3LLEA

X-ray structure of bovine sc0322,ca(2+)-s100b
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title In vitro screening and structural characterization of inhibitors of the S100B-p53 interaction.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 34
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3lleA00
1RJVA 2MAZA 2VRGA 2M1KB 1GJYA 3PLFB 2KGBC 4C0KA 1UHNA 3PFVA 2LC5A 1KFUL 3BUOB 4M2OA 1L2OB 1K94A 3NSIA 5HKZA 3IF7A 4GAOA 1LA0A 1JBAA 1A03A 2LAPA 2H2KA 1NUBA 4MZJA 4OR9B 1Y1AA 3TUYC 3DD4A 1BG1A 2K7CA 1H8BA 1DJXA 1JF0A 4XJKB 1RWYA 3JTDB 5HLVA 5K89A 4MZKA 4C0LA 4FTGA 2MJWB 2MBXA 1BOCA 1SPYA 4PE0A 3HX4A 1BODA 1UP5A 1AJ4A 2L50A 4P2YB 4YGBB 1L7ZA 1CFPA 2LMUA 1A2XA 2IS9A 2Y5IA 1B9AA 2KHNA 1CNPA 2KQYA 2LNKA 4FQOA 5AEQA 1YUTA 2AAOA 2KI6C 2L98A 3BOWA 2F3YA 3M0WA 3O6BA 4GFTA 1QIVA 1KK8C 5I2QA 1TIZA 2ZNDA 3OP0A 5G08A 2WNDA 1B1GA 1DT7B 1S3PA 4R1EA 2CNPA 3D0YB 3D10A 1BJFA 5ER5A 1CDMA 2G2BA 1JUOA 1B47A 3KF9A 3FWBA 1KSMA 2KSPA 1CDPA 3OB1B 1TCOB 3VRPA 1ODBA 3DVMA 1F4QA 4QJ3B 2PMYA 4CIDA 1KQMB 1B7TZ 3EKJA 5D69A 1ZMZA 3LCPC 2CBLA 2M1UA 1J1DA 1A4PA 3I5FB 3SG4A 4PDZA 3NXAA 3EVVA 1XO5A 1B8RA 1Y6WA 3DVEA 3CS1A 1KK7Z 1NIWA 1S36A 3SJSA 3PN7B 1FPWA 3CLNA 4XYNA 4HSZA 5KSZA 1N2DA 3CWGA 2LVKA 1KK7Y 1QVIY 1IQ3A 1JWDA 1QX5B 1QIWA 1XFVO 3OHMB 3H4SE 1S6CA 2LP2A 1AP4A 1WRLA 2LV7A 3TDUA 4YGAA 1SR6B 2KI4C 1AVSA 1IG5A 1EG3A 2M97A 2LLSA 1ALWA 3DF0A 4DS7A 4I5KA 5KTYA 3PATA 4MRXA 1IJ5A 1WRZA 2JC2A 4IL1A 5BPJA 2ZN9A 1KFUS 4ORAB 4WQ3A 2MHHA 3O4YA 4ZCUA 1CLBA 3PALA 5CSNA 1YTZC 3A4UB 1PRWA 3EK7A 5I2OA 2P6BB 3VGOA 1Y1XA 2OS8B 3RLZA 1SK6D 1QV0A 1XFUO 2F2PA 1DVIA 2L5XB 1XYDA 2LM5A 4YGDB 5J3XA 1YR5A 5KU1A 1SKTA 2LCPA 3BUMB 2HQ8A 1DF0A 4BY5A 1OE9B 1WY9A 1OQPA 2JULA 3IQQA 1SNLA 1QASA 2K2AA 4JWQA 3F45A 2WCBA 4I5LB 4C0JA 1B4CA 3EK8A 2Y1NA 3CTNA 1KFXL 5CPVA 1ALVA 1Y0VH 3I5HC 1QLKA 3SG2A 1WRKA 1X02A 3DVJA 1S6IA 2KAXA 4QJ4B 1QATA 1SL7A 2JNXA 1SCMB 3I5IC 2SASA 5DKNA 1GGWA 3TZ1A 1WLZA 5AXIA 5CSJA 2I94A 2CXJA 2JOJA 1YVLA 2LUCA 2HQWA 3KEVA 1S5GY 1SCVA 1J55A 1BMOA 2KAVA 2ZRTA 4AQIA 5HLOA 1K8UA 4NQGA 3WHTB 1L2OC 2KGRA 1OMDA 1CFFA 4HRHA 2L51A 5DKRA 2QACA 2L4IA 2LVVA 2K0JA 2K7DA 1MF8B 2I7AA 2BCXA 4HREE 1J7PA 1YRUB 2D8NA 3JTDC 2JTTA 4ICBA 2M29A 1KCYA 4GNKB 3ICBA 3O2PA 3QRXA 1N0YA 2KFGA 4I5JA 4QJ5B 3BOWB 3OX5A 4OKHA 1QX2A 1NX1A 2BKIB 2K2FA 2NZ0A 2OPOA 2ZNEA 5HYDA 1FF1A 3BUXB 2JT8A 1S6JA 1SRAA 2JQ6A 4DCKA 1PULA 1QLSA 4A4CA 3EVUA 1J1EA 4D1EA 2OTGC 5I8NA 1OMRA 2LVIA 3GOFA 1SYMA 1K2HA 1RFJA 2PSRA 1W7JB 1IGVA 1LA3A 1UUSA 1CKKA 1KWOB 2M3WA 2Y4QA 1B8CA 2BL0B 2NCOA 1C7WA 2TN4A 3NSOA 5PALA 3GK1A 2PASA 2AMIA 2K61A 1TNQA 2JRFA 3IQOA 4GUKA 2F2OA 1PVBA 5I2LA 1KQMC 2V53A 1JFKA 3MSEB 3RM1A 3CR5X 3VROA 3SG7A 2FOTA 1JF2A 3DVKA 1LINA 1SL8A 3I5FC 1K96A 4A4BA 2GGZA 2O5GA 1CDLA 1K9PA 1NYAA 3CR4X 1J7OA 3PN7C 1KFXS 1UHHA 5GQQC 5CSFA 4XJKA 4M2PA 3CZTX 2CTNA 2LE9B 1QVIZ 3DF0B 4F0ZB 1MXLC 2LHLA 1H4BA 1MR8A 2AUCA 1MWNA 1DJIA 3BQ3A 1EJ3A 1XK4C 4MLWA 1SR6C 5DKQA 3VRNA 2DOQA 3I5GB 2JT3A 3WXAA 5ER4X 2KI6D 4N1FA 4GPLB 1AJ5A 3AAJA 1GGZA 4DRWA 2GV5A 2Q4UA 4Q04A 2F33A 2LLTA 2LLUA 4MEWA 1BF5A 3C1VA 1A75B 2FCDA 2L0PA 2OS8C 1MQ1A 1W7IB 2EC6B 1YVHA 1XFWO 1OZSA 1XFXO 1S26D 2GGMA 2KNEA 4YI8A 4DUQA 4JPZB 2M8UA 2MLFC 3BXKA 1SW8A 2KFFA 4OV2A 1PK0D 2L4HA 1XFZO 4YBHB 2K7OA 2LANA 2M9GA 2RGIA 1G8IA 4PE1A 1FI6A 4CPVA 1FI5A 1CMFA 1LVCD 2M7NA 1M31A 1WDCB 3FIAA 1IH0A 1TCFA 2HPSA 1EH2A 1SCMC 1YUSA 2EGDA 4CLNA 1YX7A 2E6WA 5IBWA 3WNXB 1PSRA 4PCWA 1TNWA 1F8HA 4USLA 1KQVA 1JSAA 1OOJA 2LHIA 1OMVA 2KBMA 3LLEA 1LXFC 1S5GZ 5AFPA 4WRIA 3AKAA 4CFRA 3AAKA 1RROA 2MLEC 3KHEA 1EXRA 2JXCA 2KYCA 4PE4A 1F54A 1J7RA 4JQ0D 4MN0A 2BCAA 2I2RE 1ZFSA 1K9KA 4N5XA 5AANA 4WQ2A 1K95A 1BT6A 1DJZA 3SIAA 1E8AA 4YGEB 2ISDA 1QXPA 4GBAA 4PHKA 3JVTB 5B8IB 1TRFA 1QV1A 2Q91A 3TS5B 2JWWA 4NDDA 4MRYA 4NDCA 1DTLA 2JPTA 3HCMA 1FW4A 4OVNF 1NCZA 3K21A 4NDBA 2I18A 4YI9A 2KYFA 1UHJA 3KPXA 3OX6A 2EHBA 2WCFA 1V1FA 1OSAA 2A4JA 1IJ6A 1AHRA 2BE4A 1NX3A 1UURA 2JZIA 1NWDA 1S1EA 1TNXA 5TNCA 1PALA 2H61C 3TDZA 5FYXA 1CTRA 1CFCA 1KWOC 1YUUA 5AERA 1NCYA 5JOLA 1SL9A 2FCEA 1BLQA 2BL0C 1U5IA 2KAYA 3A8RA 2KQ6A 3CR2A 3ZNIA 1SBJA 3KO0A 2MRDA 4YGCB 2JTZA 2F8PA 1F4OA 1KSOA 1CLLA 1N65A 5HKWA 4UPGA 1IKUA 1NPQA 4M2QA 1DMOA 1NX0A 2LMVA 1DJYA 2BE6A 3NSKA 1BU3A 3TUYB 4CFQA 2QPTA 1QS7A 1SMGA 4ORCB 2NLNA 1CMGA 2ZFDA 1DJHA 3BYAA 4HRGA 5CSIA 1V1GA 2LUXA 2ZKMX 1TN4A 4PHNA 2WCEA 4PHJA 1UWOA 2R2IA 2PVBA 2HETA 2OTGB 2WOSA 1M39A 1ZUZA 2WC8A 1NP8A 4L9MA 1M45A 3SG3A 2K8MB 1MHOA 1F55A 1DJGA 3I5GC 4ETOA 2L2EA 4PALA 3CGAA 1OZOA 1CDNA 1AUIB 1B8LA 1KK8B 3BUNB 3FS7A 2BECA 2KDHA 3EK4A 1YRTB 4GGFC 2BCBA 2G9BA 2H61A 1UHIA 2PALA 1C7VA 4ORBB 4OCIA 1M63B 4AOMA 3SG5A 2BKHB 2WORA 4GGNA 3D0YA 2NCPA 1B7TY 1MUXA 1XA5A 2ZN8A 2EC6C 2LP3A 3O78A 1QX7A 1HT9A 1PSBA 3SIBA 4N1GA 1DF0B 2KOTA 4PHMA 4AQJA 1XVJA 1Q80A 1JFJA 1GQMA 1BR1B 2JT0A 2M49B 2HF5A 3GK4X 3TDIA 2BBNA 3VRRA 5JJGA 4DIRA 1F71A 1R2UA 1M46A 5D7FA 4U8DA 2Y1MA 1RECA 2FJUB 1WDCC 1K93D 4MBEA 3LL8B 3VRQA 4MVFA 2JXLA 1DGVA 3SG6A 1SY9A 2KI4B 2MA2A 3LK1A 2E30A 2M7LA 1IWQA 2LMTA 3AKBA 3E3RA 4PE7A 2CT9A 1J7QA 3LK0A 1IRJA 2BBMA 2KFHA 1F70A 1ZACA 1XFYO 3EKHA 4I5NB 1TOPA 1XK4A 2B1UA 2KBIA 1DJWA 4GGFA 2COLB 4MSPA 1HQVA 1R6PA 2K7BA 1EL4A 1D1OA 2LVJA 1CM4A 2PRUA 1YX8A 1CLMA 1C07A 3FWCA 1A29A 1CM1A 2F3ZA 3OB2B 1A75A 2O60A 1MXEA 1CFDA 1RK9A 2JU0A 2ZRSA 3JVTC 1PVAA 1QJTA 5F6TA 4P5OE 1IQ5A 3ZWHA 3EVRA 1CB1A 1EG4A 3TS5C 3PSRA 4YRUA 1K90D 1QTXA 1WLMA 3PM8A 1FBVA 4TNCA 2M0RA 3I5HB 1TTXA 1NCXA 1U5IB 1G33A 2CCMA 5HKYA 1YURA 2JNFA 1BR4B 1RTP1 2SCPA 3WHUB 4BY4A 3I5IB 1G4YR 4ZCVA 4E68A 1NSHA 1TNPA 1ZOTB 3GK2A 4MZLA 1AK8A 1VRKA 3BUWB 1LKJA 1K9UA 3NSLA 1DGUA 1NX2A 1JC2A 2NXQA 1Y1UA 1UHKA
chains in the Genus database with same CATH superfamily
1RJVA 2MAZA 2VRGA 3FE6A 2M1KB 1GJYA 3PLFB 2KGBC 4C0KA 1UHNA 3PFVA 4INWA 1DQEA 1KFUL 2LC5A 3BUOB 1L2OB 3CYZA 4M2OA 1K94A 3NSIA 5HKZA 3IF7A 4GAOA 1LA0A 1JBAA 1A03A 2LAPA 2H2KA 1NUBA 4MZJA 4OR9B 1Y1AA 3TUYC 3DD4A 1BG1A 2K7CA 1H8BA 4KYNA 1DJXA 1JF0A 1SSEB 1RWYA 1W9ZA 3JTDB 4XJKB 5HLVA 5K89A 4MZKA 4C0LA 4FTGA 2MJWB 2MBXA 1BOCA 1SPYA 2KLDA 3HX4A 4PE0A 1BODA 1UP5A 1AJ4A 2L50A 4P2YB 4YGBB 1L7ZA 1CFPA 2LMUA 1A2XA 2IS9A 2Y5IA 1B9AA 2KHNA 1CNPA 2L2CA 2KQYA 2LNKA 4FQOA 1T14A 1YUTA 2AAOA 5AEQA 5EL2A 2KI6C 2L98A 3BOWA 2F3YA 3M0WA 3O6BA 4GFTA 1OW4A 1QIVA 1KK8C 5I2QA 1TIZA 2ZNDA 3OP0A 5G08A 2WNDA 1B1GA 1DT7B 1S3PA 4R1EA 2CNPA 3D0YB 3D10A 1BJFA 5ER5A 1CDMA 2G2BA 1JUOA 1B47A 1TWOA 3KF9A 3FWBA 1KSMA 2KSPA 1CDPA 3OB1B 1TCOB 3VRPA 1ODBA 3DVMA 1F4QA 4QJ3B 3VB1A 2PMYA 4CIDA 1KQMB 1B7TZ 3EKJA 5D69A 1ZMZA 3LCPC 2CBLA 2M1UA 1J1DA 1A4PA 3I5FB 3SG4A 3O4XA 4PDZA 3NXAA 3EVVA 1XO5A 2KLEA 1B8RA 1Y6WA 3DVEA 3CS1A 1KK7Z 1NIWA 1S36A 4OZDA 3SJSA 3PN7B 1FPWA 3CLNA 3S0EA 4XYNA 4HSZA 5KSZA 1N2DA 3CWGA 2LVKA 1KK7Y 1QVIY 1IQ3A 1JWDA 1QX5B 3IVTA 1QIWA 1XFVO 3OHMB 3H4SE 1S6CA 2LP2A 1AP4A 1WRLA 2LV7A 3SS4A 3TDUA 4YGAA 1SR6B 2KI4C 1AVSA 1IG5A 1EG3A 2M97A 3S0DA 2LLSA 1ALWA 3DF0A 4DS7A 4I5KA 5KTYA 3PATA 4MRXA 1IJ5A 1WRZA 2JC2A 4IL1A 5BPJA 2ZN9A 1KFUS 4ORAB 4WQ3A 2MHHA 3O4YA 4ZCUA 1CLBA 3PALA 5CSNA 1OOIX 1YTZC 2BNXA 1Z2CB 1PRWA 3A4UB 3B86A 3EK7A 5I2OA 2P6BB 3R1VA 3VGOA 1Y1XA 2OS8B 3CDNA 3DYEA 3RLZA 1SK6D 1QV0A 1XFUO 2F2PA 1DVIA 2L5XB 1XYDA 2LM5A 4YGDB 3BFAA 5J3XA 1YR5A 5KU1A 1SKTA 2LCPA 1DELA 3BUMB 2HQ8A 1DF0A 3SS5A 1OE9B 1WY9A 4INXA 4BY5A 1OQPA 2JULA 3IQQA 1SNLA 1QASA 2K2AA 4JWQA 3F45A 2WCBA 4I5LB 4C0JA 1B4CA 3EK8A 2Y1NA 3D78A 3CTNA 1KFXL 5CPVA 1ALVA 1Y0VH 3I5HC 3D74A 1QLKA 4JKTA 3SG2A 1WRKA 1X02A 3DVJA 1S6IA 2KAXA 4QJ4B 1QATA 1SL7A 2JNXA 1SCMB 2PQLA 3FE8A 3I5IC 2SASA 5DKNA 1GGWA 3TZ1A 1WLZA 5AXIA 5CSJA 2I94A 3B88A 2CXJA 2JOJA 1YVLA 2LUCA 2HQWA 3KEVA 1S5GY 1SCVA 1J55A 1BMOA 2KAVA 2ZRTA 4AQIA 5HLOA 1K8UA 4NQGA 3WHTB 1L2OC 2KGRA 1OMDA 3NHIA 4HRHA 1CFFA 2L51A 5DKRA 2QACA 2L4IA 2LVVA 3L4LA 2K0JA 3D77A 2K7DA 1MF8B 2I7AA 2BCXA 4HREE 1J7PA 1YRUB 2D8NA 3JTDC 3L47A 2JTTA 4ICBA 2M29A 1KCYA 4GNKB 3ICBA 3O2PA 3QRXA 1N0YA 2KFGA 5FI2A 4I5JA 4QJ5B 3BOWB 3OX5A 4OKHA 1QX2A 1NX1A 2BKIB 1DEKA 2K2FA 2NZ0A 2OPOA 2ZNEA 5HYDA 3BUXB 1FF1A 2JT8A 1S6JA 1SRAA 2JQ6A 4DCKA 5I94A 1PULA 1QLSA 4A4CA 3EVUA 1J1EA 4D1EA 2OTGC 5I8NA 1OMRA 2LVIA 2QEVA 1SYMA 3GOFA 1K2HA 1RFJA 2PSRA 1W7JB 1IGVA 1LA3A 1UUSA 1CKKA 1KWOB 2M3WA 2Y4QA 3BFHA 3CZ0A 1B8CA 2BL0B 2NCOA 1C7WA 2TN4A 3NSOA 5PALA 3GK1A 2PASA 2AMIA 2K61A 1TNQA 2JRFA 3IQOA 4GUKA 2F2OA 1PVBA 5I2LA 1KQMC 2V53A 1JFKA 3MSEB 3PJIA 4FQTA 3CR5X 3RM1A 3SG7A 3VROA 2FOTA 1JF2A 3DVKA 1LINA 1SL8A 3I5FC 3V2LA 1K96A 1OOHA 4A4BA 2GGZA 2O5GA 1CDLA 1K9PA 1NYAA 3CR4X 1J7OA 3PN7C 1KFXS 1UHHA 3CABA 5GQQC 5CSFA 4XJKA 4M2PA 3CZTX 3D76A 1GM0A 2CTNA 4PT1A 2LE9B 1QVIZ 2QEHA 3DF0B 4IJ7A 4F0ZB 1MXLC 2LHLA 1H4BA 1MR8A 2AUCA 1MWNA 1DJIA 3BQ3A 1EJ3A 1XK4C 4MLWA 1SR6C 5DKQA 5FI7A 3VRNA 2DOQA 3I5GB 2JT3A 3WXAA 5ER4X 2KI6D 4N1FA 4GPLB 3SS3A 5HL1A 1ORGA 1AJ5A 3AAJA 1GGZA 4DRWA 2GV5A 2Q4UA 3EG5B 2L5YA 1TUZA 4Q04A 2YGUA 2F33A 2LLTA 2LLUA 4MEWA 1BF5A 3UO9A 3C1VA 1A75B 2FCDA 2L0PA 2OS8C 3NHTA 1MQ1A 1W7IB 2EC6B 1YVHA 1XFWO 3FE9A 1OZSA 1XFXO 1S26D 2GGMA 2KNEA 2P71A 4YI8A 3D73A 4JPZB 4DUQA 2M8UA 2MLFC 3BXKA 2H8VA 1SW8A 3S0FA 3N7HA 2KFFA 4OV2A 1PK0D 2L4HA 1XFZO 4YBHB 2K7OA 2LANA 5FI6A 2M9GA 2RGIA 3B7AA 1G8IA 4PE1A 1FI6A 4CPVA 1FI5A 1CMFA 1LVCD 2QDIA 2M7NA 1M31A 1WDCB 3FIAA 1IH0A 1TCFA 3L4AA 2HPSA 1EH2A 1SCMC 1YUSA 2EGDA 4CLNA 1YX7A 2E6WA 5IBWA 3WNXB 1PSRA 4PCWA 1TNWA 1F8HA 4USLA 2WC6A 3S0AA 1KQVA 1JSAA 1OOJA 2LHIA 1OMVA 2KBMA 2PYQA 3LLEA 1LXFC 1S5GZ 5AFPA 4WRIA 1IIOA 3AKAA 4CFRA 3AAKA 1RROA 2MLEC 1XFRA 3KHEA 1EXRA 2JXCA 2KYCA 3B6XA 4PE4A 1F54A 1J7RA 3B87A 4JQ0D 4MN0A 2BCAA 2I2RE 1OOGA 1TUJA 1ZFSA 1K9KA 4N5XA 5AANA 4WQ2A 1K95A 1BT6A 1DJZA 3SIAA 1E8AA 4YGEB 2ISDA 1QXPA 1QWVA 4GBAA 3JVTB 4PHKA 5B8IB 1TRFA 1QV1A 2Q91A 3TS5B 3BJHA 2JWWA 4NDDA 3R72A 4MRYA 4NDCA 1DTLA 2JPTA 3HCMA 1FW4A 2QEBA 4OVNF 1NCZA 3K21A 3QMEA 2I18A 4NDBA 4YI9A 2KYFA 1UHJA 3KPXA 1Z4HA 3OX6A 2EHBA 2WCFA 1V1FA 1OSAA 2WCKA 2A4JA 1IJ6A 1AHRA 3S0BA 2BE4A 1UURA 1NX3A 2JZIA 1NWDA 1S1EA 1TNXA 5TNCA 1PALA 2H61C 3TDZA 5FYXA 1CTRA 1CFCA 1KWOC 1YUUA 5AERA 1NCYA 5JOLA 1SL9A 2FCEA 1BLQA 2BL0C 1U5IA 2KAYA 3A8RA 2KQ6A 1LS8A 3CR2A 1SBJA 3KO0A 2MRDA 2FJYA 2JTZA 4YGCB 2F8PA 1F4OA 1KSOA 3CZ1A 1CLLA 2GTEA 3R1PA 1N65A 5HKWA 4UPGA 3OBVA 1IKUA 1NPQA 4M2QA 1DMOA 1NX0A 2LMVA 1DJYA 2P70A 2BE6A 3NSKA 1BU3A 3TUYB 4CFQA 2QPTA 1QS7A 1SMGA 4ORCB 2NLNA 1CMGA 2KPHA 1DJHA 2ZFDA 3BYAA 4HRGA 5CSIA 1V1GA 2LUXA 2ZKMX 1TN4A 4PHNA 3K1EA 2WCEA 4PHJA 1UWOA 2R2IA 2PVBA 2HETA 2OTGB 2WOSA 1M39A 1ZUZA 2WC8A 1NP8A 4L9MA 1M45A 3SG3A 2K8MB 1MHOA 1F55A 1DJGA 2WCLA 3I5GC 4ETOA 2L2EA 4PALA 3CGAA 1OZOA 1CDNA 1AUIB 1B8LA 1KK8B 3BUNB 3FS7A 2BECA 2KDHA 3EK4A 1YRTB 4GGFC 1DC1A 2BCBA 2G9BA 2H61A 2WCMA 1UHIA 2PALA 1C7VA 4ORBB 4OCIA 1M63B 4AOMA 3SG5A 2BKHB 2WORA 4GGNA 2BAPA 3D0YA 2NCPA 1B7TY 1MUXA 1XA5A 2ZN8A 2EC6C 2LP3A 3O78A 1QX7A 1HT9A 1PSBA 3ZNIA 3SIBA 4N1GA 1DF0B 2KOTA 4PHMA 4AQJA 1XVJA 1Q80A 1JFJA 1GQMA 3CZ2A 3Q8IA 1BR1B 2JT0A 2M49B 3D75A 3S0GA 5DICA 2HF5A 3GK4X 3TDIA 2BBNA 3VRRA 5JJGA 4DIRA 1F71A 1R2UA 1M46A 2ERBA 3NGVA 4U8DA 5D3OA 2Y1MA 5D7FA 2QEOA 1RECA 2FJUB 1WDCC 1K93D 4MBEA 4F7FA 3LL8B 3VRQA 2WCJA 4MVFA 2JXLA 1DGVA 3SG6A 1SY9A 2KI4B 2MA2A 3LK1A 2E30A 2M7LA 1P28A 1IWQA 1OOFA 2LMTA 3AKBA 3E3RA 4PE7A 2CT9A 1J7QA 3LK0A 1IRJA 2BBMA 2KFHA 1F70A 1ZACA 1XFYO 3EKHA 4I5NB 1TOPA 1XK4A 2B1UA 2KBIA 1DJWA 4GGFA 2COLB 4MSPA 1HQVA 1R6PA 2K7BA 1EL4A 1D1OA 2LVJA 2JPOA 1CM4A 2PRUA 1YX8A 1CLMA 1C07A 3FWCA 1A29A 1CM1A 2F3ZA 3OB2B 1A75A 2O60A 1MXEA 2K60A 1CFDA 1RK9A 2JU0A 3UNWA 2ZRSA 3JVTC 1PVAA 1QJTA 5F6TA 4P5OE 1IQ5A 3ZWHA 3EVRA 1CB1A 1EG4A 3TS5C 3PSRA 4YRUA 1K90D 1QTXA 1WLMA 3PM8A 3OGNA 1FBVA 4TNCA 2WC5A 4JD9A 2M0RA 3RZSA 1C3YA 3I5HB 1TTXA 1C3ZA 1NCXA 1U5IB 1G33A 2CCMA 3DY9A 5HKYA 3R1OA 1YURA 2JNFA 1BR4B 1RTP1 2SCPA 3BFBA 2WCHA 3PM2A 3WHUB 4BY4A 3I5IB 1G4YR 3DXLA 4ZCVA 4E68A 1NSHA 3DZTA 1TNPA 1ZOTB 3GK2A 4MZLA 1AK8A 1VRKA 3BUWB 1LKJA 1K9UA 3NSLA 1DGUA 1NX2A 1JC2A 2NXQA 1Y1UA 1UHKA
chains in the Genus database with same CATH topology
1RJVA 2MAZA 2VRGA 2M1KB 1GJYA 3PLFB 2KGBC 4C0KA 1UHNA 3PFVA 2LC5A 1KFUL 3BUOB 4M2OA 1L2OB 1K94A 3NSIA 5HKZA 3IF7A 4GAOA 1LA0A 1JBAA 1A03A 2LAPA 2H2KA 1NUBA 4MZJA 4OR9B 1Y1AA 3TUYC 3DD4A 1BG1A 2K7CA 1H8BA 1DJXA 1JF0A 4XJKB 1RWYA 3JTDB 5HLVA 5K89A 4MZKA 4C0LA 4FTGA 2MJWB 2MBXA 1BOCA 1SPYA 4PE0A 3HX4A 1BODA 1UP5A 1AJ4A 2L50A 4P2YB 4YGBB 1L7ZA 1CFPA 2LMUA 1A2XA 2IS9A 2Y5IA 1B9AA 2KHNA 1CNPA 2KQYA 2LNKA 4FQOA 5AEQA 1YUTA 2AAOA 2KI6C 2L98A 3BOWA 2F3YA 3M0WA 3O6BA 4GFTA 1QIVA 1KK8C 5I2QA 1TIZA 2ZNDA 3OP0A 5G08A 2WNDA 1B1GA 1DT7B 1S3PA 4R1EA 2CNPA 3D0YB 3D10A 1BJFA 5ER5A 1CDMA 2G2BA 1JUOA 1B47A 3KF9A 3FWBA 1KSMA 2KSPA 1CDPA 3OB1B 1TCOB 3VRPA 1ODBA 3DVMA 1F4QA 4QJ3B 2PMYA 4CIDA 1KQMB 1B7TZ 3EKJA 5D69A 1ZMZA 3LCPC 2CBLA 2M1UA 1J1DA 1A4PA 3I5FB 3SG4A 4PDZA 3NXAA 3EVVA 1XO5A 1B8RA 1Y6WA 3DVEA 3CS1A 1KK7Z 1NIWA 1S36A 3SJSA 3PN7B 1FPWA 3CLNA 4XYNA 4HSZA 5KSZA 1N2DA 3CWGA 2LVKA 1KK7Y 1QVIY 1IQ3A 1JWDA 1QX5B 1QIWA 1XFVO 3OHMB 3H4SE 1S6CA 2LP2A 1AP4A 1WRLA 2LV7A 3TDUA 4YGAA 1SR6B 2KI4C 1AVSA 1IG5A 1EG3A 2M97A 2LLSA 1ALWA 3DF0A 4DS7A 4I5KA 5KTYA 3PATA 4MRXA 1IJ5A 1WRZA 2JC2A 4IL1A 5BPJA 2ZN9A 1KFUS 4ORAB 4WQ3A 2MHHA 3O4YA 4ZCUA 1CLBA 3PALA 5CSNA 1YTZC 3A4UB 1PRWA 3EK7A 5I2OA 2P6BB 3VGOA 1Y1XA 2OS8B 3RLZA 1SK6D 1QV0A 1XFUO 2F2PA 1DVIA 2L5XB 1XYDA 2LM5A 4YGDB 5J3XA 1YR5A 5KU1A 1SKTA 2LCPA 3BUMB 2HQ8A 1DF0A 4BY5A 1OE9B 1WY9A 1OQPA 2JULA 3IQQA 1SNLA 1QASA 2K2AA 4JWQA 3F45A 2WCBA 4I5LB 4C0JA 1B4CA 3EK8A 2Y1NA 3CTNA 1KFXL 5CPVA 1ALVA 1Y0VH 3I5HC 1QLKA 3SG2A 1WRKA 1X02A 3DVJA 1S6IA 2KAXA 4QJ4B 1QATA 1SL7A 2JNXA 1SCMB 3I5IC 2SASA 5DKNA 1GGWA 3TZ1A 1WLZA 5AXIA 5CSJA 2I94A 2CXJA 2JOJA 1YVLA 2LUCA 2HQWA 3KEVA 1S5GY 1SCVA 1J55A 1BMOA 2KAVA 2ZRTA 4AQIA 5HLOA 1K8UA 4NQGA 3WHTB 1L2OC 2KGRA 1OMDA 1CFFA 4HRHA 2L51A 5DKRA 2QACA 2L4IA 2LVVA 2K0JA 2K7DA 1MF8B 2I7AA 2BCXA 4HREE 1J7PA 1YRUB 2D8NA 3JTDC 2JTTA 4ICBA 2M29A 1KCYA 4GNKB 3ICBA 3O2PA 3QRXA 1N0YA 2KFGA 4I5JA 4QJ5B 3BOWB 3OX5A 4OKHA 1QX2A 1NX1A 2BKIB 2K2FA 2NZ0A 2OPOA 2ZNEA 5HYDA 1FF1A 3BUXB 2JT8A 1S6JA 1SRAA 2JQ6A 4DCKA 1PULA 1QLSA 4A4CA 3EVUA 1J1EA 4D1EA 2OTGC 5I8NA 1OMRA 2LVIA 3GOFA 1SYMA 1K2HA 1RFJA 2PSRA 1W7JB 1IGVA 1LA3A 1UUSA 1CKKA 1KWOB 2M3WA 2Y4QA 1B8CA 2BL0B 2NCOA 1C7WA 2TN4A 3NSOA 5PALA 3GK1A 2PASA 2AMIA 2K61A 1TNQA 2JRFA 3IQOA 4GUKA 2F2OA 1PVBA 5I2LA 1KQMC 2V53A 1JFKA 3MSEB 3RM1A 3CR5X 3VROA 3SG7A 2FOTA 1JF2A 3DVKA 1LINA 1SL8A 3I5FC 1K96A 4A4BA 2GGZA 2O5GA 1CDLA 1K9PA 1NYAA 3CR4X 1J7OA 3PN7C 1KFXS 1UHHA 5GQQC 5CSFA 4XJKA 4M2PA 3CZTX 2CTNA 2LE9B 1QVIZ 3DF0B 4F0ZB 1MXLC 2LHLA 1H4BA 1MR8A 2AUCA 1MWNA 1DJIA 3BQ3A 1EJ3A 1XK4C 4MLWA 1SR6C 5DKQA 3VRNA 2DOQA 3I5GB 2JT3A 3WXAA 5ER4X 2KI6D 4N1FA 4GPLB 1AJ5A 3AAJA 1GGZA 4DRWA 2GV5A 2Q4UA 4Q04A 2F33A 2LLTA 2LLUA 4MEWA 1BF5A 3C1VA 1A75B 2FCDA 2L0PA 2OS8C 1MQ1A 1W7IB 2EC6B 1YVHA 1XFWO 1OZSA 1XFXO 1S26D 2GGMA 2KNEA 4YI8A 4DUQA 4JPZB 2M8UA 2MLFC 3BXKA 1SW8A 2KFFA 4OV2A 1PK0D 2L4HA 1XFZO 4YBHB 2K7OA 2LANA 2M9GA 2RGIA 1G8IA 4PE1A 1FI6A 4CPVA 1FI5A 1CMFA 1LVCD 2M7NA 1M31A 1WDCB 3FIAA 1IH0A 1TCFA 2HPSA 1EH2A 1SCMC 1YUSA 2EGDA 4CLNA 1YX7A 2E6WA 5IBWA 3WNXB 1PSRA 4PCWA 1TNWA 1F8HA 4USLA 1KQVA 1JSAA 1OOJA 2LHIA 1OMVA 2KBMA 3LLEA 1LXFC 1S5GZ 5AFPA 4WRIA 3AKAA 4CFRA 3AAKA 1RROA 2MLEC 3KHEA 1EXRA 2JXCA 2KYCA 4PE4A 1F54A 1J7RA 4JQ0D 4MN0A 2BCAA 2I2RE 1ZFSA 1K9KA 4N5XA 5AANA 4WQ2A 1K95A 1BT6A 1DJZA 3SIAA 1E8AA 4YGEB 2ISDA 1QXPA 4GBAA 4PHKA 3JVTB 5B8IB 1TRFA 1QV1A 2Q91A 3TS5B 2JWWA 4NDDA 4MRYA 4NDCA 1DTLA 2JPTA 3HCMA 1FW4A 4OVNF 1NCZA 3K21A 4NDBA 2I18A 4YI9A 2KYFA 1UHJA 3KPXA 3OX6A 2EHBA 2WCFA 1V1FA 1OSAA 2A4JA 1IJ6A 1AHRA 2BE4A 1NX3A 1UURA 2JZIA 1NWDA 1S1EA 1TNXA 5TNCA 1PALA 2H61C 3TDZA 5FYXA 1CTRA 1CFCA 1KWOC 1YUUA 5AERA 1NCYA 5JOLA 1SL9A 2FCEA 1BLQA 2BL0C 1U5IA 2KAYA 3A8RA 2KQ6A 3CR2A 3ZNIA 1SBJA 3KO0A 2MRDA 4YGCB 2JTZA 2F8PA 1F4OA 1KSOA 1CLLA 1N65A 5HKWA 4UPGA 1IKUA 1NPQA 4M2QA 1DMOA 1NX0A 2LMVA 1DJYA 2BE6A 3NSKA 1BU3A 3TUYB 4CFQA 2QPTA 1QS7A 1SMGA 4ORCB 2NLNA 1CMGA 2ZFDA 1DJHA 3BYAA 4HRGA 5CSIA 1V1GA 2LUXA 2ZKMX 1TN4A 4PHNA 2WCEA 4PHJA 1UWOA 2R2IA 2PVBA 2HETA 2OTGB 2WOSA 1M39A 1ZUZA 2WC8A 1NP8A 4L9MA 1M45A 3SG3A 2K8MB 1MHOA 1F55A 1DJGA 3I5GC 4ETOA 2L2EA 4PALA 3CGAA 1OZOA 1CDNA 1AUIB 1B8LA 1KK8B 3BUNB 3FS7A 2BECA 2KDHA 3EK4A 1YRTB 4GGFC 2BCBA 2G9BA 2H61A 1UHIA 2PALA 1C7VA 4ORBB 4OCIA 1M63B 4AOMA 3SG5A 2BKHB 2WORA 4GGNA 3D0YA 2NCPA 1B7TY 1MUXA 1XA5A 2ZN8A 2EC6C 2LP3A 3O78A 1QX7A 1HT9A 1PSBA 3SIBA 4N1GA 1DF0B 2KOTA 4PHMA 4AQJA 1XVJA 1Q80A 1JFJA 1GQMA 1BR1B 2JT0A 2M49B 2HF5A 3GK4X 3TDIA 2BBNA 3VRRA 5JJGA 4DIRA 1F71A 1R2UA 1M46A 5D7FA 4U8DA 2Y1MA 1RECA 2FJUB 1WDCC 1K93D 4MBEA 3LL8B 3VRQA 4MVFA 2JXLA 1DGVA 3SG6A 1SY9A 2KI4B 2MA2A 3LK1A 2E30A 2M7LA 1IWQA 2LMTA 3AKBA 3E3RA 4PE7A 2CT9A 1J7QA 3LK0A 1IRJA 2BBMA 2KFHA 1F70A 1ZACA 1XFYO 3EKHA 4I5NB 1TOPA 1XK4A 2B1UA 2KBIA 1DJWA 4GGFA 2COLB 4MSPA 1HQVA 1R6PA 2K7BA 1EL4A 1D1OA 2LVJA 1CM4A 2PRUA 1YX8A 1CLMA 1C07A 3FWCA 1A29A 1CM1A 2F3ZA 3OB2B 1A75A 2O60A 1MXEA 1CFDA 1RK9A 2JU0A 2ZRSA 3JVTC 1PVAA 1QJTA 5F6TA 4P5OE 1IQ5A 3ZWHA 3EVRA 1CB1A 1EG4A 3TS5C 3PSRA 4YRUA 1K90D 1QTXA 1WLMA 3PM8A 1FBVA 4TNCA 2M0RA 3I5HB 1TTXA 1NCXA 1U5IB 1G33A 2CCMA 5HKYA 1YURA 2JNFA 1BR4B 1RTP1 2SCPA 3WHUB 4BY4A 3I5IB 1G4YR 4ZCVA 4E68A 1NSHA 1TNPA 1ZOTB 3GK2A 4MZLA 1AK8A 1VRKA 3BUWB 1LKJA 1K9UA 3NSLA 1DGUA 1NX2A 1JC2A 2NXQA 1Y1UA 1UHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RJV A;  2MAZ A;  2VRG A;  2M1K B;  1GJY A;  3PLF B;  2KGB C;  4C0K A;  1UHN A;  3PFV A;  2LC5 A;  1KFU L;  3BUO B;  4M2O A;  1L2O B;  1K94 A;  3NSI A;  5HKZ A;  3IF7 A;  4GAO A;  1LA0 A;  1JBA A;  1A03 A;  2LAP A;  2H2K A;  1NUB A;  4MZJ A;  4OR9 B;  1Y1A A;  3TUY C;  3DD4 A;  1BG1 A;  2K7C A;  1H8B A;  1DJX A;  1JF0 A;  4XJK B;  1RWY A;  3JTD B;  5HLV A;  5K89 A;  4MZK A;  4C0L A;  4FTG A;  2MJW B;  2MBX A;  1BOC A;  1SPY A;  4PE0 A;  3HX4 A;  1BOD A;  1UP5 A;  1AJ4 A;  2L50 A;  4P2Y B;  4YGB B;  1L7Z A;  1CFP A;  2LMU A;  1A2X A;  2IS9 A;  2Y5I A;  1B9A A;  2KHN A;  1CNP A;  2KQY A;  2LNK A;  4FQO A;  5AEQ A;  1YUT A;  2AAO A;  2KI6 C;  2L98 A;  3BOW A;  2F3Y A;  3M0W A;  3O6B A;  4GFT A;  1QIV A;  1KK8 C;  5I2Q A;  1TIZ A;  2ZND A;  3OP0 A;  5G08 A;  2WND A;  1B1G A;  1DT7 B;  1S3P A;  4R1E A;  2CNP A;  3D0Y B;  3D10 A;  1BJF A;  5ER5 A;  1CDM A;  2G2B A;  1JUO A;  1B47 A;  3KF9 A;  3FWB A;  1KSM A;  2KSP A;  1CDP A;  3OB1 B;  1TCO B;  3VRP A;  1ODB A;  3DVM A;  1F4Q A;  4QJ3 B;  2PMY A;  4CID A;  1KQM B;  1B7T Z;  3EKJ A;  5D69 A;  1ZMZ A;  3LCP C;  2CBL A;  2M1U A;  1J1D A;  1A4P A;  3I5F B;  3SG4 A;  4PDZ A;  3NXA A;  3EVV A;  1XO5 A;  1B8R A;  1Y6W A;  3DVE A;  3CS1 A;  1KK7 Z;  1NIW A;  1S36 A;  3SJS A;  3PN7 B;  1FPW A;  3CLN A;  4XYN A;  4HSZ A;  5KSZ A;  1N2D A;  3CWG A;  2LVK A;  1KK7 Y;  1QVI Y;  1IQ3 A;  1JWD A;  1QX5 B;  1QIW A;  1XFV O;  3OHM B;  3H4S E;  1S6C A;  2LP2 A;  1AP4 A;  1WRL A;  2LV7 A;  3TDU A;  4YGA A;  1SR6 B;  2KI4 C;  1AVS A;  1IG5 A;  1EG3 A;  2M97 A;  2LLS A;  1ALW A;  3DF0 A;  4DS7 A;  4I5K A;  5KTY A;  3PAT A;  4MRX A;  1IJ5 A;  1WRZ A;  2JC2 A;  4IL1 A;  5BPJ A;  2ZN9 A;  1KFU S;  4ORA B;  4WQ3 A;  2MHH A;  3O4Y A;  4ZCU A;  1CLB A;  3PAL A;  5CSN A;  1YTZ C;  3A4U B;  1PRW A;  3EK7 A;  5I2O A;  2P6B B;  3VGO A;  1Y1X A;  2OS8 B;  3RLZ A;  1SK6 D;  1QV0 A;  1XFU O;  2F2P A;  1DVI A;  2L5X B;  1XYD A;  2LM5 A;  4YGD B;  5J3X A;  1YR5 A;  5KU1 A;  1SKT A;  2LCP A;  3BUM B;  2HQ8 A;  1DF0 A;  4BY5 A;  1OE9 B;  1WY9 A;  1OQP A;  2JUL A;  3IQQ A;  1SNL A;  1QAS A;  2K2A A;  4JWQ A;  3F45 A;  2WCB A;  4I5L B;  4C0J A;  1B4C A;  3EK8 A;  2Y1N A;  3CTN A;  1KFX L;  5CPV A;  1ALV A;  1Y0V H;  3I5H C;  1QLK A;  3SG2 A;  1WRK A;  1X02 A;  3DVJ A;  1S6I A;  2KAX A;  4QJ4 B;  1QAT A;  1SL7 A;  2JNX A;  1SCM B;  3I5I C;  2SAS A;  5DKN A;  1GGW A;  3TZ1 A;  1WLZ A;  5AXI A;  5CSJ A;  2I94 A;  2CXJ A;  2JOJ A;  1YVL A;  2LUC A;  2HQW A;  3KEV A;  1S5G Y;  1SCV A;  1J55 A;  1BMO A;  2KAV A;  2ZRT A;  4AQI A;  5HLO A;  1K8U A;  4NQG A;  3WHT B;  1L2O C;  2KGR A;  1OMD A;  1CFF A;  4HRH A;  2L51 A;  5DKR A;  2QAC A;  2L4I A;  2LVV A;  2K0J A;  2K7D A;  1MF8 B;  2I7A A;  2BCX A;  4HRE E;  1J7P A;  1YRU B;  2D8N A;  3JTD C;  2JTT A;  4ICB A;  2M29 A;  1KCY A;  4GNK B;  3ICB A;  3O2P A;  3QRX A;  1N0Y A;  2KFG A;  4I5J A;  4QJ5 B;  3BOW B;  3OX5 A;  4OKH A;  1QX2 A;  1NX1 A;  2BKI B;  2K2F A;  2NZ0 A;  2OPO A;  2ZNE A;  5HYD A;  1FF1 A;  3BUX B;  2JT8 A;  1S6J A;  1SRA A;  2JQ6 A;  4DCK A;  1PUL A;  1QLS A;  4A4C A;  3EVU A;  1J1E A;  4D1E A;  2OTG C;  5I8N A;  1OMR A;  2LVI A;  3GOF A;  1SYM A;  1K2H A;  1RFJ A;  2PSR A;  1W7J B;  1IGV A;  1LA3 A;  1UUS A;  1CKK A;  1KWO B;  2M3W A;  2Y4Q A;  1B8C A;  2BL0 B;  2NCO A;  1C7W A;  2TN4 A;  3NSO A;  5PAL A;  3GK1 A;  2PAS A;  2AMI A;  2K61 A;  1TNQ A;  2JRF A;  3IQO A;  4GUK A;  2F2O A;  1PVB A;  5I2L A;  1KQM C;  2V53 A;  1JFK A;  3MSE B;  3RM1 A;  3CR5 X;  3VRO A;  3SG7 A;  2FOT A;  1JF2 A;  3DVK A;  1LIN A;  1SL8 A;  3I5F C;  1K96 A;  4A4B A;  2GGZ A;  2O5G A;  1CDL A;  1K9P A;  1NYA A;  3CR4 X;  1J7O A;  3PN7 C;  1KFX S;  1UHH A;  5GQQ C;  5CSF A;  4XJK A;  4M2P A;  3CZT X;  2CTN A;  2LE9 B;  1QVI Z;  3DF0 B;  4F0Z B;  1MXL C;  2LHL A;  1H4B A;  1MR8 A;  2AUC A;  1MWN A;  1DJI A;  3BQ3 A;  1EJ3 A;  1XK4 C;  4MLW A;  1SR6 C;  5DKQ A;  3VRN A;  2DOQ A;  3I5G B;  2JT3 A;  3WXA A;  5ER4 X;  2KI6 D;  4N1F A;  4GPL B;  1AJ5 A;  3AAJ A;  1GGZ A;  4DRW A;  2GV5 A;  2Q4U A;  4Q04 A;  2F33 A;  2LLT A;  2LLU A;  4MEW A;  1BF5 A;  3C1V A;  1A75 B;  2FCD A;  2L0P A;  2OS8 C;  1MQ1 A;  1W7I B;  2EC6 B;  1YVH A;  1XFW O;  1OZS A;  1XFX O;  1S26 D;  2GGM A;  2KNE A;  4YI8 A;  4DUQ A;  4JPZ B;  2M8U A;  2MLF C;  3BXK A;  1SW8 A;  2KFF A;  4OV2 A;  1PK0 D;  2L4H A;  1XFZ O;  4YBH B;  2K7O A;  2LAN A;  2M9G A;  2RGI A;  1G8I A;  4PE1 A;  1FI6 A;  4CPV A;  1FI5 A;  1CMF A;  1LVC D;  2M7N A;  1M31 A;  1WDC B;  3FIA A;  1IH0 A;  1TCF A;  2HPS A;  1EH2 A;  1SCM C;  1YUS A;  2EGD A;  4CLN A;  1YX7 A;  2E6W A;  5IBW A;  3WNX B;  1PSR A;  4PCW A;  1TNW A;  1F8H A;  4USL A;  1KQV A;  1JSA A;  1OOJ A;  2LHI A;  1OMV A;  2KBM A;  3LLE A;  1LXF C;  1S5G Z;  5AFP A;  4WRI A;  3AKA A;  4CFR A;  3AAK A;  1RRO A;  2MLE C;  3KHE A;  1EXR A;  2JXC A;  2KYC A;  4PE4 A;  1F54 A;  1J7R A;  4JQ0 D;  4MN0 A;  2BCA A;  2I2R E;  1ZFS A;  1K9K A;  4N5X A;  5AAN A;  4WQ2 A;  1K95 A;  1BT6 A;  1DJZ A;  3SIA A;  1E8A A;  4YGE B;  2ISD A;  1QXP A;  4GBA A;  4PHK A;  3JVT B;  5B8I B;  1TRF A;  1QV1 A;  2Q91 A;  3TS5 B;  2JWW A;  4NDD A;  4MRY A;  4NDC A;  1DTL A;  2JPT A;  3HCM A;  1FW4 A;  4OVN F;  1NCZ A;  3K21 A;  4NDB A;  2I18 A;  4YI9 A;  2KYF A;  1UHJ A;  3KPX A;  3OX6 A;  2EHB A;  2WCF A;  1V1F A;  1OSA A;  2A4J A;  1IJ6 A;  1AHR A;  2BE4 A;  1NX3 A;  1UUR A;  2JZI A;  1NWD A;  1S1E A;  1TNX A;  5TNC A;  1PAL A;  2H61 C;  3TDZ A;  5FYX A;  1CTR A;  1CFC A;  1KWO C;  1YUU A;  5AER A;  1NCY A;  5JOL A;  1SL9 A;  2FCE A;  1BLQ A;  2BL0 C;  1U5I A;  2KAY A;  3A8R A;  2KQ6 A;  3CR2 A;  3ZNI A;  1SBJ A;  3KO0 A;  2MRD A;  4YGC B;  2JTZ A;  2F8P A;  1F4O A;  1KSO A;  1CLL A;  1N65 A;  5HKW A;  4UPG A;  1IKU A;  1NPQ A;  4M2Q A;  1DMO A;  1NX0 A;  2LMV A;  1DJY A;  2BE6 A;  3NSK A;  1BU3 A;  3TUY B;  4CFQ A;  2QPT A;  1QS7 A;  1SMG A;  4ORC B;  2NLN A;  1CMG A;  2ZFD A;  1DJH A;  3BYA A;  4HRG A;  5CSI A;  1V1G A;  2LUX A;  2ZKM X;  1TN4 A;  4PHN A;  2WCE A;  4PHJ A;  1UWO A;  2R2I A;  2PVB A;  2HET A;  2OTG B;  2WOS A;  1M39 A;  1ZUZ A;  2WC8 A;  1NP8 A;  4L9M A;  1M45 A;  3SG3 A;  2K8M B;  1MHO A;  1F55 A;  1DJG A;  3I5G C;  4ETO A;  2L2E A;  4PAL A;  3CGA A;  1OZO A;  1CDN A;  1AUI B;  1B8L A;  1KK8 B;  3BUN B;  3FS7 A;  2BEC A;  2KDH A;  3EK4 A;  1YRT B;  4GGF C;  2BCB A;  2G9B A;  2H61 A;  1UHI A;  2PAL A;  1C7V A;  4ORB B;  4OCI A;  1M63 B;  4AOM A;  3SG5 A;  2BKH B;  2WOR A;  4GGN A;  3D0Y A;  2NCP A;  1B7T Y;  1MUX A;  1XA5 A;  2ZN8 A;  2EC6 C;  2LP3 A;  3O78 A;  1QX7 A;  1HT9 A;  1PSB A;  3SIB A;  4N1G A;  1DF0 B;  2KOT A;  4PHM A;  4AQJ A;  1XVJ A;  1Q80 A;  1JFJ A;  1GQM A;  1BR1 B;  2JT0 A;  2M49 B;  2HF5 A;  3GK4 X;  3TDI A;  2BBN A;  3VRR A;  5JJG A;  4DIR A;  1F71 A;  1R2U A;  1M46 A;  5D7F A;  4U8D A;  2Y1M A;  1REC A;  2FJU B;  1WDC C;  1K93 D;  4MBE A;  3LL8 B;  3VRQ A;  4MVF A;  2JXL A;  1DGV A;  3SG6 A;  1SY9 A;  2KI4 B;  2MA2 A;  3LK1 A;  2E30 A;  2M7L A;  1IWQ A;  2LMT A;  3AKB A;  3E3R A;  4PE7 A;  2CT9 A;  1J7Q A;  3LK0 A;  1IRJ A;  2BBM A;  2KFH A;  1F70 A;  1ZAC A;  1XFY O;  3EKH A;  4I5N B;  1TOP A;  1XK4 A;  2B1U A;  2KBI A;  1DJW A;  4GGF A;  2COL B;  4MSP A;  1HQV A;  1R6P A;  2K7B A;  1EL4 A;  1D1O A;  2LVJ A;  1CM4 A;  2PRU A;  1YX8 A;  1CLM A;  1C07 A;  3FWC A;  1A29 A;  1CM1 A;  2F3Z A;  3OB2 B;  1A75 A;  2O60 A;  1MXE A;  1CFD A;  1RK9 A;  2JU0 A;  2ZRS A;  3JVT C;  1PVA A;  1QJT A;  5F6T A;  4P5O E;  1IQ5 A;  3ZWH A;  3EVR A;  1CB1 A;  1EG4 A;  3TS5 C;  3PSR A;  4YRU A;  1K90 D;  1QTX A;  1WLM A;  3PM8 A;  1FBV A;  4TNC A;  2M0R A;  3I5H B;  1TTX A;  1NCX A;  1U5I B;  1G33 A;  2CCM A;  5HKY A;  1YUR A;  2JNF A;  1BR4 B;  1RTP 1;  2SCP A;  3WHU B;  4BY4 A;  3I5I B;  1G4Y R;  4ZCV A;  4E68 A;  1NSH A;  1TNP A;  1ZOT B;  3GK2 A;  4MZL A;  1AK8 A;  1VRK A;  3BUW B;  1LKJ A;  1K9U A;  3NSL A;  1DGU A;  1NX2 A;  1JC2 A;  2NXQ A;  1Y1U A;  1UHK A; 
#chains in the Genus database with same CATH topology
 1RJV A;  2MAZ A;  2VRG A;  3FE6 A;  2M1K B;  1GJY A;  3PLF B;  2KGB C;  4C0K A;  1UHN A;  3PFV A;  4INW A;  1DQE A;  1KFU L;  2LC5 A;  3BUO B;  1L2O B;  3CYZ A;  4M2O A;  1K94 A;  3NSI A;  5HKZ A;  3IF7 A;  4GAO A;  1LA0 A;  1JBA A;  1A03 A;  2LAP A;  2H2K A;  1NUB A;  4MZJ A;  4OR9 B;  1Y1A A;  3TUY C;  3DD4 A;  1BG1 A;  2K7C A;  1H8B A;  4KYN A;  1DJX A;  1JF0 A;  1SSE B;  1RWY A;  1W9Z A;  3JTD B;  4XJK B;  5HLV A;  5K89 A;  4MZK A;  4C0L A;  4FTG A;  2MJW B;  2MBX A;  1BOC A;  1SPY A;  2KLD A;  3HX4 A;  4PE0 A;  1BOD A;  1UP5 A;  1AJ4 A;  2L50 A;  4P2Y B;  4YGB B;  1L7Z A;  1CFP A;  2LMU A;  1A2X A;  2IS9 A;  2Y5I A;  1B9A A;  2KHN A;  1CNP A;  2L2C A;  2KQY A;  2LNK A;  4FQO A;  1T14 A;  1YUT A;  2AAO A;  5AEQ A;  5EL2 A;  2KI6 C;  2L98 A;  3BOW A;  2F3Y A;  3M0W A;  3O6B A;  4GFT A;  1OW4 A;  1QIV A;  1KK8 C;  5I2Q A;  1TIZ A;  2ZND A;  3OP0 A;  5G08 A;  2WND A;  1B1G A;  1DT7 B;  1S3P A;  4R1E A;  2CNP A;  3D0Y B;  3D10 A;  1BJF A;  5ER5 A;  1CDM A;  2G2B A;  1JUO A;  1B47 A;  1TWO A;  3KF9 A;  3FWB A;  1KSM A;  2KSP A;  1CDP A;  3OB1 B;  1TCO B;  3VRP A;  1ODB A;  3DVM A;  1F4Q A;  4QJ3 B;  3VB1 A;  2PMY A;  4CID A;  1KQM B;  1B7T Z;  3EKJ A;  5D69 A;  1ZMZ A;  3LCP C;  2CBL A;  2M1U A;  1J1D A;  1A4P A;  3I5F B;  3SG4 A;  3O4X A;  4PDZ A;  3NXA A;  3EVV A;  1XO5 A;  2KLE A;  1B8R A;  1Y6W A;  3DVE A;  3CS1 A;  1KK7 Z;  1NIW A;  1S36 A;  4OZD A;  3SJS A;  3PN7 B;  1FPW A;  3CLN A;  3S0E A;  4XYN A;  4HSZ A;  5KSZ A;  1N2D A;  3CWG A;  2LVK A;  1KK7 Y;  1QVI Y;  1IQ3 A;  1JWD A;  1QX5 B;  3IVT A;  1QIW A;  1XFV O;  3OHM B;  3H4S E;  1S6C A;  2LP2 A;  1AP4 A;  1WRL A;  2LV7 A;  3SS4 A;  3TDU A;  4YGA A;  1SR6 B;  2KI4 C;  1AVS A;  1IG5 A;  1EG3 A;  2M97 A;  3S0D A;  2LLS A;  1ALW A;  3DF0 A;  4DS7 A;  4I5K A;  5KTY A;  3PAT A;  4MRX A;  1IJ5 A;  1WRZ A;  2JC2 A;  4IL1 A;  5BPJ A;  2ZN9 A;  1KFU S;  4ORA B;  4WQ3 A;  2MHH A;  3O4Y A;  4ZCU A;  1CLB A;  3PAL A;  5CSN A;  1OOI X;  1YTZ C;  2BNX A;  1Z2C B;  1PRW A;  3A4U B;  3B86 A;  3EK7 A;  5I2O A;  2P6B B;  3R1V A;  3VGO A;  1Y1X A;  2OS8 B;  3CDN A;  3DYE A;  3RLZ A;  1SK6 D;  1QV0 A;  1XFU O;  2F2P A;  1DVI A;  2L5X B;  1XYD A;  2LM5 A;  4YGD B;  3BFA A;  5J3X A;  1YR5 A;  5KU1 A;  1SKT A;  2LCP A;  1DEL A;  3BUM B;  2HQ8 A;  1DF0 A;  3SS5 A;  1OE9 B;  1WY9 A;  4INX A;  4BY5 A;  1OQP A;  2JUL A;  3IQQ A;  1SNL A;  1QAS A;  2K2A A;  4JWQ A;  3F45 A;  2WCB A;  4I5L B;  4C0J A;  1B4C A;  3EK8 A;  2Y1N A;  3D78 A;  3CTN A;  1KFX L;  5CPV A;  1ALV A;  1Y0V H;  3I5H C;  3D74 A;  1QLK A;  4JKT A;  3SG2 A;  1WRK A;  1X02 A;  3DVJ A;  1S6I A;  2KAX A;  4QJ4 B;  1QAT A;  1SL7 A;  2JNX A;  1SCM B;  2PQL A;  3FE8 A;  3I5I C;  2SAS A;  5DKN A;  1GGW A;  3TZ1 A;  1WLZ A;  5AXI A;  5CSJ A;  2I94 A;  3B88 A;  2CXJ A;  2JOJ A;  1YVL A;  2LUC A;  2HQW A;  3KEV A;  1S5G Y;  1SCV A;  1J55 A;  1BMO A;  2KAV A;  2ZRT A;  4AQI A;  5HLO A;  1K8U A;  4NQG A;  3WHT B;  1L2O C;  2KGR A;  1OMD A;  3NHI A;  4HRH A;  1CFF A;  2L51 A;  5DKR A;  2QAC A;  2L4I A;  2LVV A;  3L4L A;  2K0J A;  3D77 A;  2K7D A;  1MF8 B;  2I7A A;  2BCX A;  4HRE E;  1J7P A;  1YRU B;  2D8N A;  3JTD C;  3L47 A;  2JTT A;  4ICB A;  2M29 A;  1KCY A;  4GNK B;  3ICB A;  3O2P A;  3QRX A;  1N0Y A;  2KFG A;  5FI2 A;  4I5J A;  4QJ5 B;  3BOW B;  3OX5 A;  4OKH A;  1QX2 A;  1NX1 A;  2BKI B;  1DEK A;  2K2F A;  2NZ0 A;  2OPO A;  2ZNE A;  5HYD A;  3BUX B;  1FF1 A;  2JT8 A;  1S6J A;  1SRA A;  2JQ6 A;  4DCK A;  5I94 A;  1PUL A;  1QLS A;  4A4C A;  3EVU A;  1J1E A;  4D1E A;  2OTG C;  5I8N A;  1OMR A;  2LVI A;  2QEV A;  1SYM A;  3GOF A;  1K2H A;  1RFJ A;  2PSR A;  1W7J B;  1IGV A;  1LA3 A;  1UUS A;  1CKK A;  1KWO B;  2M3W A;  2Y4Q A;  3BFH A;  3CZ0 A;  1B8C A;  2BL0 B;  2NCO A;  1C7W A;  2TN4 A;  3NSO A;  5PAL A;  3GK1 A;  2PAS A;  2AMI A;  2K61 A;  1TNQ A;  2JRF A;  3IQO A;  4GUK A;  2F2O A;  1PVB A;  5I2L A;  1KQM C;  2V53 A;  1JFK A;  3MSE B;  3PJI A;  4FQT A;  3CR5 X;  3RM1 A;  3SG7 A;  3VRO A;  2FOT A;  1JF2 A;  3DVK A;  1LIN A;  1SL8 A;  3I5F C;  3V2L A;  1K96 A;  1OOH A;  4A4B A;  2GGZ A;  2O5G A;  1CDL A;  1K9P A;  1NYA A;  3CR4 X;  1J7O A;  3PN7 C;  1KFX S;  1UHH A;  3CAB A;  5GQQ C;  5CSF A;  4XJK A;  4M2P A;  3CZT X;  3D76 A;  1GM0 A;  2CTN A;  4PT1 A;  2LE9 B;  1QVI Z;  2QEH A;  3DF0 B;  4IJ7 A;  4F0Z B;  1MXL C;  2LHL A;  1H4B A;  1MR8 A;  2AUC A;  1MWN A;  1DJI A;  3BQ3 A;  1EJ3 A;  1XK4 C;  4MLW A;  1SR6 C;  5DKQ A;  5FI7 A;  3VRN A;  2DOQ A;  3I5G B;  2JT3 A;  3WXA A;  5ER4 X;  2KI6 D;  4N1F A;  4GPL B;  3SS3 A;  5HL1 A;  1ORG A;  1AJ5 A;  3AAJ A;  1GGZ A;  4DRW A;  2GV5 A;  2Q4U A;  3EG5 B;  2L5Y A;  1TUZ A;  4Q04 A;  2YGU A;  2F33 A;  2LLT A;  2LLU A;  4MEW A;  1BF5 A;  3UO9 A;  3C1V A;  1A75 B;  2FCD A;  2L0P A;  2OS8 C;  3NHT A;  1MQ1 A;  1W7I B;  2EC6 B;  1YVH A;  1XFW O;  3FE9 A;  1OZS A;  1XFX O;  1S26 D;  2GGM A;  2KNE A;  2P71 A;  4YI8 A;  3D73 A;  4JPZ B;  4DUQ A;  2M8U A;  2MLF C;  3BXK A;  2H8V A;  1SW8 A;  3S0F A;  3N7H A;  2KFF A;  4OV2 A;  1PK0 D;  2L4H A;  1XFZ O;  4YBH B;  2K7O A;  2LAN A;  5FI6 A;  2M9G A;  2RGI A;  3B7A A;  1G8I A;  4PE1 A;  1FI6 A;  4CPV A;  1FI5 A;  1CMF A;  1LVC D;  2QDI A;  2M7N A;  1M31 A;  1WDC B;  3FIA A;  1IH0 A;  1TCF A;  3L4A A;  2HPS A;  1EH2 A;  1SCM C;  1YUS A;  2EGD A;  4CLN A;  1YX7 A;  2E6W A;  5IBW A;  3WNX B;  1PSR A;  4PCW A;  1TNW A;  1F8H A;  4USL A;  2WC6 A;  3S0A A;  1KQV A;  1JSA A;  1OOJ A;  2LHI A;  1OMV A;  2KBM A;  2PYQ A;  3LLE A;  1LXF C;  1S5G Z;  5AFP A;  4WRI A;  1IIO A;  3AKA A;  4CFR A;  3AAK A;  1RRO A;  2MLE C;  1XFR A;  3KHE A;  1EXR A;  2JXC A;  2KYC A;  3B6X A;  4PE4 A;  1F54 A;  1J7R A;  3B87 A;  4JQ0 D;  4MN0 A;  2BCA A;  2I2R E;  1OOG A;  1TUJ A;  1ZFS A;  1K9K A;  4N5X A;  5AAN A;  4WQ2 A;  1K95 A;  1BT6 A;  1DJZ A;  3SIA A;  1E8A A;  4YGE B;  2ISD A;  1QXP A;  1QWV A;  4GBA A;  3JVT B;  4PHK A;  5B8I B;  1TRF A;  1QV1 A;  2Q91 A;  3TS5 B;  3BJH A;  2JWW A;  4NDD A;  3R72 A;  4MRY A;  4NDC A;  1DTL A;  2JPT A;  3HCM A;  1FW4 A;  2QEB A;  4OVN F;  1NCZ A;  3K21 A;  3QME A;  2I18 A;  4NDB A;  4YI9 A;  2KYF A;  1UHJ A;  3KPX A;  1Z4H A;  3OX6 A;  2EHB A;  2WCF A;  1V1F A;  1OSA A;  2WCK A;  2A4J A;  1IJ6 A;  1AHR A;  3S0B A;  2BE4 A;  1UUR A;  1NX3 A;  2JZI A;  1NWD A;  1S1E A;  1TNX A;  5TNC A;  1PAL A;  2H61 C;  3TDZ A;  5FYX A;  1CTR A;  1CFC A;  1KWO C;  1YUU A;  5AER A;  1NCY A;  5JOL A;  1SL9 A;  2FCE A;  1BLQ A;  2BL0 C;  1U5I A;  2KAY A;  3A8R A;  2KQ6 A;  1LS8 A;  3CR2 A;  1SBJ A;  3KO0 A;  2MRD A;  2FJY A;  2JTZ A;  4YGC B;  2F8P A;  1F4O A;  1KSO A;  3CZ1 A;  1CLL A;  2GTE A;  3R1P A;  1N65 A;  5HKW A;  4UPG A;  3OBV A;  1IKU A;  1NPQ A;  4M2Q A;  1DMO A;  1NX0 A;  2LMV A;  1DJY A;  2P70 A;  2BE6 A;  3NSK A;  1BU3 A;  3TUY B;  4CFQ A;  2QPT A;  1QS7 A;  1SMG A;  4ORC B;  2NLN A;  1CMG A;  2KPH A;  1DJH A;  2ZFD A;  3BYA A;  4HRG A;  5CSI A;  1V1G A;  2LUX A;  2ZKM X;  1TN4 A;  4PHN A;  3K1E A;  2WCE A;  4PHJ A;  1UWO A;  2R2I A;  2PVB A;  2HET A;  2OTG B;  2WOS A;  1M39 A;  1ZUZ A;  2WC8 A;  1NP8 A;  4L9M A;  1M45 A;  3SG3 A;  2K8M B;  1MHO A;  1F55 A;  1DJG A;  2WCL A;  3I5G C;  4ETO A;  2L2E A;  4PAL A;  3CGA A;  1OZO A;  1CDN A;  1AUI B;  1B8L A;  1KK8 B;  3BUN B;  3FS7 A;  2BEC A;  2KDH A;  3EK4 A;  1YRT B;  4GGF C;  1DC1 A;  2BCB A;  2G9B A;  2H61 A;  2WCM A;  1UHI A;  2PAL A;  1C7V A;  4ORB B;  4OCI A;  1M63 B;  4AOM A;  3SG5 A;  2BKH B;  2WOR A;  4GGN A;  2BAP A;  3D0Y A;  2NCP A;  1B7T Y;  1MUX A;  1XA5 A;  2ZN8 A;  2EC6 C;  2LP3 A;  3O78 A;  1QX7 A;  1HT9 A;  1PSB A;  3ZNI A;  3SIB A;  4N1G A;  1DF0 B;  2KOT A;  4PHM A;  4AQJ A;  1XVJ A;  1Q80 A;  1JFJ A;  1GQM A;  3CZ2 A;  3Q8I A;  1BR1 B;  2JT0 A;  2M49 B;  3D75 A;  3S0G A;  5DIC A;  2HF5 A;  3GK4 X;  3TDI A;  2BBN A;  3VRR A;  5JJG A;  4DIR A;  1F71 A;  1R2U A;  1M46 A;  2ERB A;  3NGV A;  4U8D A;  5D3O A;  2Y1M A;  5D7F A;  2QEO A;  1REC A;  2FJU B;  1WDC C;  1K93 D;  4MBE A;  4F7F A;  3LL8 B;  3VRQ A;  2WCJ A;  4MVF A;  2JXL A;  1DGV A;  3SG6 A;  1SY9 A;  2KI4 B;  2MA2 A;  3LK1 A;  2E30 A;  2M7L A;  1P28 A;  1IWQ A;  1OOF A;  2LMT A;  3AKB A;  3E3R A;  4PE7 A;  2CT9 A;  1J7Q A;  3LK0 A;  1IRJ A;  2BBM A;  2KFH A;  1F70 A;  1ZAC A;  1XFY O;  3EKH A;  4I5N B;  1TOP A;  1XK4 A;  2B1U A;  2KBI A;  1DJW A;  4GGF A;  2COL B;  4MSP A;  1HQV A;  1R6P A;  2K7B A;  1EL4 A;  1D1O A;  2LVJ A;  2JPO A;  1CM4 A;  2PRU A;  1YX8 A;  1CLM A;  1C07 A;  3FWC A;  1A29 A;  1CM1 A;  2F3Z A;  3OB2 B;  1A75 A;  2O60 A;  1MXE A;  2K60 A;  1CFD A;  1RK9 A;  2JU0 A;  3UNW A;  2ZRS A;  3JVT C;  1PVA A;  1QJT A;  5F6T A;  4P5O E;  1IQ5 A;  3ZWH A;  3EVR A;  1CB1 A;  1EG4 A;  3TS5 C;  3PSR A;  4YRU A;  1K90 D;  1QTX A;  1WLM A;  3PM8 A;  3OGN A;  1FBV A;  4TNC A;  2WC5 A;  4JD9 A;  2M0R A;  3RZS A;  1C3Y A;  3I5H B;  1TTX A;  1C3Z A;  1NCX A;  1U5I B;  1G33 A;  2CCM A;  3DY9 A;  5HKY A;  3R1O A;  1YUR A;  2JNF A;  1BR4 B;  1RTP 1;  2SCP A;  3BFB A;  2WCH A;  3PM2 A;  3WHU B;  4BY4 A;  3I5I B;  1G4Y R;  3DXL A;  4ZCV A;  4E68 A;  1NSH A;  3DZT A;  1TNP A;  1ZOT B;  3GK2 A;  4MZL A;  1AK8 A;  1VRK A;  3BUW B;  1LKJ A;  1K9U A;  3NSL A;  1DGU A;  1NX2 A;  1JC2 A;  2NXQ A;  1Y1U A;  1UHK A; 
#chains in the Genus database with same CATH homology
 1RJV A;  2MAZ A;  2VRG A;  2M1K B;  1GJY A;  3PLF B;  2KGB C;  4C0K A;  1UHN A;  3PFV A;  2LC5 A;  1KFU L;  3BUO B;  4M2O A;  1L2O B;  1K94 A;  3NSI A;  5HKZ A;  3IF7 A;  4GAO A;  1LA0 A;  1JBA A;  1A03 A;  2LAP A;  2H2K A;  1NUB A;  4MZJ A;  4OR9 B;  1Y1A A;  3TUY C;  3DD4 A;  1BG1 A;  2K7C A;  1H8B A;  1DJX A;  1JF0 A;  4XJK B;  1RWY A;  3JTD B;  5HLV A;  5K89 A;  4MZK A;  4C0L A;  4FTG A;  2MJW B;  2MBX A;  1BOC A;  1SPY A;  4PE0 A;  3HX4 A;  1BOD A;  1UP5 A;  1AJ4 A;  2L50 A;  4P2Y B;  4YGB B;  1L7Z A;  1CFP A;  2LMU A;  1A2X A;  2IS9 A;  2Y5I A;  1B9A A;  2KHN A;  1CNP A;  2KQY A;  2LNK A;  4FQO A;  5AEQ A;  1YUT A;  2AAO A;  2KI6 C;  2L98 A;  3BOW A;  2F3Y A;  3M0W A;  3O6B A;  4GFT A;  1QIV A;  1KK8 C;  5I2Q A;  1TIZ A;  2ZND A;  3OP0 A;  5G08 A;  2WND A;  1B1G A;  1DT7 B;  1S3P A;  4R1E A;  2CNP A;  3D0Y B;  3D10 A;  1BJF A;  5ER5 A;  1CDM A;  2G2B A;  1JUO A;  1B47 A;  3KF9 A;  3FWB A;  1KSM A;  2KSP A;  1CDP A;  3OB1 B;  1TCO B;  3VRP A;  1ODB A;  3DVM A;  1F4Q A;  4QJ3 B;  2PMY A;  4CID A;  1KQM B;  1B7T Z;  3EKJ A;  5D69 A;  1ZMZ A;  3LCP C;  2CBL A;  2M1U A;  1J1D A;  1A4P A;  3I5F B;  3SG4 A;  4PDZ A;  3NXA A;  3EVV A;  1XO5 A;  1B8R A;  1Y6W A;  3DVE A;  3CS1 A;  1KK7 Z;  1NIW A;  1S36 A;  3SJS A;  3PN7 B;  1FPW A;  3CLN A;  4XYN A;  4HSZ A;  5KSZ A;  1N2D A;  3CWG A;  2LVK A;  1KK7 Y;  1QVI Y;  1IQ3 A;  1JWD A;  1QX5 B;  1QIW A;  1XFV O;  3OHM B;  3H4S E;  1S6C A;  2LP2 A;  1AP4 A;  1WRL A;  2LV7 A;  3TDU A;  4YGA A;  1SR6 B;  2KI4 C;  1AVS A;  1IG5 A;  1EG3 A;  2M97 A;  2LLS A;  1ALW A;  3DF0 A;  4DS7 A;  4I5K A;  5KTY A;  3PAT A;  4MRX A;  1IJ5 A;  1WRZ A;  2JC2 A;  4IL1 A;  5BPJ A;  2ZN9 A;  1KFU S;  4ORA B;  4WQ3 A;  2MHH A;  3O4Y A;  4ZCU A;  1CLB A;  3PAL A;  5CSN A;  1YTZ C;  3A4U B;  1PRW A;  3EK7 A;  5I2O A;  2P6B B;  3VGO A;  1Y1X A;  2OS8 B;  3RLZ A;  1SK6 D;  1QV0 A;  1XFU O;  2F2P A;  1DVI A;  2L5X B;  1XYD A;  2LM5 A;  4YGD B;  5J3X A;  1YR5 A;  5KU1 A;  1SKT A;  2LCP A;  3BUM B;  2HQ8 A;  1DF0 A;  4BY5 A;  1OE9 B;  1WY9 A;  1OQP A;  2JUL A;  3IQQ A;  1SNL A;  1QAS A;  2K2A A;  4JWQ A;  3F45 A;  2WCB A;  4I5L B;  4C0J A;  1B4C A;  3EK8 A;  2Y1N A;  3CTN A;  1KFX L;  5CPV A;  1ALV A;  1Y0V H;  3I5H C;  1QLK A;  3SG2 A;  1WRK A;  1X02 A;  3DVJ A;  1S6I A;  2KAX A;  4QJ4 B;  1QAT A;  1SL7 A;  2JNX A;  1SCM B;  3I5I C;  2SAS A;  5DKN A;  1GGW A;  3TZ1 A;  1WLZ A;  5AXI A;  5CSJ A;  2I94 A;  2CXJ A;  2JOJ A;  1YVL A;  2LUC A;  2HQW A;  3KEV A;  1S5G Y;  1SCV A;  1J55 A;  1BMO A;  2KAV A;  2ZRT A;  4AQI A;  5HLO A;  1K8U A;  4NQG A;  3WHT B;  1L2O C;  2KGR A;  1OMD A;  1CFF A;  4HRH A;  2L51 A;  5DKR A;  2QAC A;  2L4I A;  2LVV A;  2K0J A;  2K7D A;  1MF8 B;  2I7A A;  2BCX A;  4HRE E;  1J7P A;  1YRU B;  2D8N A;  3JTD C;  2JTT A;  4ICB A;  2M29 A;  1KCY A;  4GNK B;  3ICB A;  3O2P A;  3QRX A;  1N0Y A;  2KFG A;  4I5J A;  4QJ5 B;  3BOW B;  3OX5 A;  4OKH A;  1QX2 A;  1NX1 A;  2BKI B;  2K2F A;  2NZ0 A;  2OPO A;  2ZNE A;  5HYD A;  1FF1 A;  3BUX B;  2JT8 A;  1S6J A;  1SRA A;  2JQ6 A;  4DCK A;  1PUL A;  1QLS A;  4A4C A;  3EVU A;  1J1E A;  4D1E A;  2OTG C;  5I8N A;  1OMR A;  2LVI A;  3GOF A;  1SYM A;  1K2H A;  1RFJ A;  2PSR A;  1W7J B;  1IGV A;  1LA3 A;  1UUS A;  1CKK A;  1KWO B;  2M3W A;  2Y4Q A;  1B8C A;  2BL0 B;  2NCO A;  1C7W A;  2TN4 A;  3NSO A;  5PAL A;  3GK1 A;  2PAS A;  2AMI A;  2K61 A;  1TNQ A;  2JRF A;  3IQO A;  4GUK A;  2F2O A;  1PVB A;  5I2L A;  1KQM C;  2V53 A;  1JFK A;  3MSE B;  3RM1 A;  3CR5 X;  3VRO A;  3SG7 A;  2FOT A;  1JF2 A;  3DVK A;  1LIN A;  1SL8 A;  3I5F C;  1K96 A;  4A4B A;  2GGZ A;  2O5G A;  1CDL A;  1K9P A;  1NYA A;  3CR4 X;  1J7O A;  3PN7 C;  1KFX S;  1UHH A;  5GQQ C;  5CSF A;  4XJK A;  4M2P A;  3CZT X;  2CTN A;  2LE9 B;  1QVI Z;  3DF0 B;  4F0Z B;  1MXL C;  2LHL A;  1H4B A;  1MR8 A;  2AUC A;  1MWN A;  1DJI A;  3BQ3 A;  1EJ3 A;  1XK4 C;  4MLW A;  1SR6 C;  5DKQ A;  3VRN A;  2DOQ A;  3I5G B;  2JT3 A;  3WXA A;  5ER4 X;  2KI6 D;  4N1F A;  4GPL B;  1AJ5 A;  3AAJ A;  1GGZ A;  4DRW A;  2GV5 A;  2Q4U A;  4Q04 A;  2F33 A;  2LLT A;  2LLU A;  4MEW A;  1BF5 A;  3C1V A;  1A75 B;  2FCD A;  2L0P A;  2OS8 C;  1MQ1 A;  1W7I B;  2EC6 B;  1YVH A;  1XFW O;  1OZS A;  1XFX O;  1S26 D;  2GGM A;  2KNE A;  4YI8 A;  4DUQ A;  4JPZ B;  2M8U A;  2MLF C;  3BXK A;  1SW8 A;  2KFF A;  4OV2 A;  1PK0 D;  2L4H A;  1XFZ O;  4YBH B;  2K7O A;  2LAN A;  2M9G A;  2RGI A;  1G8I A;  4PE1 A;  1FI6 A;  4CPV A;  1FI5 A;  1CMF A;  1LVC D;  2M7N A;  1M31 A;  1WDC B;  3FIA A;  1IH0 A;  1TCF A;  2HPS A;  1EH2 A;  1SCM C;  1YUS A;  2EGD A;  4CLN A;  1YX7 A;  2E6W A;  5IBW A;  3WNX B;  1PSR A;  4PCW A;  1TNW A;  1F8H A;  4USL A;  1KQV A;  1JSA A;  1OOJ A;  2LHI A;  1OMV A;  2KBM A;  3LLE A;  1LXF C;  1S5G Z;  5AFP A;  4WRI A;  3AKA A;  4CFR A;  3AAK A;  1RRO A;  2MLE C;  3KHE A;  1EXR A;  2JXC A;  2KYC A;  4PE4 A;  1F54 A;  1J7R A;  4JQ0 D;  4MN0 A;  2BCA A;  2I2R E;  1ZFS A;  1K9K A;  4N5X A;  5AAN A;  4WQ2 A;  1K95 A;  1BT6 A;  1DJZ A;  3SIA A;  1E8A A;  4YGE B;  2ISD A;  1QXP A;  4GBA A;  4PHK A;  3JVT B;  5B8I B;  1TRF A;  1QV1 A;  2Q91 A;  3TS5 B;  2JWW A;  4NDD A;  4MRY A;  4NDC A;  1DTL A;  2JPT A;  3HCM A;  1FW4 A;  4OVN F;  1NCZ A;  3K21 A;  4NDB A;  2I18 A;  4YI9 A;  2KYF A;  1UHJ A;  3KPX A;  3OX6 A;  2EHB A;  2WCF A;  1V1F A;  1OSA A;  2A4J A;  1IJ6 A;  1AHR A;  2BE4 A;  1NX3 A;  1UUR A;  2JZI A;  1NWD A;  1S1E A;  1TNX A;  5TNC A;  1PAL A;  2H61 C;  3TDZ A;  5FYX A;  1CTR A;  1CFC A;  1KWO C;  1YUU A;  5AER A;  1NCY A;  5JOL A;  1SL9 A;  2FCE A;  1BLQ A;  2BL0 C;  1U5I A;  2KAY A;  3A8R A;  2KQ6 A;  3CR2 A;  3ZNI A;  1SBJ A;  3KO0 A;  2MRD A;  4YGC B;  2JTZ A;  2F8P A;  1F4O A;  1KSO A;  1CLL A;  1N65 A;  5HKW A;  4UPG A;  1IKU A;  1NPQ A;  4M2Q A;  1DMO A;  1NX0 A;  2LMV A;  1DJY A;  2BE6 A;  3NSK A;  1BU3 A;  3TUY B;  4CFQ A;  2QPT A;  1QS7 A;  1SMG A;  4ORC B;  2NLN A;  1CMG A;  2ZFD A;  1DJH A;  3BYA A;  4HRG A;  5CSI A;  1V1G A;  2LUX A;  2ZKM X;  1TN4 A;  4PHN A;  2WCE A;  4PHJ A;  1UWO A;  2R2I A;  2PVB A;  2HET A;  2OTG B;  2WOS A;  1M39 A;  1ZUZ A;  2WC8 A;  1NP8 A;  4L9M A;  1M45 A;  3SG3 A;  2K8M B;  1MHO A;  1F55 A;  1DJG A;  3I5G C;  4ETO A;  2L2E A;  4PAL A;  3CGA A;  1OZO A;  1CDN A;  1AUI B;  1B8L A;  1KK8 B;  3BUN B;  3FS7 A;  2BEC A;  2KDH A;  3EK4 A;  1YRT B;  4GGF C;  2BCB A;  2G9B A;  2H61 A;  1UHI A;  2PAL A;  1C7V A;  4ORB B;  4OCI A;  1M63 B;  4AOM A;  3SG5 A;  2BKH B;  2WOR A;  4GGN A;  3D0Y A;  2NCP A;  1B7T Y;  1MUX A;  1XA5 A;  2ZN8 A;  2EC6 C;  2LP3 A;  3O78 A;  1QX7 A;  1HT9 A;  1PSB A;  3SIB A;  4N1G A;  1DF0 B;  2KOT A;  4PHM A;  4AQJ A;  1XVJ A;  1Q80 A;  1JFJ A;  1GQM A;  1BR1 B;  2JT0 A;  2M49 B;  2HF5 A;  3GK4 X;  3TDI A;  2BBN A;  3VRR A;  5JJG A;  4DIR A;  1F71 A;  1R2U A;  1M46 A;  5D7F A;  4U8D A;  2Y1M A;  1REC A;  2FJU B;  1WDC C;  1K93 D;  4MBE A;  3LL8 B;  3VRQ A;  4MVF A;  2JXL A;  1DGV A;  3SG6 A;  1SY9 A;  2KI4 B;  2MA2 A;  3LK1 A;  2E30 A;  2M7L A;  1IWQ A;  2LMT A;  3AKB A;  3E3R A;  4PE7 A;  2CT9 A;  1J7Q A;  3LK0 A;  1IRJ A;  2BBM A;  2KFH A;  1F70 A;  1ZAC A;  1XFY O;  3EKH A;  4I5N B;  1TOP A;  1XK4 A;  2B1U A;  2KBI A;  1DJW A;  4GGF A;  2COL B;  4MSP A;  1HQV A;  1R6P A;  2K7B A;  1EL4 A;  1D1O A;  2LVJ A;  1CM4 A;  2PRU A;  1YX8 A;  1CLM A;  1C07 A;  3FWC A;  1A29 A;  1CM1 A;  2F3Z A;  3OB2 B;  1A75 A;  2O60 A;  1MXE A;  1CFD A;  1RK9 A;  2JU0 A;  2ZRS A;  3JVT C;  1PVA A;  1QJT A;  5F6T A;  4P5O E;  1IQ5 A;  3ZWH A;  3EVR A;  1CB1 A;  1EG4 A;  3TS5 C;  3PSR A;  4YRU A;  1K90 D;  1QTX A;  1WLM A;  3PM8 A;  1FBV A;  4TNC A;  2M0R A;  3I5H B;  1TTX A;  1NCX A;  1U5I B;  1G33 A;  2CCM A;  5HKY A;  1YUR A;  2JNF A;  1BR4 B;  1RTP 1;  2SCP A;  3WHU B;  4BY4 A;  3I5I B;  1G4Y R;  4ZCV A;  4E68 A;  1NSH A;  1TNP A;  1ZOT B;  3GK2 A;  4MZL A;  1AK8 A;  1VRK A;  3BUW B;  1LKJ A;  1K9U A;  3NSL A;  1DGU A;  1NX2 A;  1JC2 A;  2NXQ A;  1Y1U A;  1UHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...