1TNPA

Structures of the apo and calcium troponin-c regulatory domains: the muscle contraction switch
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
90
structure length
90
Chain Sequence
ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords TROPONIN-C (APO)
publication title Structures of the troponin C regulatory domains in the apo and calcium-saturated states.
pubmed doi rcsb
source organism Gallus gallus
total genus 17
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 1995-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1tnpA00
1PALA 1TN4A 2WCBA 3VRQA 3WHTB 2AMIA 1DF0A 1BT6A 3IQOA 2K7DA 3WHUB 4ICBA 2BL0C 1OE9B 4DS7A 1SNLA 3VRPA 1UWOA 3NSLA 1IJ6A 1J55A 3ICBA 2NZ0A 4FQOA 1D1OA 2H61C 1JWDA 1AVSA 1CM1A 1CDPA 1CM4A 1DVIA 1G8IA 1XK4C 3PFVA 1KQMB 2KBMA 2GGZA 4YI9A 3CGAA 1OOJA 1WLZA 4ORBB 2KDHA 4C0KA 1EG3A 1AJ4A 1XVJA 1ZMZA 4TNCA 3TDIA 4YGDB 5I2QA 4DRWA 5G08A 1DGUA 2CXJA 1S6IA 2M1KB 2MLFC 4P5OE 1QTXA 1AHRA 1YUSA 1IKUA 3IQQA 2KAXA 3I5HB 3TDUA 1SCMB 2LMVA 5JOLA 2JNXA 3TS5C 2LLTA 1G33A 2Y1MA 2LHIA 1CFDA 1KFXS 1B9AA 2BE6A 1WY9A 1S3PA 2PSRA 5KTYA 1JSAA 5FYXA 3VROA 3AKBA 1F55A 2CBLA 3HX4A 1S36A 1CFPA 5AERA 1IG5A 1M31A 2HPSA 1MHOA 2RGIA 1DJGA 4JQ0D 4I5KA 2BBNA 1YR5A 2MAZA 1J7QA 2BCAA 2K2FA 2LANA 2BL0B 1QX7A 4A4BA 4P2YB 1BF5A 1CDNA 1QATA 3CZTX 4PE4A 1A29A 5HKWA 1IRJA 3LCPC 3I5FC 2P6BB 5AANA 1S6CA 2LC5A 1K2HA 2L51A 3CR5X 2OPOA 4OKHA 3D0YA 2HQWA 1MXLC 1WDCC 5CSIA 5F6TA 1SPYA 4AOMA 4ORAB 3KEVA 2KI6D 1C7WA 2KGBC 4QJ5B 3CLNA 1TNXA 2I94A 4YGAA 5HKYA 2WCFA 1BR1B 4I5NB 4MBEA 2IS9A 1YRTB 1SL9A 1WRLA 4M2PA 3LL8B 1UHKA 1PULA 3TS5B 2LM5A 1NWDA 4BY4A 2MA2A 3BUXB 2ISDA 4I5JA 4CLNA 1SL7A 2M0RA 4QJ3B 3ZNIA 1K96A 1TCOB 1W7JB 4HRGA 5B8IB 1RTP1 4AQIA 3PM8A 2L4HA 2ZFDA 5DKRA 3DD4A 1J1EA 2NCOA 1EG4A 3EVVA 2SASA 4GBAA 3VRRA 2FCDA 2FOTA 3D10A 3CWGA 1KSOA 1AUIB 1EJ3A 1RECA 1EH2A 1GQMA 1MF8B 5GQQC 1OZSA 3O2PA 3PSRA 3SIBA 1QX2A 3M0WA 1JF0A 1J1DA 1LA3A 1LXFC 4JWQA 1DJWA 2JT8A 1TRFA 1OMVA 2GV5A 3I5FB 4MVFA 1BOCA 5D7FA 1QS7A 3GK4X 3I5GC 5CSFA 1BLQA 4CFQA 4PE1A 1QIWA 1GGWA 1WDCB 2JPTA 5DKNA 3EVRA 1JUOA 2M49B 4YGBB 1TOPA 4GFTA 2LNKA 4AQJA 2M1UA 4D1EA 1Y1UA 3OHMB 4WQ2A 5HLOA 3VGOA 2LUCA 1Y1AA 1QV0A 1WRZA 1AK8A 2JULA 2K0JA 4XJKB 1F4QA 1SL8A 2I2RE 1OMRA 3BUMB 3ZWHA 1KK8C 4C0LA 1N0YA 2BKIB 1JFKA 2JTZA 2F3ZA 1A4PA 1B7TZ 1QJTA 1UHJA 2LUXA 5CPVA 3KF9A 2B1UA 2KFHA 3SG7A 1UURA 3FWBA 1GGZA 1K9UA 1U5IA 2KYCA 2PASA 2M7LA 1N2DA 5PALA 1YX7A 2AUCA 1QVIZ 2PVBA 3GK1A 4M2OA 2LV7A 1BMOA 2Q91A 4GGFC 5CSJA 2BE4A 1DJHA 1CMFA 4U8DA 4WQ3A 1DMOA 2LLSA 3RM1A 1JBAA 1IGVA 1LKJA 1XFXO 2I7AA 2KNEA 1C07A 1A75A 2KAVA 3HCMA 2ZKMX 3BUWB 3C1VA 1RWYA 1UUSA 3I5IC 5HKZA 2TN4A 1TNPA 3BUNB 2I18A 1BR4B 1DF0B 4MSPA 4OR9B 4YGCB 3BXKA 3BOWB 5HYDA 1FF1A 1A2XA 4MZKA 2BCXA 2KOTA 3I5GB 1V1GA 4OVNF 2LVJA 2WNDA 3KO0A 5I2LA 1VRKA 1G4YR 2OTGC 3DF0B 3CR2A 1F70A 1OSAA 3TDZA 4M2QA 2JU0A 2ZNDA 1QIVA 2KAYA 1KQVA 1XK4A 4GPLB 1XO5A 2KFFA 4PCWA 2KFGA 1H8BA 3AKAA 1AP4A 1RFJA 1M39A 1KWOC 1KK7Z 1NSHA 2ZNEA 4FTGA 1HQVA 1N65A 4OV2A 1L2OC 1FPWA 2F8PA 3NSIA 1FW4A 2Y5IA 1B8CA 1KK8B 4ETOA 1OZOA 4QJ4B 2LE9B 1SK6D 3JTDC 2COLB 1XFZO 3H4SE 1K93D 3TZ1A 1JFJA 1NX0A 4BY5A 1PSRA 1K95A 5K89A 1KFUL 2Y1NA 2L4IA 2JXLA 2BKHB 1PSBA 4PDZA 3EVUA 1JC2A 2FCEA 2M3WA 2DOQA 1XFVO 2SCPA 4HREE 2JXCA 2KQYA 2MRDA 1CLLA 1TTXA 1CMGA 1QXPA 4DIRA 1M45A 5DKQA 2MJWB 3TUYC 4E68A 1B7TY 1K9PA 1QASA 1ZACA 2ZRSA 4JPZB 1FBVA 1K8UA 2O60A 3RLZA 2KSPA 4CFRA 1XYDA 1Q80A 4CIDA 4GAOA 2CT9A 1NPQA 3I5IB 3JVTC 4I5LB 4GGNA 2F2PA 1Y0VH 2WC8A 3CTNA 1QVIY 2AAOA 1NCZA 5I2OA 1ZUZA 1SYMA 2K2AA 4HRHA 1Y6WA 2OTGB 1K94A 2LLUA 4MN0A 1LA0A 2WCEA 3VRNA 1CFFA 4YGEB 2F33A 1SCVA 1RK9A 2EHBA 1V1FA 3A8RA 3EK7A 5IBWA 1NUBA 1SBJA 3SG6A 1KSMA 1X02A 3OX6A 1KWOB 1Y1XA 1HT9A 1F54A 1L2OB 3FWCA 1A03A 3BYAA 1SKTA 3DVMA 4CPVA 4GUKA 2BBMA 4MLWA 1B8RA 2G2BA 2JZIA 1CB1A 1K90D 1DJXA 4XJKA 3A4UB 3JTDB 3O6BA 2F3YA 5ER5A 1B1GA 2JQ6A 4PHMA 2M97A 3EKHA 1S5GZ 3OP0A 5BPJA 2L2EA 2ZRTA 1YVLA 3EK4A 3PLFB 2H2KA 1TCFA 3O78A 2JNFA 3IF7A 1KK7Y 4R1EA 2PALA 2A4JA 2M9GA 4NDBA 2JT0A 2K8MB 4OCIA 2CNPA 5HLVA 2O5GA 2MBXA 4N1GA 4IL1A 4N1FA 1YVHA 1SW8A 1UHIA 3TUYB 1BJFA 1S1EA 3DVJA 2BCBA 4Q04A 1YRUB 1YTZC 4MRXA 1NP8A 1OMDA 2ZN8A 3JVTB 1GJYA 3OX5A 2JRFA 2PMYA 1L7ZA 3QRXA 1YURA 2L5XB 3NXAA 1B47A 3SG2A 5D69A 2G9BA 2V53A 1C7VA 3WXAA 1EXRA 1NIWA 3BOWA 1F8HA 4A4CA 3DVKA 2L0PA 3DF0A 1RJVA 1CLBA 2ZN9A 2K7BA 3E3RA 3CR4X 1MQ1A 1UP5A 2GGMA 5AXIA 1CTRA 2VRGA 3LK1A 1RROA 1W7IB 2WORA 1BODA 4MRYA 2F2OA 4PE7A 3OB1B 4DCKA 3K21A 4UPGA 2LP2A 2MHHA 3AAKA 4WRIA 5ER4X 3GOFA 1S26D 3F45A 2E30A 1KFXL 3PALA 2L98A 3PN7C 5JJGA 1NX1A 1H4BA 1QX5B 2H61A 1SR6C 3CS1A 3SG3A 4PHKA 2JT3A 1B8LA 2CCMA 2LVIA 2EC6C 1XFUO 2OS8C 1J7OA 1E8AA 1IH0A 4XYNA 1OQPA 2JTTA 3SG5A 2LP3A 1U5IB 1MR8A 2JC2A 2M8UA 3WNXB 2FJUB 1NX2A 4PHJA 1PK0D 4F0ZB 4GGFA 2KQ6A 5I8NA 1IQ3A 3LLEA 3MSEB 2D8NA 1LVCD 1R2UA 2EGDA 2KI6C 1S5GY 1TIZA 1DTLA 2R2IA 2HETA 4MZLA 1DJZA 2KGRA 2NLNA 1F4OA 3KPXA 1AJ5A 1M63B 1A75B 4DUQA 1JF2A 1ALVA 4L9MA 2LVVA 3SIAA 4MZJA 2BECA 2LHLA 2KI4C 2M7NA 3BUOB 1MXEA 1DGVA 1CLMA 1QLKA 2JWWA 1UHNA 1CDMA 2JOJA 3EK8A 1CDLA 1ZFSA 2NCPA 2K61A 1MWNA 1KCYA 1F71A 1KFUS 4NDCA 3GK2A 5AEQA 1WLMA 2HQ8A 4ORCB 5CSNA 2LMUA 3FIAA 3AAJA 3OB2B 3PN7B 4YI8A 3O4YA 1WRKA 4ZCVA 1XFYO 1DJIA 3FS7A 1NX3A 1SR6B 1NCYA 5TNCA 2K7CA 3PATA 1YUUA 3SJSA 1PRWA 2EC6B 3KHEA 2OS8B 1QLSA 2QACA 2Y4QA 2LAPA 2MLEC 1SRAA 2PRUA 4HSZA 3D0YB 4MEWA 1BG1A 2CTNA 1LINA 1YUTA 1TNWA 1TNQA 2K7OA 1CFCA 1J7RA 1KQMC 1IWQA 5AFPA 1SY9A 2E6WA 1BU3A 1DT7B 2HF5A 2Q4UA 1FI6A 3BQ3A 1XFWO 1ODBA 2KBIA 2KYFA 3EKJA 2M29A 4GNKB 1FI5A 1YX8A 2WOSA 2LVKA 4YRUA 1PVAA 1ALWA 1K9KA 2L50A 2NXQA 4ZCUA 1NCXA 1NYAA 1UHHA 2KHNA 4N5XA 1ZOTB 1J7PA 3NSKA 4PALA 5KSZA 1CNPA 1DJYA 4USLA 3I5HC 1R6PA 2KI4B 2LMTA 1S6JA 1SCMC 1IJ5A 1MUXA 4YBHB 3LK0A 1SMGA 5J3XA 4PE0A 4PHNA 2QPTA 4NDDA 5KU1A 4C0JA 1EL4A 1XA5A 3SG4A 1IQ5A 1B4CA 1PVBA 4NQGA 3NSOA 1M46A 2LCPA 1CKKA 1QV1A 3DVEA
chains in the Genus database with same CATH superfamily
1PALA 1TN4A 2L2CA 2WCBA 3VRQA 3WHTB 1TUJA 2AMIA 1DF0A 1BT6A 1SSEB 3IQOA 2K7DA 2PQLA 3WHUB 4ICBA 2BL0C 1OE9B 4DS7A 1SNLA 3VRPA 1UWOA 3NSLA 2QEHA 1IJ6A 1J55A 1OOGA 3ICBA 4PT1A 2NZ0A 3B88A 4FQOA 1D1OA 2H61C 5D3OA 1AVSA 1CM1A 1CDPA 3L47A 1JWDA 1CM4A 3B87A 1DVIA 1G8IA 3IVTA 1XK4C 3PFVA 1KQMB 3SS5A 2KBMA 2GGZA 4YI9A 3CGAA 1OOJA 1WLZA 4ORBB 2KDHA 3K1EA 4C0KA 1EG3A 1AJ4A 1XVJA 1ZMZA 4TNCA 3TDIA 4YGDB 2WCKA 5I2QA 2PYQA 3SS4A 4DRWA 5G08A 1DGUA 2CXJA 1OOIX 1S6IA 2M1KB 2MLFC 1QTXA 1AHRA 1YUSA 3CZ0A 3IQQA 1IKUA 2KAXA 3I5HB 3S0AA 3TDUA 1SCMB 2LMVA 5JOLA 2JNXA 3TS5C 2LLTA 1G33A 2Y1MA 2LHIA 1CFDA 4P5OE 1KFXS 1B9AA 2BE6A 1WY9A 3S0EA 1S3PA 2QEVA 2PSRA 5KTYA 3DZTA 1TWOA 5FYXA 3VROA 1JSAA 3AKBA 1F55A 2CBLA 3HX4A 1S36A 1CFPA 3CYZA 1IG5A 1M31A 5AERA 1OW4A 2HPSA 1MHOA 2RGIA 1DJGA 2QEOA 3VB1A 4JQ0D 3B7AA 4I5KA 2BBNA 1YR5A 2MAZA 1J7QA 2BCAA 2K2FA 2LANA 2BL0B 3UO9A 1QX7A 4A4BA 4P2YB 1BF5A 1CDNA 1QATA 3CZTX 4PE4A 1A29A 3NGVA 5HKWA 1IRJA 3LCPC 3I5FC 2P6BB 5AANA 1S6CA 2LC5A 1K2HA 2L51A 3CR5X 2OPOA 4OKHA 3D0YA 2HQWA 1MXLC 1WDCC 5CSIA 5F6TA 1SPYA 4AOMA 4ORAB 3KEVA 2KI6D 1C7WA 2KGBC 4QJ5B 3CLNA 1TNXA 2I94A 3R1PA 4YGAA 5HKYA 2WCFA 1BR1B 4I5NB 4MBEA 3DYEA 2IS9A 1YRTB 1SL9A 1WRLA 4M2PA 3LL8B 1UHKA 1PULA 2KPHA 3O4XA 2LM5A 3TS5B 1NWDA 2BAPA 4BY4A 2MA2A 3BUXB 2ISDA 4I5JA 4CLNA 1SL7A 2M0RA 4QJ3B 3ZNIA 1K96A 1TCOB 1W7JB 4HRGA 5B8IB 1RTP1 2H8VA 4AQIA 3PM8A 2L4HA 2ZFDA 3CDNA 5DKRA 3DD4A 1J1EA 2NCOA 3D75A 1EG4A 3EVVA 3B6XA 2SASA 4GBAA 3VRRA 2FCDA 2FOTA 3D10A 3CWGA 1KSOA 1AUIB 1EJ3A 1RECA 1EH2A 1GQMA 1MF8B 5GQQC 1OZSA 3O2PA 2YGUA 3PSRA 3SIBA 1QX2A 3M0WA 1JF0A 1J1DA 1LA3A 1LXFC 4JWQA 1DJWA 3SS3A 2JT8A 1TRFA 1OMVA 2GV5A 3I5FB 3N7HA 4MVFA 1BOCA 5D7FA 1QS7A 3GK4X 3I5GC 1GM0A 2WC6A 5CSFA 1BLQA 4CFQA 4PE1A 1QIWA 1GGWA 1WDCB 2JPTA 5DKNA 3EVRA 1JUOA 2M49B 3RZSA 4YGBB 1TOPA 4GFTA 2LNKA 4AQJA 2M1UA 4D1EA 1Y1UA 3OHMB 2BNXA 1LS8A 1T14A 4WQ2A 5HLOA 3VGOA 2LUCA 1Y1AA 1IIOA 1QV0A 1WRZA 1AK8A 2JULA 2K0JA 4XJKB 1F4QA 1SL8A 2I2RE 1OMRA 3BUMB 3ZWHA 1KK8C 4C0LA 1N0YA 2BKIB 1JFKA 2JTZA 2F3ZA 1A4PA 1B7TZ 1QJTA 1UHJA 2LUXA 5CPVA 3B86A 3KF9A 2B1UA 2KFHA 3SG7A 1UURA 3FWBA 1GGZA 1K9UA 1U5IA 2KYCA 5FI7A 2PASA 2M7LA 3DY9A 1N2DA 5PALA 1YX7A 2AUCA 1QVIZ 2PVBA 3GK1A 4M2OA 2LV7A 1BMOA 2Q91A 4GGFC 5CSJA 2BE4A 1DJHA 1CMFA 4U8DA 4WQ3A 1DMOA 2LLSA 3RM1A 1JBAA 1IGVA 1LKJA 1XFXO 2I7AA 2KNEA 2FJYA 1C07A 1A75A 2KAVA 3R1OA 4JD9A 3HCMA 2ZKMX 1P28A 3S0DA 3BUWB 3C1VA 3R72A 1RWYA 1UUSA 3BFHA 3I5IC 2TN4A 1XFRA 5HKZA 1TNPA 3BUNB 2I18A 3S0BA 1BR4B 1DF0B 4MSPA 4OR9B 4YGCB 3BXKA 5FI2A 3BOWB 5HYDA 1FF1A 1A2XA 4MZKA 2BCXA 2KOTA 3I5GB 1V1GA 4OVNF 2LVJA 2WNDA 3KO0A 5I2LA 1VRKA 5I94A 1C3ZA 1G4YR 2OTGC 3DF0B 3CR2A 4IJ7A 1OSAA 3TDZA 1F70A 4M2QA 3V2LA 2JU0A 2ZNDA 3L4AA 1QIVA 2KAYA 1KQVA 1XK4A 4GPLB 1XO5A 3D74A 2KFFA 4PCWA 2KFGA 1H8BA 3D76A 3AKAA 1AP4A 1RFJA 1W9ZA 3R1VA 1M39A 1KWOC 1KK7Z 1NSHA 2ZNEA 4FTGA 1HQVA 1N65A 4OV2A 1L2OC 1FPWA 2F8PA 3NSIA 1Z4HA 1FW4A 4OZDA 2Y5IA 1B8CA 1KK8B 2GTEA 4ETOA 1OZOA 4QJ4B 2LE9B 1SK6D 3L4LA 3JTDC 2COLB 1XFZO 3H4SE 1K93D 3TZ1A 1DQEA 1NX0A 4BY5A 1PSRA 1K95A 1JFJA 5FI6A 5K89A 1KFUL 2Y1NA 2L4IA 2JXLA 2BKHB 1PSBA 5DICA 4PDZA 3EVUA 1JC2A 2FCEA 2M3WA 2P71A 2DOQA 1XFVO 2SCPA 4HREE 2JXCA 2JPOA 2KQYA 2MRDA 1CLLA 1TTXA 1CMGA 1C3YA 1QXPA 4DIRA 1M45A 5DKQA 2MJWB 3TUYC 4E68A 1B7TY 1K9PA 1QASA 1ZACA 2ZRSA 4JPZB 1FBVA 1K8UA 2O60A 3D78A 3RLZA 2KSPA 4CFRA 1XYDA 1Q80A 4CIDA 3NHIA 2CT9A 1NPQA 3I5IB 3JVTC 4GAOA 1Z2CB 4I5LB 4GGNA 2F2PA 1Y0VH 2WC8A 3CTNA 1QVIY 2AAOA 1NCZA 5I2OA 1ZUZA 1SYMA 3D77A 2K2AA 3CABA 4HRHA 1Y6WA 2OTGB 1K94A 2LLUA 4MN0A 1LA0A 2WCEA 3VRNA 1CFFA 4YGEB 2F33A 1SCVA 1RK9A 2EHBA 1TUZA 1V1FA 3A8RA 3EK7A 3BFBA 5IBWA 1NUBA 1SBJA 3SG6A 3UNWA 1KSMA 1X02A 3OX6A 1KWOB 3D73A 1Y1XA 1HT9A 1OOFA 1F54A 1L2OB 3FWCA 1A03A 2WC5A 3BYAA 1SKTA 4INWA 3DVMA 4CPVA 4GUKA 2BBMA 4MLWA 1B8RA 3DXLA 2G2BA 4INXA 1DC1A 2JZIA 1CB1A 1K90D 1DJXA 4XJKA 3A4UB 3JTDB 3O6BA 2F3YA 5ER5A 1B1GA 2JQ6A 4PHMA 2M97A 3EKHA 1S5GZ 3OP0A 4F7FA 5BPJA 3EG5B 2L2EA 2ZRTA 1YVLA 3EK4A 2WCHA 3PLFB 2H2KA 1TCFA 3O78A 2JNFA 3IF7A 1KK7Y 4R1EA 2PALA 2L5YA 2A4JA 2M9GA 4NDBA 2JT0A 2K8MB 4OCIA 2CNPA 5HLVA 2O5GA 2MBXA 4N1GA 4IL1A 4N1FA 1YVHA 1SW8A 1UHIA 3TUYB 1BJFA 1S1EA 3DVJA 2BCBA 4Q04A 1YRUB 1YTZC 4MRXA 1NP8A 1OMDA 2ZN8A 3JVTB 1GJYA 3OX5A 2JRFA 1DELA 2PMYA 1L7ZA 1QWVA 3QRXA 1YURA 2L5XB 3NXAA 5EL2A 1B47A 3SG2A 5D69A 2G9BA 2KLDA 2V53A 1C7VA 3WXAA 1EXRA 1NIWA 3BOWA 1F8HA 4A4CA 3DVKA 2L0PA 4KYNA 3OGNA 3DF0A 1RJVA 2KLEA 1CLBA 2ZN9A 2K7BA 3E3RA 3CR4X 1MQ1A 1UP5A 2GGMA 3OBVA 5AXIA 1CTRA 2VRGA 3LK1A 1RROA 1W7IB 2ERBA 2WORA 1BODA 4MRYA 2F2OA 4PE7A 3OB1B 4DCKA 3K21A 4UPGA 2LP2A 2MHHA 3AAKA 4WRIA 5ER4X 3GOFA 1S26D 3F45A 2E30A 1KFXL 3PALA 2L98A 3PN7C 5JJGA 1NX1A 1H4BA 1QX5B 3CZ2A 3S0GA 2H61A 1SR6C 3CS1A 3PJIA 3SG3A 4PHKA 2JT3A 1B8LA 2CCMA 2LVIA 2EC6C 1XFUO 2OS8C 1J7OA 1E8AA 1IH0A 4XYNA 1OQPA 2JTTA 3SG5A 3S0FA 2LP3A 1U5IB 1MR8A 2JC2A 2M8UA 3QMEA 2FJUB 1NX2A 4PHJA 3WNXB 2P70A 1PK0D 4F0ZB 4GGFA 2KQ6A 5I8NA 2QDIA 1IQ3A 3LLEA 3FE9A 3MSEB 2D8NA 1LVCD 1R2UA 2EGDA 2KI6C 1S5GY 1TIZA 1DTLA 2R2IA 2HETA 4MZLA 1DJZA 2KGRA 2NLNA 1F4OA 2WCJA 3KPXA 1AJ5A 1M63B 1A75B 4DUQA 1JF2A 1ALVA 4L9MA 2LVVA 3SIAA 4MZJA 2BECA 2LHLA 3FE6A 2KI4C 2M7NA 3BUOB 1MXEA 1DGVA 1CLMA 1QLKA 2JWWA 1UHNA 4FQTA 1CDMA 1ORGA 2JOJA 3EK8A 1CDLA 1ZFSA 2NCPA 2K61A 1MWNA 1OOHA 1DEKA 1KCYA 1F71A 1KFUS 4NDCA 3GK2A 5AEQA 1WLMA 2HQ8A 4ORCB 5CSNA 2LMUA 3FIAA 3AAJA 3OB2B 3PN7B 4YI8A 3O4YA 1WRKA 4ZCVA 1XFYO 3Q8IA 1DJIA 3FS7A 1NX3A 1SR6B 1NCYA 5TNCA 2K7CA 3PATA 1YUUA 3SJSA 1PRWA 2EC6B 3KHEA 2WCMA 3BJHA 2OS8B 1QLSA 2QACA 2Y4QA 2LAPA 3CZ1A 2MLEC 1SRAA 2PRUA 4HSZA 3D0YB 4MEWA 1BG1A 2CTNA 2QEBA 1LINA 1YUTA 1TNWA 1TNQA 2K7OA 2K60A 1CFCA 1J7RA 1KQMC 1IWQA 5AFPA 1SY9A 2E6WA 1BU3A 1DT7B 2HF5A 2Q4UA 1FI6A 3BQ3A 1XFWO 1ODBA 2KBIA 2KYFA 3NHTA 3EKJA 2M29A 4GNKB 4JKTA 1FI5A 1YX8A 3FE8A 5HL1A 2WOSA 2LVKA 4YRUA 1PVAA 1ALWA 1K9KA 2L50A 2NXQA 4ZCUA 1NCXA 1NYAA 1UHHA 2KHNA 4N5XA 1ZOTB 1J7PA 3NSKA 4PALA 5KSZA 1CNPA 1DJYA 4USLA 3I5HC 1R6PA 2KI4B 2LMTA 1S6JA 3BFAA 1SCMC 1IJ5A 1MUXA 4YBHB 3LK0A 1SMGA 5J3XA 4PE0A 4PHNA 2QPTA 2WCLA 4NDDA 5KU1A 4C0JA 3PM2A 1EL4A 1XA5A 3SG4A 1IQ5A 1B4CA 1PVBA 4NQGA 3NSOA 1M46A 2LCPA 1CKKA 1QV1A 3DVEA
chains in the Genus database with same CATH topology
1PALA 1TN4A 2WCBA 3VRQA 3WHTB 2AMIA 1DF0A 1BT6A 3IQOA 2K7DA 3WHUB 4ICBA 2BL0C 1OE9B 4DS7A 1SNLA 3VRPA 1UWOA 3NSLA 1IJ6A 1J55A 3ICBA 2NZ0A 4FQOA 1D1OA 2H61C 1JWDA 1AVSA 1CM1A 1CDPA 1CM4A 1DVIA 1G8IA 1XK4C 3PFVA 1KQMB 2KBMA 2GGZA 4YI9A 3CGAA 1OOJA 1WLZA 4ORBB 2KDHA 4C0KA 1EG3A 1AJ4A 1XVJA 1ZMZA 4TNCA 3TDIA 4YGDB 5I2QA 4DRWA 5G08A 1DGUA 2CXJA 1S6IA 2M1KB 2MLFC 4P5OE 1QTXA 1AHRA 1YUSA 1IKUA 3IQQA 2KAXA 3I5HB 3TDUA 1SCMB 2LMVA 5JOLA 2JNXA 3TS5C 2LLTA 1G33A 2Y1MA 2LHIA 1CFDA 1KFXS 1B9AA 2BE6A 1WY9A 1S3PA 2PSRA 5KTYA 1JSAA 5FYXA 3VROA 3AKBA 1F55A 2CBLA 3HX4A 1S36A 1CFPA 5AERA 1IG5A 1M31A 2HPSA 1MHOA 2RGIA 1DJGA 4JQ0D 4I5KA 2BBNA 1YR5A 2MAZA 1J7QA 2BCAA 2K2FA 2LANA 2BL0B 1QX7A 4A4BA 4P2YB 1BF5A 1CDNA 1QATA 3CZTX 4PE4A 1A29A 5HKWA 1IRJA 3LCPC 3I5FC 2P6BB 5AANA 1S6CA 2LC5A 1K2HA 2L51A 3CR5X 2OPOA 4OKHA 3D0YA 2HQWA 1MXLC 1WDCC 5CSIA 5F6TA 1SPYA 4AOMA 4ORAB 3KEVA 2KI6D 1C7WA 2KGBC 4QJ5B 3CLNA 1TNXA 2I94A 4YGAA 5HKYA 2WCFA 1BR1B 4I5NB 4MBEA 2IS9A 1YRTB 1SL9A 1WRLA 4M2PA 3LL8B 1UHKA 1PULA 3TS5B 2LM5A 1NWDA 4BY4A 2MA2A 3BUXB 2ISDA 4I5JA 4CLNA 1SL7A 2M0RA 4QJ3B 3ZNIA 1K96A 1TCOB 1W7JB 4HRGA 5B8IB 1RTP1 4AQIA 3PM8A 2L4HA 2ZFDA 5DKRA 3DD4A 1J1EA 2NCOA 1EG4A 3EVVA 2SASA 4GBAA 3VRRA 2FCDA 2FOTA 3D10A 3CWGA 1KSOA 1AUIB 1EJ3A 1RECA 1EH2A 1GQMA 1MF8B 5GQQC 1OZSA 3O2PA 3PSRA 3SIBA 1QX2A 3M0WA 1JF0A 1J1DA 1LA3A 1LXFC 4JWQA 1DJWA 2JT8A 1TRFA 1OMVA 2GV5A 3I5FB 4MVFA 1BOCA 5D7FA 1QS7A 3GK4X 3I5GC 5CSFA 1BLQA 4CFQA 4PE1A 1QIWA 1GGWA 1WDCB 2JPTA 5DKNA 3EVRA 1JUOA 2M49B 4YGBB 1TOPA 4GFTA 2LNKA 4AQJA 2M1UA 4D1EA 1Y1UA 3OHMB 4WQ2A 5HLOA 3VGOA 2LUCA 1Y1AA 1QV0A 1WRZA 1AK8A 2JULA 2K0JA 4XJKB 1F4QA 1SL8A 2I2RE 1OMRA 3BUMB 3ZWHA 1KK8C 4C0LA 1N0YA 2BKIB 1JFKA 2JTZA 2F3ZA 1A4PA 1B7TZ 1QJTA 1UHJA 2LUXA 5CPVA 3KF9A 2B1UA 2KFHA 3SG7A 1UURA 3FWBA 1GGZA 1K9UA 1U5IA 2KYCA 2PASA 2M7LA 1N2DA 5PALA 1YX7A 2AUCA 1QVIZ 2PVBA 3GK1A 4M2OA 2LV7A 1BMOA 2Q91A 4GGFC 5CSJA 2BE4A 1DJHA 1CMFA 4U8DA 4WQ3A 1DMOA 2LLSA 3RM1A 1JBAA 1IGVA 1LKJA 1XFXO 2I7AA 2KNEA 1C07A 1A75A 2KAVA 3HCMA 2ZKMX 3BUWB 3C1VA 1RWYA 1UUSA 3I5IC 5HKZA 2TN4A 1TNPA 3BUNB 2I18A 1BR4B 1DF0B 4MSPA 4OR9B 4YGCB 3BXKA 3BOWB 5HYDA 1FF1A 1A2XA 4MZKA 2BCXA 2KOTA 3I5GB 1V1GA 4OVNF 2LVJA 2WNDA 3KO0A 5I2LA 1VRKA 1G4YR 2OTGC 3DF0B 3CR2A 1F70A 1OSAA 3TDZA 4M2QA 2JU0A 2ZNDA 1QIVA 2KAYA 1KQVA 1XK4A 4GPLB 1XO5A 2KFFA 4PCWA 2KFGA 1H8BA 3AKAA 1AP4A 1RFJA 1M39A 1KWOC 1KK7Z 1NSHA 2ZNEA 4FTGA 1HQVA 1N65A 4OV2A 1L2OC 1FPWA 2F8PA 3NSIA 1FW4A 2Y5IA 1B8CA 1KK8B 4ETOA 1OZOA 4QJ4B 2LE9B 1SK6D 3JTDC 2COLB 1XFZO 3H4SE 1K93D 3TZ1A 1JFJA 1NX0A 4BY5A 1PSRA 1K95A 5K89A 1KFUL 2Y1NA 2L4IA 2JXLA 2BKHB 1PSBA 4PDZA 3EVUA 1JC2A 2FCEA 2M3WA 2DOQA 1XFVO 2SCPA 4HREE 2JXCA 2KQYA 2MRDA 1CLLA 1TTXA 1CMGA 1QXPA 4DIRA 1M45A 5DKQA 2MJWB 3TUYC 4E68A 1B7TY 1K9PA 1QASA 1ZACA 2ZRSA 4JPZB 1FBVA 1K8UA 2O60A 3RLZA 2KSPA 4CFRA 1XYDA 1Q80A 4CIDA 4GAOA 2CT9A 1NPQA 3I5IB 3JVTC 4I5LB 4GGNA 2F2PA 1Y0VH 2WC8A 3CTNA 1QVIY 2AAOA 1NCZA 5I2OA 1ZUZA 1SYMA 2K2AA 4HRHA 1Y6WA 2OTGB 1K94A 2LLUA 4MN0A 1LA0A 2WCEA 3VRNA 1CFFA 4YGEB 2F33A 1SCVA 1RK9A 2EHBA 1V1FA 3A8RA 3EK7A 5IBWA 1NUBA 1SBJA 3SG6A 1KSMA 1X02A 3OX6A 1KWOB 1Y1XA 1HT9A 1F54A 1L2OB 3FWCA 1A03A 3BYAA 1SKTA 3DVMA 4CPVA 4GUKA 2BBMA 4MLWA 1B8RA 2G2BA 2JZIA 1CB1A 1K90D 1DJXA 4XJKA 3A4UB 3JTDB 3O6BA 2F3YA 5ER5A 1B1GA 2JQ6A 4PHMA 2M97A 3EKHA 1S5GZ 3OP0A 5BPJA 2L2EA 2ZRTA 1YVLA 3EK4A 3PLFB 2H2KA 1TCFA 3O78A 2JNFA 3IF7A 1KK7Y 4R1EA 2PALA 2A4JA 2M9GA 4NDBA 2JT0A 2K8MB 4OCIA 2CNPA 5HLVA 2O5GA 2MBXA 4N1GA 4IL1A 4N1FA 1YVHA 1SW8A 1UHIA 3TUYB 1BJFA 1S1EA 3DVJA 2BCBA 4Q04A 1YRUB 1YTZC 4MRXA 1NP8A 1OMDA 2ZN8A 3JVTB 1GJYA 3OX5A 2JRFA 2PMYA 1L7ZA 3QRXA 1YURA 2L5XB 3NXAA 1B47A 3SG2A 5D69A 2G9BA 2V53A 1C7VA 3WXAA 1EXRA 1NIWA 3BOWA 1F8HA 4A4CA 3DVKA 2L0PA 3DF0A 1RJVA 1CLBA 2ZN9A 2K7BA 3E3RA 3CR4X 1MQ1A 1UP5A 2GGMA 5AXIA 1CTRA 2VRGA 3LK1A 1RROA 1W7IB 2WORA 1BODA 4MRYA 2F2OA 4PE7A 3OB1B 4DCKA 3K21A 4UPGA 2LP2A 2MHHA 3AAKA 4WRIA 5ER4X 3GOFA 1S26D 3F45A 2E30A 1KFXL 3PALA 2L98A 3PN7C 5JJGA 1NX1A 1H4BA 1QX5B 2H61A 1SR6C 3CS1A 3SG3A 4PHKA 2JT3A 1B8LA 2CCMA 2LVIA 2EC6C 1XFUO 2OS8C 1J7OA 1E8AA 1IH0A 4XYNA 1OQPA 2JTTA 3SG5A 2LP3A 1U5IB 1MR8A 2JC2A 2M8UA 3WNXB 2FJUB 1NX2A 4PHJA 1PK0D 4F0ZB 4GGFA 2KQ6A 5I8NA 1IQ3A 3LLEA 3MSEB 2D8NA 1LVCD 1R2UA 2EGDA 2KI6C 1S5GY 1TIZA 1DTLA 2R2IA 2HETA 4MZLA 1DJZA 2KGRA 2NLNA 1F4OA 3KPXA 1AJ5A 1M63B 1A75B 4DUQA 1JF2A 1ALVA 4L9MA 2LVVA 3SIAA 4MZJA 2BECA 2LHLA 2KI4C 2M7NA 3BUOB 1MXEA 1DGVA 1CLMA 1QLKA 2JWWA 1UHNA 1CDMA 2JOJA 3EK8A 1CDLA 1ZFSA 2NCPA 2K61A 1MWNA 1KCYA 1F71A 1KFUS 4NDCA 3GK2A 5AEQA 1WLMA 2HQ8A 4ORCB 5CSNA 2LMUA 3FIAA 3AAJA 3OB2B 3PN7B 4YI8A 3O4YA 1WRKA 4ZCVA 1XFYO 1DJIA 3FS7A 1NX3A 1SR6B 1NCYA 5TNCA 2K7CA 3PATA 1YUUA 3SJSA 1PRWA 2EC6B 3KHEA 2OS8B 1QLSA 2QACA 2Y4QA 2LAPA 2MLEC 1SRAA 2PRUA 4HSZA 3D0YB 4MEWA 1BG1A 2CTNA 1LINA 1YUTA 1TNWA 1TNQA 2K7OA 1CFCA 1J7RA 1KQMC 1IWQA 5AFPA 1SY9A 2E6WA 1BU3A 1DT7B 2HF5A 2Q4UA 1FI6A 3BQ3A 1XFWO 1ODBA 2KBIA 2KYFA 3EKJA 2M29A 4GNKB 1FI5A 1YX8A 2WOSA 2LVKA 4YRUA 1PVAA 1ALWA 1K9KA 2L50A 2NXQA 4ZCUA 1NCXA 1NYAA 1UHHA 2KHNA 4N5XA 1ZOTB 1J7PA 3NSKA 4PALA 5KSZA 1CNPA 1DJYA 4USLA 3I5HC 1R6PA 2KI4B 2LMTA 1S6JA 1SCMC 1IJ5A 1MUXA 4YBHB 3LK0A 1SMGA 5J3XA 4PE0A 4PHNA 2QPTA 4NDDA 5KU1A 4C0JA 1EL4A 1XA5A 3SG4A 1IQ5A 1B4CA 1PVBA 4NQGA 3NSOA 1M46A 2LCPA 1CKKA 1QV1A 3DVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PAL A;  1TN4 A;  2WCB A;  3VRQ A;  3WHT B;  2AMI A;  1DF0 A;  1BT6 A;  3IQO A;  2K7D A;  3WHU B;  4ICB A;  2BL0 C;  1OE9 B;  4DS7 A;  1SNL A;  3VRP A;  1UWO A;  3NSL A;  1IJ6 A;  1J55 A;  3ICB A;  2NZ0 A;  4FQO A;  1D1O A;  2H61 C;  1JWD A;  1AVS A;  1CM1 A;  1CDP A;  1CM4 A;  1DVI A;  1G8I A;  1XK4 C;  3PFV A;  1KQM B;  2KBM A;  2GGZ A;  4YI9 A;  3CGA A;  1OOJ A;  1WLZ A;  4ORB B;  2KDH A;  4C0K A;  1EG3 A;  1AJ4 A;  1XVJ A;  1ZMZ A;  4TNC A;  3TDI A;  4YGD B;  5I2Q A;  4DRW A;  5G08 A;  1DGU A;  2CXJ A;  1S6I A;  2M1K B;  2MLF C;  4P5O E;  1QTX A;  1AHR A;  1YUS A;  1IKU A;  3IQQ A;  2KAX A;  3I5H B;  3TDU A;  1SCM B;  2LMV A;  5JOL A;  2JNX A;  3TS5 C;  2LLT A;  1G33 A;  2Y1M A;  2LHI A;  1CFD A;  1KFX S;  1B9A A;  2BE6 A;  1WY9 A;  1S3P A;  2PSR A;  5KTY A;  1JSA A;  5FYX A;  3VRO A;  3AKB A;  1F55 A;  2CBL A;  3HX4 A;  1S36 A;  1CFP A;  5AER A;  1IG5 A;  1M31 A;  2HPS A;  1MHO A;  2RGI A;  1DJG A;  4JQ0 D;  4I5K A;  2BBN A;  1YR5 A;  2MAZ A;  1J7Q A;  2BCA A;  2K2F A;  2LAN A;  2BL0 B;  1QX7 A;  4A4B A;  4P2Y B;  1BF5 A;  1CDN A;  1QAT A;  3CZT X;  4PE4 A;  1A29 A;  5HKW A;  1IRJ A;  3LCP C;  3I5F C;  2P6B B;  5AAN A;  1S6C A;  2LC5 A;  1K2H A;  2L51 A;  3CR5 X;  2OPO A;  4OKH A;  3D0Y A;  2HQW A;  1MXL C;  1WDC C;  5CSI A;  5F6T A;  1SPY A;  4AOM A;  4ORA B;  3KEV A;  2KI6 D;  1C7W A;  2KGB C;  4QJ5 B;  3CLN A;  1TNX A;  2I94 A;  4YGA A;  5HKY A;  2WCF A;  1BR1 B;  4I5N B;  4MBE A;  2IS9 A;  1YRT B;  1SL9 A;  1WRL A;  4M2P A;  3LL8 B;  1UHK A;  1PUL A;  3TS5 B;  2LM5 A;  1NWD A;  4BY4 A;  2MA2 A;  3BUX B;  2ISD A;  4I5J A;  4CLN A;  1SL7 A;  2M0R A;  4QJ3 B;  3ZNI A;  1K96 A;  1TCO B;  1W7J B;  4HRG A;  5B8I B;  1RTP 1;  4AQI A;  3PM8 A;  2L4H A;  2ZFD A;  5DKR A;  3DD4 A;  1J1E A;  2NCO A;  1EG4 A;  3EVV A;  2SAS A;  4GBA A;  3VRR A;  2FCD A;  2FOT A;  3D10 A;  3CWG A;  1KSO A;  1AUI B;  1EJ3 A;  1REC A;  1EH2 A;  1GQM A;  1MF8 B;  5GQQ C;  1OZS A;  3O2P A;  3PSR A;  3SIB A;  1QX2 A;  3M0W A;  1JF0 A;  1J1D A;  1LA3 A;  1LXF C;  4JWQ A;  1DJW A;  2JT8 A;  1TRF A;  1OMV A;  2GV5 A;  3I5F B;  4MVF A;  1BOC A;  5D7F A;  1QS7 A;  3GK4 X;  3I5G C;  5CSF A;  1BLQ A;  4CFQ A;  4PE1 A;  1QIW A;  1GGW A;  1WDC B;  2JPT A;  5DKN A;  3EVR A;  1JUO A;  2M49 B;  4YGB B;  1TOP A;  4GFT A;  2LNK A;  4AQJ A;  2M1U A;  4D1E A;  1Y1U A;  3OHM B;  4WQ2 A;  5HLO A;  3VGO A;  2LUC A;  1Y1A A;  1QV0 A;  1WRZ A;  1AK8 A;  2JUL A;  2K0J A;  4XJK B;  1F4Q A;  1SL8 A;  2I2R E;  1OMR A;  3BUM B;  3ZWH A;  1KK8 C;  4C0L A;  1N0Y A;  2BKI B;  1JFK A;  2JTZ A;  2F3Z A;  1A4P A;  1B7T Z;  1QJT A;  1UHJ A;  2LUX A;  5CPV A;  3KF9 A;  2B1U A;  2KFH A;  3SG7 A;  1UUR A;  3FWB A;  1GGZ A;  1K9U A;  1U5I A;  2KYC A;  2PAS A;  2M7L A;  1N2D A;  5PAL A;  1YX7 A;  2AUC A;  1QVI Z;  2PVB A;  3GK1 A;  4M2O A;  2LV7 A;  1BMO A;  2Q91 A;  4GGF C;  5CSJ A;  2BE4 A;  1DJH A;  1CMF A;  4U8D A;  4WQ3 A;  1DMO A;  2LLS A;  3RM1 A;  1JBA A;  1IGV A;  1LKJ A;  1XFX O;  2I7A A;  2KNE A;  1C07 A;  1A75 A;  2KAV A;  3HCM A;  2ZKM X;  3BUW B;  3C1V A;  1RWY A;  1UUS A;  3I5I C;  5HKZ A;  2TN4 A;  1TNP A;  3BUN B;  2I18 A;  1BR4 B;  1DF0 B;  4MSP A;  4OR9 B;  4YGC B;  3BXK A;  3BOW B;  5HYD A;  1FF1 A;  1A2X A;  4MZK A;  2BCX A;  2KOT A;  3I5G B;  1V1G A;  4OVN F;  2LVJ A;  2WND A;  3KO0 A;  5I2L A;  1VRK A;  1G4Y R;  2OTG C;  3DF0 B;  3CR2 A;  1F70 A;  1OSA A;  3TDZ A;  4M2Q A;  2JU0 A;  2ZND A;  1QIV A;  2KAY A;  1KQV A;  1XK4 A;  4GPL B;  1XO5 A;  2KFF A;  4PCW A;  2KFG A;  1H8B A;  3AKA A;  1AP4 A;  1RFJ A;  1M39 A;  1KWO C;  1KK7 Z;  1NSH A;  2ZNE A;  4FTG A;  1HQV A;  1N65 A;  4OV2 A;  1L2O C;  1FPW A;  2F8P A;  3NSI A;  1FW4 A;  2Y5I A;  1B8C A;  1KK8 B;  4ETO A;  1OZO A;  4QJ4 B;  2LE9 B;  1SK6 D;  3JTD C;  2COL B;  1XFZ O;  3H4S E;  1K93 D;  3TZ1 A;  1JFJ A;  1NX0 A;  4BY5 A;  1PSR A;  1K95 A;  5K89 A;  1KFU L;  2Y1N A;  2L4I A;  2JXL A;  2BKH B;  1PSB A;  4PDZ A;  3EVU A;  1JC2 A;  2FCE A;  2M3W A;  2DOQ A;  1XFV O;  2SCP A;  4HRE E;  2JXC A;  2KQY A;  2MRD A;  1CLL A;  1TTX A;  1CMG A;  1QXP A;  4DIR A;  1M45 A;  5DKQ A;  2MJW B;  3TUY C;  4E68 A;  1B7T Y;  1K9P A;  1QAS A;  1ZAC A;  2ZRS A;  4JPZ B;  1FBV A;  1K8U A;  2O60 A;  3RLZ A;  2KSP A;  4CFR A;  1XYD A;  1Q80 A;  4CID A;  4GAO A;  2CT9 A;  1NPQ A;  3I5I B;  3JVT C;  4I5L B;  4GGN A;  2F2P A;  1Y0V H;  2WC8 A;  3CTN A;  1QVI Y;  2AAO A;  1NCZ A;  5I2O A;  1ZUZ A;  1SYM A;  2K2A A;  4HRH A;  1Y6W A;  2OTG B;  1K94 A;  2LLU A;  4MN0 A;  1LA0 A;  2WCE A;  3VRN A;  1CFF A;  4YGE B;  2F33 A;  1SCV A;  1RK9 A;  2EHB A;  1V1F A;  3A8R A;  3EK7 A;  5IBW A;  1NUB A;  1SBJ A;  3SG6 A;  1KSM A;  1X02 A;  3OX6 A;  1KWO B;  1Y1X A;  1HT9 A;  1F54 A;  1L2O B;  3FWC A;  1A03 A;  3BYA A;  1SKT A;  3DVM A;  4CPV A;  4GUK A;  2BBM A;  4MLW A;  1B8R A;  2G2B A;  2JZI A;  1CB1 A;  1K90 D;  1DJX A;  4XJK A;  3A4U B;  3JTD B;  3O6B A;  2F3Y A;  5ER5 A;  1B1G A;  2JQ6 A;  4PHM A;  2M97 A;  3EKH A;  1S5G Z;  3OP0 A;  5BPJ A;  2L2E A;  2ZRT A;  1YVL A;  3EK4 A;  3PLF B;  2H2K A;  1TCF A;  3O78 A;  2JNF A;  3IF7 A;  1KK7 Y;  4R1E A;  2PAL A;  2A4J A;  2M9G A;  4NDB A;  2JT0 A;  2K8M B;  4OCI A;  2CNP A;  5HLV A;  2O5G A;  2MBX A;  4N1G A;  4IL1 A;  4N1F A;  1YVH A;  1SW8 A;  1UHI A;  3TUY B;  1BJF A;  1S1E A;  3DVJ A;  2BCB A;  4Q04 A;  1YRU B;  1YTZ C;  4MRX A;  1NP8 A;  1OMD A;  2ZN8 A;  3JVT B;  1GJY A;  3OX5 A;  2JRF A;  2PMY A;  1L7Z A;  3QRX A;  1YUR A;  2L5X B;  3NXA A;  1B47 A;  3SG2 A;  5D69 A;  2G9B A;  2V53 A;  1C7V A;  3WXA A;  1EXR A;  1NIW A;  3BOW A;  1F8H A;  4A4C A;  3DVK A;  2L0P A;  3DF0 A;  1RJV A;  1CLB A;  2ZN9 A;  2K7B A;  3E3R A;  3CR4 X;  1MQ1 A;  1UP5 A;  2GGM A;  5AXI A;  1CTR A;  2VRG A;  3LK1 A;  1RRO A;  1W7I B;  2WOR A;  1BOD A;  4MRY A;  2F2O A;  4PE7 A;  3OB1 B;  4DCK A;  3K21 A;  4UPG A;  2LP2 A;  2MHH A;  3AAK A;  4WRI A;  5ER4 X;  3GOF A;  1S26 D;  3F45 A;  2E30 A;  1KFX L;  3PAL A;  2L98 A;  3PN7 C;  5JJG A;  1NX1 A;  1H4B A;  1QX5 B;  2H61 A;  1SR6 C;  3CS1 A;  3SG3 A;  4PHK A;  2JT3 A;  1B8L A;  2CCM A;  2LVI A;  2EC6 C;  1XFU O;  2OS8 C;  1J7O A;  1E8A A;  1IH0 A;  4XYN A;  1OQP A;  2JTT A;  3SG5 A;  2LP3 A;  1U5I B;  1MR8 A;  2JC2 A;  2M8U A;  3WNX B;  2FJU B;  1NX2 A;  4PHJ A;  1PK0 D;  4F0Z B;  4GGF A;  2KQ6 A;  5I8N A;  1IQ3 A;  3LLE A;  3MSE B;  2D8N A;  1LVC D;  1R2U A;  2EGD A;  2KI6 C;  1S5G Y;  1TIZ A;  1DTL A;  2R2I A;  2HET A;  4MZL A;  1DJZ A;  2KGR A;  2NLN A;  1F4O A;  3KPX A;  1AJ5 A;  1M63 B;  1A75 B;  4DUQ A;  1JF2 A;  1ALV A;  4L9M A;  2LVV A;  3SIA A;  4MZJ A;  2BEC A;  2LHL A;  2KI4 C;  2M7N A;  3BUO B;  1MXE A;  1DGV A;  1CLM A;  1QLK A;  2JWW A;  1UHN A;  1CDM A;  2JOJ A;  3EK8 A;  1CDL A;  1ZFS A;  2NCP A;  2K61 A;  1MWN A;  1KCY A;  1F71 A;  1KFU S;  4NDC A;  3GK2 A;  5AEQ A;  1WLM A;  2HQ8 A;  4ORC B;  5CSN A;  2LMU A;  3FIA A;  3AAJ A;  3OB2 B;  3PN7 B;  4YI8 A;  3O4Y A;  1WRK A;  4ZCV A;  1XFY O;  1DJI A;  3FS7 A;  1NX3 A;  1SR6 B;  1NCY A;  5TNC A;  2K7C A;  3PAT A;  1YUU A;  3SJS A;  1PRW A;  2EC6 B;  3KHE A;  2OS8 B;  1QLS A;  2QAC A;  2Y4Q A;  2LAP A;  2MLE C;  1SRA A;  2PRU A;  4HSZ A;  3D0Y B;  4MEW A;  1BG1 A;  2CTN A;  1LIN A;  1YUT A;  1TNW A;  1TNQ A;  2K7O A;  1CFC A;  1J7R A;  1KQM C;  1IWQ A;  5AFP A;  1SY9 A;  2E6W A;  1BU3 A;  1DT7 B;  2HF5 A;  2Q4U A;  1FI6 A;  3BQ3 A;  1XFW O;  1ODB A;  2KBI A;  2KYF A;  3EKJ A;  2M29 A;  4GNK B;  1FI5 A;  1YX8 A;  2WOS A;  2LVK A;  4YRU A;  1PVA A;  1ALW A;  1K9K A;  2L50 A;  2NXQ A;  4ZCU A;  1NCX A;  1NYA A;  1UHH A;  2KHN A;  4N5X A;  1ZOT B;  1J7P A;  3NSK A;  4PAL A;  5KSZ A;  1CNP A;  1DJY A;  4USL A;  3I5H C;  1R6P A;  2KI4 B;  2LMT A;  1S6J A;  1SCM C;  1IJ5 A;  1MUX A;  4YBH B;  3LK0 A;  1SMG A;  5J3X A;  4PE0 A;  4PHN A;  2QPT A;  4NDD A;  5KU1 A;  4C0J A;  1EL4 A;  1XA5 A;  3SG4 A;  1IQ5 A;  1B4C A;  1PVB A;  4NQG A;  3NSO A;  1M46 A;  2LCP A;  1CKK A;  1QV1 A;  3DVE A; 
#chains in the Genus database with same CATH topology
 1PAL A;  1TN4 A;  2L2C A;  2WCB A;  3VRQ A;  3WHT B;  1TUJ A;  2AMI A;  1DF0 A;  1BT6 A;  1SSE B;  3IQO A;  2K7D A;  2PQL A;  3WHU B;  4ICB A;  2BL0 C;  1OE9 B;  4DS7 A;  1SNL A;  3VRP A;  1UWO A;  3NSL A;  2QEH A;  1IJ6 A;  1J55 A;  1OOG A;  3ICB A;  4PT1 A;  2NZ0 A;  3B88 A;  4FQO A;  1D1O A;  2H61 C;  5D3O A;  1AVS A;  1CM1 A;  1CDP A;  3L47 A;  1JWD A;  1CM4 A;  3B87 A;  1DVI A;  1G8I A;  3IVT A;  1XK4 C;  3PFV A;  1KQM B;  3SS5 A;  2KBM A;  2GGZ A;  4YI9 A;  3CGA A;  1OOJ A;  1WLZ A;  4ORB B;  2KDH A;  3K1E A;  4C0K A;  1EG3 A;  1AJ4 A;  1XVJ A;  1ZMZ A;  4TNC A;  3TDI A;  4YGD B;  2WCK A;  5I2Q A;  2PYQ A;  3SS4 A;  4DRW A;  5G08 A;  1DGU A;  2CXJ A;  1OOI X;  1S6I A;  2M1K B;  2MLF C;  1QTX A;  1AHR A;  1YUS A;  3CZ0 A;  3IQQ A;  1IKU A;  2KAX A;  3I5H B;  3S0A A;  3TDU A;  1SCM B;  2LMV A;  5JOL A;  2JNX A;  3TS5 C;  2LLT A;  1G33 A;  2Y1M A;  2LHI A;  1CFD A;  4P5O E;  1KFX S;  1B9A A;  2BE6 A;  1WY9 A;  3S0E A;  1S3P A;  2QEV A;  2PSR A;  5KTY A;  3DZT A;  1TWO A;  5FYX A;  3VRO A;  1JSA A;  3AKB A;  1F55 A;  2CBL A;  3HX4 A;  1S36 A;  1CFP A;  3CYZ A;  1IG5 A;  1M31 A;  5AER A;  1OW4 A;  2HPS A;  1MHO A;  2RGI A;  1DJG A;  2QEO A;  3VB1 A;  4JQ0 D;  3B7A A;  4I5K A;  2BBN A;  1YR5 A;  2MAZ A;  1J7Q A;  2BCA A;  2K2F A;  2LAN A;  2BL0 B;  3UO9 A;  1QX7 A;  4A4B A;  4P2Y B;  1BF5 A;  1CDN A;  1QAT A;  3CZT X;  4PE4 A;  1A29 A;  3NGV A;  5HKW A;  1IRJ A;  3LCP C;  3I5F C;  2P6B B;  5AAN A;  1S6C A;  2LC5 A;  1K2H A;  2L51 A;  3CR5 X;  2OPO A;  4OKH A;  3D0Y A;  2HQW A;  1MXL C;  1WDC C;  5CSI A;  5F6T A;  1SPY A;  4AOM A;  4ORA B;  3KEV A;  2KI6 D;  1C7W A;  2KGB C;  4QJ5 B;  3CLN A;  1TNX A;  2I94 A;  3R1P A;  4YGA A;  5HKY A;  2WCF A;  1BR1 B;  4I5N B;  4MBE A;  3DYE A;  2IS9 A;  1YRT B;  1SL9 A;  1WRL A;  4M2P A;  3LL8 B;  1UHK A;  1PUL A;  2KPH A;  3O4X A;  2LM5 A;  3TS5 B;  1NWD A;  2BAP A;  4BY4 A;  2MA2 A;  3BUX B;  2ISD A;  4I5J A;  4CLN A;  1SL7 A;  2M0R A;  4QJ3 B;  3ZNI A;  1K96 A;  1TCO B;  1W7J B;  4HRG A;  5B8I B;  1RTP 1;  2H8V A;  4AQI A;  3PM8 A;  2L4H A;  2ZFD A;  3CDN A;  5DKR A;  3DD4 A;  1J1E A;  2NCO A;  3D75 A;  1EG4 A;  3EVV A;  3B6X A;  2SAS A;  4GBA A;  3VRR A;  2FCD A;  2FOT A;  3D10 A;  3CWG A;  1KSO A;  1AUI B;  1EJ3 A;  1REC A;  1EH2 A;  1GQM A;  1MF8 B;  5GQQ C;  1OZS A;  3O2P A;  2YGU A;  3PSR A;  3SIB A;  1QX2 A;  3M0W A;  1JF0 A;  1J1D A;  1LA3 A;  1LXF C;  4JWQ A;  1DJW A;  3SS3 A;  2JT8 A;  1TRF A;  1OMV A;  2GV5 A;  3I5F B;  3N7H A;  4MVF A;  1BOC A;  5D7F A;  1QS7 A;  3GK4 X;  3I5G C;  1GM0 A;  2WC6 A;  5CSF A;  1BLQ A;  4CFQ A;  4PE1 A;  1QIW A;  1GGW A;  1WDC B;  2JPT A;  5DKN A;  3EVR A;  1JUO A;  2M49 B;  3RZS A;  4YGB B;  1TOP A;  4GFT A;  2LNK A;  4AQJ A;  2M1U A;  4D1E A;  1Y1U A;  3OHM B;  2BNX A;  1LS8 A;  1T14 A;  4WQ2 A;  5HLO A;  3VGO A;  2LUC A;  1Y1A A;  1IIO A;  1QV0 A;  1WRZ A;  1AK8 A;  2JUL A;  2K0J A;  4XJK B;  1F4Q A;  1SL8 A;  2I2R E;  1OMR A;  3BUM B;  3ZWH A;  1KK8 C;  4C0L A;  1N0Y A;  2BKI B;  1JFK A;  2JTZ A;  2F3Z A;  1A4P A;  1B7T Z;  1QJT A;  1UHJ A;  2LUX A;  5CPV A;  3B86 A;  3KF9 A;  2B1U A;  2KFH A;  3SG7 A;  1UUR A;  3FWB A;  1GGZ A;  1K9U A;  1U5I A;  2KYC A;  5FI7 A;  2PAS A;  2M7L A;  3DY9 A;  1N2D A;  5PAL A;  1YX7 A;  2AUC A;  1QVI Z;  2PVB A;  3GK1 A;  4M2O A;  2LV7 A;  1BMO A;  2Q91 A;  4GGF C;  5CSJ A;  2BE4 A;  1DJH A;  1CMF A;  4U8D A;  4WQ3 A;  1DMO A;  2LLS A;  3RM1 A;  1JBA A;  1IGV A;  1LKJ A;  1XFX O;  2I7A A;  2KNE A;  2FJY A;  1C07 A;  1A75 A;  2KAV A;  3R1O A;  4JD9 A;  3HCM A;  2ZKM X;  1P28 A;  3S0D A;  3BUW B;  3C1V A;  3R72 A;  1RWY A;  1UUS A;  3BFH A;  3I5I C;  2TN4 A;  1XFR A;  5HKZ A;  1TNP A;  3BUN B;  2I18 A;  3S0B A;  1BR4 B;  1DF0 B;  4MSP A;  4OR9 B;  4YGC B;  3BXK A;  5FI2 A;  3BOW B;  5HYD A;  1FF1 A;  1A2X A;  4MZK A;  2BCX A;  2KOT A;  3I5G B;  1V1G A;  4OVN F;  2LVJ A;  2WND A;  3KO0 A;  5I2L A;  1VRK A;  5I94 A;  1C3Z A;  1G4Y R;  2OTG C;  3DF0 B;  3CR2 A;  4IJ7 A;  1OSA A;  3TDZ A;  1F70 A;  4M2Q A;  3V2L A;  2JU0 A;  2ZND A;  3L4A A;  1QIV A;  2KAY A;  1KQV A;  1XK4 A;  4GPL B;  1XO5 A;  3D74 A;  2KFF A;  4PCW A;  2KFG A;  1H8B A;  3D76 A;  3AKA A;  1AP4 A;  1RFJ A;  1W9Z A;  3R1V A;  1M39 A;  1KWO C;  1KK7 Z;  1NSH A;  2ZNE A;  4FTG A;  1HQV A;  1N65 A;  4OV2 A;  1L2O C;  1FPW A;  2F8P A;  3NSI A;  1Z4H A;  1FW4 A;  4OZD A;  2Y5I A;  1B8C A;  1KK8 B;  2GTE A;  4ETO A;  1OZO A;  4QJ4 B;  2LE9 B;  1SK6 D;  3L4L A;  3JTD C;  2COL B;  1XFZ O;  3H4S E;  1K93 D;  3TZ1 A;  1DQE A;  1NX0 A;  4BY5 A;  1PSR A;  1K95 A;  1JFJ A;  5FI6 A;  5K89 A;  1KFU L;  2Y1N A;  2L4I A;  2JXL A;  2BKH B;  1PSB A;  5DIC A;  4PDZ A;  3EVU A;  1JC2 A;  2FCE A;  2M3W A;  2P71 A;  2DOQ A;  1XFV O;  2SCP A;  4HRE E;  2JXC A;  2JPO A;  2KQY A;  2MRD A;  1CLL A;  1TTX A;  1CMG A;  1C3Y A;  1QXP A;  4DIR A;  1M45 A;  5DKQ A;  2MJW B;  3TUY C;  4E68 A;  1B7T Y;  1K9P A;  1QAS A;  1ZAC A;  2ZRS A;  4JPZ B;  1FBV A;  1K8U A;  2O60 A;  3D78 A;  3RLZ A;  2KSP A;  4CFR A;  1XYD A;  1Q80 A;  4CID A;  3NHI A;  2CT9 A;  1NPQ A;  3I5I B;  3JVT C;  4GAO A;  1Z2C B;  4I5L B;  4GGN A;  2F2P A;  1Y0V H;  2WC8 A;  3CTN A;  1QVI Y;  2AAO A;  1NCZ A;  5I2O A;  1ZUZ A;  1SYM A;  3D77 A;  2K2A A;  3CAB A;  4HRH A;  1Y6W A;  2OTG B;  1K94 A;  2LLU A;  4MN0 A;  1LA0 A;  2WCE A;  3VRN A;  1CFF A;  4YGE B;  2F33 A;  1SCV A;  1RK9 A;  2EHB A;  1TUZ A;  1V1F A;  3A8R A;  3EK7 A;  3BFB A;  5IBW A;  1NUB A;  1SBJ A;  3SG6 A;  3UNW A;  1KSM A;  1X02 A;  3OX6 A;  1KWO B;  3D73 A;  1Y1X A;  1HT9 A;  1OOF A;  1F54 A;  1L2O B;  3FWC A;  1A03 A;  2WC5 A;  3BYA A;  1SKT A;  4INW A;  3DVM A;  4CPV A;  4GUK A;  2BBM A;  4MLW A;  1B8R A;  3DXL A;  2G2B A;  4INX A;  1DC1 A;  2JZI A;  1CB1 A;  1K90 D;  1DJX A;  4XJK A;  3A4U B;  3JTD B;  3O6B A;  2F3Y A;  5ER5 A;  1B1G A;  2JQ6 A;  4PHM A;  2M97 A;  3EKH A;  1S5G Z;  3OP0 A;  4F7F A;  5BPJ A;  3EG5 B;  2L2E A;  2ZRT A;  1YVL A;  3EK4 A;  2WCH A;  3PLF B;  2H2K A;  1TCF A;  3O78 A;  2JNF A;  3IF7 A;  1KK7 Y;  4R1E A;  2PAL A;  2L5Y A;  2A4J A;  2M9G A;  4NDB A;  2JT0 A;  2K8M B;  4OCI A;  2CNP A;  5HLV A;  2O5G A;  2MBX A;  4N1G A;  4IL1 A;  4N1F A;  1YVH A;  1SW8 A;  1UHI A;  3TUY B;  1BJF A;  1S1E A;  3DVJ A;  2BCB A;  4Q04 A;  1YRU B;  1YTZ C;  4MRX A;  1NP8 A;  1OMD A;  2ZN8 A;  3JVT B;  1GJY A;  3OX5 A;  2JRF A;  1DEL A;  2PMY A;  1L7Z A;  1QWV A;  3QRX A;  1YUR A;  2L5X B;  3NXA A;  5EL2 A;  1B47 A;  3SG2 A;  5D69 A;  2G9B A;  2KLD A;  2V53 A;  1C7V A;  3WXA A;  1EXR A;  1NIW A;  3BOW A;  1F8H A;  4A4C A;  3DVK A;  2L0P A;  4KYN A;  3OGN A;  3DF0 A;  1RJV A;  2KLE A;  1CLB A;  2ZN9 A;  2K7B A;  3E3R A;  3CR4 X;  1MQ1 A;  1UP5 A;  2GGM A;  3OBV A;  5AXI A;  1CTR A;  2VRG A;  3LK1 A;  1RRO A;  1W7I B;  2ERB A;  2WOR A;  1BOD A;  4MRY A;  2F2O A;  4PE7 A;  3OB1 B;  4DCK A;  3K21 A;  4UPG A;  2LP2 A;  2MHH A;  3AAK A;  4WRI A;  5ER4 X;  3GOF A;  1S26 D;  3F45 A;  2E30 A;  1KFX L;  3PAL A;  2L98 A;  3PN7 C;  5JJG A;  1NX1 A;  1H4B A;  1QX5 B;  3CZ2 A;  3S0G A;  2H61 A;  1SR6 C;  3CS1 A;  3PJI A;  3SG3 A;  4PHK A;  2JT3 A;  1B8L A;  2CCM A;  2LVI A;  2EC6 C;  1XFU O;  2OS8 C;  1J7O A;  1E8A A;  1IH0 A;  4XYN A;  1OQP A;  2JTT A;  3SG5 A;  3S0F A;  2LP3 A;  1U5I B;  1MR8 A;  2JC2 A;  2M8U A;  3QME A;  2FJU B;  1NX2 A;  4PHJ A;  3WNX B;  2P70 A;  1PK0 D;  4F0Z B;  4GGF A;  2KQ6 A;  5I8N A;  2QDI A;  1IQ3 A;  3LLE A;  3FE9 A;  3MSE B;  2D8N A;  1LVC D;  1R2U A;  2EGD A;  2KI6 C;  1S5G Y;  1TIZ A;  1DTL A;  2R2I A;  2HET A;  4MZL A;  1DJZ A;  2KGR A;  2NLN A;  1F4O A;  2WCJ A;  3KPX A;  1AJ5 A;  1M63 B;  1A75 B;  4DUQ A;  1JF2 A;  1ALV A;  4L9M A;  2LVV A;  3SIA A;  4MZJ A;  2BEC A;  2LHL A;  3FE6 A;  2KI4 C;  2M7N A;  3BUO B;  1MXE A;  1DGV A;  1CLM A;  1QLK A;  2JWW A;  1UHN A;  4FQT A;  1CDM A;  1ORG A;  2JOJ A;  3EK8 A;  1CDL A;  1ZFS A;  2NCP A;  2K61 A;  1MWN A;  1OOH A;  1DEK A;  1KCY A;  1F71 A;  1KFU S;  4NDC A;  3GK2 A;  5AEQ A;  1WLM A;  2HQ8 A;  4ORC B;  5CSN A;  2LMU A;  3FIA A;  3AAJ A;  3OB2 B;  3PN7 B;  4YI8 A;  3O4Y A;  1WRK A;  4ZCV A;  1XFY O;  3Q8I A;  1DJI A;  3FS7 A;  1NX3 A;  1SR6 B;  1NCY A;  5TNC A;  2K7C A;  3PAT A;  1YUU A;  3SJS A;  1PRW A;  2EC6 B;  3KHE A;  2WCM A;  3BJH A;  2OS8 B;  1QLS A;  2QAC A;  2Y4Q A;  2LAP A;  3CZ1 A;  2MLE C;  1SRA A;  2PRU A;  4HSZ A;  3D0Y B;  4MEW A;  1BG1 A;  2CTN A;  2QEB A;  1LIN A;  1YUT A;  1TNW A;  1TNQ A;  2K7O A;  2K60 A;  1CFC A;  1J7R A;  1KQM C;  1IWQ A;  5AFP A;  1SY9 A;  2E6W A;  1BU3 A;  1DT7 B;  2HF5 A;  2Q4U A;  1FI6 A;  3BQ3 A;  1XFW O;  1ODB A;  2KBI A;  2KYF A;  3NHT A;  3EKJ A;  2M29 A;  4GNK B;  4JKT A;  1FI5 A;  1YX8 A;  3FE8 A;  5HL1 A;  2WOS A;  2LVK A;  4YRU A;  1PVA A;  1ALW A;  1K9K A;  2L50 A;  2NXQ A;  4ZCU A;  1NCX A;  1NYA A;  1UHH A;  2KHN A;  4N5X A;  1ZOT B;  1J7P A;  3NSK A;  4PAL A;  5KSZ A;  1CNP A;  1DJY A;  4USL A;  3I5H C;  1R6P A;  2KI4 B;  2LMT A;  1S6J A;  3BFA A;  1SCM C;  1IJ5 A;  1MUX A;  4YBH B;  3LK0 A;  1SMG A;  5J3X A;  4PE0 A;  4PHN A;  2QPT A;  2WCL A;  4NDD A;  5KU1 A;  4C0J A;  3PM2 A;  1EL4 A;  1XA5 A;  3SG4 A;  1IQ5 A;  1B4C A;  1PVB A;  4NQG A;  3NSO A;  1M46 A;  2LCP A;  1CKK A;  1QV1 A;  3DVE A; 
#chains in the Genus database with same CATH homology
 1PAL A;  1TN4 A;  2WCB A;  3VRQ A;  3WHT B;  2AMI A;  1DF0 A;  1BT6 A;  3IQO A;  2K7D A;  3WHU B;  4ICB A;  2BL0 C;  1OE9 B;  4DS7 A;  1SNL A;  3VRP A;  1UWO A;  3NSL A;  1IJ6 A;  1J55 A;  3ICB A;  2NZ0 A;  4FQO A;  1D1O A;  2H61 C;  1JWD A;  1AVS A;  1CM1 A;  1CDP A;  1CM4 A;  1DVI A;  1G8I A;  1XK4 C;  3PFV A;  1KQM B;  2KBM A;  2GGZ A;  4YI9 A;  3CGA A;  1OOJ A;  1WLZ A;  4ORB B;  2KDH A;  4C0K A;  1EG3 A;  1AJ4 A;  1XVJ A;  1ZMZ A;  4TNC A;  3TDI A;  4YGD B;  5I2Q A;  4DRW A;  5G08 A;  1DGU A;  2CXJ A;  1S6I A;  2M1K B;  2MLF C;  4P5O E;  1QTX A;  1AHR A;  1YUS A;  1IKU A;  3IQQ A;  2KAX A;  3I5H B;  3TDU A;  1SCM B;  2LMV A;  5JOL A;  2JNX A;  3TS5 C;  2LLT A;  1G33 A;  2Y1M A;  2LHI A;  1CFD A;  1KFX S;  1B9A A;  2BE6 A;  1WY9 A;  1S3P A;  2PSR A;  5KTY A;  1JSA A;  5FYX A;  3VRO A;  3AKB A;  1F55 A;  2CBL A;  3HX4 A;  1S36 A;  1CFP A;  5AER A;  1IG5 A;  1M31 A;  2HPS A;  1MHO A;  2RGI A;  1DJG A;  4JQ0 D;  4I5K A;  2BBN A;  1YR5 A;  2MAZ A;  1J7Q A;  2BCA A;  2K2F A;  2LAN A;  2BL0 B;  1QX7 A;  4A4B A;  4P2Y B;  1BF5 A;  1CDN A;  1QAT A;  3CZT X;  4PE4 A;  1A29 A;  5HKW A;  1IRJ A;  3LCP C;  3I5F C;  2P6B B;  5AAN A;  1S6C A;  2LC5 A;  1K2H A;  2L51 A;  3CR5 X;  2OPO A;  4OKH A;  3D0Y A;  2HQW A;  1MXL C;  1WDC C;  5CSI A;  5F6T A;  1SPY A;  4AOM A;  4ORA B;  3KEV A;  2KI6 D;  1C7W A;  2KGB C;  4QJ5 B;  3CLN A;  1TNX A;  2I94 A;  4YGA A;  5HKY A;  2WCF A;  1BR1 B;  4I5N B;  4MBE A;  2IS9 A;  1YRT B;  1SL9 A;  1WRL A;  4M2P A;  3LL8 B;  1UHK A;  1PUL A;  3TS5 B;  2LM5 A;  1NWD A;  4BY4 A;  2MA2 A;  3BUX B;  2ISD A;  4I5J A;  4CLN A;  1SL7 A;  2M0R A;  4QJ3 B;  3ZNI A;  1K96 A;  1TCO B;  1W7J B;  4HRG A;  5B8I B;  1RTP 1;  4AQI A;  3PM8 A;  2L4H A;  2ZFD A;  5DKR A;  3DD4 A;  1J1E A;  2NCO A;  1EG4 A;  3EVV A;  2SAS A;  4GBA A;  3VRR A;  2FCD A;  2FOT A;  3D10 A;  3CWG A;  1KSO A;  1AUI B;  1EJ3 A;  1REC A;  1EH2 A;  1GQM A;  1MF8 B;  5GQQ C;  1OZS A;  3O2P A;  3PSR A;  3SIB A;  1QX2 A;  3M0W A;  1JF0 A;  1J1D A;  1LA3 A;  1LXF C;  4JWQ A;  1DJW A;  2JT8 A;  1TRF A;  1OMV A;  2GV5 A;  3I5F B;  4MVF A;  1BOC A;  5D7F A;  1QS7 A;  3GK4 X;  3I5G C;  5CSF A;  1BLQ A;  4CFQ A;  4PE1 A;  1QIW A;  1GGW A;  1WDC B;  2JPT A;  5DKN A;  3EVR A;  1JUO A;  2M49 B;  4YGB B;  1TOP A;  4GFT A;  2LNK A;  4AQJ A;  2M1U A;  4D1E A;  1Y1U A;  3OHM B;  4WQ2 A;  5HLO A;  3VGO A;  2LUC A;  1Y1A A;  1QV0 A;  1WRZ A;  1AK8 A;  2JUL A;  2K0J A;  4XJK B;  1F4Q A;  1SL8 A;  2I2R E;  1OMR A;  3BUM B;  3ZWH A;  1KK8 C;  4C0L A;  1N0Y A;  2BKI B;  1JFK A;  2JTZ A;  2F3Z A;  1A4P A;  1B7T Z;  1QJT A;  1UHJ A;  2LUX A;  5CPV A;  3KF9 A;  2B1U A;  2KFH A;  3SG7 A;  1UUR A;  3FWB A;  1GGZ A;  1K9U A;  1U5I A;  2KYC A;  2PAS A;  2M7L A;  1N2D A;  5PAL A;  1YX7 A;  2AUC A;  1QVI Z;  2PVB A;  3GK1 A;  4M2O A;  2LV7 A;  1BMO A;  2Q91 A;  4GGF C;  5CSJ A;  2BE4 A;  1DJH A;  1CMF A;  4U8D A;  4WQ3 A;  1DMO A;  2LLS A;  3RM1 A;  1JBA A;  1IGV A;  1LKJ A;  1XFX O;  2I7A A;  2KNE A;  1C07 A;  1A75 A;  2KAV A;  3HCM A;  2ZKM X;  3BUW B;  3C1V A;  1RWY A;  1UUS A;  3I5I C;  5HKZ A;  2TN4 A;  1TNP A;  3BUN B;  2I18 A;  1BR4 B;  1DF0 B;  4MSP A;  4OR9 B;  4YGC B;  3BXK A;  3BOW B;  5HYD A;  1FF1 A;  1A2X A;  4MZK A;  2BCX A;  2KOT A;  3I5G B;  1V1G A;  4OVN F;  2LVJ A;  2WND A;  3KO0 A;  5I2L A;  1VRK A;  1G4Y R;  2OTG C;  3DF0 B;  3CR2 A;  1F70 A;  1OSA A;  3TDZ A;  4M2Q A;  2JU0 A;  2ZND A;  1QIV A;  2KAY A;  1KQV A;  1XK4 A;  4GPL B;  1XO5 A;  2KFF A;  4PCW A;  2KFG A;  1H8B A;  3AKA A;  1AP4 A;  1RFJ A;  1M39 A;  1KWO C;  1KK7 Z;  1NSH A;  2ZNE A;  4FTG A;  1HQV A;  1N65 A;  4OV2 A;  1L2O C;  1FPW A;  2F8P A;  3NSI A;  1FW4 A;  2Y5I A;  1B8C A;  1KK8 B;  4ETO A;  1OZO A;  4QJ4 B;  2LE9 B;  1SK6 D;  3JTD C;  2COL B;  1XFZ O;  3H4S E;  1K93 D;  3TZ1 A;  1JFJ A;  1NX0 A;  4BY5 A;  1PSR A;  1K95 A;  5K89 A;  1KFU L;  2Y1N A;  2L4I A;  2JXL A;  2BKH B;  1PSB A;  4PDZ A;  3EVU A;  1JC2 A;  2FCE A;  2M3W A;  2DOQ A;  1XFV O;  2SCP A;  4HRE E;  2JXC A;  2KQY A;  2MRD A;  1CLL A;  1TTX A;  1CMG A;  1QXP A;  4DIR A;  1M45 A;  5DKQ A;  2MJW B;  3TUY C;  4E68 A;  1B7T Y;  1K9P A;  1QAS A;  1ZAC A;  2ZRS A;  4JPZ B;  1FBV A;  1K8U A;  2O60 A;  3RLZ A;  2KSP A;  4CFR A;  1XYD A;  1Q80 A;  4CID A;  4GAO A;  2CT9 A;  1NPQ A;  3I5I B;  3JVT C;  4I5L B;  4GGN A;  2F2P A;  1Y0V H;  2WC8 A;  3CTN A;  1QVI Y;  2AAO A;  1NCZ A;  5I2O A;  1ZUZ A;  1SYM A;  2K2A A;  4HRH A;  1Y6W A;  2OTG B;  1K94 A;  2LLU A;  4MN0 A;  1LA0 A;  2WCE A;  3VRN A;  1CFF A;  4YGE B;  2F33 A;  1SCV A;  1RK9 A;  2EHB A;  1V1F A;  3A8R A;  3EK7 A;  5IBW A;  1NUB A;  1SBJ A;  3SG6 A;  1KSM A;  1X02 A;  3OX6 A;  1KWO B;  1Y1X A;  1HT9 A;  1F54 A;  1L2O B;  3FWC A;  1A03 A;  3BYA A;  1SKT A;  3DVM A;  4CPV A;  4GUK A;  2BBM A;  4MLW A;  1B8R A;  2G2B A;  2JZI A;  1CB1 A;  1K90 D;  1DJX A;  4XJK A;  3A4U B;  3JTD B;  3O6B A;  2F3Y A;  5ER5 A;  1B1G A;  2JQ6 A;  4PHM A;  2M97 A;  3EKH A;  1S5G Z;  3OP0 A;  5BPJ A;  2L2E A;  2ZRT A;  1YVL A;  3EK4 A;  3PLF B;  2H2K A;  1TCF A;  3O78 A;  2JNF A;  3IF7 A;  1KK7 Y;  4R1E A;  2PAL A;  2A4J A;  2M9G A;  4NDB A;  2JT0 A;  2K8M B;  4OCI A;  2CNP A;  5HLV A;  2O5G A;  2MBX A;  4N1G A;  4IL1 A;  4N1F A;  1YVH A;  1SW8 A;  1UHI A;  3TUY B;  1BJF A;  1S1E A;  3DVJ A;  2BCB A;  4Q04 A;  1YRU B;  1YTZ C;  4MRX A;  1NP8 A;  1OMD A;  2ZN8 A;  3JVT B;  1GJY A;  3OX5 A;  2JRF A;  2PMY A;  1L7Z A;  3QRX A;  1YUR A;  2L5X B;  3NXA A;  1B47 A;  3SG2 A;  5D69 A;  2G9B A;  2V53 A;  1C7V A;  3WXA A;  1EXR A;  1NIW A;  3BOW A;  1F8H A;  4A4C A;  3DVK A;  2L0P A;  3DF0 A;  1RJV A;  1CLB A;  2ZN9 A;  2K7B A;  3E3R A;  3CR4 X;  1MQ1 A;  1UP5 A;  2GGM A;  5AXI A;  1CTR A;  2VRG A;  3LK1 A;  1RRO A;  1W7I B;  2WOR A;  1BOD A;  4MRY A;  2F2O A;  4PE7 A;  3OB1 B;  4DCK A;  3K21 A;  4UPG A;  2LP2 A;  2MHH A;  3AAK A;  4WRI A;  5ER4 X;  3GOF A;  1S26 D;  3F45 A;  2E30 A;  1KFX L;  3PAL A;  2L98 A;  3PN7 C;  5JJG A;  1NX1 A;  1H4B A;  1QX5 B;  2H61 A;  1SR6 C;  3CS1 A;  3SG3 A;  4PHK A;  2JT3 A;  1B8L A;  2CCM A;  2LVI A;  2EC6 C;  1XFU O;  2OS8 C;  1J7O A;  1E8A A;  1IH0 A;  4XYN A;  1OQP A;  2JTT A;  3SG5 A;  2LP3 A;  1U5I B;  1MR8 A;  2JC2 A;  2M8U A;  3WNX B;  2FJU B;  1NX2 A;  4PHJ A;  1PK0 D;  4F0Z B;  4GGF A;  2KQ6 A;  5I8N A;  1IQ3 A;  3LLE A;  3MSE B;  2D8N A;  1LVC D;  1R2U A;  2EGD A;  2KI6 C;  1S5G Y;  1TIZ A;  1DTL A;  2R2I A;  2HET A;  4MZL A;  1DJZ A;  2KGR A;  2NLN A;  1F4O A;  3KPX A;  1AJ5 A;  1M63 B;  1A75 B;  4DUQ A;  1JF2 A;  1ALV A;  4L9M A;  2LVV A;  3SIA A;  4MZJ A;  2BEC A;  2LHL A;  2KI4 C;  2M7N A;  3BUO B;  1MXE A;  1DGV A;  1CLM A;  1QLK A;  2JWW A;  1UHN A;  1CDM A;  2JOJ A;  3EK8 A;  1CDL A;  1ZFS A;  2NCP A;  2K61 A;  1MWN A;  1KCY A;  1F71 A;  1KFU S;  4NDC A;  3GK2 A;  5AEQ A;  1WLM A;  2HQ8 A;  4ORC B;  5CSN A;  2LMU A;  3FIA A;  3AAJ A;  3OB2 B;  3PN7 B;  4YI8 A;  3O4Y A;  1WRK A;  4ZCV A;  1XFY O;  1DJI A;  3FS7 A;  1NX3 A;  1SR6 B;  1NCY A;  5TNC A;  2K7C A;  3PAT A;  1YUU A;  3SJS A;  1PRW A;  2EC6 B;  3KHE A;  2OS8 B;  1QLS A;  2QAC A;  2Y4Q A;  2LAP A;  2MLE C;  1SRA A;  2PRU A;  4HSZ A;  3D0Y B;  4MEW A;  1BG1 A;  2CTN A;  1LIN A;  1YUT A;  1TNW A;  1TNQ A;  2K7O A;  1CFC A;  1J7R A;  1KQM C;  1IWQ A;  5AFP A;  1SY9 A;  2E6W A;  1BU3 A;  1DT7 B;  2HF5 A;  2Q4U A;  1FI6 A;  3BQ3 A;  1XFW O;  1ODB A;  2KBI A;  2KYF A;  3EKJ A;  2M29 A;  4GNK B;  1FI5 A;  1YX8 A;  2WOS A;  2LVK A;  4YRU A;  1PVA A;  1ALW A;  1K9K A;  2L50 A;  2NXQ A;  4ZCU A;  1NCX A;  1NYA A;  1UHH A;  2KHN A;  4N5X A;  1ZOT B;  1J7P A;  3NSK A;  4PAL A;  5KSZ A;  1CNP A;  1DJY A;  4USL A;  3I5H C;  1R6P A;  2KI4 B;  2LMT A;  1S6J A;  1SCM C;  1IJ5 A;  1MUX A;  4YBH B;  3LK0 A;  1SMG A;  5J3X A;  4PE0 A;  4PHN A;  2QPT A;  4NDD A;  5KU1 A;  4C0J A;  1EL4 A;  1XA5 A;  3SG4 A;  1IQ5 A;  1B4C A;  1PVB A;  4NQG A;  3NSO A;  1M46 A;  2LCP A;  1CKK A;  1QV1 A;  3DVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...