3HCMA

Crystal structure of human s100b in complex with s45
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
b'MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Fragmenting the S100B-p53 Interaction: Combined Virtual/Biophysical Screening Approaches to Identify Ligands
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 31
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3hcmA00
2BBMA 4YGEB 3WHUB 4CFQA 2Y1NA 1B8LA 2BE6A 1CNPA 2K2FA 3TS5C 2SASA 3PSRA 4JQ0D 1NX3A 4NDDA 4USLA 2MAZA 4M2OA 1LKJA 1WDCB 5AXIA 4R1EA 1CB1A 2M0RA 1AUIB 2AMIA 3CTNA 2LUCA 4GBAA 2FCEA 4WRIA 2BKIB 3SG3A 2JULA 1C7VA 3SG2A 5AFPA 1Y1AA 1DF0B 5HKWA 3LLEA 2WCFA 1UHIA 4A4CA 1XFUO 1DMOA 2F3YA 1XFWO 2HF5A 5I2QA 5GQQC 1RWYA 1YVLA 3CWGA 1DVIA 1IWQA 3A4UB 5PALA 1MF8B 2M1KB 3NSKA 1SCMC 1A29A 1WY9A 3CGAA 5B8IB 1QX7A 1M39A 3EVRA 3NSOA 4ICBA 2FJUB 2L4IA 1CM4A 1FI5A 1Y1XA 1SYMA 1RK9A 3A8RA 4F0ZB 3KF9A 1JSAA 5G08A 3GK4X 1PK0D 4GPLB 1DJHA 3O4YA 1GQMA 2CT9A 1UHNA 2KQYA 1KWOB 1UUSA 1DGVA 4MZLA 2LVIA 1SR6C 1WLMA 2D8NA 5CSJA 1HT9A 3O6BA 4CFRA 1ZFSA 1KSMA 1CMFA 1J55A 1QVIZ 2M1UA 2AAOA 1M63B 1XFVO 1EJ3A 2K61A 1F71A 1CLLA 2VRGA 1YURA 3TDIA 4HREE 1G8IA 1QVIY 1YRUB 1R2UA 1BLQA 2JRFA 3PATA 1K95A 1QX5B 1QV1A 2KHNA 2LLTA 2KI6D 1XK4C 3DVMA 3BXKA 1ZMZA 3EVUA 4DUQA 1AP4A 2QPTA 4GGNA 4QJ5B 1LA3A 1U5IA 1BOCA 1K93D 2QACA 2Y1MA 1QLSA 1B8RA 3CZTX 3JVTC 1BMOA 1TN4A 2PSRA 3MSEB 2ZRSA 1AJ4A 1TIZA 1DT7B 2LUXA 1SY9A 1NX1A 3AAKA 2ZFDA 5DKQA 1MQ1A 2MA2A 1IG5A 3I5IC 1DJZA 2MRDA 5JOLA 3AKAA 4A4BA 1IGVA 2R2IA 4YGDB 1K96A 1B47A 1WLZA 3I5FC 2JT8A 2K7CA 4CLNA 3IQOA 2KQ6A 4OCIA 4YGCB 2I2RE 3JTDC 2BCBA 1SMGA 4ORBB 1RROA 4PALA 3SG7A 3D0YA 1EG3A 4N1GA 4DS7A 1XK4A 4JWQA 1CDLA 2ZRTA 1LVCD 2HQWA 1WDCC 3H4SE 1OZSA 2ISDA 2K8MB 1A75B 2F33A 5I2OA 2WOSA 1IQ3A 1X02A 4MRYA 3E3RA 1PRWA 2M7LA 4PHMA 3DD4A 1CMGA 1OMRA 4ORCB 1IKUA 4P5OE 1TOPA 2Y5IA 2BECA 2LLSA 2HPSA 3BUNB 2NCPA 2RGIA 5D7FA 1M46A 2H61C 2JQ6A 1CLBA 1R6PA 1NUBA 2PVBA 3VROA 1K9KA 4OVNF 2WCEA 1A03A 1KWOC 1DF0A 2F2PA 3EKHA 2KAYA 1TCFA 2M49B 3NSIA 1CFPA 3EK7A 2KDHA 1YTZC 1C7WA 4GGFC 2ZNDA 1K90D 2L0PA 3KPXA 1B7TZ 1N2DA 1XO5A 2FCDA 2JNXA 2KAXA 2BL0B 3KEVA 1B7TY 2H61A 1BF5A 1MXEA 1OOJA 5I2LA 3NSLA 2A4JA 1J7QA 1SNLA 2PMYA 2I7AA 3EK8A 3CS1A 1YVHA 2JPTA 2AUCA 1KCYA 5KU1A 2HETA 1SCVA 1S1EA 1CM1A 1WRZA 1OMVA 4GGFA 2CTNA 2LVKA 4GFTA 1Y6WA 2M9GA 2JTTA 3AKBA 1K2HA 1V1FA 3CLNA 3LCPC 3BUXB 1XVJA 1KK8B 3RM1A 2M97A 5J3XA 4WQ3A 1SBJA 1XFXO 1SRAA 4PE1A 1S36A 1MXLC 1F4OA 1QJTA 4MVFA 5K89A 5AEQA 5TNCA 3SIAA 1K94A 2KBIA 2JNFA 1OMDA 4N5XA 1QXPA 2B1UA 3PM8A 1PALA 1ZUZA 4L9MA 2LP3A 2KYFA 3VRPA 3I5GB 1NIWA 3CR5X 2SCPA 1OZOA 2GV5A 2L5XB 4PE4A 4XYNA 5I8NA 2JT3A 1F54A 1MR8A 2I94A 1UWOA 2KFGA 1QIWA 3VRRA 3LL8B 2WNDA 5FYXA 5ER4X 2BBNA 3SG5A 1KSOA 1QS7A 3QRXA 1TNPA 1QASA 4E68A 4PE7A 1MWNA 2KI6C 4Q04A 1TNXA 2BE4A 1QIVA 2JC2A 2DOQA 5HLOA 1SPYA 3VGOA 2MJWB 1BR1B 3PN7B 1CDNA 2LMVA 1DJIA 2KI4B 1GJYA 2PRUA 4GUKA 4I5JA 4ETOA 1S26D 3BOWB 1J7PA 2LC5A 5ER5A 3D10A 1SL9A 1A75A 5IBWA 1QATA 1S6JA 1N0YA 4I5KA 4DCKA 2HQ8A 2WORA 2Q91A 3FS7A 1VRKA 5AERA 2COLB 4MN0A 2M3WA 2LANA 3BQ3A 2Q4UA 3AAJA 2CXJA 1TNWA 1NWDA 4GAOA 4C0LA 1IQ5A 5HKYA 3SG4A 2TN4A 2EGDA 4CIDA 2BCXA 2LCPA 4C0KA 2LE9B 4PHKA 4NDBA 2ZN9A 1H8BA 2BL0C 1NCXA 3VRQA 3OX6A 5F6TA 4M2PA 2K7BA 4D1EA 1JBAA 1DGUA 2MHHA 1TTXA 4AQIA 4YGAA 1YX7A 3SIBA 4DIRA 4XJKB 1JFKA 1C07A 2BKHB 3C1VA 2V53A 1PVBA 2LAPA 4MEWA 1FF1A 1SL8A 1J7OA 1CLMA 2IS9A 1BODA 2KGRA 1NP8A 2PASA 3WXAA 1KK8C 2K7DA 4ZCUA 1QV0A 4BY4A 1CKKA 1YR5A 4JPZB 1XFZO 1Y1UA 2KYCA 2OTGB 3I5HB 3PALA 4N1FA 1AJ5A 1JF2A 4NQGA 1F55A 1B8CA 2LHIA 3DF0B 3LK0A 1S6IA 4TNCA 1XFYO 1PVAA 4M2QA 1LA0A 1YUUA 3BUMB 3FWBA 4HSZA 4YI8A 2G2BA 1TNQA 1KFUS 1AHRA 1QTXA 1SL7A 4YGBB 2ZNEA 3SG6A 2CNPA 1OE9B 2MLFC 3I5GC 4YBHB 2M7NA 3FWCA 3HCMA 3OX5A 4MRXA 3CR4X 2KSPA 1G33A 1TCOB 1S5GZ 2Y4QA 1F70A 3KO0A 4QJ3B 2LHLA 2O60A 3HX4A 2K2AA 1PSBA 1QX2A 3EK4A 1S5GY 4HRGA 1F8HA 3LK1A 1NCYA 4YI9A 4P2YB 4PDZA 1FPWA 2I18A 2KOTA 4ORAB 2ZN8A 3PN7C 1KQVA 2KI4C 1ALWA 2E6WA 4AQJA 5HLVA 2G9BA 3M0WA 2M29A 1XA5A 3PLFB 1CFCA 3OB2B 5D69A 2L4HA 4OKHA 4PHNA 4OV2A 1W7JB 2LMTA 1B9AA 1BU3A 1K9PA 2FOTA 4OR9B 1NSHA 1IRJA 1NPQA 1B4CA 1CDMA 1SW8A 1JWDA 3OP0A 1AK8A 2L51A 2LNKA 1WRLA 1YUSA 1OSAA 1FW4A 2EC6B 1KFUL 1K8UA 2LVVA 1V1GA 3WNXB 1S3PA 3EVVA 3ZWHA 2KFHA 3BOWA 4MZJA 4UPGA 1L2OB 1DJYA 4YRUA 3DVJA 1YRTB 5KSZA 3TDUA 1KQMB 3TZ1A 1J1EA 1IJ5A 1K9UA 2KAVA 2M8UA 4I5NB 5KTYA 3O78A 1CFDA 2JWWA 3CR2A 1XYDA 2CCMA 2F3ZA 2JXCA 1PULA 1CFFA 3TUYB 2JOJA 2LLUA 2KNEA 1Y0VH 2F8PA 3TDZA 1J7RA 3O2PA 1RTP1 1ALVA 1BT6A 1RFJA 2MLEC 1LXFC 1N65A 1BG1A 1EH2A 2OS8B 4MBEA 2OTGC 3I5HC 2JU0A 2K7OA 5CSIA 4BY5A 4U8DA 1WRKA 1YUTA 2OPOA 3SJSA 5HYDA 2BCAA 2KGBC 4HRHA 4XJKA 3GK2A 4PHJA 1CDPA 3OHMB 4FQOA 3RLZA 1EL4A 1DJWA 4AOMA 3TS5B 2LM5A 2WC8A 3NXAA 1H4BA 1IJ6A 3EKJA 5CSFA 1DTLA 1EG4A 3BUOB 2L50A 4WQ2A 1BJFA 1ZACA 1NX0A 1ZOTB 2NZ0A 2PALA 1FBVA 3F45A 1ODBA 4DRWA 2P6BB 1GGWA 3WHTB 1S6CA 3DF0A 2NXQA 1Q80A 4GNKB 2H2KA 3FIAA 3KHEA 4MLWA 3VRNA 1G4YR 1YX8A 2JXLA 2E30A 1EXRA 1CTRA 5DKRA 2L2EA 2KBMA 1BR4B 1SCMB 3K21A 3OB1B 2JTZA 1DJXA 4QJ4B 1JFJA 1A4PA 3GK1A 2O5GA 1MHOA 1NCZA 1KFXS 1SK6D 2LV7A 2GGZA 1UP5A 5AANA 2F2OA 4MSPA 5CSNA 4ZCVA 1HQVA 1M31A 1J1DA 1JUOA 1UHJA 4CPVA 2JZIA 2JT0A 1U5IB 2K0JA 5HKZA 1DJGA 1L7ZA 1SR6B 3ZNIA 2EC6C 2LP2A 4MZKA 1RJVA 4IL1A 1L2OC 4NDCA 2ZKMX 3DVEA 1NYAA 5CPVA 1IH0A 1KK7Z 1W7IB 1F4QA 3BUWB 2NLNA 1KQMC 1SKTA 3DVKA 3IF7A 2EHBA 5JJGA 3GOFA 1JF0A 1UURA 1KK7Y 3D0YB 1UHKA 3ICBA 1AVSA 4C0JA 5DKNA 1RECA 2LVJA 3TUYC 1B1GA 5BPJA 1D1OA 1A2XA 1LINA 3JVTB 2MBXA 4FTGA 1JC2A 4PE0A 2CBLA 1TRFA 2WCBA 2L98A 1M45A 1UHHA 3IQQA 3I5IB 2KFFA 2OS8C 2NCOA 1GGZA 4PCWA 2GGMA 1QLKA 1KFXL 3BYAA 1OQPA 1NX2A 1FI6A 3PFVA 3I5FB 1PSRA 4I5LB 2LMUA 3JTDB 1MUXA 1E8AA
chains in the Genus database with same CATH superfamily
2BBMA 4YGEB 3WHUB 3UO9A 4CFQA 2Y1NA 2WCJA 1B8LA 2BE6A 2QEHA 1CNPA 2K2FA 3TS5C 2SASA 3PSRA 4JQ0D 1NX3A 4NDDA 4USLA 2MAZA 4M2OA 1LKJA 1WDCB 5AXIA 4R1EA 1CB1A 2M0RA 1AUIB 2AMIA 3L4LA 3CTNA 2LUCA 4GBAA 2FCEA 4WRIA 2BKIB 3CDNA 2JULA 2H8VA 3SG3A 1C7VA 3SG2A 5AFPA 1Y1AA 1DF0B 1T14A 2K60A 5HKWA 3LLEA 2WCFA 1UHIA 4A4CA 1XFUO 1DMOA 2F3YA 1XFWO 2HF5A 5I2QA 5GQQC 3S0AA 1RWYA 1YVLA 3CWGA 1DVIA 1IWQA 3A4UB 5PALA 1MF8B 2M1KB 3NSKA 1SCMC 1A29A 1WY9A 3CGAA 5B8IB 1QX7A 1M39A 3EVRA 3NSOA 4ICBA 3PJIA 2FJUB 2L4IA 1CM4A 1SSEB 1Y1XA 1FI5A 1SYMA 1RK9A 3A8RA 4F0ZB 3KF9A 1JSAA 5G08A 1QWVA 3GK4X 1PK0D 4GPLB 1DJHA 3O4YA 1GQMA 2CT9A 1UHNA 2KQYA 1KWOB 1UUSA 1DGVA 4MZLA 2LVIA 1SR6C 1WLMA 2D8NA 5CSJA 1HT9A 3O6BA 4CFRA 1ZFSA 1KSMA 1CMFA 1DC1A 1J55A 1QVIZ 2M1UA 2AAOA 1M63B 1XFVO 1EJ3A 2K61A 1F71A 1CLLA 2VRGA 1YURA 3TDIA 4HREE 1G8IA 3CZ0A 1QVIY 2WC6A 1YRUB 1R2UA 1BLQA 2JRFA 3PATA 1K95A 1QX5B 1QV1A 2KHNA 2LLTA 2KI6D 1XK4C 3DVMA 3BXKA 1ZMZA 3EVUA 4INWA 4DUQA 1AP4A 2QPTA 4GGNA 4QJ5B 1LA3A 1U5IA 3DXLA 1K93D 2QACA 2Y1MA 1QLSA 1B8RA 3CZTX 3JVTC 1BMOA 1TN4A 2PSRA 3MSEB 2ZRSA 1AJ4A 1TIZA 1DT7B 2LUXA 3B86A 1SY9A 1NX1A 3AAKA 2ZFDA 5DKQA 1MQ1A 2MA2A 2P70A 1IG5A 3I5IC 1DJZA 2MRDA 5JOLA 3AKAA 4A4BA 1IGVA 2R2IA 4YGDB 1K96A 1B47A 1WLZA 3I5FC 2JT8A 1TUZA 2K7CA 4CLNA 3IQOA 2KQ6A 4OCIA 3DZTA 4YGCB 2I2RE 3JTDC 2BCBA 1SMGA 4ORBB 1RROA 4PALA 3SG7A 3D0YA 3D76A 1EG3A 4INXA 4N1GA 4DS7A 1XK4A 4JWQA 5EL2A 1CDLA 2ZRTA 2QEOA 1LVCD 2HQWA 1WDCC 3H4SE 1OZSA 3L4AA 2ISDA 2K8MB 1OOHA 1A75B 2F33A 3R1OA 5I2OA 2WOSA 1IQ3A 1X02A 4MRYA 3E3RA 1PRWA 3CABA 2M7LA 4FQTA 4PHMA 3DD4A 2L2CA 1BOCA 1CMGA 1OMRA 4ORCB 3D75A 3Q8IA 1IKUA 3FE6A 4P5OE 1TOPA 3SS3A 2Y5IA 2BECA 2LLSA 2HPSA 2BAPA 3BUNB 2NCPA 2RGIA 5D7FA 1M46A 2H61C 2JQ6A 1CLBA 1R6PA 1NUBA 2PVBA 5FI6A 3FE9A 1GM0A 3VROA 2PQLA 1K9KA 3L47A 4OVNF 2WCEA 1A03A 1KWOC 1DF0A 1P28A 2F2PA 2KAYA 1TCFA 2M49B 3EKHA 3NSIA 3EK7A 1CFPA 2KDHA 1YTZC 1C7WA 3R1VA 4GGFC 1C3ZA 2ZNDA 1K90D 2L0PA 3KPXA 3B87A 3DYEA 1B7TZ 3NHIA 1N2DA 1XO5A 2FCDA 2JNXA 2KAXA 2BL0B 5FI2A 3KEVA 1B7TY 2H61A 1BF5A 1MXEA 1OOJA 5I2LA 5FI7A 3NSLA 2A4JA 1J7QA 1SNLA 2PMYA 2I7AA 3EK8A 1OOIX 3CS1A 1YVHA 2JPTA 2AUCA 1KCYA 5KU1A 2HETA 1SCVA 1S1EA 1CM1A 1WRZA 1Z2CB 1OMVA 4GGFA 2CTNA 2LVKA 3D73A 4GFTA 1Y6WA 3NGVA 3BFHA 2M9GA 2JTTA 3AKBA 1K2HA 1V1FA 2QEVA 3CLNA 3LCPC 3BUXB 3R1PA 1XVJA 1KK8B 3RM1A 2M97A 5J3XA 4WQ3A 1SBJA 1XFXO 2ERBA 1SRAA 4PE1A 1S36A 1MXLC 1F4OA 1QJTA 4JKTA 3BFAA 4MVFA 5AEQA 5TNCA 3SIAA 5K89A 1K94A 2KBIA 2JNFA 1OMDA 4N5XA 1QXPA 3OBVA 2B1UA 3PM8A 1PALA 1ZUZA 4L9MA 2LP3A 4OZDA 2KYFA 3VRPA 3I5GB 1NIWA 3CR5X 1W9ZA 2SCPA 1OZOA 2GV5A 2L5XB 4PE4A 4XYNA 5I8NA 2JT3A 1F54A 1MR8A 2I94A 1UWOA 2KFGA 1QIWA 3VRRA 3LL8B 2WNDA 5FYXA 1TWOA 5ER4X 2BBNA 3SG5A 1KSOA 1QS7A 3QRXA 3QMEA 1TNPA 1QASA 4E68A 4PE7A 1MWNA 2KI6C 4Q04A 1TNXA 2BE4A 1QIVA 2JC2A 2DOQA 5HLOA 1SPYA 3VGOA 2JPOA 2MJWB 1BR1B 3PN7B 1CDNA 2LMVA 1DJIA 2KI4B 1GJYA 2PRUA 4GUKA 4I5JA 4ETOA 1S26D 3BOWB 1J7PA 2LC5A 5ER5A 3D10A 1SL9A 1A75A 5IBWA 1QATA 1S6JA 1N0YA 4I5KA 4DCKA 2HQ8A 2WORA 2Q91A 3FS7A 1VRKA 5AERA 2COLB 4MN0A 2M3WA 2LANA 3BQ3A 2Q4UA 3AAJA 2CXJA 1TNWA 1NWDA 4GAOA 4C0LA 1IQ5A 5HKYA 5D3OA 3SG4A 2TN4A 2EGDA 4CIDA 2BCXA 2LCPA 4C0KA 2LE9B 4PHKA 1Z4HA 2ZN9A 4NDBA 1H8BA 2BL0C 1NCXA 3VRQA 3OX6A 5F6TA 3SS5A 4M2PA 2K7BA 4D1EA 3K1EA 3OGNA 1JBAA 1DGUA 1ORGA 2MHHA 1TTXA 2BNXA 4YGAA 4AQIA 1YX7A 3SIBA 4DIRA 4XJKB 4F7FA 1JFKA 1C07A 2BKHB 3C1VA 2V53A 1PVBA 2LAPA 4MEWA 1FF1A 1SL8A 1J7OA 1CLMA 2IS9A 1BODA 2KGRA 1NP8A 2PASA 3WXAA 2WCKA 1KK8C 2K7DA 4ZCUA 1QV0A 4BY4A 1CKKA 1YR5A 4JPZB 1XFZO 1Y1UA 2KYCA 2OTGB 3I5HB 3PALA 4N1FA 1AJ5A 1JF2A 4NQGA 1F55A 1B8CA 2KPHA 2LHIA 3DF0B 3LK0A 3B6XA 1S6IA 4TNCA 1XFYO 1PVAA 4M2QA 1LA0A 1YUUA 3BUMB 3FWBA 4HSZA 3SS4A 4YI8A 2G2BA 1TNQA 3B7AA 2WCLA 1KFUS 1AHRA 1QTXA 1SL7A 4YGBB 2ZNEA 3SG6A 2CNPA 1OE9B 2MLFC 3I5GC 4YBHB 2M7NA 2YGUA 3FWCA 3HCMA 2WCHA 3OX5A 4MRXA 3CR4X 2KSPA 1G33A 2FJYA 1TCOB 1S5GZ 2Y4QA 3S0EA 1F70A 3KO0A 3D74A 4QJ3B 2LHLA 2O60A 3HX4A 2K2AA 1PSBA 1QX2A 3EK4A 1S5GY 4HRGA 1F8HA 3LK1A 1NCYA 4JD9A 4YI9A 4P2YB 4PDZA 1FPWA 2I18A 2KOTA 4ORAB 2ZN8A 3PN7C 1KQVA 2KI4C 1ALWA 2E6WA 4AQJA 5HLVA 2G9BA 3M0WA 2M29A 1XA5A 3N7HA 5HL1A 3PLFB 1CFCA 3OB2B 4PT1A 3CZ2A 5D69A 2L4HA 4OKHA 4PHNA 4OV2A 1W7JB 2LMTA 5DICA 2L5YA 1B9AA 1BU3A 1K9PA 2FOTA 3O4XA 1NSHA 3R72A 4OR9B 1IRJA 1NPQA 1XFRA 1B4CA 1CDMA 1SW8A 1JWDA 3OP0A 1AK8A 2L51A 2LNKA 4KYNA 1WRLA 1YUSA 1OSAA 1FW4A 2EC6B 1KFUL 1K8UA 2LVVA 1V1GA 3WNXB 1S3PA 3EVVA 1LS8A 2KFHA 3BOWA 4MZJA 3ZWHA 1L2OB 4UPGA 1DJYA 3BFBA 4YRUA 3DVJA 1YRTB 5KSZA 3TDUA 1KQMB 2WC5A 3TZ1A 1J1EA 1IJ5A 1K9UA 2KAVA 2M8UA 3B88A 2GTEA 4I5NB 5KTYA 3O78A 1CFDA 3S0FA 2JWWA 1TUJA 3CR2A 1XYDA 2CCMA 2F3ZA 2JXCA 1PULA 1CFFA 3TUYB 2JOJA 2LLUA 2KNEA 3DY9A 1Y0VH 2F8PA 3TDZA 1J7RA 3O2PA 1RTP1 1ALVA 1BT6A 1RFJA 2MLEC 1LXFC 1N65A 1BG1A 1EH2A 2OS8B 4MBEA 2OTGC 3I5HC 3V2LA 2JU0A 2K7OA 5CSIA 4BY5A 4U8DA 1WRKA 1YUTA 3NHTA 2OPOA 1DQEA 2QDIA 3SJSA 5HYDA 2BCAA 2P71A 2KGBC 4HRHA 4XJKA 3GK2A 4PHJA 1CDPA 3OHMB 4FQOA 3RLZA 1OW4A 1IIOA 1EL4A 2PYQA 1DJWA 4AOMA 3TS5B 3S0GA 2LM5A 2WC8A 3FE8A 3NXAA 3UNWA 1H4BA 1IJ6A 3EKJA 5CSFA 3CZ1A 3S0BA 1DTLA 1EG4A 3BUOB 2L50A 3CYZA 4WQ2A 1BJFA 1ZACA 1NX0A 1ZOTB 2NZ0A 2PALA 1FBVA 3F45A 1ODBA 4DRWA 3IVTA 2P6BB 1GGWA 3WHTB 3RZSA 1S6CA 3DF0A 2NXQA 1Q80A 4GNKB 2H2KA 3FIAA 1DELA 3KHEA 4MLWA 3VRNA 1G4YR 1YX8A 2JXLA 3EG5B 2E30A 1EXRA 1CTRA 3D77A 5DKRA 2L2EA 2KBMA 1BR4B 1SCMB 3K21A 3OB1B 2JTZA 1DJXA 4IJ7A 4QJ4B 1JFJA 1A4PA 3GK1A 2O5GA 1MHOA 1NCZA 1KFXS 1SK6D 2LV7A 3PM2A 2GGZA 1UP5A 5AANA 1OOFA 2F2OA 4MSPA 5CSNA 4ZCVA 1HQVA 2WCMA 1M31A 1J1DA 1JUOA 1UHJA 4CPVA 2JZIA 2JT0A 1U5IB 2K0JA 5HKZA 1DJGA 3S0DA 1L7ZA 1SR6B 3ZNIA 2EC6C 1OOGA 2LP2A 4MZKA 1RJVA 4IL1A 5I94A 1L2OC 4NDCA 2ZKMX 3DVEA 1NYAA 5CPVA 1IH0A 1KK7Z 1W7IB 1F4QA 3BUWB 2NLNA 1KQMC 1SKTA 3DVKA 3IF7A 2EHBA 5JJGA 3GOFA 1JF0A 1UURA 1KK7Y 3D0YB 1UHKA 3ICBA 1AVSA 4C0JA 5DKNA 1RECA 2LVJA 3VB1A 3TUYC 5BPJA 1B1GA 1D1OA 1A2XA 1LINA 3JVTB 1DEKA 4FTGA 2MBXA 1JC2A 4PE0A 2CBLA 1TRFA 3BJHA 2QEBA 3D78A 2WCBA 2L98A 1M45A 1UHHA 3IQQA 3I5IB 2KFFA 2OS8C 2NCOA 1GGZA 4PCWA 2GGMA 1QLKA 1KFXL 3BYAA 1C3YA 1OQPA 1NX2A 1FI6A 3PFVA 3I5FB 1PSRA 2KLDA 4I5LB 2LMUA 3JTDB 2KLEA 1MUXA 1E8AA
chains in the Genus database with same CATH topology
2BBMA 4YGEB 3WHUB 4CFQA 2Y1NA 1B8LA 2BE6A 1CNPA 2K2FA 3TS5C 2SASA 3PSRA 4JQ0D 1NX3A 4NDDA 4USLA 2MAZA 4M2OA 1LKJA 1WDCB 5AXIA 4R1EA 1CB1A 2M0RA 1AUIB 2AMIA 3CTNA 2LUCA 4GBAA 2FCEA 4WRIA 2BKIB 3SG3A 2JULA 1C7VA 3SG2A 5AFPA 1Y1AA 1DF0B 5HKWA 3LLEA 2WCFA 1UHIA 4A4CA 1XFUO 1DMOA 2F3YA 1XFWO 2HF5A 5I2QA 5GQQC 1RWYA 1YVLA 3CWGA 1DVIA 1IWQA 3A4UB 5PALA 1MF8B 2M1KB 3NSKA 1SCMC 1A29A 1WY9A 3CGAA 5B8IB 1QX7A 1M39A 3EVRA 3NSOA 4ICBA 2FJUB 2L4IA 1CM4A 1FI5A 1Y1XA 1SYMA 1RK9A 3A8RA 4F0ZB 3KF9A 1JSAA 5G08A 3GK4X 1PK0D 4GPLB 1DJHA 3O4YA 1GQMA 2CT9A 1UHNA 2KQYA 1KWOB 1UUSA 1DGVA 4MZLA 2LVIA 1SR6C 1WLMA 2D8NA 5CSJA 1HT9A 3O6BA 4CFRA 1ZFSA 1KSMA 1CMFA 1J55A 1QVIZ 2M1UA 2AAOA 1M63B 1XFVO 1EJ3A 2K61A 1F71A 1CLLA 2VRGA 1YURA 3TDIA 4HREE 1G8IA 1QVIY 1YRUB 1R2UA 1BLQA 2JRFA 3PATA 1K95A 1QX5B 1QV1A 2KHNA 2LLTA 2KI6D 1XK4C 3DVMA 3BXKA 1ZMZA 3EVUA 4DUQA 1AP4A 2QPTA 4GGNA 4QJ5B 1LA3A 1U5IA 1BOCA 1K93D 2QACA 2Y1MA 1QLSA 1B8RA 3CZTX 3JVTC 1BMOA 1TN4A 2PSRA 3MSEB 2ZRSA 1AJ4A 1TIZA 1DT7B 2LUXA 1SY9A 1NX1A 3AAKA 2ZFDA 5DKQA 1MQ1A 2MA2A 1IG5A 3I5IC 1DJZA 2MRDA 5JOLA 3AKAA 4A4BA 1IGVA 2R2IA 4YGDB 1K96A 1B47A 1WLZA 3I5FC 2JT8A 2K7CA 4CLNA 3IQOA 2KQ6A 4OCIA 4YGCB 2I2RE 3JTDC 2BCBA 1SMGA 4ORBB 1RROA 4PALA 3SG7A 3D0YA 1EG3A 4N1GA 4DS7A 1XK4A 4JWQA 1CDLA 2ZRTA 1LVCD 2HQWA 1WDCC 3H4SE 1OZSA 2ISDA 2K8MB 1A75B 2F33A 5I2OA 2WOSA 1IQ3A 1X02A 4MRYA 3E3RA 1PRWA 2M7LA 4PHMA 3DD4A 1CMGA 1OMRA 4ORCB 1IKUA 4P5OE 1TOPA 2Y5IA 2BECA 2LLSA 2HPSA 3BUNB 2NCPA 2RGIA 5D7FA 1M46A 2H61C 2JQ6A 1CLBA 1R6PA 1NUBA 2PVBA 3VROA 1K9KA 4OVNF 2WCEA 1A03A 1KWOC 1DF0A 2F2PA 3EKHA 2KAYA 1TCFA 2M49B 3NSIA 1CFPA 3EK7A 2KDHA 1YTZC 1C7WA 4GGFC 2ZNDA 1K90D 2L0PA 3KPXA 1B7TZ 1N2DA 1XO5A 2FCDA 2JNXA 2KAXA 2BL0B 3KEVA 1B7TY 2H61A 1BF5A 1MXEA 1OOJA 5I2LA 3NSLA 2A4JA 1J7QA 1SNLA 2PMYA 2I7AA 3EK8A 3CS1A 1YVHA 2JPTA 2AUCA 1KCYA 5KU1A 2HETA 1SCVA 1S1EA 1CM1A 1WRZA 1OMVA 4GGFA 2CTNA 2LVKA 4GFTA 1Y6WA 2M9GA 2JTTA 3AKBA 1K2HA 1V1FA 3CLNA 3LCPC 3BUXB 1XVJA 1KK8B 3RM1A 2M97A 5J3XA 4WQ3A 1SBJA 1XFXO 1SRAA 4PE1A 1S36A 1MXLC 1F4OA 1QJTA 4MVFA 5K89A 5AEQA 5TNCA 3SIAA 1K94A 2KBIA 2JNFA 1OMDA 4N5XA 1QXPA 2B1UA 3PM8A 1PALA 1ZUZA 4L9MA 2LP3A 2KYFA 3VRPA 3I5GB 1NIWA 3CR5X 2SCPA 1OZOA 2GV5A 2L5XB 4PE4A 4XYNA 5I8NA 2JT3A 1F54A 1MR8A 2I94A 1UWOA 2KFGA 1QIWA 3VRRA 3LL8B 2WNDA 5FYXA 5ER4X 2BBNA 3SG5A 1KSOA 1QS7A 3QRXA 1TNPA 1QASA 4E68A 4PE7A 1MWNA 2KI6C 4Q04A 1TNXA 2BE4A 1QIVA 2JC2A 2DOQA 5HLOA 1SPYA 3VGOA 2MJWB 1BR1B 3PN7B 1CDNA 2LMVA 1DJIA 2KI4B 1GJYA 2PRUA 4GUKA 4I5JA 4ETOA 1S26D 3BOWB 1J7PA 2LC5A 5ER5A 3D10A 1SL9A 1A75A 5IBWA 1QATA 1S6JA 1N0YA 4I5KA 4DCKA 2HQ8A 2WORA 2Q91A 3FS7A 1VRKA 5AERA 2COLB 4MN0A 2M3WA 2LANA 3BQ3A 2Q4UA 3AAJA 2CXJA 1TNWA 1NWDA 4GAOA 4C0LA 1IQ5A 5HKYA 3SG4A 2TN4A 2EGDA 4CIDA 2BCXA 2LCPA 4C0KA 2LE9B 4PHKA 4NDBA 2ZN9A 1H8BA 2BL0C 1NCXA 3VRQA 3OX6A 5F6TA 4M2PA 2K7BA 4D1EA 1JBAA 1DGUA 2MHHA 1TTXA 4AQIA 4YGAA 1YX7A 3SIBA 4DIRA 4XJKB 1JFKA 1C07A 2BKHB 3C1VA 2V53A 1PVBA 2LAPA 4MEWA 1FF1A 1SL8A 1J7OA 1CLMA 2IS9A 1BODA 2KGRA 1NP8A 2PASA 3WXAA 1KK8C 2K7DA 4ZCUA 1QV0A 4BY4A 1CKKA 1YR5A 4JPZB 1XFZO 1Y1UA 2KYCA 2OTGB 3I5HB 3PALA 4N1FA 1AJ5A 1JF2A 4NQGA 1F55A 1B8CA 2LHIA 3DF0B 3LK0A 1S6IA 4TNCA 1XFYO 1PVAA 4M2QA 1LA0A 1YUUA 3BUMB 3FWBA 4HSZA 4YI8A 2G2BA 1TNQA 1KFUS 1AHRA 1QTXA 1SL7A 4YGBB 2ZNEA 3SG6A 2CNPA 1OE9B 2MLFC 3I5GC 4YBHB 2M7NA 3FWCA 3HCMA 3OX5A 4MRXA 3CR4X 2KSPA 1G33A 1TCOB 1S5GZ 2Y4QA 1F70A 3KO0A 4QJ3B 2LHLA 2O60A 3HX4A 2K2AA 1PSBA 1QX2A 3EK4A 1S5GY 4HRGA 1F8HA 3LK1A 1NCYA 4YI9A 4P2YB 4PDZA 1FPWA 2I18A 2KOTA 4ORAB 2ZN8A 3PN7C 1KQVA 2KI4C 1ALWA 2E6WA 4AQJA 5HLVA 2G9BA 3M0WA 2M29A 1XA5A 3PLFB 1CFCA 3OB2B 5D69A 2L4HA 4OKHA 4PHNA 4OV2A 1W7JB 2LMTA 1B9AA 1BU3A 1K9PA 2FOTA 4OR9B 1NSHA 1IRJA 1NPQA 1B4CA 1CDMA 1SW8A 1JWDA 3OP0A 1AK8A 2L51A 2LNKA 1WRLA 1YUSA 1OSAA 1FW4A 2EC6B 1KFUL 1K8UA 2LVVA 1V1GA 3WNXB 1S3PA 3EVVA 3ZWHA 2KFHA 3BOWA 4MZJA 4UPGA 1L2OB 1DJYA 4YRUA 3DVJA 1YRTB 5KSZA 3TDUA 1KQMB 3TZ1A 1J1EA 1IJ5A 1K9UA 2KAVA 2M8UA 4I5NB 5KTYA 3O78A 1CFDA 2JWWA 3CR2A 1XYDA 2CCMA 2F3ZA 2JXCA 1PULA 1CFFA 3TUYB 2JOJA 2LLUA 2KNEA 1Y0VH 2F8PA 3TDZA 1J7RA 3O2PA 1RTP1 1ALVA 1BT6A 1RFJA 2MLEC 1LXFC 1N65A 1BG1A 1EH2A 2OS8B 4MBEA 2OTGC 3I5HC 2JU0A 2K7OA 5CSIA 4BY5A 4U8DA 1WRKA 1YUTA 2OPOA 3SJSA 5HYDA 2BCAA 2KGBC 4HRHA 4XJKA 3GK2A 4PHJA 1CDPA 3OHMB 4FQOA 3RLZA 1EL4A 1DJWA 4AOMA 3TS5B 2LM5A 2WC8A 3NXAA 1H4BA 1IJ6A 3EKJA 5CSFA 1DTLA 1EG4A 3BUOB 2L50A 4WQ2A 1BJFA 1ZACA 1NX0A 1ZOTB 2NZ0A 2PALA 1FBVA 3F45A 1ODBA 4DRWA 2P6BB 1GGWA 3WHTB 1S6CA 3DF0A 2NXQA 1Q80A 4GNKB 2H2KA 3FIAA 3KHEA 4MLWA 3VRNA 1G4YR 1YX8A 2JXLA 2E30A 1EXRA 1CTRA 5DKRA 2L2EA 2KBMA 1BR4B 1SCMB 3K21A 3OB1B 2JTZA 1DJXA 4QJ4B 1JFJA 1A4PA 3GK1A 2O5GA 1MHOA 1NCZA 1KFXS 1SK6D 2LV7A 2GGZA 1UP5A 5AANA 2F2OA 4MSPA 5CSNA 4ZCVA 1HQVA 1M31A 1J1DA 1JUOA 1UHJA 4CPVA 2JZIA 2JT0A 1U5IB 2K0JA 5HKZA 1DJGA 1L7ZA 1SR6B 3ZNIA 2EC6C 2LP2A 4MZKA 1RJVA 4IL1A 1L2OC 4NDCA 2ZKMX 3DVEA 1NYAA 5CPVA 1IH0A 1KK7Z 1W7IB 1F4QA 3BUWB 2NLNA 1KQMC 1SKTA 3DVKA 3IF7A 2EHBA 5JJGA 3GOFA 1JF0A 1UURA 1KK7Y 3D0YB 1UHKA 3ICBA 1AVSA 4C0JA 5DKNA 1RECA 2LVJA 3TUYC 1B1GA 5BPJA 1D1OA 1A2XA 1LINA 3JVTB 2MBXA 4FTGA 1JC2A 4PE0A 2CBLA 1TRFA 2WCBA 2L98A 1M45A 1UHHA 3IQQA 3I5IB 2KFFA 2OS8C 2NCOA 1GGZA 4PCWA 2GGMA 1QLKA 1KFXL 3BYAA 1OQPA 1NX2A 1FI6A 3PFVA 3I5FB 1PSRA 4I5LB 2LMUA 3JTDB 1MUXA 1E8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBM A;  4YGE B;  3WHU B;  4CFQ A;  2Y1N A;  1B8L A;  2BE6 A;  1CNP A;  2K2F A;  3TS5 C;  2SAS A;  3PSR A;  4JQ0 D;  1NX3 A;  4NDD A;  4USL A;  2MAZ A;  4M2O A;  1LKJ A;  1WDC B;  5AXI A;  4R1E A;  1CB1 A;  2M0R A;  1AUI B;  2AMI A;  3CTN A;  2LUC A;  4GBA A;  2FCE A;  4WRI A;  2BKI B;  3SG3 A;  2JUL A;  1C7V A;  3SG2 A;  5AFP A;  1Y1A A;  1DF0 B;  5HKW A;  3LLE A;  2WCF A;  1UHI A;  4A4C A;  1XFU O;  1DMO A;  2F3Y A;  1XFW O;  2HF5 A;  5I2Q A;  5GQQ C;  1RWY A;  1YVL A;  3CWG A;  1DVI A;  1IWQ A;  3A4U B;  5PAL A;  1MF8 B;  2M1K B;  3NSK A;  1SCM C;  1A29 A;  1WY9 A;  3CGA A;  5B8I B;  1QX7 A;  1M39 A;  3EVR A;  3NSO A;  4ICB A;  2FJU B;  2L4I A;  1CM4 A;  1FI5 A;  1Y1X A;  1SYM A;  1RK9 A;  3A8R A;  4F0Z B;  3KF9 A;  1JSA A;  5G08 A;  3GK4 X;  1PK0 D;  4GPL B;  1DJH A;  3O4Y A;  1GQM A;  2CT9 A;  1UHN A;  2KQY A;  1KWO B;  1UUS A;  1DGV A;  4MZL A;  2LVI A;  1SR6 C;  1WLM A;  2D8N A;  5CSJ A;  1HT9 A;  3O6B A;  4CFR A;  1ZFS A;  1KSM A;  1CMF A;  1J55 A;  1QVI Z;  2M1U A;  2AAO A;  1M63 B;  1XFV O;  1EJ3 A;  2K61 A;  1F71 A;  1CLL A;  2VRG A;  1YUR A;  3TDI A;  4HRE E;  1G8I A;  1QVI Y;  1YRU B;  1R2U A;  1BLQ A;  2JRF A;  3PAT A;  1K95 A;  1QX5 B;  1QV1 A;  2KHN A;  2LLT A;  2KI6 D;  1XK4 C;  3DVM A;  3BXK A;  1ZMZ A;  3EVU A;  4DUQ A;  1AP4 A;  2QPT A;  4GGN A;  4QJ5 B;  1LA3 A;  1U5I A;  1BOC A;  1K93 D;  2QAC A;  2Y1M A;  1QLS A;  1B8R A;  3CZT X;  3JVT C;  1BMO A;  1TN4 A;  2PSR A;  3MSE B;  2ZRS A;  1AJ4 A;  1TIZ A;  1DT7 B;  2LUX A;  1SY9 A;  1NX1 A;  3AAK A;  2ZFD A;  5DKQ A;  1MQ1 A;  2MA2 A;  1IG5 A;  3I5I C;  1DJZ A;  2MRD A;  5JOL A;  3AKA A;  4A4B A;  1IGV A;  2R2I A;  4YGD B;  1K96 A;  1B47 A;  1WLZ A;  3I5F C;  2JT8 A;  2K7C A;  4CLN A;  3IQO A;  2KQ6 A;  4OCI A;  4YGC B;  2I2R E;  3JTD C;  2BCB A;  1SMG A;  4ORB B;  1RRO A;  4PAL A;  3SG7 A;  3D0Y A;  1EG3 A;  4N1G A;  4DS7 A;  1XK4 A;  4JWQ A;  1CDL A;  2ZRT A;  1LVC D;  2HQW A;  1WDC C;  3H4S E;  1OZS A;  2ISD A;  2K8M B;  1A75 B;  2F33 A;  5I2O A;  2WOS A;  1IQ3 A;  1X02 A;  4MRY A;  3E3R A;  1PRW A;  2M7L A;  4PHM A;  3DD4 A;  1CMG A;  1OMR A;  4ORC B;  1IKU A;  4P5O E;  1TOP A;  2Y5I A;  2BEC A;  2LLS A;  2HPS A;  3BUN B;  2NCP A;  2RGI A;  5D7F A;  1M46 A;  2H61 C;  2JQ6 A;  1CLB A;  1R6P A;  1NUB A;  2PVB A;  3VRO A;  1K9K A;  4OVN F;  2WCE A;  1A03 A;  1KWO C;  1DF0 A;  2F2P A;  3EKH A;  2KAY A;  1TCF A;  2M49 B;  3NSI A;  1CFP A;  3EK7 A;  2KDH A;  1YTZ C;  1C7W A;  4GGF C;  2ZND A;  1K90 D;  2L0P A;  3KPX A;  1B7T Z;  1N2D A;  1XO5 A;  2FCD A;  2JNX A;  2KAX A;  2BL0 B;  3KEV A;  1B7T Y;  2H61 A;  1BF5 A;  1MXE A;  1OOJ A;  5I2L A;  3NSL A;  2A4J A;  1J7Q A;  1SNL A;  2PMY A;  2I7A A;  3EK8 A;  3CS1 A;  1YVH A;  2JPT A;  2AUC A;  1KCY A;  5KU1 A;  2HET A;  1SCV A;  1S1E A;  1CM1 A;  1WRZ A;  1OMV A;  4GGF A;  2CTN A;  2LVK A;  4GFT A;  1Y6W A;  2M9G A;  2JTT A;  3AKB A;  1K2H A;  1V1F A;  3CLN A;  3LCP C;  3BUX B;  1XVJ A;  1KK8 B;  3RM1 A;  2M97 A;  5J3X A;  4WQ3 A;  1SBJ A;  1XFX O;  1SRA A;  4PE1 A;  1S36 A;  1MXL C;  1F4O A;  1QJT A;  4MVF A;  5K89 A;  5AEQ A;  5TNC A;  3SIA A;  1K94 A;  2KBI A;  2JNF A;  1OMD A;  4N5X A;  1QXP A;  2B1U A;  3PM8 A;  1PAL A;  1ZUZ A;  4L9M A;  2LP3 A;  2KYF A;  3VRP A;  3I5G B;  1NIW A;  3CR5 X;  2SCP A;  1OZO A;  2GV5 A;  2L5X B;  4PE4 A;  4XYN A;  5I8N A;  2JT3 A;  1F54 A;  1MR8 A;  2I94 A;  1UWO A;  2KFG A;  1QIW A;  3VRR A;  3LL8 B;  2WND A;  5FYX A;  5ER4 X;  2BBN A;  3SG5 A;  1KSO A;  1QS7 A;  3QRX A;  1TNP A;  1QAS A;  4E68 A;  4PE7 A;  1MWN A;  2KI6 C;  4Q04 A;  1TNX A;  2BE4 A;  1QIV A;  2JC2 A;  2DOQ A;  5HLO A;  1SPY A;  3VGO A;  2MJW B;  1BR1 B;  3PN7 B;  1CDN A;  2LMV A;  1DJI A;  2KI4 B;  1GJY A;  2PRU A;  4GUK A;  4I5J A;  4ETO A;  1S26 D;  3BOW B;  1J7P A;  2LC5 A;  5ER5 A;  3D10 A;  1SL9 A;  1A75 A;  5IBW A;  1QAT A;  1S6J A;  1N0Y A;  4I5K A;  4DCK A;  2HQ8 A;  2WOR A;  2Q91 A;  3FS7 A;  1VRK A;  5AER A;  2COL B;  4MN0 A;  2M3W A;  2LAN A;  3BQ3 A;  2Q4U A;  3AAJ A;  2CXJ A;  1TNW A;  1NWD A;  4GAO A;  4C0L A;  1IQ5 A;  5HKY A;  3SG4 A;  2TN4 A;  2EGD A;  4CID A;  2BCX A;  2LCP A;  4C0K A;  2LE9 B;  4PHK A;  4NDB A;  2ZN9 A;  1H8B A;  2BL0 C;  1NCX A;  3VRQ A;  3OX6 A;  5F6T A;  4M2P A;  2K7B A;  4D1E A;  1JBA A;  1DGU A;  2MHH A;  1TTX A;  4AQI A;  4YGA A;  1YX7 A;  3SIB A;  4DIR A;  4XJK B;  1JFK A;  1C07 A;  2BKH B;  3C1V A;  2V53 A;  1PVB A;  2LAP A;  4MEW A;  1FF1 A;  1SL8 A;  1J7O A;  1CLM A;  2IS9 A;  1BOD A;  2KGR A;  1NP8 A;  2PAS A;  3WXA A;  1KK8 C;  2K7D A;  4ZCU A;  1QV0 A;  4BY4 A;  1CKK A;  1YR5 A;  4JPZ B;  1XFZ O;  1Y1U A;  2KYC A;  2OTG B;  3I5H B;  3PAL A;  4N1F A;  1AJ5 A;  1JF2 A;  4NQG A;  1F55 A;  1B8C A;  2LHI A;  3DF0 B;  3LK0 A;  1S6I A;  4TNC A;  1XFY O;  1PVA A;  4M2Q A;  1LA0 A;  1YUU A;  3BUM B;  3FWB A;  4HSZ A;  4YI8 A;  2G2B A;  1TNQ A;  1KFU S;  1AHR A;  1QTX A;  1SL7 A;  4YGB B;  2ZNE A;  3SG6 A;  2CNP A;  1OE9 B;  2MLF C;  3I5G C;  4YBH B;  2M7N A;  3FWC A;  3HCM A;  3OX5 A;  4MRX A;  3CR4 X;  2KSP A;  1G33 A;  1TCO B;  1S5G Z;  2Y4Q A;  1F70 A;  3KO0 A;  4QJ3 B;  2LHL A;  2O60 A;  3HX4 A;  2K2A A;  1PSB A;  1QX2 A;  3EK4 A;  1S5G Y;  4HRG A;  1F8H A;  3LK1 A;  1NCY A;  4YI9 A;  4P2Y B;  4PDZ A;  1FPW A;  2I18 A;  2KOT A;  4ORA B;  2ZN8 A;  3PN7 C;  1KQV A;  2KI4 C;  1ALW A;  2E6W A;  4AQJ A;  5HLV A;  2G9B A;  3M0W A;  2M29 A;  1XA5 A;  3PLF B;  1CFC A;  3OB2 B;  5D69 A;  2L4H A;  4OKH A;  4PHN A;  4OV2 A;  1W7J B;  2LMT A;  1B9A A;  1BU3 A;  1K9P A;  2FOT A;  4OR9 B;  1NSH A;  1IRJ A;  1NPQ A;  1B4C A;  1CDM A;  1SW8 A;  1JWD A;  3OP0 A;  1AK8 A;  2L51 A;  2LNK A;  1WRL A;  1YUS A;  1OSA A;  1FW4 A;  2EC6 B;  1KFU L;  1K8U A;  2LVV A;  1V1G A;  3WNX B;  1S3P A;  3EVV A;  3ZWH A;  2KFH A;  3BOW A;  4MZJ A;  4UPG A;  1L2O B;  1DJY A;  4YRU A;  3DVJ A;  1YRT B;  5KSZ A;  3TDU A;  1KQM B;  3TZ1 A;  1J1E A;  1IJ5 A;  1K9U A;  2KAV A;  2M8U A;  4I5N B;  5KTY A;  3O78 A;  1CFD A;  2JWW A;  3CR2 A;  1XYD A;  2CCM A;  2F3Z A;  2JXC A;  1PUL A;  1CFF A;  3TUY B;  2JOJ A;  2LLU A;  2KNE A;  1Y0V H;  2F8P A;  3TDZ A;  1J7R A;  3O2P A;  1RTP 1;  1ALV A;  1BT6 A;  1RFJ A;  2MLE C;  1LXF C;  1N65 A;  1BG1 A;  1EH2 A;  2OS8 B;  4MBE A;  2OTG C;  3I5H C;  2JU0 A;  2K7O A;  5CSI A;  4BY5 A;  4U8D A;  1WRK A;  1YUT A;  2OPO A;  3SJS A;  5HYD A;  2BCA A;  2KGB C;  4HRH A;  4XJK A;  3GK2 A;  4PHJ A;  1CDP A;  3OHM B;  4FQO A;  3RLZ A;  1EL4 A;  1DJW A;  4AOM A;  3TS5 B;  2LM5 A;  2WC8 A;  3NXA A;  1H4B A;  1IJ6 A;  3EKJ A;  5CSF A;  1DTL A;  1EG4 A;  3BUO B;  2L50 A;  4WQ2 A;  1BJF A;  1ZAC A;  1NX0 A;  1ZOT B;  2NZ0 A;  2PAL A;  1FBV A;  3F45 A;  1ODB A;  4DRW A;  2P6B B;  1GGW A;  3WHT B;  1S6C A;  3DF0 A;  2NXQ A;  1Q80 A;  4GNK B;  2H2K A;  3FIA A;  3KHE A;  4MLW A;  3VRN A;  1G4Y R;  1YX8 A;  2JXL A;  2E30 A;  1EXR A;  1CTR A;  5DKR A;  2L2E A;  2KBM A;  1BR4 B;  1SCM B;  3K21 A;  3OB1 B;  2JTZ A;  1DJX A;  4QJ4 B;  1JFJ A;  1A4P A;  3GK1 A;  2O5G A;  1MHO A;  1NCZ A;  1KFX S;  1SK6 D;  2LV7 A;  2GGZ A;  1UP5 A;  5AAN A;  2F2O A;  4MSP A;  5CSN A;  4ZCV A;  1HQV A;  1M31 A;  1J1D A;  1JUO A;  1UHJ A;  4CPV A;  2JZI A;  2JT0 A;  1U5I B;  2K0J A;  5HKZ A;  1DJG A;  1L7Z A;  1SR6 B;  3ZNI A;  2EC6 C;  2LP2 A;  4MZK A;  1RJV A;  4IL1 A;  1L2O C;  4NDC A;  2ZKM X;  3DVE A;  1NYA A;  5CPV A;  1IH0 A;  1KK7 Z;  1W7I B;  1F4Q A;  3BUW B;  2NLN A;  1KQM C;  1SKT A;  3DVK A;  3IF7 A;  2EHB A;  5JJG A;  3GOF A;  1JF0 A;  1UUR A;  1KK7 Y;  3D0Y B;  1UHK A;  3ICB A;  1AVS A;  4C0J A;  5DKN A;  1REC A;  2LVJ A;  3TUY C;  1B1G A;  5BPJ A;  1D1O A;  1A2X A;  1LIN A;  3JVT B;  2MBX A;  4FTG A;  1JC2 A;  4PE0 A;  2CBL A;  1TRF A;  2WCB A;  2L98 A;  1M45 A;  1UHH A;  3IQQ A;  3I5I B;  2KFF A;  2OS8 C;  2NCO A;  1GGZ A;  4PCW A;  2GGM A;  1QLK A;  1KFX L;  3BYA A;  1OQP A;  1NX2 A;  1FI6 A;  3PFV A;  3I5F B;  1PSR A;  4I5L B;  2LMU A;  3JTD B;  1MUX A;  1E8A A; 
#chains in the Genus database with same CATH topology
 2BBM A;  4YGE B;  3WHU B;  3UO9 A;  4CFQ A;  2Y1N A;  2WCJ A;  1B8L A;  2BE6 A;  2QEH A;  1CNP A;  2K2F A;  3TS5 C;  2SAS A;  3PSR A;  4JQ0 D;  1NX3 A;  4NDD A;  4USL A;  2MAZ A;  4M2O A;  1LKJ A;  1WDC B;  5AXI A;  4R1E A;  1CB1 A;  2M0R A;  1AUI B;  2AMI A;  3L4L A;  3CTN A;  2LUC A;  4GBA A;  2FCE A;  4WRI A;  2BKI B;  3CDN A;  2JUL A;  2H8V A;  3SG3 A;  1C7V A;  3SG2 A;  5AFP A;  1Y1A A;  1DF0 B;  1T14 A;  2K60 A;  5HKW A;  3LLE A;  2WCF A;  1UHI A;  4A4C A;  1XFU O;  1DMO A;  2F3Y A;  1XFW O;  2HF5 A;  5I2Q A;  5GQQ C;  3S0A A;  1RWY A;  1YVL A;  3CWG A;  1DVI A;  1IWQ A;  3A4U B;  5PAL A;  1MF8 B;  2M1K B;  3NSK A;  1SCM C;  1A29 A;  1WY9 A;  3CGA A;  5B8I B;  1QX7 A;  1M39 A;  3EVR A;  3NSO A;  4ICB A;  3PJI A;  2FJU B;  2L4I A;  1CM4 A;  1SSE B;  1Y1X A;  1FI5 A;  1SYM A;  1RK9 A;  3A8R A;  4F0Z B;  3KF9 A;  1JSA A;  5G08 A;  1QWV A;  3GK4 X;  1PK0 D;  4GPL B;  1DJH A;  3O4Y A;  1GQM A;  2CT9 A;  1UHN A;  2KQY A;  1KWO B;  1UUS A;  1DGV A;  4MZL A;  2LVI A;  1SR6 C;  1WLM A;  2D8N A;  5CSJ A;  1HT9 A;  3O6B A;  4CFR A;  1ZFS A;  1KSM A;  1CMF A;  1DC1 A;  1J55 A;  1QVI Z;  2M1U A;  2AAO A;  1M63 B;  1XFV O;  1EJ3 A;  2K61 A;  1F71 A;  1CLL A;  2VRG A;  1YUR A;  3TDI A;  4HRE E;  1G8I A;  3CZ0 A;  1QVI Y;  2WC6 A;  1YRU B;  1R2U A;  1BLQ A;  2JRF A;  3PAT A;  1K95 A;  1QX5 B;  1QV1 A;  2KHN A;  2LLT A;  2KI6 D;  1XK4 C;  3DVM A;  3BXK A;  1ZMZ A;  3EVU A;  4INW A;  4DUQ A;  1AP4 A;  2QPT A;  4GGN A;  4QJ5 B;  1LA3 A;  1U5I A;  3DXL A;  1K93 D;  2QAC A;  2Y1M A;  1QLS A;  1B8R A;  3CZT X;  3JVT C;  1BMO A;  1TN4 A;  2PSR A;  3MSE B;  2ZRS A;  1AJ4 A;  1TIZ A;  1DT7 B;  2LUX A;  3B86 A;  1SY9 A;  1NX1 A;  3AAK A;  2ZFD A;  5DKQ A;  1MQ1 A;  2MA2 A;  2P70 A;  1IG5 A;  3I5I C;  1DJZ A;  2MRD A;  5JOL A;  3AKA A;  4A4B A;  1IGV A;  2R2I A;  4YGD B;  1K96 A;  1B47 A;  1WLZ A;  3I5F C;  2JT8 A;  1TUZ A;  2K7C A;  4CLN A;  3IQO A;  2KQ6 A;  4OCI A;  3DZT A;  4YGC B;  2I2R E;  3JTD C;  2BCB A;  1SMG A;  4ORB B;  1RRO A;  4PAL A;  3SG7 A;  3D0Y A;  3D76 A;  1EG3 A;  4INX A;  4N1G A;  4DS7 A;  1XK4 A;  4JWQ A;  5EL2 A;  1CDL A;  2ZRT A;  2QEO A;  1LVC D;  2HQW A;  1WDC C;  3H4S E;  1OZS A;  3L4A A;  2ISD A;  2K8M B;  1OOH A;  1A75 B;  2F33 A;  3R1O A;  5I2O A;  2WOS A;  1IQ3 A;  1X02 A;  4MRY A;  3E3R A;  1PRW A;  3CAB A;  2M7L A;  4FQT A;  4PHM A;  3DD4 A;  2L2C A;  1BOC A;  1CMG A;  1OMR A;  4ORC B;  3D75 A;  3Q8I A;  1IKU A;  3FE6 A;  4P5O E;  1TOP A;  3SS3 A;  2Y5I A;  2BEC A;  2LLS A;  2HPS A;  2BAP A;  3BUN B;  2NCP A;  2RGI A;  5D7F A;  1M46 A;  2H61 C;  2JQ6 A;  1CLB A;  1R6P A;  1NUB A;  2PVB A;  5FI6 A;  3FE9 A;  1GM0 A;  3VRO A;  2PQL A;  1K9K A;  3L47 A;  4OVN F;  2WCE A;  1A03 A;  1KWO C;  1DF0 A;  1P28 A;  2F2P A;  2KAY A;  1TCF A;  2M49 B;  3EKH A;  3NSI A;  3EK7 A;  1CFP A;  2KDH A;  1YTZ C;  1C7W A;  3R1V A;  4GGF C;  1C3Z A;  2ZND A;  1K90 D;  2L0P A;  3KPX A;  3B87 A;  3DYE A;  1B7T Z;  3NHI A;  1N2D A;  1XO5 A;  2FCD A;  2JNX A;  2KAX A;  2BL0 B;  5FI2 A;  3KEV A;  1B7T Y;  2H61 A;  1BF5 A;  1MXE A;  1OOJ A;  5I2L A;  5FI7 A;  3NSL A;  2A4J A;  1J7Q A;  1SNL A;  2PMY A;  2I7A A;  3EK8 A;  1OOI X;  3CS1 A;  1YVH A;  2JPT A;  2AUC A;  1KCY A;  5KU1 A;  2HET A;  1SCV A;  1S1E A;  1CM1 A;  1WRZ A;  1Z2C B;  1OMV A;  4GGF A;  2CTN A;  2LVK A;  3D73 A;  4GFT A;  1Y6W A;  3NGV A;  3BFH A;  2M9G A;  2JTT A;  3AKB A;  1K2H A;  1V1F A;  2QEV A;  3CLN A;  3LCP C;  3BUX B;  3R1P A;  1XVJ A;  1KK8 B;  3RM1 A;  2M97 A;  5J3X A;  4WQ3 A;  1SBJ A;  1XFX O;  2ERB A;  1SRA A;  4PE1 A;  1S36 A;  1MXL C;  1F4O A;  1QJT A;  4JKT A;  3BFA A;  4MVF A;  5AEQ A;  5TNC A;  3SIA A;  5K89 A;  1K94 A;  2KBI A;  2JNF A;  1OMD A;  4N5X A;  1QXP A;  3OBV A;  2B1U A;  3PM8 A;  1PAL A;  1ZUZ A;  4L9M A;  2LP3 A;  4OZD A;  2KYF A;  3VRP A;  3I5G B;  1NIW A;  3CR5 X;  1W9Z A;  2SCP A;  1OZO A;  2GV5 A;  2L5X B;  4PE4 A;  4XYN A;  5I8N A;  2JT3 A;  1F54 A;  1MR8 A;  2I94 A;  1UWO A;  2KFG A;  1QIW A;  3VRR A;  3LL8 B;  2WND A;  5FYX A;  1TWO A;  5ER4 X;  2BBN A;  3SG5 A;  1KSO A;  1QS7 A;  3QRX A;  3QME A;  1TNP A;  1QAS A;  4E68 A;  4PE7 A;  1MWN A;  2KI6 C;  4Q04 A;  1TNX A;  2BE4 A;  1QIV A;  2JC2 A;  2DOQ A;  5HLO A;  1SPY A;  3VGO A;  2JPO A;  2MJW B;  1BR1 B;  3PN7 B;  1CDN A;  2LMV A;  1DJI A;  2KI4 B;  1GJY A;  2PRU A;  4GUK A;  4I5J A;  4ETO A;  1S26 D;  3BOW B;  1J7P A;  2LC5 A;  5ER5 A;  3D10 A;  1SL9 A;  1A75 A;  5IBW A;  1QAT A;  1S6J A;  1N0Y A;  4I5K A;  4DCK A;  2HQ8 A;  2WOR A;  2Q91 A;  3FS7 A;  1VRK A;  5AER A;  2COL B;  4MN0 A;  2M3W A;  2LAN A;  3BQ3 A;  2Q4U A;  3AAJ A;  2CXJ A;  1TNW A;  1NWD A;  4GAO A;  4C0L A;  1IQ5 A;  5HKY A;  5D3O A;  3SG4 A;  2TN4 A;  2EGD A;  4CID A;  2BCX A;  2LCP A;  4C0K A;  2LE9 B;  4PHK A;  1Z4H A;  2ZN9 A;  4NDB A;  1H8B A;  2BL0 C;  1NCX A;  3VRQ A;  3OX6 A;  5F6T A;  3SS5 A;  4M2P A;  2K7B A;  4D1E A;  3K1E A;  3OGN A;  1JBA A;  1DGU A;  1ORG A;  2MHH A;  1TTX A;  2BNX A;  4YGA A;  4AQI A;  1YX7 A;  3SIB A;  4DIR A;  4XJK B;  4F7F A;  1JFK A;  1C07 A;  2BKH B;  3C1V A;  2V53 A;  1PVB A;  2LAP A;  4MEW A;  1FF1 A;  1SL8 A;  1J7O A;  1CLM A;  2IS9 A;  1BOD A;  2KGR A;  1NP8 A;  2PAS A;  3WXA A;  2WCK A;  1KK8 C;  2K7D A;  4ZCU A;  1QV0 A;  4BY4 A;  1CKK A;  1YR5 A;  4JPZ B;  1XFZ O;  1Y1U A;  2KYC A;  2OTG B;  3I5H B;  3PAL A;  4N1F A;  1AJ5 A;  1JF2 A;  4NQG A;  1F55 A;  1B8C A;  2KPH A;  2LHI A;  3DF0 B;  3LK0 A;  3B6X A;  1S6I A;  4TNC A;  1XFY O;  1PVA A;  4M2Q A;  1LA0 A;  1YUU A;  3BUM B;  3FWB A;  4HSZ A;  3SS4 A;  4YI8 A;  2G2B A;  1TNQ A;  3B7A A;  2WCL A;  1KFU S;  1AHR A;  1QTX A;  1SL7 A;  4YGB B;  2ZNE A;  3SG6 A;  2CNP A;  1OE9 B;  2MLF C;  3I5G C;  4YBH B;  2M7N A;  2YGU A;  3FWC A;  3HCM A;  2WCH A;  3OX5 A;  4MRX A;  3CR4 X;  2KSP A;  1G33 A;  2FJY A;  1TCO B;  1S5G Z;  2Y4Q A;  3S0E A;  1F70 A;  3KO0 A;  3D74 A;  4QJ3 B;  2LHL A;  2O60 A;  3HX4 A;  2K2A A;  1PSB A;  1QX2 A;  3EK4 A;  1S5G Y;  4HRG A;  1F8H A;  3LK1 A;  1NCY A;  4JD9 A;  4YI9 A;  4P2Y B;  4PDZ A;  1FPW A;  2I18 A;  2KOT A;  4ORA B;  2ZN8 A;  3PN7 C;  1KQV A;  2KI4 C;  1ALW A;  2E6W A;  4AQJ A;  5HLV A;  2G9B A;  3M0W A;  2M29 A;  1XA5 A;  3N7H A;  5HL1 A;  3PLF B;  1CFC A;  3OB2 B;  4PT1 A;  3CZ2 A;  5D69 A;  2L4H A;  4OKH A;  4PHN A;  4OV2 A;  1W7J B;  2LMT A;  5DIC A;  2L5Y A;  1B9A A;  1BU3 A;  1K9P A;  2FOT A;  3O4X A;  1NSH A;  3R72 A;  4OR9 B;  1IRJ A;  1NPQ A;  1XFR A;  1B4C A;  1CDM A;  1SW8 A;  1JWD A;  3OP0 A;  1AK8 A;  2L51 A;  2LNK A;  4KYN A;  1WRL A;  1YUS A;  1OSA A;  1FW4 A;  2EC6 B;  1KFU L;  1K8U A;  2LVV A;  1V1G A;  3WNX B;  1S3P A;  3EVV A;  1LS8 A;  2KFH A;  3BOW A;  4MZJ A;  3ZWH A;  1L2O B;  4UPG A;  1DJY A;  3BFB A;  4YRU A;  3DVJ A;  1YRT B;  5KSZ A;  3TDU A;  1KQM B;  2WC5 A;  3TZ1 A;  1J1E A;  1IJ5 A;  1K9U A;  2KAV A;  2M8U A;  3B88 A;  2GTE A;  4I5N B;  5KTY A;  3O78 A;  1CFD A;  3S0F A;  2JWW A;  1TUJ A;  3CR2 A;  1XYD A;  2CCM A;  2F3Z A;  2JXC A;  1PUL A;  1CFF A;  3TUY B;  2JOJ A;  2LLU A;  2KNE A;  3DY9 A;  1Y0V H;  2F8P A;  3TDZ A;  1J7R A;  3O2P A;  1RTP 1;  1ALV A;  1BT6 A;  1RFJ A;  2MLE C;  1LXF C;  1N65 A;  1BG1 A;  1EH2 A;  2OS8 B;  4MBE A;  2OTG C;  3I5H C;  3V2L A;  2JU0 A;  2K7O A;  5CSI A;  4BY5 A;  4U8D A;  1WRK A;  1YUT A;  3NHT A;  2OPO A;  1DQE A;  2QDI A;  3SJS A;  5HYD A;  2BCA A;  2P71 A;  2KGB C;  4HRH A;  4XJK A;  3GK2 A;  4PHJ A;  1CDP A;  3OHM B;  4FQO A;  3RLZ A;  1OW4 A;  1IIO A;  1EL4 A;  2PYQ A;  1DJW A;  4AOM A;  3TS5 B;  3S0G A;  2LM5 A;  2WC8 A;  3FE8 A;  3NXA A;  3UNW A;  1H4B A;  1IJ6 A;  3EKJ A;  5CSF A;  3CZ1 A;  3S0B A;  1DTL A;  1EG4 A;  3BUO B;  2L50 A;  3CYZ A;  4WQ2 A;  1BJF A;  1ZAC A;  1NX0 A;  1ZOT B;  2NZ0 A;  2PAL A;  1FBV A;  3F45 A;  1ODB A;  4DRW A;  3IVT A;  2P6B B;  1GGW A;  3WHT B;  3RZS A;  1S6C A;  3DF0 A;  2NXQ A;  1Q80 A;  4GNK B;  2H2K A;  3FIA A;  1DEL A;  3KHE A;  4MLW A;  3VRN A;  1G4Y R;  1YX8 A;  2JXL A;  3EG5 B;  2E30 A;  1EXR A;  1CTR A;  3D77 A;  5DKR A;  2L2E A;  2KBM A;  1BR4 B;  1SCM B;  3K21 A;  3OB1 B;  2JTZ A;  1DJX A;  4IJ7 A;  4QJ4 B;  1JFJ A;  1A4P A;  3GK1 A;  2O5G A;  1MHO A;  1NCZ A;  1KFX S;  1SK6 D;  2LV7 A;  3PM2 A;  2GGZ A;  1UP5 A;  5AAN A;  1OOF A;  2F2O A;  4MSP A;  5CSN A;  4ZCV A;  1HQV A;  2WCM A;  1M31 A;  1J1D A;  1JUO A;  1UHJ A;  4CPV A;  2JZI A;  2JT0 A;  1U5I B;  2K0J A;  5HKZ A;  1DJG A;  3S0D A;  1L7Z A;  1SR6 B;  3ZNI A;  2EC6 C;  1OOG A;  2LP2 A;  4MZK A;  1RJV A;  4IL1 A;  5I94 A;  1L2O C;  4NDC A;  2ZKM X;  3DVE A;  1NYA A;  5CPV A;  1IH0 A;  1KK7 Z;  1W7I B;  1F4Q A;  3BUW B;  2NLN A;  1KQM C;  1SKT A;  3DVK A;  3IF7 A;  2EHB A;  5JJG A;  3GOF A;  1JF0 A;  1UUR A;  1KK7 Y;  3D0Y B;  1UHK A;  3ICB A;  1AVS A;  4C0J A;  5DKN A;  1REC A;  2LVJ A;  3VB1 A;  3TUY C;  5BPJ A;  1B1G A;  1D1O A;  1A2X A;  1LIN A;  3JVT B;  1DEK A;  4FTG A;  2MBX A;  1JC2 A;  4PE0 A;  2CBL A;  1TRF A;  3BJH A;  2QEB A;  3D78 A;  2WCB A;  2L98 A;  1M45 A;  1UHH A;  3IQQ A;  3I5I B;  2KFF A;  2OS8 C;  2NCO A;  1GGZ A;  4PCW A;  2GGM A;  1QLK A;  1KFX L;  3BYA A;  1C3Y A;  1OQP A;  1NX2 A;  1FI6 A;  3PFV A;  3I5F B;  1PSR A;  2KLD A;  4I5L B;  2LMU A;  3JTD B;  2KLE A;  1MUX A;  1E8A A; 
#chains in the Genus database with same CATH homology
 2BBM A;  4YGE B;  3WHU B;  4CFQ A;  2Y1N A;  1B8L A;  2BE6 A;  1CNP A;  2K2F A;  3TS5 C;  2SAS A;  3PSR A;  4JQ0 D;  1NX3 A;  4NDD A;  4USL A;  2MAZ A;  4M2O A;  1LKJ A;  1WDC B;  5AXI A;  4R1E A;  1CB1 A;  2M0R A;  1AUI B;  2AMI A;  3CTN A;  2LUC A;  4GBA A;  2FCE A;  4WRI A;  2BKI B;  3SG3 A;  2JUL A;  1C7V A;  3SG2 A;  5AFP A;  1Y1A A;  1DF0 B;  5HKW A;  3LLE A;  2WCF A;  1UHI A;  4A4C A;  1XFU O;  1DMO A;  2F3Y A;  1XFW O;  2HF5 A;  5I2Q A;  5GQQ C;  1RWY A;  1YVL A;  3CWG A;  1DVI A;  1IWQ A;  3A4U B;  5PAL A;  1MF8 B;  2M1K B;  3NSK A;  1SCM C;  1A29 A;  1WY9 A;  3CGA A;  5B8I B;  1QX7 A;  1M39 A;  3EVR A;  3NSO A;  4ICB A;  2FJU B;  2L4I A;  1CM4 A;  1FI5 A;  1Y1X A;  1SYM A;  1RK9 A;  3A8R A;  4F0Z B;  3KF9 A;  1JSA A;  5G08 A;  3GK4 X;  1PK0 D;  4GPL B;  1DJH A;  3O4Y A;  1GQM A;  2CT9 A;  1UHN A;  2KQY A;  1KWO B;  1UUS A;  1DGV A;  4MZL A;  2LVI A;  1SR6 C;  1WLM A;  2D8N A;  5CSJ A;  1HT9 A;  3O6B A;  4CFR A;  1ZFS A;  1KSM A;  1CMF A;  1J55 A;  1QVI Z;  2M1U A;  2AAO A;  1M63 B;  1XFV O;  1EJ3 A;  2K61 A;  1F71 A;  1CLL A;  2VRG A;  1YUR A;  3TDI A;  4HRE E;  1G8I A;  1QVI Y;  1YRU B;  1R2U A;  1BLQ A;  2JRF A;  3PAT A;  1K95 A;  1QX5 B;  1QV1 A;  2KHN A;  2LLT A;  2KI6 D;  1XK4 C;  3DVM A;  3BXK A;  1ZMZ A;  3EVU A;  4DUQ A;  1AP4 A;  2QPT A;  4GGN A;  4QJ5 B;  1LA3 A;  1U5I A;  1BOC A;  1K93 D;  2QAC A;  2Y1M A;  1QLS A;  1B8R A;  3CZT X;  3JVT C;  1BMO A;  1TN4 A;  2PSR A;  3MSE B;  2ZRS A;  1AJ4 A;  1TIZ A;  1DT7 B;  2LUX A;  1SY9 A;  1NX1 A;  3AAK A;  2ZFD A;  5DKQ A;  1MQ1 A;  2MA2 A;  1IG5 A;  3I5I C;  1DJZ A;  2MRD A;  5JOL A;  3AKA A;  4A4B A;  1IGV A;  2R2I A;  4YGD B;  1K96 A;  1B47 A;  1WLZ A;  3I5F C;  2JT8 A;  2K7C A;  4CLN A;  3IQO A;  2KQ6 A;  4OCI A;  4YGC B;  2I2R E;  3JTD C;  2BCB A;  1SMG A;  4ORB B;  1RRO A;  4PAL A;  3SG7 A;  3D0Y A;  1EG3 A;  4N1G A;  4DS7 A;  1XK4 A;  4JWQ A;  1CDL A;  2ZRT A;  1LVC D;  2HQW A;  1WDC C;  3H4S E;  1OZS A;  2ISD A;  2K8M B;  1A75 B;  2F33 A;  5I2O A;  2WOS A;  1IQ3 A;  1X02 A;  4MRY A;  3E3R A;  1PRW A;  2M7L A;  4PHM A;  3DD4 A;  1CMG A;  1OMR A;  4ORC B;  1IKU A;  4P5O E;  1TOP A;  2Y5I A;  2BEC A;  2LLS A;  2HPS A;  3BUN B;  2NCP A;  2RGI A;  5D7F A;  1M46 A;  2H61 C;  2JQ6 A;  1CLB A;  1R6P A;  1NUB A;  2PVB A;  3VRO A;  1K9K A;  4OVN F;  2WCE A;  1A03 A;  1KWO C;  1DF0 A;  2F2P A;  3EKH A;  2KAY A;  1TCF A;  2M49 B;  3NSI A;  1CFP A;  3EK7 A;  2KDH A;  1YTZ C;  1C7W A;  4GGF C;  2ZND A;  1K90 D;  2L0P A;  3KPX A;  1B7T Z;  1N2D A;  1XO5 A;  2FCD A;  2JNX A;  2KAX A;  2BL0 B;  3KEV A;  1B7T Y;  2H61 A;  1BF5 A;  1MXE A;  1OOJ A;  5I2L A;  3NSL A;  2A4J A;  1J7Q A;  1SNL A;  2PMY A;  2I7A A;  3EK8 A;  3CS1 A;  1YVH A;  2JPT A;  2AUC A;  1KCY A;  5KU1 A;  2HET A;  1SCV A;  1S1E A;  1CM1 A;  1WRZ A;  1OMV A;  4GGF A;  2CTN A;  2LVK A;  4GFT A;  1Y6W A;  2M9G A;  2JTT A;  3AKB A;  1K2H A;  1V1F A;  3CLN A;  3LCP C;  3BUX B;  1XVJ A;  1KK8 B;  3RM1 A;  2M97 A;  5J3X A;  4WQ3 A;  1SBJ A;  1XFX O;  1SRA A;  4PE1 A;  1S36 A;  1MXL C;  1F4O A;  1QJT A;  4MVF A;  5K89 A;  5AEQ A;  5TNC A;  3SIA A;  1K94 A;  2KBI A;  2JNF A;  1OMD A;  4N5X A;  1QXP A;  2B1U A;  3PM8 A;  1PAL A;  1ZUZ A;  4L9M A;  2LP3 A;  2KYF A;  3VRP A;  3I5G B;  1NIW A;  3CR5 X;  2SCP A;  1OZO A;  2GV5 A;  2L5X B;  4PE4 A;  4XYN A;  5I8N A;  2JT3 A;  1F54 A;  1MR8 A;  2I94 A;  1UWO A;  2KFG A;  1QIW A;  3VRR A;  3LL8 B;  2WND A;  5FYX A;  5ER4 X;  2BBN A;  3SG5 A;  1KSO A;  1QS7 A;  3QRX A;  1TNP A;  1QAS A;  4E68 A;  4PE7 A;  1MWN A;  2KI6 C;  4Q04 A;  1TNX A;  2BE4 A;  1QIV A;  2JC2 A;  2DOQ A;  5HLO A;  1SPY A;  3VGO A;  2MJW B;  1BR1 B;  3PN7 B;  1CDN A;  2LMV A;  1DJI A;  2KI4 B;  1GJY A;  2PRU A;  4GUK A;  4I5J A;  4ETO A;  1S26 D;  3BOW B;  1J7P A;  2LC5 A;  5ER5 A;  3D10 A;  1SL9 A;  1A75 A;  5IBW A;  1QAT A;  1S6J A;  1N0Y A;  4I5K A;  4DCK A;  2HQ8 A;  2WOR A;  2Q91 A;  3FS7 A;  1VRK A;  5AER A;  2COL B;  4MN0 A;  2M3W A;  2LAN A;  3BQ3 A;  2Q4U A;  3AAJ A;  2CXJ A;  1TNW A;  1NWD A;  4GAO A;  4C0L A;  1IQ5 A;  5HKY A;  3SG4 A;  2TN4 A;  2EGD A;  4CID A;  2BCX A;  2LCP A;  4C0K A;  2LE9 B;  4PHK A;  4NDB A;  2ZN9 A;  1H8B A;  2BL0 C;  1NCX A;  3VRQ A;  3OX6 A;  5F6T A;  4M2P A;  2K7B A;  4D1E A;  1JBA A;  1DGU A;  2MHH A;  1TTX A;  4AQI A;  4YGA A;  1YX7 A;  3SIB A;  4DIR A;  4XJK B;  1JFK A;  1C07 A;  2BKH B;  3C1V A;  2V53 A;  1PVB A;  2LAP A;  4MEW A;  1FF1 A;  1SL8 A;  1J7O A;  1CLM A;  2IS9 A;  1BOD A;  2KGR A;  1NP8 A;  2PAS A;  3WXA A;  1KK8 C;  2K7D A;  4ZCU A;  1QV0 A;  4BY4 A;  1CKK A;  1YR5 A;  4JPZ B;  1XFZ O;  1Y1U A;  2KYC A;  2OTG B;  3I5H B;  3PAL A;  4N1F A;  1AJ5 A;  1JF2 A;  4NQG A;  1F55 A;  1B8C A;  2LHI A;  3DF0 B;  3LK0 A;  1S6I A;  4TNC A;  1XFY O;  1PVA A;  4M2Q A;  1LA0 A;  1YUU A;  3BUM B;  3FWB A;  4HSZ A;  4YI8 A;  2G2B A;  1TNQ A;  1KFU S;  1AHR A;  1QTX A;  1SL7 A;  4YGB B;  2ZNE A;  3SG6 A;  2CNP A;  1OE9 B;  2MLF C;  3I5G C;  4YBH B;  2M7N A;  3FWC A;  3HCM A;  3OX5 A;  4MRX A;  3CR4 X;  2KSP A;  1G33 A;  1TCO B;  1S5G Z;  2Y4Q A;  1F70 A;  3KO0 A;  4QJ3 B;  2LHL A;  2O60 A;  3HX4 A;  2K2A A;  1PSB A;  1QX2 A;  3EK4 A;  1S5G Y;  4HRG A;  1F8H A;  3LK1 A;  1NCY A;  4YI9 A;  4P2Y B;  4PDZ A;  1FPW A;  2I18 A;  2KOT A;  4ORA B;  2ZN8 A;  3PN7 C;  1KQV A;  2KI4 C;  1ALW A;  2E6W A;  4AQJ A;  5HLV A;  2G9B A;  3M0W A;  2M29 A;  1XA5 A;  3PLF B;  1CFC A;  3OB2 B;  5D69 A;  2L4H A;  4OKH A;  4PHN A;  4OV2 A;  1W7J B;  2LMT A;  1B9A A;  1BU3 A;  1K9P A;  2FOT A;  4OR9 B;  1NSH A;  1IRJ A;  1NPQ A;  1B4C A;  1CDM A;  1SW8 A;  1JWD A;  3OP0 A;  1AK8 A;  2L51 A;  2LNK A;  1WRL A;  1YUS A;  1OSA A;  1FW4 A;  2EC6 B;  1KFU L;  1K8U A;  2LVV A;  1V1G A;  3WNX B;  1S3P A;  3EVV A;  3ZWH A;  2KFH A;  3BOW A;  4MZJ A;  4UPG A;  1L2O B;  1DJY A;  4YRU A;  3DVJ A;  1YRT B;  5KSZ A;  3TDU A;  1KQM B;  3TZ1 A;  1J1E A;  1IJ5 A;  1K9U A;  2KAV A;  2M8U A;  4I5N B;  5KTY A;  3O78 A;  1CFD A;  2JWW A;  3CR2 A;  1XYD A;  2CCM A;  2F3Z A;  2JXC A;  1PUL A;  1CFF A;  3TUY B;  2JOJ A;  2LLU A;  2KNE A;  1Y0V H;  2F8P A;  3TDZ A;  1J7R A;  3O2P A;  1RTP 1;  1ALV A;  1BT6 A;  1RFJ A;  2MLE C;  1LXF C;  1N65 A;  1BG1 A;  1EH2 A;  2OS8 B;  4MBE A;  2OTG C;  3I5H C;  2JU0 A;  2K7O A;  5CSI A;  4BY5 A;  4U8D A;  1WRK A;  1YUT A;  2OPO A;  3SJS A;  5HYD A;  2BCA A;  2KGB C;  4HRH A;  4XJK A;  3GK2 A;  4PHJ A;  1CDP A;  3OHM B;  4FQO A;  3RLZ A;  1EL4 A;  1DJW A;  4AOM A;  3TS5 B;  2LM5 A;  2WC8 A;  3NXA A;  1H4B A;  1IJ6 A;  3EKJ A;  5CSF A;  1DTL A;  1EG4 A;  3BUO B;  2L50 A;  4WQ2 A;  1BJF A;  1ZAC A;  1NX0 A;  1ZOT B;  2NZ0 A;  2PAL A;  1FBV A;  3F45 A;  1ODB A;  4DRW A;  2P6B B;  1GGW A;  3WHT B;  1S6C A;  3DF0 A;  2NXQ A;  1Q80 A;  4GNK B;  2H2K A;  3FIA A;  3KHE A;  4MLW A;  3VRN A;  1G4Y R;  1YX8 A;  2JXL A;  2E30 A;  1EXR A;  1CTR A;  5DKR A;  2L2E A;  2KBM A;  1BR4 B;  1SCM B;  3K21 A;  3OB1 B;  2JTZ A;  1DJX A;  4QJ4 B;  1JFJ A;  1A4P A;  3GK1 A;  2O5G A;  1MHO A;  1NCZ A;  1KFX S;  1SK6 D;  2LV7 A;  2GGZ A;  1UP5 A;  5AAN A;  2F2O A;  4MSP A;  5CSN A;  4ZCV A;  1HQV A;  1M31 A;  1J1D A;  1JUO A;  1UHJ A;  4CPV A;  2JZI A;  2JT0 A;  1U5I B;  2K0J A;  5HKZ A;  1DJG A;  1L7Z A;  1SR6 B;  3ZNI A;  2EC6 C;  2LP2 A;  4MZK A;  1RJV A;  4IL1 A;  1L2O C;  4NDC A;  2ZKM X;  3DVE A;  1NYA A;  5CPV A;  1IH0 A;  1KK7 Z;  1W7I B;  1F4Q A;  3BUW B;  2NLN A;  1KQM C;  1SKT A;  3DVK A;  3IF7 A;  2EHB A;  5JJG A;  3GOF A;  1JF0 A;  1UUR A;  1KK7 Y;  3D0Y B;  1UHK A;  3ICB A;  1AVS A;  4C0J A;  5DKN A;  1REC A;  2LVJ A;  3TUY C;  1B1G A;  5BPJ A;  1D1O A;  1A2X A;  1LIN A;  3JVT B;  2MBX A;  4FTG A;  1JC2 A;  4PE0 A;  2CBL A;  1TRF A;  2WCB A;  2L98 A;  1M45 A;  1UHH A;  3IQQ A;  3I5I B;  2KFF A;  2OS8 C;  2NCO A;  1GGZ A;  4PCW A;  2GGM A;  1QLK A;  1KFX L;  3BYA A;  1OQP A;  1NX2 A;  1FI6 A;  3PFV A;  3I5F B;  1PSR A;  4I5L B;  2LMU A;  3JTD B;  1MUX A;  1E8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...