1TNPA

Structures of the apo and calcium troponin-c regulatory domains: the muscle contraction switch
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
90
structure length
90
Chain Sequence
ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN-C (APO)
publication title Structures of the troponin C regulatory domains in the apo and calcium-saturated states.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Calcium-binding protein
total genus 17
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 1995-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1tnpA00
1YVHA 3CWGA 2V53A 3KPXA 5AANA 1R2UA 3KHEA 1CKKA 1IJ5A 4R1EA 1A75B 1SR6B 2MLEC 3F45A 2P6BB 1QVIZ 3D0YB 1MQ1A 2JULA 2Y5IA 1DF0A 2EGDA 3NXAA 1BLQA 3JTDB 5GQQC 1WLZA 1IJ6A 1NPQA 3TZ1A 5K89A 4UPGA 2BCBA 1DTLA 1XFVO 1N65A 1RECA 1S1EA 2H2KA 2HF5A 3NSLA 3I5FC 2LVJA 3PATA 4CIDA 1PULA 1YX8A 4YGDB 3CS1A 2L50A 3TDIA 1BF5A 1AVSA 1YURA 1K90D 1JFJA 1J7RA 2LC5A 4F0ZB 1TCFA 1F54A 3VRPA 1C7VA 2K61A 4HRGA 5I2LA 1OMRA 4AOMA 2LVKA 1AJ5A 3AAJA 3BOWA 3I5HB 1YTZC 1LA0A 3HX4A 2BL0C 2LLUA 2LVVA 1TNQA 5HKWA 1FI6A 2PSRA 2BECA 3EVUA 4C0LA 3LK1A 1Y1XA 1ZOTB 4C0KA 3WNXB 1C07A 3BQ3A 3RLZA 4PCWA 1JF0A 1DJXA 1K9KA 1K95A 4MVFA 2E30A 1ZMZA 1U5IB 1KFUL 1M45A 3WHUB 4MRYA 4WQ3A 3LCPC 3C1VA 1M63B 3SG7A 1GJYA 1AP4A 5CSFA 4QJ3B 1CDNA 2LHIA 4PE1A 1EL4A 1QX2A 2G9BA 3VRQA 1K2HA 1KK7Z 4GAOA 2Q4UA 3PN7B 4Q04A 3O4YA 3O6BA 2CT9A 4N1GA 2CXJA 2KFFA 3NSKA 5I2OA 2MLFC 1N0YA 2AUCA 1L2OC 1OMDA 1DVIA 1TTXA 2JRFA 2ZN8A 4GGFA 2KAXA 4OCIA 5G08A 1NCZA 1GGWA 2GGZA 3O2PA 3I5GC 2MHHA 1ZUZA 3ZNIA 1SL8A 2LP3A 1VRKA 3JVTB 2NCPA 3PM8A 2KFHA 2K2FA 4A4BA 4BY4A 2PMYA 1F70A 2OS8B 4M2OA 1UHHA 1WY9A 2CNPA 2ZNEA 4L9MA 4JQ0D 2CTNA 1DJHA 2GGMA 5JOLA 1PALA 2ZRTA 1F55A 1K8UA 1HQVA 5CPVA 2JTTA 2WNDA 2M9GA 3PALA 3IF7A 3OX5A 4JWQA 1WRZA 2M0RA 2BKHB 5AFPA 2F2PA 2F3YA 2AAOA 4M2PA 4XJKA 3SIBA 1KQMC 1XK4A 3DVEA 2Y4QA 3GOFA 1PK0D 2JNFA 2ZFDA 4NDDA 1KWOB 1TIZA 4PE4A 2KGRA 4CPVA 3FIAA 2L2EA 1XYDA 1OZSA 1OOJA 1SR6C 3GK4X 4U8DA 2CBLA 4ORCB 5HYDA 1QLSA 4YGEB 2HETA 3SG6A 1ALWA 1LXFC 3JTDC 1Q80A 2BE4A 1YX7A 2D8NA 4MZLA 2GV5A 1S6IA 2OTGB 1CLBA 3DD4A 4I5NB 1CTRA 2FCDA 1JF2A 5ER5A 4PHKA 4E68A 2LLTA 4MEWA 4YI9A 3NSIA 5ER4X 3HCMA 1S3PA 2L5XB 2LMVA 3VRRA 1RK9A 2H61A 2WORA 5DKRA 4I5KA 5DKNA 1SKTA 1BR1B 1CFDA 1JWDA 1SL9A 1UUSA 1MR8A 2JT0A 2L51A 3I5HC 2JQ6A 3CR4X 5DKQA 1EG4A 2KHNA 2LNKA 4ORAB 1IH0A 1S6JA 1UWOA 1DMOA 1S5GZ 1NP8A 3H4SE 2K7DA 2ZNDA 1TNPA 4MN0A 1OSAA 3FWBA 1G33A 1CFCA 2WOSA 3BUNB 1QVIY 1DJGA 1QIVA 2WCEA 1PSBA 3EKJA 1B4CA 1M46A 5TNCA 2JXLA 3AAKA 2LP2A 1DGUA 1LKJA 1TNWA 1QJTA 1IWQA 1WRLA 1XFWO 4PHNA 4I5JA 1NX0A 1WDCB 3PN7C 2BBMA 5JJGA 2K7BA 1IG5A 3EVRA 4N5XA 4CFQA 1LA3A 1FF1A 3LLEA 1V1GA 2NZ0A 1PRWA 1QV1A 4NQGA 1EXRA 4GFTA 4PE7A 4HSZA 1QLKA 2KQYA 5IBWA 3NSOA 3SJSA 3BUWB 4DIRA 2PVBA 1S6CA 1MWNA 1DJIA 2BCXA 3I5IB 2MJWB 3CTNA 1MF8B 1NX1A 4OKHA 1B47A 1B8RA 1QASA 1QTXA 1TOPA 3JVTC 5AXIA 1MXLC 2LM5A 2OS8C 4MBEA 1J7PA 1A75A 1IQ3A 1B7TZ 2NLNA 2WCFA 1LVCD 3TUYB 1V1FA 3DF0B 2MA2A 3LK0A 1QIWA 3D0YA 1CFPA 1TCOB 1XFYO 3SG4A 1DT7B 1JSAA 2JXCA 2EC6B 2K7OA 3TS5B 1NX2A 4USLA 2LLSA 1YRTB 2LMUA 2TN4A 5HKYA 3VROA 1KK7Y 4YBHB 1L7ZA 1IGVA 1SW8A 3A8RA 4P5OE 1QV0A 4NDBA 2JWWA 1DJZA 3EK8A 1BJFA 1B9AA 3GK1A 5J3XA 2SCPA 3SG3A 1E8AA 3WHTB 3IQOA 1B8LA 3VRNA 1KSOA 1BR4B 1GGZA 1W7JB 4M2QA 2M29A 1NIWA 4FTGA 2JU0A 1QS7A 1J7OA 1JBAA 1G4YR 2PASA 5HKZA 1M39A 2MAZA 2KBIA 4GNKB 4D1EA 5D69A 1D1OA 5KSZA 2ZRSA 3OX6A 1AJ4A 4YGBB 1ODBA 2OTGC 1MHOA 1KK8B 5HLVA 1CMFA 4P2YB 1OQPA 2F2OA 3AKAA 1DF0B 4PHMA 1X02A 2L4IA 2ZN9A 4PDZA 1RWYA 1W7IB 1U5IA 2KGBC 1CDMA 2PRUA 1M31A 5BPJA 4CLNA 1BU3A 5AERA 2E6WA 1BMOA 1TNXA 1UHKA 4HREE 1R6PA 2MBXA 1KFXL 3QRXA 2R2IA 2M49B 2NCOA 1FBVA 5B8IB 1SCMB 2NXQA 3BOWB 2JZIA 1A4PA 3PLFB 3MSEB 2WCBA 3ICBA 3PSRA 1K96A 2CCMA 4NDCA 1CLMA 1F4OA 2L98A 1DJWA 1OE9B 1UURA 2KOTA 3SIAA 3BUMB 3WXAA 2KI4B 2K0JA 4PHJA 4JPZB 4YI8A 2B1UA 4GPLB 2BKIB 3BUOB 5CSNA 5HLOA 3VGOA 4YRUA 1PVAA 1BT6A 3BYAA 3E3RA 4DCKA 4WQ2A 1S26D 2F33A 2M7NA 1G8IA 1K9PA 1WDCC 5CSIA 4GGFC 1BOCA 2ISDA 2AMIA 2I2RE 2FJUB 2IS9A 2COLB 1XFXO 1MUXA 3EKHA 3PFVA 1AHRA 1TRFA 2KAVA 3GK2A 4MLWA 4ORBB 2ZKMX 2LCPA 3AKBA 3D10A 1A2XA 2G2BA 3DVJA 1XFZO 3O78A 1UHNA 3I5IC 1S5GY 3KF9A 1QATA 3A4UB 4WRIA 1RTP1 1YUTA 2BCAA 2Y1NA 1CNPA 4FQOA 2KFGA 1XO5A 1C7WA 1SL7A 4A4CA 3CGAA 3SG2A 1BODA 2BE6A 4AQIA 1EJ3A 3TUYC 5KTYA 3BUXB 2I18A 1LINA 1S36A 5I8NA 1QX7A 4AQJA 1CDLA 1J1EA 1UP5A 4YGCB 2JT3A 2K8MB 3EVVA 1JFKA 2QPTA 1GQMA 2EC6C 3TS5C 1NX3A 1XK4C 1AK8A 2KBMA 2KSPA 1YR5A 3DVMA 2LANA 2LE9B 2PALA 5CSJA 1JC2A 1ZFSA 1PSRA 1CLLA 3IQQA 3BXKA 4OV2A 1CDPA 1J1DA 1SPYA 2KYCA 3CLNA 5D7FA 1SBJA 2KDHA 2FOTA 4ETOA 5FYXA 3I5FB 1IKUA 1SYMA 3TDUA 1A03A 3CR2A 1XA5A 1KQVA 5PALA 1YUUA 4XJKB 1OZOA 1NCXA 1SY9A 3SG5A 1H4BA 4XYNA 2SASA 1A29A 3EK7A 3EK4A 3DVKA 2H61C 1ZACA 4DRWA 4OR9B 1QX5B 2JOJA 1F8HA 2LMTA 1OMVA 1B7TY 2Y1MA 1KK8C 1Y0VH 2KI6C 4TNCA 2KYFA 2HPSA 2BL0B 3K21A 3OB1B 4ZCVA 4DUQA 1DJYA 1ALVA 1KFUS 1MXEA 2KNEA 3ZWHA 2JC2A 1KWOC 1WLMA 2MRDA 4YGAA 1SNLA 2JPTA 4HRHA 3TDZA 1CFFA 2JNXA 2JT8A 2DOQA 1FW4A 4GBAA 5KU1A 4PALA 1AUIB 4I5LB 3CR5X 4ZCUA 4BY5A 5F6TA 2F3ZA 2M3WA 1Y6WA 2M7LA 2WC8A 3OP0A 1F4QA 2A4JA 5I2QA 4MRXA 1NYAA 1YRUB 1RROA 1SCMC 3KEVA 1UHIA 2RGIA 1CMGA 3KO0A 1K93D 4OVNF 1TN4A 4N1FA 1IQ5A 1PVBA 1FPWA 2M1UA 1NWDA 2EHBA 1SMGA 2FCEA 1XVJA 3OB2B 4QJ5B 2KAYA 2M8UA 2BBNA 2KI4C 4MSPA 4MZJA 3CZTX 1XFUO 4C0JA 1WRKA 2LHLA 4GGNA 1YUSA 1L2OB 2OPOA 1KCYA 3M0WA 2O60A 3DF0A 1CM1A 3I5GB 1JUOA 4DS7A 1FI5A 1Y1AA 5AEQA 4QJ4B 3LL8B 1QXPA 4CFRA 2HQWA 1NCYA 3RM1A 1SK6D 2Q91A 1DGVA 2KI6D 1KSMA 2I7AA 2LUCA 1B8CA 1NUBA 4GUKA 1SCVA 2M97A 1N2DA 2VRGA 1Y1UA 2LUXA 1EH2A 1K9UA 1RJVA 2K7CA 2L0PA 2KQ6A 4PE0A 2M1KB 1CB1A 1EG3A 3FS7A 1UHJA 2I94A 1F71A 1H8BA 2LV7A 4IL1A 2F8PA 2LAPA 1J7QA 1HT9A 1NSHA 1K94A 4MZKA 1CM4A 2QACA 1B1GA 1IRJA 3FWCA 2JTZA 1RFJA 1KQMB 2O5GA 4ICBA 1BG1A 1SRAA 2HQ8A 1YVLA 2L4HA 2LVIA 1KFXS 2K2AA 3OHMB 1J55A
chains in the Genus database with same CATH superfamily
1YVHA 3CWGA 2V53A 3KPXA 5AANA 1R2UA 3KHEA 1CKKA 1IJ5A 4R1EA 1A75B 1SR6B 2MLEC 3F45A 3Q8IA 1W9ZA 2P6BB 1C3YA 1QVIZ 3D0YB 1MQ1A 2JULA 2Y5IA 1F8HA 1DF0A 2EGDA 1DEKA 2QEVA 3NXAA 1BLQA 3JTDB 5GQQC 1WLZA 1IJ6A 1NPQA 3TZ1A 5K89A 4UPGA 1OOHA 2BCBA 1DTLA 1XFVO 1N65A 1RECA 1S1EA 2H2KA 2HF5A 3NGVA 3I5FC 2LVJA 3NSLA 3PATA 1PULA 4CIDA 1YX8A 4YGDB 3CS1A 2L50A 3TDIA 1BF5A 4JKTA 1AVSA 1YURA 1DC1A 1K90D 1JFJA 3N7HA 1J7RA 2LC5A 4INWA 1C3ZA 1TCFA 4F0ZB 1F54A 3VRPA 1C7VA 2K61A 4HRGA 3SS3A 5I2LA 1OMRA 4AOMA 2LVKA 1AJ5A 1TWOA 3AAJA 3BOWA 3I5HB 1YTZC 1LA0A 3HX4A 2BL0C 2LLUA 2LVVA 1TNQA 5HKWA 1FI6A 3OGNA 2PSRA 2BECA 3EVUA 4C0LA 5EL2A 3LK1A 1Y1XA 1ZOTB 4C0KA 3S0EA 3WNXB 1C07A 3BQ3A 3RLZA 4PCWA 1JF0A 1DJXA 1K9KA 1K95A 4MVFA 2E30A 1ZMZA 1U5IB 1KFUL 3CZ1A 1M45A 3WHUB 4MRYA 4WQ3A 3LCPC 3C1VA 1M63B 3SG7A 1GJYA 1AP4A 5CSFA 4QJ3B 1CDNA 2LHIA 4PE1A 1EL4A 1QX2A 2G9BA 3VRQA 3BFAA 1KK7Z 1K2HA 4GAOA 2Q4UA 3PN7B 4Q04A 3D76A 3O4YA 3O6BA 2CT9A 4N1GA 2WC5A 2CXJA 2KFFA 3NSKA 5I2OA 2QDIA 2MLFC 1N0YA 2L5YA 2AUCA 1L2OC 1OMDA 1DVIA 1TTXA 2JRFA 3CZ0A 2ZN8A 4GGFA 2KAXA 4OCIA 5G08A 1NCZA 1GGWA 2GGZA 3O2PA 3I5GC 2MHHA 1ZUZA 3ZNIA 1ORGA 1SL8A 2LP3A 1VRKA 3JVTB 2NCPA 3PM8A 2KFHA 2K2FA 4A4BA 4BY4A 2PMYA 1F70A 2OS8B 2WCHA 1IIOA 4M2OA 1UHHA 3V2LA 1WY9A 2CNPA 2ZNEA 2JPOA 3B88A 4L9MA 4JQ0D 2CTNA 1DJHA 2GGMA 3NHTA 1PALA 2ZRTA 5JOLA 1F55A 2P71A 1K8UA 1HQVA 5CPVA 2JTTA 2WNDA 2M9GA 3PALA 3IF7A 3OX5A 4JWQA 3S0GA 1WRZA 2M0RA 2BKHB 2BAPA 5AFPA 2F2PA 2F3YA 2AAOA 4M2PA 4XJKA 3SIBA 1KQMC 1XK4A 3DVEA 2Y4QA 3GOFA 1PK0D 2JNFA 2ZFDA 4NDDA 1KWOB 1TIZA 4PE4A 2KGRA 4CPVA 3FIAA 2L2EA 1XYDA 1OZSA 1OOJA 1SR6C 3GK4X 2P70A 4U8DA 2CBLA 4ORCB 5HYDA 1QLSA 4YGEB 2HETA 3SG6A 1ALWA 1LXFC 3JTDC 1Q80A 3O4XA 2BE4A 1YX7A 2D8NA 4MZLA 2GV5A 1S6IA 2OTGB 1Z2CB 1CLBA 3DD4A 4I5NB 1CTRA 2FCDA 1JF2A 5ER5A 4PHKA 4E68A 2LLTA 2YGUA 4MEWA 4YI9A 3NSIA 5ER4X 3HCMA 1S3PA 2L5XB 2LMVA 3VRRA 1RK9A 2H61A 2WORA 5DKRA 4I5KA 5DKNA 1SKTA 1BR1B 1CFDA 1JWDA 1SL9A 1UUSA 1MR8A 2JT0A 2L51A 4JD9A 3I5HC 2JQ6A 3CR4X 2FJYA 5DKQA 1EG4A 2KHNA 2LNKA 4ORAB 1IH0A 1S6JA 1UWOA 1DMOA 4KYNA 1S5GZ 3DZTA 1NP8A 3H4SE 2K7DA 2ZNDA 1QWVA 1TNPA 3PJIA 4MN0A 1OSAA 3FWBA 1G33A 1CFCA 2WOSA 3BUNB 1QVIY 1DJGA 1QIVA 2WCEA 1PSBA 3B86A 3EKJA 3OBVA 1B4CA 1M46A 5TNCA 2JXLA 3AAKA 3BJHA 2LP2A 1DGUA 1LKJA 1TNWA 1QJTA 1IWQA 1WRLA 1XFWO 3D77A 3S0DA 4PHNA 4I5JA 1NX0A 1WDCB 3PN7C 2BBMA 5JJGA 2K7BA 1IG5A 3EVRA 1P28A 4N5XA 4CFQA 1LA3A 1FF1A 3LLEA 1V1GA 2NZ0A 1PRWA 1QV1A 4NQGA 1EXRA 4FQTA 4GFTA 3D74A 4HSZA 4PE7A 1QLKA 2KQYA 5IBWA 3NSOA 5FI7A 3SJSA 3BUWB 4DIRA 2PVBA 1S6CA 1MWNA 1DJIA 2BCXA 3I5IB 2MJWB 3CTNA 1DQEA 3EG5B 1MF8B 1NX1A 4OKHA 1B47A 1B8RA 1QASA 1QTXA 1TOPA 3JVTC 5AXIA 1MXLC 2LM5A 2OS8C 4MBEA 1J7PA 1A75A 1Z4HA 3RZSA 3CABA 1IQ3A 1B7TZ 2NLNA 2WCFA 1LVCD 4IJ7A 3TUYB 1V1FA 3DF0B 2MA2A 2L2CA 3LK0A 1QIWA 3D0YA 3QMEA 1CFPA 1TCOB 1XFYO 3SG4A 1DT7B 1JSAA 2JXCA 2EC6B 2K7OA 3TS5B 1NX2A 3FE6A 4USLA 2LLSA 1YRTB 2LMUA 2TN4A 5HKYA 3VROA 1KK7Y 4YBHB 1L7ZA 1IGVA 1SW8A 3A8RA 3L4AA 1QV0A 4P5OE 1TUJA 2JWWA 1DJZA 3EK8A 4NDBA 1BJFA 1B9AA 3GK1A 5J3XA 2SCPA 3SG3A 1E8AA 3WHTB 3IQOA 1B8LA 3VRNA 1KSOA 3UNWA 1BR4B 1GGZA 1W7JB 4M2QA 2M29A 1NIWA 4FTGA 3SS4A 2GTEA 2JU0A 1QS7A 1J7OA 1JBAA 1G4YR 2PASA 5HKZA 1M39A 2MAZA 2KBIA 4GNKB 4D1EA 5D69A 1D1OA 3R72A 5KSZA 2PQLA 3B6XA 2ZRSA 1T14A 1AJ4A 3OX6A 4YGBB 4F7FA 1ODBA 2OTGC 1MHOA 1KK8B 5HLVA 1CMFA 4P2YB 3BFBA 1OQPA 2F2OA 3AKAA 1DF0B 4PHMA 1X02A 2L4IA 4INXA 2ZN9A 4PDZA 1RWYA 1W7IB 3S0AA 1U5IA 2KGBC 1OOFA 3D73A 1CDMA 2PRUA 1M31A 5BPJA 4CLNA 1BU3A 5AERA 2E6WA 1BMOA 1TNXA 1UHKA 4HREE 1R6PA 2WCMA 2MBXA 1KFXL 3QRXA 2PYQA 2R2IA 2M49B 2NCOA 1FBVA 5B8IB 1SCMB 2NXQA 3BOWB 2JZIA 1A4PA 3PLFB 3MSEB 2WCBA 3ICBA 3PSRA 3K1EA 1K96A 2CCMA 4NDCA 1CLMA 1F4OA 2L98A 1DJWA 1OE9B 1UURA 2KOTA 3SIAA 3BUMB 3WXAA 2KI4B 2K0JA 2QEHA 4PHJA 4JPZB 4YI8A 2B1UA 4GPLB 2BKIB 3BUOB 5CSNA 5HLOA 2KLDA 3VGOA 4YRUA 1PVAA 1BT6A 3BYAA 2WCKA 2WCLA 3E3RA 4DCKA 4WQ2A 1S26D 2F33A 2M7NA 1G8IA 1K9PA 1WDCC 5CSIA 4GGFC 1BOCA 2ISDA 2AMIA 2I2RE 2FJUB 2IS9A 2COLB 1XFXO 1MUXA 3EKHA 3PFVA 1AHRA 1TRFA 2KAVA 3GK2A 3IVTA 4MLWA 2ZKMX 4ORBB 2LCPA 3AKBA 2ERBA 3D10A 1A2XA 2G2BA 3DVJA 5D3OA 1XFZO 3O78A 1UHNA 3I5IC 1S5GY 3KF9A 1QATA 3A4UB 4WRIA 1RTP1 1YUTA 2BCAA 2Y1NA 3NHIA 1CNPA 4FQOA 2KFGA 1XO5A 1C7WA 1SL7A 2K60A 5FI2A 1SSEB 4A4CA 3CGAA 3S0BA 3SG2A 1BODA 2BE6A 4AQIA 1EJ3A 3TUYC 5KTYA 3BUXB 2I18A 1LINA 1S36A 5I8NA 1QX7A 4AQJA 1CDLA 1J1EA 1UP5A 4YGCB 2JT3A 3R1PA 2K8MB 3EVVA 1JFKA 2QPTA 1GQMA 2EC6C 3TS5C 1NX3A 1XK4C 1AK8A 3DXLA 1LS8A 2KBMA 2KSPA 1YR5A 3DVMA 2LANA 2LE9B 3B7AA 2PALA 2H8VA 5CSJA 1JC2A 1ZFSA 1PSRA 1CLLA 3IQQA 3BXKA 3PM2A 1DELA 4OV2A 1CDPA 1J1DA 1SPYA 2KYCA 3CLNA 5D7FA 1SBJA 2KDHA 3DY9A 2FOTA 4ETOA 5FYXA 1GM0A 3I5FB 1IKUA 1SYMA 3TDUA 1A03A 3CR2A 1XA5A 5DICA 1KQVA 5PALA 1YUUA 4XJKB 1OZOA 3SS5A 1NCXA 1SY9A 2KPHA 3SG5A 1H4BA 3L47A 3DYEA 4XYNA 2SASA 1A29A 3EK7A 3EK4A 3DVKA 2H61C 1ZACA 4DRWA 4OR9B 1QX5B 2JOJA 3S0FA 2LMTA 1OMVA 1B7TY 2Y1MA 1KK8C 1Y0VH 2KI6C 4TNCA 2KYFA 5HL1A 2HPSA 2BL0B 3VB1A 3D78A 3K21A 3OB1B 4ZCVA 4DUQA 1DJYA 1ALVA 1KFUS 1MXEA 2KNEA 3ZWHA 2JC2A 1KWOC 2WC6A 1WLMA 2MRDA 4YGAA 1SNLA 2JPTA 4HRHA 3TDZA 1CFFA 4PT1A 2JNXA 2JT8A 3R1OA 1OOGA 4OZDA 2DOQA 1FW4A 4GBAA 5KU1A 4PALA 1AUIB 4I5LB 3CR5X 4ZCUA 4BY5A 5F6TA 1XFRA 2F3ZA 2M3WA 2QEBA 3B87A 1Y6WA 2M7LA 2WC8A 3OP0A 3FE8A 1F4QA 2A4JA 5I2QA 4MRXA 1NYAA 3CZ2A 3UO9A 1YRUB 3R1VA 3CDNA 1RROA 1SCMC 3KEVA 3L4LA 3D75A 1UHIA 5FI6A 2RGIA 1CMGA 3KO0A 1K93D 4OVNF 1TN4A 4N1FA 1IQ5A 1PVBA 1FPWA 2M1UA 1NWDA 2EHBA 1SMGA 2FCEA 1XVJA 3OB2B 4QJ5B 2KAYA 2M8UA 2BBNA 2KI4C 4MSPA 4MZJA 3CZTX 1XFUO 4C0JA 1WRKA 2LHLA 4GGNA 1YUSA 1L2OB 2OPOA 1KCYA 3M0WA 2O60A 3DF0A 5I94A 1CM1A 3I5GB 1JUOA 4DS7A 1TUZA 1Y1AA 5AEQA 4QJ4B 1FI5A 3LL8B 1QXPA 4CFRA 2HQWA 1NCYA 3FE9A 3RM1A 1SK6D 2Q91A 1DGVA 2KI6D 1KSMA 2I7AA 2BNXA 1B8CA 1NUBA 2LUCA 4GUKA 1SCVA 2M97A 1N2DA 2VRGA 1Y1UA 2LUXA 1EH2A 2KLEA 1K9UA 1RJVA 2K7CA 2L0PA 2KQ6A 4PE0A 2M1KB 1CB1A 3BFHA 1EG3A 3FS7A 1UHJA 2I94A 1OOIX 1F71A 1H8BA 2LV7A 3CYZA 4IL1A 2F8PA 2LAPA 1J7QA 1HT9A 1NSHA 1K94A 4MZKA 1CM4A 2QACA 1B1GA 2QEOA 1IRJA 3FWCA 2JTZA 1RFJA 2WCJA 1KQMB 2O5GA 4ICBA 1BG1A 1OW4A 1SRAA 2HQ8A 1YVLA 2L4HA 2LVIA 1KFXS 2K2AA 3OHMB 1J55A
chains in the Genus database with same CATH topology
1YVHA 3CWGA 2V53A 3KPXA 5AANA 1R2UA 3KHEA 1CKKA 1IJ5A 4R1EA 1A75B 1SR6B 2MLEC 3F45A 2P6BB 1QVIZ 3D0YB 1MQ1A 2JULA 2Y5IA 1DF0A 2EGDA 3NXAA 1BLQA 3JTDB 5GQQC 1WLZA 1IJ6A 1NPQA 3TZ1A 5K89A 4UPGA 2BCBA 1DTLA 1XFVO 1N65A 1RECA 1S1EA 2H2KA 2HF5A 3NSLA 3I5FC 2LVJA 3PATA 4CIDA 1PULA 1YX8A 4YGDB 3CS1A 2L50A 3TDIA 1BF5A 1AVSA 1YURA 1K90D 1JFJA 1J7RA 2LC5A 4F0ZB 1TCFA 1F54A 3VRPA 1C7VA 2K61A 4HRGA 5I2LA 1OMRA 4AOMA 2LVKA 1AJ5A 3AAJA 3BOWA 3I5HB 1YTZC 1LA0A 3HX4A 2BL0C 2LLUA 2LVVA 1TNQA 5HKWA 1FI6A 2PSRA 2BECA 3EVUA 4C0LA 3LK1A 1Y1XA 1ZOTB 4C0KA 3WNXB 1C07A 3BQ3A 3RLZA 4PCWA 1JF0A 1DJXA 1K9KA 1K95A 4MVFA 2E30A 1ZMZA 1U5IB 1KFUL 1M45A 3WHUB 4MRYA 4WQ3A 3LCPC 3C1VA 1M63B 3SG7A 1GJYA 1AP4A 5CSFA 4QJ3B 1CDNA 2LHIA 4PE1A 1EL4A 1QX2A 2G9BA 3VRQA 1K2HA 1KK7Z 4GAOA 2Q4UA 3PN7B 4Q04A 3O4YA 3O6BA 2CT9A 4N1GA 2CXJA 2KFFA 3NSKA 5I2OA 2MLFC 1N0YA 2AUCA 1L2OC 1OMDA 1DVIA 1TTXA 2JRFA 2ZN8A 4GGFA 2KAXA 4OCIA 5G08A 1NCZA 1GGWA 2GGZA 3O2PA 3I5GC 2MHHA 1ZUZA 3ZNIA 1SL8A 2LP3A 1VRKA 3JVTB 2NCPA 3PM8A 2KFHA 2K2FA 4A4BA 4BY4A 2PMYA 1F70A 2OS8B 4M2OA 1UHHA 1WY9A 2CNPA 2ZNEA 4L9MA 4JQ0D 2CTNA 1DJHA 2GGMA 5JOLA 1PALA 2ZRTA 1F55A 1K8UA 1HQVA 5CPVA 2JTTA 2WNDA 2M9GA 3PALA 3IF7A 3OX5A 4JWQA 1WRZA 2M0RA 2BKHB 5AFPA 2F2PA 2F3YA 2AAOA 4M2PA 4XJKA 3SIBA 1KQMC 1XK4A 3DVEA 2Y4QA 3GOFA 1PK0D 2JNFA 2ZFDA 4NDDA 1KWOB 1TIZA 4PE4A 2KGRA 4CPVA 3FIAA 2L2EA 1XYDA 1OZSA 1OOJA 1SR6C 3GK4X 4U8DA 2CBLA 4ORCB 5HYDA 1QLSA 4YGEB 2HETA 3SG6A 1ALWA 1LXFC 3JTDC 1Q80A 2BE4A 1YX7A 2D8NA 4MZLA 2GV5A 1S6IA 2OTGB 1CLBA 3DD4A 4I5NB 1CTRA 2FCDA 1JF2A 5ER5A 4PHKA 4E68A 2LLTA 4MEWA 4YI9A 3NSIA 5ER4X 3HCMA 1S3PA 2L5XB 2LMVA 3VRRA 1RK9A 2H61A 2WORA 5DKRA 4I5KA 5DKNA 1SKTA 1BR1B 1CFDA 1JWDA 1SL9A 1UUSA 1MR8A 2JT0A 2L51A 3I5HC 2JQ6A 3CR4X 5DKQA 1EG4A 2KHNA 2LNKA 4ORAB 1IH0A 1S6JA 1UWOA 1DMOA 1S5GZ 1NP8A 3H4SE 2K7DA 2ZNDA 1TNPA 4MN0A 1OSAA 3FWBA 1G33A 1CFCA 2WOSA 3BUNB 1QVIY 1DJGA 1QIVA 2WCEA 1PSBA 3EKJA 1B4CA 1M46A 5TNCA 2JXLA 3AAKA 2LP2A 1DGUA 1LKJA 1TNWA 1QJTA 1IWQA 1WRLA 1XFWO 4PHNA 4I5JA 1NX0A 1WDCB 3PN7C 2BBMA 5JJGA 2K7BA 1IG5A 3EVRA 4N5XA 4CFQA 1LA3A 1FF1A 3LLEA 1V1GA 2NZ0A 1PRWA 1QV1A 4NQGA 1EXRA 4GFTA 4PE7A 4HSZA 1QLKA 2KQYA 5IBWA 3NSOA 3SJSA 3BUWB 4DIRA 2PVBA 1S6CA 1MWNA 1DJIA 2BCXA 3I5IB 2MJWB 3CTNA 1MF8B 1NX1A 4OKHA 1B47A 1B8RA 1QASA 1QTXA 1TOPA 3JVTC 5AXIA 1MXLC 2LM5A 2OS8C 4MBEA 1J7PA 1A75A 1IQ3A 1B7TZ 2NLNA 2WCFA 1LVCD 3TUYB 1V1FA 3DF0B 2MA2A 3LK0A 1QIWA 3D0YA 1CFPA 1TCOB 1XFYO 3SG4A 1DT7B 1JSAA 2JXCA 2EC6B 2K7OA 3TS5B 1NX2A 4USLA 2LLSA 1YRTB 2LMUA 2TN4A 5HKYA 3VROA 1KK7Y 4YBHB 1L7ZA 1IGVA 1SW8A 3A8RA 4P5OE 1QV0A 4NDBA 2JWWA 1DJZA 3EK8A 1BJFA 1B9AA 3GK1A 5J3XA 2SCPA 3SG3A 1E8AA 3WHTB 3IQOA 1B8LA 3VRNA 1KSOA 1BR4B 1GGZA 1W7JB 4M2QA 2M29A 1NIWA 4FTGA 2JU0A 1QS7A 1J7OA 1JBAA 1G4YR 2PASA 5HKZA 1M39A 2MAZA 2KBIA 4GNKB 4D1EA 5D69A 1D1OA 5KSZA 2ZRSA 3OX6A 1AJ4A 4YGBB 1ODBA 2OTGC 1MHOA 1KK8B 5HLVA 1CMFA 4P2YB 1OQPA 2F2OA 3AKAA 1DF0B 4PHMA 1X02A 2L4IA 2ZN9A 4PDZA 1RWYA 1W7IB 1U5IA 2KGBC 1CDMA 2PRUA 1M31A 5BPJA 4CLNA 1BU3A 5AERA 2E6WA 1BMOA 1TNXA 1UHKA 4HREE 1R6PA 2MBXA 1KFXL 3QRXA 2R2IA 2M49B 2NCOA 1FBVA 5B8IB 1SCMB 2NXQA 3BOWB 2JZIA 1A4PA 3PLFB 3MSEB 2WCBA 3ICBA 3PSRA 1K96A 2CCMA 4NDCA 1CLMA 1F4OA 2L98A 1DJWA 1OE9B 1UURA 2KOTA 3SIAA 3BUMB 3WXAA 2KI4B 2K0JA 4PHJA 4JPZB 4YI8A 2B1UA 4GPLB 2BKIB 3BUOB 5CSNA 5HLOA 3VGOA 4YRUA 1PVAA 1BT6A 3BYAA 3E3RA 4DCKA 4WQ2A 1S26D 2F33A 2M7NA 1G8IA 1K9PA 1WDCC 5CSIA 4GGFC 1BOCA 2ISDA 2AMIA 2I2RE 2FJUB 2IS9A 2COLB 1XFXO 1MUXA 3EKHA 3PFVA 1AHRA 1TRFA 2KAVA 3GK2A 4MLWA 4ORBB 2ZKMX 2LCPA 3AKBA 3D10A 1A2XA 2G2BA 3DVJA 1XFZO 3O78A 1UHNA 3I5IC 1S5GY 3KF9A 1QATA 3A4UB 4WRIA 1RTP1 1YUTA 2BCAA 2Y1NA 1CNPA 4FQOA 2KFGA 1XO5A 1C7WA 1SL7A 4A4CA 3CGAA 3SG2A 1BODA 2BE6A 4AQIA 1EJ3A 3TUYC 5KTYA 3BUXB 2I18A 1LINA 1S36A 5I8NA 1QX7A 4AQJA 1CDLA 1J1EA 1UP5A 4YGCB 2JT3A 2K8MB 3EVVA 1JFKA 2QPTA 1GQMA 2EC6C 3TS5C 1NX3A 1XK4C 1AK8A 2KBMA 2KSPA 1YR5A 3DVMA 2LANA 2LE9B 2PALA 5CSJA 1JC2A 1ZFSA 1PSRA 1CLLA 3IQQA 3BXKA 4OV2A 1CDPA 1J1DA 1SPYA 2KYCA 3CLNA 5D7FA 1SBJA 2KDHA 2FOTA 4ETOA 5FYXA 3I5FB 1IKUA 1SYMA 3TDUA 1A03A 3CR2A 1XA5A 1KQVA 5PALA 1YUUA 4XJKB 1OZOA 1NCXA 1SY9A 3SG5A 1H4BA 4XYNA 2SASA 1A29A 3EK7A 3EK4A 3DVKA 2H61C 1ZACA 4DRWA 4OR9B 1QX5B 2JOJA 1F8HA 2LMTA 1OMVA 1B7TY 2Y1MA 1KK8C 1Y0VH 2KI6C 4TNCA 2KYFA 2HPSA 2BL0B 3K21A 3OB1B 4ZCVA 4DUQA 1DJYA 1ALVA 1KFUS 1MXEA 2KNEA 3ZWHA 2JC2A 1KWOC 1WLMA 2MRDA 4YGAA 1SNLA 2JPTA 4HRHA 3TDZA 1CFFA 2JNXA 2JT8A 2DOQA 1FW4A 4GBAA 5KU1A 4PALA 1AUIB 4I5LB 3CR5X 4ZCUA 4BY5A 5F6TA 2F3ZA 2M3WA 1Y6WA 2M7LA 2WC8A 3OP0A 1F4QA 2A4JA 5I2QA 4MRXA 1NYAA 1YRUB 1RROA 1SCMC 3KEVA 1UHIA 2RGIA 1CMGA 3KO0A 1K93D 4OVNF 1TN4A 4N1FA 1IQ5A 1PVBA 1FPWA 2M1UA 1NWDA 2EHBA 1SMGA 2FCEA 1XVJA 3OB2B 4QJ5B 2KAYA 2M8UA 2BBNA 2KI4C 4MSPA 4MZJA 3CZTX 1XFUO 4C0JA 1WRKA 2LHLA 4GGNA 1YUSA 1L2OB 2OPOA 1KCYA 3M0WA 2O60A 3DF0A 1CM1A 3I5GB 1JUOA 4DS7A 1FI5A 1Y1AA 5AEQA 4QJ4B 3LL8B 1QXPA 4CFRA 2HQWA 1NCYA 3RM1A 1SK6D 2Q91A 1DGVA 2KI6D 1KSMA 2I7AA 2LUCA 1B8CA 1NUBA 4GUKA 1SCVA 2M97A 1N2DA 2VRGA 1Y1UA 2LUXA 1EH2A 1K9UA 1RJVA 2K7CA 2L0PA 2KQ6A 4PE0A 2M1KB 1CB1A 1EG3A 3FS7A 1UHJA 2I94A 1F71A 1H8BA 2LV7A 4IL1A 2F8PA 2LAPA 1J7QA 1HT9A 1NSHA 1K94A 4MZKA 1CM4A 2QACA 1B1GA 1IRJA 3FWCA 2JTZA 1RFJA 1KQMB 2O5GA 4ICBA 1BG1A 1SRAA 2HQ8A 1YVLA 2L4HA 2LVIA 1KFXS 2K2AA 3OHMB 1J55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVH A;  3CWG A;  2V53 A;  3KPX A;  5AAN A;  1R2U A;  3KHE A;  1CKK A;  1IJ5 A;  4R1E A;  1A75 B;  1SR6 B;  2MLE C;  3F45 A;  2P6B B;  1QVI Z;  3D0Y B;  1MQ1 A;  2JUL A;  2Y5I A;  1DF0 A;  2EGD A;  3NXA A;  1BLQ A;  3JTD B;  5GQQ C;  1WLZ A;  1IJ6 A;  1NPQ A;  3TZ1 A;  5K89 A;  4UPG A;  2BCB A;  1DTL A;  1XFV O;  1N65 A;  1REC A;  1S1E A;  2H2K A;  2HF5 A;  3NSL A;  3I5F C;  2LVJ A;  3PAT A;  4CID A;  1PUL A;  1YX8 A;  4YGD B;  3CS1 A;  2L50 A;  3TDI A;  1BF5 A;  1AVS A;  1YUR A;  1K90 D;  1JFJ A;  1J7R A;  2LC5 A;  4F0Z B;  1TCF A;  1F54 A;  3VRP A;  1C7V A;  2K61 A;  4HRG A;  5I2L A;  1OMR A;  4AOM A;  2LVK A;  1AJ5 A;  3AAJ A;  3BOW A;  3I5H B;  1YTZ C;  1LA0 A;  3HX4 A;  2BL0 C;  2LLU A;  2LVV A;  1TNQ A;  5HKW A;  1FI6 A;  2PSR A;  2BEC A;  3EVU A;  4C0L A;  3LK1 A;  1Y1X A;  1ZOT B;  4C0K A;  3WNX B;  1C07 A;  3BQ3 A;  3RLZ A;  4PCW A;  1JF0 A;  1DJX A;  1K9K A;  1K95 A;  4MVF A;  2E30 A;  1ZMZ A;  1U5I B;  1KFU L;  1M45 A;  3WHU B;  4MRY A;  4WQ3 A;  3LCP C;  3C1V A;  1M63 B;  3SG7 A;  1GJY A;  1AP4 A;  5CSF A;  4QJ3 B;  1CDN A;  2LHI A;  4PE1 A;  1EL4 A;  1QX2 A;  2G9B A;  3VRQ A;  1K2H A;  1KK7 Z;  4GAO A;  2Q4U A;  3PN7 B;  4Q04 A;  3O4Y A;  3O6B A;  2CT9 A;  4N1G A;  2CXJ A;  2KFF A;  3NSK A;  5I2O A;  2MLF C;  1N0Y A;  2AUC A;  1L2O C;  1OMD A;  1DVI A;  1TTX A;  2JRF A;  2ZN8 A;  4GGF A;  2KAX A;  4OCI A;  5G08 A;  1NCZ A;  1GGW A;  2GGZ A;  3O2P A;  3I5G C;  2MHH A;  1ZUZ A;  3ZNI A;  1SL8 A;  2LP3 A;  1VRK A;  3JVT B;  2NCP A;  3PM8 A;  2KFH A;  2K2F A;  4A4B A;  4BY4 A;  2PMY A;  1F70 A;  2OS8 B;  4M2O A;  1UHH A;  1WY9 A;  2CNP A;  2ZNE A;  4L9M A;  4JQ0 D;  2CTN A;  1DJH A;  2GGM A;  5JOL A;  1PAL A;  2ZRT A;  1F55 A;  1K8U A;  1HQV A;  5CPV A;  2JTT A;  2WND A;  2M9G A;  3PAL A;  3IF7 A;  3OX5 A;  4JWQ A;  1WRZ A;  2M0R A;  2BKH B;  5AFP A;  2F2P A;  2F3Y A;  2AAO A;  4M2P A;  4XJK A;  3SIB A;  1KQM C;  1XK4 A;  3DVE A;  2Y4Q A;  3GOF A;  1PK0 D;  2JNF A;  2ZFD A;  4NDD A;  1KWO B;  1TIZ A;  4PE4 A;  2KGR A;  4CPV A;  3FIA A;  2L2E A;  1XYD A;  1OZS A;  1OOJ A;  1SR6 C;  3GK4 X;  4U8D A;  2CBL A;  4ORC B;  5HYD A;  1QLS A;  4YGE B;  2HET A;  3SG6 A;  1ALW A;  1LXF C;  3JTD C;  1Q80 A;  2BE4 A;  1YX7 A;  2D8N A;  4MZL A;  2GV5 A;  1S6I A;  2OTG B;  1CLB A;  3DD4 A;  4I5N B;  1CTR A;  2FCD A;  1JF2 A;  5ER5 A;  4PHK A;  4E68 A;  2LLT A;  4MEW A;  4YI9 A;  3NSI A;  5ER4 X;  3HCM A;  1S3P A;  2L5X B;  2LMV A;  3VRR A;  1RK9 A;  2H61 A;  2WOR A;  5DKR A;  4I5K A;  5DKN A;  1SKT A;  1BR1 B;  1CFD A;  1JWD A;  1SL9 A;  1UUS A;  1MR8 A;  2JT0 A;  2L51 A;  3I5H C;  2JQ6 A;  3CR4 X;  5DKQ A;  1EG4 A;  2KHN A;  2LNK A;  4ORA B;  1IH0 A;  1S6J A;  1UWO A;  1DMO A;  1S5G Z;  1NP8 A;  3H4S E;  2K7D A;  2ZND A;  1TNP A;  4MN0 A;  1OSA A;  3FWB A;  1G33 A;  1CFC A;  2WOS A;  3BUN B;  1QVI Y;  1DJG A;  1QIV A;  2WCE A;  1PSB A;  3EKJ A;  1B4C A;  1M46 A;  5TNC A;  2JXL A;  3AAK A;  2LP2 A;  1DGU A;  1LKJ A;  1TNW A;  1QJT A;  1IWQ A;  1WRL A;  1XFW O;  4PHN A;  4I5J A;  1NX0 A;  1WDC B;  3PN7 C;  2BBM A;  5JJG A;  2K7B A;  1IG5 A;  3EVR A;  4N5X A;  4CFQ A;  1LA3 A;  1FF1 A;  3LLE A;  1V1G A;  2NZ0 A;  1PRW A;  1QV1 A;  4NQG A;  1EXR A;  4GFT A;  4PE7 A;  4HSZ A;  1QLK A;  2KQY A;  5IBW A;  3NSO A;  3SJS A;  3BUW B;  4DIR A;  2PVB A;  1S6C A;  1MWN A;  1DJI A;  2BCX A;  3I5I B;  2MJW B;  3CTN A;  1MF8 B;  1NX1 A;  4OKH A;  1B47 A;  1B8R A;  1QAS A;  1QTX A;  1TOP A;  3JVT C;  5AXI A;  1MXL C;  2LM5 A;  2OS8 C;  4MBE A;  1J7P A;  1A75 A;  1IQ3 A;  1B7T Z;  2NLN A;  2WCF A;  1LVC D;  3TUY B;  1V1F A;  3DF0 B;  2MA2 A;  3LK0 A;  1QIW A;  3D0Y A;  1CFP A;  1TCO B;  1XFY O;  3SG4 A;  1DT7 B;  1JSA A;  2JXC A;  2EC6 B;  2K7O A;  3TS5 B;  1NX2 A;  4USL A;  2LLS A;  1YRT B;  2LMU A;  2TN4 A;  5HKY A;  3VRO A;  1KK7 Y;  4YBH B;  1L7Z A;  1IGV A;  1SW8 A;  3A8R A;  4P5O E;  1QV0 A;  4NDB A;  2JWW A;  1DJZ A;  3EK8 A;  1BJF A;  1B9A A;  3GK1 A;  5J3X A;  2SCP A;  3SG3 A;  1E8A A;  3WHT B;  3IQO A;  1B8L A;  3VRN A;  1KSO A;  1BR4 B;  1GGZ A;  1W7J B;  4M2Q A;  2M29 A;  1NIW A;  4FTG A;  2JU0 A;  1QS7 A;  1J7O A;  1JBA A;  1G4Y R;  2PAS A;  5HKZ A;  1M39 A;  2MAZ A;  2KBI A;  4GNK B;  4D1E A;  5D69 A;  1D1O A;  5KSZ A;  2ZRS A;  3OX6 A;  1AJ4 A;  4YGB B;  1ODB A;  2OTG C;  1MHO A;  1KK8 B;  5HLV A;  1CMF A;  4P2Y B;  1OQP A;  2F2O A;  3AKA A;  1DF0 B;  4PHM A;  1X02 A;  2L4I A;  2ZN9 A;  4PDZ A;  1RWY A;  1W7I B;  1U5I A;  2KGB C;  1CDM A;  2PRU A;  1M31 A;  5BPJ A;  4CLN A;  1BU3 A;  5AER A;  2E6W A;  1BMO A;  1TNX A;  1UHK A;  4HRE E;  1R6P A;  2MBX A;  1KFX L;  3QRX A;  2R2I A;  2M49 B;  2NCO A;  1FBV A;  5B8I B;  1SCM B;  2NXQ A;  3BOW B;  2JZI A;  1A4P A;  3PLF B;  3MSE B;  2WCB A;  3ICB A;  3PSR A;  1K96 A;  2CCM A;  4NDC A;  1CLM A;  1F4O A;  2L98 A;  1DJW A;  1OE9 B;  1UUR A;  2KOT A;  3SIA A;  3BUM B;  3WXA A;  2KI4 B;  2K0J A;  4PHJ A;  4JPZ B;  4YI8 A;  2B1U A;  4GPL B;  2BKI B;  3BUO B;  5CSN A;  5HLO A;  3VGO A;  4YRU A;  1PVA A;  1BT6 A;  3BYA A;  3E3R A;  4DCK A;  4WQ2 A;  1S26 D;  2F33 A;  2M7N A;  1G8I A;  1K9P A;  1WDC C;  5CSI A;  4GGF C;  1BOC A;  2ISD A;  2AMI A;  2I2R E;  2FJU B;  2IS9 A;  2COL B;  1XFX O;  1MUX A;  3EKH A;  3PFV A;  1AHR A;  1TRF A;  2KAV A;  3GK2 A;  4MLW A;  4ORB B;  2ZKM X;  2LCP A;  3AKB A;  3D10 A;  1A2X A;  2G2B A;  3DVJ A;  1XFZ O;  3O78 A;  1UHN A;  3I5I C;  1S5G Y;  3KF9 A;  1QAT A;  3A4U B;  4WRI A;  1RTP 1;  1YUT A;  2BCA A;  2Y1N A;  1CNP A;  4FQO A;  2KFG A;  1XO5 A;  1C7W A;  1SL7 A;  4A4C A;  3CGA A;  3SG2 A;  1BOD A;  2BE6 A;  4AQI A;  1EJ3 A;  3TUY C;  5KTY A;  3BUX B;  2I18 A;  1LIN A;  1S36 A;  5I8N A;  1QX7 A;  4AQJ A;  1CDL A;  1J1E A;  1UP5 A;  4YGC B;  2JT3 A;  2K8M B;  3EVV A;  1JFK A;  2QPT A;  1GQM A;  2EC6 C;  3TS5 C;  1NX3 A;  1XK4 C;  1AK8 A;  2KBM A;  2KSP A;  1YR5 A;  3DVM A;  2LAN A;  2LE9 B;  2PAL A;  5CSJ A;  1JC2 A;  1ZFS A;  1PSR A;  1CLL A;  3IQQ A;  3BXK A;  4OV2 A;  1CDP A;  1J1D A;  1SPY A;  2KYC A;  3CLN A;  5D7F A;  1SBJ A;  2KDH A;  2FOT A;  4ETO A;  5FYX A;  3I5F B;  1IKU A;  1SYM A;  3TDU A;  1A03 A;  3CR2 A;  1XA5 A;  1KQV A;  5PAL A;  1YUU A;  4XJK B;  1OZO A;  1NCX A;  1SY9 A;  3SG5 A;  1H4B A;  4XYN A;  2SAS A;  1A29 A;  3EK7 A;  3EK4 A;  3DVK A;  2H61 C;  1ZAC A;  4DRW A;  4OR9 B;  1QX5 B;  2JOJ A;  1F8H A;  2LMT A;  1OMV A;  1B7T Y;  2Y1M A;  1KK8 C;  1Y0V H;  2KI6 C;  4TNC A;  2KYF A;  2HPS A;  2BL0 B;  3K21 A;  3OB1 B;  4ZCV A;  4DUQ A;  1DJY A;  1ALV A;  1KFU S;  1MXE A;  2KNE A;  3ZWH A;  2JC2 A;  1KWO C;  1WLM A;  2MRD A;  4YGA A;  1SNL A;  2JPT A;  4HRH A;  3TDZ A;  1CFF A;  2JNX A;  2JT8 A;  2DOQ A;  1FW4 A;  4GBA A;  5KU1 A;  4PAL A;  1AUI B;  4I5L B;  3CR5 X;  4ZCU A;  4BY5 A;  5F6T A;  2F3Z A;  2M3W A;  1Y6W A;  2M7L A;  2WC8 A;  3OP0 A;  1F4Q A;  2A4J A;  5I2Q A;  4MRX A;  1NYA A;  1YRU B;  1RRO A;  1SCM C;  3KEV A;  1UHI A;  2RGI A;  1CMG A;  3KO0 A;  1K93 D;  4OVN F;  1TN4 A;  4N1F A;  1IQ5 A;  1PVB A;  1FPW A;  2M1U A;  1NWD A;  2EHB A;  1SMG A;  2FCE A;  1XVJ A;  3OB2 B;  4QJ5 B;  2KAY A;  2M8U A;  2BBN A;  2KI4 C;  4MSP A;  4MZJ A;  3CZT X;  1XFU O;  4C0J A;  1WRK A;  2LHL A;  4GGN A;  1YUS A;  1L2O B;  2OPO A;  1KCY A;  3M0W A;  2O60 A;  3DF0 A;  1CM1 A;  3I5G B;  1JUO A;  4DS7 A;  1FI5 A;  1Y1A A;  5AEQ A;  4QJ4 B;  3LL8 B;  1QXP A;  4CFR A;  2HQW A;  1NCY A;  3RM1 A;  1SK6 D;  2Q91 A;  1DGV A;  2KI6 D;  1KSM A;  2I7A A;  2LUC A;  1B8C A;  1NUB A;  4GUK A;  1SCV A;  2M97 A;  1N2D A;  2VRG A;  1Y1U A;  2LUX A;  1EH2 A;  1K9U A;  1RJV A;  2K7C A;  2L0P A;  2KQ6 A;  4PE0 A;  2M1K B;  1CB1 A;  1EG3 A;  3FS7 A;  1UHJ A;  2I94 A;  1F71 A;  1H8B A;  2LV7 A;  4IL1 A;  2F8P A;  2LAP A;  1J7Q A;  1HT9 A;  1NSH A;  1K94 A;  4MZK A;  1CM4 A;  2QAC A;  1B1G A;  1IRJ A;  3FWC A;  2JTZ A;  1RFJ A;  1KQM B;  2O5G A;  4ICB A;  1BG1 A;  1SRA A;  2HQ8 A;  1YVL A;  2L4H A;  2LVI A;  1KFX S;  2K2A A;  3OHM B;  1J55 A; 
#chains in the Genus database with same CATH topology
 1YVH A;  3CWG A;  2V53 A;  3KPX A;  5AAN A;  1R2U A;  3KHE A;  1CKK A;  1IJ5 A;  4R1E A;  1A75 B;  1SR6 B;  2MLE C;  3F45 A;  3Q8I A;  1W9Z A;  2P6B B;  1C3Y A;  1QVI Z;  3D0Y B;  1MQ1 A;  2JUL A;  2Y5I A;  1F8H A;  1DF0 A;  2EGD A;  1DEK A;  2QEV A;  3NXA A;  1BLQ A;  3JTD B;  5GQQ C;  1WLZ A;  1IJ6 A;  1NPQ A;  3TZ1 A;  5K89 A;  4UPG A;  1OOH A;  2BCB A;  1DTL A;  1XFV O;  1N65 A;  1REC A;  1S1E A;  2H2K A;  2HF5 A;  3NGV A;  3I5F C;  2LVJ A;  3NSL A;  3PAT A;  1PUL A;  4CID A;  1YX8 A;  4YGD B;  3CS1 A;  2L50 A;  3TDI A;  1BF5 A;  4JKT A;  1AVS A;  1YUR A;  1DC1 A;  1K90 D;  1JFJ A;  3N7H A;  1J7R A;  2LC5 A;  4INW A;  1C3Z A;  1TCF A;  4F0Z B;  1F54 A;  3VRP A;  1C7V A;  2K61 A;  4HRG A;  3SS3 A;  5I2L A;  1OMR A;  4AOM A;  2LVK A;  1AJ5 A;  1TWO A;  3AAJ A;  3BOW A;  3I5H B;  1YTZ C;  1LA0 A;  3HX4 A;  2BL0 C;  2LLU A;  2LVV A;  1TNQ A;  5HKW A;  1FI6 A;  3OGN A;  2PSR A;  2BEC A;  3EVU A;  4C0L A;  5EL2 A;  3LK1 A;  1Y1X A;  1ZOT B;  4C0K A;  3S0E A;  3WNX B;  1C07 A;  3BQ3 A;  3RLZ A;  4PCW A;  1JF0 A;  1DJX A;  1K9K A;  1K95 A;  4MVF A;  2E30 A;  1ZMZ A;  1U5I B;  1KFU L;  3CZ1 A;  1M45 A;  3WHU B;  4MRY A;  4WQ3 A;  3LCP C;  3C1V A;  1M63 B;  3SG7 A;  1GJY A;  1AP4 A;  5CSF A;  4QJ3 B;  1CDN A;  2LHI A;  4PE1 A;  1EL4 A;  1QX2 A;  2G9B A;  3VRQ A;  3BFA A;  1KK7 Z;  1K2H A;  4GAO A;  2Q4U A;  3PN7 B;  4Q04 A;  3D76 A;  3O4Y A;  3O6B A;  2CT9 A;  4N1G A;  2WC5 A;  2CXJ A;  2KFF A;  3NSK A;  5I2O A;  2QDI A;  2MLF C;  1N0Y A;  2L5Y A;  2AUC A;  1L2O C;  1OMD A;  1DVI A;  1TTX A;  2JRF A;  3CZ0 A;  2ZN8 A;  4GGF A;  2KAX A;  4OCI A;  5G08 A;  1NCZ A;  1GGW A;  2GGZ A;  3O2P A;  3I5G C;  2MHH A;  1ZUZ A;  3ZNI A;  1ORG A;  1SL8 A;  2LP3 A;  1VRK A;  3JVT B;  2NCP A;  3PM8 A;  2KFH A;  2K2F A;  4A4B A;  4BY4 A;  2PMY A;  1F70 A;  2OS8 B;  2WCH A;  1IIO A;  4M2O A;  1UHH A;  3V2L A;  1WY9 A;  2CNP A;  2ZNE A;  2JPO A;  3B88 A;  4L9M A;  4JQ0 D;  2CTN A;  1DJH A;  2GGM A;  3NHT A;  1PAL A;  2ZRT A;  5JOL A;  1F55 A;  2P71 A;  1K8U A;  1HQV A;  5CPV A;  2JTT A;  2WND A;  2M9G A;  3PAL A;  3IF7 A;  3OX5 A;  4JWQ A;  3S0G A;  1WRZ A;  2M0R A;  2BKH B;  2BAP A;  5AFP A;  2F2P A;  2F3Y A;  2AAO A;  4M2P A;  4XJK A;  3SIB A;  1KQM C;  1XK4 A;  3DVE A;  2Y4Q A;  3GOF A;  1PK0 D;  2JNF A;  2ZFD A;  4NDD A;  1KWO B;  1TIZ A;  4PE4 A;  2KGR A;  4CPV A;  3FIA A;  2L2E A;  1XYD A;  1OZS A;  1OOJ A;  1SR6 C;  3GK4 X;  2P70 A;  4U8D A;  2CBL A;  4ORC B;  5HYD A;  1QLS A;  4YGE B;  2HET A;  3SG6 A;  1ALW A;  1LXF C;  3JTD C;  1Q80 A;  3O4X A;  2BE4 A;  1YX7 A;  2D8N A;  4MZL A;  2GV5 A;  1S6I A;  2OTG B;  1Z2C B;  1CLB A;  3DD4 A;  4I5N B;  1CTR A;  2FCD A;  1JF2 A;  5ER5 A;  4PHK A;  4E68 A;  2LLT A;  2YGU A;  4MEW A;  4YI9 A;  3NSI A;  5ER4 X;  3HCM A;  1S3P A;  2L5X B;  2LMV A;  3VRR A;  1RK9 A;  2H61 A;  2WOR A;  5DKR A;  4I5K A;  5DKN A;  1SKT A;  1BR1 B;  1CFD A;  1JWD A;  1SL9 A;  1UUS A;  1MR8 A;  2JT0 A;  2L51 A;  4JD9 A;  3I5H C;  2JQ6 A;  3CR4 X;  2FJY A;  5DKQ A;  1EG4 A;  2KHN A;  2LNK A;  4ORA B;  1IH0 A;  1S6J A;  1UWO A;  1DMO A;  4KYN A;  1S5G Z;  3DZT A;  1NP8 A;  3H4S E;  2K7D A;  2ZND A;  1QWV A;  1TNP A;  3PJI A;  4MN0 A;  1OSA A;  3FWB A;  1G33 A;  1CFC A;  2WOS A;  3BUN B;  1QVI Y;  1DJG A;  1QIV A;  2WCE A;  1PSB A;  3B86 A;  3EKJ A;  3OBV A;  1B4C A;  1M46 A;  5TNC A;  2JXL A;  3AAK A;  3BJH A;  2LP2 A;  1DGU A;  1LKJ A;  1TNW A;  1QJT A;  1IWQ A;  1WRL A;  1XFW O;  3D77 A;  3S0D A;  4PHN A;  4I5J A;  1NX0 A;  1WDC B;  3PN7 C;  2BBM A;  5JJG A;  2K7B A;  1IG5 A;  3EVR A;  1P28 A;  4N5X A;  4CFQ A;  1LA3 A;  1FF1 A;  3LLE A;  1V1G A;  2NZ0 A;  1PRW A;  1QV1 A;  4NQG A;  1EXR A;  4FQT A;  4GFT A;  3D74 A;  4HSZ A;  4PE7 A;  1QLK A;  2KQY A;  5IBW A;  3NSO A;  5FI7 A;  3SJS A;  3BUW B;  4DIR A;  2PVB A;  1S6C A;  1MWN A;  1DJI A;  2BCX A;  3I5I B;  2MJW B;  3CTN A;  1DQE A;  3EG5 B;  1MF8 B;  1NX1 A;  4OKH A;  1B47 A;  1B8R A;  1QAS A;  1QTX A;  1TOP A;  3JVT C;  5AXI A;  1MXL C;  2LM5 A;  2OS8 C;  4MBE A;  1J7P A;  1A75 A;  1Z4H A;  3RZS A;  3CAB A;  1IQ3 A;  1B7T Z;  2NLN A;  2WCF A;  1LVC D;  4IJ7 A;  3TUY B;  1V1F A;  3DF0 B;  2MA2 A;  2L2C A;  3LK0 A;  1QIW A;  3D0Y A;  3QME A;  1CFP A;  1TCO B;  1XFY O;  3SG4 A;  1DT7 B;  1JSA A;  2JXC A;  2EC6 B;  2K7O A;  3TS5 B;  1NX2 A;  3FE6 A;  4USL A;  2LLS A;  1YRT B;  2LMU A;  2TN4 A;  5HKY A;  3VRO A;  1KK7 Y;  4YBH B;  1L7Z A;  1IGV A;  1SW8 A;  3A8R A;  3L4A A;  1QV0 A;  4P5O E;  1TUJ A;  2JWW A;  1DJZ A;  3EK8 A;  4NDB A;  1BJF A;  1B9A A;  3GK1 A;  5J3X A;  2SCP A;  3SG3 A;  1E8A A;  3WHT B;  3IQO A;  1B8L A;  3VRN A;  1KSO A;  3UNW A;  1BR4 B;  1GGZ A;  1W7J B;  4M2Q A;  2M29 A;  1NIW A;  4FTG A;  3SS4 A;  2GTE A;  2JU0 A;  1QS7 A;  1J7O A;  1JBA A;  1G4Y R;  2PAS A;  5HKZ A;  1M39 A;  2MAZ A;  2KBI A;  4GNK B;  4D1E A;  5D69 A;  1D1O A;  3R72 A;  5KSZ A;  2PQL A;  3B6X A;  2ZRS A;  1T14 A;  1AJ4 A;  3OX6 A;  4YGB B;  4F7F A;  1ODB A;  2OTG C;  1MHO A;  1KK8 B;  5HLV A;  1CMF A;  4P2Y B;  3BFB A;  1OQP A;  2F2O A;  3AKA A;  1DF0 B;  4PHM A;  1X02 A;  2L4I A;  4INX A;  2ZN9 A;  4PDZ A;  1RWY A;  1W7I B;  3S0A A;  1U5I A;  2KGB C;  1OOF A;  3D73 A;  1CDM A;  2PRU A;  1M31 A;  5BPJ A;  4CLN A;  1BU3 A;  5AER A;  2E6W A;  1BMO A;  1TNX A;  1UHK A;  4HRE E;  1R6P A;  2WCM A;  2MBX A;  1KFX L;  3QRX A;  2PYQ A;  2R2I A;  2M49 B;  2NCO A;  1FBV A;  5B8I B;  1SCM B;  2NXQ A;  3BOW B;  2JZI A;  1A4P A;  3PLF B;  3MSE B;  2WCB A;  3ICB A;  3PSR A;  3K1E A;  1K96 A;  2CCM A;  4NDC A;  1CLM A;  1F4O A;  2L98 A;  1DJW A;  1OE9 B;  1UUR A;  2KOT A;  3SIA A;  3BUM B;  3WXA A;  2KI4 B;  2K0J A;  2QEH A;  4PHJ A;  4JPZ B;  4YI8 A;  2B1U A;  4GPL B;  2BKI B;  3BUO B;  5CSN A;  5HLO A;  2KLD A;  3VGO A;  4YRU A;  1PVA A;  1BT6 A;  3BYA A;  2WCK A;  2WCL A;  3E3R A;  4DCK A;  4WQ2 A;  1S26 D;  2F33 A;  2M7N A;  1G8I A;  1K9P A;  1WDC C;  5CSI A;  4GGF C;  1BOC A;  2ISD A;  2AMI A;  2I2R E;  2FJU B;  2IS9 A;  2COL B;  1XFX O;  1MUX A;  3EKH A;  3PFV A;  1AHR A;  1TRF A;  2KAV A;  3GK2 A;  3IVT A;  4MLW A;  2ZKM X;  4ORB B;  2LCP A;  3AKB A;  2ERB A;  3D10 A;  1A2X A;  2G2B A;  3DVJ A;  5D3O A;  1XFZ O;  3O78 A;  1UHN A;  3I5I C;  1S5G Y;  3KF9 A;  1QAT A;  3A4U B;  4WRI A;  1RTP 1;  1YUT A;  2BCA A;  2Y1N A;  3NHI A;  1CNP A;  4FQO A;  2KFG A;  1XO5 A;  1C7W A;  1SL7 A;  2K60 A;  5FI2 A;  1SSE B;  4A4C A;  3CGA A;  3S0B A;  3SG2 A;  1BOD A;  2BE6 A;  4AQI A;  1EJ3 A;  3TUY C;  5KTY A;  3BUX B;  2I18 A;  1LIN A;  1S36 A;  5I8N A;  1QX7 A;  4AQJ A;  1CDL A;  1J1E A;  1UP5 A;  4YGC B;  2JT3 A;  3R1P A;  2K8M B;  3EVV A;  1JFK A;  2QPT A;  1GQM A;  2EC6 C;  3TS5 C;  1NX3 A;  1XK4 C;  1AK8 A;  3DXL A;  1LS8 A;  2KBM A;  2KSP A;  1YR5 A;  3DVM A;  2LAN A;  2LE9 B;  3B7A A;  2PAL A;  2H8V A;  5CSJ A;  1JC2 A;  1ZFS A;  1PSR A;  1CLL A;  3IQQ A;  3BXK A;  3PM2 A;  1DEL A;  4OV2 A;  1CDP A;  1J1D A;  1SPY A;  2KYC A;  3CLN A;  5D7F A;  1SBJ A;  2KDH A;  3DY9 A;  2FOT A;  4ETO A;  5FYX A;  1GM0 A;  3I5F B;  1IKU A;  1SYM A;  3TDU A;  1A03 A;  3CR2 A;  1XA5 A;  5DIC A;  1KQV A;  5PAL A;  1YUU A;  4XJK B;  1OZO A;  3SS5 A;  1NCX A;  1SY9 A;  2KPH A;  3SG5 A;  1H4B A;  3L47 A;  3DYE A;  4XYN A;  2SAS A;  1A29 A;  3EK7 A;  3EK4 A;  3DVK A;  2H61 C;  1ZAC A;  4DRW A;  4OR9 B;  1QX5 B;  2JOJ A;  3S0F A;  2LMT A;  1OMV A;  1B7T Y;  2Y1M A;  1KK8 C;  1Y0V H;  2KI6 C;  4TNC A;  2KYF A;  5HL1 A;  2HPS A;  2BL0 B;  3VB1 A;  3D78 A;  3K21 A;  3OB1 B;  4ZCV A;  4DUQ A;  1DJY A;  1ALV A;  1KFU S;  1MXE A;  2KNE A;  3ZWH A;  2JC2 A;  1KWO C;  2WC6 A;  1WLM A;  2MRD A;  4YGA A;  1SNL A;  2JPT A;  4HRH A;  3TDZ A;  1CFF A;  4PT1 A;  2JNX A;  2JT8 A;  3R1O A;  1OOG A;  4OZD A;  2DOQ A;  1FW4 A;  4GBA A;  5KU1 A;  4PAL A;  1AUI B;  4I5L B;  3CR5 X;  4ZCU A;  4BY5 A;  5F6T A;  1XFR A;  2F3Z A;  2M3W A;  2QEB A;  3B87 A;  1Y6W A;  2M7L A;  2WC8 A;  3OP0 A;  3FE8 A;  1F4Q A;  2A4J A;  5I2Q A;  4MRX A;  1NYA A;  3CZ2 A;  3UO9 A;  1YRU B;  3R1V A;  3CDN A;  1RRO A;  1SCM C;  3KEV A;  3L4L A;  3D75 A;  1UHI A;  5FI6 A;  2RGI A;  1CMG A;  3KO0 A;  1K93 D;  4OVN F;  1TN4 A;  4N1F A;  1IQ5 A;  1PVB A;  1FPW A;  2M1U A;  1NWD A;  2EHB A;  1SMG A;  2FCE A;  1XVJ A;  3OB2 B;  4QJ5 B;  2KAY A;  2M8U A;  2BBN A;  2KI4 C;  4MSP A;  4MZJ A;  3CZT X;  1XFU O;  4C0J A;  1WRK A;  2LHL A;  4GGN A;  1YUS A;  1L2O B;  2OPO A;  1KCY A;  3M0W A;  2O60 A;  3DF0 A;  5I94 A;  1CM1 A;  3I5G B;  1JUO A;  4DS7 A;  1TUZ A;  1Y1A A;  5AEQ A;  4QJ4 B;  1FI5 A;  3LL8 B;  1QXP A;  4CFR A;  2HQW A;  1NCY A;  3FE9 A;  3RM1 A;  1SK6 D;  2Q91 A;  1DGV A;  2KI6 D;  1KSM A;  2I7A A;  2BNX A;  1B8C A;  1NUB A;  2LUC A;  4GUK A;  1SCV A;  2M97 A;  1N2D A;  2VRG A;  1Y1U A;  2LUX A;  1EH2 A;  2KLE A;  1K9U A;  1RJV A;  2K7C A;  2L0P A;  2KQ6 A;  4PE0 A;  2M1K B;  1CB1 A;  3BFH A;  1EG3 A;  3FS7 A;  1UHJ A;  2I94 A;  1OOI X;  1F71 A;  1H8B A;  2LV7 A;  3CYZ A;  4IL1 A;  2F8P A;  2LAP A;  1J7Q A;  1HT9 A;  1NSH A;  1K94 A;  4MZK A;  1CM4 A;  2QAC A;  1B1G A;  2QEO A;  1IRJ A;  3FWC A;  2JTZ A;  1RFJ A;  2WCJ A;  1KQM B;  2O5G A;  4ICB A;  1BG1 A;  1OW4 A;  1SRA A;  2HQ8 A;  1YVL A;  2L4H A;  2LVI A;  1KFX S;  2K2A A;  3OHM B;  1J55 A; 
#chains in the Genus database with same CATH homology
 1YVH A;  3CWG A;  2V53 A;  3KPX A;  5AAN A;  1R2U A;  3KHE A;  1CKK A;  1IJ5 A;  4R1E A;  1A75 B;  1SR6 B;  2MLE C;  3F45 A;  2P6B B;  1QVI Z;  3D0Y B;  1MQ1 A;  2JUL A;  2Y5I A;  1DF0 A;  2EGD A;  3NXA A;  1BLQ A;  3JTD B;  5GQQ C;  1WLZ A;  1IJ6 A;  1NPQ A;  3TZ1 A;  5K89 A;  4UPG A;  2BCB A;  1DTL A;  1XFV O;  1N65 A;  1REC A;  1S1E A;  2H2K A;  2HF5 A;  3NSL A;  3I5F C;  2LVJ A;  3PAT A;  4CID A;  1PUL A;  1YX8 A;  4YGD B;  3CS1 A;  2L50 A;  3TDI A;  1BF5 A;  1AVS A;  1YUR A;  1K90 D;  1JFJ A;  1J7R A;  2LC5 A;  4F0Z B;  1TCF A;  1F54 A;  3VRP A;  1C7V A;  2K61 A;  4HRG A;  5I2L A;  1OMR A;  4AOM A;  2LVK A;  1AJ5 A;  3AAJ A;  3BOW A;  3I5H B;  1YTZ C;  1LA0 A;  3HX4 A;  2BL0 C;  2LLU A;  2LVV A;  1TNQ A;  5HKW A;  1FI6 A;  2PSR A;  2BEC A;  3EVU A;  4C0L A;  3LK1 A;  1Y1X A;  1ZOT B;  4C0K A;  3WNX B;  1C07 A;  3BQ3 A;  3RLZ A;  4PCW A;  1JF0 A;  1DJX A;  1K9K A;  1K95 A;  4MVF A;  2E30 A;  1ZMZ A;  1U5I B;  1KFU L;  1M45 A;  3WHU B;  4MRY A;  4WQ3 A;  3LCP C;  3C1V A;  1M63 B;  3SG7 A;  1GJY A;  1AP4 A;  5CSF A;  4QJ3 B;  1CDN A;  2LHI A;  4PE1 A;  1EL4 A;  1QX2 A;  2G9B A;  3VRQ A;  1K2H A;  1KK7 Z;  4GAO A;  2Q4U A;  3PN7 B;  4Q04 A;  3O4Y A;  3O6B A;  2CT9 A;  4N1G A;  2CXJ A;  2KFF A;  3NSK A;  5I2O A;  2MLF C;  1N0Y A;  2AUC A;  1L2O C;  1OMD A;  1DVI A;  1TTX A;  2JRF A;  2ZN8 A;  4GGF A;  2KAX A;  4OCI A;  5G08 A;  1NCZ A;  1GGW A;  2GGZ A;  3O2P A;  3I5G C;  2MHH A;  1ZUZ A;  3ZNI A;  1SL8 A;  2LP3 A;  1VRK A;  3JVT B;  2NCP A;  3PM8 A;  2KFH A;  2K2F A;  4A4B A;  4BY4 A;  2PMY A;  1F70 A;  2OS8 B;  4M2O A;  1UHH A;  1WY9 A;  2CNP A;  2ZNE A;  4L9M A;  4JQ0 D;  2CTN A;  1DJH A;  2GGM A;  5JOL A;  1PAL A;  2ZRT A;  1F55 A;  1K8U A;  1HQV A;  5CPV A;  2JTT A;  2WND A;  2M9G A;  3PAL A;  3IF7 A;  3OX5 A;  4JWQ A;  1WRZ A;  2M0R A;  2BKH B;  5AFP A;  2F2P A;  2F3Y A;  2AAO A;  4M2P A;  4XJK A;  3SIB A;  1KQM C;  1XK4 A;  3DVE A;  2Y4Q A;  3GOF A;  1PK0 D;  2JNF A;  2ZFD A;  4NDD A;  1KWO B;  1TIZ A;  4PE4 A;  2KGR A;  4CPV A;  3FIA A;  2L2E A;  1XYD A;  1OZS A;  1OOJ A;  1SR6 C;  3GK4 X;  4U8D A;  2CBL A;  4ORC B;  5HYD A;  1QLS A;  4YGE B;  2HET A;  3SG6 A;  1ALW A;  1LXF C;  3JTD C;  1Q80 A;  2BE4 A;  1YX7 A;  2D8N A;  4MZL A;  2GV5 A;  1S6I A;  2OTG B;  1CLB A;  3DD4 A;  4I5N B;  1CTR A;  2FCD A;  1JF2 A;  5ER5 A;  4PHK A;  4E68 A;  2LLT A;  4MEW A;  4YI9 A;  3NSI A;  5ER4 X;  3HCM A;  1S3P A;  2L5X B;  2LMV A;  3VRR A;  1RK9 A;  2H61 A;  2WOR A;  5DKR A;  4I5K A;  5DKN A;  1SKT A;  1BR1 B;  1CFD A;  1JWD A;  1SL9 A;  1UUS A;  1MR8 A;  2JT0 A;  2L51 A;  3I5H C;  2JQ6 A;  3CR4 X;  5DKQ A;  1EG4 A;  2KHN A;  2LNK A;  4ORA B;  1IH0 A;  1S6J A;  1UWO A;  1DMO A;  1S5G Z;  1NP8 A;  3H4S E;  2K7D A;  2ZND A;  1TNP A;  4MN0 A;  1OSA A;  3FWB A;  1G33 A;  1CFC A;  2WOS A;  3BUN B;  1QVI Y;  1DJG A;  1QIV A;  2WCE A;  1PSB A;  3EKJ A;  1B4C A;  1M46 A;  5TNC A;  2JXL A;  3AAK A;  2LP2 A;  1DGU A;  1LKJ A;  1TNW A;  1QJT A;  1IWQ A;  1WRL A;  1XFW O;  4PHN A;  4I5J A;  1NX0 A;  1WDC B;  3PN7 C;  2BBM A;  5JJG A;  2K7B A;  1IG5 A;  3EVR A;  4N5X A;  4CFQ A;  1LA3 A;  1FF1 A;  3LLE A;  1V1G A;  2NZ0 A;  1PRW A;  1QV1 A;  4NQG A;  1EXR A;  4GFT A;  4PE7 A;  4HSZ A;  1QLK A;  2KQY A;  5IBW A;  3NSO A;  3SJS A;  3BUW B;  4DIR A;  2PVB A;  1S6C A;  1MWN A;  1DJI A;  2BCX A;  3I5I B;  2MJW B;  3CTN A;  1MF8 B;  1NX1 A;  4OKH A;  1B47 A;  1B8R A;  1QAS A;  1QTX A;  1TOP A;  3JVT C;  5AXI A;  1MXL C;  2LM5 A;  2OS8 C;  4MBE A;  1J7P A;  1A75 A;  1IQ3 A;  1B7T Z;  2NLN A;  2WCF A;  1LVC D;  3TUY B;  1V1F A;  3DF0 B;  2MA2 A;  3LK0 A;  1QIW A;  3D0Y A;  1CFP A;  1TCO B;  1XFY O;  3SG4 A;  1DT7 B;  1JSA A;  2JXC A;  2EC6 B;  2K7O A;  3TS5 B;  1NX2 A;  4USL A;  2LLS A;  1YRT B;  2LMU A;  2TN4 A;  5HKY A;  3VRO A;  1KK7 Y;  4YBH B;  1L7Z A;  1IGV A;  1SW8 A;  3A8R A;  4P5O E;  1QV0 A;  4NDB A;  2JWW A;  1DJZ A;  3EK8 A;  1BJF A;  1B9A A;  3GK1 A;  5J3X A;  2SCP A;  3SG3 A;  1E8A A;  3WHT B;  3IQO A;  1B8L A;  3VRN A;  1KSO A;  1BR4 B;  1GGZ A;  1W7J B;  4M2Q A;  2M29 A;  1NIW A;  4FTG A;  2JU0 A;  1QS7 A;  1J7O A;  1JBA A;  1G4Y R;  2PAS A;  5HKZ A;  1M39 A;  2MAZ A;  2KBI A;  4GNK B;  4D1E A;  5D69 A;  1D1O A;  5KSZ A;  2ZRS A;  3OX6 A;  1AJ4 A;  4YGB B;  1ODB A;  2OTG C;  1MHO A;  1KK8 B;  5HLV A;  1CMF A;  4P2Y B;  1OQP A;  2F2O A;  3AKA A;  1DF0 B;  4PHM A;  1X02 A;  2L4I A;  2ZN9 A;  4PDZ A;  1RWY A;  1W7I B;  1U5I A;  2KGB C;  1CDM A;  2PRU A;  1M31 A;  5BPJ A;  4CLN A;  1BU3 A;  5AER A;  2E6W A;  1BMO A;  1TNX A;  1UHK A;  4HRE E;  1R6P A;  2MBX A;  1KFX L;  3QRX A;  2R2I A;  2M49 B;  2NCO A;  1FBV A;  5B8I B;  1SCM B;  2NXQ A;  3BOW B;  2JZI A;  1A4P A;  3PLF B;  3MSE B;  2WCB A;  3ICB A;  3PSR A;  1K96 A;  2CCM A;  4NDC A;  1CLM A;  1F4O A;  2L98 A;  1DJW A;  1OE9 B;  1UUR A;  2KOT A;  3SIA A;  3BUM B;  3WXA A;  2KI4 B;  2K0J A;  4PHJ A;  4JPZ B;  4YI8 A;  2B1U A;  4GPL B;  2BKI B;  3BUO B;  5CSN A;  5HLO A;  3VGO A;  4YRU A;  1PVA A;  1BT6 A;  3BYA A;  3E3R A;  4DCK A;  4WQ2 A;  1S26 D;  2F33 A;  2M7N A;  1G8I A;  1K9P A;  1WDC C;  5CSI A;  4GGF C;  1BOC A;  2ISD A;  2AMI A;  2I2R E;  2FJU B;  2IS9 A;  2COL B;  1XFX O;  1MUX A;  3EKH A;  3PFV A;  1AHR A;  1TRF A;  2KAV A;  3GK2 A;  4MLW A;  4ORB B;  2ZKM X;  2LCP A;  3AKB A;  3D10 A;  1A2X A;  2G2B A;  3DVJ A;  1XFZ O;  3O78 A;  1UHN A;  3I5I C;  1S5G Y;  3KF9 A;  1QAT A;  3A4U B;  4WRI A;  1RTP 1;  1YUT A;  2BCA A;  2Y1N A;  1CNP A;  4FQO A;  2KFG A;  1XO5 A;  1C7W A;  1SL7 A;  4A4C A;  3CGA A;  3SG2 A;  1BOD A;  2BE6 A;  4AQI A;  1EJ3 A;  3TUY C;  5KTY A;  3BUX B;  2I18 A;  1LIN A;  1S36 A;  5I8N A;  1QX7 A;  4AQJ A;  1CDL A;  1J1E A;  1UP5 A;  4YGC B;  2JT3 A;  2K8M B;  3EVV A;  1JFK A;  2QPT A;  1GQM A;  2EC6 C;  3TS5 C;  1NX3 A;  1XK4 C;  1AK8 A;  2KBM A;  2KSP A;  1YR5 A;  3DVM A;  2LAN A;  2LE9 B;  2PAL A;  5CSJ A;  1JC2 A;  1ZFS A;  1PSR A;  1CLL A;  3IQQ A;  3BXK A;  4OV2 A;  1CDP A;  1J1D A;  1SPY A;  2KYC A;  3CLN A;  5D7F A;  1SBJ A;  2KDH A;  2FOT A;  4ETO A;  5FYX A;  3I5F B;  1IKU A;  1SYM A;  3TDU A;  1A03 A;  3CR2 A;  1XA5 A;  1KQV A;  5PAL A;  1YUU A;  4XJK B;  1OZO A;  1NCX A;  1SY9 A;  3SG5 A;  1H4B A;  4XYN A;  2SAS A;  1A29 A;  3EK7 A;  3EK4 A;  3DVK A;  2H61 C;  1ZAC A;  4DRW A;  4OR9 B;  1QX5 B;  2JOJ A;  1F8H A;  2LMT A;  1OMV A;  1B7T Y;  2Y1M A;  1KK8 C;  1Y0V H;  2KI6 C;  4TNC A;  2KYF A;  2HPS A;  2BL0 B;  3K21 A;  3OB1 B;  4ZCV A;  4DUQ A;  1DJY A;  1ALV A;  1KFU S;  1MXE A;  2KNE A;  3ZWH A;  2JC2 A;  1KWO C;  1WLM A;  2MRD A;  4YGA A;  1SNL A;  2JPT A;  4HRH A;  3TDZ A;  1CFF A;  2JNX A;  2JT8 A;  2DOQ A;  1FW4 A;  4GBA A;  5KU1 A;  4PAL A;  1AUI B;  4I5L B;  3CR5 X;  4ZCU A;  4BY5 A;  5F6T A;  2F3Z A;  2M3W A;  1Y6W A;  2M7L A;  2WC8 A;  3OP0 A;  1F4Q A;  2A4J A;  5I2Q A;  4MRX A;  1NYA A;  1YRU B;  1RRO A;  1SCM C;  3KEV A;  1UHI A;  2RGI A;  1CMG A;  3KO0 A;  1K93 D;  4OVN F;  1TN4 A;  4N1F A;  1IQ5 A;  1PVB A;  1FPW A;  2M1U A;  1NWD A;  2EHB A;  1SMG A;  2FCE A;  1XVJ A;  3OB2 B;  4QJ5 B;  2KAY A;  2M8U A;  2BBN A;  2KI4 C;  4MSP A;  4MZJ A;  3CZT X;  1XFU O;  4C0J A;  1WRK A;  2LHL A;  4GGN A;  1YUS A;  1L2O B;  2OPO A;  1KCY A;  3M0W A;  2O60 A;  3DF0 A;  1CM1 A;  3I5G B;  1JUO A;  4DS7 A;  1FI5 A;  1Y1A A;  5AEQ A;  4QJ4 B;  3LL8 B;  1QXP A;  4CFR A;  2HQW A;  1NCY A;  3RM1 A;  1SK6 D;  2Q91 A;  1DGV A;  2KI6 D;  1KSM A;  2I7A A;  2LUC A;  1B8C A;  1NUB A;  4GUK A;  1SCV A;  2M97 A;  1N2D A;  2VRG A;  1Y1U A;  2LUX A;  1EH2 A;  1K9U A;  1RJV A;  2K7C A;  2L0P A;  2KQ6 A;  4PE0 A;  2M1K B;  1CB1 A;  1EG3 A;  3FS7 A;  1UHJ A;  2I94 A;  1F71 A;  1H8B A;  2LV7 A;  4IL1 A;  2F8P A;  2LAP A;  1J7Q A;  1HT9 A;  1NSH A;  1K94 A;  4MZK A;  1CM4 A;  2QAC A;  1B1G A;  1IRJ A;  3FWC A;  2JTZ A;  1RFJ A;  1KQM B;  2O5G A;  4ICB A;  1BG1 A;  1SRA A;  2HQ8 A;  1YVL A;  2L4H A;  2LVI A;  1KFX S;  2K2A A;  3OHM B;  1J55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...