1MR8A

Migration inhibitory factor-related protein 8 from human
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
90
structure length
90
Chain Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MIGRATION INHIBITORY FACTOR-RELATED PROTEIN 8
publication title The structure of human MRP8, a member of the S100 calcium-binding protein family, by MAD phasing at 1.9 A resolution.
pubmed doi rcsb
molecule tags Metal transport
total genus 37
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1mr8A00
4YGAA 3PSRA 4JPZB 1DF0A 3BUMB 1CB1A 3WNXB 3O2PA 3O6BA 4ICBA 3C1VA 1U5IB 1G4YR 1QS7A 2F33A 1CMFA 2M8UA 2BE6A 1XFWO 3MSEB 5ER4X 1IJ6A 3D0YA 4BY4A 1UUSA 1JC2A 1PULA 2JQ6A 4PDZA 3DVEA 1LA0A 1Q80A 2JTZA 1K9UA 1Y1AA 1KK7Z 2F3ZA 2LP3A 2A4JA 2FJUB 3RLZA 4GFTA 2M29A 1CKKA 4OKHA 1NCZA 1TNQA 2EC6B 1K94A 1MXEA 1Y6WA 3PLFB 1KFUS 2K2AA 1G33A 2JTTA 3DF0A 3EK4A 4M2PA 4MZLA 4UPGA 2VRGA 1MQ1A 3ICBA 1RECA 4PHMA 5HYDA 3IF7A 1B1GA 3PN7C 5J3XA 2M9GA 4PHKA 2M1UA 1QX2A 1OOJA 1UWOA 5HKWA 1BT6A 3SG5A 3TS5B 3KHEA 1LINA 1DJWA 4FTGA 4MZJA 2L5XB 2EHBA 1ZMZA 1TN4A 1B7TZ 4NDCA 2MRDA 1GGZA 3AAJA 2I2RE 1NWDA 3CR2A 1M45A 1FI6A 2JNXA 1CDLA 2AAOA 1K93D 4I5LB 2KGBC 1UHKA 2LHLA 4PALA 1RK9A 4FQOA 3I5HB 2O60A 3EVUA 4GNKB 1H4BA 1YURA 2CXJA 2HQ8A 2JU0A 4CFQA 1YR5A 1WY9A 2ISDA 2D8NA 1A29A 3FS7A 3EKHA 5AERA 1TCFA 2Y4QA 2ZN8A 4I5NB 5G08A 3I5GB 5CPVA 2JZIA 4DUQA 1YTZC 1U5IA 1TNXA 4E68A 2ZRSA 3NSOA 4MRXA 1CFFA 1QLSA 1B47A 3NXAA 3TZ1A 1CNPA 1WLMA 1AP4A 3BOWB 2JWWA 1OMVA 1C07A 1TRFA 2FCEA 3CS1A 1K9PA 1SR6B 4M2OA 2COLB 1CM4A 1KQMB 4DCKA 2O5GA 2PSRA 4P2YB 2Q91A 1IJ5A 3D10A 1X02A 2LLSA 1KK8C 1SK6D 4MRYA 4YGEB 4PHJA 1DJXA 1B8RA 4I5JA 1Y1UA 4DRWA 5AFPA 2M97A 3KPXA 1AVSA 3SG7A 5HLOA 2MBXA 1F71A 4AOMA 1XYDA 2P6BB 1TNPA 1YUUA 4CIDA 5I2QA 1WDCC 3IQOA 2KYFA 2BECA 2OTGC 1KFXS 3VGOA 4MVFA 5IBWA 5PALA 1EJ3A 3K21A 1NP8A 2BKIB 5CSIA 1QIVA 4CFRA 2LUXA 5FYXA 1R2UA 2LMTA 4R1EA 2JNFA 4Q04A 1EG4A 2KBMA 4GGFC 1H8BA 1XK4A 1EG3A 1QVIZ 1NX3A 2JT8A 1L2OC 4YRUA 1DJHA 2LANA 1FBVA 3OB1B 3VROA 1QASA 3PN7B 5K89A 1YX7A 2H61A 1CDPA 5AEQA 1Y1XA 3GK4X 1LKJA 3BUXB 2L0PA 5JOLA 1A75B 1NCYA 4WQ3A 1UP5A 2SASA 1BLQA 3DVKA 1KCYA 2MAZA 2LVJA 2E30A 3HX4A 3H4SE 3SG3A 3BOWA 4OCIA 4CLNA 1LVCD 1NPQA 4PE1A 4ETOA 1NYAA 2CTNA 1PALA 1SNLA 4ZCVA 1CFPA 1TTXA 1GJYA 1UHIA 2M3WA 4ORAB 1B9AA 4ORBB 2BCXA 4MZKA 2PALA 4MBEA 4BY5A 4C0LA 1AHRA 3SIAA 2ZNEA 2ZKMX 4GGNA 1N0YA 1IQ5A 2MLEC 1JF2A 1SCMC 2KAYA 1KK7Y 2NXQA 1PSBA 3PM8A 2QPTA 4A4CA 3EK7A 1XVJA 1CLBA 1NUBA 1TIZA 5D69A 2KAVA 4YGDB 2LLTA 2BBMA 2LHIA 1BF5A 1SCVA 4NDDA 4JQ0D 1C7VA 1SBJA 1QXPA 1TOPA 2V53A 3BUWB 3PALA 5I8NA 3TUYC 2WC8A 5DKRA 1EH2A 1SL9A 2K0JA 1JUOA 1KK8B 2PASA 1W7IB 1RWYA 1B7TY 2KGRA 2KI6D 2M0RA 1IKUA 1CFCA 1JWDA 2JT0A 1DJZA 1MWNA 1IH0A 1A75A 1GQMA 2LUCA 4OV2A 3WXAA 1B4CA 1J7PA 1F70A 1WDCB 1RFJA 5HKZA 1HT9A 2OTGB 1XFXO 3WHTB 4C0KA 2NZ0A 2LMVA 1YRTB 3SIBA 1RROA 2KSPA 2OPOA 1BR4B 1PSRA 1RTP1 1CMGA 1JFKA 1MUXA 3CGAA 1NX1A 3FIAA 1QX5B 1AK8A 1S6IA 2PVBA 4NDBA 1YUSA 3LK0A 4IL1A 5BPJA 1BG1A 1ALVA 2F2OA 2M7NA 2KQ6A 3CLNA 1L2OB 4XJKB 1QLKA 5KU1A 2AMIA 2IS9A 2KOTA 1N65A 4N5XA 1M39A 1PVBA 2HQWA 2OS8C 1C7WA 4DIRA 2F3YA 3CR4X 3TDUA 2FCDA 3GOFA 2QACA 2MHHA 2L98A 1XA5A 1W7JB 1PVAA 1AUIB 3BUOB 1KWOC 1ZACA 4MLWA 4WRIA 3VRRA 4MEWA 4QJ5B 1OZSA 2WCEA 2CT9A 2SCPA 2LM5A 1BMOA 3FWBA 4PE0A 2BE4A 1UHJA 2ZRTA 4DS7A 3EVRA 3FWCA 3HCMA 4JWQA 1OE9B 2CBLA 5JJGA 1CFDA 1K9KA 1N2DA 2HETA 1IQ3A 1WRLA 1YVHA 1SCMB 4HREE 1DJGA 1CLMA 1SRAA 1WRKA 4D1EA 1CDMA 4AQJA 1FI5A 3DVMA 1MHOA 4A4BA 3GK2A 2LNKA 3NSIA 1E8AA 2KI4C 3A8RA 1R6PA 3EVVA 5GQQC 2L2EA 1FF1A 3RM1A 1QVIY 1UHNA 2LVIA 5AXIA 2TN4A 2KYCA 1J7RA 1S6JA 1SPYA 4QJ4B 2BCBA 1BODA 1HQVA 4PE7A 4GGFA 3WHUB 1AJ5A 2BBNA 3TUYB 1DT7B 1JF0A 1QATA 4YBHB 4XJKA 2KFHA 1BU3A 2ZN9A 3TDZA 3O78A 2Y5IA 3LLEA 2F2PA 2KHNA 1KSOA 4HRGA 4ZCUA 2GGMA 3VRQA 3ZWHA 1SL8A 2MLFC 1QV1A 3BXKA 5DKNA 1FPWA 4U8DA 3SG6A 1DGVA 2LAPA 3DF0B 3KEVA 1EXRA 1ODBA 1A2XA 3I5IC 4N1FA 1F4OA 3CZTX 2E6WA 1K8UA 3F45A 1K90D 3JTDC 1CDNA 1KFUL 1CTRA 2K2FA 1WLZA 2LMUA 2K7DA 2WCBA 2MJWB 1PK0D 4WQ2A 1B8LA 1IWQA 1OMDA 1J7QA 1SL7A 2KFGA 1A03A 2BL0C 1NX2A 2JC2A 1WRZA 2LE9B 2PMYA 1S1EA 2CNPA 2GV5A 3I5FC 1YVLA 1F8HA 1J1DA 1DTLA 1OZOA 4GAOA 3AAKA 2K7OA 2OS8B 3QRXA 3O4YA 1QJTA 2KQYA 3NSLA 1Y0VH 1V1FA 1OMRA 2L51A 5AANA 2KFFA 2PRUA 5ER5A 4HRHA 3SJSA 1KWOB 1VRKA 3CTNA 4OR9B 2RGIA 2K8MB 5CSFA 1M46A 2LP2A 3LK1A 3JVTC 3CR5X 5CSJA 3BYAA 1UURA 1FW4A 2JPTA 1S36A 1BJFA 1GGWA 2M49B 3PATA 3KO0A 2K7CA 2K61A 1A4PA 1LXFC 3BQ3A 4I5KA 2M1KB 2JOJA 3VRPA 3DD4A 1TNWA 1SW8A 4NQGA 1BOCA 5D7FA 1M31A 1IGVA 1UHHA 1XFZO 1RJVA 3IQQA 4GPLB 1ZFSA 1XFUO 1DJYA 4CPVA 2KI4B 2G9BA 4N1GA 3OB2B 4AQIA 1J55A 4ORCB 5B8IB 4MSPA 1SKTA 1NIWA 3PFVA 1CLLA 1F54A 2JULA 1NX0A 3ZNIA 4YI9A 2I18A 3M0WA 3NSKA 1K96A 1YX8A 2LC5A 1B8CA 3A4UB 4PCWA 2K7BA 2LLUA 1SYMA 2KNEA 1KFXL 1KQVA 1TCOB 2WORA 1KSMA 1BR1B 2ZFDA 3KF9A 2LVVA 3I5IB 1OQPA 1NSHA 5KSZA 4OVNF 4QJ3B 1YRUB 1NCXA 5I2LA 1K95A 2AUCA 3JTDB 1QV0A 2LV7A 2M7LA 2JXCA 2NCPA 1JFJA 1J7OA 1G8IA 1SMGA 2LCPA 3GK1A 1IRJA 3DVJA 1QX7A 1MR8A 4PHNA 3OX5A 2F8PA 2HPSA 2EC6C 4P5OE 1D1OA 2JXLA 1DGUA 2HF5A 2Y1NA 2BL0B 5HKYA 2Y1MA 1S26D 5KTYA 2WNDA 3LCPC 1V1GA 2I7AA 2NCOA 4PE4A 3I5FB 1DF0B 4L9MA 3AKBA 2FOTA 4YGCB 5I2OA 1S3PA 1F4QA 3OP0A 1JSAA 1M63B 2G2BA 3SG4A 3TS5C 1DVIA 1JBAA 2ZNDA 1XO5A 4YI8A 3D0YB 1J1EA 3E3RA 2H2KA 1ALWA 2CCMA 2JRFA 2EGDA 2JT3A 2KI6C 1DJIA 3JVTB 3TDIA 3VRNA 4C0JA 2KAXA 2KDHA 1YUTA 4GBAA 1ZOTB 1S5GY 4XYNA 3I5HC 2KBIA 1AJ4A 1QTXA 3SG2A 1XK4C 4F0ZB 1S6CA 3OHMB 1DMOA 1S5GZ 1PRWA 1EL4A 2MA2A 2BCAA 3CWGA 5HLVA 3I5GC 5TNCA 2WOSA 1K2HA 1CM1A 2R2IA 4GUKA 1QIWA 2L50A 2H61C 2LVKA 2B1UA 3OX6A 4HSZA 4YGBB 4MN0A 2Q4UA 2L4IA 2GGZA 1OSAA 5CSNA 1LA3A 3AKAA 2I94A 3BUNB 1XFVO 2WCFA 1SY9A 5DKQA 1F55A 2NLNA 1MXLC 1IG5A 3EK8A 4USLA 4TNCA 3LL8B 5F6TA 4M2QA 1SR6C 2L4HA 2BKHB 1KQMC 3EKJA 1L7ZA 2DOQA 1ZUZA 1MF8B 1XFYO
chains in the Genus database with same CATH superfamily
4YGAA 3PSRA 1P28A 4JPZB 1DF0A 3BUMB 1CB1A 5DICA 3WNXB 3O2PA 3O6BA 1Z2CB 3C1VA 4ICBA 1U5IB 1G4YR 1QS7A 2F33A 1CMFA 2M8UA 2BE6A 1XFWO 3MSEB 5ER4X 1IJ6A 3D0YA 4BY4A 1UUSA 1JC2A 1PULA 2JQ6A 4PDZA 3DVEA 1LA0A 1Q80A 2JTZA 1K9UA 1Y1AA 1KK7Z 2F3ZA 1DQEA 2A4JA 2FJUB 2LP3A 3RLZA 4GFTA 3D74A 2M29A 1CKKA 4OKHA 1NCZA 1TNQA 2EC6B 1K94A 1MXEA 1Y6WA 3PLFB 1KFUS 2K2AA 1G33A 3D73A 2JTTA 3DF0A 3EK4A 4M2PA 2ERBA 3CZ1A 4MZLA 4UPGA 2VRGA 1MQ1A 3ICBA 1RECA 4PHMA 5HYDA 3IF7A 1B1GA 3PN7C 5J3XA 2M9GA 4PHKA 2M1UA 1QX2A 1OOJA 1UWOA 5HKWA 1BT6A 3SG5A 3TS5B 3KHEA 1LINA 1DJWA 4FTGA 4MZJA 1GM0A 2L5XB 2EHBA 3DYEA 1ZMZA 1TN4A 1B7TZ 2BAPA 2FJYA 2MRDA 1GGZA 3AAJA 4NDCA 2I2RE 1NWDA 3CR2A 1M45A 1FI6A 2JNXA 1CDLA 2AAOA 3NHTA 1K93D 4I5LB 3S0EA 2KGBC 1UHKA 2LHLA 4PALA 1RK9A 3RZSA 4FQOA 3I5HB 2O60A 3EVUA 3UNWA 4GNKB 1H4BA 2WCJA 1YURA 2CXJA 2HQ8A 2JU0A 4CFQA 1YR5A 3L4LA 1WY9A 4JD9A 2ISDA 2D8NA 1A29A 3FS7A 3EKHA 5AERA 1TCFA 2Y4QA 2ZN8A 4I5NB 5G08A 3I5GB 5CPVA 2L2CA 2JZIA 4DUQA 1YTZC 1U5IA 1TNXA 4E68A 2ZRSA 3NSOA 4MRXA 1CFFA 1QLSA 1B47A 3NXAA 3TZ1A 1CNPA 1WLMA 1AP4A 3BOWB 2JWWA 1OMVA 1C07A 1C3YA 1TRFA 2FCEA 3N7HA 3CS1A 3S0DA 1K9PA 2QEHA 3DZTA 1SR6B 4M2OA 2COLB 2YGUA 1CM4A 2WCKA 1KQMB 4DCKA 2O5GA 2PSRA 4P2YB 2Q91A 5EL2A 1OOGA 1IJ5A 3D10A 1X02A 1W9ZA 1KK8C 1SK6D 2LLSA 4FQTA 4MRYA 1DJXA 4PHJA 1B8RA 4YGEB 3V2LA 4I5JA 3SS4A 1Y1UA 4DRWA 5AFPA 2M97A 3R72A 3KPXA 1AVSA 3SG7A 5HLOA 2QEOA 2MBXA 1F71A 4AOMA 1XYDA 2KLDA 2P6BB 1TNPA 1YUUA 4CIDA 5I2QA 1WDCC 3IQOA 2KYFA 2BECA 4INXA 2OTGC 1KFXS 3VGOA 4MVFA 5IBWA 5PALA 1EJ3A 3K21A 3R1VA 1NP8A 2BKIB 5CSIA 1QIVA 3S0BA 4CFRA 2LUXA 5FYXA 1R2UA 2LMTA 4R1EA 3QMEA 2JNFA 4Q04A 1EG4A 2KBMA 3B6XA 4GGFC 1H8BA 1XK4A 1EG3A 1QVIZ 1NX3A 2JT8A 1L2OC 4YRUA 1TWOA 1DJHA 2LANA 1FBVA 3OB1B 3VROA 1QASA 3PN7B 5K89A 4PT1A 1YX7A 2H61A 1CDPA 5AEQA 1Y1XA 3GK4X 1LKJA 3BUXB 2L0PA 5JOLA 1A75B 1NCYA 4WQ3A 1UP5A 2SASA 1BLQA 3DVKA 1KCYA 2MAZA 3B87A 2LVJA 2E30A 3HX4A 3H4SE 3SG3A 3BOWA 4OCIA 4CLNA 1LVCD 1NPQA 4PE1A 4ETOA 1NYAA 2CTNA 1PALA 1SNLA 2KLEA 4ZCVA 1CFPA 1TTXA 1GJYA 1UHIA 2M3WA 4ORAB 1B9AA 4ORBB 5FI7A 2BCXA 1GGWA 4MZKA 2PALA 4MBEA 3O4XA 4BY5A 4C0LA 1AHRA 3SIAA 4INWA 2ZNEA 2ZKMX 4GGNA 1N0YA 1IQ5A 2MLEC 3BFBA 1JF2A 1LS8A 1SCMC 1KK7Y 2KAYA 2NXQA 1PSBA 3FE9A 3PM8A 2QPTA 4A4CA 3SS3A 1C3ZA 1XVJA 3EK7A 1CLBA 1NUBA 1TIZA 5D69A 2KAVA 4YGDB 3CZ0A 2LLTA 2BBMA 2QEVA 2LHIA 1BF5A 1SCVA 4NDDA 3IVTA 3S0GA 4JQ0D 3PM2A 1C7VA 1SBJA 1QXPA 1TOPA 2V53A 3BUWB 3PALA 5I8NA 5FI2A 3TUYC 2WC8A 5DKRA 1EH2A 1SL9A 2K0JA 1JUOA 1KK8B 2P70A 2PASA 1W7IB 1RWYA 1B7TY 2KGRA 2KI6D 2M0RA 1IKUA 1CFCA 3DXLA 1JWDA 2GTEA 2JT0A 1DJZA 1MWNA 1IH0A 1A75A 1GQMA 2LUCA 3D76A 3DY9A 4OV2A 3WXAA 1B4CA 1J7PA 1F70A 1WDCB 1RFJA 3D78A 5HKZA 1HT9A 2K60A 2OTGB 1XFXO 3WHTB 4C0KA 2NZ0A 2QEBA 2LMVA 1YRTB 3SIBA 1RROA 3VB1A 2KSPA 1OW4A 2OPOA 1BR4B 1PSRA 1RTP1 1CMGA 2JPOA 1JFKA 1MUXA 1OOFA 3CGAA 1NX1A 3FIAA 1QX5B 1AK8A 1S6IA 2PVBA 4NDBA 1YUSA 3LK0A 4IL1A 5BPJA 1BG1A 1ALVA 2F2OA 2M7NA 2KQ6A 3CLNA 1L2OB 4XJKB 1QLKA 5KU1A 2AMIA 2IS9A 3CZ2A 2KOTA 1N65A 5FI6A 4N5XA 1M39A 1PVBA 2HQWA 2OS8C 1C7WA 4DIRA 2F3YA 3CR4X 3TDUA 2FCDA 3GOFA 2QACA 3S0FA 2MHHA 3FE8A 2L98A 1XA5A 3CYZA 1W7JB 1PVAA 1AUIB 3BUOB 1KWOC 1ZACA 4MLWA 4WRIA 3VRRA 4MEWA 4QJ5B 1OZSA 2WCEA 2CT9A 2SCPA 2LM5A 1BMOA 3FWBA 4PE0A 2BE4A 1OOIX 1UHJA 2ZRTA 4DS7A 3EVRA 3FWCA 1Z4HA 3HCMA 4JWQA 1OE9B 2CBLA 5JJGA 5HL1A 1CFDA 1K9KA 1N2DA 2HETA 1IQ3A 1WRLA 1YVHA 1SCMB 4HREE 1DJGA 1DELA 1CLMA 1OOHA 1SRAA 1WRKA 4IJ7A 4D1EA 1CDMA 4AQJA 1FI5A 3DVMA 1MHOA 3S0AA 4A4BA 3GK2A 2LNKA 3NSIA 1E8AA 2KI4C 3A8RA 1R6PA 3EVVA 5GQQC 2L2EA 1FF1A 3RM1A 1QVIY 1UHNA 2LVIA 3CDNA 5AXIA 2TN4A 2KYCA 1J7RA 1S6JA 1SPYA 4QJ4B 2BCBA 1BODA 1HQVA 4PE7A 4GGFA 3WHUB 1AJ5A 2BBNA 3TUYB 1DT7B 1JF0A 1QATA 4YBHB 3B7AA 4XJKA 2KFHA 1BU3A 1QWVA 2ZN9A 3TDZA 3O78A 2Y5IA 3CABA 2F2PA 2KHNA 1KSOA 3LLEA 4HRGA 2GGMA 4ZCUA 3VRQA 3ZWHA 1SL8A 2MLFC 1QV1A 3BXKA 5DKNA 1FPWA 4U8DA 3SG6A 2L5YA 1DGVA 2LAPA 3DF0B 3KEVA 1EXRA 1ODBA 1A2XA 3I5IC 4N1FA 1F4OA 3CZTX 3L4AA 2E6WA 1DEKA 1K8UA 3FE6A 3F45A 1K90D 3JTDC 3EG5B 1KFUL 1CTRA 2K2FA 1WLZA 1CDNA 2LMUA 2K7DA 2WCBA 3B86A 2MJWB 1PK0D 3BFHA 4WQ2A 1B8LA 1IWQA 2WCMA 1OMDA 4F7FA 1J7QA 1SL7A 2KFGA 1A03A 2BL0C 1NX2A 2JC2A 1WRZA 2LE9B 2PMYA 1S1EA 2CNPA 2GV5A 3I5FC 1YVLA 1F8HA 1J1DA 1DTLA 1OZOA 4GAOA 3AAKA 2K7OA 2OS8B 3QRXA 3O4YA 1QJTA 2BNXA 2KQYA 3NSLA 1Y0VH 1V1FA 1OMRA 2L51A 5AANA 2KFFA 2PRUA 5ER5A 2WCHA 4HRHA 3SJSA 1KWOB 1VRKA 3CTNA 4OR9B 2RGIA 2K8MB 5CSFA 1M46A 1TUJA 2LP2A 1T14A 3LK1A 3JVTC 3R1OA 3CR5X 3NGVA 3BYAA 1UURA 1FW4A 2JPTA 1S36A 1BJFA 2QDIA 5CSJA 2M49B 3PATA 1XFRA 3KO0A 2K7CA 2K61A 1A4PA 1LXFC 3BQ3A 3OBVA 4I5KA 2M1KB 2JOJA 3VRPA 3DD4A 1TNWA 1SW8A 4NQGA 1BOCA 5D7FA 1M31A 2KPHA 1IGVA 2WCLA 1UHHA 1XFZO 2WC5A 1RJVA 3IQQA 4GPLB 3R1PA 1ZFSA 4JKTA 1XFUO 1DJYA 4CPVA 2KI4B 2G9BA 3BJHA 4N1GA 3OB2B 4AQIA 1J55A 4ORCB 5B8IB 4MSPA 1SKTA 1NIWA 3PFVA 2WC6A 1CLLA 1F54A 2JULA 1NX0A 3ZNIA 4YI9A 2I18A 2PQLA 3M0WA 3NSKA 1K96A 1YX8A 2LC5A 1B8CA 3D77A 3A4UB 4PCWA 2K7BA 2LLUA 1SYMA 3B88A 3D75A 2KNEA 1KFXL 1KQVA 1TCOB 2WORA 3K1EA 1KSMA 1BR1B 2ZFDA 3KF9A 2LVVA 3I5IB 5I94A 1OQPA 1NSHA 5KSZA 4OVNF 4QJ3B 1YRUB 1NCXA 5I2LA 1IIOA 3BFAA 1K95A 2AUCA 3Q8IA 3JTDB 1QV0A 2LV7A 2M7LA 2JXCA 2NCPA 1JFJA 1J7OA 1G8IA 1SMGA 2LCPA 3GK1A 1IRJA 3DVJA 1QX7A 1MR8A 4PHNA 1DC1A 3OX5A 2F8PA 2HPSA 2EC6C 4P5OE 1D1OA 2JXLA 4KYNA 1DGUA 2HF5A 2Y1NA 2BL0B 4OZDA 2Y1MA 1S26D 5HKYA 5KTYA 2WNDA 3LCPC 1V1GA 2I7AA 2NCOA 4PE4A 3I5FB 1DF0B 4L9MA 2H8VA 2FOTA 3AKBA 4YGCB 5I2OA 1S3PA 1TUZA 1F4QA 3OP0A 1JSAA 1M63B 2G2BA 3PJIA 3SG4A 3TS5C 1DVIA 1JBAA 3UO9A 2ZNDA 1XO5A 4YI8A 3D0YB 1J1EA 3E3RA 2H2KA 1ALWA 2CCMA 2JRFA 2EGDA 2JT3A 2KI6C 1DJIA 3JVTB 3TDIA 3VRNA 4C0JA 2KAXA 2KDHA 1YUTA 4GBAA 1ZOTB 1S5GY 5D3OA 4XYNA 3I5HC 2KBIA 1AJ4A 1QTXA 3SG2A 1XK4C 4F0ZB 1S6CA 3OHMB 1DMOA 1S5GZ 1PRWA 1EL4A 2MA2A 2BCAA 3CWGA 5HLVA 3I5GC 5TNCA 2WOSA 1K2HA 1CM1A 2PYQA 2R2IA 4GUKA 1QIWA 2L50A 2H61C 2LVKA 2B1UA 3NHIA 3OX6A 3SS5A 4HSZA 4YGBB 4MN0A 2Q4UA 2L4IA 2GGZA 1OSAA 5CSNA 1LA3A 3AKAA 2I94A 3BUNB 1XFVO 2WCFA 1SY9A 5DKQA 1F55A 2NLNA 3OGNA 1MXLC 1IG5A 3EK8A 4USLA 4TNCA 3LL8B 5F6TA 1SSEB 4M2QA 1SR6C 2L4HA 2P71A 1ORGA 2BKHB 1KQMC 3EKJA 1L7ZA 3L47A 2DOQA 1ZUZA 1MF8B 1XFYO
chains in the Genus database with same CATH topology
4YGAA 3PSRA 4JPZB 1DF0A 3BUMB 1CB1A 3WNXB 3O2PA 3O6BA 4ICBA 3C1VA 1U5IB 1G4YR 1QS7A 2F33A 1CMFA 2M8UA 2BE6A 1XFWO 3MSEB 5ER4X 1IJ6A 3D0YA 4BY4A 1UUSA 1JC2A 1PULA 2JQ6A 4PDZA 3DVEA 1LA0A 1Q80A 2JTZA 1K9UA 1Y1AA 1KK7Z 2F3ZA 2LP3A 2A4JA 2FJUB 3RLZA 4GFTA 2M29A 1CKKA 4OKHA 1NCZA 1TNQA 2EC6B 1K94A 1MXEA 1Y6WA 3PLFB 1KFUS 2K2AA 1G33A 2JTTA 3DF0A 3EK4A 4M2PA 4MZLA 4UPGA 2VRGA 1MQ1A 3ICBA 1RECA 4PHMA 5HYDA 3IF7A 1B1GA 3PN7C 5J3XA 2M9GA 4PHKA 2M1UA 1QX2A 1OOJA 1UWOA 5HKWA 1BT6A 3SG5A 3TS5B 3KHEA 1LINA 1DJWA 4FTGA 4MZJA 2L5XB 2EHBA 1ZMZA 1TN4A 1B7TZ 4NDCA 2MRDA 1GGZA 3AAJA 2I2RE 1NWDA 3CR2A 1M45A 1FI6A 2JNXA 1CDLA 2AAOA 1K93D 4I5LB 2KGBC 1UHKA 2LHLA 4PALA 1RK9A 4FQOA 3I5HB 2O60A 3EVUA 4GNKB 1H4BA 1YURA 2CXJA 2HQ8A 2JU0A 4CFQA 1YR5A 1WY9A 2ISDA 2D8NA 1A29A 3FS7A 3EKHA 5AERA 1TCFA 2Y4QA 2ZN8A 4I5NB 5G08A 3I5GB 5CPVA 2JZIA 4DUQA 1YTZC 1U5IA 1TNXA 4E68A 2ZRSA 3NSOA 4MRXA 1CFFA 1QLSA 1B47A 3NXAA 3TZ1A 1CNPA 1WLMA 1AP4A 3BOWB 2JWWA 1OMVA 1C07A 1TRFA 2FCEA 3CS1A 1K9PA 1SR6B 4M2OA 2COLB 1CM4A 1KQMB 4DCKA 2O5GA 2PSRA 4P2YB 2Q91A 1IJ5A 3D10A 1X02A 2LLSA 1KK8C 1SK6D 4MRYA 4YGEB 4PHJA 1DJXA 1B8RA 4I5JA 1Y1UA 4DRWA 5AFPA 2M97A 3KPXA 1AVSA 3SG7A 5HLOA 2MBXA 1F71A 4AOMA 1XYDA 2P6BB 1TNPA 1YUUA 4CIDA 5I2QA 1WDCC 3IQOA 2KYFA 2BECA 2OTGC 1KFXS 3VGOA 4MVFA 5IBWA 5PALA 1EJ3A 3K21A 1NP8A 2BKIB 5CSIA 1QIVA 4CFRA 2LUXA 5FYXA 1R2UA 2LMTA 4R1EA 2JNFA 4Q04A 1EG4A 2KBMA 4GGFC 1H8BA 1XK4A 1EG3A 1QVIZ 1NX3A 2JT8A 1L2OC 4YRUA 1DJHA 2LANA 1FBVA 3OB1B 3VROA 1QASA 3PN7B 5K89A 1YX7A 2H61A 1CDPA 5AEQA 1Y1XA 3GK4X 1LKJA 3BUXB 2L0PA 5JOLA 1A75B 1NCYA 4WQ3A 1UP5A 2SASA 1BLQA 3DVKA 1KCYA 2MAZA 2LVJA 2E30A 3HX4A 3H4SE 3SG3A 3BOWA 4OCIA 4CLNA 1LVCD 1NPQA 4PE1A 4ETOA 1NYAA 2CTNA 1PALA 1SNLA 4ZCVA 1CFPA 1TTXA 1GJYA 1UHIA 2M3WA 4ORAB 1B9AA 4ORBB 2BCXA 4MZKA 2PALA 4MBEA 4BY5A 4C0LA 1AHRA 3SIAA 2ZNEA 2ZKMX 4GGNA 1N0YA 1IQ5A 2MLEC 1JF2A 1SCMC 2KAYA 1KK7Y 2NXQA 1PSBA 3PM8A 2QPTA 4A4CA 3EK7A 1XVJA 1CLBA 1NUBA 1TIZA 5D69A 2KAVA 4YGDB 2LLTA 2BBMA 2LHIA 1BF5A 1SCVA 4NDDA 4JQ0D 1C7VA 1SBJA 1QXPA 1TOPA 2V53A 3BUWB 3PALA 5I8NA 3TUYC 2WC8A 5DKRA 1EH2A 1SL9A 2K0JA 1JUOA 1KK8B 2PASA 1W7IB 1RWYA 1B7TY 2KGRA 2KI6D 2M0RA 1IKUA 1CFCA 1JWDA 2JT0A 1DJZA 1MWNA 1IH0A 1A75A 1GQMA 2LUCA 4OV2A 3WXAA 1B4CA 1J7PA 1F70A 1WDCB 1RFJA 5HKZA 1HT9A 2OTGB 1XFXO 3WHTB 4C0KA 2NZ0A 2LMVA 1YRTB 3SIBA 1RROA 2KSPA 2OPOA 1BR4B 1PSRA 1RTP1 1CMGA 1JFKA 1MUXA 3CGAA 1NX1A 3FIAA 1QX5B 1AK8A 1S6IA 2PVBA 4NDBA 1YUSA 3LK0A 4IL1A 5BPJA 1BG1A 1ALVA 2F2OA 2M7NA 2KQ6A 3CLNA 1L2OB 4XJKB 1QLKA 5KU1A 2AMIA 2IS9A 2KOTA 1N65A 4N5XA 1M39A 1PVBA 2HQWA 2OS8C 1C7WA 4DIRA 2F3YA 3CR4X 3TDUA 2FCDA 3GOFA 2QACA 2MHHA 2L98A 1XA5A 1W7JB 1PVAA 1AUIB 3BUOB 1KWOC 1ZACA 4MLWA 4WRIA 3VRRA 4MEWA 4QJ5B 1OZSA 2WCEA 2CT9A 2SCPA 2LM5A 1BMOA 3FWBA 4PE0A 2BE4A 1UHJA 2ZRTA 4DS7A 3EVRA 3FWCA 3HCMA 4JWQA 1OE9B 2CBLA 5JJGA 1CFDA 1K9KA 1N2DA 2HETA 1IQ3A 1WRLA 1YVHA 1SCMB 4HREE 1DJGA 1CLMA 1SRAA 1WRKA 4D1EA 1CDMA 4AQJA 1FI5A 3DVMA 1MHOA 4A4BA 3GK2A 2LNKA 3NSIA 1E8AA 2KI4C 3A8RA 1R6PA 3EVVA 5GQQC 2L2EA 1FF1A 3RM1A 1QVIY 1UHNA 2LVIA 5AXIA 2TN4A 2KYCA 1J7RA 1S6JA 1SPYA 4QJ4B 2BCBA 1BODA 1HQVA 4PE7A 4GGFA 3WHUB 1AJ5A 2BBNA 3TUYB 1DT7B 1JF0A 1QATA 4YBHB 4XJKA 2KFHA 1BU3A 2ZN9A 3TDZA 3O78A 2Y5IA 3LLEA 2F2PA 2KHNA 1KSOA 4HRGA 4ZCUA 2GGMA 3VRQA 3ZWHA 1SL8A 2MLFC 1QV1A 3BXKA 5DKNA 1FPWA 4U8DA 3SG6A 1DGVA 2LAPA 3DF0B 3KEVA 1EXRA 1ODBA 1A2XA 3I5IC 4N1FA 1F4OA 3CZTX 2E6WA 1K8UA 3F45A 1K90D 3JTDC 1CDNA 1KFUL 1CTRA 2K2FA 1WLZA 2LMUA 2K7DA 2WCBA 2MJWB 1PK0D 4WQ2A 1B8LA 1IWQA 1OMDA 1J7QA 1SL7A 2KFGA 1A03A 2BL0C 1NX2A 2JC2A 1WRZA 2LE9B 2PMYA 1S1EA 2CNPA 2GV5A 3I5FC 1YVLA 1F8HA 1J1DA 1DTLA 1OZOA 4GAOA 3AAKA 2K7OA 2OS8B 3QRXA 3O4YA 1QJTA 2KQYA 3NSLA 1Y0VH 1V1FA 1OMRA 2L51A 5AANA 2KFFA 2PRUA 5ER5A 4HRHA 3SJSA 1KWOB 1VRKA 3CTNA 4OR9B 2RGIA 2K8MB 5CSFA 1M46A 2LP2A 3LK1A 3JVTC 3CR5X 5CSJA 3BYAA 1UURA 1FW4A 2JPTA 1S36A 1BJFA 1GGWA 2M49B 3PATA 3KO0A 2K7CA 2K61A 1A4PA 1LXFC 3BQ3A 4I5KA 2M1KB 2JOJA 3VRPA 3DD4A 1TNWA 1SW8A 4NQGA 1BOCA 5D7FA 1M31A 1IGVA 1UHHA 1XFZO 1RJVA 3IQQA 4GPLB 1ZFSA 1XFUO 1DJYA 4CPVA 2KI4B 2G9BA 4N1GA 3OB2B 4AQIA 1J55A 4ORCB 5B8IB 4MSPA 1SKTA 1NIWA 3PFVA 1CLLA 1F54A 2JULA 1NX0A 3ZNIA 4YI9A 2I18A 3M0WA 3NSKA 1K96A 1YX8A 2LC5A 1B8CA 3A4UB 4PCWA 2K7BA 2LLUA 1SYMA 2KNEA 1KFXL 1KQVA 1TCOB 2WORA 1KSMA 1BR1B 2ZFDA 3KF9A 2LVVA 3I5IB 1OQPA 1NSHA 5KSZA 4OVNF 4QJ3B 1YRUB 1NCXA 5I2LA 1K95A 2AUCA 3JTDB 1QV0A 2LV7A 2M7LA 2JXCA 2NCPA 1JFJA 1J7OA 1G8IA 1SMGA 2LCPA 3GK1A 1IRJA 3DVJA 1QX7A 1MR8A 4PHNA 3OX5A 2F8PA 2HPSA 2EC6C 4P5OE 1D1OA 2JXLA 1DGUA 2HF5A 2Y1NA 2BL0B 5HKYA 2Y1MA 1S26D 5KTYA 2WNDA 3LCPC 1V1GA 2I7AA 2NCOA 4PE4A 3I5FB 1DF0B 4L9MA 3AKBA 2FOTA 4YGCB 5I2OA 1S3PA 1F4QA 3OP0A 1JSAA 1M63B 2G2BA 3SG4A 3TS5C 1DVIA 1JBAA 2ZNDA 1XO5A 4YI8A 3D0YB 1J1EA 3E3RA 2H2KA 1ALWA 2CCMA 2JRFA 2EGDA 2JT3A 2KI6C 1DJIA 3JVTB 3TDIA 3VRNA 4C0JA 2KAXA 2KDHA 1YUTA 4GBAA 1ZOTB 1S5GY 4XYNA 3I5HC 2KBIA 1AJ4A 1QTXA 3SG2A 1XK4C 4F0ZB 1S6CA 3OHMB 1DMOA 1S5GZ 1PRWA 1EL4A 2MA2A 2BCAA 3CWGA 5HLVA 3I5GC 5TNCA 2WOSA 1K2HA 1CM1A 2R2IA 4GUKA 1QIWA 2L50A 2H61C 2LVKA 2B1UA 3OX6A 4HSZA 4YGBB 4MN0A 2Q4UA 2L4IA 2GGZA 1OSAA 5CSNA 1LA3A 3AKAA 2I94A 3BUNB 1XFVO 2WCFA 1SY9A 5DKQA 1F55A 2NLNA 1MXLC 1IG5A 3EK8A 4USLA 4TNCA 3LL8B 5F6TA 4M2QA 1SR6C 2L4HA 2BKHB 1KQMC 3EKJA 1L7ZA 2DOQA 1ZUZA 1MF8B 1XFYO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YGA A;  3PSR A;  4JPZ B;  1DF0 A;  3BUM B;  1CB1 A;  3WNX B;  3O2P A;  3O6B A;  4ICB A;  3C1V A;  1U5I B;  1G4Y R;  1QS7 A;  2F33 A;  1CMF A;  2M8U A;  2BE6 A;  1XFW O;  3MSE B;  5ER4 X;  1IJ6 A;  3D0Y A;  4BY4 A;  1UUS A;  1JC2 A;  1PUL A;  2JQ6 A;  4PDZ A;  3DVE A;  1LA0 A;  1Q80 A;  2JTZ A;  1K9U A;  1Y1A A;  1KK7 Z;  2F3Z A;  2LP3 A;  2A4J A;  2FJU B;  3RLZ A;  4GFT A;  2M29 A;  1CKK A;  4OKH A;  1NCZ A;  1TNQ A;  2EC6 B;  1K94 A;  1MXE A;  1Y6W A;  3PLF B;  1KFU S;  2K2A A;  1G33 A;  2JTT A;  3DF0 A;  3EK4 A;  4M2P A;  4MZL A;  4UPG A;  2VRG A;  1MQ1 A;  3ICB A;  1REC A;  4PHM A;  5HYD A;  3IF7 A;  1B1G A;  3PN7 C;  5J3X A;  2M9G A;  4PHK A;  2M1U A;  1QX2 A;  1OOJ A;  1UWO A;  5HKW A;  1BT6 A;  3SG5 A;  3TS5 B;  3KHE A;  1LIN A;  1DJW A;  4FTG A;  4MZJ A;  2L5X B;  2EHB A;  1ZMZ A;  1TN4 A;  1B7T Z;  4NDC A;  2MRD A;  1GGZ A;  3AAJ A;  2I2R E;  1NWD A;  3CR2 A;  1M45 A;  1FI6 A;  2JNX A;  1CDL A;  2AAO A;  1K93 D;  4I5L B;  2KGB C;  1UHK A;  2LHL A;  4PAL A;  1RK9 A;  4FQO A;  3I5H B;  2O60 A;  3EVU A;  4GNK B;  1H4B A;  1YUR A;  2CXJ A;  2HQ8 A;  2JU0 A;  4CFQ A;  1YR5 A;  1WY9 A;  2ISD A;  2D8N A;  1A29 A;  3FS7 A;  3EKH A;  5AER A;  1TCF A;  2Y4Q A;  2ZN8 A;  4I5N B;  5G08 A;  3I5G B;  5CPV A;  2JZI A;  4DUQ A;  1YTZ C;  1U5I A;  1TNX A;  4E68 A;  2ZRS A;  3NSO A;  4MRX A;  1CFF A;  1QLS A;  1B47 A;  3NXA A;  3TZ1 A;  1CNP A;  1WLM A;  1AP4 A;  3BOW B;  2JWW A;  1OMV A;  1C07 A;  1TRF A;  2FCE A;  3CS1 A;  1K9P A;  1SR6 B;  4M2O A;  2COL B;  1CM4 A;  1KQM B;  4DCK A;  2O5G A;  2PSR A;  4P2Y B;  2Q91 A;  1IJ5 A;  3D10 A;  1X02 A;  2LLS A;  1KK8 C;  1SK6 D;  4MRY A;  4YGE B;  4PHJ A;  1DJX A;  1B8R A;  4I5J A;  1Y1U A;  4DRW A;  5AFP A;  2M97 A;  3KPX A;  1AVS A;  3SG7 A;  5HLO A;  2MBX A;  1F71 A;  4AOM A;  1XYD A;  2P6B B;  1TNP A;  1YUU A;  4CID A;  5I2Q A;  1WDC C;  3IQO A;  2KYF A;  2BEC A;  2OTG C;  1KFX S;  3VGO A;  4MVF A;  5IBW A;  5PAL A;  1EJ3 A;  3K21 A;  1NP8 A;  2BKI B;  5CSI A;  1QIV A;  4CFR A;  2LUX A;  5FYX A;  1R2U A;  2LMT A;  4R1E A;  2JNF A;  4Q04 A;  1EG4 A;  2KBM A;  4GGF C;  1H8B A;  1XK4 A;  1EG3 A;  1QVI Z;  1NX3 A;  2JT8 A;  1L2O C;  4YRU A;  1DJH A;  2LAN A;  1FBV A;  3OB1 B;  3VRO A;  1QAS A;  3PN7 B;  5K89 A;  1YX7 A;  2H61 A;  1CDP A;  5AEQ A;  1Y1X A;  3GK4 X;  1LKJ A;  3BUX B;  2L0P A;  5JOL A;  1A75 B;  1NCY A;  4WQ3 A;  1UP5 A;  2SAS A;  1BLQ A;  3DVK A;  1KCY A;  2MAZ A;  2LVJ A;  2E30 A;  3HX4 A;  3H4S E;  3SG3 A;  3BOW A;  4OCI A;  4CLN A;  1LVC D;  1NPQ A;  4PE1 A;  4ETO A;  1NYA A;  2CTN A;  1PAL A;  1SNL A;  4ZCV A;  1CFP A;  1TTX A;  1GJY A;  1UHI A;  2M3W A;  4ORA B;  1B9A A;  4ORB B;  2BCX A;  4MZK A;  2PAL A;  4MBE A;  4BY5 A;  4C0L A;  1AHR A;  3SIA A;  2ZNE A;  2ZKM X;  4GGN A;  1N0Y A;  1IQ5 A;  2MLE C;  1JF2 A;  1SCM C;  2KAY A;  1KK7 Y;  2NXQ A;  1PSB A;  3PM8 A;  2QPT A;  4A4C A;  3EK7 A;  1XVJ A;  1CLB A;  1NUB A;  1TIZ A;  5D69 A;  2KAV A;  4YGD B;  2LLT A;  2BBM A;  2LHI A;  1BF5 A;  1SCV A;  4NDD A;  4JQ0 D;  1C7V A;  1SBJ A;  1QXP A;  1TOP A;  2V53 A;  3BUW B;  3PAL A;  5I8N A;  3TUY C;  2WC8 A;  5DKR A;  1EH2 A;  1SL9 A;  2K0J A;  1JUO A;  1KK8 B;  2PAS A;  1W7I B;  1RWY A;  1B7T Y;  2KGR A;  2KI6 D;  2M0R A;  1IKU A;  1CFC A;  1JWD A;  2JT0 A;  1DJZ A;  1MWN A;  1IH0 A;  1A75 A;  1GQM A;  2LUC A;  4OV2 A;  3WXA A;  1B4C A;  1J7P A;  1F70 A;  1WDC B;  1RFJ A;  5HKZ A;  1HT9 A;  2OTG B;  1XFX O;  3WHT B;  4C0K A;  2NZ0 A;  2LMV A;  1YRT B;  3SIB A;  1RRO A;  2KSP A;  2OPO A;  1BR4 B;  1PSR A;  1RTP 1;  1CMG A;  1JFK A;  1MUX A;  3CGA A;  1NX1 A;  3FIA A;  1QX5 B;  1AK8 A;  1S6I A;  2PVB A;  4NDB A;  1YUS A;  3LK0 A;  4IL1 A;  5BPJ A;  1BG1 A;  1ALV A;  2F2O A;  2M7N A;  2KQ6 A;  3CLN A;  1L2O B;  4XJK B;  1QLK A;  5KU1 A;  2AMI A;  2IS9 A;  2KOT A;  1N65 A;  4N5X A;  1M39 A;  1PVB A;  2HQW A;  2OS8 C;  1C7W A;  4DIR A;  2F3Y A;  3CR4 X;  3TDU A;  2FCD A;  3GOF A;  2QAC A;  2MHH A;  2L98 A;  1XA5 A;  1W7J B;  1PVA A;  1AUI B;  3BUO B;  1KWO C;  1ZAC A;  4MLW A;  4WRI A;  3VRR A;  4MEW A;  4QJ5 B;  1OZS A;  2WCE A;  2CT9 A;  2SCP A;  2LM5 A;  1BMO A;  3FWB A;  4PE0 A;  2BE4 A;  1UHJ A;  2ZRT A;  4DS7 A;  3EVR A;  3FWC A;  3HCM A;  4JWQ A;  1OE9 B;  2CBL A;  5JJG A;  1CFD A;  1K9K A;  1N2D A;  2HET A;  1IQ3 A;  1WRL A;  1YVH A;  1SCM B;  4HRE E;  1DJG A;  1CLM A;  1SRA A;  1WRK A;  4D1E A;  1CDM A;  4AQJ A;  1FI5 A;  3DVM A;  1MHO A;  4A4B A;  3GK2 A;  2LNK A;  3NSI A;  1E8A A;  2KI4 C;  3A8R A;  1R6P A;  3EVV A;  5GQQ C;  2L2E A;  1FF1 A;  3RM1 A;  1QVI Y;  1UHN A;  2LVI A;  5AXI A;  2TN4 A;  2KYC A;  1J7R A;  1S6J A;  1SPY A;  4QJ4 B;  2BCB A;  1BOD A;  1HQV A;  4PE7 A;  4GGF A;  3WHU B;  1AJ5 A;  2BBN A;  3TUY B;  1DT7 B;  1JF0 A;  1QAT A;  4YBH B;  4XJK A;  2KFH A;  1BU3 A;  2ZN9 A;  3TDZ A;  3O78 A;  2Y5I A;  3LLE A;  2F2P A;  2KHN A;  1KSO A;  4HRG A;  4ZCU A;  2GGM A;  3VRQ A;  3ZWH A;  1SL8 A;  2MLF C;  1QV1 A;  3BXK A;  5DKN A;  1FPW A;  4U8D A;  3SG6 A;  1DGV A;  2LAP A;  3DF0 B;  3KEV A;  1EXR A;  1ODB A;  1A2X A;  3I5I C;  4N1F A;  1F4O A;  3CZT X;  2E6W A;  1K8U A;  3F45 A;  1K90 D;  3JTD C;  1CDN A;  1KFU L;  1CTR A;  2K2F A;  1WLZ A;  2LMU A;  2K7D A;  2WCB A;  2MJW B;  1PK0 D;  4WQ2 A;  1B8L A;  1IWQ A;  1OMD A;  1J7Q A;  1SL7 A;  2KFG A;  1A03 A;  2BL0 C;  1NX2 A;  2JC2 A;  1WRZ A;  2LE9 B;  2PMY A;  1S1E A;  2CNP A;  2GV5 A;  3I5F C;  1YVL A;  1F8H A;  1J1D A;  1DTL A;  1OZO A;  4GAO A;  3AAK A;  2K7O A;  2OS8 B;  3QRX A;  3O4Y A;  1QJT A;  2KQY A;  3NSL A;  1Y0V H;  1V1F A;  1OMR A;  2L51 A;  5AAN A;  2KFF A;  2PRU A;  5ER5 A;  4HRH A;  3SJS A;  1KWO B;  1VRK A;  3CTN A;  4OR9 B;  2RGI A;  2K8M B;  5CSF A;  1M46 A;  2LP2 A;  3LK1 A;  3JVT C;  3CR5 X;  5CSJ A;  3BYA A;  1UUR A;  1FW4 A;  2JPT A;  1S36 A;  1BJF A;  1GGW A;  2M49 B;  3PAT A;  3KO0 A;  2K7C A;  2K61 A;  1A4P A;  1LXF C;  3BQ3 A;  4I5K A;  2M1K B;  2JOJ A;  3VRP A;  3DD4 A;  1TNW A;  1SW8 A;  4NQG A;  1BOC A;  5D7F A;  1M31 A;  1IGV A;  1UHH A;  1XFZ O;  1RJV A;  3IQQ A;  4GPL B;  1ZFS A;  1XFU O;  1DJY A;  4CPV A;  2KI4 B;  2G9B A;  4N1G A;  3OB2 B;  4AQI A;  1J55 A;  4ORC B;  5B8I B;  4MSP A;  1SKT A;  1NIW A;  3PFV A;  1CLL A;  1F54 A;  2JUL A;  1NX0 A;  3ZNI A;  4YI9 A;  2I18 A;  3M0W A;  3NSK A;  1K96 A;  1YX8 A;  2LC5 A;  1B8C A;  3A4U B;  4PCW A;  2K7B A;  2LLU A;  1SYM A;  2KNE A;  1KFX L;  1KQV A;  1TCO B;  2WOR A;  1KSM A;  1BR1 B;  2ZFD A;  3KF9 A;  2LVV A;  3I5I B;  1OQP A;  1NSH A;  5KSZ A;  4OVN F;  4QJ3 B;  1YRU B;  1NCX A;  5I2L A;  1K95 A;  2AUC A;  3JTD B;  1QV0 A;  2LV7 A;  2M7L A;  2JXC A;  2NCP A;  1JFJ A;  1J7O A;  1G8I A;  1SMG A;  2LCP A;  3GK1 A;  1IRJ A;  3DVJ A;  1QX7 A;  1MR8 A;  4PHN A;  3OX5 A;  2F8P A;  2HPS A;  2EC6 C;  4P5O E;  1D1O A;  2JXL A;  1DGU A;  2HF5 A;  2Y1N A;  2BL0 B;  5HKY A;  2Y1M A;  1S26 D;  5KTY A;  2WND A;  3LCP C;  1V1G A;  2I7A A;  2NCO A;  4PE4 A;  3I5F B;  1DF0 B;  4L9M A;  3AKB A;  2FOT A;  4YGC B;  5I2O A;  1S3P A;  1F4Q A;  3OP0 A;  1JSA A;  1M63 B;  2G2B A;  3SG4 A;  3TS5 C;  1DVI A;  1JBA A;  2ZND A;  1XO5 A;  4YI8 A;  3D0Y B;  1J1E A;  3E3R A;  2H2K A;  1ALW A;  2CCM A;  2JRF A;  2EGD A;  2JT3 A;  2KI6 C;  1DJI A;  3JVT B;  3TDI A;  3VRN A;  4C0J A;  2KAX A;  2KDH A;  1YUT A;  4GBA A;  1ZOT B;  1S5G Y;  4XYN A;  3I5H C;  2KBI A;  1AJ4 A;  1QTX A;  3SG2 A;  1XK4 C;  4F0Z B;  1S6C A;  3OHM B;  1DMO A;  1S5G Z;  1PRW A;  1EL4 A;  2MA2 A;  2BCA A;  3CWG A;  5HLV A;  3I5G C;  5TNC A;  2WOS A;  1K2H A;  1CM1 A;  2R2I A;  4GUK A;  1QIW A;  2L50 A;  2H61 C;  2LVK A;  2B1U A;  3OX6 A;  4HSZ A;  4YGB B;  4MN0 A;  2Q4U A;  2L4I A;  2GGZ A;  1OSA A;  5CSN A;  1LA3 A;  3AKA A;  2I94 A;  3BUN B;  1XFV O;  2WCF A;  1SY9 A;  5DKQ A;  1F55 A;  2NLN A;  1MXL C;  1IG5 A;  3EK8 A;  4USL A;  4TNC A;  3LL8 B;  5F6T A;  4M2Q A;  1SR6 C;  2L4H A;  2BKH B;  1KQM C;  3EKJ A;  1L7Z A;  2DOQ A;  1ZUZ A;  1MF8 B;  1XFY O; 
#chains in the Genus database with same CATH topology
 4YGA A;  3PSR A;  1P28 A;  4JPZ B;  1DF0 A;  3BUM B;  1CB1 A;  5DIC A;  3WNX B;  3O2P A;  3O6B A;  1Z2C B;  3C1V A;  4ICB A;  1U5I B;  1G4Y R;  1QS7 A;  2F33 A;  1CMF A;  2M8U A;  2BE6 A;  1XFW O;  3MSE B;  5ER4 X;  1IJ6 A;  3D0Y A;  4BY4 A;  1UUS A;  1JC2 A;  1PUL A;  2JQ6 A;  4PDZ A;  3DVE A;  1LA0 A;  1Q80 A;  2JTZ A;  1K9U A;  1Y1A A;  1KK7 Z;  2F3Z A;  1DQE A;  2A4J A;  2FJU B;  2LP3 A;  3RLZ A;  4GFT A;  3D74 A;  2M29 A;  1CKK A;  4OKH A;  1NCZ A;  1TNQ A;  2EC6 B;  1K94 A;  1MXE A;  1Y6W A;  3PLF B;  1KFU S;  2K2A A;  1G33 A;  3D73 A;  2JTT A;  3DF0 A;  3EK4 A;  4M2P A;  2ERB A;  3CZ1 A;  4MZL A;  4UPG A;  2VRG A;  1MQ1 A;  3ICB A;  1REC A;  4PHM A;  5HYD A;  3IF7 A;  1B1G A;  3PN7 C;  5J3X A;  2M9G A;  4PHK A;  2M1U A;  1QX2 A;  1OOJ A;  1UWO A;  5HKW A;  1BT6 A;  3SG5 A;  3TS5 B;  3KHE A;  1LIN A;  1DJW A;  4FTG A;  4MZJ A;  1GM0 A;  2L5X B;  2EHB A;  3DYE A;  1ZMZ A;  1TN4 A;  1B7T Z;  2BAP A;  2FJY A;  2MRD A;  1GGZ A;  3AAJ A;  4NDC A;  2I2R E;  1NWD A;  3CR2 A;  1M45 A;  1FI6 A;  2JNX A;  1CDL A;  2AAO A;  3NHT A;  1K93 D;  4I5L B;  3S0E A;  2KGB C;  1UHK A;  2LHL A;  4PAL A;  1RK9 A;  3RZS A;  4FQO A;  3I5H B;  2O60 A;  3EVU A;  3UNW A;  4GNK B;  1H4B A;  2WCJ A;  1YUR A;  2CXJ A;  2HQ8 A;  2JU0 A;  4CFQ A;  1YR5 A;  3L4L A;  1WY9 A;  4JD9 A;  2ISD A;  2D8N A;  1A29 A;  3FS7 A;  3EKH A;  5AER A;  1TCF A;  2Y4Q A;  2ZN8 A;  4I5N B;  5G08 A;  3I5G B;  5CPV A;  2L2C A;  2JZI A;  4DUQ A;  1YTZ C;  1U5I A;  1TNX A;  4E68 A;  2ZRS A;  3NSO A;  4MRX A;  1CFF A;  1QLS A;  1B47 A;  3NXA A;  3TZ1 A;  1CNP A;  1WLM A;  1AP4 A;  3BOW B;  2JWW A;  1OMV A;  1C07 A;  1C3Y A;  1TRF A;  2FCE A;  3N7H A;  3CS1 A;  3S0D A;  1K9P A;  2QEH A;  3DZT A;  1SR6 B;  4M2O A;  2COL B;  2YGU A;  1CM4 A;  2WCK A;  1KQM B;  4DCK A;  2O5G A;  2PSR A;  4P2Y B;  2Q91 A;  5EL2 A;  1OOG A;  1IJ5 A;  3D10 A;  1X02 A;  1W9Z A;  1KK8 C;  1SK6 D;  2LLS A;  4FQT A;  4MRY A;  1DJX A;  4PHJ A;  1B8R A;  4YGE B;  3V2L A;  4I5J A;  3SS4 A;  1Y1U A;  4DRW A;  5AFP A;  2M97 A;  3R72 A;  3KPX A;  1AVS A;  3SG7 A;  5HLO A;  2QEO A;  2MBX A;  1F71 A;  4AOM A;  1XYD A;  2KLD A;  2P6B B;  1TNP A;  1YUU A;  4CID A;  5I2Q A;  1WDC C;  3IQO A;  2KYF A;  2BEC A;  4INX A;  2OTG C;  1KFX S;  3VGO A;  4MVF A;  5IBW A;  5PAL A;  1EJ3 A;  3K21 A;  3R1V A;  1NP8 A;  2BKI B;  5CSI A;  1QIV A;  3S0B A;  4CFR A;  2LUX A;  5FYX A;  1R2U A;  2LMT A;  4R1E A;  3QME A;  2JNF A;  4Q04 A;  1EG4 A;  2KBM A;  3B6X A;  4GGF C;  1H8B A;  1XK4 A;  1EG3 A;  1QVI Z;  1NX3 A;  2JT8 A;  1L2O C;  4YRU A;  1TWO A;  1DJH A;  2LAN A;  1FBV A;  3OB1 B;  3VRO A;  1QAS A;  3PN7 B;  5K89 A;  4PT1 A;  1YX7 A;  2H61 A;  1CDP A;  5AEQ A;  1Y1X A;  3GK4 X;  1LKJ A;  3BUX B;  2L0P A;  5JOL A;  1A75 B;  1NCY A;  4WQ3 A;  1UP5 A;  2SAS A;  1BLQ A;  3DVK A;  1KCY A;  2MAZ A;  3B87 A;  2LVJ A;  2E30 A;  3HX4 A;  3H4S E;  3SG3 A;  3BOW A;  4OCI A;  4CLN A;  1LVC D;  1NPQ A;  4PE1 A;  4ETO A;  1NYA A;  2CTN A;  1PAL A;  1SNL A;  2KLE A;  4ZCV A;  1CFP A;  1TTX A;  1GJY A;  1UHI A;  2M3W A;  4ORA B;  1B9A A;  4ORB B;  5FI7 A;  2BCX A;  1GGW A;  4MZK A;  2PAL A;  4MBE A;  3O4X A;  4BY5 A;  4C0L A;  1AHR A;  3SIA A;  4INW A;  2ZNE A;  2ZKM X;  4GGN A;  1N0Y A;  1IQ5 A;  2MLE C;  3BFB A;  1JF2 A;  1LS8 A;  1SCM C;  1KK7 Y;  2KAY A;  2NXQ A;  1PSB A;  3FE9 A;  3PM8 A;  2QPT A;  4A4C A;  3SS3 A;  1C3Z A;  1XVJ A;  3EK7 A;  1CLB A;  1NUB A;  1TIZ A;  5D69 A;  2KAV A;  4YGD B;  3CZ0 A;  2LLT A;  2BBM A;  2QEV A;  2LHI A;  1BF5 A;  1SCV A;  4NDD A;  3IVT A;  3S0G A;  4JQ0 D;  3PM2 A;  1C7V A;  1SBJ A;  1QXP A;  1TOP A;  2V53 A;  3BUW B;  3PAL A;  5I8N A;  5FI2 A;  3TUY C;  2WC8 A;  5DKR A;  1EH2 A;  1SL9 A;  2K0J A;  1JUO A;  1KK8 B;  2P70 A;  2PAS A;  1W7I B;  1RWY A;  1B7T Y;  2KGR A;  2KI6 D;  2M0R A;  1IKU A;  1CFC A;  3DXL A;  1JWD A;  2GTE A;  2JT0 A;  1DJZ A;  1MWN A;  1IH0 A;  1A75 A;  1GQM A;  2LUC A;  3D76 A;  3DY9 A;  4OV2 A;  3WXA A;  1B4C A;  1J7P A;  1F70 A;  1WDC B;  1RFJ A;  3D78 A;  5HKZ A;  1HT9 A;  2K60 A;  2OTG B;  1XFX O;  3WHT B;  4C0K A;  2NZ0 A;  2QEB A;  2LMV A;  1YRT B;  3SIB A;  1RRO A;  3VB1 A;  2KSP A;  1OW4 A;  2OPO A;  1BR4 B;  1PSR A;  1RTP 1;  1CMG A;  2JPO A;  1JFK A;  1MUX A;  1OOF A;  3CGA A;  1NX1 A;  3FIA A;  1QX5 B;  1AK8 A;  1S6I A;  2PVB A;  4NDB A;  1YUS A;  3LK0 A;  4IL1 A;  5BPJ A;  1BG1 A;  1ALV A;  2F2O A;  2M7N A;  2KQ6 A;  3CLN A;  1L2O B;  4XJK B;  1QLK A;  5KU1 A;  2AMI A;  2IS9 A;  3CZ2 A;  2KOT A;  1N65 A;  5FI6 A;  4N5X A;  1M39 A;  1PVB A;  2HQW A;  2OS8 C;  1C7W A;  4DIR A;  2F3Y A;  3CR4 X;  3TDU A;  2FCD A;  3GOF A;  2QAC A;  3S0F A;  2MHH A;  3FE8 A;  2L98 A;  1XA5 A;  3CYZ A;  1W7J B;  1PVA A;  1AUI B;  3BUO B;  1KWO C;  1ZAC A;  4MLW A;  4WRI A;  3VRR A;  4MEW A;  4QJ5 B;  1OZS A;  2WCE A;  2CT9 A;  2SCP A;  2LM5 A;  1BMO A;  3FWB A;  4PE0 A;  2BE4 A;  1OOI X;  1UHJ A;  2ZRT A;  4DS7 A;  3EVR A;  3FWC A;  1Z4H A;  3HCM A;  4JWQ A;  1OE9 B;  2CBL A;  5JJG A;  5HL1 A;  1CFD A;  1K9K A;  1N2D A;  2HET A;  1IQ3 A;  1WRL A;  1YVH A;  1SCM B;  4HRE E;  1DJG A;  1DEL A;  1CLM A;  1OOH A;  1SRA A;  1WRK A;  4IJ7 A;  4D1E A;  1CDM A;  4AQJ A;  1FI5 A;  3DVM A;  1MHO A;  3S0A A;  4A4B A;  3GK2 A;  2LNK A;  3NSI A;  1E8A A;  2KI4 C;  3A8R A;  1R6P A;  3EVV A;  5GQQ C;  2L2E A;  1FF1 A;  3RM1 A;  1QVI Y;  1UHN A;  2LVI A;  3CDN A;  5AXI A;  2TN4 A;  2KYC A;  1J7R A;  1S6J A;  1SPY A;  4QJ4 B;  2BCB A;  1BOD A;  1HQV A;  4PE7 A;  4GGF A;  3WHU B;  1AJ5 A;  2BBN A;  3TUY B;  1DT7 B;  1JF0 A;  1QAT A;  4YBH B;  3B7A A;  4XJK A;  2KFH A;  1BU3 A;  1QWV A;  2ZN9 A;  3TDZ A;  3O78 A;  2Y5I A;  3CAB A;  2F2P A;  2KHN A;  1KSO A;  3LLE A;  4HRG A;  2GGM A;  4ZCU A;  3VRQ A;  3ZWH A;  1SL8 A;  2MLF C;  1QV1 A;  3BXK A;  5DKN A;  1FPW A;  4U8D A;  3SG6 A;  2L5Y A;  1DGV A;  2LAP A;  3DF0 B;  3KEV A;  1EXR A;  1ODB A;  1A2X A;  3I5I C;  4N1F A;  1F4O A;  3CZT X;  3L4A A;  2E6W A;  1DEK A;  1K8U A;  3FE6 A;  3F45 A;  1K90 D;  3JTD C;  3EG5 B;  1KFU L;  1CTR A;  2K2F A;  1WLZ A;  1CDN A;  2LMU A;  2K7D A;  2WCB A;  3B86 A;  2MJW B;  1PK0 D;  3BFH A;  4WQ2 A;  1B8L A;  1IWQ A;  2WCM A;  1OMD A;  4F7F A;  1J7Q A;  1SL7 A;  2KFG A;  1A03 A;  2BL0 C;  1NX2 A;  2JC2 A;  1WRZ A;  2LE9 B;  2PMY A;  1S1E A;  2CNP A;  2GV5 A;  3I5F C;  1YVL A;  1F8H A;  1J1D A;  1DTL A;  1OZO A;  4GAO A;  3AAK A;  2K7O A;  2OS8 B;  3QRX A;  3O4Y A;  1QJT A;  2BNX A;  2KQY A;  3NSL A;  1Y0V H;  1V1F A;  1OMR A;  2L51 A;  5AAN A;  2KFF A;  2PRU A;  5ER5 A;  2WCH A;  4HRH A;  3SJS A;  1KWO B;  1VRK A;  3CTN A;  4OR9 B;  2RGI A;  2K8M B;  5CSF A;  1M46 A;  1TUJ A;  2LP2 A;  1T14 A;  3LK1 A;  3JVT C;  3R1O A;  3CR5 X;  3NGV A;  3BYA A;  1UUR A;  1FW4 A;  2JPT A;  1S36 A;  1BJF A;  2QDI A;  5CSJ A;  2M49 B;  3PAT A;  1XFR A;  3KO0 A;  2K7C A;  2K61 A;  1A4P A;  1LXF C;  3BQ3 A;  3OBV A;  4I5K A;  2M1K B;  2JOJ A;  3VRP A;  3DD4 A;  1TNW A;  1SW8 A;  4NQG A;  1BOC A;  5D7F A;  1M31 A;  2KPH A;  1IGV A;  2WCL A;  1UHH A;  1XFZ O;  2WC5 A;  1RJV A;  3IQQ A;  4GPL B;  3R1P A;  1ZFS A;  4JKT A;  1XFU O;  1DJY A;  4CPV A;  2KI4 B;  2G9B A;  3BJH A;  4N1G A;  3OB2 B;  4AQI A;  1J55 A;  4ORC B;  5B8I B;  4MSP A;  1SKT A;  1NIW A;  3PFV A;  2WC6 A;  1CLL A;  1F54 A;  2JUL A;  1NX0 A;  3ZNI A;  4YI9 A;  2I18 A;  2PQL A;  3M0W A;  3NSK A;  1K96 A;  1YX8 A;  2LC5 A;  1B8C A;  3D77 A;  3A4U B;  4PCW A;  2K7B A;  2LLU A;  1SYM A;  3B88 A;  3D75 A;  2KNE A;  1KFX L;  1KQV A;  1TCO B;  2WOR A;  3K1E A;  1KSM A;  1BR1 B;  2ZFD A;  3KF9 A;  2LVV A;  3I5I B;  5I94 A;  1OQP A;  1NSH A;  5KSZ A;  4OVN F;  4QJ3 B;  1YRU B;  1NCX A;  5I2L A;  1IIO A;  3BFA A;  1K95 A;  2AUC A;  3Q8I A;  3JTD B;  1QV0 A;  2LV7 A;  2M7L A;  2JXC A;  2NCP A;  1JFJ A;  1J7O A;  1G8I A;  1SMG A;  2LCP A;  3GK1 A;  1IRJ A;  3DVJ A;  1QX7 A;  1MR8 A;  4PHN A;  1DC1 A;  3OX5 A;  2F8P A;  2HPS A;  2EC6 C;  4P5O E;  1D1O A;  2JXL A;  4KYN A;  1DGU A;  2HF5 A;  2Y1N A;  2BL0 B;  4OZD A;  2Y1M A;  1S26 D;  5HKY A;  5KTY A;  2WND A;  3LCP C;  1V1G A;  2I7A A;  2NCO A;  4PE4 A;  3I5F B;  1DF0 B;  4L9M A;  2H8V A;  2FOT A;  3AKB A;  4YGC B;  5I2O A;  1S3P A;  1TUZ A;  1F4Q A;  3OP0 A;  1JSA A;  1M63 B;  2G2B A;  3PJI A;  3SG4 A;  3TS5 C;  1DVI A;  1JBA A;  3UO9 A;  2ZND A;  1XO5 A;  4YI8 A;  3D0Y B;  1J1E A;  3E3R A;  2H2K A;  1ALW A;  2CCM A;  2JRF A;  2EGD A;  2JT3 A;  2KI6 C;  1DJI A;  3JVT B;  3TDI A;  3VRN A;  4C0J A;  2KAX A;  2KDH A;  1YUT A;  4GBA A;  1ZOT B;  1S5G Y;  5D3O A;  4XYN A;  3I5H C;  2KBI A;  1AJ4 A;  1QTX A;  3SG2 A;  1XK4 C;  4F0Z B;  1S6C A;  3OHM B;  1DMO A;  1S5G Z;  1PRW A;  1EL4 A;  2MA2 A;  2BCA A;  3CWG A;  5HLV A;  3I5G C;  5TNC A;  2WOS A;  1K2H A;  1CM1 A;  2PYQ A;  2R2I A;  4GUK A;  1QIW A;  2L50 A;  2H61 C;  2LVK A;  2B1U A;  3NHI A;  3OX6 A;  3SS5 A;  4HSZ A;  4YGB B;  4MN0 A;  2Q4U A;  2L4I A;  2GGZ A;  1OSA A;  5CSN A;  1LA3 A;  3AKA A;  2I94 A;  3BUN B;  1XFV O;  2WCF A;  1SY9 A;  5DKQ A;  1F55 A;  2NLN A;  3OGN A;  1MXL C;  1IG5 A;  3EK8 A;  4USL A;  4TNC A;  3LL8 B;  5F6T A;  1SSE B;  4M2Q A;  1SR6 C;  2L4H A;  2P71 A;  1ORG A;  2BKH B;  1KQM C;  3EKJ A;  1L7Z A;  3L47 A;  2DOQ A;  1ZUZ A;  1MF8 B;  1XFY O; 
#chains in the Genus database with same CATH homology
 4YGA A;  3PSR A;  4JPZ B;  1DF0 A;  3BUM B;  1CB1 A;  3WNX B;  3O2P A;  3O6B A;  4ICB A;  3C1V A;  1U5I B;  1G4Y R;  1QS7 A;  2F33 A;  1CMF A;  2M8U A;  2BE6 A;  1XFW O;  3MSE B;  5ER4 X;  1IJ6 A;  3D0Y A;  4BY4 A;  1UUS A;  1JC2 A;  1PUL A;  2JQ6 A;  4PDZ A;  3DVE A;  1LA0 A;  1Q80 A;  2JTZ A;  1K9U A;  1Y1A A;  1KK7 Z;  2F3Z A;  2LP3 A;  2A4J A;  2FJU B;  3RLZ A;  4GFT A;  2M29 A;  1CKK A;  4OKH A;  1NCZ A;  1TNQ A;  2EC6 B;  1K94 A;  1MXE A;  1Y6W A;  3PLF B;  1KFU S;  2K2A A;  1G33 A;  2JTT A;  3DF0 A;  3EK4 A;  4M2P A;  4MZL A;  4UPG A;  2VRG A;  1MQ1 A;  3ICB A;  1REC A;  4PHM A;  5HYD A;  3IF7 A;  1B1G A;  3PN7 C;  5J3X A;  2M9G A;  4PHK A;  2M1U A;  1QX2 A;  1OOJ A;  1UWO A;  5HKW A;  1BT6 A;  3SG5 A;  3TS5 B;  3KHE A;  1LIN A;  1DJW A;  4FTG A;  4MZJ A;  2L5X B;  2EHB A;  1ZMZ A;  1TN4 A;  1B7T Z;  4NDC A;  2MRD A;  1GGZ A;  3AAJ A;  2I2R E;  1NWD A;  3CR2 A;  1M45 A;  1FI6 A;  2JNX A;  1CDL A;  2AAO A;  1K93 D;  4I5L B;  2KGB C;  1UHK A;  2LHL A;  4PAL A;  1RK9 A;  4FQO A;  3I5H B;  2O60 A;  3EVU A;  4GNK B;  1H4B A;  1YUR A;  2CXJ A;  2HQ8 A;  2JU0 A;  4CFQ A;  1YR5 A;  1WY9 A;  2ISD A;  2D8N A;  1A29 A;  3FS7 A;  3EKH A;  5AER A;  1TCF A;  2Y4Q A;  2ZN8 A;  4I5N B;  5G08 A;  3I5G B;  5CPV A;  2JZI A;  4DUQ A;  1YTZ C;  1U5I A;  1TNX A;  4E68 A;  2ZRS A;  3NSO A;  4MRX A;  1CFF A;  1QLS A;  1B47 A;  3NXA A;  3TZ1 A;  1CNP A;  1WLM A;  1AP4 A;  3BOW B;  2JWW A;  1OMV A;  1C07 A;  1TRF A;  2FCE A;  3CS1 A;  1K9P A;  1SR6 B;  4M2O A;  2COL B;  1CM4 A;  1KQM B;  4DCK A;  2O5G A;  2PSR A;  4P2Y B;  2Q91 A;  1IJ5 A;  3D10 A;  1X02 A;  2LLS A;  1KK8 C;  1SK6 D;  4MRY A;  4YGE B;  4PHJ A;  1DJX A;  1B8R A;  4I5J A;  1Y1U A;  4DRW A;  5AFP A;  2M97 A;  3KPX A;  1AVS A;  3SG7 A;  5HLO A;  2MBX A;  1F71 A;  4AOM A;  1XYD A;  2P6B B;  1TNP A;  1YUU A;  4CID A;  5I2Q A;  1WDC C;  3IQO A;  2KYF A;  2BEC A;  2OTG C;  1KFX S;  3VGO A;  4MVF A;  5IBW A;  5PAL A;  1EJ3 A;  3K21 A;  1NP8 A;  2BKI B;  5CSI A;  1QIV A;  4CFR A;  2LUX A;  5FYX A;  1R2U A;  2LMT A;  4R1E A;  2JNF A;  4Q04 A;  1EG4 A;  2KBM A;  4GGF C;  1H8B A;  1XK4 A;  1EG3 A;  1QVI Z;  1NX3 A;  2JT8 A;  1L2O C;  4YRU A;  1DJH A;  2LAN A;  1FBV A;  3OB1 B;  3VRO A;  1QAS A;  3PN7 B;  5K89 A;  1YX7 A;  2H61 A;  1CDP A;  5AEQ A;  1Y1X A;  3GK4 X;  1LKJ A;  3BUX B;  2L0P A;  5JOL A;  1A75 B;  1NCY A;  4WQ3 A;  1UP5 A;  2SAS A;  1BLQ A;  3DVK A;  1KCY A;  2MAZ A;  2LVJ A;  2E30 A;  3HX4 A;  3H4S E;  3SG3 A;  3BOW A;  4OCI A;  4CLN A;  1LVC D;  1NPQ A;  4PE1 A;  4ETO A;  1NYA A;  2CTN A;  1PAL A;  1SNL A;  4ZCV A;  1CFP A;  1TTX A;  1GJY A;  1UHI A;  2M3W A;  4ORA B;  1B9A A;  4ORB B;  2BCX A;  4MZK A;  2PAL A;  4MBE A;  4BY5 A;  4C0L A;  1AHR A;  3SIA A;  2ZNE A;  2ZKM X;  4GGN A;  1N0Y A;  1IQ5 A;  2MLE C;  1JF2 A;  1SCM C;  2KAY A;  1KK7 Y;  2NXQ A;  1PSB A;  3PM8 A;  2QPT A;  4A4C A;  3EK7 A;  1XVJ A;  1CLB A;  1NUB A;  1TIZ A;  5D69 A;  2KAV A;  4YGD B;  2LLT A;  2BBM A;  2LHI A;  1BF5 A;  1SCV A;  4NDD A;  4JQ0 D;  1C7V A;  1SBJ A;  1QXP A;  1TOP A;  2V53 A;  3BUW B;  3PAL A;  5I8N A;  3TUY C;  2WC8 A;  5DKR A;  1EH2 A;  1SL9 A;  2K0J A;  1JUO A;  1KK8 B;  2PAS A;  1W7I B;  1RWY A;  1B7T Y;  2KGR A;  2KI6 D;  2M0R A;  1IKU A;  1CFC A;  1JWD A;  2JT0 A;  1DJZ A;  1MWN A;  1IH0 A;  1A75 A;  1GQM A;  2LUC A;  4OV2 A;  3WXA A;  1B4C A;  1J7P A;  1F70 A;  1WDC B;  1RFJ A;  5HKZ A;  1HT9 A;  2OTG B;  1XFX O;  3WHT B;  4C0K A;  2NZ0 A;  2LMV A;  1YRT B;  3SIB A;  1RRO A;  2KSP A;  2OPO A;  1BR4 B;  1PSR A;  1RTP 1;  1CMG A;  1JFK A;  1MUX A;  3CGA A;  1NX1 A;  3FIA A;  1QX5 B;  1AK8 A;  1S6I A;  2PVB A;  4NDB A;  1YUS A;  3LK0 A;  4IL1 A;  5BPJ A;  1BG1 A;  1ALV A;  2F2O A;  2M7N A;  2KQ6 A;  3CLN A;  1L2O B;  4XJK B;  1QLK A;  5KU1 A;  2AMI A;  2IS9 A;  2KOT A;  1N65 A;  4N5X A;  1M39 A;  1PVB A;  2HQW A;  2OS8 C;  1C7W A;  4DIR A;  2F3Y A;  3CR4 X;  3TDU A;  2FCD A;  3GOF A;  2QAC A;  2MHH A;  2L98 A;  1XA5 A;  1W7J B;  1PVA A;  1AUI B;  3BUO B;  1KWO C;  1ZAC A;  4MLW A;  4WRI A;  3VRR A;  4MEW A;  4QJ5 B;  1OZS A;  2WCE A;  2CT9 A;  2SCP A;  2LM5 A;  1BMO A;  3FWB A;  4PE0 A;  2BE4 A;  1UHJ A;  2ZRT A;  4DS7 A;  3EVR A;  3FWC A;  3HCM A;  4JWQ A;  1OE9 B;  2CBL A;  5JJG A;  1CFD A;  1K9K A;  1N2D A;  2HET A;  1IQ3 A;  1WRL A;  1YVH A;  1SCM B;  4HRE E;  1DJG A;  1CLM A;  1SRA A;  1WRK A;  4D1E A;  1CDM A;  4AQJ A;  1FI5 A;  3DVM A;  1MHO A;  4A4B A;  3GK2 A;  2LNK A;  3NSI A;  1E8A A;  2KI4 C;  3A8R A;  1R6P A;  3EVV A;  5GQQ C;  2L2E A;  1FF1 A;  3RM1 A;  1QVI Y;  1UHN A;  2LVI A;  5AXI A;  2TN4 A;  2KYC A;  1J7R A;  1S6J A;  1SPY A;  4QJ4 B;  2BCB A;  1BOD A;  1HQV A;  4PE7 A;  4GGF A;  3WHU B;  1AJ5 A;  2BBN A;  3TUY B;  1DT7 B;  1JF0 A;  1QAT A;  4YBH B;  4XJK A;  2KFH A;  1BU3 A;  2ZN9 A;  3TDZ A;  3O78 A;  2Y5I A;  3LLE A;  2F2P A;  2KHN A;  1KSO A;  4HRG A;  4ZCU A;  2GGM A;  3VRQ A;  3ZWH A;  1SL8 A;  2MLF C;  1QV1 A;  3BXK A;  5DKN A;  1FPW A;  4U8D A;  3SG6 A;  1DGV A;  2LAP A;  3DF0 B;  3KEV A;  1EXR A;  1ODB A;  1A2X A;  3I5I C;  4N1F A;  1F4O A;  3CZT X;  2E6W A;  1K8U A;  3F45 A;  1K90 D;  3JTD C;  1CDN A;  1KFU L;  1CTR A;  2K2F A;  1WLZ A;  2LMU A;  2K7D A;  2WCB A;  2MJW B;  1PK0 D;  4WQ2 A;  1B8L A;  1IWQ A;  1OMD A;  1J7Q A;  1SL7 A;  2KFG A;  1A03 A;  2BL0 C;  1NX2 A;  2JC2 A;  1WRZ A;  2LE9 B;  2PMY A;  1S1E A;  2CNP A;  2GV5 A;  3I5F C;  1YVL A;  1F8H A;  1J1D A;  1DTL A;  1OZO A;  4GAO A;  3AAK A;  2K7O A;  2OS8 B;  3QRX A;  3O4Y A;  1QJT A;  2KQY A;  3NSL A;  1Y0V H;  1V1F A;  1OMR A;  2L51 A;  5AAN A;  2KFF A;  2PRU A;  5ER5 A;  4HRH A;  3SJS A;  1KWO B;  1VRK A;  3CTN A;  4OR9 B;  2RGI A;  2K8M B;  5CSF A;  1M46 A;  2LP2 A;  3LK1 A;  3JVT C;  3CR5 X;  5CSJ A;  3BYA A;  1UUR A;  1FW4 A;  2JPT A;  1S36 A;  1BJF A;  1GGW A;  2M49 B;  3PAT A;  3KO0 A;  2K7C A;  2K61 A;  1A4P A;  1LXF C;  3BQ3 A;  4I5K A;  2M1K B;  2JOJ A;  3VRP A;  3DD4 A;  1TNW A;  1SW8 A;  4NQG A;  1BOC A;  5D7F A;  1M31 A;  1IGV A;  1UHH A;  1XFZ O;  1RJV A;  3IQQ A;  4GPL B;  1ZFS A;  1XFU O;  1DJY A;  4CPV A;  2KI4 B;  2G9B A;  4N1G A;  3OB2 B;  4AQI A;  1J55 A;  4ORC B;  5B8I B;  4MSP A;  1SKT A;  1NIW A;  3PFV A;  1CLL A;  1F54 A;  2JUL A;  1NX0 A;  3ZNI A;  4YI9 A;  2I18 A;  3M0W A;  3NSK A;  1K96 A;  1YX8 A;  2LC5 A;  1B8C A;  3A4U B;  4PCW A;  2K7B A;  2LLU A;  1SYM A;  2KNE A;  1KFX L;  1KQV A;  1TCO B;  2WOR A;  1KSM A;  1BR1 B;  2ZFD A;  3KF9 A;  2LVV A;  3I5I B;  1OQP A;  1NSH A;  5KSZ A;  4OVN F;  4QJ3 B;  1YRU B;  1NCX A;  5I2L A;  1K95 A;  2AUC A;  3JTD B;  1QV0 A;  2LV7 A;  2M7L A;  2JXC A;  2NCP A;  1JFJ A;  1J7O A;  1G8I A;  1SMG A;  2LCP A;  3GK1 A;  1IRJ A;  3DVJ A;  1QX7 A;  1MR8 A;  4PHN A;  3OX5 A;  2F8P A;  2HPS A;  2EC6 C;  4P5O E;  1D1O A;  2JXL A;  1DGU A;  2HF5 A;  2Y1N A;  2BL0 B;  5HKY A;  2Y1M A;  1S26 D;  5KTY A;  2WND A;  3LCP C;  1V1G A;  2I7A A;  2NCO A;  4PE4 A;  3I5F B;  1DF0 B;  4L9M A;  3AKB A;  2FOT A;  4YGC B;  5I2O A;  1S3P A;  1F4Q A;  3OP0 A;  1JSA A;  1M63 B;  2G2B A;  3SG4 A;  3TS5 C;  1DVI A;  1JBA A;  2ZND A;  1XO5 A;  4YI8 A;  3D0Y B;  1J1E A;  3E3R A;  2H2K A;  1ALW A;  2CCM A;  2JRF A;  2EGD A;  2JT3 A;  2KI6 C;  1DJI A;  3JVT B;  3TDI A;  3VRN A;  4C0J A;  2KAX A;  2KDH A;  1YUT A;  4GBA A;  1ZOT B;  1S5G Y;  4XYN A;  3I5H C;  2KBI A;  1AJ4 A;  1QTX A;  3SG2 A;  1XK4 C;  4F0Z B;  1S6C A;  3OHM B;  1DMO A;  1S5G Z;  1PRW A;  1EL4 A;  2MA2 A;  2BCA A;  3CWG A;  5HLV A;  3I5G C;  5TNC A;  2WOS A;  1K2H A;  1CM1 A;  2R2I A;  4GUK A;  1QIW A;  2L50 A;  2H61 C;  2LVK A;  2B1U A;  3OX6 A;  4HSZ A;  4YGB B;  4MN0 A;  2Q4U A;  2L4I A;  2GGZ A;  1OSA A;  5CSN A;  1LA3 A;  3AKA A;  2I94 A;  3BUN B;  1XFV O;  2WCF A;  1SY9 A;  5DKQ A;  1F55 A;  2NLN A;  1MXL C;  1IG5 A;  3EK8 A;  4USL A;  4TNC A;  3LL8 B;  5F6T A;  4M2Q A;  1SR6 C;  2L4H A;  2BKH B;  1KQM C;  3EKJ A;  1L7Z A;  2DOQ A;  1ZUZ A;  1MF8 B;  1XFY O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...