1C07A

Structure of the third eps15 homology domain of human eps15
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
TWVVSPAEKAKYDEIFLKTDKDMDGFVSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKDQFALAFHLISQKLIKGIDPPHVLTPEMIPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Eps15's third EH domain reveals coincident Phe-Trp and Asn-Pro-Phe binding sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords PROTEIN (EPIDERMAL GROWTH FACTOR RECEPTOR PATHWAY SUBSTRATE
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 1999-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1c07A00
5AXIA 1SL8A 2ZNDA 1J7OA 2JXCA 5PALA 3BOWB 3E3RA 2FCEA 4CPVA 5HLOA 3NSLA 1JUOA 1B8RA 2MRDA 4WQ2A 3I5IC 2Y4QA 3BOWA 4OCIA 1BOCA 3KEVA 2OTGC 1KK8B 1XFUO 3AAJA 1XO5A 4Q04A 2PASA 1B7TZ 5DKQA 3AKBA 1B8LA 4TNCA 2G9BA 2I18A 1F71A 4ETOA 1VRKA 1NPQA 1A4PA 4DUQA 1NX2A 1KQMC 2KFHA 2BBMA 2LV7A 1TCFA 5F6TA 4M2PA 1L7ZA 2KI4C 1R6PA 1KFUS 1Y1UA 3O6BA 1SYMA 1CLMA 3BUMB 2OS8B 1HT9A 1SRAA 4GAOA 1GJYA 2LE9B 1DJGA 2OTGB 2JU0A 1IJ5A 3JVTC 3VRPA 1K96A 3I5HC 4N1FA 4XJKB 2KAYA 1JBAA 3CR2A 1GQMA 4JQ0D 1Y6WA 2F3YA 1Y1XA 1L2OC 1AJ5A 2ISDA 3SIAA 1IQ5A 1FBVA 1S36A 1SR6B 3D10A 1CKKA 1KFXS 3M0WA 1J7PA 3OB1B 1XK4A 1SNLA 2WORA 3DF0B 1J55A 3CR5X 2L2EA 1DT7B 1QATA 3EVVA 5TNCA 3KO0A 3CTNA 2F3ZA 1OOJA 2LLUA 4DCKA 1B7TY 1N0YA 2BCBA 2JTZA 1IGVA 3BYAA 1NCXA 3I5GC 1YUSA 1KFXL 1SR6C 2BKIB 2O5GA 2JQ6A 4WQ3A 5ER5A 2KI6C 1H4BA 4MBEA 1K94A 3RLZA 1EL4A 2JWWA 1J7RA 3TS5C 4UPGA 4OKHA 1DF0B 1SW8A 3IQOA 3LK1A 3RM1A 2LMTA 5K89A 1Y0VH 4PE1A 1IH0A 4NDBA 1QX2A 3EVUA 2F2OA 2K7BA 4YI8A 1KWOC 4JWQA 5KTYA 3DF0A 1QV0A 2L51A 1DJXA 2K7OA 3D0YB 3TZ1A 2JZIA 3SG7A 1ZUZA 1FI6A 2HQWA 3TDUA 5DKNA 1V1GA 4A4BA 4CFQA 3CR4X 4IL1A 3KHEA 4I5KA 2LVKA 1TCOB 2EC6B 1Q80A 1YTZC 1OZOA 4AQIA 3AKAA 4GUKA 4GNKB 5CSFA 1UHJA 1K93D 2AAOA 3SG3A 4DRWA 1SKTA 1XVJA 1QX7A 4NQGA 1EH2A 2LHIA 1RWYA 2MBXA 3DVEA 1S6JA 1BG1A 1YR5A 2M1UA 1S3PA 2OPOA 1SMGA 2LANA 1KCYA 4N1GA 1U5IA 1A75A 2KYFA 3ICBA 4MLWA 4PHKA 1AK8A 1IKUA 1UHIA 2M7LA 4CLNA 2FCDA 2K0JA 1NX0A 1PALA 2KGRA 1TN4A 2L0PA 3WHUB 5B8IB 1XYDA 1WRLA 5FYXA 1TOPA 1EG4A 1KFUL 3BUXB 1EXRA 4PHMA 1JFJA 1CMGA 1SPYA 1K2HA 2I94A 1XK4C 4YGCB 5I2LA 4FTGA 1TNWA 2CNPA 1OZSA 2L50A 2HPSA 1B4CA 1CB1A 2I2RE 2QPTA 3EKJA 2JULA 2K7CA 1DGUA 1WY9A 4HSZA 3VRNA 3BUNB 1MR8A 4PE4A 4PDZA 1RFJA 4QJ5B 1CLBA 2PVBA 2LLSA 1SCMB 1S1EA 1YVLA 3DVKA 5HKYA 1BLQA 1J1EA 1DTLA 1CFDA 4ZCUA 2PMYA 1PK0D 1U5IB 1FPWA 1WDCB 4PCWA 5AERA 1SBJA 2KI4B 1MXEA 3O78A 2I7AA 1LKJA 1K9PA 1NCZA 1XFXO 4PHJA 1OMDA 1Y1AA 1CDMA 2KAVA 2LUXA 1OMVA 4NDDA 1RK9A 1OE9B 3MSEB 3JVTB 3SJSA 4JPZB 1DVIA 2KGBC 2WOSA 1SCMC 2LVJA 2LP2A 3GK1A 4OR9B 2CT9A 4C0KA 1N65A 2KQ6A 1JC2A 3O2PA 4MRYA 3DVMA 2NLNA 2EGDA 4HRHA 1D1OA 1QLKA 5KU1A 3CWGA 3GOFA 5D69A 1V1FA 1CDPA 5HKWA 1UHNA 2V53A 5I2QA 2KFFA 3IQQA 1TNXA 1JWDA 1XFWO 1QXPA 4USLA 1NIWA 4YI9A 2JNFA 2K61A 3OHMB 3C1VA 4YGBB 2SCPA 2PSRA 1RTP1 1SL9A 2M29A 3NSIA 3NSKA 4NDCA 1FI5A 1B1GA 1CFCA 1KQVA 3OB2B 2H2KA 2E6WA 1JFKA 4P2YB 1S5GY 3TS5B 3ZWHA 4YGAA 2A4JA 1MXLC 4DS7A 4OVNF 2Y1NA 1DJWA 3TUYC 2BL0B 1R2UA 2COLB 1PSRA 2LLTA 3CLNA 1TNPA 2MAZA 1NYAA 1G4YR 4YGDB 2JRFA 1C7WA 1ODBA 1F8HA 1KWOB 2B1UA 2WCFA 1LA3A 2NZ0A 1DF0A 1UHKA 1HQVA 1IG5A 1F54A 4YGEB 3HX4A 2GGZA 1NWDA 3VGOA 3SG5A 1XFYO 4E68A 4C0LA 1JF2A 1UP5A 1PVBA 3NXAA 4FQOA 2AMIA 4MZKA 4HRGA 3LCPC 2EC6C 3GK4X 1XA5A 1PULA 2LMUA 1IRJA 3PN7C 1A2XA 2KOTA 4MZLA 5AFPA 3OP0A 1CFPA 3CZTX 1TTXA 1BMOA 3I5HB 1CFFA 4OV2A 2JT8A 2MLEC 2LNKA 3BUOB 1A75B 2WCBA 2LVIA 2CCMA 3O4YA 4XYNA 2PALA 1ZMZA 2BE6A 1BR4B 3BQ3A 5GQQC 3WHTB 1PSBA 2P6BB 3EK8A 5BPJA 3SG4A 1M45A 1IWQA 1GGWA 1WDCC 5KSZA 2O60A 4C0JA 1XFVO 2M1KB 1ZFSA 2F8PA 5CSNA 3A4UB 1BR1B 1NX3A 1WRKA 3FWBA 5JOLA 4A4CA 1A29A 1EJ3A 3LL8B 2Q91A 1QV1A 2SASA 1E8AA 1SY9A 1M63B 2LHLA 3I5FC 1LXFC 1AP4A 1UHHA 1K95A 1TIZA 1FW4A 3OX5A 4MEWA 1YRTB 1YVHA 2M9GA 1K90D 4P5OE 4YBHB 1YRUB 1MHOA 2HQ8A 2Y1MA 2KAXA 1AJ4A 1F4QA 2BBNA 1QIWA 1W7JB 3QRXA 2WC8A 2GV5A 3KPXA 2GGMA 3FIAA 1IQ3A 5I8NA 4PALA 1CM4A 2PRUA 4N5XA 3WNXB 1OQPA 4WRIA 4MZJA 1SK6D 1X02A 3LLEA 2BE4A 2F2PA 1MWNA 4CIDA 1CMFA 2MJWB 4ZCVA 5CPVA 1W7IB 2JPTA 1NP8A 3VROA 2M8UA 2E30A 2EHBA 1ALVA 1RECA 2QACA 1UURA 1WLMA 1QJTA 2LUCA 1SL7A 4GPLB 5I2OA 1B47A 1S26D 5ER4X 4AOMA 1IJ6A 1F55A 2L5XB 4F0ZB 2KQYA 1QLSA 4GBAA 1A03A 1GGZA 2M49B 4MSPA 2CTNA 1SCVA 2KI6D 1C07A 5CSIA 1UUSA 3K21A 1N2DA 3NSOA 3TDZA 2JOJA 2K2FA 2BCAA 3PFVA 1J1DA 4R1EA 3FWCA 2RGIA 2NCPA 1JF0A 2TN4A 1G8IA 1CDNA 1MUXA 2L98A 4ORAB 1YUTA 1ALWA 1S5GZ 3I5IB 2D8NA 3SIBA 3VRQA 1BF5A 3PN7B 2FJUB 1KK8C 1MF8B 1F4OA 4I5LB 1NX1A 3KF9A 4QJ4B 5G08A 1NUBA 4ORBB 1WLZA 3EVRA 1QASA 1BU3A 1M46A 1KQMB 4HREE 1C7VA 1KSMA 3JTDB 1EG3A 2MLFC 1DJZA 1QVIY 5J3XA 2BCXA 1DJYA 2LC5A 1LVCD 3TUYB 1FF1A 1DGVA 1K9KA 2K7DA 1M31A 2NXQA 1AVSA 2M3WA 3PM8A 1M39A 1RJVA 1LINA 1QTXA 2HF5A 3I5FB 2G2BA 4MN0A 2MHHA 4BY4A 4CFRA 4MRXA 4DIRA 2M7NA 4PHNA 3JTDC 1YURA 2AUCA 2ZKMX 1B8CA 2K2AA 1QIVA 3TDIA 5HYDA 1YX7A 2KSPA 1TNQA 1MQ1A 1QS7A 2CXJA 3BXKA 5CSJA 2ZNEA 1AUIB 1B9AA 5D7FA 1PVAA 5HLVA 4ICBA 5AANA 2H61C 3HCMA 1OMRA 2KHNA 2M97A 3H4SE 1ZACA 1H8BA 1G33A 1TRFA 3I5GB 2JT0A 1UWOA 2ZRSA 2KBIA 1CTRA 1QX5B 2JC2A 1NSHA 2MA2A 3AAKA 1LA0A 3CGAA 3PLFB 2BKHB 3PSRA 2WNDA 2BECA 2JXLA 2KBMA 2OS8C 4M2OA 4YRUA 1K8UA 2NCOA 3F45A 2L4IA 1CNPA 2LAPA 1WRZA 2ZN8A 1KK7Z 3EKHA 3WXAA 3GK2A 2ZN9A 1L2OB 3SG2A 5JJGA 2DOQA 3SG6A 1J7QA 2M0RA 2VRGA 4M2QA 2Q4UA 2CBLA 3LK0A 1QVIZ 2F33A 2KFGA 3EK7A 3FS7A 5DKRA 3OX6A 2KYCA 5IBWA 4XJKA 5HKZA 2KDHA 4L9MA 4MVFA 1CM1A 1KSOA 1CDLA 3A8RA 2ZRTA 2LVVA 3PALA 2JNXA 1BODA 4GFTA 2BL0C 2FOTA 2HETA 1ZOTB 2R2IA 1K9UA 1KK7Y 3EK4A 4AQJA 3VRRA 1YX8A 3CS1A 4GGNA 4D1EA 2H61A 1AHRA 2LM5A 2Y5IA 3DD4A 1OSAA 2KNEA 1S6CA 2JTTA 2LMVA 2LP3A 4U8DA 1PRWA 4QJ3B 3PATA 1NCYA 2JT3A 2IS9A 3BUWB 3DVJA 4GGFA 5AEQA 1DJIA 3ZNIA 4BY5A 2K8MB 3IF7A 1S6IA 2ZFDA 4GGFC 4ORCB 4PE7A 1YUUA 4I5JA 2LCPA 1F70A 1BJFA 3D0YA 1XFZO 1RROA 1DJHA 4I5NB 1JSAA 1CLLA 2L4HA 1BT6A 4PE0A 1DMOA 2WCEA
chains in the Genus database with same CATH superfamily
5AXIA 1SL8A 2ZNDA 1J7OA 2JXCA 5PALA 3BOWB 3E3RA 1DELA 3PM2A 4INXA 2FCEA 4CPVA 5HLOA 3NSLA 1JUOA 1B8RA 2MRDA 4WQ2A 2L5YA 3I5IC 2Y4QA 3BOWA 4OCIA 1BOCA 3KEVA 2OTGC 1KK8B 1XFUO 3AAJA 1XO5A 4Q04A 2PASA 1B7TZ 5DKQA 3AKBA 1B8LA 4TNCA 2G9BA 2I18A 1F71A 4ETOA 1VRKA 1NPQA 4PT1A 1A4PA 4DUQA 1NX2A 1KQMC 2KFHA 2BBMA 2LV7A 1TCFA 5F6TA 3PJIA 4M2PA 1L7ZA 2KI4C 1R6PA 1KFUS 1Y1UA 3CYZA 1SYMA 3O6BA 3QMEA 1CLMA 3BUMB 2OS8B 1HT9A 1SRAA 4GAOA 1GJYA 2LE9B 1DJGA 2OTGB 2JU0A 1IJ5A 3JVTC 3VRPA 3NGVA 1K96A 3I5HC 4N1FA 4XJKB 2KAYA 1JBAA 3CR2A 4FQTA 1GQMA 4JQ0D 1Y6WA 2F3YA 1Y1XA 1L2OC 1AJ5A 2ISDA 3SIAA 1IQ5A 1FBVA 1S36A 1SR6B 3D10A 1CKKA 1KFXS 3M0WA 2BNXA 1J7PA 3OB1B 1XK4A 1SNLA 2WORA 3DF0B 1J55A 3CR5X 2L2EA 1DT7B 2WCKA 3CZ2A 1QATA 3EVVA 5TNCA 1C3ZA 3KO0A 3CTNA 2F3ZA 3D77A 1OOJA 2LLUA 3UNWA 1B7TY 1N0YA 4DCKA 3S0AA 3CZ0A 2BCBA 5FI6A 2JTZA 1IGVA 3BYAA 1ORGA 1NCXA 3I5GC 1YUSA 3B87A 1KFXL 1SR6C 2BKIB 2O5GA 2JQ6A 4WQ3A 5ER5A 2KI6C 1H4BA 4MBEA 1K94A 3RLZA 1EL4A 2JWWA 1J7RA 3TS5C 4UPGA 4OKHA 1DF0B 1SW8A 3IQOA 3LK1A 2PYQA 3RM1A 2LMTA 3S0GA 1Y0VH 4PE1A 5K89A 1IH0A 4NDBA 1QX2A 3EVUA 2F2OA 2K7BA 4YI8A 1KWOC 4JWQA 5KTYA 3DF0A 1QV0A 2K60A 2L51A 1DJXA 2K7OA 3D0YB 2WCLA 3D75A 2JZIA 3TZ1A 3SG7A 1ZUZA 3D78A 1FI6A 2HQWA 3TDUA 5DKNA 1V1GA 4A4BA 4CFQA 3EG5B 3CR4X 4IL1A 3KHEA 4I5KA 2LVKA 1TCOB 2EC6B 1Q80A 1YTZC 1OZOA 4AQIA 3AKAA 4GUKA 4GNKB 5CSFA 1UHJA 1K93D 2AAOA 3N7HA 3SG3A 4DRWA 1SKTA 1XVJA 1QX7A 4NQGA 1DEKA 1EH2A 2LHIA 1RWYA 2MBXA 3DVEA 1S6JA 1BG1A 3DY9A 1YR5A 2M1UA 3FE8A 1S3PA 2OPOA 1SMGA 2LANA 1KCYA 4N1GA 1U5IA 1A75A 2KYFA 3ICBA 4MLWA 4PHKA 1AK8A 1IKUA 1UHIA 2M7LA 4CLNA 2FCDA 2K0JA 1NX0A 1PALA 2KGRA 1TN4A 2GTEA 2L0PA 3WHUB 3O4XA 5B8IB 1XYDA 1WRLA 5FYXA 3FE6A 1TOPA 1EG4A 1KFUL 3BUXB 1EXRA 4PHMA 1JFJA 2QEVA 1CMGA 1SPYA 1K2HA 2I94A 1XK4C 3K1EA 4YGCB 5I2LA 4FTGA 1TNWA 2CNPA 1OZSA 2L50A 2HPSA 1B4CA 1CB1A 2I2RE 2QPTA 3EKJA 2JULA 2H8VA 2K7CA 1DGUA 1WY9A 4HSZA 3VRNA 3BUNB 2FJYA 1MR8A 5I94A 4PE4A 4PDZA 1RFJA 4QJ5B 1CLBA 2PVBA 2LLSA 1SCMB 1S1EA 1YVLA 2L2CA 3DVKA 1Z2CB 5HKYA 1J1EA 1DTLA 1BLQA 3B88A 1CFDA 4ZCUA 2PMYA 1PK0D 1U5IB 4F7FA 1FPWA 1WDCB 4PCWA 5AERA 1SBJA 2KI4B 1MXEA 3O78A 3R1VA 2I7AA 1LKJA 3DXLA 1K9PA 1NCZA 1XFXO 4PHJA 5D3OA 1OMDA 1Y1AA 1CDMA 2KAVA 2LUXA 1OMVA 4NDDA 1RK9A 1OE9B 3MSEB 3JVTB 3SJSA 4JPZB 1DVIA 1TUJA 2KGBC 2WOSA 1SCMC 2LVJA 2LP2A 3GK1A 4OR9B 2CT9A 4C0KA 1N65A 2KQ6A 1JC2A 3O2PA 4MRYA 3NHIA 3R1PA 3DVMA 2NLNA 2EGDA 4HRHA 1D1OA 1QLKA 5KU1A 3CWGA 3GOFA 5D69A 1V1FA 1CDPA 2P71A 5HKWA 1UHNA 2V53A 3S0BA 2KFFA 3IQQA 3SS5A 5I2QA 5HL1A 1TNXA 1JWDA 1TUZA 1XFWO 1QXPA 4USLA 1NIWA 4YI9A 2JNFA 2K61A 3OHMB 3C1VA 4YGBB 2SCPA 2PSRA 1RTP1 1SL9A 2QDIA 2M29A 3NSIA 3NSKA 4NDCA 4JD9A 1FI5A 1B1GA 1CFCA 1KQVA 3OB2B 2H2KA 2E6WA 1JFKA 4P2YB 1S5GY 3TS5B 3ZWHA 3OBVA 4YGAA 2A4JA 1MXLC 1DQEA 4IJ7A 4DS7A 3R1OA 4OVNF 2Y1NA 1DJWA 3S0EA 3TUYC 3BJHA 2BL0B 1R2UA 2COLB 1PSRA 2LLTA 3CLNA 1TNPA 2MAZA 1IIOA 1NYAA 1G4YR 2ERBA 4YGDB 2JRFA 1C7WA 1ODBA 1W9ZA 1F8HA 1KWOB 2B1UA 2WCFA 1LA3A 2NZ0A 1DF0A 1UHKA 1HQVA 1IG5A 1F54A 3D76A 4YGEB 3HX4A 2GGZA 3B7AA 1NWDA 3L4AA 3VGOA 3SG5A 1XFYO 4E68A 4C0LA 1JF2A 1UP5A 1PVBA 3NXAA 4FQOA 2AMIA 4MZKA 4HRGA 2WCJA 3LCPC 2EC6C 3GK4X 1XA5A 1PULA 2LMUA 1IRJA 3PN7C 1A2XA 2KOTA 4MZLA 5AFPA 3OP0A 1CFPA 3CZTX 1TTXA 1BMOA 3I5HB 5EL2A 1CFFA 3D74A 4OV2A 2JT8A 2MLEC 2LNKA 3BUOB 3B6XA 1A75B 2WCBA 2LVIA 2CCMA 3O4YA 4XYNA 2PALA 1ZMZA 2BE6A 1BR4B 3BQ3A 5GQQC 3WHTB 1PSBA 2P6BB 3EK8A 5BPJA 2QEBA 1M45A 1IWQA 3SG4A 1GGWA 1WDCC 5KSZA 2O60A 4C0JA 1XFVO 2M1KB 1ZFSA 2F8PA 1QWVA 5CSNA 3OGNA 3A4UB 2BAPA 3DZTA 1BR1B 1NX3A 1WRKA 3FWBA 5JOLA 4A4CA 1A29A 1EJ3A 3LL8B 4OZDA 2Q91A 1QV1A 3DYEA 2SASA 1E8AA 1SY9A 1M63B 2LHLA 3I5FC 1LXFC 1AP4A 5DICA 1C3YA 3L4LA 1UHHA 1K95A 1TIZA 1FW4A 3OX5A 4MEWA 1YRTB 1YVHA 2M9GA 1K90D 4P5OE 4YBHB 1YRUB 1OOGA 1MHOA 2HQ8A 2Y1MA 2KAXA 1AJ4A 1F4QA 3S0FA 2BBNA 3S0DA 1QIWA 1W7JB 3QRXA 2WC8A 2GV5A 3KPXA 2GGMA 3FE9A 3FIAA 1OOIX 5FI7A 1IQ3A 5I8NA 4PALA 3SS4A 1CM4A 2PRUA 4N5XA 3WNXB 1OQPA 4WRIA 4MZJA 1SK6D 3VB1A 1X02A 3LLEA 2BE4A 2F2PA 1MWNA 4CIDA 3CZ1A 1CMFA 1XFRA 2MJWB 4ZCVA 5CPVA 1W7IB 2JPTA 1NP8A 3VROA 3V2LA 2M8UA 2E30A 2EHBA 1ALVA 1RECA 2QACA 3IVTA 1UURA 1WLMA 1QJTA 2LUCA 1SL7A 3BFAA 4GPLB 5I2OA 1B47A 1S26D 5ER4X 4AOMA 1IJ6A 1F55A 2L5XB 4F0ZB 2KQYA 1QLSA 4GBAA 1A03A 1GGZA 2M49B 4MSPA 2CTNA 1SCVA 2KI6D 1C07A 5CSIA 1UUSA 3K21A 1N2DA 3NSOA 5FI2A 2JOJA 3TDZA 2K2FA 2BCAA 3PFVA 1J1DA 4R1EA 3FWCA 2RGIA 2NCPA 1JF0A 2TN4A 1G8IA 1CDNA 1OOFA 1MUXA 2L98A 4ORAB 1YUTA 1ALWA 2KLEA 1S5GZ 3I5IB 2D8NA 3SIBA 3VRQA 1BF5A 3PN7B 2FJUB 1Z4HA 3CABA 1KK8C 1MF8B 3NHTA 1F4OA 1SSEB 4I5LB 1NX1A 3KF9A 4QJ4B 5G08A 1NUBA 1P28A 1T14A 1WLZA 4ORBB 3EVRA 1QASA 1BU3A 1M46A 1OW4A 1KQMB 4HREE 1C7VA 1KSMA 3JTDB 1EG3A 2MLFC 1DJZA 3D73A 1QVIY 5J3XA 2BCXA 3Q8IA 1DJYA 2LC5A 1LVCD 3R72A 3TUYB 1FF1A 1DGVA 3BFBA 1K9KA 4INWA 2K7DA 1M31A 2NXQA 1AVSA 2M3WA 3PM8A 1GM0A 1M39A 1RJVA 1LINA 1QTXA 2HF5A 3I5FB 2G2BA 4MN0A 2MHHA 4BY4A 4CFRA 4MRXA 4DIRA 2WCMA 2M7NA 4PHNA 3JTDC 1YURA 4JKTA 2AUCA 2ZKMX 1B8CA 2K2AA 1QIVA 3TDIA 5HYDA 1YX7A 1OOHA 2KSPA 1TNQA 2QEHA 1LS8A 1MQ1A 1QS7A 2CXJA 3BXKA 5CSJA 2ZNEA 1AUIB 1B9AA 5D7FA 1PVAA 5HLVA 4ICBA 5AANA 2H61C 3HCMA 1OMRA 2KHNA 2M97A 3H4SE 1ZACA 1H8BA 1G33A 1TRFA 3I5GB 2JT0A 1UWOA 2ZRSA 2KBIA 1CTRA 1QX5B 2JC2A 1NSHA 2MA2A 3AAKA 1LA0A 3CGAA 3PLFB 2KPHA 2BKHB 3PSRA 2WNDA 2BECA 2JXLA 2P70A 2KBMA 2OS8C 4M2OA 4YRUA 1K8UA 2NCOA 3F45A 2L4IA 1CNPA 2QEOA 2YGUA 2LAPA 3CDNA 2JPOA 1WRZA 2ZN8A 3SS3A 1KK7Z 3EKHA 3WXAA 3GK2A 2ZN9A 1L2OB 3SG2A 5JJGA 2DOQA 3SG6A 1J7QA 2M0RA 2VRGA 4M2QA 3UO9A 2Q4UA 2CBLA 3LK0A 1QVIZ 2F33A 2KFGA 3EK7A 3FS7A 5DKRA 3OX6A 2KYCA 5IBWA 3BFHA 4XJKA 5HKZA 2KDHA 4L9MA 4MVFA 1CM1A 2KLDA 1KSOA 1CDLA 3A8RA 3B86A 2ZRTA 2LVVA 3PALA 2JNXA 1BODA 4GFTA 2BL0C 2FOTA 2HETA 1ZOTB 2R2IA 1TWOA 1K9UA 1KK7Y 3EK4A 4AQJA 3VRRA 1YX8A 3CS1A 4GGNA 4D1EA 2H61A 1AHRA 2LM5A 2Y5IA 3DD4A 3RZSA 1OSAA 2KNEA 2PQLA 1S6CA 2WC6A 2JTTA 2LMVA 1DC1A 2LP3A 4U8DA 1PRWA 4QJ3B 3PATA 1NCYA 2JT3A 2IS9A 2WC5A 3BUWB 3DVJA 4GGFA 5AEQA 1DJIA 3ZNIA 4KYNA 4BY5A 2K8MB 3IF7A 3L47A 1S6IA 2ZFDA 4GGFC 4ORCB 4PE7A 1YUUA 4I5JA 2LCPA 1F70A 1BJFA 3D0YA 1XFZO 1RROA 1DJHA 4I5NB 1JSAA 1CLLA 2L4HA 2WCHA 1BT6A 4PE0A 1DMOA 2WCEA
chains in the Genus database with same CATH topology
5AXIA 1SL8A 2ZNDA 1J7OA 2JXCA 5PALA 3BOWB 3E3RA 2FCEA 4CPVA 5HLOA 3NSLA 1JUOA 1B8RA 2MRDA 4WQ2A 3I5IC 2Y4QA 3BOWA 4OCIA 1BOCA 3KEVA 2OTGC 1KK8B 1XFUO 3AAJA 1XO5A 4Q04A 2PASA 1B7TZ 5DKQA 3AKBA 1B8LA 4TNCA 2G9BA 2I18A 1F71A 4ETOA 1VRKA 1NPQA 1A4PA 4DUQA 1NX2A 1KQMC 2KFHA 2BBMA 2LV7A 1TCFA 5F6TA 4M2PA 1L7ZA 2KI4C 1R6PA 1KFUS 1Y1UA 3O6BA 1SYMA 1CLMA 3BUMB 2OS8B 1HT9A 1SRAA 4GAOA 1GJYA 2LE9B 1DJGA 2OTGB 2JU0A 1IJ5A 3JVTC 3VRPA 1K96A 3I5HC 4N1FA 4XJKB 2KAYA 1JBAA 3CR2A 1GQMA 4JQ0D 1Y6WA 2F3YA 1Y1XA 1L2OC 1AJ5A 2ISDA 3SIAA 1IQ5A 1FBVA 1S36A 1SR6B 3D10A 1CKKA 1KFXS 3M0WA 1J7PA 3OB1B 1XK4A 1SNLA 2WORA 3DF0B 1J55A 3CR5X 2L2EA 1DT7B 1QATA 3EVVA 5TNCA 3KO0A 3CTNA 2F3ZA 1OOJA 2LLUA 4DCKA 1B7TY 1N0YA 2BCBA 2JTZA 1IGVA 3BYAA 1NCXA 3I5GC 1YUSA 1KFXL 1SR6C 2BKIB 2O5GA 2JQ6A 4WQ3A 5ER5A 2KI6C 1H4BA 4MBEA 1K94A 3RLZA 1EL4A 2JWWA 1J7RA 3TS5C 4UPGA 4OKHA 1DF0B 1SW8A 3IQOA 3LK1A 3RM1A 2LMTA 5K89A 1Y0VH 4PE1A 1IH0A 4NDBA 1QX2A 3EVUA 2F2OA 2K7BA 4YI8A 1KWOC 4JWQA 5KTYA 3DF0A 1QV0A 2L51A 1DJXA 2K7OA 3D0YB 3TZ1A 2JZIA 3SG7A 1ZUZA 1FI6A 2HQWA 3TDUA 5DKNA 1V1GA 4A4BA 4CFQA 3CR4X 4IL1A 3KHEA 4I5KA 2LVKA 1TCOB 2EC6B 1Q80A 1YTZC 1OZOA 4AQIA 3AKAA 4GUKA 4GNKB 5CSFA 1UHJA 1K93D 2AAOA 3SG3A 4DRWA 1SKTA 1XVJA 1QX7A 4NQGA 1EH2A 2LHIA 1RWYA 2MBXA 3DVEA 1S6JA 1BG1A 1YR5A 2M1UA 1S3PA 2OPOA 1SMGA 2LANA 1KCYA 4N1GA 1U5IA 1A75A 2KYFA 3ICBA 4MLWA 4PHKA 1AK8A 1IKUA 1UHIA 2M7LA 4CLNA 2FCDA 2K0JA 1NX0A 1PALA 2KGRA 1TN4A 2L0PA 3WHUB 5B8IB 1XYDA 1WRLA 5FYXA 1TOPA 1EG4A 1KFUL 3BUXB 1EXRA 4PHMA 1JFJA 1CMGA 1SPYA 1K2HA 2I94A 1XK4C 4YGCB 5I2LA 4FTGA 1TNWA 2CNPA 1OZSA 2L50A 2HPSA 1B4CA 1CB1A 2I2RE 2QPTA 3EKJA 2JULA 2K7CA 1DGUA 1WY9A 4HSZA 3VRNA 3BUNB 1MR8A 4PE4A 4PDZA 1RFJA 4QJ5B 1CLBA 2PVBA 2LLSA 1SCMB 1S1EA 1YVLA 3DVKA 5HKYA 1BLQA 1J1EA 1DTLA 1CFDA 4ZCUA 2PMYA 1PK0D 1U5IB 1FPWA 1WDCB 4PCWA 5AERA 1SBJA 2KI4B 1MXEA 3O78A 2I7AA 1LKJA 1K9PA 1NCZA 1XFXO 4PHJA 1OMDA 1Y1AA 1CDMA 2KAVA 2LUXA 1OMVA 4NDDA 1RK9A 1OE9B 3MSEB 3JVTB 3SJSA 4JPZB 1DVIA 2KGBC 2WOSA 1SCMC 2LVJA 2LP2A 3GK1A 4OR9B 2CT9A 4C0KA 1N65A 2KQ6A 1JC2A 3O2PA 4MRYA 3DVMA 2NLNA 2EGDA 4HRHA 1D1OA 1QLKA 5KU1A 3CWGA 3GOFA 5D69A 1V1FA 1CDPA 5HKWA 1UHNA 2V53A 5I2QA 2KFFA 3IQQA 1TNXA 1JWDA 1XFWO 1QXPA 4USLA 1NIWA 4YI9A 2JNFA 2K61A 3OHMB 3C1VA 4YGBB 2SCPA 2PSRA 1RTP1 1SL9A 2M29A 3NSIA 3NSKA 4NDCA 1FI5A 1B1GA 1CFCA 1KQVA 3OB2B 2H2KA 2E6WA 1JFKA 4P2YB 1S5GY 3TS5B 3ZWHA 4YGAA 2A4JA 1MXLC 4DS7A 4OVNF 2Y1NA 1DJWA 3TUYC 2BL0B 1R2UA 2COLB 1PSRA 2LLTA 3CLNA 1TNPA 2MAZA 1NYAA 1G4YR 4YGDB 2JRFA 1C7WA 1ODBA 1F8HA 1KWOB 2B1UA 2WCFA 1LA3A 2NZ0A 1DF0A 1UHKA 1HQVA 1IG5A 1F54A 4YGEB 3HX4A 2GGZA 1NWDA 3VGOA 3SG5A 1XFYO 4E68A 4C0LA 1JF2A 1UP5A 1PVBA 3NXAA 4FQOA 2AMIA 4MZKA 4HRGA 3LCPC 2EC6C 3GK4X 1XA5A 1PULA 2LMUA 1IRJA 3PN7C 1A2XA 2KOTA 4MZLA 5AFPA 3OP0A 1CFPA 3CZTX 1TTXA 1BMOA 3I5HB 1CFFA 4OV2A 2JT8A 2MLEC 2LNKA 3BUOB 1A75B 2WCBA 2LVIA 2CCMA 3O4YA 4XYNA 2PALA 1ZMZA 2BE6A 1BR4B 3BQ3A 5GQQC 3WHTB 1PSBA 2P6BB 3EK8A 5BPJA 3SG4A 1M45A 1IWQA 1GGWA 1WDCC 5KSZA 2O60A 4C0JA 1XFVO 2M1KB 1ZFSA 2F8PA 5CSNA 3A4UB 1BR1B 1NX3A 1WRKA 3FWBA 5JOLA 4A4CA 1A29A 1EJ3A 3LL8B 2Q91A 1QV1A 2SASA 1E8AA 1SY9A 1M63B 2LHLA 3I5FC 1LXFC 1AP4A 1UHHA 1K95A 1TIZA 1FW4A 3OX5A 4MEWA 1YRTB 1YVHA 2M9GA 1K90D 4P5OE 4YBHB 1YRUB 1MHOA 2HQ8A 2Y1MA 2KAXA 1AJ4A 1F4QA 2BBNA 1QIWA 1W7JB 3QRXA 2WC8A 2GV5A 3KPXA 2GGMA 3FIAA 1IQ3A 5I8NA 4PALA 1CM4A 2PRUA 4N5XA 3WNXB 1OQPA 4WRIA 4MZJA 1SK6D 1X02A 3LLEA 2BE4A 2F2PA 1MWNA 4CIDA 1CMFA 2MJWB 4ZCVA 5CPVA 1W7IB 2JPTA 1NP8A 3VROA 2M8UA 2E30A 2EHBA 1ALVA 1RECA 2QACA 1UURA 1WLMA 1QJTA 2LUCA 1SL7A 4GPLB 5I2OA 1B47A 1S26D 5ER4X 4AOMA 1IJ6A 1F55A 2L5XB 4F0ZB 2KQYA 1QLSA 4GBAA 1A03A 1GGZA 2M49B 4MSPA 2CTNA 1SCVA 2KI6D 1C07A 5CSIA 1UUSA 3K21A 1N2DA 3NSOA 3TDZA 2JOJA 2K2FA 2BCAA 3PFVA 1J1DA 4R1EA 3FWCA 2RGIA 2NCPA 1JF0A 2TN4A 1G8IA 1CDNA 1MUXA 2L98A 4ORAB 1YUTA 1ALWA 1S5GZ 3I5IB 2D8NA 3SIBA 3VRQA 1BF5A 3PN7B 2FJUB 1KK8C 1MF8B 1F4OA 4I5LB 1NX1A 3KF9A 4QJ4B 5G08A 1NUBA 4ORBB 1WLZA 3EVRA 1QASA 1BU3A 1M46A 1KQMB 4HREE 1C7VA 1KSMA 3JTDB 1EG3A 2MLFC 1DJZA 1QVIY 5J3XA 2BCXA 1DJYA 2LC5A 1LVCD 3TUYB 1FF1A 1DGVA 1K9KA 2K7DA 1M31A 2NXQA 1AVSA 2M3WA 3PM8A 1M39A 1RJVA 1LINA 1QTXA 2HF5A 3I5FB 2G2BA 4MN0A 2MHHA 4BY4A 4CFRA 4MRXA 4DIRA 2M7NA 4PHNA 3JTDC 1YURA 2AUCA 2ZKMX 1B8CA 2K2AA 1QIVA 3TDIA 5HYDA 1YX7A 2KSPA 1TNQA 1MQ1A 1QS7A 2CXJA 3BXKA 5CSJA 2ZNEA 1AUIB 1B9AA 5D7FA 1PVAA 5HLVA 4ICBA 5AANA 2H61C 3HCMA 1OMRA 2KHNA 2M97A 3H4SE 1ZACA 1H8BA 1G33A 1TRFA 3I5GB 2JT0A 1UWOA 2ZRSA 2KBIA 1CTRA 1QX5B 2JC2A 1NSHA 2MA2A 3AAKA 1LA0A 3CGAA 3PLFB 2BKHB 3PSRA 2WNDA 2BECA 2JXLA 2KBMA 2OS8C 4M2OA 4YRUA 1K8UA 2NCOA 3F45A 2L4IA 1CNPA 2LAPA 1WRZA 2ZN8A 1KK7Z 3EKHA 3WXAA 3GK2A 2ZN9A 1L2OB 3SG2A 5JJGA 2DOQA 3SG6A 1J7QA 2M0RA 2VRGA 4M2QA 2Q4UA 2CBLA 3LK0A 1QVIZ 2F33A 2KFGA 3EK7A 3FS7A 5DKRA 3OX6A 2KYCA 5IBWA 4XJKA 5HKZA 2KDHA 4L9MA 4MVFA 1CM1A 1KSOA 1CDLA 3A8RA 2ZRTA 2LVVA 3PALA 2JNXA 1BODA 4GFTA 2BL0C 2FOTA 2HETA 1ZOTB 2R2IA 1K9UA 1KK7Y 3EK4A 4AQJA 3VRRA 1YX8A 3CS1A 4GGNA 4D1EA 2H61A 1AHRA 2LM5A 2Y5IA 3DD4A 1OSAA 2KNEA 1S6CA 2JTTA 2LMVA 2LP3A 4U8DA 1PRWA 4QJ3B 3PATA 1NCYA 2JT3A 2IS9A 3BUWB 3DVJA 4GGFA 5AEQA 1DJIA 3ZNIA 4BY5A 2K8MB 3IF7A 1S6IA 2ZFDA 4GGFC 4ORCB 4PE7A 1YUUA 4I5JA 2LCPA 1F70A 1BJFA 3D0YA 1XFZO 1RROA 1DJHA 4I5NB 1JSAA 1CLLA 2L4HA 1BT6A 4PE0A 1DMOA 2WCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AXI A;  1SL8 A;  2ZND A;  1J7O A;  2JXC A;  5PAL A;  3BOW B;  3E3R A;  2FCE A;  4CPV A;  5HLO A;  3NSL A;  1JUO A;  1B8R A;  2MRD A;  4WQ2 A;  3I5I C;  2Y4Q A;  3BOW A;  4OCI A;  1BOC A;  3KEV A;  2OTG C;  1KK8 B;  1XFU O;  3AAJ A;  1XO5 A;  4Q04 A;  2PAS A;  1B7T Z;  5DKQ A;  3AKB A;  1B8L A;  4TNC A;  2G9B A;  2I18 A;  1F71 A;  4ETO A;  1VRK A;  1NPQ A;  1A4P A;  4DUQ A;  1NX2 A;  1KQM C;  2KFH A;  2BBM A;  2LV7 A;  1TCF A;  5F6T A;  4M2P A;  1L7Z A;  2KI4 C;  1R6P A;  1KFU S;  1Y1U A;  3O6B A;  1SYM A;  1CLM A;  3BUM B;  2OS8 B;  1HT9 A;  1SRA A;  4GAO A;  1GJY A;  2LE9 B;  1DJG A;  2OTG B;  2JU0 A;  1IJ5 A;  3JVT C;  3VRP A;  1K96 A;  3I5H C;  4N1F A;  4XJK B;  2KAY A;  1JBA A;  3CR2 A;  1GQM A;  4JQ0 D;  1Y6W A;  2F3Y A;  1Y1X A;  1L2O C;  1AJ5 A;  2ISD A;  3SIA A;  1IQ5 A;  1FBV A;  1S36 A;  1SR6 B;  3D10 A;  1CKK A;  1KFX S;  3M0W A;  1J7P A;  3OB1 B;  1XK4 A;  1SNL A;  2WOR A;  3DF0 B;  1J55 A;  3CR5 X;  2L2E A;  1DT7 B;  1QAT A;  3EVV A;  5TNC A;  3KO0 A;  3CTN A;  2F3Z A;  1OOJ A;  2LLU A;  4DCK A;  1B7T Y;  1N0Y A;  2BCB A;  2JTZ A;  1IGV A;  3BYA A;  1NCX A;  3I5G C;  1YUS A;  1KFX L;  1SR6 C;  2BKI B;  2O5G A;  2JQ6 A;  4WQ3 A;  5ER5 A;  2KI6 C;  1H4B A;  4MBE A;  1K94 A;  3RLZ A;  1EL4 A;  2JWW A;  1J7R A;  3TS5 C;  4UPG A;  4OKH A;  1DF0 B;  1SW8 A;  3IQO A;  3LK1 A;  3RM1 A;  2LMT A;  5K89 A;  1Y0V H;  4PE1 A;  1IH0 A;  4NDB A;  1QX2 A;  3EVU A;  2F2O A;  2K7B A;  4YI8 A;  1KWO C;  4JWQ A;  5KTY A;  3DF0 A;  1QV0 A;  2L51 A;  1DJX A;  2K7O A;  3D0Y B;  3TZ1 A;  2JZI A;  3SG7 A;  1ZUZ A;  1FI6 A;  2HQW A;  3TDU A;  5DKN A;  1V1G A;  4A4B A;  4CFQ A;  3CR4 X;  4IL1 A;  3KHE A;  4I5K A;  2LVK A;  1TCO B;  2EC6 B;  1Q80 A;  1YTZ C;  1OZO A;  4AQI A;  3AKA A;  4GUK A;  4GNK B;  5CSF A;  1UHJ A;  1K93 D;  2AAO A;  3SG3 A;  4DRW A;  1SKT A;  1XVJ A;  1QX7 A;  4NQG A;  1EH2 A;  2LHI A;  1RWY A;  2MBX A;  3DVE A;  1S6J A;  1BG1 A;  1YR5 A;  2M1U A;  1S3P A;  2OPO A;  1SMG A;  2LAN A;  1KCY A;  4N1G A;  1U5I A;  1A75 A;  2KYF A;  3ICB A;  4MLW A;  4PHK A;  1AK8 A;  1IKU A;  1UHI A;  2M7L A;  4CLN A;  2FCD A;  2K0J A;  1NX0 A;  1PAL A;  2KGR A;  1TN4 A;  2L0P A;  3WHU B;  5B8I B;  1XYD A;  1WRL A;  5FYX A;  1TOP A;  1EG4 A;  1KFU L;  3BUX B;  1EXR A;  4PHM A;  1JFJ A;  1CMG A;  1SPY A;  1K2H A;  2I94 A;  1XK4 C;  4YGC B;  5I2L A;  4FTG A;  1TNW A;  2CNP A;  1OZS A;  2L50 A;  2HPS A;  1B4C A;  1CB1 A;  2I2R E;  2QPT A;  3EKJ A;  2JUL A;  2K7C A;  1DGU A;  1WY9 A;  4HSZ A;  3VRN A;  3BUN B;  1MR8 A;  4PE4 A;  4PDZ A;  1RFJ A;  4QJ5 B;  1CLB A;  2PVB A;  2LLS A;  1SCM B;  1S1E A;  1YVL A;  3DVK A;  5HKY A;  1BLQ A;  1J1E A;  1DTL A;  1CFD A;  4ZCU A;  2PMY A;  1PK0 D;  1U5I B;  1FPW A;  1WDC B;  4PCW A;  5AER A;  1SBJ A;  2KI4 B;  1MXE A;  3O78 A;  2I7A A;  1LKJ A;  1K9P A;  1NCZ A;  1XFX O;  4PHJ A;  1OMD A;  1Y1A A;  1CDM A;  2KAV A;  2LUX A;  1OMV A;  4NDD A;  1RK9 A;  1OE9 B;  3MSE B;  3JVT B;  3SJS A;  4JPZ B;  1DVI A;  2KGB C;  2WOS A;  1SCM C;  2LVJ A;  2LP2 A;  3GK1 A;  4OR9 B;  2CT9 A;  4C0K A;  1N65 A;  2KQ6 A;  1JC2 A;  3O2P A;  4MRY A;  3DVM A;  2NLN A;  2EGD A;  4HRH A;  1D1O A;  1QLK A;  5KU1 A;  3CWG A;  3GOF A;  5D69 A;  1V1F A;  1CDP A;  5HKW A;  1UHN A;  2V53 A;  5I2Q A;  2KFF A;  3IQQ A;  1TNX A;  1JWD A;  1XFW O;  1QXP A;  4USL A;  1NIW A;  4YI9 A;  2JNF A;  2K61 A;  3OHM B;  3C1V A;  4YGB B;  2SCP A;  2PSR A;  1RTP 1;  1SL9 A;  2M29 A;  3NSI A;  3NSK A;  4NDC A;  1FI5 A;  1B1G A;  1CFC A;  1KQV A;  3OB2 B;  2H2K A;  2E6W A;  1JFK A;  4P2Y B;  1S5G Y;  3TS5 B;  3ZWH A;  4YGA A;  2A4J A;  1MXL C;  4DS7 A;  4OVN F;  2Y1N A;  1DJW A;  3TUY C;  2BL0 B;  1R2U A;  2COL B;  1PSR A;  2LLT A;  3CLN A;  1TNP A;  2MAZ A;  1NYA A;  1G4Y R;  4YGD B;  2JRF A;  1C7W A;  1ODB A;  1F8H A;  1KWO B;  2B1U A;  2WCF A;  1LA3 A;  2NZ0 A;  1DF0 A;  1UHK A;  1HQV A;  1IG5 A;  1F54 A;  4YGE B;  3HX4 A;  2GGZ A;  1NWD A;  3VGO A;  3SG5 A;  1XFY O;  4E68 A;  4C0L A;  1JF2 A;  1UP5 A;  1PVB A;  3NXA A;  4FQO A;  2AMI A;  4MZK A;  4HRG A;  3LCP C;  2EC6 C;  3GK4 X;  1XA5 A;  1PUL A;  2LMU A;  1IRJ A;  3PN7 C;  1A2X A;  2KOT A;  4MZL A;  5AFP A;  3OP0 A;  1CFP A;  3CZT X;  1TTX A;  1BMO A;  3I5H B;  1CFF A;  4OV2 A;  2JT8 A;  2MLE C;  2LNK A;  3BUO B;  1A75 B;  2WCB A;  2LVI A;  2CCM A;  3O4Y A;  4XYN A;  2PAL A;  1ZMZ A;  2BE6 A;  1BR4 B;  3BQ3 A;  5GQQ C;  3WHT B;  1PSB A;  2P6B B;  3EK8 A;  5BPJ A;  3SG4 A;  1M45 A;  1IWQ A;  1GGW A;  1WDC C;  5KSZ A;  2O60 A;  4C0J A;  1XFV O;  2M1K B;  1ZFS A;  2F8P A;  5CSN A;  3A4U B;  1BR1 B;  1NX3 A;  1WRK A;  3FWB A;  5JOL A;  4A4C A;  1A29 A;  1EJ3 A;  3LL8 B;  2Q91 A;  1QV1 A;  2SAS A;  1E8A A;  1SY9 A;  1M63 B;  2LHL A;  3I5F C;  1LXF C;  1AP4 A;  1UHH A;  1K95 A;  1TIZ A;  1FW4 A;  3OX5 A;  4MEW A;  1YRT B;  1YVH A;  2M9G A;  1K90 D;  4P5O E;  4YBH B;  1YRU B;  1MHO A;  2HQ8 A;  2Y1M A;  2KAX A;  1AJ4 A;  1F4Q A;  2BBN A;  1QIW A;  1W7J B;  3QRX A;  2WC8 A;  2GV5 A;  3KPX A;  2GGM A;  3FIA A;  1IQ3 A;  5I8N A;  4PAL A;  1CM4 A;  2PRU A;  4N5X A;  3WNX B;  1OQP A;  4WRI A;  4MZJ A;  1SK6 D;  1X02 A;  3LLE A;  2BE4 A;  2F2P A;  1MWN A;  4CID A;  1CMF A;  2MJW B;  4ZCV A;  5CPV A;  1W7I B;  2JPT A;  1NP8 A;  3VRO A;  2M8U A;  2E30 A;  2EHB A;  1ALV A;  1REC A;  2QAC A;  1UUR A;  1WLM A;  1QJT A;  2LUC A;  1SL7 A;  4GPL B;  5I2O A;  1B47 A;  1S26 D;  5ER4 X;  4AOM A;  1IJ6 A;  1F55 A;  2L5X B;  4F0Z B;  2KQY A;  1QLS A;  4GBA A;  1A03 A;  1GGZ A;  2M49 B;  4MSP A;  2CTN A;  1SCV A;  2KI6 D;  1C07 A;  5CSI A;  1UUS A;  3K21 A;  1N2D A;  3NSO A;  3TDZ A;  2JOJ A;  2K2F A;  2BCA A;  3PFV A;  1J1D A;  4R1E A;  3FWC A;  2RGI A;  2NCP A;  1JF0 A;  2TN4 A;  1G8I A;  1CDN A;  1MUX A;  2L98 A;  4ORA B;  1YUT A;  1ALW A;  1S5G Z;  3I5I B;  2D8N A;  3SIB A;  3VRQ A;  1BF5 A;  3PN7 B;  2FJU B;  1KK8 C;  1MF8 B;  1F4O A;  4I5L B;  1NX1 A;  3KF9 A;  4QJ4 B;  5G08 A;  1NUB A;  4ORB B;  1WLZ A;  3EVR A;  1QAS A;  1BU3 A;  1M46 A;  1KQM B;  4HRE E;  1C7V A;  1KSM A;  3JTD B;  1EG3 A;  2MLF C;  1DJZ A;  1QVI Y;  5J3X A;  2BCX A;  1DJY A;  2LC5 A;  1LVC D;  3TUY B;  1FF1 A;  1DGV A;  1K9K A;  2K7D A;  1M31 A;  2NXQ A;  1AVS A;  2M3W A;  3PM8 A;  1M39 A;  1RJV A;  1LIN A;  1QTX A;  2HF5 A;  3I5F B;  2G2B A;  4MN0 A;  2MHH A;  4BY4 A;  4CFR A;  4MRX A;  4DIR A;  2M7N A;  4PHN A;  3JTD C;  1YUR A;  2AUC A;  2ZKM X;  1B8C A;  2K2A A;  1QIV A;  3TDI A;  5HYD A;  1YX7 A;  2KSP A;  1TNQ A;  1MQ1 A;  1QS7 A;  2CXJ A;  3BXK A;  5CSJ A;  2ZNE A;  1AUI B;  1B9A A;  5D7F A;  1PVA A;  5HLV A;  4ICB A;  5AAN A;  2H61 C;  3HCM A;  1OMR A;  2KHN A;  2M97 A;  3H4S E;  1ZAC A;  1H8B A;  1G33 A;  1TRF A;  3I5G B;  2JT0 A;  1UWO A;  2ZRS A;  2KBI A;  1CTR A;  1QX5 B;  2JC2 A;  1NSH A;  2MA2 A;  3AAK A;  1LA0 A;  3CGA A;  3PLF B;  2BKH B;  3PSR A;  2WND A;  2BEC A;  2JXL A;  2KBM A;  2OS8 C;  4M2O A;  4YRU A;  1K8U A;  2NCO A;  3F45 A;  2L4I A;  1CNP A;  2LAP A;  1WRZ A;  2ZN8 A;  1KK7 Z;  3EKH A;  3WXA A;  3GK2 A;  2ZN9 A;  1L2O B;  3SG2 A;  5JJG A;  2DOQ A;  3SG6 A;  1J7Q A;  2M0R A;  2VRG A;  4M2Q A;  2Q4U A;  2CBL A;  3LK0 A;  1QVI Z;  2F33 A;  2KFG A;  3EK7 A;  3FS7 A;  5DKR A;  3OX6 A;  2KYC A;  5IBW A;  4XJK A;  5HKZ A;  2KDH A;  4L9M A;  4MVF A;  1CM1 A;  1KSO A;  1CDL A;  3A8R A;  2ZRT A;  2LVV A;  3PAL A;  2JNX A;  1BOD A;  4GFT A;  2BL0 C;  2FOT A;  2HET A;  1ZOT B;  2R2I A;  1K9U A;  1KK7 Y;  3EK4 A;  4AQJ A;  3VRR A;  1YX8 A;  3CS1 A;  4GGN A;  4D1E A;  2H61 A;  1AHR A;  2LM5 A;  2Y5I A;  3DD4 A;  1OSA A;  2KNE A;  1S6C A;  2JTT A;  2LMV A;  2LP3 A;  4U8D A;  1PRW A;  4QJ3 B;  3PAT A;  1NCY A;  2JT3 A;  2IS9 A;  3BUW B;  3DVJ A;  4GGF A;  5AEQ A;  1DJI A;  3ZNI A;  4BY5 A;  2K8M B;  3IF7 A;  1S6I A;  2ZFD A;  4GGF C;  4ORC B;  4PE7 A;  1YUU A;  4I5J A;  2LCP A;  1F70 A;  1BJF A;  3D0Y A;  1XFZ O;  1RRO A;  1DJH A;  4I5N B;  1JSA A;  1CLL A;  2L4H A;  1BT6 A;  4PE0 A;  1DMO A;  2WCE A; 
#chains in the Genus database with same CATH topology
 5AXI A;  1SL8 A;  2ZND A;  1J7O A;  2JXC A;  5PAL A;  3BOW B;  3E3R A;  1DEL A;  3PM2 A;  4INX A;  2FCE A;  4CPV A;  5HLO A;  3NSL A;  1JUO A;  1B8R A;  2MRD A;  4WQ2 A;  2L5Y A;  3I5I C;  2Y4Q A;  3BOW A;  4OCI A;  1BOC A;  3KEV A;  2OTG C;  1KK8 B;  1XFU O;  3AAJ A;  1XO5 A;  4Q04 A;  2PAS A;  1B7T Z;  5DKQ A;  3AKB A;  1B8L A;  4TNC A;  2G9B A;  2I18 A;  1F71 A;  4ETO A;  1VRK A;  1NPQ A;  4PT1 A;  1A4P A;  4DUQ A;  1NX2 A;  1KQM C;  2KFH A;  2BBM A;  2LV7 A;  1TCF A;  5F6T A;  3PJI A;  4M2P A;  1L7Z A;  2KI4 C;  1R6P A;  1KFU S;  1Y1U A;  3CYZ A;  1SYM A;  3O6B A;  3QME A;  1CLM A;  3BUM B;  2OS8 B;  1HT9 A;  1SRA A;  4GAO A;  1GJY A;  2LE9 B;  1DJG A;  2OTG B;  2JU0 A;  1IJ5 A;  3JVT C;  3VRP A;  3NGV A;  1K96 A;  3I5H C;  4N1F A;  4XJK B;  2KAY A;  1JBA A;  3CR2 A;  4FQT A;  1GQM A;  4JQ0 D;  1Y6W A;  2F3Y A;  1Y1X A;  1L2O C;  1AJ5 A;  2ISD A;  3SIA A;  1IQ5 A;  1FBV A;  1S36 A;  1SR6 B;  3D10 A;  1CKK A;  1KFX S;  3M0W A;  2BNX A;  1J7P A;  3OB1 B;  1XK4 A;  1SNL A;  2WOR A;  3DF0 B;  1J55 A;  3CR5 X;  2L2E A;  1DT7 B;  2WCK A;  3CZ2 A;  1QAT A;  3EVV A;  5TNC A;  1C3Z A;  3KO0 A;  3CTN A;  2F3Z A;  3D77 A;  1OOJ A;  2LLU A;  3UNW A;  1B7T Y;  1N0Y A;  4DCK A;  3S0A A;  3CZ0 A;  2BCB A;  5FI6 A;  2JTZ A;  1IGV A;  3BYA A;  1ORG A;  1NCX A;  3I5G C;  1YUS A;  3B87 A;  1KFX L;  1SR6 C;  2BKI B;  2O5G A;  2JQ6 A;  4WQ3 A;  5ER5 A;  2KI6 C;  1H4B A;  4MBE A;  1K94 A;  3RLZ A;  1EL4 A;  2JWW A;  1J7R A;  3TS5 C;  4UPG A;  4OKH A;  1DF0 B;  1SW8 A;  3IQO A;  3LK1 A;  2PYQ A;  3RM1 A;  2LMT A;  3S0G A;  1Y0V H;  4PE1 A;  5K89 A;  1IH0 A;  4NDB A;  1QX2 A;  3EVU A;  2F2O A;  2K7B A;  4YI8 A;  1KWO C;  4JWQ A;  5KTY A;  3DF0 A;  1QV0 A;  2K60 A;  2L51 A;  1DJX A;  2K7O A;  3D0Y B;  2WCL A;  3D75 A;  2JZI A;  3TZ1 A;  3SG7 A;  1ZUZ A;  3D78 A;  1FI6 A;  2HQW A;  3TDU A;  5DKN A;  1V1G A;  4A4B A;  4CFQ A;  3EG5 B;  3CR4 X;  4IL1 A;  3KHE A;  4I5K A;  2LVK A;  1TCO B;  2EC6 B;  1Q80 A;  1YTZ C;  1OZO A;  4AQI A;  3AKA A;  4GUK A;  4GNK B;  5CSF A;  1UHJ A;  1K93 D;  2AAO A;  3N7H A;  3SG3 A;  4DRW A;  1SKT A;  1XVJ A;  1QX7 A;  4NQG A;  1DEK A;  1EH2 A;  2LHI A;  1RWY A;  2MBX A;  3DVE A;  1S6J A;  1BG1 A;  3DY9 A;  1YR5 A;  2M1U A;  3FE8 A;  1S3P A;  2OPO A;  1SMG A;  2LAN A;  1KCY A;  4N1G A;  1U5I A;  1A75 A;  2KYF A;  3ICB A;  4MLW A;  4PHK A;  1AK8 A;  1IKU A;  1UHI A;  2M7L A;  4CLN A;  2FCD A;  2K0J A;  1NX0 A;  1PAL A;  2KGR A;  1TN4 A;  2GTE A;  2L0P A;  3WHU B;  3O4X A;  5B8I B;  1XYD A;  1WRL A;  5FYX A;  3FE6 A;  1TOP A;  1EG4 A;  1KFU L;  3BUX B;  1EXR A;  4PHM A;  1JFJ A;  2QEV A;  1CMG A;  1SPY A;  1K2H A;  2I94 A;  1XK4 C;  3K1E A;  4YGC B;  5I2L A;  4FTG A;  1TNW A;  2CNP A;  1OZS A;  2L50 A;  2HPS A;  1B4C A;  1CB1 A;  2I2R E;  2QPT A;  3EKJ A;  2JUL A;  2H8V A;  2K7C A;  1DGU A;  1WY9 A;  4HSZ A;  3VRN A;  3BUN B;  2FJY A;  1MR8 A;  5I94 A;  4PE4 A;  4PDZ A;  1RFJ A;  4QJ5 B;  1CLB A;  2PVB A;  2LLS A;  1SCM B;  1S1E A;  1YVL A;  2L2C A;  3DVK A;  1Z2C B;  5HKY A;  1J1E A;  1DTL A;  1BLQ A;  3B88 A;  1CFD A;  4ZCU A;  2PMY A;  1PK0 D;  1U5I B;  4F7F A;  1FPW A;  1WDC B;  4PCW A;  5AER A;  1SBJ A;  2KI4 B;  1MXE A;  3O78 A;  3R1V A;  2I7A A;  1LKJ A;  3DXL A;  1K9P A;  1NCZ A;  1XFX O;  4PHJ A;  5D3O A;  1OMD A;  1Y1A A;  1CDM A;  2KAV A;  2LUX A;  1OMV A;  4NDD A;  1RK9 A;  1OE9 B;  3MSE B;  3JVT B;  3SJS A;  4JPZ B;  1DVI A;  1TUJ A;  2KGB C;  2WOS A;  1SCM C;  2LVJ A;  2LP2 A;  3GK1 A;  4OR9 B;  2CT9 A;  4C0K A;  1N65 A;  2KQ6 A;  1JC2 A;  3O2P A;  4MRY A;  3NHI A;  3R1P A;  3DVM A;  2NLN A;  2EGD A;  4HRH A;  1D1O A;  1QLK A;  5KU1 A;  3CWG A;  3GOF A;  5D69 A;  1V1F A;  1CDP A;  2P71 A;  5HKW A;  1UHN A;  2V53 A;  3S0B A;  2KFF A;  3IQQ A;  3SS5 A;  5I2Q A;  5HL1 A;  1TNX A;  1JWD A;  1TUZ A;  1XFW O;  1QXP A;  4USL A;  1NIW A;  4YI9 A;  2JNF A;  2K61 A;  3OHM B;  3C1V A;  4YGB B;  2SCP A;  2PSR A;  1RTP 1;  1SL9 A;  2QDI A;  2M29 A;  3NSI A;  3NSK A;  4NDC A;  4JD9 A;  1FI5 A;  1B1G A;  1CFC A;  1KQV A;  3OB2 B;  2H2K A;  2E6W A;  1JFK A;  4P2Y B;  1S5G Y;  3TS5 B;  3ZWH A;  3OBV A;  4YGA A;  2A4J A;  1MXL C;  1DQE A;  4IJ7 A;  4DS7 A;  3R1O A;  4OVN F;  2Y1N A;  1DJW A;  3S0E A;  3TUY C;  3BJH A;  2BL0 B;  1R2U A;  2COL B;  1PSR A;  2LLT A;  3CLN A;  1TNP A;  2MAZ A;  1IIO A;  1NYA A;  1G4Y R;  2ERB A;  4YGD B;  2JRF A;  1C7W A;  1ODB A;  1W9Z A;  1F8H A;  1KWO B;  2B1U A;  2WCF A;  1LA3 A;  2NZ0 A;  1DF0 A;  1UHK A;  1HQV A;  1IG5 A;  1F54 A;  3D76 A;  4YGE B;  3HX4 A;  2GGZ A;  3B7A A;  1NWD A;  3L4A A;  3VGO A;  3SG5 A;  1XFY O;  4E68 A;  4C0L A;  1JF2 A;  1UP5 A;  1PVB A;  3NXA A;  4FQO A;  2AMI A;  4MZK A;  4HRG A;  2WCJ A;  3LCP C;  2EC6 C;  3GK4 X;  1XA5 A;  1PUL A;  2LMU A;  1IRJ A;  3PN7 C;  1A2X A;  2KOT A;  4MZL A;  5AFP A;  3OP0 A;  1CFP A;  3CZT X;  1TTX A;  1BMO A;  3I5H B;  5EL2 A;  1CFF A;  3D74 A;  4OV2 A;  2JT8 A;  2MLE C;  2LNK A;  3BUO B;  3B6X A;  1A75 B;  2WCB A;  2LVI A;  2CCM A;  3O4Y A;  4XYN A;  2PAL A;  1ZMZ A;  2BE6 A;  1BR4 B;  3BQ3 A;  5GQQ C;  3WHT B;  1PSB A;  2P6B B;  3EK8 A;  5BPJ A;  2QEB A;  1M45 A;  1IWQ A;  3SG4 A;  1GGW A;  1WDC C;  5KSZ A;  2O60 A;  4C0J A;  1XFV O;  2M1K B;  1ZFS A;  2F8P A;  1QWV A;  5CSN A;  3OGN A;  3A4U B;  2BAP A;  3DZT A;  1BR1 B;  1NX3 A;  1WRK A;  3FWB A;  5JOL A;  4A4C A;  1A29 A;  1EJ3 A;  3LL8 B;  4OZD A;  2Q91 A;  1QV1 A;  3DYE A;  2SAS A;  1E8A A;  1SY9 A;  1M63 B;  2LHL A;  3I5F C;  1LXF C;  1AP4 A;  5DIC A;  1C3Y A;  3L4L A;  1UHH A;  1K95 A;  1TIZ A;  1FW4 A;  3OX5 A;  4MEW A;  1YRT B;  1YVH A;  2M9G A;  1K90 D;  4P5O E;  4YBH B;  1YRU B;  1OOG A;  1MHO A;  2HQ8 A;  2Y1M A;  2KAX A;  1AJ4 A;  1F4Q A;  3S0F A;  2BBN A;  3S0D A;  1QIW A;  1W7J B;  3QRX A;  2WC8 A;  2GV5 A;  3KPX A;  2GGM A;  3FE9 A;  3FIA A;  1OOI X;  5FI7 A;  1IQ3 A;  5I8N A;  4PAL A;  3SS4 A;  1CM4 A;  2PRU A;  4N5X A;  3WNX B;  1OQP A;  4WRI A;  4MZJ A;  1SK6 D;  3VB1 A;  1X02 A;  3LLE A;  2BE4 A;  2F2P A;  1MWN A;  4CID A;  3CZ1 A;  1CMF A;  1XFR A;  2MJW B;  4ZCV A;  5CPV A;  1W7I B;  2JPT A;  1NP8 A;  3VRO A;  3V2L A;  2M8U A;  2E30 A;  2EHB A;  1ALV A;  1REC A;  2QAC A;  3IVT A;  1UUR A;  1WLM A;  1QJT A;  2LUC A;  1SL7 A;  3BFA A;  4GPL B;  5I2O A;  1B47 A;  1S26 D;  5ER4 X;  4AOM A;  1IJ6 A;  1F55 A;  2L5X B;  4F0Z B;  2KQY A;  1QLS A;  4GBA A;  1A03 A;  1GGZ A;  2M49 B;  4MSP A;  2CTN A;  1SCV A;  2KI6 D;  1C07 A;  5CSI A;  1UUS A;  3K21 A;  1N2D A;  3NSO A;  5FI2 A;  2JOJ A;  3TDZ A;  2K2F A;  2BCA A;  3PFV A;  1J1D A;  4R1E A;  3FWC A;  2RGI A;  2NCP A;  1JF0 A;  2TN4 A;  1G8I A;  1CDN A;  1OOF A;  1MUX A;  2L98 A;  4ORA B;  1YUT A;  1ALW A;  2KLE A;  1S5G Z;  3I5I B;  2D8N A;  3SIB A;  3VRQ A;  1BF5 A;  3PN7 B;  2FJU B;  1Z4H A;  3CAB A;  1KK8 C;  1MF8 B;  3NHT A;  1F4O A;  1SSE B;  4I5L B;  1NX1 A;  3KF9 A;  4QJ4 B;  5G08 A;  1NUB A;  1P28 A;  1T14 A;  1WLZ A;  4ORB B;  3EVR A;  1QAS A;  1BU3 A;  1M46 A;  1OW4 A;  1KQM B;  4HRE E;  1C7V A;  1KSM A;  3JTD B;  1EG3 A;  2MLF C;  1DJZ A;  3D73 A;  1QVI Y;  5J3X A;  2BCX A;  3Q8I A;  1DJY A;  2LC5 A;  1LVC D;  3R72 A;  3TUY B;  1FF1 A;  1DGV A;  3BFB A;  1K9K A;  4INW A;  2K7D A;  1M31 A;  2NXQ A;  1AVS A;  2M3W A;  3PM8 A;  1GM0 A;  1M39 A;  1RJV A;  1LIN A;  1QTX A;  2HF5 A;  3I5F B;  2G2B A;  4MN0 A;  2MHH A;  4BY4 A;  4CFR A;  4MRX A;  4DIR A;  2WCM A;  2M7N A;  4PHN A;  3JTD C;  1YUR A;  4JKT A;  2AUC A;  2ZKM X;  1B8C A;  2K2A A;  1QIV A;  3TDI A;  5HYD A;  1YX7 A;  1OOH A;  2KSP A;  1TNQ A;  2QEH A;  1LS8 A;  1MQ1 A;  1QS7 A;  2CXJ A;  3BXK A;  5CSJ A;  2ZNE A;  1AUI B;  1B9A A;  5D7F A;  1PVA A;  5HLV A;  4ICB A;  5AAN A;  2H61 C;  3HCM A;  1OMR A;  2KHN A;  2M97 A;  3H4S E;  1ZAC A;  1H8B A;  1G33 A;  1TRF A;  3I5G B;  2JT0 A;  1UWO A;  2ZRS A;  2KBI A;  1CTR A;  1QX5 B;  2JC2 A;  1NSH A;  2MA2 A;  3AAK A;  1LA0 A;  3CGA A;  3PLF B;  2KPH A;  2BKH B;  3PSR A;  2WND A;  2BEC A;  2JXL A;  2P70 A;  2KBM A;  2OS8 C;  4M2O A;  4YRU A;  1K8U A;  2NCO A;  3F45 A;  2L4I A;  1CNP A;  2QEO A;  2YGU A;  2LAP A;  3CDN A;  2JPO A;  1WRZ A;  2ZN8 A;  3SS3 A;  1KK7 Z;  3EKH A;  3WXA A;  3GK2 A;  2ZN9 A;  1L2O B;  3SG2 A;  5JJG A;  2DOQ A;  3SG6 A;  1J7Q A;  2M0R A;  2VRG A;  4M2Q A;  3UO9 A;  2Q4U A;  2CBL A;  3LK0 A;  1QVI Z;  2F33 A;  2KFG A;  3EK7 A;  3FS7 A;  5DKR A;  3OX6 A;  2KYC A;  5IBW A;  3BFH A;  4XJK A;  5HKZ A;  2KDH A;  4L9M A;  4MVF A;  1CM1 A;  2KLD A;  1KSO A;  1CDL A;  3A8R A;  3B86 A;  2ZRT A;  2LVV A;  3PAL A;  2JNX A;  1BOD A;  4GFT A;  2BL0 C;  2FOT A;  2HET A;  1ZOT B;  2R2I A;  1TWO A;  1K9U A;  1KK7 Y;  3EK4 A;  4AQJ A;  3VRR A;  1YX8 A;  3CS1 A;  4GGN A;  4D1E A;  2H61 A;  1AHR A;  2LM5 A;  2Y5I A;  3DD4 A;  3RZS A;  1OSA A;  2KNE A;  2PQL A;  1S6C A;  2WC6 A;  2JTT A;  2LMV A;  1DC1 A;  2LP3 A;  4U8D A;  1PRW A;  4QJ3 B;  3PAT A;  1NCY A;  2JT3 A;  2IS9 A;  2WC5 A;  3BUW B;  3DVJ A;  4GGF A;  5AEQ A;  1DJI A;  3ZNI A;  4KYN A;  4BY5 A;  2K8M B;  3IF7 A;  3L47 A;  1S6I A;  2ZFD A;  4GGF C;  4ORC B;  4PE7 A;  1YUU A;  4I5J A;  2LCP A;  1F70 A;  1BJF A;  3D0Y A;  1XFZ O;  1RRO A;  1DJH A;  4I5N B;  1JSA A;  1CLL A;  2L4H A;  2WCH A;  1BT6 A;  4PE0 A;  1DMO A;  2WCE A; 
#chains in the Genus database with same CATH homology
 5AXI A;  1SL8 A;  2ZND A;  1J7O A;  2JXC A;  5PAL A;  3BOW B;  3E3R A;  2FCE A;  4CPV A;  5HLO A;  3NSL A;  1JUO A;  1B8R A;  2MRD A;  4WQ2 A;  3I5I C;  2Y4Q A;  3BOW A;  4OCI A;  1BOC A;  3KEV A;  2OTG C;  1KK8 B;  1XFU O;  3AAJ A;  1XO5 A;  4Q04 A;  2PAS A;  1B7T Z;  5DKQ A;  3AKB A;  1B8L A;  4TNC A;  2G9B A;  2I18 A;  1F71 A;  4ETO A;  1VRK A;  1NPQ A;  1A4P A;  4DUQ A;  1NX2 A;  1KQM C;  2KFH A;  2BBM A;  2LV7 A;  1TCF A;  5F6T A;  4M2P A;  1L7Z A;  2KI4 C;  1R6P A;  1KFU S;  1Y1U A;  3O6B A;  1SYM A;  1CLM A;  3BUM B;  2OS8 B;  1HT9 A;  1SRA A;  4GAO A;  1GJY A;  2LE9 B;  1DJG A;  2OTG B;  2JU0 A;  1IJ5 A;  3JVT C;  3VRP A;  1K96 A;  3I5H C;  4N1F A;  4XJK B;  2KAY A;  1JBA A;  3CR2 A;  1GQM A;  4JQ0 D;  1Y6W A;  2F3Y A;  1Y1X A;  1L2O C;  1AJ5 A;  2ISD A;  3SIA A;  1IQ5 A;  1FBV A;  1S36 A;  1SR6 B;  3D10 A;  1CKK A;  1KFX S;  3M0W A;  1J7P A;  3OB1 B;  1XK4 A;  1SNL A;  2WOR A;  3DF0 B;  1J55 A;  3CR5 X;  2L2E A;  1DT7 B;  1QAT A;  3EVV A;  5TNC A;  3KO0 A;  3CTN A;  2F3Z A;  1OOJ A;  2LLU A;  4DCK A;  1B7T Y;  1N0Y A;  2BCB A;  2JTZ A;  1IGV A;  3BYA A;  1NCX A;  3I5G C;  1YUS A;  1KFX L;  1SR6 C;  2BKI B;  2O5G A;  2JQ6 A;  4WQ3 A;  5ER5 A;  2KI6 C;  1H4B A;  4MBE A;  1K94 A;  3RLZ A;  1EL4 A;  2JWW A;  1J7R A;  3TS5 C;  4UPG A;  4OKH A;  1DF0 B;  1SW8 A;  3IQO A;  3LK1 A;  3RM1 A;  2LMT A;  5K89 A;  1Y0V H;  4PE1 A;  1IH0 A;  4NDB A;  1QX2 A;  3EVU A;  2F2O A;  2K7B A;  4YI8 A;  1KWO C;  4JWQ A;  5KTY A;  3DF0 A;  1QV0 A;  2L51 A;  1DJX A;  2K7O A;  3D0Y B;  3TZ1 A;  2JZI A;  3SG7 A;  1ZUZ A;  1FI6 A;  2HQW A;  3TDU A;  5DKN A;  1V1G A;  4A4B A;  4CFQ A;  3CR4 X;  4IL1 A;  3KHE A;  4I5K A;  2LVK A;  1TCO B;  2EC6 B;  1Q80 A;  1YTZ C;  1OZO A;  4AQI A;  3AKA A;  4GUK A;  4GNK B;  5CSF A;  1UHJ A;  1K93 D;  2AAO A;  3SG3 A;  4DRW A;  1SKT A;  1XVJ A;  1QX7 A;  4NQG A;  1EH2 A;  2LHI A;  1RWY A;  2MBX A;  3DVE A;  1S6J A;  1BG1 A;  1YR5 A;  2M1U A;  1S3P A;  2OPO A;  1SMG A;  2LAN A;  1KCY A;  4N1G A;  1U5I A;  1A75 A;  2KYF A;  3ICB A;  4MLW A;  4PHK A;  1AK8 A;  1IKU A;  1UHI A;  2M7L A;  4CLN A;  2FCD A;  2K0J A;  1NX0 A;  1PAL A;  2KGR A;  1TN4 A;  2L0P A;  3WHU B;  5B8I B;  1XYD A;  1WRL A;  5FYX A;  1TOP A;  1EG4 A;  1KFU L;  3BUX B;  1EXR A;  4PHM A;  1JFJ A;  1CMG A;  1SPY A;  1K2H A;  2I94 A;  1XK4 C;  4YGC B;  5I2L A;  4FTG A;  1TNW A;  2CNP A;  1OZS A;  2L50 A;  2HPS A;  1B4C A;  1CB1 A;  2I2R E;  2QPT A;  3EKJ A;  2JUL A;  2K7C A;  1DGU A;  1WY9 A;  4HSZ A;  3VRN A;  3BUN B;  1MR8 A;  4PE4 A;  4PDZ A;  1RFJ A;  4QJ5 B;  1CLB A;  2PVB A;  2LLS A;  1SCM B;  1S1E A;  1YVL A;  3DVK A;  5HKY A;  1BLQ A;  1J1E A;  1DTL A;  1CFD A;  4ZCU A;  2PMY A;  1PK0 D;  1U5I B;  1FPW A;  1WDC B;  4PCW A;  5AER A;  1SBJ A;  2KI4 B;  1MXE A;  3O78 A;  2I7A A;  1LKJ A;  1K9P A;  1NCZ A;  1XFX O;  4PHJ A;  1OMD A;  1Y1A A;  1CDM A;  2KAV A;  2LUX A;  1OMV A;  4NDD A;  1RK9 A;  1OE9 B;  3MSE B;  3JVT B;  3SJS A;  4JPZ B;  1DVI A;  2KGB C;  2WOS A;  1SCM C;  2LVJ A;  2LP2 A;  3GK1 A;  4OR9 B;  2CT9 A;  4C0K A;  1N65 A;  2KQ6 A;  1JC2 A;  3O2P A;  4MRY A;  3DVM A;  2NLN A;  2EGD A;  4HRH A;  1D1O A;  1QLK A;  5KU1 A;  3CWG A;  3GOF A;  5D69 A;  1V1F A;  1CDP A;  5HKW A;  1UHN A;  2V53 A;  5I2Q A;  2KFF A;  3IQQ A;  1TNX A;  1JWD A;  1XFW O;  1QXP A;  4USL A;  1NIW A;  4YI9 A;  2JNF A;  2K61 A;  3OHM B;  3C1V A;  4YGB B;  2SCP A;  2PSR A;  1RTP 1;  1SL9 A;  2M29 A;  3NSI A;  3NSK A;  4NDC A;  1FI5 A;  1B1G A;  1CFC A;  1KQV A;  3OB2 B;  2H2K A;  2E6W A;  1JFK A;  4P2Y B;  1S5G Y;  3TS5 B;  3ZWH A;  4YGA A;  2A4J A;  1MXL C;  4DS7 A;  4OVN F;  2Y1N A;  1DJW A;  3TUY C;  2BL0 B;  1R2U A;  2COL B;  1PSR A;  2LLT A;  3CLN A;  1TNP A;  2MAZ A;  1NYA A;  1G4Y R;  4YGD B;  2JRF A;  1C7W A;  1ODB A;  1F8H A;  1KWO B;  2B1U A;  2WCF A;  1LA3 A;  2NZ0 A;  1DF0 A;  1UHK A;  1HQV A;  1IG5 A;  1F54 A;  4YGE B;  3HX4 A;  2GGZ A;  1NWD A;  3VGO A;  3SG5 A;  1XFY O;  4E68 A;  4C0L A;  1JF2 A;  1UP5 A;  1PVB A;  3NXA A;  4FQO A;  2AMI A;  4MZK A;  4HRG A;  3LCP C;  2EC6 C;  3GK4 X;  1XA5 A;  1PUL A;  2LMU A;  1IRJ A;  3PN7 C;  1A2X A;  2KOT A;  4MZL A;  5AFP A;  3OP0 A;  1CFP A;  3CZT X;  1TTX A;  1BMO A;  3I5H B;  1CFF A;  4OV2 A;  2JT8 A;  2MLE C;  2LNK A;  3BUO B;  1A75 B;  2WCB A;  2LVI A;  2CCM A;  3O4Y A;  4XYN A;  2PAL A;  1ZMZ A;  2BE6 A;  1BR4 B;  3BQ3 A;  5GQQ C;  3WHT B;  1PSB A;  2P6B B;  3EK8 A;  5BPJ A;  3SG4 A;  1M45 A;  1IWQ A;  1GGW A;  1WDC C;  5KSZ A;  2O60 A;  4C0J A;  1XFV O;  2M1K B;  1ZFS A;  2F8P A;  5CSN A;  3A4U B;  1BR1 B;  1NX3 A;  1WRK A;  3FWB A;  5JOL A;  4A4C A;  1A29 A;  1EJ3 A;  3LL8 B;  2Q91 A;  1QV1 A;  2SAS A;  1E8A A;  1SY9 A;  1M63 B;  2LHL A;  3I5F C;  1LXF C;  1AP4 A;  1UHH A;  1K95 A;  1TIZ A;  1FW4 A;  3OX5 A;  4MEW A;  1YRT B;  1YVH A;  2M9G A;  1K90 D;  4P5O E;  4YBH B;  1YRU B;  1MHO A;  2HQ8 A;  2Y1M A;  2KAX A;  1AJ4 A;  1F4Q A;  2BBN A;  1QIW A;  1W7J B;  3QRX A;  2WC8 A;  2GV5 A;  3KPX A;  2GGM A;  3FIA A;  1IQ3 A;  5I8N A;  4PAL A;  1CM4 A;  2PRU A;  4N5X A;  3WNX B;  1OQP A;  4WRI A;  4MZJ A;  1SK6 D;  1X02 A;  3LLE A;  2BE4 A;  2F2P A;  1MWN A;  4CID A;  1CMF A;  2MJW B;  4ZCV A;  5CPV A;  1W7I B;  2JPT A;  1NP8 A;  3VRO A;  2M8U A;  2E30 A;  2EHB A;  1ALV A;  1REC A;  2QAC A;  1UUR A;  1WLM A;  1QJT A;  2LUC A;  1SL7 A;  4GPL B;  5I2O A;  1B47 A;  1S26 D;  5ER4 X;  4AOM A;  1IJ6 A;  1F55 A;  2L5X B;  4F0Z B;  2KQY A;  1QLS A;  4GBA A;  1A03 A;  1GGZ A;  2M49 B;  4MSP A;  2CTN A;  1SCV A;  2KI6 D;  1C07 A;  5CSI A;  1UUS A;  3K21 A;  1N2D A;  3NSO A;  3TDZ A;  2JOJ A;  2K2F A;  2BCA A;  3PFV A;  1J1D A;  4R1E A;  3FWC A;  2RGI A;  2NCP A;  1JF0 A;  2TN4 A;  1G8I A;  1CDN A;  1MUX A;  2L98 A;  4ORA B;  1YUT A;  1ALW A;  1S5G Z;  3I5I B;  2D8N A;  3SIB A;  3VRQ A;  1BF5 A;  3PN7 B;  2FJU B;  1KK8 C;  1MF8 B;  1F4O A;  4I5L B;  1NX1 A;  3KF9 A;  4QJ4 B;  5G08 A;  1NUB A;  4ORB B;  1WLZ A;  3EVR A;  1QAS A;  1BU3 A;  1M46 A;  1KQM B;  4HRE E;  1C7V A;  1KSM A;  3JTD B;  1EG3 A;  2MLF C;  1DJZ A;  1QVI Y;  5J3X A;  2BCX A;  1DJY A;  2LC5 A;  1LVC D;  3TUY B;  1FF1 A;  1DGV A;  1K9K A;  2K7D A;  1M31 A;  2NXQ A;  1AVS A;  2M3W A;  3PM8 A;  1M39 A;  1RJV A;  1LIN A;  1QTX A;  2HF5 A;  3I5F B;  2G2B A;  4MN0 A;  2MHH A;  4BY4 A;  4CFR A;  4MRX A;  4DIR A;  2M7N A;  4PHN A;  3JTD C;  1YUR A;  2AUC A;  2ZKM X;  1B8C A;  2K2A A;  1QIV A;  3TDI A;  5HYD A;  1YX7 A;  2KSP A;  1TNQ A;  1MQ1 A;  1QS7 A;  2CXJ A;  3BXK A;  5CSJ A;  2ZNE A;  1AUI B;  1B9A A;  5D7F A;  1PVA A;  5HLV A;  4ICB A;  5AAN A;  2H61 C;  3HCM A;  1OMR A;  2KHN A;  2M97 A;  3H4S E;  1ZAC A;  1H8B A;  1G33 A;  1TRF A;  3I5G B;  2JT0 A;  1UWO A;  2ZRS A;  2KBI A;  1CTR A;  1QX5 B;  2JC2 A;  1NSH A;  2MA2 A;  3AAK A;  1LA0 A;  3CGA A;  3PLF B;  2BKH B;  3PSR A;  2WND A;  2BEC A;  2JXL A;  2KBM A;  2OS8 C;  4M2O A;  4YRU A;  1K8U A;  2NCO A;  3F45 A;  2L4I A;  1CNP A;  2LAP A;  1WRZ A;  2ZN8 A;  1KK7 Z;  3EKH A;  3WXA A;  3GK2 A;  2ZN9 A;  1L2O B;  3SG2 A;  5JJG A;  2DOQ A;  3SG6 A;  1J7Q A;  2M0R A;  2VRG A;  4M2Q A;  2Q4U A;  2CBL A;  3LK0 A;  1QVI Z;  2F33 A;  2KFG A;  3EK7 A;  3FS7 A;  5DKR A;  3OX6 A;  2KYC A;  5IBW A;  4XJK A;  5HKZ A;  2KDH A;  4L9M A;  4MVF A;  1CM1 A;  1KSO A;  1CDL A;  3A8R A;  2ZRT A;  2LVV A;  3PAL A;  2JNX A;  1BOD A;  4GFT A;  2BL0 C;  2FOT A;  2HET A;  1ZOT B;  2R2I A;  1K9U A;  1KK7 Y;  3EK4 A;  4AQJ A;  3VRR A;  1YX8 A;  3CS1 A;  4GGN A;  4D1E A;  2H61 A;  1AHR A;  2LM5 A;  2Y5I A;  3DD4 A;  1OSA A;  2KNE A;  1S6C A;  2JTT A;  2LMV A;  2LP3 A;  4U8D A;  1PRW A;  4QJ3 B;  3PAT A;  1NCY A;  2JT3 A;  2IS9 A;  3BUW B;  3DVJ A;  4GGF A;  5AEQ A;  1DJI A;  3ZNI A;  4BY5 A;  2K8M B;  3IF7 A;  1S6I A;  2ZFD A;  4GGF C;  4ORC B;  4PE7 A;  1YUU A;  4I5J A;  2LCP A;  1F70 A;  1BJF A;  3D0Y A;  1XFZ O;  1RRO A;  1DJH A;  4I5N B;  1JSA A;  1CLL A;  2L4H A;  1BT6 A;  4PE0 A;  1DMO A;  2WCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...