3LLEA

X-ray structure of bovine sc0322,ca(2+)-s100b
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title In vitro screening and structural characterization of inhibitors of the S100B-p53 interaction.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 34
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3lleA00
2L98A 1PSRA 1DJGA 1GQMA 1OZSA 1QX2A 5D69A 1F55A 4MN0A 1KCYA 1WRKA 1DF0B 1A03A 1S1EA 4WQ2A 1JUOA 2G2BA 3IQOA 2M7LA 2H2KA 1SCMC 1ODBA 2OTGC 2MJWB 4NDDA 3CR2A 4CFRA 1H4BA 1CLMA 1RJVA 1QXPA 2K2FA 1NPQA 1MXEA 1D1OA 2LV7A 2LNKA 4M2OA 1FI6A 2LC5A 1CLLA 2L2EA 4GPLB 3VRNA 1M45A 2D8NA 1F71A 1OQPA 3CS1A 3BYAA 4DCKA 1UHKA 4HRHA 1Y1AA 2JT3A 3I5GC 1K90D 1WLZA 1ZUZA 4ORAB 1F4OA 1N0YA 1AK8A 1UHNA 2MLEC 2R2IA 1SCVA 3TDIA 1EG3A 1B8RA 4I5KA 1QVIZ 2SASA 2M7NA 3LLEA 5DKNA 1IRJA 1J1DA 1NIWA 1QX7A 1QS7A 4P2YB 1AHRA 2HPSA 3FS7A 2LMUA 3OX6A 1TNPA 1YX7A 1UWOA 1SW8A 2HF5A 2JT8A 1R2UA 2M1UA 2VRGA 2PVBA 3I5FC 3NSOA 4YGEB 1HT9A 1MQ1A 2B1UA 1NX2A 1KWOB 1W7JB 1BG1A 1GGZA 3SG4A 1CM1A 1M31A 1PVBA 4ETOA 4F0ZB 4MRYA 5K89A 1E8AA 3EK7A 2F3ZA 1N65A 4GAOA 1RTP1 3PALA 2WOSA 3NSLA 1YUUA 2CCMA 2A4JA 4N5XA 3AKAA 2EGDA 3A4UB 1BJFA 3DF0A 2I94A 2MHHA 1DVIA 1DMOA 1CFDA 2GGZA 4HRGA 5AANA 4PHJA 1CDPA 1U5IA 5HYDA 3JVTC 1F4QA 3EK4A 1IQ5A 1SCMB 2OTGB 2H61A 1B7TZ 3D0YA 4YI8A 1KFUS 3TDUA 4JQ0D 2L4HA 2WCEA 3CTNA 3LK0A 4HREE 1J7QA 1KSMA 1W7IB 1IJ6A 2FJUB 3IQQA 2CXJA 3EKJA 5HKWA 1R6PA 1MWNA 2ZN9A 3SIBA 5ER5A 3LL8B 3OB1B 2O5GA 2LLSA 4BY4A 2ZKMX 4QJ5B 5TNCA 4YGDB 2KDHA 1NCXA 4TNCA 1V1GA 4GFTA 4ICBA 1EL4A 1K9PA 1OMRA 2JULA 1LA0A 2MAZA 3SJSA 4OCIA 1OZOA 1C07A 2LP2A 3D10A 4CIDA 2WNDA 3I5GB 1QIVA 2ZRTA 4WQ3A 1KFUL 2PSRA 2BBMA 2BE6A 5I2LA 4MEWA 1B47A 4BY5A 2DOQA 2QPTA 1K2HA 2JZIA 1DGUA 1JFJA 3WNXB 1JSAA 1A4PA 4NQGA 1J7PA 2TN4A 1YUTA 1NYAA 4MBEA 2F8PA 4GGFC 2CTNA 3TUYC 1YURA 5KU1A 4DUQA 2JC2A 1SNLA 1YRUB 3I5FB 1MR8A 3O2PA 1S26D 1QV1A 3DVKA 3SG5A 1CM4A 5ER4X 1LA3A 3PN7B 3RLZA 1F54A 4PHKA 2K2AA 4DS7A 1Y1UA 1VRKA 4YRUA 2PRUA 2ZRSA 1XK4A 2BBNA 1TIZA 2JOJA 2RGIA 2KFHA 3OHMB 1G8IA 1PULA 2KAYA 3A8RA 1NX3A 2LANA 2KI6D 4I5JA 1PSBA 4MRXA 2JTZA 3AAJA 3ZWHA 1LXFC 1GJYA 2BKIB 1OMDA 5HKZA 3DD4A 3C1VA 2NLNA 4QJ4B 2LE9B 3JVTB 1KK7Z 3RM1A 1CNPA 1CFFA 3PLFB 1UHIA 2JPTA 2L51A 2NCPA 4ORCB 1WRLA 2LP3A 3MSEB 1XYDA 1S3PA 1QJTA 2AUCA 1QATA 3KEVA 1SKTA 5F6TA 1TNQA 4GUKA 5HLVA 1QASA 1BR4B 1QLSA 2F3YA 1NX0A 1YVHA 2KFFA 2LUCA 2LAPA 1TCOB 4PE0A 1DTLA 2KBMA 2JXLA 2EHBA 1MXLC 4XJKB 2FOTA 1KFXS 2KNEA 1TN4A 5BPJA 2JQ6A 5I8NA 2KQ6A 2MA2A 4XYNA 2L50A 2NXQA 4R1EA 1S5GZ 4DIRA 2HETA 2KSPA 5AEQA 3JTDC 1FI5A 2M0RA 3CWGA 1J55A 5CPVA 4ZCVA 1XFZO 5AFPA 1BR1B 3BQ3A 1PRWA 4PE4A 5AERA 1XFVO 4MSPA 1A75B 2I18A 3VRRA 3TUYB 1DF0A 4AQIA 1YRTB 1KFXL 1IH0A 1SRAA 1IGVA 1OE9B 2K61A 3EVRA 1ZACA 4NDCA 4OV2A 1AJ5A 3DVJA 1MUXA 1RWYA 2KFGA 4Q04A 3TS5C 3SG3A 3PATA 2EC6C 1JBAA 3I5HB 4YGAA 3PM8A 1B8LA 1BMOA 1G4YR 3PSRA 4UPGA 4D1EA 2JNFA 2E30A 3HX4A 3IF7A 1TNWA 1DJWA 2KBIA 4PHMA 3F45A 4IL1A 3SIAA 1KK8B 2M49B 1K9KA 4YI9A 4PDZA 1LVCD 4I5LB 1UUSA 1AVSA 1UP5A 1BT6A 2LVIA 1NCZA 4A4BA 5CSJA 2KAXA 2M97A 1JWDA 2KQYA 2KAVA 2M9GA 2NCOA 2F2OA 2ZNEA 3BUWB 3KF9A 1DGVA 2O60A 3VRQA 1WLMA 3HCMA 1Q80A 5D7FA 5I2OA 4MZLA 2WCBA 3CZTX 1RK9A 3CR5X 1KQMC 2LCPA 4AQJA 1TTXA 1IG5A 1UURA 2JT0A 3VGOA 4I5NB 3DVMA 1Y1XA 5GQQC 2JXCA 1ZFSA 1YR5A 1CDMA 3JTDB 2LVJA 2NZ0A 1QTXA 4USLA 1CB1A 1XFYO 1S6CA 1JC2A 1J7RA 1DJYA 4FTGA 1YX8A 2ZFDA 2JTTA 4C0JA 1A29A 1DJXA 1QLKA 2QACA 2G9BA 3WHUB 1NUBA 3AAKA 1IKUA 4NDBA 1B4CA 1NX1A 1CMGA 1HQVA 4OR9B 4CPVA 2SCPA 1JF2A 2LMTA 5G08A 1WY9A 4MLWA 1X02A 5DKQA 1CFPA 3BUNB 1RROA 4YGBB 2BL0C 2OPOA 1IJ5A 1XFUO 2KI4C 4GBAA 1MF8B 2LLTA 1IQ3A 4CLNA 2BKHB 2WCFA 2KOTA 4JWQA 1K9UA 4N1GA 4ORBB 5JJGA 1KQVA 4L9MA 2KYFA 3NSKA 5PALA 2KGRA 1SR6C 2BE4A 1QX5B 2H61C 4PCWA 1NCYA 1DJIA 2JRFA 2K7BA 2ZN8A 3M0WA 3O4YA 3AKBA 3FIAA 2Q4UA 3LK1A 3NXAA 4MZJA 1CDNA 2KHNA 2LVVA 4OVNF 3BXKA 1SL9A 1KQMB 3BUOB 3FWBA 2MBXA 1ALWA 1TRFA 4P5OE 2HQWA 3BUMB 2CT9A 1V1FA 1YUSA 2GGMA 2I7AA 2K8MB 4GNKB 1F8HA 2LLUA 1GGWA 1QVIY 4U8DA 2GV5A 1IWQA 1WDCC 4JPZB 1FBVA 2FCDA 5J3XA 1BLQA 2Y1NA 5HKYA 1KSOA 3KO0A 3H4SE 3OP0A 1TOPA 3ZNIA 3BOWB 4MVFA 2HQ8A 2COLB 1FW4A 1AUIB 4MZKA 3WHTB 2M1KB 2OS8C 1K93D 1CFCA 1FPWA 3ICBA 4OKHA 2L0PA 3OB2B 2Y1MA 1B9AA 4C0LA 1C7WA 2F2PA 2FCEA 4PE7A 4DRWA 1NSHA 2LVKA 2BL0B 2Y5IA 3I5IC 1SK6D 1XK4C 1FF1A 2P6BB 2K0JA 3KPXA 1ZOTB 3GK1A 2KI4B 4YBHB 1BF5A 3SG6A 1N2DA 3K21A 4XJKA 1XFWO 4YGCB 1TCFA 2BCXA 1EH2A 3DF0B 2AMIA 2E6WA 1B7TY 1SL7A 1U5IB 4FQOA 2LUXA 1M46A 5CSIA 3QRXA 1SY9A 1YTZC 2K7CA 1SPYA 1EJ3A 2LM5A 1G33A 1XA5A 3BOWA 3KHEA 1SR6B 2WORA 3CR4X 3D0YB 5AXIA 1H8BA 5B8IB 1DJHA 1Y6WA 1OOJA 1A75A 3CLNA 5IBWA 1CDLA 2KGBC 1SYMA 1PALA 4GGFA 4WRIA 3O78A 3WXAA 4C0KA 5I2QA 3PFVA 3PN7C 1RFJA 2BCBA 2K7DA 5JOLA 2MLFC 1M39A 2ISDA 1ALVA 1OMVA 3CGAA 1CLBA 3TDZA 2L4IA 1MHOA 1WDCB 1J7OA 2LHIA 3LCPC 3VRPA 2M3WA 1NP8A 2I2RE 1S6IA 3O6BA 2IS9A 3OX5A 1L2OC 3EVUA 4M2PA 1TNXA 1B1GA 2CBLA 2CNPA 1PVAA 1C7VA 3SG2A 1CKKA 2LMVA 2KYCA 2OS8B 5FYXA 4N1FA 1YVLA 3EKHA 4GGNA 4ZCUA 2JU0A 3EVVA 2WC8A 1K94A 2M8UA 2BECA 5CSNA 5KTYA 1A2XA 2PASA 1EXRA 1BU3A 1JF0A 1XVJA 1S36A 2PALA 3TS5B 3DVEA 3I5IB 2EC6B 3SG7A 1QIWA 2Y4QA 3TZ1A 1BOCA 1K96A 1B8CA 4AOMA 1AJ4A 1EG4A 3GK4X 1KK7Y 1QV0A 1K95A 2BCAA 2JWWA 2JNXA 1UHHA 1DJZA 2PMYA 3NSIA 5HLOA 1AP4A 1LKJA 3EK8A 1XFXO 1SBJA 1NWDA 5DKRA 1M63B 1XO5A 5KSZA 2Q91A 4PE1A 1WRZA 2KI6C 3GOFA 2LHLA 1UHJA 1S6JA 2MRDA 1SL8A 1CTRA 1RECA 2F33A 4E68A 3E3RA 2K7OA 2V53A 3BUXB 4CFQA 1F70A 4M2QA 3FWCA 3I5HC 1J1EA 1KWOC 1PK0D 1S5GY 5CSFA 1K8UA 1L7ZA 1JFKA 1Y0VH 2AAOA 4PALA 4QJ3B 4PHNA 4A4CA 1LINA 2M29A 1ZMZA 2ZNDA 4HSZA 1BODA 2L5XB 3VROA 1DT7B 3GK2A 1KK8C 1SMGA 1L2OB 1OSAA 1CMFA
chains in the Genus database with same CATH superfamily
2L98A 1PSRA 1DJGA 1GQMA 1OZSA 1QX2A 5D69A 1F55A 4MN0A 1KCYA 2WCJA 1WRKA 1DF0B 1A03A 1S1EA 4WQ2A 1GM0A 1JUOA 2G2BA 3IQOA 2M7LA 2H2KA 1SCMC 1ODBA 2OTGC 2MJWB 4NDDA 3CR2A 3D73A 3K1EA 4CFRA 1H4BA 1CLMA 1RJVA 1QXPA 2K2FA 1NPQA 4INWA 1MXEA 3VB1A 2LV7A 2LNKA 4M2OA 1D1OA 1FI6A 2LC5A 1CLLA 2P71A 2L2EA 4GPLB 3VRNA 3CZ0A 1M45A 2D8NA 1F71A 1OQPA 3CS1A 3BYAA 4DCKA 1UHKA 4HRHA 1Y1AA 2JT3A 3I5GC 1K90D 1WLZA 1ZUZA 3EG5B 4ORAB 1F4OA 1N0YA 1AK8A 1UHNA 2MLEC 2R2IA 1SCVA 3TDIA 1EG3A 1B8RA 4I5KA 1QVIZ 2SASA 2M7NA 3LLEA 5DKNA 4JKTA 1IRJA 1J1DA 1NIWA 1QX7A 1QS7A 4P2YB 1AHRA 2HPSA 3FS7A 2LMUA 3OX6A 3NGVA 1TNPA 1YX7A 1UWOA 1SW8A 2HF5A 2JT8A 1R2UA 2M1UA 2VRGA 3S0EA 2PVBA 3I5FC 3NSOA 3D76A 5FI6A 4YGEB 1HT9A 1MQ1A 2B1UA 1NX2A 1KWOB 1W7JB 1BG1A 1GGZA 1XFRA 1CM1A 1M31A 1PVBA 3SG4A 4ETOA 4F0ZB 4MRYA 5K89A 1E8AA 3EK7A 2F3ZA 1N65A 4GAOA 1RTP1 2WCMA 3PALA 2WOSA 3NSLA 1YUUA 2CCMA 2A4JA 4N5XA 3AKAA 2EGDA 2WC5A 3A4UB 1BJFA 3DF0A 2I94A 2MHHA 1DVIA 1DMOA 1CFDA 2GGZA 3DZTA 4HRGA 5AANA 4PHJA 1CDPA 1U5IA 5HYDA 3BFBA 3JVTC 1F4QA 3EK4A 1IQ5A 1SCMB 2OTGB 1P28A 2H61A 1B7TZ 3D0YA 4YI8A 1KFUS 3TDUA 4JQ0D 2L4HA 2WCEA 3CTNA 3LK0A 4HREE 1J7QA 1KSMA 1W7IB 1IJ6A 2FJUB 2K60A 2CXJA 3EKJA 3IQQA 5HKWA 1R6PA 3Q8IA 1MWNA 2ERBA 2ZN9A 5ER5A 3SIBA 3LL8B 3OB1B 1IIOA 1QWVA 2O5GA 2LLSA 4BY4A 3NHIA 2ZKMX 3CABA 4QJ5B 5TNCA 4YGDB 2KDHA 1NCXA 4TNCA 1V1GA 4GFTA 4ICBA 1EL4A 1K9PA 1OMRA 2JULA 1LA0A 2MAZA 3D78A 3SJSA 4OCIA 1OZOA 1C07A 2LP2A 3D10A 4CIDA 2WNDA 3CZ2A 1QIVA 1Z2CB 2ZRTA 3I5GB 1KFUL 2PSRA 3OGNA 2BBMA 4WQ3A 2BE6A 5I2LA 4MEWA 1Z4HA 2KLEA 1B47A 4BY5A 2DOQA 2QPTA 3DY9A 1K2HA 2JZIA 1DGUA 1JFJA 3WNXB 1JSAA 1A4PA 4NQGA 1J7PA 2TN4A 1YUTA 1NYAA 4MBEA 2F8PA 3L4AA 2CTNA 4GGFC 3TUYC 1YURA 5KU1A 4DUQA 2JC2A 1SNLA 1YRUB 3I5FB 1MR8A 3O2PA 1S26D 1QV1A 3DVKA 3SG5A 1CM4A 5ER4X 1LA3A 3PN7B 3RLZA 1F54A 4PHKA 3CYZA 2K2AA 4DS7A 1Y1UA 3UNWA 1VRKA 4YRUA 2PRUA 2ZRSA 1XK4A 2BBNA 1TIZA 2JOJA 3S0DA 1OOGA 1SSEB 2KFHA 2RGIA 3OHMB 1G8IA 1PULA 2KAYA 3A8RA 1NX3A 3RZSA 2LANA 2KI6D 4I5JA 1PSBA 4MRXA 2JTZA 2KLDA 3AAJA 1LXFC 3ZWHA 1GJYA 2BKIB 1OMDA 5HKZA 3DD4A 3C1VA 2NLNA 4QJ4B 2BAPA 2LE9B 1KK7Z 3JVTB 3RM1A 1CNPA 1CFFA 3PLFB 3R72A 1UHIA 2JPTA 2L51A 2NCPA 4ORCB 1WRLA 2JPOA 2LP3A 3MSEB 1XYDA 1S3PA 2H8VA 1QJTA 2AUCA 1QATA 3KEVA 1SKTA 5F6TA 1TNQA 3S0BA 4GUKA 2BNXA 5HLVA 1QASA 1BR4B 1QLSA 2F3YA 1NX0A 1YVHA 2KFFA 2LUCA 2LAPA 1TCOB 3FE8A 1DTLA 2KBMA 4PE0A 2JXLA 2EHBA 2P70A 1MXLC 4XJKB 2FOTA 1KFXS 2KNEA 1TN4A 5BPJA 2JQ6A 5I8NA 2KQ6A 2MA2A 4XYNA 2L50A 2NXQA 1DEKA 4R1EA 1S5GZ 3L47A 2HETA 2KSPA 5AEQA 3JTDC 4DIRA 1FI5A 2M0RA 3CWGA 1J55A 5CPVA 4ZCVA 1XFZO 5AFPA 1BR1B 3BQ3A 1PRWA 4PE4A 5AERA 1XFVO 4MSPA 1A75B 5I94A 2I18A 3VRRA 3TUYB 1DF0A 4AQIA 1YRTB 1KFXL 1IH0A 1SRAA 1IGVA 1OE9B 2K61A 3EVRA 1ZACA 3NHTA 4NDCA 4OV2A 1AJ5A 3DVJA 1MUXA 1RWYA 2KFGA 4Q04A 3TS5C 3SG3A 3PATA 2EC6C 1JBAA 3I5HB 4YGAA 3PM8A 1B8LA 1BMOA 1G4YR 2YGUA 1OOHA 3PSRA 4D1EA 2JNFA 4UPGA 2E30A 3HX4A 3IF7A 1TNWA 1DJWA 2L2CA 2L5YA 2KBIA 4PHMA 3F45A 4IL1A 3SIAA 1KK8B 2M49B 1K9KA 4YI9A 4OZDA 4PDZA 1OOIX 1LVCD 4I5LB 3S0GA 1UUSA 1AVSA 1UP5A 3S0AA 1BT6A 2LVIA 1NCZA 4A4BA 5CSJA 2KAXA 5FI7A 2M97A 1JWDA 2KQYA 2KAVA 2M9GA 2NCOA 2F2OA 2ZNEA 3BUWB 3KF9A 1DGVA 2O60A 3VRQA 3R1OA 1WLMA 3FE6A 3HCMA 4IJ7A 1Q80A 5D7FA 5I2OA 4MZLA 2WCBA 1ORGA 3CZTX 1RK9A 1TUZA 1KQMC 3CR5X 2LCPA 4AQJA 1TTXA 1IG5A 1UURA 2JT0A 3VGOA 3B7AA 3OBVA 4I5NB 5FI2A 3DVMA 1Y1XA 5GQQC 3SS3A 2JXCA 1ZFSA 1YR5A 1CDMA 3JTDB 2LVJA 2NZ0A 1QTXA 3BJHA 4USLA 1XFYO 1CB1A 1S6CA 1JC2A 1OW4A 1J7RA 1DJYA 4FTGA 1YX8A 2ZFDA 2JTTA 4C0JA 1A29A 1DJXA 1QLKA 2QACA 2G9BA 3WHUB 1NUBA 2PYQA 3AAKA 2QDIA 1IKUA 4NDBA 1B4CA 1NX1A 1CMGA 1HQVA 4OR9B 4CPVA 2SCPA 1JF2A 2GTEA 2LMTA 5G08A 1WY9A 4MLWA 1X02A 5DKQA 1CFPA 3BUNB 1RROA 4YGBB 2BL0C 2OPOA 1IJ5A 1XFUO 2KI4C 2QEHA 4GBAA 1MF8B 2LLTA 1IQ3A 4PT1A 4CLNA 2BKHB 2WCFA 2KOTA 4JWQA 1K9UA 4N1GA 4ORBB 5JJGA 1KQVA 3BFHA 2KYFA 4L9MA 3NSKA 1TUJA 5PALA 2KGRA 1SR6C 2BE4A 1QX5B 2H61C 2KPHA 4PCWA 3N7HA 1NCYA 1DJIA 2JRFA 2K7BA 2ZN8A 3QMEA 3M0WA 3O4YA 3AKBA 3FIAA 3IVTA 2Q4UA 3LK1A 1LS8A 3NXAA 4MZJA 1CDNA 2KHNA 2LVVA 2PQLA 2WC6A 4OVNF 3BXKA 5DICA 1SL9A 1KQMB 3BUOB 3FWBA 3DYEA 2MBXA 1ALWA 3CDNA 1TRFA 4P5OE 2HQWA 1C3ZA 3BUMB 2CT9A 1V1FA 1YUSA 2GGMA 2I7AA 2K8MB 4GNKB 3S0FA 1F8HA 2LLUA 1GGWA 1QVIY 4U8DA 2GV5A 1IWQA 1WDCC 4JPZB 1FBVA 2FCDA 5J3XA 1BLQA 2Y1NA 5HKYA 1KSOA 3KO0A 3H4SE 3OP0A 2FJYA 1TOPA 3ZNIA 3BOWB 4MVFA 3R1PA 2HQ8A 1DQEA 2COLB 1FW4A 1AUIB 4MZKA 3WHTB 2M1KB 2OS8C 1K93D 1CFCA 1FPWA 3ICBA 4OKHA 2L0PA 3OB2B 2Y1MA 1B9AA 1DELA 4C0LA 1C7WA 1C3YA 2F2PA 2FCEA 4PE7A 3UO9A 3B88A 1NSHA 4DRWA 2LVKA 2BL0B 2Y5IA 3I5IC 1SK6D 1XK4C 1FF1A 2P6BB 2K0JA 3KPXA 1ZOTB 3GK1A 2KI4B 4YBHB 5EL2A 1BF5A 2WCHA 3SG6A 1N2DA 3K21A 3O4XA 4XJKA 1XFWO 3CZ1A 4YGCB 1TCFA 2BCXA 1EH2A 3BFAA 3DF0B 2AMIA 2E6WA 1B7TY 1SL7A 1U5IB 4FQOA 2LUXA 1M46A 5CSIA 5D3OA 3QRXA 1SY9A 1YTZC 2K7CA 1SPYA 1EJ3A 2LM5A 1G33A 1XA5A 3BOWA 3KHEA 1SR6B 2WORA 3CR4X 3D0YB 5AXIA 3PJIA 1H8BA 5B8IB 1DJHA 1Y6WA 1OOJA 3D77A 1A75A 3CLNA 5IBWA 1CDLA 2KGBC 1SYMA 1PALA 3B87A 4GGFA 3O78A 4WRIA 3SS4A 3WXAA 3PFVA 4C0KA 5I2QA 3D75A 3PN7C 1RFJA 2QEBA 2BCBA 2K7DA 5JOLA 2MLFC 1M39A 2ISDA 1ALVA 3PM2A 1OMVA 5HL1A 3CGAA 1CLBA 3TDZA 2L4IA 1MHOA 1WDCB 2WCLA 1J7OA 2LHIA 3LCPC 3FE9A 3VRPA 2M3WA 1NP8A 2I2RE 3V2LA 1S6IA 3O6BA 2IS9A 3OX5A 1L2OC 3EVUA 4M2PA 1TNXA 1B1GA 2CBLA 2CNPA 1PVAA 1C7VA 3SG2A 4JD9A 1CKKA 2LMVA 2KYCA 3DXLA 2OS8B 5FYXA 3B86A 4N1FA 1YVLA 3EKHA 4GGNA 4ZCUA 2JU0A 3EVVA 2WC8A 1K94A 2M8UA 2BECA 5CSNA 5KTYA 1A2XA 2PASA 1EXRA 1DC1A 1BU3A 1JF0A 1XVJA 1S36A 2PALA 3R1VA 3DVEA 3I5IB 3TS5B 2EC6B 3SG7A 1QIWA 2Y4QA 3TZ1A 1BOCA 1K96A 1B8CA 1TWOA 4AOMA 1AJ4A 1EG4A 3GK4X 1KK7Y 3SS5A 1QV0A 1K95A 2BCAA 2JWWA 2JNXA 1UHHA 1DJZA 2PMYA 3NSIA 5HLOA 1AP4A 1LKJA 3EK8A 1XFXO 2WCKA 1SBJA 1NWDA 1W9ZA 5DKRA 1M63B 1XO5A 2QEVA 4INXA 5KSZA 3B6XA 2Q91A 4PE1A 1WRZA 2KI6C 4KYNA 3GOFA 2LHLA 1UHJA 4F7FA 1S6JA 2MRDA 1SL8A 1CTRA 1RECA 2F33A 3L4LA 3D74A 4E68A 3E3RA 2K7OA 2V53A 3BUXB 4CFQA 1F70A 4M2QA 3FWCA 3I5HC 1OOFA 1J1EA 1KWOC 1PK0D 1S5GY 5CSFA 1K8UA 1L7ZA 1JFKA 1Y0VH 2AAOA 4PALA 4QJ3B 4PHNA 4A4CA 1LINA 2M29A 2QEOA 4FQTA 1ZMZA 2ZNDA 4HSZA 1BODA 2L5XB 3VROA 1DT7B 3GK2A 1KK8C 1SMGA 1L2OB 1OSAA 1T14A 1CMFA
chains in the Genus database with same CATH topology
2L98A 1PSRA 1DJGA 1GQMA 1OZSA 1QX2A 5D69A 1F55A 4MN0A 1KCYA 1WRKA 1DF0B 1A03A 1S1EA 4WQ2A 1JUOA 2G2BA 3IQOA 2M7LA 2H2KA 1SCMC 1ODBA 2OTGC 2MJWB 4NDDA 3CR2A 4CFRA 1H4BA 1CLMA 1RJVA 1QXPA 2K2FA 1NPQA 1MXEA 1D1OA 2LV7A 2LNKA 4M2OA 1FI6A 2LC5A 1CLLA 2L2EA 4GPLB 3VRNA 1M45A 2D8NA 1F71A 1OQPA 3CS1A 3BYAA 4DCKA 1UHKA 4HRHA 1Y1AA 2JT3A 3I5GC 1K90D 1WLZA 1ZUZA 4ORAB 1F4OA 1N0YA 1AK8A 1UHNA 2MLEC 2R2IA 1SCVA 3TDIA 1EG3A 1B8RA 4I5KA 1QVIZ 2SASA 2M7NA 3LLEA 5DKNA 1IRJA 1J1DA 1NIWA 1QX7A 1QS7A 4P2YB 1AHRA 2HPSA 3FS7A 2LMUA 3OX6A 1TNPA 1YX7A 1UWOA 1SW8A 2HF5A 2JT8A 1R2UA 2M1UA 2VRGA 2PVBA 3I5FC 3NSOA 4YGEB 1HT9A 1MQ1A 2B1UA 1NX2A 1KWOB 1W7JB 1BG1A 1GGZA 3SG4A 1CM1A 1M31A 1PVBA 4ETOA 4F0ZB 4MRYA 5K89A 1E8AA 3EK7A 2F3ZA 1N65A 4GAOA 1RTP1 3PALA 2WOSA 3NSLA 1YUUA 2CCMA 2A4JA 4N5XA 3AKAA 2EGDA 3A4UB 1BJFA 3DF0A 2I94A 2MHHA 1DVIA 1DMOA 1CFDA 2GGZA 4HRGA 5AANA 4PHJA 1CDPA 1U5IA 5HYDA 3JVTC 1F4QA 3EK4A 1IQ5A 1SCMB 2OTGB 2H61A 1B7TZ 3D0YA 4YI8A 1KFUS 3TDUA 4JQ0D 2L4HA 2WCEA 3CTNA 3LK0A 4HREE 1J7QA 1KSMA 1W7IB 1IJ6A 2FJUB 3IQQA 2CXJA 3EKJA 5HKWA 1R6PA 1MWNA 2ZN9A 3SIBA 5ER5A 3LL8B 3OB1B 2O5GA 2LLSA 4BY4A 2ZKMX 4QJ5B 5TNCA 4YGDB 2KDHA 1NCXA 4TNCA 1V1GA 4GFTA 4ICBA 1EL4A 1K9PA 1OMRA 2JULA 1LA0A 2MAZA 3SJSA 4OCIA 1OZOA 1C07A 2LP2A 3D10A 4CIDA 2WNDA 3I5GB 1QIVA 2ZRTA 4WQ3A 1KFUL 2PSRA 2BBMA 2BE6A 5I2LA 4MEWA 1B47A 4BY5A 2DOQA 2QPTA 1K2HA 2JZIA 1DGUA 1JFJA 3WNXB 1JSAA 1A4PA 4NQGA 1J7PA 2TN4A 1YUTA 1NYAA 4MBEA 2F8PA 4GGFC 2CTNA 3TUYC 1YURA 5KU1A 4DUQA 2JC2A 1SNLA 1YRUB 3I5FB 1MR8A 3O2PA 1S26D 1QV1A 3DVKA 3SG5A 1CM4A 5ER4X 1LA3A 3PN7B 3RLZA 1F54A 4PHKA 2K2AA 4DS7A 1Y1UA 1VRKA 4YRUA 2PRUA 2ZRSA 1XK4A 2BBNA 1TIZA 2JOJA 2RGIA 2KFHA 3OHMB 1G8IA 1PULA 2KAYA 3A8RA 1NX3A 2LANA 2KI6D 4I5JA 1PSBA 4MRXA 2JTZA 3AAJA 3ZWHA 1LXFC 1GJYA 2BKIB 1OMDA 5HKZA 3DD4A 3C1VA 2NLNA 4QJ4B 2LE9B 3JVTB 1KK7Z 3RM1A 1CNPA 1CFFA 3PLFB 1UHIA 2JPTA 2L51A 2NCPA 4ORCB 1WRLA 2LP3A 3MSEB 1XYDA 1S3PA 1QJTA 2AUCA 1QATA 3KEVA 1SKTA 5F6TA 1TNQA 4GUKA 5HLVA 1QASA 1BR4B 1QLSA 2F3YA 1NX0A 1YVHA 2KFFA 2LUCA 2LAPA 1TCOB 4PE0A 1DTLA 2KBMA 2JXLA 2EHBA 1MXLC 4XJKB 2FOTA 1KFXS 2KNEA 1TN4A 5BPJA 2JQ6A 5I8NA 2KQ6A 2MA2A 4XYNA 2L50A 2NXQA 4R1EA 1S5GZ 4DIRA 2HETA 2KSPA 5AEQA 3JTDC 1FI5A 2M0RA 3CWGA 1J55A 5CPVA 4ZCVA 1XFZO 5AFPA 1BR1B 3BQ3A 1PRWA 4PE4A 5AERA 1XFVO 4MSPA 1A75B 2I18A 3VRRA 3TUYB 1DF0A 4AQIA 1YRTB 1KFXL 1IH0A 1SRAA 1IGVA 1OE9B 2K61A 3EVRA 1ZACA 4NDCA 4OV2A 1AJ5A 3DVJA 1MUXA 1RWYA 2KFGA 4Q04A 3TS5C 3SG3A 3PATA 2EC6C 1JBAA 3I5HB 4YGAA 3PM8A 1B8LA 1BMOA 1G4YR 3PSRA 4UPGA 4D1EA 2JNFA 2E30A 3HX4A 3IF7A 1TNWA 1DJWA 2KBIA 4PHMA 3F45A 4IL1A 3SIAA 1KK8B 2M49B 1K9KA 4YI9A 4PDZA 1LVCD 4I5LB 1UUSA 1AVSA 1UP5A 1BT6A 2LVIA 1NCZA 4A4BA 5CSJA 2KAXA 2M97A 1JWDA 2KQYA 2KAVA 2M9GA 2NCOA 2F2OA 2ZNEA 3BUWB 3KF9A 1DGVA 2O60A 3VRQA 1WLMA 3HCMA 1Q80A 5D7FA 5I2OA 4MZLA 2WCBA 3CZTX 1RK9A 3CR5X 1KQMC 2LCPA 4AQJA 1TTXA 1IG5A 1UURA 2JT0A 3VGOA 4I5NB 3DVMA 1Y1XA 5GQQC 2JXCA 1ZFSA 1YR5A 1CDMA 3JTDB 2LVJA 2NZ0A 1QTXA 4USLA 1CB1A 1XFYO 1S6CA 1JC2A 1J7RA 1DJYA 4FTGA 1YX8A 2ZFDA 2JTTA 4C0JA 1A29A 1DJXA 1QLKA 2QACA 2G9BA 3WHUB 1NUBA 3AAKA 1IKUA 4NDBA 1B4CA 1NX1A 1CMGA 1HQVA 4OR9B 4CPVA 2SCPA 1JF2A 2LMTA 5G08A 1WY9A 4MLWA 1X02A 5DKQA 1CFPA 3BUNB 1RROA 4YGBB 2BL0C 2OPOA 1IJ5A 1XFUO 2KI4C 4GBAA 1MF8B 2LLTA 1IQ3A 4CLNA 2BKHB 2WCFA 2KOTA 4JWQA 1K9UA 4N1GA 4ORBB 5JJGA 1KQVA 4L9MA 2KYFA 3NSKA 5PALA 2KGRA 1SR6C 2BE4A 1QX5B 2H61C 4PCWA 1NCYA 1DJIA 2JRFA 2K7BA 2ZN8A 3M0WA 3O4YA 3AKBA 3FIAA 2Q4UA 3LK1A 3NXAA 4MZJA 1CDNA 2KHNA 2LVVA 4OVNF 3BXKA 1SL9A 1KQMB 3BUOB 3FWBA 2MBXA 1ALWA 1TRFA 4P5OE 2HQWA 3BUMB 2CT9A 1V1FA 1YUSA 2GGMA 2I7AA 2K8MB 4GNKB 1F8HA 2LLUA 1GGWA 1QVIY 4U8DA 2GV5A 1IWQA 1WDCC 4JPZB 1FBVA 2FCDA 5J3XA 1BLQA 2Y1NA 5HKYA 1KSOA 3KO0A 3H4SE 3OP0A 1TOPA 3ZNIA 3BOWB 4MVFA 2HQ8A 2COLB 1FW4A 1AUIB 4MZKA 3WHTB 2M1KB 2OS8C 1K93D 1CFCA 1FPWA 3ICBA 4OKHA 2L0PA 3OB2B 2Y1MA 1B9AA 4C0LA 1C7WA 2F2PA 2FCEA 4PE7A 4DRWA 1NSHA 2LVKA 2BL0B 2Y5IA 3I5IC 1SK6D 1XK4C 1FF1A 2P6BB 2K0JA 3KPXA 1ZOTB 3GK1A 2KI4B 4YBHB 1BF5A 3SG6A 1N2DA 3K21A 4XJKA 1XFWO 4YGCB 1TCFA 2BCXA 1EH2A 3DF0B 2AMIA 2E6WA 1B7TY 1SL7A 1U5IB 4FQOA 2LUXA 1M46A 5CSIA 3QRXA 1SY9A 1YTZC 2K7CA 1SPYA 1EJ3A 2LM5A 1G33A 1XA5A 3BOWA 3KHEA 1SR6B 2WORA 3CR4X 3D0YB 5AXIA 1H8BA 5B8IB 1DJHA 1Y6WA 1OOJA 1A75A 3CLNA 5IBWA 1CDLA 2KGBC 1SYMA 1PALA 4GGFA 4WRIA 3O78A 3WXAA 4C0KA 5I2QA 3PFVA 3PN7C 1RFJA 2BCBA 2K7DA 5JOLA 2MLFC 1M39A 2ISDA 1ALVA 1OMVA 3CGAA 1CLBA 3TDZA 2L4IA 1MHOA 1WDCB 1J7OA 2LHIA 3LCPC 3VRPA 2M3WA 1NP8A 2I2RE 1S6IA 3O6BA 2IS9A 3OX5A 1L2OC 3EVUA 4M2PA 1TNXA 1B1GA 2CBLA 2CNPA 1PVAA 1C7VA 3SG2A 1CKKA 2LMVA 2KYCA 2OS8B 5FYXA 4N1FA 1YVLA 3EKHA 4GGNA 4ZCUA 2JU0A 3EVVA 2WC8A 1K94A 2M8UA 2BECA 5CSNA 5KTYA 1A2XA 2PASA 1EXRA 1BU3A 1JF0A 1XVJA 1S36A 2PALA 3TS5B 3DVEA 3I5IB 2EC6B 3SG7A 1QIWA 2Y4QA 3TZ1A 1BOCA 1K96A 1B8CA 4AOMA 1AJ4A 1EG4A 3GK4X 1KK7Y 1QV0A 1K95A 2BCAA 2JWWA 2JNXA 1UHHA 1DJZA 2PMYA 3NSIA 5HLOA 1AP4A 1LKJA 3EK8A 1XFXO 1SBJA 1NWDA 5DKRA 1M63B 1XO5A 5KSZA 2Q91A 4PE1A 1WRZA 2KI6C 3GOFA 2LHLA 1UHJA 1S6JA 2MRDA 1SL8A 1CTRA 1RECA 2F33A 4E68A 3E3RA 2K7OA 2V53A 3BUXB 4CFQA 1F70A 4M2QA 3FWCA 3I5HC 1J1EA 1KWOC 1PK0D 1S5GY 5CSFA 1K8UA 1L7ZA 1JFKA 1Y0VH 2AAOA 4PALA 4QJ3B 4PHNA 4A4CA 1LINA 2M29A 1ZMZA 2ZNDA 4HSZA 1BODA 2L5XB 3VROA 1DT7B 3GK2A 1KK8C 1SMGA 1L2OB 1OSAA 1CMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L98 A;  1PSR A;  1DJG A;  1GQM A;  1OZS A;  1QX2 A;  5D69 A;  1F55 A;  4MN0 A;  1KCY A;  1WRK A;  1DF0 B;  1A03 A;  1S1E A;  4WQ2 A;  1JUO A;  2G2B A;  3IQO A;  2M7L A;  2H2K A;  1SCM C;  1ODB A;  2OTG C;  2MJW B;  4NDD A;  3CR2 A;  4CFR A;  1H4B A;  1CLM A;  1RJV A;  1QXP A;  2K2F A;  1NPQ A;  1MXE A;  1D1O A;  2LV7 A;  2LNK A;  4M2O A;  1FI6 A;  2LC5 A;  1CLL A;  2L2E A;  4GPL B;  3VRN A;  1M45 A;  2D8N A;  1F71 A;  1OQP A;  3CS1 A;  3BYA A;  4DCK A;  1UHK A;  4HRH A;  1Y1A A;  2JT3 A;  3I5G C;  1K90 D;  1WLZ A;  1ZUZ A;  4ORA B;  1F4O A;  1N0Y A;  1AK8 A;  1UHN A;  2MLE C;  2R2I A;  1SCV A;  3TDI A;  1EG3 A;  1B8R A;  4I5K A;  1QVI Z;  2SAS A;  2M7N A;  3LLE A;  5DKN A;  1IRJ A;  1J1D A;  1NIW A;  1QX7 A;  1QS7 A;  4P2Y B;  1AHR A;  2HPS A;  3FS7 A;  2LMU A;  3OX6 A;  1TNP A;  1YX7 A;  1UWO A;  1SW8 A;  2HF5 A;  2JT8 A;  1R2U A;  2M1U A;  2VRG A;  2PVB A;  3I5F C;  3NSO A;  4YGE B;  1HT9 A;  1MQ1 A;  2B1U A;  1NX2 A;  1KWO B;  1W7J B;  1BG1 A;  1GGZ A;  3SG4 A;  1CM1 A;  1M31 A;  1PVB A;  4ETO A;  4F0Z B;  4MRY A;  5K89 A;  1E8A A;  3EK7 A;  2F3Z A;  1N65 A;  4GAO A;  1RTP 1;  3PAL A;  2WOS A;  3NSL A;  1YUU A;  2CCM A;  2A4J A;  4N5X A;  3AKA A;  2EGD A;  3A4U B;  1BJF A;  3DF0 A;  2I94 A;  2MHH A;  1DVI A;  1DMO A;  1CFD A;  2GGZ A;  4HRG A;  5AAN A;  4PHJ A;  1CDP A;  1U5I A;  5HYD A;  3JVT C;  1F4Q A;  3EK4 A;  1IQ5 A;  1SCM B;  2OTG B;  2H61 A;  1B7T Z;  3D0Y A;  4YI8 A;  1KFU S;  3TDU A;  4JQ0 D;  2L4H A;  2WCE A;  3CTN A;  3LK0 A;  4HRE E;  1J7Q A;  1KSM A;  1W7I B;  1IJ6 A;  2FJU B;  3IQQ A;  2CXJ A;  3EKJ A;  5HKW A;  1R6P A;  1MWN A;  2ZN9 A;  3SIB A;  5ER5 A;  3LL8 B;  3OB1 B;  2O5G A;  2LLS A;  4BY4 A;  2ZKM X;  4QJ5 B;  5TNC A;  4YGD B;  2KDH A;  1NCX A;  4TNC A;  1V1G A;  4GFT A;  4ICB A;  1EL4 A;  1K9P A;  1OMR A;  2JUL A;  1LA0 A;  2MAZ A;  3SJS A;  4OCI A;  1OZO A;  1C07 A;  2LP2 A;  3D10 A;  4CID A;  2WND A;  3I5G B;  1QIV A;  2ZRT A;  4WQ3 A;  1KFU L;  2PSR A;  2BBM A;  2BE6 A;  5I2L A;  4MEW A;  1B47 A;  4BY5 A;  2DOQ A;  2QPT A;  1K2H A;  2JZI A;  1DGU A;  1JFJ A;  3WNX B;  1JSA A;  1A4P A;  4NQG A;  1J7P A;  2TN4 A;  1YUT A;  1NYA A;  4MBE A;  2F8P A;  4GGF C;  2CTN A;  3TUY C;  1YUR A;  5KU1 A;  4DUQ A;  2JC2 A;  1SNL A;  1YRU B;  3I5F B;  1MR8 A;  3O2P A;  1S26 D;  1QV1 A;  3DVK A;  3SG5 A;  1CM4 A;  5ER4 X;  1LA3 A;  3PN7 B;  3RLZ A;  1F54 A;  4PHK A;  2K2A A;  4DS7 A;  1Y1U A;  1VRK A;  4YRU A;  2PRU A;  2ZRS A;  1XK4 A;  2BBN A;  1TIZ A;  2JOJ A;  2RGI A;  2KFH A;  3OHM B;  1G8I A;  1PUL A;  2KAY A;  3A8R A;  1NX3 A;  2LAN A;  2KI6 D;  4I5J A;  1PSB A;  4MRX A;  2JTZ A;  3AAJ A;  3ZWH A;  1LXF C;  1GJY A;  2BKI B;  1OMD A;  5HKZ A;  3DD4 A;  3C1V A;  2NLN A;  4QJ4 B;  2LE9 B;  3JVT B;  1KK7 Z;  3RM1 A;  1CNP A;  1CFF A;  3PLF B;  1UHI A;  2JPT A;  2L51 A;  2NCP A;  4ORC B;  1WRL A;  2LP3 A;  3MSE B;  1XYD A;  1S3P A;  1QJT A;  2AUC A;  1QAT A;  3KEV A;  1SKT A;  5F6T A;  1TNQ A;  4GUK A;  5HLV A;  1QAS A;  1BR4 B;  1QLS A;  2F3Y A;  1NX0 A;  1YVH A;  2KFF A;  2LUC A;  2LAP A;  1TCO B;  4PE0 A;  1DTL A;  2KBM A;  2JXL A;  2EHB A;  1MXL C;  4XJK B;  2FOT A;  1KFX S;  2KNE A;  1TN4 A;  5BPJ A;  2JQ6 A;  5I8N A;  2KQ6 A;  2MA2 A;  4XYN A;  2L50 A;  2NXQ A;  4R1E A;  1S5G Z;  4DIR A;  2HET A;  2KSP A;  5AEQ A;  3JTD C;  1FI5 A;  2M0R A;  3CWG A;  1J55 A;  5CPV A;  4ZCV A;  1XFZ O;  5AFP A;  1BR1 B;  3BQ3 A;  1PRW A;  4PE4 A;  5AER A;  1XFV O;  4MSP A;  1A75 B;  2I18 A;  3VRR A;  3TUY B;  1DF0 A;  4AQI A;  1YRT B;  1KFX L;  1IH0 A;  1SRA A;  1IGV A;  1OE9 B;  2K61 A;  3EVR A;  1ZAC A;  4NDC A;  4OV2 A;  1AJ5 A;  3DVJ A;  1MUX A;  1RWY A;  2KFG A;  4Q04 A;  3TS5 C;  3SG3 A;  3PAT A;  2EC6 C;  1JBA A;  3I5H B;  4YGA A;  3PM8 A;  1B8L A;  1BMO A;  1G4Y R;  3PSR A;  4UPG A;  4D1E A;  2JNF A;  2E30 A;  3HX4 A;  3IF7 A;  1TNW A;  1DJW A;  2KBI A;  4PHM A;  3F45 A;  4IL1 A;  3SIA A;  1KK8 B;  2M49 B;  1K9K A;  4YI9 A;  4PDZ A;  1LVC D;  4I5L B;  1UUS A;  1AVS A;  1UP5 A;  1BT6 A;  2LVI A;  1NCZ A;  4A4B A;  5CSJ A;  2KAX A;  2M97 A;  1JWD A;  2KQY A;  2KAV A;  2M9G A;  2NCO A;  2F2O A;  2ZNE A;  3BUW B;  3KF9 A;  1DGV A;  2O60 A;  3VRQ A;  1WLM A;  3HCM A;  1Q80 A;  5D7F A;  5I2O A;  4MZL A;  2WCB A;  3CZT X;  1RK9 A;  3CR5 X;  1KQM C;  2LCP A;  4AQJ A;  1TTX A;  1IG5 A;  1UUR A;  2JT0 A;  3VGO A;  4I5N B;  3DVM A;  1Y1X A;  5GQQ C;  2JXC A;  1ZFS A;  1YR5 A;  1CDM A;  3JTD B;  2LVJ A;  2NZ0 A;  1QTX A;  4USL A;  1CB1 A;  1XFY O;  1S6C A;  1JC2 A;  1J7R A;  1DJY A;  4FTG A;  1YX8 A;  2ZFD A;  2JTT A;  4C0J A;  1A29 A;  1DJX A;  1QLK A;  2QAC A;  2G9B A;  3WHU B;  1NUB A;  3AAK A;  1IKU A;  4NDB A;  1B4C A;  1NX1 A;  1CMG A;  1HQV A;  4OR9 B;  4CPV A;  2SCP A;  1JF2 A;  2LMT A;  5G08 A;  1WY9 A;  4MLW A;  1X02 A;  5DKQ A;  1CFP A;  3BUN B;  1RRO A;  4YGB B;  2BL0 C;  2OPO A;  1IJ5 A;  1XFU O;  2KI4 C;  4GBA A;  1MF8 B;  2LLT A;  1IQ3 A;  4CLN A;  2BKH B;  2WCF A;  2KOT A;  4JWQ A;  1K9U A;  4N1G A;  4ORB B;  5JJG A;  1KQV A;  4L9M A;  2KYF A;  3NSK A;  5PAL A;  2KGR A;  1SR6 C;  2BE4 A;  1QX5 B;  2H61 C;  4PCW A;  1NCY A;  1DJI A;  2JRF A;  2K7B A;  2ZN8 A;  3M0W A;  3O4Y A;  3AKB A;  3FIA A;  2Q4U A;  3LK1 A;  3NXA A;  4MZJ A;  1CDN A;  2KHN A;  2LVV A;  4OVN F;  3BXK A;  1SL9 A;  1KQM B;  3BUO B;  3FWB A;  2MBX A;  1ALW A;  1TRF A;  4P5O E;  2HQW A;  3BUM B;  2CT9 A;  1V1F A;  1YUS A;  2GGM A;  2I7A A;  2K8M B;  4GNK B;  1F8H A;  2LLU A;  1GGW A;  1QVI Y;  4U8D A;  2GV5 A;  1IWQ A;  1WDC C;  4JPZ B;  1FBV A;  2FCD A;  5J3X A;  1BLQ A;  2Y1N A;  5HKY A;  1KSO A;  3KO0 A;  3H4S E;  3OP0 A;  1TOP A;  3ZNI A;  3BOW B;  4MVF A;  2HQ8 A;  2COL B;  1FW4 A;  1AUI B;  4MZK A;  3WHT B;  2M1K B;  2OS8 C;  1K93 D;  1CFC A;  1FPW A;  3ICB A;  4OKH A;  2L0P A;  3OB2 B;  2Y1M A;  1B9A A;  4C0L A;  1C7W A;  2F2P A;  2FCE A;  4PE7 A;  4DRW A;  1NSH A;  2LVK A;  2BL0 B;  2Y5I A;  3I5I C;  1SK6 D;  1XK4 C;  1FF1 A;  2P6B B;  2K0J A;  3KPX A;  1ZOT B;  3GK1 A;  2KI4 B;  4YBH B;  1BF5 A;  3SG6 A;  1N2D A;  3K21 A;  4XJK A;  1XFW O;  4YGC B;  1TCF A;  2BCX A;  1EH2 A;  3DF0 B;  2AMI A;  2E6W A;  1B7T Y;  1SL7 A;  1U5I B;  4FQO A;  2LUX A;  1M46 A;  5CSI A;  3QRX A;  1SY9 A;  1YTZ C;  2K7C A;  1SPY A;  1EJ3 A;  2LM5 A;  1G33 A;  1XA5 A;  3BOW A;  3KHE A;  1SR6 B;  2WOR A;  3CR4 X;  3D0Y B;  5AXI A;  1H8B A;  5B8I B;  1DJH A;  1Y6W A;  1OOJ A;  1A75 A;  3CLN A;  5IBW A;  1CDL A;  2KGB C;  1SYM A;  1PAL A;  4GGF A;  4WRI A;  3O78 A;  3WXA A;  4C0K A;  5I2Q A;  3PFV A;  3PN7 C;  1RFJ A;  2BCB A;  2K7D A;  5JOL A;  2MLF C;  1M39 A;  2ISD A;  1ALV A;  1OMV A;  3CGA A;  1CLB A;  3TDZ A;  2L4I A;  1MHO A;  1WDC B;  1J7O A;  2LHI A;  3LCP C;  3VRP A;  2M3W A;  1NP8 A;  2I2R E;  1S6I A;  3O6B A;  2IS9 A;  3OX5 A;  1L2O C;  3EVU A;  4M2P A;  1TNX A;  1B1G A;  2CBL A;  2CNP A;  1PVA A;  1C7V A;  3SG2 A;  1CKK A;  2LMV A;  2KYC A;  2OS8 B;  5FYX A;  4N1F A;  1YVL A;  3EKH A;  4GGN A;  4ZCU A;  2JU0 A;  3EVV A;  2WC8 A;  1K94 A;  2M8U A;  2BEC A;  5CSN A;  5KTY A;  1A2X A;  2PAS A;  1EXR A;  1BU3 A;  1JF0 A;  1XVJ A;  1S36 A;  2PAL A;  3TS5 B;  3DVE A;  3I5I B;  2EC6 B;  3SG7 A;  1QIW A;  2Y4Q A;  3TZ1 A;  1BOC A;  1K96 A;  1B8C A;  4AOM A;  1AJ4 A;  1EG4 A;  3GK4 X;  1KK7 Y;  1QV0 A;  1K95 A;  2BCA A;  2JWW A;  2JNX A;  1UHH A;  1DJZ A;  2PMY A;  3NSI A;  5HLO A;  1AP4 A;  1LKJ A;  3EK8 A;  1XFX O;  1SBJ A;  1NWD A;  5DKR A;  1M63 B;  1XO5 A;  5KSZ A;  2Q91 A;  4PE1 A;  1WRZ A;  2KI6 C;  3GOF A;  2LHL A;  1UHJ A;  1S6J A;  2MRD A;  1SL8 A;  1CTR A;  1REC A;  2F33 A;  4E68 A;  3E3R A;  2K7O A;  2V53 A;  3BUX B;  4CFQ A;  1F70 A;  4M2Q A;  3FWC A;  3I5H C;  1J1E A;  1KWO C;  1PK0 D;  1S5G Y;  5CSF A;  1K8U A;  1L7Z A;  1JFK A;  1Y0V H;  2AAO A;  4PAL A;  4QJ3 B;  4PHN A;  4A4C A;  1LIN A;  2M29 A;  1ZMZ A;  2ZND A;  4HSZ A;  1BOD A;  2L5X B;  3VRO A;  1DT7 B;  3GK2 A;  1KK8 C;  1SMG A;  1L2O B;  1OSA A;  1CMF A; 
#chains in the Genus database with same CATH topology
 2L98 A;  1PSR A;  1DJG A;  1GQM A;  1OZS A;  1QX2 A;  5D69 A;  1F55 A;  4MN0 A;  1KCY A;  2WCJ A;  1WRK A;  1DF0 B;  1A03 A;  1S1E A;  4WQ2 A;  1GM0 A;  1JUO A;  2G2B A;  3IQO A;  2M7L A;  2H2K A;  1SCM C;  1ODB A;  2OTG C;  2MJW B;  4NDD A;  3CR2 A;  3D73 A;  3K1E A;  4CFR A;  1H4B A;  1CLM A;  1RJV A;  1QXP A;  2K2F A;  1NPQ A;  4INW A;  1MXE A;  3VB1 A;  2LV7 A;  2LNK A;  4M2O A;  1D1O A;  1FI6 A;  2LC5 A;  1CLL A;  2P71 A;  2L2E A;  4GPL B;  3VRN A;  3CZ0 A;  1M45 A;  2D8N A;  1F71 A;  1OQP A;  3CS1 A;  3BYA A;  4DCK A;  1UHK A;  4HRH A;  1Y1A A;  2JT3 A;  3I5G C;  1K90 D;  1WLZ A;  1ZUZ A;  3EG5 B;  4ORA B;  1F4O A;  1N0Y A;  1AK8 A;  1UHN A;  2MLE C;  2R2I A;  1SCV A;  3TDI A;  1EG3 A;  1B8R A;  4I5K A;  1QVI Z;  2SAS A;  2M7N A;  3LLE A;  5DKN A;  4JKT A;  1IRJ A;  1J1D A;  1NIW A;  1QX7 A;  1QS7 A;  4P2Y B;  1AHR A;  2HPS A;  3FS7 A;  2LMU A;  3OX6 A;  3NGV A;  1TNP A;  1YX7 A;  1UWO A;  1SW8 A;  2HF5 A;  2JT8 A;  1R2U A;  2M1U A;  2VRG A;  3S0E A;  2PVB A;  3I5F C;  3NSO A;  3D76 A;  5FI6 A;  4YGE B;  1HT9 A;  1MQ1 A;  2B1U A;  1NX2 A;  1KWO B;  1W7J B;  1BG1 A;  1GGZ A;  1XFR A;  1CM1 A;  1M31 A;  1PVB A;  3SG4 A;  4ETO A;  4F0Z B;  4MRY A;  5K89 A;  1E8A A;  3EK7 A;  2F3Z A;  1N65 A;  4GAO A;  1RTP 1;  2WCM A;  3PAL A;  2WOS A;  3NSL A;  1YUU A;  2CCM A;  2A4J A;  4N5X A;  3AKA A;  2EGD A;  2WC5 A;  3A4U B;  1BJF A;  3DF0 A;  2I94 A;  2MHH A;  1DVI A;  1DMO A;  1CFD A;  2GGZ A;  3DZT A;  4HRG A;  5AAN A;  4PHJ A;  1CDP A;  1U5I A;  5HYD A;  3BFB A;  3JVT C;  1F4Q A;  3EK4 A;  1IQ5 A;  1SCM B;  2OTG B;  1P28 A;  2H61 A;  1B7T Z;  3D0Y A;  4YI8 A;  1KFU S;  3TDU A;  4JQ0 D;  2L4H A;  2WCE A;  3CTN A;  3LK0 A;  4HRE E;  1J7Q A;  1KSM A;  1W7I B;  1IJ6 A;  2FJU B;  2K60 A;  2CXJ A;  3EKJ A;  3IQQ A;  5HKW A;  1R6P A;  3Q8I A;  1MWN A;  2ERB A;  2ZN9 A;  5ER5 A;  3SIB A;  3LL8 B;  3OB1 B;  1IIO A;  1QWV A;  2O5G A;  2LLS A;  4BY4 A;  3NHI A;  2ZKM X;  3CAB A;  4QJ5 B;  5TNC A;  4YGD B;  2KDH A;  1NCX A;  4TNC A;  1V1G A;  4GFT A;  4ICB A;  1EL4 A;  1K9P A;  1OMR A;  2JUL A;  1LA0 A;  2MAZ A;  3D78 A;  3SJS A;  4OCI A;  1OZO A;  1C07 A;  2LP2 A;  3D10 A;  4CID A;  2WND A;  3CZ2 A;  1QIV A;  1Z2C B;  2ZRT A;  3I5G B;  1KFU L;  2PSR A;  3OGN A;  2BBM A;  4WQ3 A;  2BE6 A;  5I2L A;  4MEW A;  1Z4H A;  2KLE A;  1B47 A;  4BY5 A;  2DOQ A;  2QPT A;  3DY9 A;  1K2H A;  2JZI A;  1DGU A;  1JFJ A;  3WNX B;  1JSA A;  1A4P A;  4NQG A;  1J7P A;  2TN4 A;  1YUT A;  1NYA A;  4MBE A;  2F8P A;  3L4A A;  2CTN A;  4GGF C;  3TUY C;  1YUR A;  5KU1 A;  4DUQ A;  2JC2 A;  1SNL A;  1YRU B;  3I5F B;  1MR8 A;  3O2P A;  1S26 D;  1QV1 A;  3DVK A;  3SG5 A;  1CM4 A;  5ER4 X;  1LA3 A;  3PN7 B;  3RLZ A;  1F54 A;  4PHK A;  3CYZ A;  2K2A A;  4DS7 A;  1Y1U A;  3UNW A;  1VRK A;  4YRU A;  2PRU A;  2ZRS A;  1XK4 A;  2BBN A;  1TIZ A;  2JOJ A;  3S0D A;  1OOG A;  1SSE B;  2KFH A;  2RGI A;  3OHM B;  1G8I A;  1PUL A;  2KAY A;  3A8R A;  1NX3 A;  3RZS A;  2LAN A;  2KI6 D;  4I5J A;  1PSB A;  4MRX A;  2JTZ A;  2KLD A;  3AAJ A;  1LXF C;  3ZWH A;  1GJY A;  2BKI B;  1OMD A;  5HKZ A;  3DD4 A;  3C1V A;  2NLN A;  4QJ4 B;  2BAP A;  2LE9 B;  1KK7 Z;  3JVT B;  3RM1 A;  1CNP A;  1CFF A;  3PLF B;  3R72 A;  1UHI A;  2JPT A;  2L51 A;  2NCP A;  4ORC B;  1WRL A;  2JPO A;  2LP3 A;  3MSE B;  1XYD A;  1S3P A;  2H8V A;  1QJT A;  2AUC A;  1QAT A;  3KEV A;  1SKT A;  5F6T A;  1TNQ A;  3S0B A;  4GUK A;  2BNX A;  5HLV A;  1QAS A;  1BR4 B;  1QLS A;  2F3Y A;  1NX0 A;  1YVH A;  2KFF A;  2LUC A;  2LAP A;  1TCO B;  3FE8 A;  1DTL A;  2KBM A;  4PE0 A;  2JXL A;  2EHB A;  2P70 A;  1MXL C;  4XJK B;  2FOT A;  1KFX S;  2KNE A;  1TN4 A;  5BPJ A;  2JQ6 A;  5I8N A;  2KQ6 A;  2MA2 A;  4XYN A;  2L50 A;  2NXQ A;  1DEK A;  4R1E A;  1S5G Z;  3L47 A;  2HET A;  2KSP A;  5AEQ A;  3JTD C;  4DIR A;  1FI5 A;  2M0R A;  3CWG A;  1J55 A;  5CPV A;  4ZCV A;  1XFZ O;  5AFP A;  1BR1 B;  3BQ3 A;  1PRW A;  4PE4 A;  5AER A;  1XFV O;  4MSP A;  1A75 B;  5I94 A;  2I18 A;  3VRR A;  3TUY B;  1DF0 A;  4AQI A;  1YRT B;  1KFX L;  1IH0 A;  1SRA A;  1IGV A;  1OE9 B;  2K61 A;  3EVR A;  1ZAC A;  3NHT A;  4NDC A;  4OV2 A;  1AJ5 A;  3DVJ A;  1MUX A;  1RWY A;  2KFG A;  4Q04 A;  3TS5 C;  3SG3 A;  3PAT A;  2EC6 C;  1JBA A;  3I5H B;  4YGA A;  3PM8 A;  1B8L A;  1BMO A;  1G4Y R;  2YGU A;  1OOH A;  3PSR A;  4D1E A;  2JNF A;  4UPG A;  2E30 A;  3HX4 A;  3IF7 A;  1TNW A;  1DJW A;  2L2C A;  2L5Y A;  2KBI A;  4PHM A;  3F45 A;  4IL1 A;  3SIA A;  1KK8 B;  2M49 B;  1K9K A;  4YI9 A;  4OZD A;  4PDZ A;  1OOI X;  1LVC D;  4I5L B;  3S0G A;  1UUS A;  1AVS A;  1UP5 A;  3S0A A;  1BT6 A;  2LVI A;  1NCZ A;  4A4B A;  5CSJ A;  2KAX A;  5FI7 A;  2M97 A;  1JWD A;  2KQY A;  2KAV A;  2M9G A;  2NCO A;  2F2O A;  2ZNE A;  3BUW B;  3KF9 A;  1DGV A;  2O60 A;  3VRQ A;  3R1O A;  1WLM A;  3FE6 A;  3HCM A;  4IJ7 A;  1Q80 A;  5D7F A;  5I2O A;  4MZL A;  2WCB A;  1ORG A;  3CZT X;  1RK9 A;  1TUZ A;  1KQM C;  3CR5 X;  2LCP A;  4AQJ A;  1TTX A;  1IG5 A;  1UUR A;  2JT0 A;  3VGO A;  3B7A A;  3OBV A;  4I5N B;  5FI2 A;  3DVM A;  1Y1X A;  5GQQ C;  3SS3 A;  2JXC A;  1ZFS A;  1YR5 A;  1CDM A;  3JTD B;  2LVJ A;  2NZ0 A;  1QTX A;  3BJH A;  4USL A;  1XFY O;  1CB1 A;  1S6C A;  1JC2 A;  1OW4 A;  1J7R A;  1DJY A;  4FTG A;  1YX8 A;  2ZFD A;  2JTT A;  4C0J A;  1A29 A;  1DJX A;  1QLK A;  2QAC A;  2G9B A;  3WHU B;  1NUB A;  2PYQ A;  3AAK A;  2QDI A;  1IKU A;  4NDB A;  1B4C A;  1NX1 A;  1CMG A;  1HQV A;  4OR9 B;  4CPV A;  2SCP A;  1JF2 A;  2GTE A;  2LMT A;  5G08 A;  1WY9 A;  4MLW A;  1X02 A;  5DKQ A;  1CFP A;  3BUN B;  1RRO A;  4YGB B;  2BL0 C;  2OPO A;  1IJ5 A;  1XFU O;  2KI4 C;  2QEH A;  4GBA A;  1MF8 B;  2LLT A;  1IQ3 A;  4PT1 A;  4CLN A;  2BKH B;  2WCF A;  2KOT A;  4JWQ A;  1K9U A;  4N1G A;  4ORB B;  5JJG A;  1KQV A;  3BFH A;  2KYF A;  4L9M A;  3NSK A;  1TUJ A;  5PAL A;  2KGR A;  1SR6 C;  2BE4 A;  1QX5 B;  2H61 C;  2KPH A;  4PCW A;  3N7H A;  1NCY A;  1DJI A;  2JRF A;  2K7B A;  2ZN8 A;  3QME A;  3M0W A;  3O4Y A;  3AKB A;  3FIA A;  3IVT A;  2Q4U A;  3LK1 A;  1LS8 A;  3NXA A;  4MZJ A;  1CDN A;  2KHN A;  2LVV A;  2PQL A;  2WC6 A;  4OVN F;  3BXK A;  5DIC A;  1SL9 A;  1KQM B;  3BUO B;  3FWB A;  3DYE A;  2MBX A;  1ALW A;  3CDN A;  1TRF A;  4P5O E;  2HQW A;  1C3Z A;  3BUM B;  2CT9 A;  1V1F A;  1YUS A;  2GGM A;  2I7A A;  2K8M B;  4GNK B;  3S0F A;  1F8H A;  2LLU A;  1GGW A;  1QVI Y;  4U8D A;  2GV5 A;  1IWQ A;  1WDC C;  4JPZ B;  1FBV A;  2FCD A;  5J3X A;  1BLQ A;  2Y1N A;  5HKY A;  1KSO A;  3KO0 A;  3H4S E;  3OP0 A;  2FJY A;  1TOP A;  3ZNI A;  3BOW B;  4MVF A;  3R1P A;  2HQ8 A;  1DQE A;  2COL B;  1FW4 A;  1AUI B;  4MZK A;  3WHT B;  2M1K B;  2OS8 C;  1K93 D;  1CFC A;  1FPW A;  3ICB A;  4OKH A;  2L0P A;  3OB2 B;  2Y1M A;  1B9A A;  1DEL A;  4C0L A;  1C7W A;  1C3Y A;  2F2P A;  2FCE A;  4PE7 A;  3UO9 A;  3B88 A;  1NSH A;  4DRW A;  2LVK A;  2BL0 B;  2Y5I A;  3I5I C;  1SK6 D;  1XK4 C;  1FF1 A;  2P6B B;  2K0J A;  3KPX A;  1ZOT B;  3GK1 A;  2KI4 B;  4YBH B;  5EL2 A;  1BF5 A;  2WCH A;  3SG6 A;  1N2D A;  3K21 A;  3O4X A;  4XJK A;  1XFW O;  3CZ1 A;  4YGC B;  1TCF A;  2BCX A;  1EH2 A;  3BFA A;  3DF0 B;  2AMI A;  2E6W A;  1B7T Y;  1SL7 A;  1U5I B;  4FQO A;  2LUX A;  1M46 A;  5CSI A;  5D3O A;  3QRX A;  1SY9 A;  1YTZ C;  2K7C A;  1SPY A;  1EJ3 A;  2LM5 A;  1G33 A;  1XA5 A;  3BOW A;  3KHE A;  1SR6 B;  2WOR A;  3CR4 X;  3D0Y B;  5AXI A;  3PJI A;  1H8B A;  5B8I B;  1DJH A;  1Y6W A;  1OOJ A;  3D77 A;  1A75 A;  3CLN A;  5IBW A;  1CDL A;  2KGB C;  1SYM A;  1PAL A;  3B87 A;  4GGF A;  3O78 A;  4WRI A;  3SS4 A;  3WXA A;  3PFV A;  4C0K A;  5I2Q A;  3D75 A;  3PN7 C;  1RFJ A;  2QEB A;  2BCB A;  2K7D A;  5JOL A;  2MLF C;  1M39 A;  2ISD A;  1ALV A;  3PM2 A;  1OMV A;  5HL1 A;  3CGA A;  1CLB A;  3TDZ A;  2L4I A;  1MHO A;  1WDC B;  2WCL A;  1J7O A;  2LHI A;  3LCP C;  3FE9 A;  3VRP A;  2M3W A;  1NP8 A;  2I2R E;  3V2L A;  1S6I A;  3O6B A;  2IS9 A;  3OX5 A;  1L2O C;  3EVU A;  4M2P A;  1TNX A;  1B1G A;  2CBL A;  2CNP A;  1PVA A;  1C7V A;  3SG2 A;  4JD9 A;  1CKK A;  2LMV A;  2KYC A;  3DXL A;  2OS8 B;  5FYX A;  3B86 A;  4N1F A;  1YVL A;  3EKH A;  4GGN A;  4ZCU A;  2JU0 A;  3EVV A;  2WC8 A;  1K94 A;  2M8U A;  2BEC A;  5CSN A;  5KTY A;  1A2X A;  2PAS A;  1EXR A;  1DC1 A;  1BU3 A;  1JF0 A;  1XVJ A;  1S36 A;  2PAL A;  3R1V A;  3DVE A;  3I5I B;  3TS5 B;  2EC6 B;  3SG7 A;  1QIW A;  2Y4Q A;  3TZ1 A;  1BOC A;  1K96 A;  1B8C A;  1TWO A;  4AOM A;  1AJ4 A;  1EG4 A;  3GK4 X;  1KK7 Y;  3SS5 A;  1QV0 A;  1K95 A;  2BCA A;  2JWW A;  2JNX A;  1UHH A;  1DJZ A;  2PMY A;  3NSI A;  5HLO A;  1AP4 A;  1LKJ A;  3EK8 A;  1XFX O;  2WCK A;  1SBJ A;  1NWD A;  1W9Z A;  5DKR A;  1M63 B;  1XO5 A;  2QEV A;  4INX A;  5KSZ A;  3B6X A;  2Q91 A;  4PE1 A;  1WRZ A;  2KI6 C;  4KYN A;  3GOF A;  2LHL A;  1UHJ A;  4F7F A;  1S6J A;  2MRD A;  1SL8 A;  1CTR A;  1REC A;  2F33 A;  3L4L A;  3D74 A;  4E68 A;  3E3R A;  2K7O A;  2V53 A;  3BUX B;  4CFQ A;  1F70 A;  4M2Q A;  3FWC A;  3I5H C;  1OOF A;  1J1E A;  1KWO C;  1PK0 D;  1S5G Y;  5CSF A;  1K8U A;  1L7Z A;  1JFK A;  1Y0V H;  2AAO A;  4PAL A;  4QJ3 B;  4PHN A;  4A4C A;  1LIN A;  2M29 A;  2QEO A;  4FQT A;  1ZMZ A;  2ZND A;  4HSZ A;  1BOD A;  2L5X B;  3VRO A;  1DT7 B;  3GK2 A;  1KK8 C;  1SMG A;  1L2O B;  1OSA A;  1T14 A;  1CMF A; 
#chains in the Genus database with same CATH homology
 2L98 A;  1PSR A;  1DJG A;  1GQM A;  1OZS A;  1QX2 A;  5D69 A;  1F55 A;  4MN0 A;  1KCY A;  1WRK A;  1DF0 B;  1A03 A;  1S1E A;  4WQ2 A;  1JUO A;  2G2B A;  3IQO A;  2M7L A;  2H2K A;  1SCM C;  1ODB A;  2OTG C;  2MJW B;  4NDD A;  3CR2 A;  4CFR A;  1H4B A;  1CLM A;  1RJV A;  1QXP A;  2K2F A;  1NPQ A;  1MXE A;  1D1O A;  2LV7 A;  2LNK A;  4M2O A;  1FI6 A;  2LC5 A;  1CLL A;  2L2E A;  4GPL B;  3VRN A;  1M45 A;  2D8N A;  1F71 A;  1OQP A;  3CS1 A;  3BYA A;  4DCK A;  1UHK A;  4HRH A;  1Y1A A;  2JT3 A;  3I5G C;  1K90 D;  1WLZ A;  1ZUZ A;  4ORA B;  1F4O A;  1N0Y A;  1AK8 A;  1UHN A;  2MLE C;  2R2I A;  1SCV A;  3TDI A;  1EG3 A;  1B8R A;  4I5K A;  1QVI Z;  2SAS A;  2M7N A;  3LLE A;  5DKN A;  1IRJ A;  1J1D A;  1NIW A;  1QX7 A;  1QS7 A;  4P2Y B;  1AHR A;  2HPS A;  3FS7 A;  2LMU A;  3OX6 A;  1TNP A;  1YX7 A;  1UWO A;  1SW8 A;  2HF5 A;  2JT8 A;  1R2U A;  2M1U A;  2VRG A;  2PVB A;  3I5F C;  3NSO A;  4YGE B;  1HT9 A;  1MQ1 A;  2B1U A;  1NX2 A;  1KWO B;  1W7J B;  1BG1 A;  1GGZ A;  3SG4 A;  1CM1 A;  1M31 A;  1PVB A;  4ETO A;  4F0Z B;  4MRY A;  5K89 A;  1E8A A;  3EK7 A;  2F3Z A;  1N65 A;  4GAO A;  1RTP 1;  3PAL A;  2WOS A;  3NSL A;  1YUU A;  2CCM A;  2A4J A;  4N5X A;  3AKA A;  2EGD A;  3A4U B;  1BJF A;  3DF0 A;  2I94 A;  2MHH A;  1DVI A;  1DMO A;  1CFD A;  2GGZ A;  4HRG A;  5AAN A;  4PHJ A;  1CDP A;  1U5I A;  5HYD A;  3JVT C;  1F4Q A;  3EK4 A;  1IQ5 A;  1SCM B;  2OTG B;  2H61 A;  1B7T Z;  3D0Y A;  4YI8 A;  1KFU S;  3TDU A;  4JQ0 D;  2L4H A;  2WCE A;  3CTN A;  3LK0 A;  4HRE E;  1J7Q A;  1KSM A;  1W7I B;  1IJ6 A;  2FJU B;  3IQQ A;  2CXJ A;  3EKJ A;  5HKW A;  1R6P A;  1MWN A;  2ZN9 A;  3SIB A;  5ER5 A;  3LL8 B;  3OB1 B;  2O5G A;  2LLS A;  4BY4 A;  2ZKM X;  4QJ5 B;  5TNC A;  4YGD B;  2KDH A;  1NCX A;  4TNC A;  1V1G A;  4GFT A;  4ICB A;  1EL4 A;  1K9P A;  1OMR A;  2JUL A;  1LA0 A;  2MAZ A;  3SJS A;  4OCI A;  1OZO A;  1C07 A;  2LP2 A;  3D10 A;  4CID A;  2WND A;  3I5G B;  1QIV A;  2ZRT A;  4WQ3 A;  1KFU L;  2PSR A;  2BBM A;  2BE6 A;  5I2L A;  4MEW A;  1B47 A;  4BY5 A;  2DOQ A;  2QPT A;  1K2H A;  2JZI A;  1DGU A;  1JFJ A;  3WNX B;  1JSA A;  1A4P A;  4NQG A;  1J7P A;  2TN4 A;  1YUT A;  1NYA A;  4MBE A;  2F8P A;  4GGF C;  2CTN A;  3TUY C;  1YUR A;  5KU1 A;  4DUQ A;  2JC2 A;  1SNL A;  1YRU B;  3I5F B;  1MR8 A;  3O2P A;  1S26 D;  1QV1 A;  3DVK A;  3SG5 A;  1CM4 A;  5ER4 X;  1LA3 A;  3PN7 B;  3RLZ A;  1F54 A;  4PHK A;  2K2A A;  4DS7 A;  1Y1U A;  1VRK A;  4YRU A;  2PRU A;  2ZRS A;  1XK4 A;  2BBN A;  1TIZ A;  2JOJ A;  2RGI A;  2KFH A;  3OHM B;  1G8I A;  1PUL A;  2KAY A;  3A8R A;  1NX3 A;  2LAN A;  2KI6 D;  4I5J A;  1PSB A;  4MRX A;  2JTZ A;  3AAJ A;  3ZWH A;  1LXF C;  1GJY A;  2BKI B;  1OMD A;  5HKZ A;  3DD4 A;  3C1V A;  2NLN A;  4QJ4 B;  2LE9 B;  3JVT B;  1KK7 Z;  3RM1 A;  1CNP A;  1CFF A;  3PLF B;  1UHI A;  2JPT A;  2L51 A;  2NCP A;  4ORC B;  1WRL A;  2LP3 A;  3MSE B;  1XYD A;  1S3P A;  1QJT A;  2AUC A;  1QAT A;  3KEV A;  1SKT A;  5F6T A;  1TNQ A;  4GUK A;  5HLV A;  1QAS A;  1BR4 B;  1QLS A;  2F3Y A;  1NX0 A;  1YVH A;  2KFF A;  2LUC A;  2LAP A;  1TCO B;  4PE0 A;  1DTL A;  2KBM A;  2JXL A;  2EHB A;  1MXL C;  4XJK B;  2FOT A;  1KFX S;  2KNE A;  1TN4 A;  5BPJ A;  2JQ6 A;  5I8N A;  2KQ6 A;  2MA2 A;  4XYN A;  2L50 A;  2NXQ A;  4R1E A;  1S5G Z;  4DIR A;  2HET A;  2KSP A;  5AEQ A;  3JTD C;  1FI5 A;  2M0R A;  3CWG A;  1J55 A;  5CPV A;  4ZCV A;  1XFZ O;  5AFP A;  1BR1 B;  3BQ3 A;  1PRW A;  4PE4 A;  5AER A;  1XFV O;  4MSP A;  1A75 B;  2I18 A;  3VRR A;  3TUY B;  1DF0 A;  4AQI A;  1YRT B;  1KFX L;  1IH0 A;  1SRA A;  1IGV A;  1OE9 B;  2K61 A;  3EVR A;  1ZAC A;  4NDC A;  4OV2 A;  1AJ5 A;  3DVJ A;  1MUX A;  1RWY A;  2KFG A;  4Q04 A;  3TS5 C;  3SG3 A;  3PAT A;  2EC6 C;  1JBA A;  3I5H B;  4YGA A;  3PM8 A;  1B8L A;  1BMO A;  1G4Y R;  3PSR A;  4UPG A;  4D1E A;  2JNF A;  2E30 A;  3HX4 A;  3IF7 A;  1TNW A;  1DJW A;  2KBI A;  4PHM A;  3F45 A;  4IL1 A;  3SIA A;  1KK8 B;  2M49 B;  1K9K A;  4YI9 A;  4PDZ A;  1LVC D;  4I5L B;  1UUS A;  1AVS A;  1UP5 A;  1BT6 A;  2LVI A;  1NCZ A;  4A4B A;  5CSJ A;  2KAX A;  2M97 A;  1JWD A;  2KQY A;  2KAV A;  2M9G A;  2NCO A;  2F2O A;  2ZNE A;  3BUW B;  3KF9 A;  1DGV A;  2O60 A;  3VRQ A;  1WLM A;  3HCM A;  1Q80 A;  5D7F A;  5I2O A;  4MZL A;  2WCB A;  3CZT X;  1RK9 A;  3CR5 X;  1KQM C;  2LCP A;  4AQJ A;  1TTX A;  1IG5 A;  1UUR A;  2JT0 A;  3VGO A;  4I5N B;  3DVM A;  1Y1X A;  5GQQ C;  2JXC A;  1ZFS A;  1YR5 A;  1CDM A;  3JTD B;  2LVJ A;  2NZ0 A;  1QTX A;  4USL A;  1CB1 A;  1XFY O;  1S6C A;  1JC2 A;  1J7R A;  1DJY A;  4FTG A;  1YX8 A;  2ZFD A;  2JTT A;  4C0J A;  1A29 A;  1DJX A;  1QLK A;  2QAC A;  2G9B A;  3WHU B;  1NUB A;  3AAK A;  1IKU A;  4NDB A;  1B4C A;  1NX1 A;  1CMG A;  1HQV A;  4OR9 B;  4CPV A;  2SCP A;  1JF2 A;  2LMT A;  5G08 A;  1WY9 A;  4MLW A;  1X02 A;  5DKQ A;  1CFP A;  3BUN B;  1RRO A;  4YGB B;  2BL0 C;  2OPO A;  1IJ5 A;  1XFU O;  2KI4 C;  4GBA A;  1MF8 B;  2LLT A;  1IQ3 A;  4CLN A;  2BKH B;  2WCF A;  2KOT A;  4JWQ A;  1K9U A;  4N1G A;  4ORB B;  5JJG A;  1KQV A;  4L9M A;  2KYF A;  3NSK A;  5PAL A;  2KGR A;  1SR6 C;  2BE4 A;  1QX5 B;  2H61 C;  4PCW A;  1NCY A;  1DJI A;  2JRF A;  2K7B A;  2ZN8 A;  3M0W A;  3O4Y A;  3AKB A;  3FIA A;  2Q4U A;  3LK1 A;  3NXA A;  4MZJ A;  1CDN A;  2KHN A;  2LVV A;  4OVN F;  3BXK A;  1SL9 A;  1KQM B;  3BUO B;  3FWB A;  2MBX A;  1ALW A;  1TRF A;  4P5O E;  2HQW A;  3BUM B;  2CT9 A;  1V1F A;  1YUS A;  2GGM A;  2I7A A;  2K8M B;  4GNK B;  1F8H A;  2LLU A;  1GGW A;  1QVI Y;  4U8D A;  2GV5 A;  1IWQ A;  1WDC C;  4JPZ B;  1FBV A;  2FCD A;  5J3X A;  1BLQ A;  2Y1N A;  5HKY A;  1KSO A;  3KO0 A;  3H4S E;  3OP0 A;  1TOP A;  3ZNI A;  3BOW B;  4MVF A;  2HQ8 A;  2COL B;  1FW4 A;  1AUI B;  4MZK A;  3WHT B;  2M1K B;  2OS8 C;  1K93 D;  1CFC A;  1FPW A;  3ICB A;  4OKH A;  2L0P A;  3OB2 B;  2Y1M A;  1B9A A;  4C0L A;  1C7W A;  2F2P A;  2FCE A;  4PE7 A;  4DRW A;  1NSH A;  2LVK A;  2BL0 B;  2Y5I A;  3I5I C;  1SK6 D;  1XK4 C;  1FF1 A;  2P6B B;  2K0J A;  3KPX A;  1ZOT B;  3GK1 A;  2KI4 B;  4YBH B;  1BF5 A;  3SG6 A;  1N2D A;  3K21 A;  4XJK A;  1XFW O;  4YGC B;  1TCF A;  2BCX A;  1EH2 A;  3DF0 B;  2AMI A;  2E6W A;  1B7T Y;  1SL7 A;  1U5I B;  4FQO A;  2LUX A;  1M46 A;  5CSI A;  3QRX A;  1SY9 A;  1YTZ C;  2K7C A;  1SPY A;  1EJ3 A;  2LM5 A;  1G33 A;  1XA5 A;  3BOW A;  3KHE A;  1SR6 B;  2WOR A;  3CR4 X;  3D0Y B;  5AXI A;  1H8B A;  5B8I B;  1DJH A;  1Y6W A;  1OOJ A;  1A75 A;  3CLN A;  5IBW A;  1CDL A;  2KGB C;  1SYM A;  1PAL A;  4GGF A;  4WRI A;  3O78 A;  3WXA A;  4C0K A;  5I2Q A;  3PFV A;  3PN7 C;  1RFJ A;  2BCB A;  2K7D A;  5JOL A;  2MLF C;  1M39 A;  2ISD A;  1ALV A;  1OMV A;  3CGA A;  1CLB A;  3TDZ A;  2L4I A;  1MHO A;  1WDC B;  1J7O A;  2LHI A;  3LCP C;  3VRP A;  2M3W A;  1NP8 A;  2I2R E;  1S6I A;  3O6B A;  2IS9 A;  3OX5 A;  1L2O C;  3EVU A;  4M2P A;  1TNX A;  1B1G A;  2CBL A;  2CNP A;  1PVA A;  1C7V A;  3SG2 A;  1CKK A;  2LMV A;  2KYC A;  2OS8 B;  5FYX A;  4N1F A;  1YVL A;  3EKH A;  4GGN A;  4ZCU A;  2JU0 A;  3EVV A;  2WC8 A;  1K94 A;  2M8U A;  2BEC A;  5CSN A;  5KTY A;  1A2X A;  2PAS A;  1EXR A;  1BU3 A;  1JF0 A;  1XVJ A;  1S36 A;  2PAL A;  3TS5 B;  3DVE A;  3I5I B;  2EC6 B;  3SG7 A;  1QIW A;  2Y4Q A;  3TZ1 A;  1BOC A;  1K96 A;  1B8C A;  4AOM A;  1AJ4 A;  1EG4 A;  3GK4 X;  1KK7 Y;  1QV0 A;  1K95 A;  2BCA A;  2JWW A;  2JNX A;  1UHH A;  1DJZ A;  2PMY A;  3NSI A;  5HLO A;  1AP4 A;  1LKJ A;  3EK8 A;  1XFX O;  1SBJ A;  1NWD A;  5DKR A;  1M63 B;  1XO5 A;  5KSZ A;  2Q91 A;  4PE1 A;  1WRZ A;  2KI6 C;  3GOF A;  2LHL A;  1UHJ A;  1S6J A;  2MRD A;  1SL8 A;  1CTR A;  1REC A;  2F33 A;  4E68 A;  3E3R A;  2K7O A;  2V53 A;  3BUX B;  4CFQ A;  1F70 A;  4M2Q A;  3FWC A;  3I5H C;  1J1E A;  1KWO C;  1PK0 D;  1S5G Y;  5CSF A;  1K8U A;  1L7Z A;  1JFK A;  1Y0V H;  2AAO A;  4PAL A;  4QJ3 B;  4PHN A;  4A4C A;  1LIN A;  2M29 A;  1ZMZ A;  2ZND A;  4HSZ A;  1BOD A;  2L5X B;  3VRO A;  1DT7 B;  3GK2 A;  1KK8 C;  1SMG A;  1L2O B;  1OSA A;  1CMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...