3LLEA

X-ray structure of bovine sc0322,ca(2+)-s100b
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-B
publication title In vitro screening and structural characterization of inhibitors of the S100B-p53 interaction.
pubmed doi rcsb
source organism Bos taurus
total genus 34
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3lleA00
4GUKA 3NXAA 4DUQA 3PALA 1JF0A 1RROA 5IBWA 4E68A 1LXFC 1IQ5A 4TNCA 4YGBB 1E8AA 1SBJA 2M1UA 1Y6WA 3DVEA 2V53A 2K7OA 3CWGA 3O4YA 1BODA 4FQOA 1KFXL 1XVJA 2LVKA 1QLSA 1WRZA 2KQ6A 2HPSA 3GOFA 1CDNA 2LMTA 2L4HA 1SY9A 1EL4A 1KWOB 2LLSA 3EKHA 2MBXA 3SG6A 1QXPA 1BG1A 2K2FA 1DJZA 3BQ3A 1GGZA 4OKHA 1YRTB 2KFGA 1M63B 4DIRA 3BUMB 2FCDA 3SG7A 4P5OE 2JWWA 1CFFA 2JU0A 2JTTA 4PE0A 2KGRA 4HSZA 2OTGC 5HLOA 2NLNA 1CMGA 4AQIA 4ORBB 2QACA 4C0KA 5J3XA 3PLFB 1NX1A 2ZN9A 3KO0A 1ZOTB 2HQWA 2JNXA 2L2EA 1OE9B 1DTLA 1RWYA 1KQMC 2BL0C 2LP2A 1N65A 4FTGA 4M2PA 1OSAA 1SYMA 2ZN8A 4PHNA 1C7WA 2F2OA 2HQ8A 1N2DA 1S1EA 3AKAA 1NX2A 4MEWA 5DKNA 3SG5A 4YI9A 1K90D 1QX2A 2BBNA 4CPVA 1CB1A 3VROA 2BE6A 4L9MA 4GAOA 1S6IA 3DD4A 1K93D 1PALA 1QIVA 2K7BA 2KAXA 4I5NB 3EVUA 4MLWA 3TZ1A 2LAPA 4ZCUA 1H8BA 3BXKA 1WDCC 3E3RA 1QV1A 2LM5A 1A03A 2OTGB 1JUOA 1XFYO 5ER5A 1G4YR 2PRUA 1HQVA 1KFUL 1QLKA 3EK8A 3DVMA 1JFKA 1CKKA 3I5IC 2JOJA 2F2PA 1QASA 1RK9A 2RGIA 2L98A 1CMFA 1PVBA 1A2XA 2F8PA 4YGCB 1KQMB 2LLTA 3H4SE 4Q04A 1TCFA 1J7RA 1F8HA 1OOJA 1CFDA 1W7IB 4CFQA 1F71A 1NX0A 2OS8C 2JXCA 2ISDA 1FF1A 2SASA 1KK7Z 2ZNDA 2F3YA 1G8IA 2JTZA 4A4CA 3VRPA 4MSPA 2NCPA 1S6CA 1SCMC 1ZUZA 2PASA 4C0JA 1HT9A 3O6BA 4CIDA 3PN7C 1WDCB 1B47A 4YI8A 1OZSA 2M7LA 3SIBA 5I2OA 3DF0A 1IG5A 3OP0A 2LANA 1XFVO 5B8IB 1XFWO 1K96A 3I5IB 1XK4A 2FCEA 4PCWA 5GQQC 3I5FC 1Y1AA 4YGDB 1TNWA 4PHJA 3I5GC 1R2UA 5PALA 1W7JB 1CLLA 2H2KA 3EK4A 4PDZA 2OS8B 3TDUA 2JQ6A 1CTRA 1XK4C 3SJSA 1ZACA 1F70A 1L2OC 2Q4UA 3VRQA 1F4QA 2M3WA 2O5GA 3BUOB 1CNPA 2GGZA 1YRUB 2MHHA 4OV2A 1SCMB 4OCIA 2CTNA 3FWCA 3PN7B 4NDCA 1K95A 2BBMA 4MBEA 1CLMA 2BKIB 1M46A 2BCAA 1B4CA 1XO5A 3O2PA 2R2IA 1EH2A 1GJYA 1QVIY 1WY9A 3AAJA 1MUXA 3I5FB 3EKJA 1UHKA 2Y1MA 3BUNB 1IGVA 3I5GB 4ICBA 4UPGA 1YR5A 1KFXS 5TNCA 1GGWA 4P2YB 1SMGA 2LV7A 1IJ6A 2LUCA 1S26D 3DF0B 3SIAA 4AQJA 1PRWA 3FIAA 1FI5A 1NP8A 2H61A 4YGEB 2BCXA 3CR4X 1SL8A 3JTDC 2WCFA 1L2OB 1OQPA 4BY4A 4MRXA 3BYAA 3CR5X 3KEVA 1XYDA 1QX7A 1B1GA 1LA3A 4PHKA 3FS7A 5AFPA 1TTXA 1DVIA 2H61C 1DJYA 3KPXA 4GFTA 1LVCD 1UHHA 2L50A 2M29A 1MF8B 2CBLA 1TCOB 5BPJA 4MRYA 2MA2A 4NQGA 3DVKA 2G9BA 2D8NA 1B8LA 2WORA 1Y1UA 3A8RA 1F54A 4ORCB 2QPTA 1YUSA 4D1EA 5I2QA 2KAVA 1DF0A 2KOTA 2L51A 2K8MB 3JTDB 4PE7A 2JT8A 2NZ0A 1K9UA 5F6TA 3KF9A 2E6WA 1S6JA 2I18A 2JT0A 3OB2B 1CFCA 2I7AA 1LINA 1Y0VH 1SPYA 1B8CA 2JXLA 3RLZA 2KBMA 2HETA 2IS9A 1IRJA 3IQOA 1BR1B 4PALA 4BY5A 4YRUA 1BJFA 1CDLA 1Q80A 2PALA 1QIWA 3OX5A 3CLNA 1AVSA 1AK8A 1PVAA 1DJGA 1B7TY 1CLBA 2JZIA 4C0LA 4GGNA 1KFUS 1AJ5A 1MQ1A 4ORAB 1AP4A 4DS7A 5CSJA 1JFJA 1C7VA 1MHOA 2M9GA 4HRGA 2M97A 2LVJA 2LMVA 1X02A 1A75A 1A29A 2M8UA 2GV5A 1MXEA 2E30A 3TDIA 2COLB 1XFXO 2Y1NA 1VRKA 2OPOA 1FW4A 5CSNA 3ZNIA 1DF0B 3C1VA 4WQ2A 1FBVA 3M0WA 2ZRSA 1OZOA 2I94A 3D0YA 1NIWA 4JPZB 3HX4A 1ZMZA 2MAZA 1WRKA 2KNEA 4NDDA 1V1GA 2F33A 2HF5A 1CM1A 3F45A 4PE4A 1PSRA 3PM8A 3GK4X 4MN0A 2CCMA 1PK0D 5CSIA 1U5IA 1C07A 1QV0A 2LLUA 3CS1A 4JWQA 1XA5A 2LUXA 3A4UB 4PE1A 1CDMA 3I5HC 3TDZA 4QJ5B 2M7NA 5KU1A 3OHMB 4XYNA 5I8NA 1CFPA 1WLZA 2PVBA 1DJWA 1A75B 2WOSA 1NCXA 2NXQA 1LKJA 2BKHB 2KAYA 1TOPA 1H4BA 1TIZA 1AHRA 2LE9B 5AEQA 1M31A 2B1UA 1UURA 1SR6B 1QJTA 2PSRA 2EGDA 2BE4A 2KYFA 2KSPA 1J1DA 1TNXA 1J7OA 4NDBA 1UP5A 4F0ZB 4QJ4B 1S3PA 5G08A 1S36A 1JWDA 1NWDA 3PATA 1IKUA 1WRLA 2WNDA 5KSZA 1IJ5A 3WNXB 4AOMA 2I2RE 1QVIZ 1YVLA 2KYCA 3I5HB 1SNLA 4N1FA 2FJUB 1DJXA 1YUUA 2LVIA 1A4PA 1BF5A 2L4IA 2KBIA 1J1EA 1YX7A 3LK1A 1QX5B 2KQYA 3CGAA 2TN4A 2JULA 1FPWA 2JPTA 1TRFA 1Y1XA 1DGUA 4MZLA 3RM1A 1NUBA 5DKQA 1DJIA 1KCYA 3LCPC 1BOCA 2LVVA 2LCPA 2P6BB 4N5XA 3VRRA 2GGMA 3QRXA 3O78A 3EVVA 1NPQA 1UHJA 2EHBA 1KK8B 2JRFA 3SG2A 1J7PA 1K2HA 3NSIA 5JJGA 4OVNF 5AXIA 4WQ3A 1S5GY 1XFZO 2ZKMX 3BOWA 3D10A 3CR2A 2Y4QA 2LHLA 1V1FA 3BUXB 3SG3A 1EG3A 2L5XB 3FWBA 1RECA 2K2AA 2LNKA 1MXLC 3GK1A 4GNKB 3AKBA 4HREE 2DOQA 2JNFA 5JOLA 2AMIA 5K89A 3EK7A 1NCZA 1TNQA 2LHIA 1ODBA 4GGFA 5I2LA 1SL9A 2WCEA 1TNPA 3ICBA 1WLMA 4YGAA 3WHUB 1AJ4A 2MJWB 1NX3A 3TUYB 1OMRA 3CTNA 5HKZA 4WRIA 4YBHB 1ALWA 3VGOA 2WCBA 4GGFC 4ZCVA 4MVFA 2M49B 3MSEB 5D69A 1K9KA 1OMDA 2CXJA 1B7TZ 1B9AA 4M2QA 3TS5C 1BMOA 2KDHA 1NCYA 4MZJA 1M45A 4IL1A 2LC5A 1RTP1 2KHNA 1G33A 1M39A 2CT9A 4N1GA 2K7CA 3WHTB 3LL8B 2NCOA 4MZKA 2ZRTA 2A4JA 4XJKA 1DGVA 1JF2A 3BOWB 1BLQA 1QTXA 5FYXA 2KI4C 1FI6A 2LMUA 3NSLA 1JBAA 1GQMA 1EG4A 1D1OA 4CLNA 2VRGA 2MRDA 2K7DA 3IQQA 3JVTC 3NSOA 5CPVA 2BECA 5DKRA 1F4OA 4U8DA 1PSBA 5HKYA 5CSFA 1MWNA 1J7QA 1K8UA 2PMYA 1DMOA 1DJHA 2JC2A 3PSRA 1OMVA 3HCMA 2KFHA 2M1KB 5ER4X 3SG4A 2KFFA 4HRHA 5D7FA 3TS5B 4I5KA 4A4BA 5AERA 2EC6C 1B8RA 3LLEA 2O60A 2Y5IA 4I5JA 1SR6C 1MR8A 1NSHA 2MLEC 2ZNEA 4JQ0D 4GPLB 3K21A 4PHMA 4USLA 2L0PA 1IQ3A 1YTZC 1LA0A 2KI4B 4I5LB 1K9PA 4R1EA 3OX6A 2AAOA 1BR4B 3KHEA 1ALVA 2BL0B 1NYAA 1IWQA 1YUTA 1BU3A 2AUCA 1YURA 1JC2A 3JVTB 4XJKB 1CDPA 2CNPA 3LK0A 2M0RA 2WC8A 3WXAA 1F55A 3VRNA 2K61A 1UHNA 1IH0A 1KK7Y 1SRAA 2KGBC 4GBAA 2K0JA 1EJ3A 1L7ZA 1SW8A 2G2BA 3ZWHA 1UWOA 1QS7A 2EC6B 2BCBA 1ZFSA 2SCPA 5HLVA 1KK8C 2Q91A 4QJ3B 1KSOA 2ZFDA 4OR9B 4DRWA 1KSMA 1TN4A 2KI6C 3D0YB 2MLFC 1KQVA 5AANA 2KI6D 4M2OA 1N0YA 1SL7A 3CZTX 5KTYA 1SKTA 2JT3A 5HKWA 1J55A 4CFRA 4DCKA 1RJVA 2F3ZA 3IF7A 1YX8A 1EXRA 3NSKA 1U5IB 3PFVA 1SK6D 4ETOA 3BUWB 1XFUO 3OB1B 5HYDA 1RFJA 3TUYC 1PULA 1SCVA 1KWOC 1JSAA 1QATA 1CM4A 3GK2A 1S5GZ 3AAKA 1K94A 1R6PA 1UUSA 1YVHA 1BT6A 3EVRA 2FOTA 1DT7B 3DVJA 1UHIA 2LP3A 1AUIB
chains in the Genus database with same CATH superfamily
4GUKA 3NXAA 4KYNA 4DUQA 3PALA 1JF0A 1RROA 5IBWA 4E68A 1LXFC 3FE9A 1IQ5A 4TNCA 4YGBB 1E8AA 1SBJA 2QEBA 2M1UA 1Y6WA 3DVEA 2V53A 1SSEB 2K7OA 1TUJA 3CWGA 3O4YA 1BODA 4FQOA 1KFXL 1XVJA 2LVKA 1QLSA 1WRZA 2KQ6A 2HPSA 3GOFA 3NHIA 2LMTA 2L4HA 1SY9A 1EL4A 1KWOB 2LLSA 3EKHA 2MBXA 3SG6A 1QXPA 4F7FA 1BG1A 2K2FA 1DJZA 3BFAA 3BQ3A 1GGZA 4OKHA 1YRTB 2KFGA 3VB1A 1M63B 4DIRA 3BUMB 2FCDA 3SG7A 5I94A 2PQLA 4P5OE 2JWWA 1CFFA 2JU0A 2JTTA 2WCHA 4PE0A 2KGRA 4HSZA 2OTGC 5HLOA 2NLNA 1CMGA 2QDIA 4AQIA 4ORBB 2QACA 4C0KA 5J3XA 3PLFB 1NX1A 2ZN9A 3KO0A 1ZOTB 2HQWA 3K1EA 2JNXA 2L2EA 1OE9B 1DTLA 1RWYA 1KQMC 3DZTA 2BL0C 2LP2A 1N65A 4FTGA 4M2PA 1OSAA 1SYMA 3DYEA 3R72A 3CABA 3UNWA 2WCMA 2ZN8A 1C7WA 2F2OA 2QEHA 4PHNA 2HQ8A 1N2DA 1S1EA 3AKAA 1NX2A 4MEWA 5DKNA 3SG5A 4YI9A 1K90D 1QX2A 2BBNA 4CPVA 1CB1A 3VROA 2BE6A 4L9MA 4GAOA 1S6IA 3DD4A 1K93D 1PALA 1QIVA 2K7BA 2KLDA 3V2LA 2KAXA 4I5NB 3EVUA 4MLWA 3SS4A 3TZ1A 2LAPA 4ZCUA 1H8BA 1DEKA 1WDCC 3BXKA 1QV1A 2LM5A 3E3RA 2OTGB 1DELA 1JUOA 1XFYO 5ER5A 1A03A 1G4YR 2PRUA 1HQVA 1DC1A 1KFUL 1QLKA 3EK8A 3DVMA 1JFKA 1CKKA 3I5IC 2JOJA 2F2PA 1QASA 1RK9A 2RGIA 2L98A 1CMFA 1PVBA 1A2XA 2F8PA 4YGCB 1KQMB 2LLTA 3B86A 3H4SE 4Q04A 1TCFA 1J7RA 1F8HA 1OOJA 1CFDA 1W7IB 4CFQA 1F71A 1NX0A 2OS8C 2JXCA 2ISDA 1FF1A 2SASA 1KK7Z 2ZNDA 2F3YA 2YGUA 1G8IA 2JTZA 5FI2A 4A4CA 3VRPA 4MSPA 3S0AA 2NCPA 1S6CA 1SCMC 1ZUZA 2PASA 4C0JA 1HT9A 3O6BA 4CIDA 3PN7C 1WDCB 1B47A 4YI8A 2BAPA 1OZSA 2M7LA 2WCLA 3SIBA 5I2OA 3DF0A 1IG5A 3OP0A 2LANA 1XFVO 5B8IB 2KPHA 1XFWO 1K96A 3I5IB 1XK4A 2FCEA 4PCWA 5GQQC 3I5FC 1Y1AA 3CZ0A 4YGDB 1TNWA 4PHJA 3I5GC 3CZ2A 1R2UA 5PALA 1W7JB 1CLLA 2H2KA 3EK4A 4PDZA 2OS8B 3PM2A 3TDUA 2JQ6A 1CTRA 1XK4C 3SJSA 1ZACA 1F70A 1OOIX 1L2OC 2P70A 2Q4UA 3VRQA 1F4QA 2M3WA 2O5GA 3BUOB 1CNPA 2GGZA 1YRUB 2MHHA 4OV2A 5EL2A 1SCMB 4OCIA 2CTNA 3FWCA 3FE6A 3PN7B 4NDCA 1K95A 2BBMA 4MBEA 1CLMA 2BKIB 1M46A 2BCAA 1B4CA 1XO5A 3O2PA 3R1OA 2R2IA 1EH2A 1GJYA 1QVIY 1WY9A 3AAJA 2H8VA 1MUXA 3I5FB 3EKJA 1UHKA 2Y1MA 3BUNB 1IGVA 3D75A 3I5GB 4ICBA 4UPGA 1YR5A 1KFXS 5TNCA 1GGWA 2WCJA 4P2YB 1SMGA 2LV7A 1IJ6A 2LUCA 1S26D 3DF0B 3SIAA 4AQJA 1PRWA 3FIAA 1FI5A 1NP8A 2H61A 4YGEB 2BCXA 3CR4X 1SL8A 3JTDC 3DXLA 2WCFA 1L2OB 1OQPA 4BY4A 4MRXA 3BYAA 3CR5X 3KEVA 1XYDA 1QX7A 1B1GA 1LA3A 4PHKA 3FS7A 5AFPA 5HL1A 1TTXA 1DVIA 2H61C 1DJYA 3KPXA 4GFTA 1LVCD 1UHHA 2L50A 4PT1A 1CDNA 2M29A 5FI6A 1MF8B 3L4LA 2CBLA 1TCOB 5BPJA 4MRYA 2MA2A 4NQGA 3DVKA 2G9BA 2D8NA 1B8LA 2WORA 3BFHA 1Y1UA 3A8RA 1F54A 4ORCB 2QPTA 1YUSA 3S0DA 3R1PA 4D1EA 5I2QA 2KAVA 1DF0A 2KOTA 2L51A 2K8MB 3JTDB 4PE7A 2JT8A 2NZ0A 1K9UA 5F6TA 3KF9A 4JD9A 2E6WA 1S6JA 2I18A 2JT0A 3IVTA 3OB2B 1CFCA 2I7AA 1LINA 1Y0VH 1SPYA 1B8CA 2JXLA 2WC6A 2KBMA 3RLZA 2HETA 2IS9A 1IRJA 3IQOA 3OGNA 1BR1B 4PALA 4BY5A 4YRUA 1BJFA 1CDLA 1Q80A 2PALA 1QIWA 3OX5A 3B6XA 3CLNA 1AVSA 1AK8A 1PVAA 1DJGA 1B7TY 4JKTA 1CLBA 2JZIA 4C0LA 4GGNA 1KFUS 1AJ5A 1MQ1A 3FE8A 4ORAB 1AP4A 4DS7A 5CSJA 1JFJA 1C7VA 1MHOA 1C3ZA 1W9ZA 2M9GA 4HRGA 2M97A 2LVJA 2LMVA 1X02A 1A75A 4INWA 3D78A 1A29A 2M8UA 2GV5A 2QEVA 3B88A 1MXEA 2E30A 3TDIA 2COLB 1XFXO 2Y1NA 3L4AA 2GTEA 1VRKA 1Z2CB 2OPOA 1FW4A 5CSNA 3DY9A 3ZNIA 1DF0B 3C1VA 4WQ2A 1FBVA 3M0WA 2ZRSA 3N7HA 1OZOA 2I94A 3D0YA 3EG5B 1NIWA 4JPZB 3HX4A 1ZMZA 2MAZA 1WRKA 2KNEA 4NDDA 1V1GA 2KLEA 2F33A 2HF5A 1CM1A 3F45A 4PE4A 1PSRA 3PM8A 3GK4X 4MN0A 2CCMA 1PK0D 5CSIA 2L2CA 1U5IA 1C07A 1QV0A 2LLUA 3CS1A 4JWQA 1XA5A 2LUXA 3A4UB 4PE1A 1CDMA 3I5HC 3TDZA 4QJ5B 2M7NA 3S0FA 5KU1A 3OHMB 4XYNA 5I8NA 1CFPA 1WLZA 2PVBA 1DJWA 1A75B 2WOSA 1NCXA 2NXQA 1LKJA 2BKHB 2KAYA 1TOPA 1H4BA 1TIZA 1AHRA 2LE9B 5AEQA 1M31A 2B1UA 1UURA 1SR6B 1QJTA 2PSRA 2EGDA 2BE4A 2KYFA 2KSPA 1J1DA 1TNXA 2WC5A 4NDBA 1J7OA 1UP5A 4F0ZB 1TUZA 1S3PA 5G08A 1S36A 4QJ4B 1JWDA 3CYZA 1NWDA 3PATA 1IKUA 1WRLA 2WNDA 5KSZA 1IJ5A 1DQEA 3BFBA 3WNXB 3R1VA 4AOMA 2I2RE 1QVIZ 1YVLA 2KYCA 3I5HB 3Q8IA 1SNLA 4N1FA 2FJUB 1DJXA 1YUUA 2LVIA 1A4PA 1BF5A 2L4IA 2KBIA 1J1EA 1YX7A 3LK1A 1QX5B 3UO9A 1C3YA 2KQYA 3CGAA 3SS5A 2TN4A 2JULA 1FPWA 2JPTA 1TRFA 1Y1XA 1DGUA 2P71A 4MZLA 1NUBA 1P28A 5DKQA 3RM1A 1DJIA 1KCYA 3LCPC 1BOCA 2LVVA 2LCPA 2P6BB 4N5XA 3VRRA 2GGMA 3QRXA 2QEOA 3D77A 3O78A 3EVVA 1NPQA 1UHJA 2EHBA 1KK8B 2JRFA 3SG2A 1J7PA 1K2HA 3NSIA 5JJGA 4OVNF 5AXIA 4WQ3A 1LS8A 1S5GY 4INXA 1XFZO 2ZKMX 3BOWA 3D10A 3CR2A 2Y4QA 2LHLA 1V1FA 3BUXB 3SG3A 1EG3A 2L5XB 3FWBA 1RECA 2JPOA 2K2AA 2K60A 1MXLC 2LNKA 3GK1A 3CDNA 4GNKB 3AKBA 4HREE 2DOQA 2JNFA 5JOLA 3SS3A 2L5YA 2AMIA 5K89A 3EK7A 1NCZA 1ORGA 1TNQA 2LHIA 1ODBA 4GGFA 5I2LA 1SL9A 2WCEA 1TNPA 3ICBA 1WLMA 4YGAA 3WHUB 2FJYA 1AJ4A 2MJWB 1NX3A 3TUYB 5D3OA 1XFRA 1OMRA 3CTNA 5HKZA 4WRIA 1OW4A 4YBHB 1ALWA 3VGOA 5FI7A 2WCBA 4GGFC 4ZCVA 4MVFA 3D73A 2M49B 3MSEB 5D69A 1K9KA 1TWOA 1OMDA 2CXJA 1B7TZ 1B9AA 4M2QA 4OZDA 3TS5C 1BMOA 2KDHA 1NCYA 4MZJA 1M45A 4IL1A 2LC5A 1RTP1 2KHNA 1G33A 1M39A 2CT9A 4N1GA 2K7CA 3WHTB 3LL8B 2NCOA 4MZKA 2ZRTA 2A4JA 4XJKA 1DGVA 1JF2A 3BOWB 1BLQA 1QTXA 5FYXA 2KI4C 1FI6A 3NGVA 2LMUA 3NSLA 1JBAA 1IIOA 1GQMA 1EG4A 3D74A 2BNXA 4CLNA 1D1OA 2VRGA 2MRDA 2K7DA 3IQQA 3JVTC 3NSOA 5CPVA 2BECA 5DKRA 1F4OA 4U8DA 1PSBA 5HKYA 5CSFA 1MWNA 1J7QA 1K8UA 2PMYA 1DMOA 1DJHA 2JC2A 3PSRA 1OMVA 3HCMA 2KFHA 2M1KB 3L47A 5ER4X 2KFFA 4HRHA 3SG4A 5D7FA 3TS5B 4I5KA 2WCKA 4A4BA 5AERA 2EC6C 1B8RA 3LLEA 2O60A 2Y5IA 3D76A 4I5JA 1SR6C 1MR8A 1NSHA 2MLEC 2ZNEA 4JQ0D 4GPLB 3K21A 4PHMA 4USLA 2L0PA 1IQ3A 3S0GA 1OOHA 1LA0A 1YTZC 2KI4B 4I5LB 1K9PA 4R1EA 3OX6A 2AAOA 1BR4B 3BJHA 3RZSA 3KHEA 1ALVA 2BL0B 1NYAA 1IWQA 1YUTA 1BU3A 2AUCA 1YURA 3QMEA 3S0EA 3JVTB 1JC2A 2PYQA 4XJKB 3S0BA 1CDPA 2CNPA 3LK0A 2M0RA 2WC8A 3WXAA 1F55A 3VRNA 4FQTA 2K61A 1UHNA 1IH0A 1KK7Y 1SRAA 1Z4HA 2KGBC 4GBAA 2K0JA 1EJ3A 1L7ZA 1SW8A 2G2BA 3ZWHA 1UWOA 1QS7A 2EC6B 2BCBA 1ZFSA 2SCPA 5HLVA 1KK8C 1QWVA 2Q91A 4QJ3B 1KSOA 2ZFDA 4OR9B 5DICA 4DRWA 1KSMA 1TN4A 2KI6C 3D0YB 3NHTA 2MLFC 1KQVA 5AANA 2KI6D 4M2OA 1N0YA 1SL7A 3CZTX 4IJ7A 5KTYA 1SKTA 2JT3A 5HKWA 1GM0A 1T14A 1J55A 4CFRA 4DCKA 1RJVA 2F3ZA 3IF7A 3O4XA 1YX8A 1EXRA 3NSKA 1U5IB 2ERBA 3PFVA 1SK6D 4ETOA 3BUWB 1XFUO 1OOGA 3CZ1A 3OB1B 5HYDA 1RFJA 3TUYC 1PULA 1SCVA 1KWOC 1OOFA 1JSAA 1QATA 1CM4A 3GK2A 1S5GZ 3AAKA 3B7AA 1K94A 1R6PA 1UUSA 1YVHA 1BT6A 3EVRA 3PJIA 2FOTA 3B87A 3OBVA 1DT7B 3DVJA 1UHIA 2LP3A 1AUIB
chains in the Genus database with same CATH topology
4GUKA 3NXAA 4DUQA 3PALA 1JF0A 1RROA 5IBWA 4E68A 1LXFC 1IQ5A 4TNCA 4YGBB 1E8AA 1SBJA 2M1UA 1Y6WA 3DVEA 2V53A 2K7OA 3CWGA 3O4YA 1BODA 4FQOA 1KFXL 1XVJA 2LVKA 1QLSA 1WRZA 2KQ6A 2HPSA 3GOFA 1CDNA 2LMTA 2L4HA 1SY9A 1EL4A 1KWOB 2LLSA 3EKHA 2MBXA 3SG6A 1QXPA 1BG1A 2K2FA 1DJZA 3BQ3A 1GGZA 4OKHA 1YRTB 2KFGA 1M63B 4DIRA 3BUMB 2FCDA 3SG7A 4P5OE 2JWWA 1CFFA 2JU0A 2JTTA 4PE0A 2KGRA 4HSZA 2OTGC 5HLOA 2NLNA 1CMGA 4AQIA 4ORBB 2QACA 4C0KA 5J3XA 3PLFB 1NX1A 2ZN9A 3KO0A 1ZOTB 2HQWA 2JNXA 2L2EA 1OE9B 1DTLA 1RWYA 1KQMC 2BL0C 2LP2A 1N65A 4FTGA 4M2PA 1OSAA 1SYMA 2ZN8A 4PHNA 1C7WA 2F2OA 2HQ8A 1N2DA 1S1EA 3AKAA 1NX2A 4MEWA 5DKNA 3SG5A 4YI9A 1K90D 1QX2A 2BBNA 4CPVA 1CB1A 3VROA 2BE6A 4L9MA 4GAOA 1S6IA 3DD4A 1K93D 1PALA 1QIVA 2K7BA 2KAXA 4I5NB 3EVUA 4MLWA 3TZ1A 2LAPA 4ZCUA 1H8BA 3BXKA 1WDCC 3E3RA 1QV1A 2LM5A 1A03A 2OTGB 1JUOA 1XFYO 5ER5A 1G4YR 2PRUA 1HQVA 1KFUL 1QLKA 3EK8A 3DVMA 1JFKA 1CKKA 3I5IC 2JOJA 2F2PA 1QASA 1RK9A 2RGIA 2L98A 1CMFA 1PVBA 1A2XA 2F8PA 4YGCB 1KQMB 2LLTA 3H4SE 4Q04A 1TCFA 1J7RA 1F8HA 1OOJA 1CFDA 1W7IB 4CFQA 1F71A 1NX0A 2OS8C 2JXCA 2ISDA 1FF1A 2SASA 1KK7Z 2ZNDA 2F3YA 1G8IA 2JTZA 4A4CA 3VRPA 4MSPA 2NCPA 1S6CA 1SCMC 1ZUZA 2PASA 4C0JA 1HT9A 3O6BA 4CIDA 3PN7C 1WDCB 1B47A 4YI8A 1OZSA 2M7LA 3SIBA 5I2OA 3DF0A 1IG5A 3OP0A 2LANA 1XFVO 5B8IB 1XFWO 1K96A 3I5IB 1XK4A 2FCEA 4PCWA 5GQQC 3I5FC 1Y1AA 4YGDB 1TNWA 4PHJA 3I5GC 1R2UA 5PALA 1W7JB 1CLLA 2H2KA 3EK4A 4PDZA 2OS8B 3TDUA 2JQ6A 1CTRA 1XK4C 3SJSA 1ZACA 1F70A 1L2OC 2Q4UA 3VRQA 1F4QA 2M3WA 2O5GA 3BUOB 1CNPA 2GGZA 1YRUB 2MHHA 4OV2A 1SCMB 4OCIA 2CTNA 3FWCA 3PN7B 4NDCA 1K95A 2BBMA 4MBEA 1CLMA 2BKIB 1M46A 2BCAA 1B4CA 1XO5A 3O2PA 2R2IA 1EH2A 1GJYA 1QVIY 1WY9A 3AAJA 1MUXA 3I5FB 3EKJA 1UHKA 2Y1MA 3BUNB 1IGVA 3I5GB 4ICBA 4UPGA 1YR5A 1KFXS 5TNCA 1GGWA 4P2YB 1SMGA 2LV7A 1IJ6A 2LUCA 1S26D 3DF0B 3SIAA 4AQJA 1PRWA 3FIAA 1FI5A 1NP8A 2H61A 4YGEB 2BCXA 3CR4X 1SL8A 3JTDC 2WCFA 1L2OB 1OQPA 4BY4A 4MRXA 3BYAA 3CR5X 3KEVA 1XYDA 1QX7A 1B1GA 1LA3A 4PHKA 3FS7A 5AFPA 1TTXA 1DVIA 2H61C 1DJYA 3KPXA 4GFTA 1LVCD 1UHHA 2L50A 2M29A 1MF8B 2CBLA 1TCOB 5BPJA 4MRYA 2MA2A 4NQGA 3DVKA 2G9BA 2D8NA 1B8LA 2WORA 1Y1UA 3A8RA 1F54A 4ORCB 2QPTA 1YUSA 4D1EA 5I2QA 2KAVA 1DF0A 2KOTA 2L51A 2K8MB 3JTDB 4PE7A 2JT8A 2NZ0A 1K9UA 5F6TA 3KF9A 2E6WA 1S6JA 2I18A 2JT0A 3OB2B 1CFCA 2I7AA 1LINA 1Y0VH 1SPYA 1B8CA 2JXLA 3RLZA 2KBMA 2HETA 2IS9A 1IRJA 3IQOA 1BR1B 4PALA 4BY5A 4YRUA 1BJFA 1CDLA 1Q80A 2PALA 1QIWA 3OX5A 3CLNA 1AVSA 1AK8A 1PVAA 1DJGA 1B7TY 1CLBA 2JZIA 4C0LA 4GGNA 1KFUS 1AJ5A 1MQ1A 4ORAB 1AP4A 4DS7A 5CSJA 1JFJA 1C7VA 1MHOA 2M9GA 4HRGA 2M97A 2LVJA 2LMVA 1X02A 1A75A 1A29A 2M8UA 2GV5A 1MXEA 2E30A 3TDIA 2COLB 1XFXO 2Y1NA 1VRKA 2OPOA 1FW4A 5CSNA 3ZNIA 1DF0B 3C1VA 4WQ2A 1FBVA 3M0WA 2ZRSA 1OZOA 2I94A 3D0YA 1NIWA 4JPZB 3HX4A 1ZMZA 2MAZA 1WRKA 2KNEA 4NDDA 1V1GA 2F33A 2HF5A 1CM1A 3F45A 4PE4A 1PSRA 3PM8A 3GK4X 4MN0A 2CCMA 1PK0D 5CSIA 1U5IA 1C07A 1QV0A 2LLUA 3CS1A 4JWQA 1XA5A 2LUXA 3A4UB 4PE1A 1CDMA 3I5HC 3TDZA 4QJ5B 2M7NA 5KU1A 3OHMB 4XYNA 5I8NA 1CFPA 1WLZA 2PVBA 1DJWA 1A75B 2WOSA 1NCXA 2NXQA 1LKJA 2BKHB 2KAYA 1TOPA 1H4BA 1TIZA 1AHRA 2LE9B 5AEQA 1M31A 2B1UA 1UURA 1SR6B 1QJTA 2PSRA 2EGDA 2BE4A 2KYFA 2KSPA 1J1DA 1TNXA 1J7OA 4NDBA 1UP5A 4F0ZB 4QJ4B 1S3PA 5G08A 1S36A 1JWDA 1NWDA 3PATA 1IKUA 1WRLA 2WNDA 5KSZA 1IJ5A 3WNXB 4AOMA 2I2RE 1QVIZ 1YVLA 2KYCA 3I5HB 1SNLA 4N1FA 2FJUB 1DJXA 1YUUA 2LVIA 1A4PA 1BF5A 2L4IA 2KBIA 1J1EA 1YX7A 3LK1A 1QX5B 2KQYA 3CGAA 2TN4A 2JULA 1FPWA 2JPTA 1TRFA 1Y1XA 1DGUA 4MZLA 3RM1A 1NUBA 5DKQA 1DJIA 1KCYA 3LCPC 1BOCA 2LVVA 2LCPA 2P6BB 4N5XA 3VRRA 2GGMA 3QRXA 3O78A 3EVVA 1NPQA 1UHJA 2EHBA 1KK8B 2JRFA 3SG2A 1J7PA 1K2HA 3NSIA 5JJGA 4OVNF 5AXIA 4WQ3A 1S5GY 1XFZO 2ZKMX 3BOWA 3D10A 3CR2A 2Y4QA 2LHLA 1V1FA 3BUXB 3SG3A 1EG3A 2L5XB 3FWBA 1RECA 2K2AA 2LNKA 1MXLC 3GK1A 4GNKB 3AKBA 4HREE 2DOQA 2JNFA 5JOLA 2AMIA 5K89A 3EK7A 1NCZA 1TNQA 2LHIA 1ODBA 4GGFA 5I2LA 1SL9A 2WCEA 1TNPA 3ICBA 1WLMA 4YGAA 3WHUB 1AJ4A 2MJWB 1NX3A 3TUYB 1OMRA 3CTNA 5HKZA 4WRIA 4YBHB 1ALWA 3VGOA 2WCBA 4GGFC 4ZCVA 4MVFA 2M49B 3MSEB 5D69A 1K9KA 1OMDA 2CXJA 1B7TZ 1B9AA 4M2QA 3TS5C 1BMOA 2KDHA 1NCYA 4MZJA 1M45A 4IL1A 2LC5A 1RTP1 2KHNA 1G33A 1M39A 2CT9A 4N1GA 2K7CA 3WHTB 3LL8B 2NCOA 4MZKA 2ZRTA 2A4JA 4XJKA 1DGVA 1JF2A 3BOWB 1BLQA 1QTXA 5FYXA 2KI4C 1FI6A 2LMUA 3NSLA 1JBAA 1GQMA 1EG4A 1D1OA 4CLNA 2VRGA 2MRDA 2K7DA 3IQQA 3JVTC 3NSOA 5CPVA 2BECA 5DKRA 1F4OA 4U8DA 1PSBA 5HKYA 5CSFA 1MWNA 1J7QA 1K8UA 2PMYA 1DMOA 1DJHA 2JC2A 3PSRA 1OMVA 3HCMA 2KFHA 2M1KB 5ER4X 3SG4A 2KFFA 4HRHA 5D7FA 3TS5B 4I5KA 4A4BA 5AERA 2EC6C 1B8RA 3LLEA 2O60A 2Y5IA 4I5JA 1SR6C 1MR8A 1NSHA 2MLEC 2ZNEA 4JQ0D 4GPLB 3K21A 4PHMA 4USLA 2L0PA 1IQ3A 1YTZC 1LA0A 2KI4B 4I5LB 1K9PA 4R1EA 3OX6A 2AAOA 1BR4B 3KHEA 1ALVA 2BL0B 1NYAA 1IWQA 1YUTA 1BU3A 2AUCA 1YURA 1JC2A 3JVTB 4XJKB 1CDPA 2CNPA 3LK0A 2M0RA 2WC8A 3WXAA 1F55A 3VRNA 2K61A 1UHNA 1IH0A 1KK7Y 1SRAA 2KGBC 4GBAA 2K0JA 1EJ3A 1L7ZA 1SW8A 2G2BA 3ZWHA 1UWOA 1QS7A 2EC6B 2BCBA 1ZFSA 2SCPA 5HLVA 1KK8C 2Q91A 4QJ3B 1KSOA 2ZFDA 4OR9B 4DRWA 1KSMA 1TN4A 2KI6C 3D0YB 2MLFC 1KQVA 5AANA 2KI6D 4M2OA 1N0YA 1SL7A 3CZTX 5KTYA 1SKTA 2JT3A 5HKWA 1J55A 4CFRA 4DCKA 1RJVA 2F3ZA 3IF7A 1YX8A 1EXRA 3NSKA 1U5IB 3PFVA 1SK6D 4ETOA 3BUWB 1XFUO 3OB1B 5HYDA 1RFJA 3TUYC 1PULA 1SCVA 1KWOC 1JSAA 1QATA 1CM4A 3GK2A 1S5GZ 3AAKA 1K94A 1R6PA 1UUSA 1YVHA 1BT6A 3EVRA 2FOTA 1DT7B 3DVJA 1UHIA 2LP3A 1AUIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GUK A;  3NXA A;  4DUQ A;  3PAL A;  1JF0 A;  1RRO A;  5IBW A;  4E68 A;  1LXF C;  1IQ5 A;  4TNC A;  4YGB B;  1E8A A;  1SBJ A;  2M1U A;  1Y6W A;  3DVE A;  2V53 A;  2K7O A;  3CWG A;  3O4Y A;  1BOD A;  4FQO A;  1KFX L;  1XVJ A;  2LVK A;  1QLS A;  1WRZ A;  2KQ6 A;  2HPS A;  3GOF A;  1CDN A;  2LMT A;  2L4H A;  1SY9 A;  1EL4 A;  1KWO B;  2LLS A;  3EKH A;  2MBX A;  3SG6 A;  1QXP A;  1BG1 A;  2K2F A;  1DJZ A;  3BQ3 A;  1GGZ A;  4OKH A;  1YRT B;  2KFG A;  1M63 B;  4DIR A;  3BUM B;  2FCD A;  3SG7 A;  4P5O E;  2JWW A;  1CFF A;  2JU0 A;  2JTT A;  4PE0 A;  2KGR A;  4HSZ A;  2OTG C;  5HLO A;  2NLN A;  1CMG A;  4AQI A;  4ORB B;  2QAC A;  4C0K A;  5J3X A;  3PLF B;  1NX1 A;  2ZN9 A;  3KO0 A;  1ZOT B;  2HQW A;  2JNX A;  2L2E A;  1OE9 B;  1DTL A;  1RWY A;  1KQM C;  2BL0 C;  2LP2 A;  1N65 A;  4FTG A;  4M2P A;  1OSA A;  1SYM A;  2ZN8 A;  4PHN A;  1C7W A;  2F2O A;  2HQ8 A;  1N2D A;  1S1E A;  3AKA A;  1NX2 A;  4MEW A;  5DKN A;  3SG5 A;  4YI9 A;  1K90 D;  1QX2 A;  2BBN A;  4CPV A;  1CB1 A;  3VRO A;  2BE6 A;  4L9M A;  4GAO A;  1S6I A;  3DD4 A;  1K93 D;  1PAL A;  1QIV A;  2K7B A;  2KAX A;  4I5N B;  3EVU A;  4MLW A;  3TZ1 A;  2LAP A;  4ZCU A;  1H8B A;  3BXK A;  1WDC C;  3E3R A;  1QV1 A;  2LM5 A;  1A03 A;  2OTG B;  1JUO A;  1XFY O;  5ER5 A;  1G4Y R;  2PRU A;  1HQV A;  1KFU L;  1QLK A;  3EK8 A;  3DVM A;  1JFK A;  1CKK A;  3I5I C;  2JOJ A;  2F2P A;  1QAS A;  1RK9 A;  2RGI A;  2L98 A;  1CMF A;  1PVB A;  1A2X A;  2F8P A;  4YGC B;  1KQM B;  2LLT A;  3H4S E;  4Q04 A;  1TCF A;  1J7R A;  1F8H A;  1OOJ A;  1CFD A;  1W7I B;  4CFQ A;  1F71 A;  1NX0 A;  2OS8 C;  2JXC A;  2ISD A;  1FF1 A;  2SAS A;  1KK7 Z;  2ZND A;  2F3Y A;  1G8I A;  2JTZ A;  4A4C A;  3VRP A;  4MSP A;  2NCP A;  1S6C A;  1SCM C;  1ZUZ A;  2PAS A;  4C0J A;  1HT9 A;  3O6B A;  4CID A;  3PN7 C;  1WDC B;  1B47 A;  4YI8 A;  1OZS A;  2M7L A;  3SIB A;  5I2O A;  3DF0 A;  1IG5 A;  3OP0 A;  2LAN A;  1XFV O;  5B8I B;  1XFW O;  1K96 A;  3I5I B;  1XK4 A;  2FCE A;  4PCW A;  5GQQ C;  3I5F C;  1Y1A A;  4YGD B;  1TNW A;  4PHJ A;  3I5G C;  1R2U A;  5PAL A;  1W7J B;  1CLL A;  2H2K A;  3EK4 A;  4PDZ A;  2OS8 B;  3TDU A;  2JQ6 A;  1CTR A;  1XK4 C;  3SJS A;  1ZAC A;  1F70 A;  1L2O C;  2Q4U A;  3VRQ A;  1F4Q A;  2M3W A;  2O5G A;  3BUO B;  1CNP A;  2GGZ A;  1YRU B;  2MHH A;  4OV2 A;  1SCM B;  4OCI A;  2CTN A;  3FWC A;  3PN7 B;  4NDC A;  1K95 A;  2BBM A;  4MBE A;  1CLM A;  2BKI B;  1M46 A;  2BCA A;  1B4C A;  1XO5 A;  3O2P A;  2R2I A;  1EH2 A;  1GJY A;  1QVI Y;  1WY9 A;  3AAJ A;  1MUX A;  3I5F B;  3EKJ A;  1UHK A;  2Y1M A;  3BUN B;  1IGV A;  3I5G B;  4ICB A;  4UPG A;  1YR5 A;  1KFX S;  5TNC A;  1GGW A;  4P2Y B;  1SMG A;  2LV7 A;  1IJ6 A;  2LUC A;  1S26 D;  3DF0 B;  3SIA A;  4AQJ A;  1PRW A;  3FIA A;  1FI5 A;  1NP8 A;  2H61 A;  4YGE B;  2BCX A;  3CR4 X;  1SL8 A;  3JTD C;  2WCF A;  1L2O B;  1OQP A;  4BY4 A;  4MRX A;  3BYA A;  3CR5 X;  3KEV A;  1XYD A;  1QX7 A;  1B1G A;  1LA3 A;  4PHK A;  3FS7 A;  5AFP A;  1TTX A;  1DVI A;  2H61 C;  1DJY A;  3KPX A;  4GFT A;  1LVC D;  1UHH A;  2L50 A;  2M29 A;  1MF8 B;  2CBL A;  1TCO B;  5BPJ A;  4MRY A;  2MA2 A;  4NQG A;  3DVK A;  2G9B A;  2D8N A;  1B8L A;  2WOR A;  1Y1U A;  3A8R A;  1F54 A;  4ORC B;  2QPT A;  1YUS A;  4D1E A;  5I2Q A;  2KAV A;  1DF0 A;  2KOT A;  2L51 A;  2K8M B;  3JTD B;  4PE7 A;  2JT8 A;  2NZ0 A;  1K9U A;  5F6T A;  3KF9 A;  2E6W A;  1S6J A;  2I18 A;  2JT0 A;  3OB2 B;  1CFC A;  2I7A A;  1LIN A;  1Y0V H;  1SPY A;  1B8C A;  2JXL A;  3RLZ A;  2KBM A;  2HET A;  2IS9 A;  1IRJ A;  3IQO A;  1BR1 B;  4PAL A;  4BY5 A;  4YRU A;  1BJF A;  1CDL A;  1Q80 A;  2PAL A;  1QIW A;  3OX5 A;  3CLN A;  1AVS A;  1AK8 A;  1PVA A;  1DJG A;  1B7T Y;  1CLB A;  2JZI A;  4C0L A;  4GGN A;  1KFU S;  1AJ5 A;  1MQ1 A;  4ORA B;  1AP4 A;  4DS7 A;  5CSJ A;  1JFJ A;  1C7V A;  1MHO A;  2M9G A;  4HRG A;  2M97 A;  2LVJ A;  2LMV A;  1X02 A;  1A75 A;  1A29 A;  2M8U A;  2GV5 A;  1MXE A;  2E30 A;  3TDI A;  2COL B;  1XFX O;  2Y1N A;  1VRK A;  2OPO A;  1FW4 A;  5CSN A;  3ZNI A;  1DF0 B;  3C1V A;  4WQ2 A;  1FBV A;  3M0W A;  2ZRS A;  1OZO A;  2I94 A;  3D0Y A;  1NIW A;  4JPZ B;  3HX4 A;  1ZMZ A;  2MAZ A;  1WRK A;  2KNE A;  4NDD A;  1V1G A;  2F33 A;  2HF5 A;  1CM1 A;  3F45 A;  4PE4 A;  1PSR A;  3PM8 A;  3GK4 X;  4MN0 A;  2CCM A;  1PK0 D;  5CSI A;  1U5I A;  1C07 A;  1QV0 A;  2LLU A;  3CS1 A;  4JWQ A;  1XA5 A;  2LUX A;  3A4U B;  4PE1 A;  1CDM A;  3I5H C;  3TDZ A;  4QJ5 B;  2M7N A;  5KU1 A;  3OHM B;  4XYN A;  5I8N A;  1CFP A;  1WLZ A;  2PVB A;  1DJW A;  1A75 B;  2WOS A;  1NCX A;  2NXQ A;  1LKJ A;  2BKH B;  2KAY A;  1TOP A;  1H4B A;  1TIZ A;  1AHR A;  2LE9 B;  5AEQ A;  1M31 A;  2B1U A;  1UUR A;  1SR6 B;  1QJT A;  2PSR A;  2EGD A;  2BE4 A;  2KYF A;  2KSP A;  1J1D A;  1TNX A;  1J7O A;  4NDB A;  1UP5 A;  4F0Z B;  4QJ4 B;  1S3P A;  5G08 A;  1S36 A;  1JWD A;  1NWD A;  3PAT A;  1IKU A;  1WRL A;  2WND A;  5KSZ A;  1IJ5 A;  3WNX B;  4AOM A;  2I2R E;  1QVI Z;  1YVL A;  2KYC A;  3I5H B;  1SNL A;  4N1F A;  2FJU B;  1DJX A;  1YUU A;  2LVI A;  1A4P A;  1BF5 A;  2L4I A;  2KBI A;  1J1E A;  1YX7 A;  3LK1 A;  1QX5 B;  2KQY A;  3CGA A;  2TN4 A;  2JUL A;  1FPW A;  2JPT A;  1TRF A;  1Y1X A;  1DGU A;  4MZL A;  3RM1 A;  1NUB A;  5DKQ A;  1DJI A;  1KCY A;  3LCP C;  1BOC A;  2LVV A;  2LCP A;  2P6B B;  4N5X A;  3VRR A;  2GGM A;  3QRX A;  3O78 A;  3EVV A;  1NPQ A;  1UHJ A;  2EHB A;  1KK8 B;  2JRF A;  3SG2 A;  1J7P A;  1K2H A;  3NSI A;  5JJG A;  4OVN F;  5AXI A;  4WQ3 A;  1S5G Y;  1XFZ O;  2ZKM X;  3BOW A;  3D10 A;  3CR2 A;  2Y4Q A;  2LHL A;  1V1F A;  3BUX B;  3SG3 A;  1EG3 A;  2L5X B;  3FWB A;  1REC A;  2K2A A;  2LNK A;  1MXL C;  3GK1 A;  4GNK B;  3AKB A;  4HRE E;  2DOQ A;  2JNF A;  5JOL A;  2AMI A;  5K89 A;  3EK7 A;  1NCZ A;  1TNQ A;  2LHI A;  1ODB A;  4GGF A;  5I2L A;  1SL9 A;  2WCE A;  1TNP A;  3ICB A;  1WLM A;  4YGA A;  3WHU B;  1AJ4 A;  2MJW B;  1NX3 A;  3TUY B;  1OMR A;  3CTN A;  5HKZ A;  4WRI A;  4YBH B;  1ALW A;  3VGO A;  2WCB A;  4GGF C;  4ZCV A;  4MVF A;  2M49 B;  3MSE B;  5D69 A;  1K9K A;  1OMD A;  2CXJ A;  1B7T Z;  1B9A A;  4M2Q A;  3TS5 C;  1BMO A;  2KDH A;  1NCY A;  4MZJ A;  1M45 A;  4IL1 A;  2LC5 A;  1RTP 1;  2KHN A;  1G33 A;  1M39 A;  2CT9 A;  4N1G A;  2K7C A;  3WHT B;  3LL8 B;  2NCO A;  4MZK A;  2ZRT A;  2A4J A;  4XJK A;  1DGV A;  1JF2 A;  3BOW B;  1BLQ A;  1QTX A;  5FYX A;  2KI4 C;  1FI6 A;  2LMU A;  3NSL A;  1JBA A;  1GQM A;  1EG4 A;  1D1O A;  4CLN A;  2VRG A;  2MRD A;  2K7D A;  3IQQ A;  3JVT C;  3NSO A;  5CPV A;  2BEC A;  5DKR A;  1F4O A;  4U8D A;  1PSB A;  5HKY A;  5CSF A;  1MWN A;  1J7Q A;  1K8U A;  2PMY A;  1DMO A;  1DJH A;  2JC2 A;  3PSR A;  1OMV A;  3HCM A;  2KFH A;  2M1K B;  5ER4 X;  3SG4 A;  2KFF A;  4HRH A;  5D7F A;  3TS5 B;  4I5K A;  4A4B A;  5AER A;  2EC6 C;  1B8R A;  3LLE A;  2O60 A;  2Y5I A;  4I5J A;  1SR6 C;  1MR8 A;  1NSH A;  2MLE C;  2ZNE A;  4JQ0 D;  4GPL B;  3K21 A;  4PHM A;  4USL A;  2L0P A;  1IQ3 A;  1YTZ C;  1LA0 A;  2KI4 B;  4I5L B;  1K9P A;  4R1E A;  3OX6 A;  2AAO A;  1BR4 B;  3KHE A;  1ALV A;  2BL0 B;  1NYA A;  1IWQ A;  1YUT A;  1BU3 A;  2AUC A;  1YUR A;  1JC2 A;  3JVT B;  4XJK B;  1CDP A;  2CNP A;  3LK0 A;  2M0R A;  2WC8 A;  3WXA A;  1F55 A;  3VRN A;  2K61 A;  1UHN A;  1IH0 A;  1KK7 Y;  1SRA A;  2KGB C;  4GBA A;  2K0J A;  1EJ3 A;  1L7Z A;  1SW8 A;  2G2B A;  3ZWH A;  1UWO A;  1QS7 A;  2EC6 B;  2BCB A;  1ZFS A;  2SCP A;  5HLV A;  1KK8 C;  2Q91 A;  4QJ3 B;  1KSO A;  2ZFD A;  4OR9 B;  4DRW A;  1KSM A;  1TN4 A;  2KI6 C;  3D0Y B;  2MLF C;  1KQV A;  5AAN A;  2KI6 D;  4M2O A;  1N0Y A;  1SL7 A;  3CZT X;  5KTY A;  1SKT A;  2JT3 A;  5HKW A;  1J55 A;  4CFR A;  4DCK A;  1RJV A;  2F3Z A;  3IF7 A;  1YX8 A;  1EXR A;  3NSK A;  1U5I B;  3PFV A;  1SK6 D;  4ETO A;  3BUW B;  1XFU O;  3OB1 B;  5HYD A;  1RFJ A;  3TUY C;  1PUL A;  1SCV A;  1KWO C;  1JSA A;  1QAT A;  1CM4 A;  3GK2 A;  1S5G Z;  3AAK A;  1K94 A;  1R6P A;  1UUS A;  1YVH A;  1BT6 A;  3EVR A;  2FOT A;  1DT7 B;  3DVJ A;  1UHI A;  2LP3 A;  1AUI B; 
#chains in the Genus database with same CATH topology
 4GUK A;  3NXA A;  4KYN A;  4DUQ A;  3PAL A;  1JF0 A;  1RRO A;  5IBW A;  4E68 A;  1LXF C;  3FE9 A;  1IQ5 A;  4TNC A;  4YGB B;  1E8A A;  1SBJ A;  2QEB A;  2M1U A;  1Y6W A;  3DVE A;  2V53 A;  1SSE B;  2K7O A;  1TUJ A;  3CWG A;  3O4Y A;  1BOD A;  4FQO A;  1KFX L;  1XVJ A;  2LVK A;  1QLS A;  1WRZ A;  2KQ6 A;  2HPS A;  3GOF A;  3NHI A;  2LMT A;  2L4H A;  1SY9 A;  1EL4 A;  1KWO B;  2LLS A;  3EKH A;  2MBX A;  3SG6 A;  1QXP A;  4F7F A;  1BG1 A;  2K2F A;  1DJZ A;  3BFA A;  3BQ3 A;  1GGZ A;  4OKH A;  1YRT B;  2KFG A;  3VB1 A;  1M63 B;  4DIR A;  3BUM B;  2FCD A;  3SG7 A;  5I94 A;  2PQL A;  4P5O E;  2JWW A;  1CFF A;  2JU0 A;  2JTT A;  2WCH A;  4PE0 A;  2KGR A;  4HSZ A;  2OTG C;  5HLO A;  2NLN A;  1CMG A;  2QDI A;  4AQI A;  4ORB B;  2QAC A;  4C0K A;  5J3X A;  3PLF B;  1NX1 A;  2ZN9 A;  3KO0 A;  1ZOT B;  2HQW A;  3K1E A;  2JNX A;  2L2E A;  1OE9 B;  1DTL A;  1RWY A;  1KQM C;  3DZT A;  2BL0 C;  2LP2 A;  1N65 A;  4FTG A;  4M2P A;  1OSA A;  1SYM A;  3DYE A;  3R72 A;  3CAB A;  3UNW A;  2WCM A;  2ZN8 A;  1C7W A;  2F2O A;  2QEH A;  4PHN A;  2HQ8 A;  1N2D A;  1S1E A;  3AKA A;  1NX2 A;  4MEW A;  5DKN A;  3SG5 A;  4YI9 A;  1K90 D;  1QX2 A;  2BBN A;  4CPV A;  1CB1 A;  3VRO A;  2BE6 A;  4L9M A;  4GAO A;  1S6I A;  3DD4 A;  1K93 D;  1PAL A;  1QIV A;  2K7B A;  2KLD A;  3V2L A;  2KAX A;  4I5N B;  3EVU A;  4MLW A;  3SS4 A;  3TZ1 A;  2LAP A;  4ZCU A;  1H8B A;  1DEK A;  1WDC C;  3BXK A;  1QV1 A;  2LM5 A;  3E3R A;  2OTG B;  1DEL A;  1JUO A;  1XFY O;  5ER5 A;  1A03 A;  1G4Y R;  2PRU A;  1HQV A;  1DC1 A;  1KFU L;  1QLK A;  3EK8 A;  3DVM A;  1JFK A;  1CKK A;  3I5I C;  2JOJ A;  2F2P A;  1QAS A;  1RK9 A;  2RGI A;  2L98 A;  1CMF A;  1PVB A;  1A2X A;  2F8P A;  4YGC B;  1KQM B;  2LLT A;  3B86 A;  3H4S E;  4Q04 A;  1TCF A;  1J7R A;  1F8H A;  1OOJ A;  1CFD A;  1W7I B;  4CFQ A;  1F71 A;  1NX0 A;  2OS8 C;  2JXC A;  2ISD A;  1FF1 A;  2SAS A;  1KK7 Z;  2ZND A;  2F3Y A;  2YGU A;  1G8I A;  2JTZ A;  5FI2 A;  4A4C A;  3VRP A;  4MSP A;  3S0A A;  2NCP A;  1S6C A;  1SCM C;  1ZUZ A;  2PAS A;  4C0J A;  1HT9 A;  3O6B A;  4CID A;  3PN7 C;  1WDC B;  1B47 A;  4YI8 A;  2BAP A;  1OZS A;  2M7L A;  2WCL A;  3SIB A;  5I2O A;  3DF0 A;  1IG5 A;  3OP0 A;  2LAN A;  1XFV O;  5B8I B;  2KPH A;  1XFW O;  1K96 A;  3I5I B;  1XK4 A;  2FCE A;  4PCW A;  5GQQ C;  3I5F C;  1Y1A A;  3CZ0 A;  4YGD B;  1TNW A;  4PHJ A;  3I5G C;  3CZ2 A;  1R2U A;  5PAL A;  1W7J B;  1CLL A;  2H2K A;  3EK4 A;  4PDZ A;  2OS8 B;  3PM2 A;  3TDU A;  2JQ6 A;  1CTR A;  1XK4 C;  3SJS A;  1ZAC A;  1F70 A;  1OOI X;  1L2O C;  2P70 A;  2Q4U A;  3VRQ A;  1F4Q A;  2M3W A;  2O5G A;  3BUO B;  1CNP A;  2GGZ A;  1YRU B;  2MHH A;  4OV2 A;  5EL2 A;  1SCM B;  4OCI A;  2CTN A;  3FWC A;  3FE6 A;  3PN7 B;  4NDC A;  1K95 A;  2BBM A;  4MBE A;  1CLM A;  2BKI B;  1M46 A;  2BCA A;  1B4C A;  1XO5 A;  3O2P A;  3R1O A;  2R2I A;  1EH2 A;  1GJY A;  1QVI Y;  1WY9 A;  3AAJ A;  2H8V A;  1MUX A;  3I5F B;  3EKJ A;  1UHK A;  2Y1M A;  3BUN B;  1IGV A;  3D75 A;  3I5G B;  4ICB A;  4UPG A;  1YR5 A;  1KFX S;  5TNC A;  1GGW A;  2WCJ A;  4P2Y B;  1SMG A;  2LV7 A;  1IJ6 A;  2LUC A;  1S26 D;  3DF0 B;  3SIA A;  4AQJ A;  1PRW A;  3FIA A;  1FI5 A;  1NP8 A;  2H61 A;  4YGE B;  2BCX A;  3CR4 X;  1SL8 A;  3JTD C;  3DXL A;  2WCF A;  1L2O B;  1OQP A;  4BY4 A;  4MRX A;  3BYA A;  3CR5 X;  3KEV A;  1XYD A;  1QX7 A;  1B1G A;  1LA3 A;  4PHK A;  3FS7 A;  5AFP A;  5HL1 A;  1TTX A;  1DVI A;  2H61 C;  1DJY A;  3KPX A;  4GFT A;  1LVC D;  1UHH A;  2L50 A;  4PT1 A;  1CDN A;  2M29 A;  5FI6 A;  1MF8 B;  3L4L A;  2CBL A;  1TCO B;  5BPJ A;  4MRY A;  2MA2 A;  4NQG A;  3DVK A;  2G9B A;  2D8N A;  1B8L A;  2WOR A;  3BFH A;  1Y1U A;  3A8R A;  1F54 A;  4ORC B;  2QPT A;  1YUS A;  3S0D A;  3R1P A;  4D1E A;  5I2Q A;  2KAV A;  1DF0 A;  2KOT A;  2L51 A;  2K8M B;  3JTD B;  4PE7 A;  2JT8 A;  2NZ0 A;  1K9U A;  5F6T A;  3KF9 A;  4JD9 A;  2E6W A;  1S6J A;  2I18 A;  2JT0 A;  3IVT A;  3OB2 B;  1CFC A;  2I7A A;  1LIN A;  1Y0V H;  1SPY A;  1B8C A;  2JXL A;  2WC6 A;  2KBM A;  3RLZ A;  2HET A;  2IS9 A;  1IRJ A;  3IQO A;  3OGN A;  1BR1 B;  4PAL A;  4BY5 A;  4YRU A;  1BJF A;  1CDL A;  1Q80 A;  2PAL A;  1QIW A;  3OX5 A;  3B6X A;  3CLN A;  1AVS A;  1AK8 A;  1PVA A;  1DJG A;  1B7T Y;  4JKT A;  1CLB A;  2JZI A;  4C0L A;  4GGN A;  1KFU S;  1AJ5 A;  1MQ1 A;  3FE8 A;  4ORA B;  1AP4 A;  4DS7 A;  5CSJ A;  1JFJ A;  1C7V A;  1MHO A;  1C3Z A;  1W9Z A;  2M9G A;  4HRG A;  2M97 A;  2LVJ A;  2LMV A;  1X02 A;  1A75 A;  4INW A;  3D78 A;  1A29 A;  2M8U A;  2GV5 A;  2QEV A;  3B88 A;  1MXE A;  2E30 A;  3TDI A;  2COL B;  1XFX O;  2Y1N A;  3L4A A;  2GTE A;  1VRK A;  1Z2C B;  2OPO A;  1FW4 A;  5CSN A;  3DY9 A;  3ZNI A;  1DF0 B;  3C1V A;  4WQ2 A;  1FBV A;  3M0W A;  2ZRS A;  3N7H A;  1OZO A;  2I94 A;  3D0Y A;  3EG5 B;  1NIW A;  4JPZ B;  3HX4 A;  1ZMZ A;  2MAZ A;  1WRK A;  2KNE A;  4NDD A;  1V1G A;  2KLE A;  2F33 A;  2HF5 A;  1CM1 A;  3F45 A;  4PE4 A;  1PSR A;  3PM8 A;  3GK4 X;  4MN0 A;  2CCM A;  1PK0 D;  5CSI A;  2L2C A;  1U5I A;  1C07 A;  1QV0 A;  2LLU A;  3CS1 A;  4JWQ A;  1XA5 A;  2LUX A;  3A4U B;  4PE1 A;  1CDM A;  3I5H C;  3TDZ A;  4QJ5 B;  2M7N A;  3S0F A;  5KU1 A;  3OHM B;  4XYN A;  5I8N A;  1CFP A;  1WLZ A;  2PVB A;  1DJW A;  1A75 B;  2WOS A;  1NCX A;  2NXQ A;  1LKJ A;  2BKH B;  2KAY A;  1TOP A;  1H4B A;  1TIZ A;  1AHR A;  2LE9 B;  5AEQ A;  1M31 A;  2B1U A;  1UUR A;  1SR6 B;  1QJT A;  2PSR A;  2EGD A;  2BE4 A;  2KYF A;  2KSP A;  1J1D A;  1TNX A;  2WC5 A;  4NDB A;  1J7O A;  1UP5 A;  4F0Z B;  1TUZ A;  1S3P A;  5G08 A;  1S36 A;  4QJ4 B;  1JWD A;  3CYZ A;  1NWD A;  3PAT A;  1IKU A;  1WRL A;  2WND A;  5KSZ A;  1IJ5 A;  1DQE A;  3BFB A;  3WNX B;  3R1V A;  4AOM A;  2I2R E;  1QVI Z;  1YVL A;  2KYC A;  3I5H B;  3Q8I A;  1SNL A;  4N1F A;  2FJU B;  1DJX A;  1YUU A;  2LVI A;  1A4P A;  1BF5 A;  2L4I A;  2KBI A;  1J1E A;  1YX7 A;  3LK1 A;  1QX5 B;  3UO9 A;  1C3Y A;  2KQY A;  3CGA A;  3SS5 A;  2TN4 A;  2JUL A;  1FPW A;  2JPT A;  1TRF A;  1Y1X A;  1DGU A;  2P71 A;  4MZL A;  1NUB A;  1P28 A;  5DKQ A;  3RM1 A;  1DJI A;  1KCY A;  3LCP C;  1BOC A;  2LVV A;  2LCP A;  2P6B B;  4N5X A;  3VRR A;  2GGM A;  3QRX A;  2QEO A;  3D77 A;  3O78 A;  3EVV A;  1NPQ A;  1UHJ A;  2EHB A;  1KK8 B;  2JRF A;  3SG2 A;  1J7P A;  1K2H A;  3NSI A;  5JJG A;  4OVN F;  5AXI A;  4WQ3 A;  1LS8 A;  1S5G Y;  4INX A;  1XFZ O;  2ZKM X;  3BOW A;  3D10 A;  3CR2 A;  2Y4Q A;  2LHL A;  1V1F A;  3BUX B;  3SG3 A;  1EG3 A;  2L5X B;  3FWB A;  1REC A;  2JPO A;  2K2A A;  2K60 A;  1MXL C;  2LNK A;  3GK1 A;  3CDN A;  4GNK B;  3AKB A;  4HRE E;  2DOQ A;  2JNF A;  5JOL A;  3SS3 A;  2L5Y A;  2AMI A;  5K89 A;  3EK7 A;  1NCZ A;  1ORG A;  1TNQ A;  2LHI A;  1ODB A;  4GGF A;  5I2L A;  1SL9 A;  2WCE A;  1TNP A;  3ICB A;  1WLM A;  4YGA A;  3WHU B;  2FJY A;  1AJ4 A;  2MJW B;  1NX3 A;  3TUY B;  5D3O A;  1XFR A;  1OMR A;  3CTN A;  5HKZ A;  4WRI A;  1OW4 A;  4YBH B;  1ALW A;  3VGO A;  5FI7 A;  2WCB A;  4GGF C;  4ZCV A;  4MVF A;  3D73 A;  2M49 B;  3MSE B;  5D69 A;  1K9K A;  1TWO A;  1OMD A;  2CXJ A;  1B7T Z;  1B9A A;  4M2Q A;  4OZD A;  3TS5 C;  1BMO A;  2KDH A;  1NCY A;  4MZJ A;  1M45 A;  4IL1 A;  2LC5 A;  1RTP 1;  2KHN A;  1G33 A;  1M39 A;  2CT9 A;  4N1G A;  2K7C A;  3WHT B;  3LL8 B;  2NCO A;  4MZK A;  2ZRT A;  2A4J A;  4XJK A;  1DGV A;  1JF2 A;  3BOW B;  1BLQ A;  1QTX A;  5FYX A;  2KI4 C;  1FI6 A;  3NGV A;  2LMU A;  3NSL A;  1JBA A;  1IIO A;  1GQM A;  1EG4 A;  3D74 A;  2BNX A;  4CLN A;  1D1O A;  2VRG A;  2MRD A;  2K7D A;  3IQQ A;  3JVT C;  3NSO A;  5CPV A;  2BEC A;  5DKR A;  1F4O A;  4U8D A;  1PSB A;  5HKY A;  5CSF A;  1MWN A;  1J7Q A;  1K8U A;  2PMY A;  1DMO A;  1DJH A;  2JC2 A;  3PSR A;  1OMV A;  3HCM A;  2KFH A;  2M1K B;  3L47 A;  5ER4 X;  2KFF A;  4HRH A;  3SG4 A;  5D7F A;  3TS5 B;  4I5K A;  2WCK A;  4A4B A;  5AER A;  2EC6 C;  1B8R A;  3LLE A;  2O60 A;  2Y5I A;  3D76 A;  4I5J A;  1SR6 C;  1MR8 A;  1NSH A;  2MLE C;  2ZNE A;  4JQ0 D;  4GPL B;  3K21 A;  4PHM A;  4USL A;  2L0P A;  1IQ3 A;  3S0G A;  1OOH A;  1LA0 A;  1YTZ C;  2KI4 B;  4I5L B;  1K9P A;  4R1E A;  3OX6 A;  2AAO A;  1BR4 B;  3BJH A;  3RZS A;  3KHE A;  1ALV A;  2BL0 B;  1NYA A;  1IWQ A;  1YUT A;  1BU3 A;  2AUC A;  1YUR A;  3QME A;  3S0E A;  3JVT B;  1JC2 A;  2PYQ A;  4XJK B;  3S0B A;  1CDP A;  2CNP A;  3LK0 A;  2M0R A;  2WC8 A;  3WXA A;  1F55 A;  3VRN A;  4FQT A;  2K61 A;  1UHN A;  1IH0 A;  1KK7 Y;  1SRA A;  1Z4H A;  2KGB C;  4GBA A;  2K0J A;  1EJ3 A;  1L7Z A;  1SW8 A;  2G2B A;  3ZWH A;  1UWO A;  1QS7 A;  2EC6 B;  2BCB A;  1ZFS A;  2SCP A;  5HLV A;  1KK8 C;  1QWV A;  2Q91 A;  4QJ3 B;  1KSO A;  2ZFD A;  4OR9 B;  5DIC A;  4DRW A;  1KSM A;  1TN4 A;  2KI6 C;  3D0Y B;  3NHT A;  2MLF C;  1KQV A;  5AAN A;  2KI6 D;  4M2O A;  1N0Y A;  1SL7 A;  3CZT X;  4IJ7 A;  5KTY A;  1SKT A;  2JT3 A;  5HKW A;  1GM0 A;  1T14 A;  1J55 A;  4CFR A;  4DCK A;  1RJV A;  2F3Z A;  3IF7 A;  3O4X A;  1YX8 A;  1EXR A;  3NSK A;  1U5I B;  2ERB A;  3PFV A;  1SK6 D;  4ETO A;  3BUW B;  1XFU O;  1OOG A;  3CZ1 A;  3OB1 B;  5HYD A;  1RFJ A;  3TUY C;  1PUL A;  1SCV A;  1KWO C;  1OOF A;  1JSA A;  1QAT A;  1CM4 A;  3GK2 A;  1S5G Z;  3AAK A;  3B7A A;  1K94 A;  1R6P A;  1UUS A;  1YVH A;  1BT6 A;  3EVR A;  3PJI A;  2FOT A;  3B87 A;  3OBV A;  1DT7 B;  3DVJ A;  1UHI A;  2LP3 A;  1AUI B; 
#chains in the Genus database with same CATH homology
 4GUK A;  3NXA A;  4DUQ A;  3PAL A;  1JF0 A;  1RRO A;  5IBW A;  4E68 A;  1LXF C;  1IQ5 A;  4TNC A;  4YGB B;  1E8A A;  1SBJ A;  2M1U A;  1Y6W A;  3DVE A;  2V53 A;  2K7O A;  3CWG A;  3O4Y A;  1BOD A;  4FQO A;  1KFX L;  1XVJ A;  2LVK A;  1QLS A;  1WRZ A;  2KQ6 A;  2HPS A;  3GOF A;  1CDN A;  2LMT A;  2L4H A;  1SY9 A;  1EL4 A;  1KWO B;  2LLS A;  3EKH A;  2MBX A;  3SG6 A;  1QXP A;  1BG1 A;  2K2F A;  1DJZ A;  3BQ3 A;  1GGZ A;  4OKH A;  1YRT B;  2KFG A;  1M63 B;  4DIR A;  3BUM B;  2FCD A;  3SG7 A;  4P5O E;  2JWW A;  1CFF A;  2JU0 A;  2JTT A;  4PE0 A;  2KGR A;  4HSZ A;  2OTG C;  5HLO A;  2NLN A;  1CMG A;  4AQI A;  4ORB B;  2QAC A;  4C0K A;  5J3X A;  3PLF B;  1NX1 A;  2ZN9 A;  3KO0 A;  1ZOT B;  2HQW A;  2JNX A;  2L2E A;  1OE9 B;  1DTL A;  1RWY A;  1KQM C;  2BL0 C;  2LP2 A;  1N65 A;  4FTG A;  4M2P A;  1OSA A;  1SYM A;  2ZN8 A;  4PHN A;  1C7W A;  2F2O A;  2HQ8 A;  1N2D A;  1S1E A;  3AKA A;  1NX2 A;  4MEW A;  5DKN A;  3SG5 A;  4YI9 A;  1K90 D;  1QX2 A;  2BBN A;  4CPV A;  1CB1 A;  3VRO A;  2BE6 A;  4L9M A;  4GAO A;  1S6I A;  3DD4 A;  1K93 D;  1PAL A;  1QIV A;  2K7B A;  2KAX A;  4I5N B;  3EVU A;  4MLW A;  3TZ1 A;  2LAP A;  4ZCU A;  1H8B A;  3BXK A;  1WDC C;  3E3R A;  1QV1 A;  2LM5 A;  1A03 A;  2OTG B;  1JUO A;  1XFY O;  5ER5 A;  1G4Y R;  2PRU A;  1HQV A;  1KFU L;  1QLK A;  3EK8 A;  3DVM A;  1JFK A;  1CKK A;  3I5I C;  2JOJ A;  2F2P A;  1QAS A;  1RK9 A;  2RGI A;  2L98 A;  1CMF A;  1PVB A;  1A2X A;  2F8P A;  4YGC B;  1KQM B;  2LLT A;  3H4S E;  4Q04 A;  1TCF A;  1J7R A;  1F8H A;  1OOJ A;  1CFD A;  1W7I B;  4CFQ A;  1F71 A;  1NX0 A;  2OS8 C;  2JXC A;  2ISD A;  1FF1 A;  2SAS A;  1KK7 Z;  2ZND A;  2F3Y A;  1G8I A;  2JTZ A;  4A4C A;  3VRP A;  4MSP A;  2NCP A;  1S6C A;  1SCM C;  1ZUZ A;  2PAS A;  4C0J A;  1HT9 A;  3O6B A;  4CID A;  3PN7 C;  1WDC B;  1B47 A;  4YI8 A;  1OZS A;  2M7L A;  3SIB A;  5I2O A;  3DF0 A;  1IG5 A;  3OP0 A;  2LAN A;  1XFV O;  5B8I B;  1XFW O;  1K96 A;  3I5I B;  1XK4 A;  2FCE A;  4PCW A;  5GQQ C;  3I5F C;  1Y1A A;  4YGD B;  1TNW A;  4PHJ A;  3I5G C;  1R2U A;  5PAL A;  1W7J B;  1CLL A;  2H2K A;  3EK4 A;  4PDZ A;  2OS8 B;  3TDU A;  2JQ6 A;  1CTR A;  1XK4 C;  3SJS A;  1ZAC A;  1F70 A;  1L2O C;  2Q4U A;  3VRQ A;  1F4Q A;  2M3W A;  2O5G A;  3BUO B;  1CNP A;  2GGZ A;  1YRU B;  2MHH A;  4OV2 A;  1SCM B;  4OCI A;  2CTN A;  3FWC A;  3PN7 B;  4NDC A;  1K95 A;  2BBM A;  4MBE A;  1CLM A;  2BKI B;  1M46 A;  2BCA A;  1B4C A;  1XO5 A;  3O2P A;  2R2I A;  1EH2 A;  1GJY A;  1QVI Y;  1WY9 A;  3AAJ A;  1MUX A;  3I5F B;  3EKJ A;  1UHK A;  2Y1M A;  3BUN B;  1IGV A;  3I5G B;  4ICB A;  4UPG A;  1YR5 A;  1KFX S;  5TNC A;  1GGW A;  4P2Y B;  1SMG A;  2LV7 A;  1IJ6 A;  2LUC A;  1S26 D;  3DF0 B;  3SIA A;  4AQJ A;  1PRW A;  3FIA A;  1FI5 A;  1NP8 A;  2H61 A;  4YGE B;  2BCX A;  3CR4 X;  1SL8 A;  3JTD C;  2WCF A;  1L2O B;  1OQP A;  4BY4 A;  4MRX A;  3BYA A;  3CR5 X;  3KEV A;  1XYD A;  1QX7 A;  1B1G A;  1LA3 A;  4PHK A;  3FS7 A;  5AFP A;  1TTX A;  1DVI A;  2H61 C;  1DJY A;  3KPX A;  4GFT A;  1LVC D;  1UHH A;  2L50 A;  2M29 A;  1MF8 B;  2CBL A;  1TCO B;  5BPJ A;  4MRY A;  2MA2 A;  4NQG A;  3DVK A;  2G9B A;  2D8N A;  1B8L A;  2WOR A;  1Y1U A;  3A8R A;  1F54 A;  4ORC B;  2QPT A;  1YUS A;  4D1E A;  5I2Q A;  2KAV A;  1DF0 A;  2KOT A;  2L51 A;  2K8M B;  3JTD B;  4PE7 A;  2JT8 A;  2NZ0 A;  1K9U A;  5F6T A;  3KF9 A;  2E6W A;  1S6J A;  2I18 A;  2JT0 A;  3OB2 B;  1CFC A;  2I7A A;  1LIN A;  1Y0V H;  1SPY A;  1B8C A;  2JXL A;  3RLZ A;  2KBM A;  2HET A;  2IS9 A;  1IRJ A;  3IQO A;  1BR1 B;  4PAL A;  4BY5 A;  4YRU A;  1BJF A;  1CDL A;  1Q80 A;  2PAL A;  1QIW A;  3OX5 A;  3CLN A;  1AVS A;  1AK8 A;  1PVA A;  1DJG A;  1B7T Y;  1CLB A;  2JZI A;  4C0L A;  4GGN A;  1KFU S;  1AJ5 A;  1MQ1 A;  4ORA B;  1AP4 A;  4DS7 A;  5CSJ A;  1JFJ A;  1C7V A;  1MHO A;  2M9G A;  4HRG A;  2M97 A;  2LVJ A;  2LMV A;  1X02 A;  1A75 A;  1A29 A;  2M8U A;  2GV5 A;  1MXE A;  2E30 A;  3TDI A;  2COL B;  1XFX O;  2Y1N A;  1VRK A;  2OPO A;  1FW4 A;  5CSN A;  3ZNI A;  1DF0 B;  3C1V A;  4WQ2 A;  1FBV A;  3M0W A;  2ZRS A;  1OZO A;  2I94 A;  3D0Y A;  1NIW A;  4JPZ B;  3HX4 A;  1ZMZ A;  2MAZ A;  1WRK A;  2KNE A;  4NDD A;  1V1G A;  2F33 A;  2HF5 A;  1CM1 A;  3F45 A;  4PE4 A;  1PSR A;  3PM8 A;  3GK4 X;  4MN0 A;  2CCM A;  1PK0 D;  5CSI A;  1U5I A;  1C07 A;  1QV0 A;  2LLU A;  3CS1 A;  4JWQ A;  1XA5 A;  2LUX A;  3A4U B;  4PE1 A;  1CDM A;  3I5H C;  3TDZ A;  4QJ5 B;  2M7N A;  5KU1 A;  3OHM B;  4XYN A;  5I8N A;  1CFP A;  1WLZ A;  2PVB A;  1DJW A;  1A75 B;  2WOS A;  1NCX A;  2NXQ A;  1LKJ A;  2BKH B;  2KAY A;  1TOP A;  1H4B A;  1TIZ A;  1AHR A;  2LE9 B;  5AEQ A;  1M31 A;  2B1U A;  1UUR A;  1SR6 B;  1QJT A;  2PSR A;  2EGD A;  2BE4 A;  2KYF A;  2KSP A;  1J1D A;  1TNX A;  1J7O A;  4NDB A;  1UP5 A;  4F0Z B;  4QJ4 B;  1S3P A;  5G08 A;  1S36 A;  1JWD A;  1NWD A;  3PAT A;  1IKU A;  1WRL A;  2WND A;  5KSZ A;  1IJ5 A;  3WNX B;  4AOM A;  2I2R E;  1QVI Z;  1YVL A;  2KYC A;  3I5H B;  1SNL A;  4N1F A;  2FJU B;  1DJX A;  1YUU A;  2LVI A;  1A4P A;  1BF5 A;  2L4I A;  2KBI A;  1J1E A;  1YX7 A;  3LK1 A;  1QX5 B;  2KQY A;  3CGA A;  2TN4 A;  2JUL A;  1FPW A;  2JPT A;  1TRF A;  1Y1X A;  1DGU A;  4MZL A;  3RM1 A;  1NUB A;  5DKQ A;  1DJI A;  1KCY A;  3LCP C;  1BOC A;  2LVV A;  2LCP A;  2P6B B;  4N5X A;  3VRR A;  2GGM A;  3QRX A;  3O78 A;  3EVV A;  1NPQ A;  1UHJ A;  2EHB A;  1KK8 B;  2JRF A;  3SG2 A;  1J7P A;  1K2H A;  3NSI A;  5JJG A;  4OVN F;  5AXI A;  4WQ3 A;  1S5G Y;  1XFZ O;  2ZKM X;  3BOW A;  3D10 A;  3CR2 A;  2Y4Q A;  2LHL A;  1V1F A;  3BUX B;  3SG3 A;  1EG3 A;  2L5X B;  3FWB A;  1REC A;  2K2A A;  2LNK A;  1MXL C;  3GK1 A;  4GNK B;  3AKB A;  4HRE E;  2DOQ A;  2JNF A;  5JOL A;  2AMI A;  5K89 A;  3EK7 A;  1NCZ A;  1TNQ A;  2LHI A;  1ODB A;  4GGF A;  5I2L A;  1SL9 A;  2WCE A;  1TNP A;  3ICB A;  1WLM A;  4YGA A;  3WHU B;  1AJ4 A;  2MJW B;  1NX3 A;  3TUY B;  1OMR A;  3CTN A;  5HKZ A;  4WRI A;  4YBH B;  1ALW A;  3VGO A;  2WCB A;  4GGF C;  4ZCV A;  4MVF A;  2M49 B;  3MSE B;  5D69 A;  1K9K A;  1OMD A;  2CXJ A;  1B7T Z;  1B9A A;  4M2Q A;  3TS5 C;  1BMO A;  2KDH A;  1NCY A;  4MZJ A;  1M45 A;  4IL1 A;  2LC5 A;  1RTP 1;  2KHN A;  1G33 A;  1M39 A;  2CT9 A;  4N1G A;  2K7C A;  3WHT B;  3LL8 B;  2NCO A;  4MZK A;  2ZRT A;  2A4J A;  4XJK A;  1DGV A;  1JF2 A;  3BOW B;  1BLQ A;  1QTX A;  5FYX A;  2KI4 C;  1FI6 A;  2LMU A;  3NSL A;  1JBA A;  1GQM A;  1EG4 A;  1D1O A;  4CLN A;  2VRG A;  2MRD A;  2K7D A;  3IQQ A;  3JVT C;  3NSO A;  5CPV A;  2BEC A;  5DKR A;  1F4O A;  4U8D A;  1PSB A;  5HKY A;  5CSF A;  1MWN A;  1J7Q A;  1K8U A;  2PMY A;  1DMO A;  1DJH A;  2JC2 A;  3PSR A;  1OMV A;  3HCM A;  2KFH A;  2M1K B;  5ER4 X;  3SG4 A;  2KFF A;  4HRH A;  5D7F A;  3TS5 B;  4I5K A;  4A4B A;  5AER A;  2EC6 C;  1B8R A;  3LLE A;  2O60 A;  2Y5I A;  4I5J A;  1SR6 C;  1MR8 A;  1NSH A;  2MLE C;  2ZNE A;  4JQ0 D;  4GPL B;  3K21 A;  4PHM A;  4USL A;  2L0P A;  1IQ3 A;  1YTZ C;  1LA0 A;  2KI4 B;  4I5L B;  1K9P A;  4R1E A;  3OX6 A;  2AAO A;  1BR4 B;  3KHE A;  1ALV A;  2BL0 B;  1NYA A;  1IWQ A;  1YUT A;  1BU3 A;  2AUC A;  1YUR A;  1JC2 A;  3JVT B;  4XJK B;  1CDP A;  2CNP A;  3LK0 A;  2M0R A;  2WC8 A;  3WXA A;  1F55 A;  3VRN A;  2K61 A;  1UHN A;  1IH0 A;  1KK7 Y;  1SRA A;  2KGB C;  4GBA A;  2K0J A;  1EJ3 A;  1L7Z A;  1SW8 A;  2G2B A;  3ZWH A;  1UWO A;  1QS7 A;  2EC6 B;  2BCB A;  1ZFS A;  2SCP A;  5HLV A;  1KK8 C;  2Q91 A;  4QJ3 B;  1KSO A;  2ZFD A;  4OR9 B;  4DRW A;  1KSM A;  1TN4 A;  2KI6 C;  3D0Y B;  2MLF C;  1KQV A;  5AAN A;  2KI6 D;  4M2O A;  1N0Y A;  1SL7 A;  3CZT X;  5KTY A;  1SKT A;  2JT3 A;  5HKW A;  1J55 A;  4CFR A;  4DCK A;  1RJV A;  2F3Z A;  3IF7 A;  1YX8 A;  1EXR A;  3NSK A;  1U5I B;  3PFV A;  1SK6 D;  4ETO A;  3BUW B;  1XFU O;  3OB1 B;  5HYD A;  1RFJ A;  3TUY C;  1PUL A;  1SCV A;  1KWO C;  1JSA A;  1QAT A;  1CM4 A;  3GK2 A;  1S5G Z;  3AAK A;  1K94 A;  1R6P A;  1UUS A;  1YVH A;  1BT6 A;  3EVR A;  2FOT A;  1DT7 B;  3DVJ A;  1UHI A;  2LP3 A;  1AUI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...