1MR8A

Migration inhibitory factor-related protein 8 from human
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
90
structure length
90
Chain Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords MIGRATION INHIBITORY FACTOR-RELATED PROTEIN 8
publication title The structure of human MRP8, a member of the S100 calcium-binding protein family, by MAD phasing at 1.9 A resolution.
pubmed doi rcsb
total genus 37
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1mr8A00
1K95A 5HKYA 1J7OA 1A2XA 1S26D 4WQ3A 2B1UA 1WDCC 2LV7A 3MSEB 1OMRA 1CLLA 4HSZA 1CM4A 4GAOA 1IQ5A 3I5FC 2JT3A 2F8PA 1KQMB 2BBMA 2BKIB 3JVTB 4MRYA 2EC6C 1H8BA 1LA3A 3EK7A 1RWYA 3NSLA 1B1GA 2VRGA 3WHUB 1TCFA 3AAKA 1LINA 1GQMA 1AJ5A 1M31A 2AAOA 1W7IB 3AKBA 4ZCUA 4YGBB 4N1FA 4BY5A 3OB2B 3GK1A 3I5HB 5CPVA 1PK0D 3BOWB 4OKHA 1SKTA 1Y1AA 1G8IA 4XYNA 2F33A 1YRUB 1BT6A 1N0YA 1V1GA 1ZFSA 2PRUA 1KFUS 4U8DA 2JT8A 5B8IB 1QXPA 1SRAA 2HQWA 2LCPA 2NCPA 2H61C 3TUYB 3WHTB 2LLTA 1JSAA 5HLOA 1S6IA 4PE0A 2QPTA 4OCIA 1XFZO 1YRTB 1Y1UA 3VROA 1LA0A 4MEWA 3SG4A 1B7TY 3ZNIA 1CM1A 3O78A 3OHMB 4AQJA 2KSPA 1KQMC 1MR8A 3JVTC 1K9UA 4GBAA 2M1KB 3D10A 1RJVA 2JU0A 2PMYA 3K21A 1S5GZ 2L2EA 1W7JB 2E30A 1DGVA 1KK7Z 2WCFA 3SIBA 2FCDA 3CR4X 2KBIA 2L4HA 1CDMA 5CSIA 1DF0B 3F45A 1TNPA 2LE9B 1QLKA 4WQ2A 1AVSA 1PULA 1UHNA 2KAVA 4N1GA 3SJSA 3PFVA 4ICBA 5AFPA 5CSNA 2QACA 2GV5A 1K9KA 2M7NA 3BUWB 1QVIZ 1SL8A 3VRQA 3DVEA 2KI6C 2LC5A 5G08A 2Y5IA 1D1OA 2K7BA 1OQPA 1HQVA 2M49B 2KI6D 3FWCA 3RLZA 1YUUA 3TUYC 4USLA 3ICBA 1F70A 5JOLA 2JTZA 2EGDA 4GGFC 4XJKA 2MHHA 1WRZA 1XFVO 3PLFB 5CSFA 3RM1A 1TTXA 5I2OA 1BJFA 4N5XA 1A4PA 2I18A 1JWDA 2JRFA 1QX2A 3A8RA 3LLEA 2CBLA 1DJIA 4YI9A 1WY9A 5D69A 1YVLA 1JF2A 4OV2A 2ZNEA 1F71A 4ETOA 1DJZA 5KTYA 1PVAA 1U5IA 2LUXA 1B8CA 2PASA 5D7FA 1CKKA 1CB1A 2KFHA 3I5IB 5F6TA 1UHKA 1SPYA 4ZCVA 1A75A 3HX4A 1DTLA 1NX3A 2KGBC 2I7AA 5HKWA 1C7WA 1QX5B 2EHBA 5HLVA 2LHLA 1KQVA 1IJ5A 3TDZA 2ZN8A 1NCYA 3H4SE 4FTGA 4I5JA 1MF8B 4NDCA 2M97A 3QRXA 4PHJA 1YURA 2IS9A 3FIAA 1JUOA 1Q80A 1NX0A 1KFUL 4ORCB 2HETA 1RTP1 3BUMB 5TNCA 1RECA 1LVCD 2KFGA 1SCVA 2LHIA 4HRGA 4DIRA 5CSJA 1SNLA 1MXLC 1DVIA 1MXEA 2Y1NA 2KYFA 4ORBB 1DJXA 1B9AA 4IL1A 1K8UA 4AOMA 1N2DA 2LP3A 4DCKA 1UHHA 2COLB 4PDZA 2LVJA 2R2IA 5AEQA 2LMUA 5ER5A 1C07A 1SR6B 2K2FA 2LMVA 3I5IC 1V1FA 3PATA 1SYMA 4CLNA 2JC2A 2KNEA 2I94A 1Y0VH 1ZACA 3OX6A 2M0RA 1AHRA 1QS7A 1OMVA 2BE6A 2LAPA 2CCMA 1NYAA 1M45A 1YR5A 1VRKA 1TNXA 2LVIA 3CGAA 4MRXA 5AERA 2JT0A 1QATA 2KAXA 1KK8B 2LANA 1UUSA 1TN4A 1F4QA 2KOTA 1MHOA 1DJHA 1A29A 1BF5A 2RGIA 4YI8A 1WRLA 2DOQA 2CNPA 3CWGA 3O6BA 1S5GY 3NXAA 2LP2A 1JF0A 1KK7Y 4MSPA 3GOFA 4XJKB 1TNQA 3EKJA 2LMTA 2MRDA 3SIAA 1FW4A 1Y6WA 4CPVA 1J7QA 1FI5A 2LM5A 4PHMA 1SR6C 3LK0A 1XFYO 2GGZA 4QJ4B 3BYAA 1F54A 1JBAA 1QVIY 2BCXA 5PALA 3C1VA 3WXAA 1KCYA 2NXQA 1H4BA 1K93D 3BXKA 3IQOA 1M63B 4TNCA 4BY4A 4CFRA 2JWWA 1J1EA 3CTNA 3CLNA 4OR9B 2H2KA 1U5IB 3AAJA 4HREE 1GGWA 1JFKA 5IBWA 1IKUA 2K7CA 1MWNA 2BKHB 1QIVA 4F0ZB 3KPXA 1NWDA 2M3WA 1KFXS 2L4IA 3LL8B 2L0PA 3EVUA 1A75B 1KK8C 2F2PA 4JWQA 1WRKA 2BCAA 3TZ1A 1B4CA 1IRJA 4C0JA 1KSMA 1K2HA 4GPLB 3DVMA 2KI4B 3CZTX 4I5LB 1XFWO 1J1DA 2L5XB 1LXFC 1OZSA 1LKJA 5DKRA 4PE1A 1X02A 3CR5X 5J3XA 1ALWA 1NIWA 1QV1A 1YTZC 1UURA 3O4YA 2E6WA 2BE4A 3SG2A 4YGCB 3CR2A 2ZRTA 2JXLA 5GQQC 1XYDA 1BODA 2F3YA 2LNKA 1JC2A 3PSRA 4WRIA 1DT7B 2M29A 1F55A 3EVRA 5ER4X 2KGRA 4DUQA 1CLMA 1WLZA 3DVJA 4MZKA 1WLMA 3BQ3A 3FS7A 1QTXA 2G9BA 2F3ZA 4YGAA 2K0JA 2KAYA 2GGMA 1S3PA 2F2OA 2M9GA 1XVJA 3ZWHA 1EJ3A 1YVHA 1ZOTB 4I5NB 1FI6A 3SG3A 1SL9A 1YX8A 1M39A 1IJ6A 3D0YA 3OB1B 1TRFA 2Y1MA 1QIWA 4MZJA 2KI4C 2JNXA 3PALA 1CDPA 1L2OB 1R2UA 1CFDA 1DJYA 2ISDA 5JJGA 1J7PA 2I2RE 1N65A 1QASA 2BL0B 2V53A 1GJYA 4YBHB 1PSBA 3DD4A 2HF5A 5I8NA 1KSOA 4YGEB 1BMOA 1XK4A 1K94A 2FOTA 1EG4A 1TCOB 1J55A 1XFXO 4MVFA 1SL7A 4PE7A 1M46A 1FBVA 2Q91A 2BBNA 2LLSA 3LCPC 2K7DA 1ALVA 1RFJA 2NLNA 1DGUA 1K90D 1RK9A 2OTGB 1OMDA 1J7RA 1EL4A 2JQ6A 1SK6D 1PALA 2FJUB 2LVVA 2PVBA 2CT9A 2KFFA 4HRHA 1IG5A 1CFCA 2KBMA 3EK8A 4ORAB 3I5GB 2O5GA 5BPJA 1L2OC 1KFXL 1XO5A 2BCBA 2BL0C 2LUCA 3LK1A 1EH2A 1OSAA 3KEVA 2L50A 2MAZA 1EG3A 1SCMB 4FQOA 1PSRA 1TIZA 4YRUA 5I2LA 3IF7A 3JTDB 1BR1B 1F4OA 1SY9A 2M1UA 2WCBA 4R1EA 1CDLA 1UWOA 4UPGA 2LVKA 4P2YB 1MUXA 2LLUA 4YGDB 4I5KA 1XFUO 2PSRA 5KSZA 2AMIA 2WOSA 3VRNA 1NUBA 2MBXA 2PALA 1G33A 1IGVA 1UP5A 2OTGC 3PN7B 3WNXB 3BUOB 1SBJA 2L51A 3TDUA 3KF9A 2G2BA 2K2AA 1C7VA 1FF1A 1B8RA 2KHNA 4GUKA 1KWOB 1YUTA 3GK2A 1IH0A 3AKAA 3I5GC 3TDIA 1NCXA 1IQ3A 1UHIA 1BR4B 4A4BA 4OVNF 3VRRA 1EXRA 1NX1A 1CFFA 1L7ZA 1NCZA 1CNPA 1ZMZA 1ODBA 1K9PA 2WORA 4PCWA 4JQ0D 3IQQA 1S1EA 3D0YB 4GFTA 1SCMC 2TN4A 1NPQA 4A4CA 1JFJA 2Y4QA 1S6CA 2A4JA 4AQIA 3SG7A 3JTDC 3CS1A 1DMOA 2L98A 2NCOA 2ZRSA 3OP0A 2AUCA 2CXJA 2MLEC 2JPTA 4MN0A 5FYXA 3DF0A 2O60A 2JTTA 2CTNA 3KHEA 3SG6A 1Y1XA 2FCEA 2K7OA 3PN7C 2MLFC 4P5OE 2OPOA 5AXIA 1DJGA 4MZLA 2NZ0A 2ZKMX 1HT9A 1DJWA 1KWOC 4MLWA 4PE4A 5DKQA 1YX7A 2H61A 2KQ6A 3TS5B 1FPWA 1G4YR 1QX7A 1S6JA 1TNWA 2KYCA 3EK4A 2JZIA 1S36A 2WCEA 2ZNDA 3SG5A 4C0LA 1AP4A 1CTRA 1F8HA 2KQYA 3VRPA 2K8MB 1B47A 2P6BB 3I5HC 1CMGA 2D8NA 2JXCA 1BOCA 2WNDA 4PALA 2SCPA 5I2QA 1PVBA 4CIDA 4PHNA 2MA2A 4NQGA 5AANA 1IWQA 1OE9B 2KDHA 1B7TZ 3E3RA 1TOPA 1CLBA 1BU3A 1XK4C 2OS8B 3BUNB 3BOWA 3VGOA 4D1EA 3NSIA 4JPZB 4MBEA 1ZUZA 1PRWA 2M7LA 1AK8A 1OOJA 5KU1A 2JOJA 1AJ4A 2JULA 3EVVA 4QJ3B 3TS5C 1MQ1A 1BLQA 4L9MA 4GGNA 4Q04A 4GGFA 1CDNA 3OX5A 1CMFA 3NSKA 2ZN9A 3FWBA 1QLSA 4DRWA 1B8LA 2WC8A 3M0WA 1QJTA 2HQ8A 1K96A 1E8AA 1NX2A 3GK4X 1A03A 3NSOA 4M2OA 2SASA 4NDBA 2MJWB 3PM8A 1SW8A 2K61A 1WDCB 1CFPA 2Q4UA 2M8UA 4GNKB 3I5FB 1QV0A 1DF0A 2EC6B 1BG1A 1AUIB 2HPSA 2OS8C 3HCMA 1NSHA 1OZOA 4E68A 1NP8A 4M2QA 4QJ5B 3DF0B 3KO0A 5K89A 1R6PA 5HKZA 4NDDA 3A4UB 1SMGA 3EKHA 5HYDA 1RROA 4DS7A 2BECA 5DKNA 3DVKA 4C0KA 1GGZA 4PHKA 2JNFA 2ZFDA 1XA5A 4CFQA 4M2PA 1UHJA 3O2PA 3BUXB 1YUSA
chains in the Genus database with same CATH superfamily
1OOGA 1K95A 5HKYA 1J7OA 1A2XA 1S26D 4WQ3A 2B1UA 1WDCC 2LV7A 3MSEB 1OMRA 1CLLA 4HSZA 1CM4A 4GAOA 1IQ5A 3I5FC 2JT3A 2F8PA 1KQMB 2BBMA 2BKIB 3JVTB 4MRYA 2EC6C 2QDIA 1LA3A 3S0EA 3EK7A 1H8BA 1RWYA 3NSLA 1B1GA 2VRGA 4JD9A 3WHUB 1TCFA 3AAKA 1LINA 1AJ5A 1GQMA 1M31A 1W7IB 2AAOA 3AKBA 4ZCUA 4IJ7A 3UNWA 4YGBB 4N1FA 4BY5A 3OB2B 3GK1A 3I5HB 5CPVA 1PK0D 3BOWB 4OKHA 1SKTA 1Y1AA 1G8IA 4XYNA 1C07A 2F33A 1YRUB 1BT6A 1N0YA 1V1GA 1ZFSA 2PRUA 1KFUS 4U8DA 2JT8A 5B8IB 1QXPA 1SRAA 2HQWA 2LCPA 2NCPA 2H61C 2KLEA 3TUYB 3WHTB 2LLTA 1JSAA 5HLOA 1S6IA 4PE0A 2QPTA 4OCIA 1XFZO 3QMEA 1YRTB 1Y1UA 3VROA 1LA0A 4MEWA 3SG4A 1B7TY 3ZNIA 1CM1A 3O78A 3OHMB 4AQJA 2BAPA 2KSPA 1KQMC 1MR8A 3JVTC 4JKTA 1K9UA 3R1PA 4GBAA 2M1KB 3D10A 1RJVA 3V2LA 2JU0A 2PMYA 3D78A 1DELA 3K21A 4INXA 1S5GZ 2L2EA 1W7JB 2E30A 1DGVA 1KK7Z 2H8VA 2WCFA 3SIBA 2FCDA 3CR4X 2KBIA 2L4HA 1CDMA 5CSIA 1DF0B 3F45A 1TNPA 2LE9B 1QLKA 2KLDA 4WQ2A 1XFRA 1AVSA 1PULA 1SSEB 1UHNA 2KAVA 4N1GA 3PFVA 4ICBA 3SJSA 5CSNA 2QACA 2GV5A 1K9KA 2M7NA 3BUWB 1QVIZ 1SL8A 2QEBA 5I94A 3VRQA 3DVEA 2KI6C 2LC5A 4KYNA 5G08A 2Y5IA 1D1OA 2K7BA 1OQPA 1HQVA 2M49B 2KI6D 3FWCA 3RLZA 1YUUA 3TUYC 4USLA 3ICBA 1F70A 5JOLA 2JTZA 1OOFA 2EGDA 4GGFC 4XJKA 4FQTA 2MHHA 1WRZA 1XFVO 3PLFB 5CSFA 3RM1A 1TTXA 5I2OA 1BJFA 3D75A 4N5XA 1A4PA 3D76A 2I18A 1JWDA 2JRFA 3S0GA 1QX2A 3A8RA 3LLEA 2CBLA 1DJIA 4YI9A 1WY9A 5D69A 1YVLA 1JF2A 4OV2A 2ZNEA 1F71A 4ETOA 2QEHA 1DJZA 3CABA 1PVAA 1U5IA 2LUXA 1B8CA 2PASA 5KTYA 5D7FA 1CKKA 1CB1A 2KFHA 3I5IB 5F6TA 1UHKA 3DYEA 2KPHA 1SPYA 4ZCVA 1A75A 3HX4A 1DTLA 1NX3A 2KGBC 2I7AA 5HKWA 1C7WA 1QX5B 2EHBA 2L5YA 3CZ2A 1DC1A 2P71A 5HLVA 2LHLA 1KQVA 1IJ5A 3TDZA 2ZN8A 1NCYA 3H4SE 4FTGA 4I5JA 1MF8B 3NHTA 4NDCA 2M97A 3QRXA 5EL2A 4PHJA 1YURA 2IS9A 3FIAA 1JUOA 1Q80A 1NX0A 1KFUL 4ORCB 2HETA 1RTP1 3BUMB 5TNCA 1RECA 1LVCD 2KFGA 1SCVA 2LHIA 3FE9A 4HRGA 4DIRA 1TUJA 5CSJA 5FI6A 1SNLA 1MXLC 1CNPA 1DVIA 1MXEA 2Y1NA 2KYFA 4ORBB 1DJXA 1B9AA 4IL1A 1K8UA 3OGNA 1N2DA 2LP3A 4AOMA 1UHHA 2COLB 4PDZA 2LVJA 2R2IA 5AEQA 2LMUA 5ER5A 4DCKA 1SR6B 2K2FA 2LMVA 3I5IC 1V1FA 3PATA 1SYMA 3R1VA 4CLNA 2JC2A 2KNEA 2I94A 1Y0VH 1ZACA 3OX6A 2M0RA 1AHRA 1QS7A 1OMVA 2BE6A 2LAPA 2CCMA 1NYAA 3B87A 5D3OA 1M45A 1YR5A 2PQLA 1VRKA 1TNXA 2LVIA 3CGAA 3OBVA 4MRXA 2JT0A 5FI7A 1QATA 2KAXA 1KK8B 5AERA 2LANA 1UUSA 1TN4A 1F4QA 2KOTA 1MHOA 1DJHA 1A29A 5AFPA 1BF5A 2RGIA 4YI8A 1WRLA 2DOQA 2CNPA 3CWGA 3O6BA 3S0BA 1S5GY 3NXAA 2LP2A 1JF0A 1KK7Y 4MSPA 3GOFA 4XJKB 1TNQA 3EKJA 2LMTA 2MRDA 3SIAA 1FW4A 1Y6WA 3IVTA 4CPVA 1J7QA 2LM5A 1FI5A 4PHMA 1SR6C 3LK0A 1XFYO 2GGZA 4QJ4B 3BYAA 1F54A 1JBAA 1QVIY 2BCXA 5PALA 3C1VA 3BFAA 3WXAA 1OOIX 1KCYA 2NXQA 1H4BA 1K93D 3BXKA 3IQOA 1M63B 4TNCA 3UO9A 4BY4A 4CFRA 2JWWA 1J1EA 3CTNA 3CLNA 4OR9B 2H2KA 1U5IB 3AAJA 4HREE 1GGWA 1JFKA 5IBWA 1IKUA 2K7CA 1MWNA 2BKHB 1QIVA 4F0ZB 3KPXA 1NWDA 2M3WA 1KFXS 2L4IA 3LL8B 2L0PA 3N7HA 3EVUA 1A75B 1KK8C 2F2PA 4JWQA 1WRKA 2BCAA 3TZ1A 1B4CA 1GM0A 1IRJA 2ERBA 4C0JA 1KSMA 1K2HA 4GPLB 3VB1A 3DVMA 2KI4B 3CZTX 4I5LB 1Z2CB 1XFWO 1J1DA 2L5XB 1LXFC 1OZSA 1LKJA 1P28A 2WC5A 1TUZA 3SS3A 5DKRA 4PE1A 1X02A 3CR5X 3NGVA 3BFBA 5J3XA 5DICA 1ALWA 1NIWA 1QV1A 1YTZC 1UURA 3O4YA 2E6WA 2BE4A 3SG2A 4YGCB 3CR2A 2ZRTA 2JXLA 5GQQC 1XYDA 1BODA 2F3YA 2LNKA 1JC2A 3PSRA 4WRIA 1DT7B 2M29A 1F55A 3EVRA 5HL1A 5ER4X 2QEOA 2KGRA 4DUQA 1CLMA 1WLZA 3DVJA 4MZKA 1WLMA 3BQ3A 3FS7A 3EG5B 1QTXA 1QWVA 2G9BA 2F3ZA 4YGAA 2K0JA 2KAYA 2GGMA 1S3PA 2F2OA 2M9GA 1XVJA 2P70A 1EJ3A 4INWA 3ZWHA 1YVHA 1ZOTB 4I5NB 1FI6A 3SG3A 1SL9A 1YX8A 1M39A 1IJ6A 3D0YA 3OB1B 4F7FA 1TRFA 2Y1MA 1QIWA 3CYZA 4MZJA 2KI4C 2JNXA 3PALA 1CDPA 1L2OB 1R2UA 1CFDA 1DJYA 3BJHA 2ISDA 5JJGA 1J7PA 2I2RE 1N65A 1QASA 2BL0B 2V53A 3DXLA 1GJYA 2PYQA 1PSBA 4YBHB 3DD4A 2HF5A 5I8NA 1KSOA 4YGEB 1BMOA 1XK4A 1K94A 2FOTA 1EG4A 1TCOB 3DZTA 1J55A 1XFXO 4MVFA 1SL7A 4PE7A 1M46A 1FBVA 2Q91A 2BBNA 2LLSA 3LCPC 2K7DA 1IIOA 1ALVA 1RFJA 2NLNA 1DGUA 1K90D 1RK9A 1T14A 2K60A 2OTGB 1OMDA 3NHIA 3R1OA 3S0AA 1J7RA 1EL4A 2JQ6A 1SK6D 1PALA 2FJUB 2LVVA 2PVBA 2CT9A 2KFFA 4HRHA 1IG5A 1CFCA 2KBMA 3EK8A 4ORAB 3I5GB 3PM2A 2O5GA 5BPJA 1L2OC 1KFXL 1XO5A 2BCBA 2BL0C 2LUCA 3LK1A 1EH2A 1OSAA 2GTEA 3KEVA 2L50A 2MAZA 1EG3A 2WCMA 1SCMB 4FQOA 1PSRA 1TIZA 3O4XA 2FJYA 4YRUA 5I2LA 3IF7A 3JTDB 1BR1B 1F4OA 1SY9A 2M1UA 2WCBA 3DY9A 3FE8A 1CDLA 1UWOA 4R1EA 4UPGA 2LVKA 4P2YB 1MUXA 2LLUA 3L47A 4I5KA 4YGDB 1XFUO 2PSRA 5KSZA 3R72A 2AMIA 2WOSA 3VRNA 1NUBA 2MBXA 2PALA 3B86A 1G33A 1IGVA 1UP5A 2OTGC 2WCLA 3PN7B 3WNXB 3BUOB 1SBJA 2L51A 3D73A 3TDUA 3KF9A 2G2BA 2K2AA 1C7VA 1FF1A 1B8RA 2KHNA 4GUKA 5FI2A 1KWOB 1YUTA 2WCHA 3GK2A 3AKAA 1IH0A 3I5GC 3TDIA 1NCXA 1IQ3A 1UHIA 3B88A 3CZ0A 1BR4B 4A4BA 4OVNF 3VRRA 3D74A 1EXRA 1NX1A 3SS4A 1L7ZA 1NCZA 1CFFA 1ZMZA 1ODBA 1K9PA 2WORA 3Q8IA 4JQ0D 4PCWA 3S0DA 3IQQA 1S1EA 3D0YB 4GFTA 1SCMC 2TN4A 1NPQA 4A4CA 1W9ZA 1JFJA 2Y4QA 4PT1A 1S6CA 2A4JA 4AQIA 3SG7A 3JTDC 3CS1A 1DMOA 2L98A 2NCOA 3K1EA 2ZRSA 3OP0A 2AUCA 1TWOA 2CXJA 2MLEC 2JPTA 4MN0A 5FYXA 3DF0A 2O60A 2JTTA 2CTNA 3KHEA 3SG6A 1Y1XA 2FCEA 2K7OA 3PN7C 1OW4A 2MLFC 2OPOA 4P5OE 5AXIA 1DJGA 1C3YA 4MZLA 1DEKA 2NZ0A 2ZKMX 1HT9A 1DJWA 1KWOC 4MLWA 4PE4A 2WCJA 1YX7A 2WCKA 3B6XA 2H61A 2KQ6A 5DKQA 3TS5B 1FPWA 1ORGA 1DQEA 1G4YR 1QX7A 3L4AA 1S6JA 1TNWA 2KYCA 2QEVA 3EK4A 2JZIA 1S36A 2WCEA 2ZNDA 3SG5A 4C0LA 1AP4A 1CTRA 1F8HA 2KQYA 4OZDA 3VRPA 2K8MB 1B47A 2P6BB 3I5HC 1CMGA 2D8NA 2JXCA 1C3ZA 1BOCA 2JPOA 2WNDA 4PALA 2SCPA 5I2QA 1PVBA 4CIDA 3L4LA 4PHNA 2MA2A 4NQGA 5AANA 1IWQA 1OE9B 2KDHA 1B7TZ 3E3RA 1TOPA 1CLBA 1BU3A 1XK4C 2OS8B 3BUNB 3BOWA 3FE6A 3VGOA 1LS8A 3NSIA 4D1EA 3BFHA 4JPZB 3S0FA 4MBEA 1ZUZA 1PRWA 2M7LA 2YGUA 1AK8A 1OOJA 5KU1A 2JOJA 1AJ4A 2JULA 3EVVA 4QJ3B 3TS5C 1MQ1A 1BLQA 4L9MA 4GGNA 4Q04A 4GGFA 1CDNA 3OX5A 3SS5A 3NSKA 1CMFA 2ZN9A 3FWBA 1QLSA 4DRWA 1Z4HA 1B8LA 2WC8A 3M0WA 1QJTA 2HQ8A 3RZSA 1K96A 1E8AA 1NX2A 3GK4X 1A03A 3CDNA 3NSOA 4M2OA 2SASA 4NDBA 2MJWB 3PM8A 1SW8A 2K61A 1WDCB 1CFPA 2Q4UA 2M8UA 4GNKB 3CZ1A 3I5FB 2L2CA 1QV0A 1DF0A 2EC6B 2WC6A 1BG1A 1AUIB 2HPSA 2OS8C 3HCMA 1NSHA 1OZOA 4E68A 1NP8A 4M2QA 3PJIA 4QJ5B 3DF0B 3KO0A 5K89A 1R6PA 5HKZA 4NDDA 3B7AA 3A4UB 1SMGA 3EKHA 5HYDA 1RROA 4DS7A 2BECA 5DKNA 3DVKA 4C0KA 1GGZA 4PHKA 2BNXA 2JNFA 2ZFDA 1XA5A 4CFQA 4M2PA 3D77A 1UHJA 3O2PA 3BUXB 1YUSA 1OOHA
chains in the Genus database with same CATH topology
1K95A 5HKYA 1J7OA 1A2XA 1S26D 4WQ3A 2B1UA 1WDCC 2LV7A 3MSEB 1OMRA 1CLLA 4HSZA 1CM4A 4GAOA 1IQ5A 3I5FC 2JT3A 2F8PA 1KQMB 2BBMA 2BKIB 3JVTB 4MRYA 2EC6C 1H8BA 1LA3A 3EK7A 1RWYA 3NSLA 1B1GA 2VRGA 3WHUB 1TCFA 3AAKA 1LINA 1GQMA 1AJ5A 1M31A 2AAOA 1W7IB 3AKBA 4ZCUA 4YGBB 4N1FA 4BY5A 3OB2B 3GK1A 3I5HB 5CPVA 1PK0D 3BOWB 4OKHA 1SKTA 1Y1AA 1G8IA 4XYNA 2F33A 1YRUB 1BT6A 1N0YA 1V1GA 1ZFSA 2PRUA 1KFUS 4U8DA 2JT8A 5B8IB 1QXPA 1SRAA 2HQWA 2LCPA 2NCPA 2H61C 3TUYB 3WHTB 2LLTA 1JSAA 5HLOA 1S6IA 4PE0A 2QPTA 4OCIA 1XFZO 1YRTB 1Y1UA 3VROA 1LA0A 4MEWA 3SG4A 1B7TY 3ZNIA 1CM1A 3O78A 3OHMB 4AQJA 2KSPA 1KQMC 1MR8A 3JVTC 1K9UA 4GBAA 2M1KB 3D10A 1RJVA 2JU0A 2PMYA 3K21A 1S5GZ 2L2EA 1W7JB 2E30A 1DGVA 1KK7Z 2WCFA 3SIBA 2FCDA 3CR4X 2KBIA 2L4HA 1CDMA 5CSIA 1DF0B 3F45A 1TNPA 2LE9B 1QLKA 4WQ2A 1AVSA 1PULA 1UHNA 2KAVA 4N1GA 3SJSA 3PFVA 4ICBA 5AFPA 5CSNA 2QACA 2GV5A 1K9KA 2M7NA 3BUWB 1QVIZ 1SL8A 3VRQA 3DVEA 2KI6C 2LC5A 5G08A 2Y5IA 1D1OA 2K7BA 1OQPA 1HQVA 2M49B 2KI6D 3FWCA 3RLZA 1YUUA 3TUYC 4USLA 3ICBA 1F70A 5JOLA 2JTZA 2EGDA 4GGFC 4XJKA 2MHHA 1WRZA 1XFVO 3PLFB 5CSFA 3RM1A 1TTXA 5I2OA 1BJFA 4N5XA 1A4PA 2I18A 1JWDA 2JRFA 1QX2A 3A8RA 3LLEA 2CBLA 1DJIA 4YI9A 1WY9A 5D69A 1YVLA 1JF2A 4OV2A 2ZNEA 1F71A 4ETOA 1DJZA 5KTYA 1PVAA 1U5IA 2LUXA 1B8CA 2PASA 5D7FA 1CKKA 1CB1A 2KFHA 3I5IB 5F6TA 1UHKA 1SPYA 4ZCVA 1A75A 3HX4A 1DTLA 1NX3A 2KGBC 2I7AA 5HKWA 1C7WA 1QX5B 2EHBA 5HLVA 2LHLA 1KQVA 1IJ5A 3TDZA 2ZN8A 1NCYA 3H4SE 4FTGA 4I5JA 1MF8B 4NDCA 2M97A 3QRXA 4PHJA 1YURA 2IS9A 3FIAA 1JUOA 1Q80A 1NX0A 1KFUL 4ORCB 2HETA 1RTP1 3BUMB 5TNCA 1RECA 1LVCD 2KFGA 1SCVA 2LHIA 4HRGA 4DIRA 5CSJA 1SNLA 1MXLC 1DVIA 1MXEA 2Y1NA 2KYFA 4ORBB 1DJXA 1B9AA 4IL1A 1K8UA 4AOMA 1N2DA 2LP3A 4DCKA 1UHHA 2COLB 4PDZA 2LVJA 2R2IA 5AEQA 2LMUA 5ER5A 1C07A 1SR6B 2K2FA 2LMVA 3I5IC 1V1FA 3PATA 1SYMA 4CLNA 2JC2A 2KNEA 2I94A 1Y0VH 1ZACA 3OX6A 2M0RA 1AHRA 1QS7A 1OMVA 2BE6A 2LAPA 2CCMA 1NYAA 1M45A 1YR5A 1VRKA 1TNXA 2LVIA 3CGAA 4MRXA 5AERA 2JT0A 1QATA 2KAXA 1KK8B 2LANA 1UUSA 1TN4A 1F4QA 2KOTA 1MHOA 1DJHA 1A29A 1BF5A 2RGIA 4YI8A 1WRLA 2DOQA 2CNPA 3CWGA 3O6BA 1S5GY 3NXAA 2LP2A 1JF0A 1KK7Y 4MSPA 3GOFA 4XJKB 1TNQA 3EKJA 2LMTA 2MRDA 3SIAA 1FW4A 1Y6WA 4CPVA 1J7QA 1FI5A 2LM5A 4PHMA 1SR6C 3LK0A 1XFYO 2GGZA 4QJ4B 3BYAA 1F54A 1JBAA 1QVIY 2BCXA 5PALA 3C1VA 3WXAA 1KCYA 2NXQA 1H4BA 1K93D 3BXKA 3IQOA 1M63B 4TNCA 4BY4A 4CFRA 2JWWA 1J1EA 3CTNA 3CLNA 4OR9B 2H2KA 1U5IB 3AAJA 4HREE 1GGWA 1JFKA 5IBWA 1IKUA 2K7CA 1MWNA 2BKHB 1QIVA 4F0ZB 3KPXA 1NWDA 2M3WA 1KFXS 2L4IA 3LL8B 2L0PA 3EVUA 1A75B 1KK8C 2F2PA 4JWQA 1WRKA 2BCAA 3TZ1A 1B4CA 1IRJA 4C0JA 1KSMA 1K2HA 4GPLB 3DVMA 2KI4B 3CZTX 4I5LB 1XFWO 1J1DA 2L5XB 1LXFC 1OZSA 1LKJA 5DKRA 4PE1A 1X02A 3CR5X 5J3XA 1ALWA 1NIWA 1QV1A 1YTZC 1UURA 3O4YA 2E6WA 2BE4A 3SG2A 4YGCB 3CR2A 2ZRTA 2JXLA 5GQQC 1XYDA 1BODA 2F3YA 2LNKA 1JC2A 3PSRA 4WRIA 1DT7B 2M29A 1F55A 3EVRA 5ER4X 2KGRA 4DUQA 1CLMA 1WLZA 3DVJA 4MZKA 1WLMA 3BQ3A 3FS7A 1QTXA 2G9BA 2F3ZA 4YGAA 2K0JA 2KAYA 2GGMA 1S3PA 2F2OA 2M9GA 1XVJA 3ZWHA 1EJ3A 1YVHA 1ZOTB 4I5NB 1FI6A 3SG3A 1SL9A 1YX8A 1M39A 1IJ6A 3D0YA 3OB1B 1TRFA 2Y1MA 1QIWA 4MZJA 2KI4C 2JNXA 3PALA 1CDPA 1L2OB 1R2UA 1CFDA 1DJYA 2ISDA 5JJGA 1J7PA 2I2RE 1N65A 1QASA 2BL0B 2V53A 1GJYA 4YBHB 1PSBA 3DD4A 2HF5A 5I8NA 1KSOA 4YGEB 1BMOA 1XK4A 1K94A 2FOTA 1EG4A 1TCOB 1J55A 1XFXO 4MVFA 1SL7A 4PE7A 1M46A 1FBVA 2Q91A 2BBNA 2LLSA 3LCPC 2K7DA 1ALVA 1RFJA 2NLNA 1DGUA 1K90D 1RK9A 2OTGB 1OMDA 1J7RA 1EL4A 2JQ6A 1SK6D 1PALA 2FJUB 2LVVA 2PVBA 2CT9A 2KFFA 4HRHA 1IG5A 1CFCA 2KBMA 3EK8A 4ORAB 3I5GB 2O5GA 5BPJA 1L2OC 1KFXL 1XO5A 2BCBA 2BL0C 2LUCA 3LK1A 1EH2A 1OSAA 3KEVA 2L50A 2MAZA 1EG3A 1SCMB 4FQOA 1PSRA 1TIZA 4YRUA 5I2LA 3IF7A 3JTDB 1BR1B 1F4OA 1SY9A 2M1UA 2WCBA 4R1EA 1CDLA 1UWOA 4UPGA 2LVKA 4P2YB 1MUXA 2LLUA 4YGDB 4I5KA 1XFUO 2PSRA 5KSZA 2AMIA 2WOSA 3VRNA 1NUBA 2MBXA 2PALA 1G33A 1IGVA 1UP5A 2OTGC 3PN7B 3WNXB 3BUOB 1SBJA 2L51A 3TDUA 3KF9A 2G2BA 2K2AA 1C7VA 1FF1A 1B8RA 2KHNA 4GUKA 1KWOB 1YUTA 3GK2A 1IH0A 3AKAA 3I5GC 3TDIA 1NCXA 1IQ3A 1UHIA 1BR4B 4A4BA 4OVNF 3VRRA 1EXRA 1NX1A 1CFFA 1L7ZA 1NCZA 1CNPA 1ZMZA 1ODBA 1K9PA 2WORA 4PCWA 4JQ0D 3IQQA 1S1EA 3D0YB 4GFTA 1SCMC 2TN4A 1NPQA 4A4CA 1JFJA 2Y4QA 1S6CA 2A4JA 4AQIA 3SG7A 3JTDC 3CS1A 1DMOA 2L98A 2NCOA 2ZRSA 3OP0A 2AUCA 2CXJA 2MLEC 2JPTA 4MN0A 5FYXA 3DF0A 2O60A 2JTTA 2CTNA 3KHEA 3SG6A 1Y1XA 2FCEA 2K7OA 3PN7C 2MLFC 4P5OE 2OPOA 5AXIA 1DJGA 4MZLA 2NZ0A 2ZKMX 1HT9A 1DJWA 1KWOC 4MLWA 4PE4A 5DKQA 1YX7A 2H61A 2KQ6A 3TS5B 1FPWA 1G4YR 1QX7A 1S6JA 1TNWA 2KYCA 3EK4A 2JZIA 1S36A 2WCEA 2ZNDA 3SG5A 4C0LA 1AP4A 1CTRA 1F8HA 2KQYA 3VRPA 2K8MB 1B47A 2P6BB 3I5HC 1CMGA 2D8NA 2JXCA 1BOCA 2WNDA 4PALA 2SCPA 5I2QA 1PVBA 4CIDA 4PHNA 2MA2A 4NQGA 5AANA 1IWQA 1OE9B 2KDHA 1B7TZ 3E3RA 1TOPA 1CLBA 1BU3A 1XK4C 2OS8B 3BUNB 3BOWA 3VGOA 4D1EA 3NSIA 4JPZB 4MBEA 1ZUZA 1PRWA 2M7LA 1AK8A 1OOJA 5KU1A 2JOJA 1AJ4A 2JULA 3EVVA 4QJ3B 3TS5C 1MQ1A 1BLQA 4L9MA 4GGNA 4Q04A 4GGFA 1CDNA 3OX5A 1CMFA 3NSKA 2ZN9A 3FWBA 1QLSA 4DRWA 1B8LA 2WC8A 3M0WA 1QJTA 2HQ8A 1K96A 1E8AA 1NX2A 3GK4X 1A03A 3NSOA 4M2OA 2SASA 4NDBA 2MJWB 3PM8A 1SW8A 2K61A 1WDCB 1CFPA 2Q4UA 2M8UA 4GNKB 3I5FB 1QV0A 1DF0A 2EC6B 1BG1A 1AUIB 2HPSA 2OS8C 3HCMA 1NSHA 1OZOA 4E68A 1NP8A 4M2QA 4QJ5B 3DF0B 3KO0A 5K89A 1R6PA 5HKZA 4NDDA 3A4UB 1SMGA 3EKHA 5HYDA 1RROA 4DS7A 2BECA 5DKNA 3DVKA 4C0KA 1GGZA 4PHKA 2JNFA 2ZFDA 1XA5A 4CFQA 4M2PA 1UHJA 3O2PA 3BUXB 1YUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K95 A;  5HKY A;  1J7O A;  1A2X A;  1S26 D;  4WQ3 A;  2B1U A;  1WDC C;  2LV7 A;  3MSE B;  1OMR A;  1CLL A;  4HSZ A;  1CM4 A;  4GAO A;  1IQ5 A;  3I5F C;  2JT3 A;  2F8P A;  1KQM B;  2BBM A;  2BKI B;  3JVT B;  4MRY A;  2EC6 C;  1H8B A;  1LA3 A;  3EK7 A;  1RWY A;  3NSL A;  1B1G A;  2VRG A;  3WHU B;  1TCF A;  3AAK A;  1LIN A;  1GQM A;  1AJ5 A;  1M31 A;  2AAO A;  1W7I B;  3AKB A;  4ZCU A;  4YGB B;  4N1F A;  4BY5 A;  3OB2 B;  3GK1 A;  3I5H B;  5CPV A;  1PK0 D;  3BOW B;  4OKH A;  1SKT A;  1Y1A A;  1G8I A;  4XYN A;  2F33 A;  1YRU B;  1BT6 A;  1N0Y A;  1V1G A;  1ZFS A;  2PRU A;  1KFU S;  4U8D A;  2JT8 A;  5B8I B;  1QXP A;  1SRA A;  2HQW A;  2LCP A;  2NCP A;  2H61 C;  3TUY B;  3WHT B;  2LLT A;  1JSA A;  5HLO A;  1S6I A;  4PE0 A;  2QPT A;  4OCI A;  1XFZ O;  1YRT B;  1Y1U A;  3VRO A;  1LA0 A;  4MEW A;  3SG4 A;  1B7T Y;  3ZNI A;  1CM1 A;  3O78 A;  3OHM B;  4AQJ A;  2KSP A;  1KQM C;  1MR8 A;  3JVT C;  1K9U A;  4GBA A;  2M1K B;  3D10 A;  1RJV A;  2JU0 A;  2PMY A;  3K21 A;  1S5G Z;  2L2E A;  1W7J B;  2E30 A;  1DGV A;  1KK7 Z;  2WCF A;  3SIB A;  2FCD A;  3CR4 X;  2KBI A;  2L4H A;  1CDM A;  5CSI A;  1DF0 B;  3F45 A;  1TNP A;  2LE9 B;  1QLK A;  4WQ2 A;  1AVS A;  1PUL A;  1UHN A;  2KAV A;  4N1G A;  3SJS A;  3PFV A;  4ICB A;  5AFP A;  5CSN A;  2QAC A;  2GV5 A;  1K9K A;  2M7N A;  3BUW B;  1QVI Z;  1SL8 A;  3VRQ A;  3DVE A;  2KI6 C;  2LC5 A;  5G08 A;  2Y5I A;  1D1O A;  2K7B A;  1OQP A;  1HQV A;  2M49 B;  2KI6 D;  3FWC A;  3RLZ A;  1YUU A;  3TUY C;  4USL A;  3ICB A;  1F70 A;  5JOL A;  2JTZ A;  2EGD A;  4GGF C;  4XJK A;  2MHH A;  1WRZ A;  1XFV O;  3PLF B;  5CSF A;  3RM1 A;  1TTX A;  5I2O A;  1BJF A;  4N5X A;  1A4P A;  2I18 A;  1JWD A;  2JRF A;  1QX2 A;  3A8R A;  3LLE A;  2CBL A;  1DJI A;  4YI9 A;  1WY9 A;  5D69 A;  1YVL A;  1JF2 A;  4OV2 A;  2ZNE A;  1F71 A;  4ETO A;  1DJZ A;  5KTY A;  1PVA A;  1U5I A;  2LUX A;  1B8C A;  2PAS A;  5D7F A;  1CKK A;  1CB1 A;  2KFH A;  3I5I B;  5F6T A;  1UHK A;  1SPY A;  4ZCV A;  1A75 A;  3HX4 A;  1DTL A;  1NX3 A;  2KGB C;  2I7A A;  5HKW A;  1C7W A;  1QX5 B;  2EHB A;  5HLV A;  2LHL A;  1KQV A;  1IJ5 A;  3TDZ A;  2ZN8 A;  1NCY A;  3H4S E;  4FTG A;  4I5J A;  1MF8 B;  4NDC A;  2M97 A;  3QRX A;  4PHJ A;  1YUR A;  2IS9 A;  3FIA A;  1JUO A;  1Q80 A;  1NX0 A;  1KFU L;  4ORC B;  2HET A;  1RTP 1;  3BUM B;  5TNC A;  1REC A;  1LVC D;  2KFG A;  1SCV A;  2LHI A;  4HRG A;  4DIR A;  5CSJ A;  1SNL A;  1MXL C;  1DVI A;  1MXE A;  2Y1N A;  2KYF A;  4ORB B;  1DJX A;  1B9A A;  4IL1 A;  1K8U A;  4AOM A;  1N2D A;  2LP3 A;  4DCK A;  1UHH A;  2COL B;  4PDZ A;  2LVJ A;  2R2I A;  5AEQ A;  2LMU A;  5ER5 A;  1C07 A;  1SR6 B;  2K2F A;  2LMV A;  3I5I C;  1V1F A;  3PAT A;  1SYM A;  4CLN A;  2JC2 A;  2KNE A;  2I94 A;  1Y0V H;  1ZAC A;  3OX6 A;  2M0R A;  1AHR A;  1QS7 A;  1OMV A;  2BE6 A;  2LAP A;  2CCM A;  1NYA A;  1M45 A;  1YR5 A;  1VRK A;  1TNX A;  2LVI A;  3CGA A;  4MRX A;  5AER A;  2JT0 A;  1QAT A;  2KAX A;  1KK8 B;  2LAN A;  1UUS A;  1TN4 A;  1F4Q A;  2KOT A;  1MHO A;  1DJH A;  1A29 A;  1BF5 A;  2RGI A;  4YI8 A;  1WRL A;  2DOQ A;  2CNP A;  3CWG A;  3O6B A;  1S5G Y;  3NXA A;  2LP2 A;  1JF0 A;  1KK7 Y;  4MSP A;  3GOF A;  4XJK B;  1TNQ A;  3EKJ A;  2LMT A;  2MRD A;  3SIA A;  1FW4 A;  1Y6W A;  4CPV A;  1J7Q A;  1FI5 A;  2LM5 A;  4PHM A;  1SR6 C;  3LK0 A;  1XFY O;  2GGZ A;  4QJ4 B;  3BYA A;  1F54 A;  1JBA A;  1QVI Y;  2BCX A;  5PAL A;  3C1V A;  3WXA A;  1KCY A;  2NXQ A;  1H4B A;  1K93 D;  3BXK A;  3IQO A;  1M63 B;  4TNC A;  4BY4 A;  4CFR A;  2JWW A;  1J1E A;  3CTN A;  3CLN A;  4OR9 B;  2H2K A;  1U5I B;  3AAJ A;  4HRE E;  1GGW A;  1JFK A;  5IBW A;  1IKU A;  2K7C A;  1MWN A;  2BKH B;  1QIV A;  4F0Z B;  3KPX A;  1NWD A;  2M3W A;  1KFX S;  2L4I A;  3LL8 B;  2L0P A;  3EVU A;  1A75 B;  1KK8 C;  2F2P A;  4JWQ A;  1WRK A;  2BCA A;  3TZ1 A;  1B4C A;  1IRJ A;  4C0J A;  1KSM A;  1K2H A;  4GPL B;  3DVM A;  2KI4 B;  3CZT X;  4I5L B;  1XFW O;  1J1D A;  2L5X B;  1LXF C;  1OZS A;  1LKJ A;  5DKR A;  4PE1 A;  1X02 A;  3CR5 X;  5J3X A;  1ALW A;  1NIW A;  1QV1 A;  1YTZ C;  1UUR A;  3O4Y A;  2E6W A;  2BE4 A;  3SG2 A;  4YGC B;  3CR2 A;  2ZRT A;  2JXL A;  5GQQ C;  1XYD A;  1BOD A;  2F3Y A;  2LNK A;  1JC2 A;  3PSR A;  4WRI A;  1DT7 B;  2M29 A;  1F55 A;  3EVR A;  5ER4 X;  2KGR A;  4DUQ A;  1CLM A;  1WLZ A;  3DVJ A;  4MZK A;  1WLM A;  3BQ3 A;  3FS7 A;  1QTX A;  2G9B A;  2F3Z A;  4YGA A;  2K0J A;  2KAY A;  2GGM A;  1S3P A;  2F2O A;  2M9G A;  1XVJ A;  3ZWH A;  1EJ3 A;  1YVH A;  1ZOT B;  4I5N B;  1FI6 A;  3SG3 A;  1SL9 A;  1YX8 A;  1M39 A;  1IJ6 A;  3D0Y A;  3OB1 B;  1TRF A;  2Y1M A;  1QIW A;  4MZJ A;  2KI4 C;  2JNX A;  3PAL A;  1CDP A;  1L2O B;  1R2U A;  1CFD A;  1DJY A;  2ISD A;  5JJG A;  1J7P A;  2I2R E;  1N65 A;  1QAS A;  2BL0 B;  2V53 A;  1GJY A;  4YBH B;  1PSB A;  3DD4 A;  2HF5 A;  5I8N A;  1KSO A;  4YGE B;  1BMO A;  1XK4 A;  1K94 A;  2FOT A;  1EG4 A;  1TCO B;  1J55 A;  1XFX O;  4MVF A;  1SL7 A;  4PE7 A;  1M46 A;  1FBV A;  2Q91 A;  2BBN A;  2LLS A;  3LCP C;  2K7D A;  1ALV A;  1RFJ A;  2NLN A;  1DGU A;  1K90 D;  1RK9 A;  2OTG B;  1OMD A;  1J7R A;  1EL4 A;  2JQ6 A;  1SK6 D;  1PAL A;  2FJU B;  2LVV A;  2PVB A;  2CT9 A;  2KFF A;  4HRH A;  1IG5 A;  1CFC A;  2KBM A;  3EK8 A;  4ORA B;  3I5G B;  2O5G A;  5BPJ A;  1L2O C;  1KFX L;  1XO5 A;  2BCB A;  2BL0 C;  2LUC A;  3LK1 A;  1EH2 A;  1OSA A;  3KEV A;  2L50 A;  2MAZ A;  1EG3 A;  1SCM B;  4FQO A;  1PSR A;  1TIZ A;  4YRU A;  5I2L A;  3IF7 A;  3JTD B;  1BR1 B;  1F4O A;  1SY9 A;  2M1U A;  2WCB A;  4R1E A;  1CDL A;  1UWO A;  4UPG A;  2LVK A;  4P2Y B;  1MUX A;  2LLU A;  4YGD B;  4I5K A;  1XFU O;  2PSR A;  5KSZ A;  2AMI A;  2WOS A;  3VRN A;  1NUB A;  2MBX A;  2PAL A;  1G33 A;  1IGV A;  1UP5 A;  2OTG C;  3PN7 B;  3WNX B;  3BUO B;  1SBJ A;  2L51 A;  3TDU A;  3KF9 A;  2G2B A;  2K2A A;  1C7V A;  1FF1 A;  1B8R A;  2KHN A;  4GUK A;  1KWO B;  1YUT A;  3GK2 A;  1IH0 A;  3AKA A;  3I5G C;  3TDI A;  1NCX A;  1IQ3 A;  1UHI A;  1BR4 B;  4A4B A;  4OVN F;  3VRR A;  1EXR A;  1NX1 A;  1CFF A;  1L7Z A;  1NCZ A;  1CNP A;  1ZMZ A;  1ODB A;  1K9P A;  2WOR A;  4PCW A;  4JQ0 D;  3IQQ A;  1S1E A;  3D0Y B;  4GFT A;  1SCM C;  2TN4 A;  1NPQ A;  4A4C A;  1JFJ A;  2Y4Q A;  1S6C A;  2A4J A;  4AQI A;  3SG7 A;  3JTD C;  3CS1 A;  1DMO A;  2L98 A;  2NCO A;  2ZRS A;  3OP0 A;  2AUC A;  2CXJ A;  2MLE C;  2JPT A;  4MN0 A;  5FYX A;  3DF0 A;  2O60 A;  2JTT A;  2CTN A;  3KHE A;  3SG6 A;  1Y1X A;  2FCE A;  2K7O A;  3PN7 C;  2MLF C;  4P5O E;  2OPO A;  5AXI A;  1DJG A;  4MZL A;  2NZ0 A;  2ZKM X;  1HT9 A;  1DJW A;  1KWO C;  4MLW A;  4PE4 A;  5DKQ A;  1YX7 A;  2H61 A;  2KQ6 A;  3TS5 B;  1FPW A;  1G4Y R;  1QX7 A;  1S6J A;  1TNW A;  2KYC A;  3EK4 A;  2JZI A;  1S36 A;  2WCE A;  2ZND A;  3SG5 A;  4C0L A;  1AP4 A;  1CTR A;  1F8H A;  2KQY A;  3VRP A;  2K8M B;  1B47 A;  2P6B B;  3I5H C;  1CMG A;  2D8N A;  2JXC A;  1BOC A;  2WND A;  4PAL A;  2SCP A;  5I2Q A;  1PVB A;  4CID A;  4PHN A;  2MA2 A;  4NQG A;  5AAN A;  1IWQ A;  1OE9 B;  2KDH A;  1B7T Z;  3E3R A;  1TOP A;  1CLB A;  1BU3 A;  1XK4 C;  2OS8 B;  3BUN B;  3BOW A;  3VGO A;  4D1E A;  3NSI A;  4JPZ B;  4MBE A;  1ZUZ A;  1PRW A;  2M7L A;  1AK8 A;  1OOJ A;  5KU1 A;  2JOJ A;  1AJ4 A;  2JUL A;  3EVV A;  4QJ3 B;  3TS5 C;  1MQ1 A;  1BLQ A;  4L9M A;  4GGN A;  4Q04 A;  4GGF A;  1CDN A;  3OX5 A;  1CMF A;  3NSK A;  2ZN9 A;  3FWB A;  1QLS A;  4DRW A;  1B8L A;  2WC8 A;  3M0W A;  1QJT A;  2HQ8 A;  1K96 A;  1E8A A;  1NX2 A;  3GK4 X;  1A03 A;  3NSO A;  4M2O A;  2SAS A;  4NDB A;  2MJW B;  3PM8 A;  1SW8 A;  2K61 A;  1WDC B;  1CFP A;  2Q4U A;  2M8U A;  4GNK B;  3I5F B;  1QV0 A;  1DF0 A;  2EC6 B;  1BG1 A;  1AUI B;  2HPS A;  2OS8 C;  3HCM A;  1NSH A;  1OZO A;  4E68 A;  1NP8 A;  4M2Q A;  4QJ5 B;  3DF0 B;  3KO0 A;  5K89 A;  1R6P A;  5HKZ A;  4NDD A;  3A4U B;  1SMG A;  3EKH A;  5HYD A;  1RRO A;  4DS7 A;  2BEC A;  5DKN A;  3DVK A;  4C0K A;  1GGZ A;  4PHK A;  2JNF A;  2ZFD A;  1XA5 A;  4CFQ A;  4M2P A;  1UHJ A;  3O2P A;  3BUX B;  1YUS A; 
#chains in the Genus database with same CATH topology
 1OOG A;  1K95 A;  5HKY A;  1J7O A;  1A2X A;  1S26 D;  4WQ3 A;  2B1U A;  1WDC C;  2LV7 A;  3MSE B;  1OMR A;  1CLL A;  4HSZ A;  1CM4 A;  4GAO A;  1IQ5 A;  3I5F C;  2JT3 A;  2F8P A;  1KQM B;  2BBM A;  2BKI B;  3JVT B;  4MRY A;  2EC6 C;  2QDI A;  1LA3 A;  3S0E A;  3EK7 A;  1H8B A;  1RWY A;  3NSL A;  1B1G A;  2VRG A;  4JD9 A;  3WHU B;  1TCF A;  3AAK A;  1LIN A;  1AJ5 A;  1GQM A;  1M31 A;  1W7I B;  2AAO A;  3AKB A;  4ZCU A;  4IJ7 A;  3UNW A;  4YGB B;  4N1F A;  4BY5 A;  3OB2 B;  3GK1 A;  3I5H B;  5CPV A;  1PK0 D;  3BOW B;  4OKH A;  1SKT A;  1Y1A A;  1G8I A;  4XYN A;  1C07 A;  2F33 A;  1YRU B;  1BT6 A;  1N0Y A;  1V1G A;  1ZFS A;  2PRU A;  1KFU S;  4U8D A;  2JT8 A;  5B8I B;  1QXP A;  1SRA A;  2HQW A;  2LCP A;  2NCP A;  2H61 C;  2KLE A;  3TUY B;  3WHT B;  2LLT A;  1JSA A;  5HLO A;  1S6I A;  4PE0 A;  2QPT A;  4OCI A;  1XFZ O;  3QME A;  1YRT B;  1Y1U A;  3VRO A;  1LA0 A;  4MEW A;  3SG4 A;  1B7T Y;  3ZNI A;  1CM1 A;  3O78 A;  3OHM B;  4AQJ A;  2BAP A;  2KSP A;  1KQM C;  1MR8 A;  3JVT C;  4JKT A;  1K9U A;  3R1P A;  4GBA A;  2M1K B;  3D10 A;  1RJV A;  3V2L A;  2JU0 A;  2PMY A;  3D78 A;  1DEL A;  3K21 A;  4INX A;  1S5G Z;  2L2E A;  1W7J B;  2E30 A;  1DGV A;  1KK7 Z;  2H8V A;  2WCF A;  3SIB A;  2FCD A;  3CR4 X;  2KBI A;  2L4H A;  1CDM A;  5CSI A;  1DF0 B;  3F45 A;  1TNP A;  2LE9 B;  1QLK A;  2KLD A;  4WQ2 A;  1XFR A;  1AVS A;  1PUL A;  1SSE B;  1UHN A;  2KAV A;  4N1G A;  3PFV A;  4ICB A;  3SJS A;  5CSN A;  2QAC A;  2GV5 A;  1K9K A;  2M7N A;  3BUW B;  1QVI Z;  1SL8 A;  2QEB A;  5I94 A;  3VRQ A;  3DVE A;  2KI6 C;  2LC5 A;  4KYN A;  5G08 A;  2Y5I A;  1D1O A;  2K7B A;  1OQP A;  1HQV A;  2M49 B;  2KI6 D;  3FWC A;  3RLZ A;  1YUU A;  3TUY C;  4USL A;  3ICB A;  1F70 A;  5JOL A;  2JTZ A;  1OOF A;  2EGD A;  4GGF C;  4XJK A;  4FQT A;  2MHH A;  1WRZ A;  1XFV O;  3PLF B;  5CSF A;  3RM1 A;  1TTX A;  5I2O A;  1BJF A;  3D75 A;  4N5X A;  1A4P A;  3D76 A;  2I18 A;  1JWD A;  2JRF A;  3S0G A;  1QX2 A;  3A8R A;  3LLE A;  2CBL A;  1DJI A;  4YI9 A;  1WY9 A;  5D69 A;  1YVL A;  1JF2 A;  4OV2 A;  2ZNE A;  1F71 A;  4ETO A;  2QEH A;  1DJZ A;  3CAB A;  1PVA A;  1U5I A;  2LUX A;  1B8C A;  2PAS A;  5KTY A;  5D7F A;  1CKK A;  1CB1 A;  2KFH A;  3I5I B;  5F6T A;  1UHK A;  3DYE A;  2KPH A;  1SPY A;  4ZCV A;  1A75 A;  3HX4 A;  1DTL A;  1NX3 A;  2KGB C;  2I7A A;  5HKW A;  1C7W A;  1QX5 B;  2EHB A;  2L5Y A;  3CZ2 A;  1DC1 A;  2P71 A;  5HLV A;  2LHL A;  1KQV A;  1IJ5 A;  3TDZ A;  2ZN8 A;  1NCY A;  3H4S E;  4FTG A;  4I5J A;  1MF8 B;  3NHT A;  4NDC A;  2M97 A;  3QRX A;  5EL2 A;  4PHJ A;  1YUR A;  2IS9 A;  3FIA A;  1JUO A;  1Q80 A;  1NX0 A;  1KFU L;  4ORC B;  2HET A;  1RTP 1;  3BUM B;  5TNC A;  1REC A;  1LVC D;  2KFG A;  1SCV A;  2LHI A;  3FE9 A;  4HRG A;  4DIR A;  1TUJ A;  5CSJ A;  5FI6 A;  1SNL A;  1MXL C;  1CNP A;  1DVI A;  1MXE A;  2Y1N A;  2KYF A;  4ORB B;  1DJX A;  1B9A A;  4IL1 A;  1K8U A;  3OGN A;  1N2D A;  2LP3 A;  4AOM A;  1UHH A;  2COL B;  4PDZ A;  2LVJ A;  2R2I A;  5AEQ A;  2LMU A;  5ER5 A;  4DCK A;  1SR6 B;  2K2F A;  2LMV A;  3I5I C;  1V1F A;  3PAT A;  1SYM A;  3R1V A;  4CLN A;  2JC2 A;  2KNE A;  2I94 A;  1Y0V H;  1ZAC A;  3OX6 A;  2M0R A;  1AHR A;  1QS7 A;  1OMV A;  2BE6 A;  2LAP A;  2CCM A;  1NYA A;  3B87 A;  5D3O A;  1M45 A;  1YR5 A;  2PQL A;  1VRK A;  1TNX A;  2LVI A;  3CGA A;  3OBV A;  4MRX A;  2JT0 A;  5FI7 A;  1QAT A;  2KAX A;  1KK8 B;  5AER A;  2LAN A;  1UUS A;  1TN4 A;  1F4Q A;  2KOT A;  1MHO A;  1DJH A;  1A29 A;  5AFP A;  1BF5 A;  2RGI A;  4YI8 A;  1WRL A;  2DOQ A;  2CNP A;  3CWG A;  3O6B A;  3S0B A;  1S5G Y;  3NXA A;  2LP2 A;  1JF0 A;  1KK7 Y;  4MSP A;  3GOF A;  4XJK B;  1TNQ A;  3EKJ A;  2LMT A;  2MRD A;  3SIA A;  1FW4 A;  1Y6W A;  3IVT A;  4CPV A;  1J7Q A;  2LM5 A;  1FI5 A;  4PHM A;  1SR6 C;  3LK0 A;  1XFY O;  2GGZ A;  4QJ4 B;  3BYA A;  1F54 A;  1JBA A;  1QVI Y;  2BCX A;  5PAL A;  3C1V A;  3BFA A;  3WXA A;  1OOI X;  1KCY A;  2NXQ A;  1H4B A;  1K93 D;  3BXK A;  3IQO A;  1M63 B;  4TNC A;  3UO9 A;  4BY4 A;  4CFR A;  2JWW A;  1J1E A;  3CTN A;  3CLN A;  4OR9 B;  2H2K A;  1U5I B;  3AAJ A;  4HRE E;  1GGW A;  1JFK A;  5IBW A;  1IKU A;  2K7C A;  1MWN A;  2BKH B;  1QIV A;  4F0Z B;  3KPX A;  1NWD A;  2M3W A;  1KFX S;  2L4I A;  3LL8 B;  2L0P A;  3N7H A;  3EVU A;  1A75 B;  1KK8 C;  2F2P A;  4JWQ A;  1WRK A;  2BCA A;  3TZ1 A;  1B4C A;  1GM0 A;  1IRJ A;  2ERB A;  4C0J A;  1KSM A;  1K2H A;  4GPL B;  3VB1 A;  3DVM A;  2KI4 B;  3CZT X;  4I5L B;  1Z2C B;  1XFW O;  1J1D A;  2L5X B;  1LXF C;  1OZS A;  1LKJ A;  1P28 A;  2WC5 A;  1TUZ A;  3SS3 A;  5DKR A;  4PE1 A;  1X02 A;  3CR5 X;  3NGV A;  3BFB A;  5J3X A;  5DIC A;  1ALW A;  1NIW A;  1QV1 A;  1YTZ C;  1UUR A;  3O4Y A;  2E6W A;  2BE4 A;  3SG2 A;  4YGC B;  3CR2 A;  2ZRT A;  2JXL A;  5GQQ C;  1XYD A;  1BOD A;  2F3Y A;  2LNK A;  1JC2 A;  3PSR A;  4WRI A;  1DT7 B;  2M29 A;  1F55 A;  3EVR A;  5HL1 A;  5ER4 X;  2QEO A;  2KGR A;  4DUQ A;  1CLM A;  1WLZ A;  3DVJ A;  4MZK A;  1WLM A;  3BQ3 A;  3FS7 A;  3EG5 B;  1QTX A;  1QWV A;  2G9B A;  2F3Z A;  4YGA A;  2K0J A;  2KAY A;  2GGM A;  1S3P A;  2F2O A;  2M9G A;  1XVJ A;  2P70 A;  1EJ3 A;  4INW A;  3ZWH A;  1YVH A;  1ZOT B;  4I5N B;  1FI6 A;  3SG3 A;  1SL9 A;  1YX8 A;  1M39 A;  1IJ6 A;  3D0Y A;  3OB1 B;  4F7F A;  1TRF A;  2Y1M A;  1QIW A;  3CYZ A;  4MZJ A;  2KI4 C;  2JNX A;  3PAL A;  1CDP A;  1L2O B;  1R2U A;  1CFD A;  1DJY A;  3BJH A;  2ISD A;  5JJG A;  1J7P A;  2I2R E;  1N65 A;  1QAS A;  2BL0 B;  2V53 A;  3DXL A;  1GJY A;  2PYQ A;  1PSB A;  4YBH B;  3DD4 A;  2HF5 A;  5I8N A;  1KSO A;  4YGE B;  1BMO A;  1XK4 A;  1K94 A;  2FOT A;  1EG4 A;  1TCO B;  3DZT A;  1J55 A;  1XFX O;  4MVF A;  1SL7 A;  4PE7 A;  1M46 A;  1FBV A;  2Q91 A;  2BBN A;  2LLS A;  3LCP C;  2K7D A;  1IIO A;  1ALV A;  1RFJ A;  2NLN A;  1DGU A;  1K90 D;  1RK9 A;  1T14 A;  2K60 A;  2OTG B;  1OMD A;  3NHI A;  3R1O A;  3S0A A;  1J7R A;  1EL4 A;  2JQ6 A;  1SK6 D;  1PAL A;  2FJU B;  2LVV A;  2PVB A;  2CT9 A;  2KFF A;  4HRH A;  1IG5 A;  1CFC A;  2KBM A;  3EK8 A;  4ORA B;  3I5G B;  3PM2 A;  2O5G A;  5BPJ A;  1L2O C;  1KFX L;  1XO5 A;  2BCB A;  2BL0 C;  2LUC A;  3LK1 A;  1EH2 A;  1OSA A;  2GTE A;  3KEV A;  2L50 A;  2MAZ A;  1EG3 A;  2WCM A;  1SCM B;  4FQO A;  1PSR A;  1TIZ A;  3O4X A;  2FJY A;  4YRU A;  5I2L A;  3IF7 A;  3JTD B;  1BR1 B;  1F4O A;  1SY9 A;  2M1U A;  2WCB A;  3DY9 A;  3FE8 A;  1CDL A;  1UWO A;  4R1E A;  4UPG A;  2LVK A;  4P2Y B;  1MUX A;  2LLU A;  3L47 A;  4I5K A;  4YGD B;  1XFU O;  2PSR A;  5KSZ A;  3R72 A;  2AMI A;  2WOS A;  3VRN A;  1NUB A;  2MBX A;  2PAL A;  3B86 A;  1G33 A;  1IGV A;  1UP5 A;  2OTG C;  2WCL A;  3PN7 B;  3WNX B;  3BUO B;  1SBJ A;  2L51 A;  3D73 A;  3TDU A;  3KF9 A;  2G2B A;  2K2A A;  1C7V A;  1FF1 A;  1B8R A;  2KHN A;  4GUK A;  5FI2 A;  1KWO B;  1YUT A;  2WCH A;  3GK2 A;  3AKA A;  1IH0 A;  3I5G C;  3TDI A;  1NCX A;  1IQ3 A;  1UHI A;  3B88 A;  3CZ0 A;  1BR4 B;  4A4B A;  4OVN F;  3VRR A;  3D74 A;  1EXR A;  1NX1 A;  3SS4 A;  1L7Z A;  1NCZ A;  1CFF A;  1ZMZ A;  1ODB A;  1K9P A;  2WOR A;  3Q8I A;  4JQ0 D;  4PCW A;  3S0D A;  3IQQ A;  1S1E A;  3D0Y B;  4GFT A;  1SCM C;  2TN4 A;  1NPQ A;  4A4C A;  1W9Z A;  1JFJ A;  2Y4Q A;  4PT1 A;  1S6C A;  2A4J A;  4AQI A;  3SG7 A;  3JTD C;  3CS1 A;  1DMO A;  2L98 A;  2NCO A;  3K1E A;  2ZRS A;  3OP0 A;  2AUC A;  1TWO A;  2CXJ A;  2MLE C;  2JPT A;  4MN0 A;  5FYX A;  3DF0 A;  2O60 A;  2JTT A;  2CTN A;  3KHE A;  3SG6 A;  1Y1X A;  2FCE A;  2K7O A;  3PN7 C;  1OW4 A;  2MLF C;  2OPO A;  4P5O E;  5AXI A;  1DJG A;  1C3Y A;  4MZL A;  1DEK A;  2NZ0 A;  2ZKM X;  1HT9 A;  1DJW A;  1KWO C;  4MLW A;  4PE4 A;  2WCJ A;  1YX7 A;  2WCK A;  3B6X A;  2H61 A;  2KQ6 A;  5DKQ A;  3TS5 B;  1FPW A;  1ORG A;  1DQE A;  1G4Y R;  1QX7 A;  3L4A A;  1S6J A;  1TNW A;  2KYC A;  2QEV A;  3EK4 A;  2JZI A;  1S36 A;  2WCE A;  2ZND A;  3SG5 A;  4C0L A;  1AP4 A;  1CTR A;  1F8H A;  2KQY A;  4OZD A;  3VRP A;  2K8M B;  1B47 A;  2P6B B;  3I5H C;  1CMG A;  2D8N A;  2JXC A;  1C3Z A;  1BOC A;  2JPO A;  2WND A;  4PAL A;  2SCP A;  5I2Q A;  1PVB A;  4CID A;  3L4L A;  4PHN A;  2MA2 A;  4NQG A;  5AAN A;  1IWQ A;  1OE9 B;  2KDH A;  1B7T Z;  3E3R A;  1TOP A;  1CLB A;  1BU3 A;  1XK4 C;  2OS8 B;  3BUN B;  3BOW A;  3FE6 A;  3VGO A;  1LS8 A;  3NSI A;  4D1E A;  3BFH A;  4JPZ B;  3S0F A;  4MBE A;  1ZUZ A;  1PRW A;  2M7L A;  2YGU A;  1AK8 A;  1OOJ A;  5KU1 A;  2JOJ A;  1AJ4 A;  2JUL A;  3EVV A;  4QJ3 B;  3TS5 C;  1MQ1 A;  1BLQ A;  4L9M A;  4GGN A;  4Q04 A;  4GGF A;  1CDN A;  3OX5 A;  3SS5 A;  3NSK A;  1CMF A;  2ZN9 A;  3FWB A;  1QLS A;  4DRW A;  1Z4H A;  1B8L A;  2WC8 A;  3M0W A;  1QJT A;  2HQ8 A;  3RZS A;  1K96 A;  1E8A A;  1NX2 A;  3GK4 X;  1A03 A;  3CDN A;  3NSO A;  4M2O A;  2SAS A;  4NDB A;  2MJW B;  3PM8 A;  1SW8 A;  2K61 A;  1WDC B;  1CFP A;  2Q4U A;  2M8U A;  4GNK B;  3CZ1 A;  3I5F B;  2L2C A;  1QV0 A;  1DF0 A;  2EC6 B;  2WC6 A;  1BG1 A;  1AUI B;  2HPS A;  2OS8 C;  3HCM A;  1NSH A;  1OZO A;  4E68 A;  1NP8 A;  4M2Q A;  3PJI A;  4QJ5 B;  3DF0 B;  3KO0 A;  5K89 A;  1R6P A;  5HKZ A;  4NDD A;  3B7A A;  3A4U B;  1SMG A;  3EKH A;  5HYD A;  1RRO A;  4DS7 A;  2BEC A;  5DKN A;  3DVK A;  4C0K A;  1GGZ A;  4PHK A;  2BNX A;  2JNF A;  2ZFD A;  1XA5 A;  4CFQ A;  4M2P A;  3D77 A;  1UHJ A;  3O2P A;  3BUX B;  1YUS A;  1OOH A; 
#chains in the Genus database with same CATH homology
 1K95 A;  5HKY A;  1J7O A;  1A2X A;  1S26 D;  4WQ3 A;  2B1U A;  1WDC C;  2LV7 A;  3MSE B;  1OMR A;  1CLL A;  4HSZ A;  1CM4 A;  4GAO A;  1IQ5 A;  3I5F C;  2JT3 A;  2F8P A;  1KQM B;  2BBM A;  2BKI B;  3JVT B;  4MRY A;  2EC6 C;  1H8B A;  1LA3 A;  3EK7 A;  1RWY A;  3NSL A;  1B1G A;  2VRG A;  3WHU B;  1TCF A;  3AAK A;  1LIN A;  1GQM A;  1AJ5 A;  1M31 A;  2AAO A;  1W7I B;  3AKB A;  4ZCU A;  4YGB B;  4N1F A;  4BY5 A;  3OB2 B;  3GK1 A;  3I5H B;  5CPV A;  1PK0 D;  3BOW B;  4OKH A;  1SKT A;  1Y1A A;  1G8I A;  4XYN A;  2F33 A;  1YRU B;  1BT6 A;  1N0Y A;  1V1G A;  1ZFS A;  2PRU A;  1KFU S;  4U8D A;  2JT8 A;  5B8I B;  1QXP A;  1SRA A;  2HQW A;  2LCP A;  2NCP A;  2H61 C;  3TUY B;  3WHT B;  2LLT A;  1JSA A;  5HLO A;  1S6I A;  4PE0 A;  2QPT A;  4OCI A;  1XFZ O;  1YRT B;  1Y1U A;  3VRO A;  1LA0 A;  4MEW A;  3SG4 A;  1B7T Y;  3ZNI A;  1CM1 A;  3O78 A;  3OHM B;  4AQJ A;  2KSP A;  1KQM C;  1MR8 A;  3JVT C;  1K9U A;  4GBA A;  2M1K B;  3D10 A;  1RJV A;  2JU0 A;  2PMY A;  3K21 A;  1S5G Z;  2L2E A;  1W7J B;  2E30 A;  1DGV A;  1KK7 Z;  2WCF A;  3SIB A;  2FCD A;  3CR4 X;  2KBI A;  2L4H A;  1CDM A;  5CSI A;  1DF0 B;  3F45 A;  1TNP A;  2LE9 B;  1QLK A;  4WQ2 A;  1AVS A;  1PUL A;  1UHN A;  2KAV A;  4N1G A;  3SJS A;  3PFV A;  4ICB A;  5AFP A;  5CSN A;  2QAC A;  2GV5 A;  1K9K A;  2M7N A;  3BUW B;  1QVI Z;  1SL8 A;  3VRQ A;  3DVE A;  2KI6 C;  2LC5 A;  5G08 A;  2Y5I A;  1D1O A;  2K7B A;  1OQP A;  1HQV A;  2M49 B;  2KI6 D;  3FWC A;  3RLZ A;  1YUU A;  3TUY C;  4USL A;  3ICB A;  1F70 A;  5JOL A;  2JTZ A;  2EGD A;  4GGF C;  4XJK A;  2MHH A;  1WRZ A;  1XFV O;  3PLF B;  5CSF A;  3RM1 A;  1TTX A;  5I2O A;  1BJF A;  4N5X A;  1A4P A;  2I18 A;  1JWD A;  2JRF A;  1QX2 A;  3A8R A;  3LLE A;  2CBL A;  1DJI A;  4YI9 A;  1WY9 A;  5D69 A;  1YVL A;  1JF2 A;  4OV2 A;  2ZNE A;  1F71 A;  4ETO A;  1DJZ A;  5KTY A;  1PVA A;  1U5I A;  2LUX A;  1B8C A;  2PAS A;  5D7F A;  1CKK A;  1CB1 A;  2KFH A;  3I5I B;  5F6T A;  1UHK A;  1SPY A;  4ZCV A;  1A75 A;  3HX4 A;  1DTL A;  1NX3 A;  2KGB C;  2I7A A;  5HKW A;  1C7W A;  1QX5 B;  2EHB A;  5HLV A;  2LHL A;  1KQV A;  1IJ5 A;  3TDZ A;  2ZN8 A;  1NCY A;  3H4S E;  4FTG A;  4I5J A;  1MF8 B;  4NDC A;  2M97 A;  3QRX A;  4PHJ A;  1YUR A;  2IS9 A;  3FIA A;  1JUO A;  1Q80 A;  1NX0 A;  1KFU L;  4ORC B;  2HET A;  1RTP 1;  3BUM B;  5TNC A;  1REC A;  1LVC D;  2KFG A;  1SCV A;  2LHI A;  4HRG A;  4DIR A;  5CSJ A;  1SNL A;  1MXL C;  1DVI A;  1MXE A;  2Y1N A;  2KYF A;  4ORB B;  1DJX A;  1B9A A;  4IL1 A;  1K8U A;  4AOM A;  1N2D A;  2LP3 A;  4DCK A;  1UHH A;  2COL B;  4PDZ A;  2LVJ A;  2R2I A;  5AEQ A;  2LMU A;  5ER5 A;  1C07 A;  1SR6 B;  2K2F A;  2LMV A;  3I5I C;  1V1F A;  3PAT A;  1SYM A;  4CLN A;  2JC2 A;  2KNE A;  2I94 A;  1Y0V H;  1ZAC A;  3OX6 A;  2M0R A;  1AHR A;  1QS7 A;  1OMV A;  2BE6 A;  2LAP A;  2CCM A;  1NYA A;  1M45 A;  1YR5 A;  1VRK A;  1TNX A;  2LVI A;  3CGA A;  4MRX A;  5AER A;  2JT0 A;  1QAT A;  2KAX A;  1KK8 B;  2LAN A;  1UUS A;  1TN4 A;  1F4Q A;  2KOT A;  1MHO A;  1DJH A;  1A29 A;  1BF5 A;  2RGI A;  4YI8 A;  1WRL A;  2DOQ A;  2CNP A;  3CWG A;  3O6B A;  1S5G Y;  3NXA A;  2LP2 A;  1JF0 A;  1KK7 Y;  4MSP A;  3GOF A;  4XJK B;  1TNQ A;  3EKJ A;  2LMT A;  2MRD A;  3SIA A;  1FW4 A;  1Y6W A;  4CPV A;  1J7Q A;  1FI5 A;  2LM5 A;  4PHM A;  1SR6 C;  3LK0 A;  1XFY O;  2GGZ A;  4QJ4 B;  3BYA A;  1F54 A;  1JBA A;  1QVI Y;  2BCX A;  5PAL A;  3C1V A;  3WXA A;  1KCY A;  2NXQ A;  1H4B A;  1K93 D;  3BXK A;  3IQO A;  1M63 B;  4TNC A;  4BY4 A;  4CFR A;  2JWW A;  1J1E A;  3CTN A;  3CLN A;  4OR9 B;  2H2K A;  1U5I B;  3AAJ A;  4HRE E;  1GGW A;  1JFK A;  5IBW A;  1IKU A;  2K7C A;  1MWN A;  2BKH B;  1QIV A;  4F0Z B;  3KPX A;  1NWD A;  2M3W A;  1KFX S;  2L4I A;  3LL8 B;  2L0P A;  3EVU A;  1A75 B;  1KK8 C;  2F2P A;  4JWQ A;  1WRK A;  2BCA A;  3TZ1 A;  1B4C A;  1IRJ A;  4C0J A;  1KSM A;  1K2H A;  4GPL B;  3DVM A;  2KI4 B;  3CZT X;  4I5L B;  1XFW O;  1J1D A;  2L5X B;  1LXF C;  1OZS A;  1LKJ A;  5DKR A;  4PE1 A;  1X02 A;  3CR5 X;  5J3X A;  1ALW A;  1NIW A;  1QV1 A;  1YTZ C;  1UUR A;  3O4Y A;  2E6W A;  2BE4 A;  3SG2 A;  4YGC B;  3CR2 A;  2ZRT A;  2JXL A;  5GQQ C;  1XYD A;  1BOD A;  2F3Y A;  2LNK A;  1JC2 A;  3PSR A;  4WRI A;  1DT7 B;  2M29 A;  1F55 A;  3EVR A;  5ER4 X;  2KGR A;  4DUQ A;  1CLM A;  1WLZ A;  3DVJ A;  4MZK A;  1WLM A;  3BQ3 A;  3FS7 A;  1QTX A;  2G9B A;  2F3Z A;  4YGA A;  2K0J A;  2KAY A;  2GGM A;  1S3P A;  2F2O A;  2M9G A;  1XVJ A;  3ZWH A;  1EJ3 A;  1YVH A;  1ZOT B;  4I5N B;  1FI6 A;  3SG3 A;  1SL9 A;  1YX8 A;  1M39 A;  1IJ6 A;  3D0Y A;  3OB1 B;  1TRF A;  2Y1M A;  1QIW A;  4MZJ A;  2KI4 C;  2JNX A;  3PAL A;  1CDP A;  1L2O B;  1R2U A;  1CFD A;  1DJY A;  2ISD A;  5JJG A;  1J7P A;  2I2R E;  1N65 A;  1QAS A;  2BL0 B;  2V53 A;  1GJY A;  4YBH B;  1PSB A;  3DD4 A;  2HF5 A;  5I8N A;  1KSO A;  4YGE B;  1BMO A;  1XK4 A;  1K94 A;  2FOT A;  1EG4 A;  1TCO B;  1J55 A;  1XFX O;  4MVF A;  1SL7 A;  4PE7 A;  1M46 A;  1FBV A;  2Q91 A;  2BBN A;  2LLS A;  3LCP C;  2K7D A;  1ALV A;  1RFJ A;  2NLN A;  1DGU A;  1K90 D;  1RK9 A;  2OTG B;  1OMD A;  1J7R A;  1EL4 A;  2JQ6 A;  1SK6 D;  1PAL A;  2FJU B;  2LVV A;  2PVB A;  2CT9 A;  2KFF A;  4HRH A;  1IG5 A;  1CFC A;  2KBM A;  3EK8 A;  4ORA B;  3I5G B;  2O5G A;  5BPJ A;  1L2O C;  1KFX L;  1XO5 A;  2BCB A;  2BL0 C;  2LUC A;  3LK1 A;  1EH2 A;  1OSA A;  3KEV A;  2L50 A;  2MAZ A;  1EG3 A;  1SCM B;  4FQO A;  1PSR A;  1TIZ A;  4YRU A;  5I2L A;  3IF7 A;  3JTD B;  1BR1 B;  1F4O A;  1SY9 A;  2M1U A;  2WCB A;  4R1E A;  1CDL A;  1UWO A;  4UPG A;  2LVK A;  4P2Y B;  1MUX A;  2LLU A;  4YGD B;  4I5K A;  1XFU O;  2PSR A;  5KSZ A;  2AMI A;  2WOS A;  3VRN A;  1NUB A;  2MBX A;  2PAL A;  1G33 A;  1IGV A;  1UP5 A;  2OTG C;  3PN7 B;  3WNX B;  3BUO B;  1SBJ A;  2L51 A;  3TDU A;  3KF9 A;  2G2B A;  2K2A A;  1C7V A;  1FF1 A;  1B8R A;  2KHN A;  4GUK A;  1KWO B;  1YUT A;  3GK2 A;  1IH0 A;  3AKA A;  3I5G C;  3TDI A;  1NCX A;  1IQ3 A;  1UHI A;  1BR4 B;  4A4B A;  4OVN F;  3VRR A;  1EXR A;  1NX1 A;  1CFF A;  1L7Z A;  1NCZ A;  1CNP A;  1ZMZ A;  1ODB A;  1K9P A;  2WOR A;  4PCW A;  4JQ0 D;  3IQQ A;  1S1E A;  3D0Y B;  4GFT A;  1SCM C;  2TN4 A;  1NPQ A;  4A4C A;  1JFJ A;  2Y4Q A;  1S6C A;  2A4J A;  4AQI A;  3SG7 A;  3JTD C;  3CS1 A;  1DMO A;  2L98 A;  2NCO A;  2ZRS A;  3OP0 A;  2AUC A;  2CXJ A;  2MLE C;  2JPT A;  4MN0 A;  5FYX A;  3DF0 A;  2O60 A;  2JTT A;  2CTN A;  3KHE A;  3SG6 A;  1Y1X A;  2FCE A;  2K7O A;  3PN7 C;  2MLF C;  4P5O E;  2OPO A;  5AXI A;  1DJG A;  4MZL A;  2NZ0 A;  2ZKM X;  1HT9 A;  1DJW A;  1KWO C;  4MLW A;  4PE4 A;  5DKQ A;  1YX7 A;  2H61 A;  2KQ6 A;  3TS5 B;  1FPW A;  1G4Y R;  1QX7 A;  1S6J A;  1TNW A;  2KYC A;  3EK4 A;  2JZI A;  1S36 A;  2WCE A;  2ZND A;  3SG5 A;  4C0L A;  1AP4 A;  1CTR A;  1F8H A;  2KQY A;  3VRP A;  2K8M B;  1B47 A;  2P6B B;  3I5H C;  1CMG A;  2D8N A;  2JXC A;  1BOC A;  2WND A;  4PAL A;  2SCP A;  5I2Q A;  1PVB A;  4CID A;  4PHN A;  2MA2 A;  4NQG A;  5AAN A;  1IWQ A;  1OE9 B;  2KDH A;  1B7T Z;  3E3R A;  1TOP A;  1CLB A;  1BU3 A;  1XK4 C;  2OS8 B;  3BUN B;  3BOW A;  3VGO A;  4D1E A;  3NSI A;  4JPZ B;  4MBE A;  1ZUZ A;  1PRW A;  2M7L A;  1AK8 A;  1OOJ A;  5KU1 A;  2JOJ A;  1AJ4 A;  2JUL A;  3EVV A;  4QJ3 B;  3TS5 C;  1MQ1 A;  1BLQ A;  4L9M A;  4GGN A;  4Q04 A;  4GGF A;  1CDN A;  3OX5 A;  1CMF A;  3NSK A;  2ZN9 A;  3FWB A;  1QLS A;  4DRW A;  1B8L A;  2WC8 A;  3M0W A;  1QJT A;  2HQ8 A;  1K96 A;  1E8A A;  1NX2 A;  3GK4 X;  1A03 A;  3NSO A;  4M2O A;  2SAS A;  4NDB A;  2MJW B;  3PM8 A;  1SW8 A;  2K61 A;  1WDC B;  1CFP A;  2Q4U A;  2M8U A;  4GNK B;  3I5F B;  1QV0 A;  1DF0 A;  2EC6 B;  1BG1 A;  1AUI B;  2HPS A;  2OS8 C;  3HCM A;  1NSH A;  1OZO A;  4E68 A;  1NP8 A;  4M2Q A;  4QJ5 B;  3DF0 B;  3KO0 A;  5K89 A;  1R6P A;  5HKZ A;  4NDD A;  3A4U B;  1SMG A;  3EKH A;  5HYD A;  1RRO A;  4DS7 A;  2BEC A;  5DKN A;  3DVK A;  4C0K A;  1GGZ A;  4PHK A;  2JNF A;  2ZFD A;  1XA5 A;  4CFQ A;  4M2P A;  1UHJ A;  3O2P A;  3BUX B;  1YUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...