;  3KHE A;  1J7R A;  3BUN B;  1SCM B;  3GK2 A;  3BUM B;  1GGZ A;  1BOC A;  1PK0 D;  1CFD A;  1DJH A;  1NX2 A;  2MAZ A;  3BOW A;  5CSF A;  3KEV A;  3NSL A;  3PAT A;  1KSM A;  3OB1 B;  5KSZ A;  3PM8 A;  3SG4 A;  1ZFS A;  1IRJ A;  2JZI A;  1KWO B;  4USL A;  3OX6 A;  5AXI A;  3VRP A;  1NX0 A;  1B8C A;  2MA2 A;  2SAS A;  1QLK A;  5I8N A;  2BCB A;  1OE9 B;  3DVK A;  2JNX A;  1NCZ A;  1TCF A;  2LVK A;  3FWB A;  4YGE B;  1TOP A;  2M8U A;  1REC A;  1JBA A;  5CSI A;  4L9M A;  2WND A;  2A4J A;  4A4B A;  2LMV A;  1S1E A;  1DTL A;  2AMI A;  4U8D A;  5BPJ A;  1DJW A;  2JNF A;  1C7W A;  1B8R A;  2O60 A;  2ISD A;  3I5H C;  4FTG A;  1A03 A;  1XFU O;  1DGV A;  2KFG A;  4ZCV A;  5K89 A;  3LLE A;  4DS7 A;  3IQO A;  2WC8 A;  1YX8 A;  4M2P A;  4MLW A;  1CM4 A;  2LM5 A;  1UHN A;  1IWQ A;  1SCV A;  2L4H A;  2Y1N A;  1CLL A;  1ZUZ A;  3DVJ A;  5KU1 A;  2Y4Q A;  3I5I C;  1LA3 A;  2ZFD A;  1OMR A;  1AJ4 A;  4N5X A;  3TZ1 A;  4JWQ A;  2JC2 A;  4E68 A;  1OMD A;  3A4U B;  1QAT A;  3TS5 B;  2K2F A;  4YGC B;  3TDU A;  4NDD A;  3AKA A;  5CPV A;  1NYA A;  1AK8 A;  1IQ3 A;  1GQM A;  2OPO A;  3KO0 A;  4P5O E;  2LMU A;  2KFH A;  3DF0 B;  1QX2 A;  1QX5 B;  4N1F A;  1TCO B;  1TNW A;  4GBA A;  1YRT B;  2WCF A;  4YBH B;  3I5G B;  1U5I B;  4XYN A;  4A4C A;  1G4Y R;  2M1K B;  4C0K A;  2BEC A;  1R6P A;  1TNX A;  3CLN A;  3GK1 A;  1HT9 A;  4QJ5 B;  1QXP A;  3BUW B;  2M0R A;  1YUR A;  2K7C A;  1S6J A;  2NLN A;  1XYD A;  1K95 A;  1CDM A;  1XFW O;  2NCP A;  3OHM B;  4PHN A;  3GK4 X;  4YRU A;  1XVJ A;  3EK4 A;  2L51 A;  1J7P A;  1MXL C;  2I7A A;  2KGB C;  1J55 A;  3LCP C;  3BYA A;  4P2Y B;  4QJ3 B;  2HQ8 A;  3E3R A;  2QPT A;  5CSJ A;  3OP0 A;  4XJK B;  3BUO B;  1G8I A;  3IF7 A;  1CLM A;  4I5N B;  3JTD C;  4C0J A;  1YUU A;  3HX4 A;  2MLE C;  5ER4 X;  1PUL A;  3D0Y A;  3PFV A;  4GPL B;  1XK4 A;  4HRH A;  2BE6 A;  4DUQ A;  1TN4 A;  2L50 A;  2ZN9 A;  2CBL A;  1BMO A;  1B9A A;  1ZOT B;  2CCM A;  1KQM B;  1BLQ A;  1K9K A;  2LCP A;  5GQQ C;  1CTR A;  4R1E A;  4JQ0 D;  1OSA A;  2F3Y A;  3QRX A;  2L2E A;  4CID A;  2JT3 A;  1SRA A;  2B1U A;  4PCW A;  1JSA A;  1FI5 A;  1S5G Y;  2K61 A;  4ZCU A;  1XFV O;  1BT6 A;  4WRI A;  2Q4U A;  5B8I B;  4GFT A;  4AQJ A;  1IQ5 A;  1BJF A;  3BQ3 A;  1ALW A;  2KYF A;  2LMT A;  3O78 A;  1SR6 B;  1V1G A;  2KI6 C;  4NDB A;  5J3X A;  2KSP A;  4PE4 A;  4WQ3 A;  1WRL A;  1D1O A;  1RWY A;  2M29 A;  1S3P A;  2P6B B;  3WXA A;  4PHM A;  4MN0 A;  3ICB A;  3EVR A;  4GAO A;  3WHU B;  1MXE A;  1YUS A;  3KPX A;  3OX5 A;  2BBN A;  3CR4 X;  4YGB B;  3VRN A;  3RM1 A;  1GGW A;  2NCO A;  2OS8 B;  3TUY C;  2EGD A;  2Q91 A;  3CTN A;  1F70 A;  2KAV A;  1OOJ A;  2BE4 A;  4YGA A;  2JOJ A;  3TUY B;  2G2B A;  3WHT B;  1K90 D;  3LK1 A;  2KNE A;  4M2O A;  1UHJ A;  4F0Z B;  1XA5 A;  1M31 A;  1QX7 A;  3O2P A;  2K7O A;  1DJZ A;  1AUI B;  4I5J A;  2JXC A;  1KFX L;  4ICB A;  1Y1A A;  2F8P A;  2EC6 B;  2V53 A;  3PN7 C;  1RRO A;  3JVT B;  1A4P A;  1FBV A;  1KFU L;  3F45 A;  1MWN A;  4HRE E;  3SJS A;  2CT9 A;  1CKK A;  3EVV A;  1F8H A;  4PE7 A;  1OMV A;  2L98 A;  3FIA A;  1SK6 D;  3FWC A;  3NSK A;  1CB1 A;  5HYD A;  1EH2 A;  1S6C A;  4UPG A;  2I2R E;  1J1E A;  1MF8 B;  1B4C A;  1V1F A;  1W7I B;  2D8N A;  3VRQ A;  1NX3 A;  4C0L A;  1SBJ A;  3BXK A;  3PLF B;  1KK8 B;  4ORC B;  1RTP 1;  1CFP A;  2K8M B;  1JFK A;  3K21 A;  2PSR A;  2HF5 A;  2M97 A;  4GUK A;  4OVN F;  4HRG A;  4MZJ A;  3AAJ A;  4YI8 A;  3SIB A;  1LIN A;  1EG3 A;  1F71 A;  1QJT A;  1AVS A;  2CXJ A;  2GGZ A;  1J7O A;  4GGN A;  5HLV A;  3AAK A;  1PVB A;  1SL7 A;  1CFC A;  1IJ6 A;  1SW8 A;  2OS8 C;  4I5K A;  2LVI A;  1KSO A;  4QJ4 B;  4M2Q A;  3D0Y B;  3D10 A;  4CFR A;  2JRF A;  1KK7 Z;  1WLZ A;  5HKW A;  5KTY A;  2ZNE A;  1UUR A;  5TNC A;  1LKJ A;  1MUX A;  1EL4 A;  1S5G Z;  2K2A A;  4XJK A;  1EXR A;  2KQY A;  1NCY A;  1S26 D;  5ER5 A;  2JQ6 A;  2M7L A;  4BY5 A;  1N2D A;  4IL1 A;  1B7T Z;  1DF0 B;  2AUC A;  2LP2 A;  5FYX A;  1AJ5 A;  1X02 A;  3C1V A;  1K9P A;  5IBW A;  1QIW A;  1Q80 A;  2WCE A;  4N1G A;  1K96 A;  2JTT A;  2H61 C;  3NXA A;  1M39 A;  4OKH A;  2GGM A;  1IKU A;  2ZRS A;  2OTG B;  1UWO A;  4PE1 A;  3I5H B;  4DIR A;  4ETO A;  1DJY A;  5JJG A;  3CZT X;  1CLB A;  2E6W A;  2K0J A;  5DKN A;  2KDH A;  1K93 D;  1K8U A;  1OZO A;  1U5I A;  2FCE A;  3GOF A;  2OTG C;  1SL8 A;  2PMY A;  5CSN A;  4ORB B;  1KFX S;  2E30 A;  1QVI Y;  3CS1 A;  1MR8 A;  3WNX B;  3DF0 A;  3EK8 A;  2KBI A;  1C07 A;  1TNQ A;  1YX7 A;  1QAS A;  1ZAC A;  2LUX A;  3I5G C;  4NDC A;  1BR4 B;  1BG1 A;  1SNL A;  2F2O A;  4GGF A;  1KWO C;  3CWG A;  4PHK A;  4DCK A;  1UHK A;  1ODB A;  2K7D A;  1C7V A;  1N0Y A;  1CFF A;  1Y0V H;  5G08 A;  1B8L A;  1UUS A;  4GGF C;  3SG7 A;  1CDN A;  1WLM A;  2JT8 A;  5F6T A;  2M3W A;  1SCM C;  3PN7 B;  3IQQ A;  5D7F A;  2LVV A;  1SPY A;  2EC6 C;  2PVB A;  4HSZ A;  1BU3 A;  2KYC A;  1LA0 A;  2I94 A;  5AEQ A;  1N65 A;  1R2U A;  1F4O A;  2NXQ A;  2WOR A;  4OR9 B;  4MBE A;  1KK7 Y;  4DRW A;  2ZND A;  1WDC C;  1CDL A;  2JTZ A;  1QS7 A;  3I5F B;  1RK9 A;  1LVC D;  4TNC A;  1CM1 A;  1IGV A;  3MSE B;  3LK0 A;  4I5L B;  4OCI A;  2BKI B;  1B7T Y;  1A2X A;  1YUT A;  3NSI A;  2KOT A;  5PAL A;  1KK8 C;  3SG3 A;  2LV7 A;  1H4B A;  1AHR A;  1DVI A;  2F33 A;  2LP3 A;  1KQV A;  4YGD B;  2SCP A;  1NCX A;  4BY4 A;  3ZNI A;  2RGI A;  4CLN A;  2MRD A;  3PSR A;  2MLF C;  2JXL A;  2EHB A;  1UHI A;  2K7B A;  4Q04 A;  4GNK B;  1SMG A;  2ZRT A;  1VRK A;  1DT7 B;  1Y6W A;  4MVF A;  1PVA A;  4NQG A;  2M49 B;  3EKH A;  2QAC A;  1SR6 C;  3JVT C;  3BOW B;  5D69 A;  5AER A;  1YRU B;  2G9B A;  1M45 A;  2M9G A;  1FI6 A;  2BCX A;  1TNP A;  2CNP A;  1K2H A;  1SL9 A;  4CFQ A;  1H8B A;  1PSB A;  1FF1 A;  2KI4 C;  1HQV A;  2BL0 C;  3RLZ A;  5HKZ A;  2KBM A;  3O6B A;  2PRU A;  3PAL A;  1UHH A;  2DOQ A;  1A75 B;  1XK4 C;  1Y1X A;  1WY9 A;  1QV1 A;  1A75 A;  4ORA B;  1TIZ A;  2KAY A;  2KI4 B;  1L2O C;  2JT0 A;  1SY9 A;  2BKH B;  2JWW A;  1PAL A;  4D1E A;  1QLS A;  1IG5 A;  1GJY A;  3H4S E;  1SYM A;  3TDI A;  3KF9 A;  1B47 A;  1M46 A;  2LUC A;  1YR5 A;  1NP8 A;  1F4Q A;  1M63 B;  4OV2 A;  3DVE A;  1JF2 A;  5DKR A;  3I5I B;  3SG6 A;  1NPQ A;  2O5G A;  3EVU A;  5I2L A;  3JTD B;  1LXF C;  1S36 A;  1FW4 A;  3DD4 A;  3SG5 A;  1YVH A;  2LLU A;  2L0P A;  1BR1 B;  1J1D A;  1KCY A;  2JU0 A;  1XFZ O;  1QV0 A;  4FQO A;  1QVI Z;  1PSR A;  2Y1M A;  4AOM A;  2JUL A;  1TTX A;  2M7N A;  3EK7 A;  1RJV A;  5HKY A;  1YTZ C;  3EKJ A;  1EJ3 A;  3SIA A;  1DJI A;  1A29 A;  1G33 A;  2JPT A;  3SG2 A;  1L7Z A;  2AAO A;  2H2K A;  4PHJ A;  4CPV A;  1B1G A;  1JFJ A;  4WQ2 A;  2R2I A;  4MRY A;  1BOD A;  1CDP A;  1NUB A;  2LHL A;  2M1U A;  1AP4 A;  2LLT A;  1IH0 A;  3TDZ A;  4JPZ B;  2HET A;  2Y5I A;  2PAS A;  5I2O A;  3CR2 A;  3DVM A;  5HLO A;  1J7Q A;  1OZS A;  2LAP A;  1XFX O;  3HCM A;  1L2O B;  1DGU A;  1KQM C;  2ZN8 A;  1ZMZ A;  4PDZ A;  2CTN A;  4MEW A;  2F3Z A;  5AFP A;  1WDC B;  5DKQ A;  3CR5 X;  3BUX B;  2BL0 B;  1BF5 A;  3OB2 B;  3LL8 B;  2KI6 D;  1F54 A;  2LNK A;  1NWD A;  1K94 A;  1K9U A;  1WRK A;  2BBM A;  2VRG A;  1JC2 A;  1YVL A;  2KAX A;  2LLS A;  4MSP A;  1QIV A;  3VRR A;  2FJU B;  2KQ6 A;  1W7J B;  1WRZ A;  4YI9 A;  5JOL A;  1PRW A;  2L5X B;  2WOS A;  4MZK A;  2FCD A;  2KGR A;  1RFJ A;  2KFF A;  3M0W A;  1CMG A;  1NIW A;  3ZWH A;  2ZKM X;  1DMO A;  2WCB A;  4MRX A;  4PAL A;  2MHH A;  1CNP A;  2H61 A;  1UP5 A;  1ALV A;  3FS7 A;  2LC5 A;  5AAN A;  2LHI A;  2BCA A;  1DJX A;  1XFY O;  2LVJ A;  2HQW A;  1S6I A;  2FOT A;  2I18 A;  2TN4 A;  1IJ5 A;  2GV5 A;  2KHN A;  2NZ0 A;  1FPW A;  1EG4 A;  1JWD A;  1NX1 A;  2MJW B;  3CGA A;  3AKB A;  3I5F C;  2LE9 B;  2COL B;  3VGO A;  3NSO A;  5I2Q A;  2MBX A;  4PE0 A;  1DJG A;  4AQI A;  1KFU S;  1SKT A;  1XO5 A;  2LAN A;  1QTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...