1C07A

Structure of the third eps15 homology domain of human eps15
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
TWVVSPAEKAKYDEIFLKTDKDMDGFVSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKDQFALAFHLISQKLIKGIDPPHVLTPEMIPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (EPIDERMAL GROWTH FACTOR RECEPTOR PATHWAY SUBSTRATE
publication title Solution structure of Eps15's third EH domain reveals coincident Phe-Trp and Asn-Pro-Phe binding sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 1999-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1c07A00
2L2EA 1AJ4A 5HYDA 1LA0A 1XK4C 2NLNA 2I94A 2E6WA 4N1FA 2MAZA 5DKNA 3WHUB 4DRWA 3RLZA 1J7RA 1PRWA 2ZRSA 5HKZA 1CTRA 3NXAA 1TNWA 1S1EA 4PDZA 1NCZA 1H8BA 1R2UA 1QLKA 1YURA 2KI6D 2M49B 1KFUS 2ZKMX 1KSOA 5AEQA 3WXAA 3FWBA 1KQVA 3CWGA 2MJWB 2A4JA 3K21A 4CLNA 1DMOA 2ZN9A 1YX8A 3EK7A 2JULA 2K7CA 1KFXL 1BJFA 3MSEB 3I5HB 4MZJA 2ZFDA 1W7IB 4NDBA 2FCEA 1WLMA 2HQWA 4PE7A 1JSAA 5HKYA 1ZFSA 2CCMA 5KU1A 4ETOA 1PVAA 3SG4A 1EG3A 4UPGA 1CFDA 3F45A 1S26D 2F3YA 1BU3A 2JC2A 1RROA 2JOJA 5I2OA 1CLBA 4I5LB 2ISDA 2K7BA 4C0JA 1JUOA 2BKHB 1QTXA 1QV1A 2LP2A 2BBNA 3RM1A 4GBAA 1L2OB 2H2KA 2HQ8A 3JVTB 3SG6A 2M97A 1CNPA 2O60A 1QVIY 2MA2A 4HREE 3EKHA 1DGVA 1K9PA 1NIWA 3VGOA 1QVIZ 1Q80A 4A4CA 1KWOC 4YGCB 3D0YB 3SJSA 4C0KA 1LVCD 4PALA 1OSAA 5I2LA 1UWOA 5ER4X 4I5NB 2ZRTA 1Y1AA 4PHMA 2K0JA 1CFPA 1LXFC 5GQQC 4QJ3B 1MR8A 1HQVA 1XA5A 5G08A 1BR1B 2KI4B 2M3WA 1YTZC 4D1EA 1PSBA 2KAYA 4ORCB 1YRUB 1PALA 4YGEB 4IL1A 1MF8B 1K2HA 3DVMA 3O4YA 1A03A 5JJGA 1MXEA 1S6JA 2KFGA 3EVRA 1UHJA 4MSPA 1BT6A 2EC6C 2WOSA 1NWDA 2LLTA 1SY9A 2LM5A 4PE0A 1CDLA 5BPJA 2WCBA 3KEVA 4GNKB 5JOLA 1WDCC 2I18A 3KHEA 4YGDB 2G2BA 2WNDA 2M1KB 3PN7C 1DJZA 3EK8A 1ZOTB 1CMGA 3NSLA 4MN0A 1TRFA 2MLFC 1CMFA 2BCBA 2Q91A 2ZNEA 5PALA 1NP8A 2L0PA 2WORA 2KNEA 1SL7A 5K89A 3BYAA 3ZWHA 4E68A 1ODBA 3NSOA 1XFYO 1TIZA 3CZTX 3GK1A 2JT8A 3D0YA 1C7WA 1RJVA 4JPZB 1K9KA 1R6PA 4DIRA 4TNCA 2L4HA 4GAOA 1TNXA 2SASA 2MRDA 4OCIA 3VRQA 4AQJA 2PASA 1UUSA 1IJ5A 1SK6D 1E8AA 1M46A 1MXLC 2JNXA 1DJWA 2ZNDA 3CR2A 3ZNIA 1GGWA 3C1VA 4MRYA 4CPVA 1CDNA 1UHIA 3BUOB 1DJYA 3DVEA 5CPVA 3ICBA 1EG4A 1JF2A 4C0LA 5AANA 2LMVA 1PSRA 5F6TA 1LINA 1NX1A 1LKJA 3AAKA 5J3XA 1KK7Z 2EHBA 3LL8B 2BECA 1D1OA 2MHHA 2PMYA 1J7QA 1NYAA 4M2PA 4NDCA 1BF5A 2ZN8A 4FTGA 2KBMA 1IH0A 2JTTA 1SR6B 2LUXA 2AAOA 2HPSA 1CFCA 1F55A 1IJ6A 1QX2A 2PALA 2KYFA 1OZOA 1JF0A 3IF7A 3TUYB 3TS5B 1A75B 5CSFA 1GQMA 1FI6A 1S6CA 1TCOB 2BE6A 4MZLA 1EJ3A 1MUXA 2F3ZA 1L2OC 3VROA 3DD4A 4NDDA 4GPLB 3GK4X 1JWDA 3TZ1A 1G33A 1CDMA 2WC8A 2HF5A 5CSJA 4F0ZB 5AFPA 2JPTA 3PLFB 3OB2B 3IQOA 3CR5X 1CM4A 1YVHA 3CS1A 1JFJA 3I5GC 2G9BA 4CFQA 4AQIA 5KSZA 2K2AA 3M0WA 2L50A 3FWCA 1N65A 1NX0A 1UHKA 1Y1UA 5HKWA 3O6BA 3VRPA 4XJKA 1QV0A 1F54A 1SCMC 2COLB 1DJXA 1IG5A 2JT3A 2VRGA 3PATA 1BLQA 3H4SE 1K94A 1J7PA 1XFZO 4BY5A 4NQGA 1OMDA 1GGZA 1BODA 1DGUA 1S36A 2V53A 1SL8A 2BKIB 2M29A 1B47A 2F2PA 1YX7A 1QXPA 2HETA 4DS7A 4P2YB 1SL9A 1J55A 1K9UA 1KSMA 1W7JB 2LP3A 2LE9B 3OX5A 2JT0A 4DUQA 1ZACA 1L7ZA 2KHNA 3D10A 4MEWA 1G4YR 1HT9A 1A75A 1EL4A 1QX7A 2LMTA 1FW4A 2NCPA 2RGIA 1XFUO 4MZKA 1F70A 1KFUL 2LC5A 3FIAA 1K93D 4CFRA 1RFJA 3DVKA 2F33A 1FPWA 1V1GA 3PSRA 5D7FA 1B8LA 1SCVA 2K61A 5FYXA 5IBWA 2GGZA 1QATA 1KCYA 5CSNA 3I5FB 2LMUA 3I5IC 4ICBA 2JU0A 4YBHB 3BUMB 2M0RA 1SYMA 1WRKA 1XVJA 2H61A 2O5GA 5HLOA 1RWYA 2BL0C 2TN4A 1CB1A 2BCAA 2E30A 1B4CA 4PE4A 2PSRA 2KFFA 1IRJA 4PHNA 1OE9B 1QJTA 1F4OA 1IGVA 2LVJA 2JNFA 2PRUA 4PCWA 1VRKA 4ORBB 5CSIA 1KK8C 2WCFA 2LNKA 1Y0VH 1IQ3A 1MWNA 1NPQA 1SRAA 5I8NA 1WLZA 3VRNA 1C7VA 1B7TY 2KBIA 3BOWB 1B7TZ 4GGFA 1NSHA 2LVVA 1QS7A 4YI8A 2QPTA 4MBEA 1QASA 1XYDA 3PALA 2D8NA 4M2OA 3LLEA 5KTYA 1AVSA 1Y1XA 2JXCA 3TS5C 3BQ3A 1AK8A 1K96A 1BMOA 4L9MA 2LCPA 2LHIA 3KF9A 3SG3A 2M8UA 4GGNA 1BG1A 4MLWA 1F8HA 2WCEA 1ZUZA 5D69A 2KGBC 1TOPA 3DF0B 2BCXA 1CKKA 1NX2A 1QLSA 1JBAA 1KWOB 2L5XB 1M63B 3BUXB 1TN4A 1IQ5A 3E3RA 2H61C 3I5HC 4I5KA 3WHTB 1OMRA 1ZMZA 1KK7Y 2JXLA 2Y5IA 1DJGA 1SBJA 4YGAA 3SG5A 3TDZA 4HSZA 1CLMA 3CTNA 5DKQA 1NUBA 1B1GA 2B1UA 1M31A 3BOWA 4OV2A 2KGRA 1SKTA 2JZIA 2FOTA 5AXIA 2M7LA 1KFXS 3QRXA 2BE4A 2JWWA 2CTNA 1TTXA 2LHLA 5B8IB 2NCOA 2LLUA 4N1GA 1J1DA 4ORAB 2LANA 1S5GY 1YUSA 2OPOA 2LVIA 2Y1MA 4GGFC 3JTDB 3JVTC 1S5GZ 1YUTA 1PK0D 2F2OA 1J1EA 1NX3A 1DVIA 2K8MB 1AJ5A 2OTGB 4R1EA 1DJHA 1RK9A 3DF0A 3KO0A 5DKRA 1SMGA 2JQ6A 3BUWB 3FS7A 1IKUA 3I5FC 1XFWO 2OS8B 3LK1A 3CGAA 1S3PA 1B9AA 4USLA 4OKHA 2KI6C 2I7AA 4I5JA 2CBLA 1UHNA 1TNQA 2KI4C 2JTZA 3GOFA 1DF0B 1DTLA 1AHRA 4JQ0D 1B8RA 1G8IA 1RTP1 3O2PA 4MVFA 4OVNF 4WQ3A 2FCDA 4BY4A 1ALVA 3TDUA 1TCFA 1PVBA 3EKJA 1KQMB 2QACA 4GFTA 1OZSA 1H4BA 1AUIB 2KDHA 2KAVA 5ER5A 2K2FA 1A4PA 1WRLA 2K7OA 2DOQA 1U5IB 3HCMA 1K8UA 3EVVA 3SIBA 1A2XA 2K7DA 4Q04A 1QX5B 1WRZA 2FJUB 2NZ0A 1YVLA 1M45A 3OX6A 2LV7A 4CIDA 1JFKA 1FBVA 1J7OA 4QJ5B 1PULA 4YGBB 2KQ6A 1N0YA 2I2RE 4HRHA 2MBXA 1A29A 3EVUA 1OQPA 3PFVA 4XYNA 1DT7B 2L4IA 4AOMA 4A4BA 1WY9A 3BUNB 5AERA 2Y4QA 1M39A 1YRTB 3AKBA 3AKAA 1NCYA 3SG7A 3WNXB 4QJ4B 1QIVA 2JRFA 1UP5A 3LK0A 2GGMA 3I5GB 1DF0A 3OP0A 2P6BB 2MLEC 1MHOA 4FQOA 3OHMB 3TDIA 5I2QA 1SCMB 1BR4B 4ZCUA 1CFFA 1K90D 1LA3A 4GUKA 2KQYA 3BXKA 3CLNA 3NSIA 3NSKA 1V1FA 3EK4A 1SR6C 1U5IA 1NCXA 2M7NA 2R2IA 1AP4A 3KPXA 3SIAA 1UHHA 3IQQA 1B8CA 3TUYC 4YRUA 1XK4A 1X02A 1BOCA 4N5XA 2KFHA 1EXRA 1DJIA 1CM1A 1N2DA 1EH2A 1RECA 2LAPA 2KYCA 3JTDC 4HRGA 4JWQA 1OOJA 1S6IA 2M1UA 2BBMA 2LLSA 3GK2A 3O78A 4PHJA 4OR9B 3PM8A 2OTGC 4MRXA 1FI5A 4PHKA 1UURA 4ZCVA 1CLLA 1XFXO 3OB1B 1FF1A 2OS8C 2LUCA 3I5IB 2F8PA 3VRRA 2AMIA 2L51A 2NXQA 2LVKA 2Y1NA 2CT9A 4WRIA 4YI9A 4WQ2A 3AAJA 2BL0B 1JC2A 1GJYA 2SCPA 3A4UB 3HX4A 4M2QA 1Y6WA 2L98A 3LCPC 2IS9A 4PE1A 1XFVO 5HLVA 2EGDA 3DVJA 1F4QA 1SNLA 1YR5A 2KAXA 4P5OE 2KSPA 1OMVA 1ALWA 1MQ1A 1SPYA 2CXJA 4XJKB 2EC6B 1KQMC 4U8DA 1CDPA 1QIWA 1SW8A 2AUCA 2PVBA 2Q4UA 1K95A 1KK8B 1TNPA 1C07A 2CNPA 5TNCA 1F71A 3CR4X 1IWQA 2GV5A 1WDCB 1YUUA 2M9GA 3A8RA 3SG2A 3PN7B 2KOTA 1XO5A 4DCKA
chains in the Genus database with same CATH superfamily
2JPOA 2L2EA 1AJ4A 5HYDA 1LA0A 3D78A 1XK4C 2NLNA 2I94A 2E6WA 4PT1A 4N1FA 2MAZA 5DKNA 2KLEA 3WHUB 4DRWA 5DICA 3RLZA 1J7RA 1OOFA 1PRWA 2ZRSA 1CTRA 3NXAA 5HKZA 2GTEA 1TNWA 1S1EA 4PDZA 1NCZA 1H8BA 1R2UA 1QLKA 1YURA 2KI6D 2M49B 1KFUS 2ZKMX 1KSOA 5AEQA 3WXAA 3FWBA 4OZDA 1KQVA 3CWGA 2MJWB 2A4JA 3K21A 4CLNA 1DMOA 2ZN9A 1YX8A 2QDIA 3EK7A 2JULA 2K7CA 1KFXL 1BJFA 3MSEB 3I5HB 4MZJA 2ZFDA 1W7IB 4NDBA 4JD9A 2FCEA 1WLMA 2HQWA 3K1EA 4PE7A 1JSAA 5HKYA 1ZFSA 2CCMA 3EG5B 5KU1A 3UO9A 4ETOA 1PVAA 3SG4A 3CZ2A 1EG3A 4UPGA 1CFDA 1OOGA 3F45A 1S26D 2F3YA 3CDNA 1BU3A 2JC2A 1RROA 2JOJA 5I2OA 1CLBA 4I5LB 2ISDA 2K7BA 4C0JA 1JUOA 2BKHB 1QTXA 1QV1A 2LP2A 2BBNA 3RM1A 4GBAA 1L2OB 2H2KA 2HQ8A 3JVTB 3SG6A 2M97A 5FI7A 2O60A 1QVIY 4F7FA 2MA2A 4HREE 1CNPA 3EKHA 3CYZA 1DGVA 1K9PA 1NIWA 3VGOA 1QVIZ 1Q80A 4A4CA 1KWOC 4YGCB 3D0YB 3SS4A 3SJSA 4C0KA 1LVCD 4PALA 1OSAA 5I2LA 3V2LA 1UWOA 3S0EA 5ER4X 4I5NB 2ZRTA 1Y1AA 4PHMA 2K0JA 1CFPA 1LXFC 5GQQC 4QJ3B 1MR8A 1HQVA 1XA5A 5G08A 1BR1B 2KI4B 2M3WA 1YTZC 4D1EA 1PSBA 2KAYA 4ORCB 1YRUB 1SSEB 1PALA 4YGEB 4IL1A 1MF8B 1K2HA 3DVMA 3O4YA 1A03A 5JJGA 1MXEA 1S6JA 2KFGA 3EVRA 1UHJA 4MSPA 1BT6A 2EC6C 3DXLA 2QEVA 3NHIA 2WOSA 1NWDA 2LLTA 1SY9A 2LM5A 4PE0A 1CDLA 5BPJA 2WCBA 3KEVA 4GNKB 5JOLA 1WDCC 2I18A 3KHEA 4YGDB 2G2BA 2WNDA 2M1KB 3PN7C 1DJZA 3EK8A 1ZOTB 1CMGA 3NSLA 4MN0A 1TRFA 2MLFC 1CMFA 2BCBA 2Q91A 2ZNEA 5PALA 1NP8A 1JFJA 2L0PA 2WORA 2KNEA 3DY9A 1SL7A 3R1OA 5K89A 2BAPA 3BYAA 3ZWHA 1ODBA 3NSOA 4E68A 1XFYO 1TIZA 3CZTX 3GK1A 2JT8A 3D0YA 1C7WA 3PJIA 1RJVA 4JPZB 1K9KA 1R6PA 4DIRA 4TNCA 2L4HA 4GAOA 1TNXA 3N7HA 2SASA 3CABA 2MRDA 4OCIA 3VRQA 4AQJA 2PASA 1UUSA 1OW4A 1IJ5A 1SK6D 1E8AA 1M46A 1MXLC 2JNXA 1DJWA 2ZNDA 3CR2A 3D75A 3ZNIA 1GGWA 3C1VA 2WCHA 4MRYA 4CPVA 1T14A 1CDNA 1UHIA 3BUOB 2PQLA 1DJYA 3BFBA 2ERBA 3DVEA 5CPVA 3ICBA 1EG4A 1JF2A 4C0LA 5AANA 2LMVA 1PSRA 5F6TA 1LINA 1GM0A 1NX1A 1LKJA 3AAKA 5FI2A 5J3XA 1KK7Z 2EHBA 3LL8B 2BECA 1D1OA 2MHHA 2PMYA 1J7QA 1NYAA 4M2PA 4NDCA 1BF5A 2ZN8A 4FTGA 2KBMA 2QEHA 1IH0A 2JTTA 1SR6B 2LUXA 2AAOA 2HPSA 1CFCA 1F55A 1IJ6A 1QX2A 2PALA 1DC1A 2KYFA 1OZOA 1JF0A 2WC6A 3IF7A 3TS5B 3TUYB 3B87A 1A75B 5CSFA 1GQMA 1FI6A 1S6CA 3DYEA 1TCOB 2BE6A 4MZLA 3B7AA 1EJ3A 1MUXA 2F3ZA 1L2OC 3FE9A 3VROA 3DD4A 4NDDA 3NGVA 4GPLB 3GK4X 1JWDA 3TZ1A 1G33A 1CDMA 2WC8A 2HF5A 5CSJA 4F0ZB 3CZ0A 5AFPA 2L5YA 2JPTA 3PLFB 3OB2B 3CZ1A 3IQOA 2KLDA 1CM4A 1YVHA 3CS1A 3CR5X 3I5GC 2G9BA 3Q8IA 4AQIA 4CFQA 2WC5A 5KSZA 2K2AA 3M0WA 2L50A 3FWCA 1N65A 1DEKA 1NX0A 1UHKA 1Y1UA 3B6XA 5HKWA 3O6BA 3VRPA 4XJKA 1QV0A 1F54A 1SCMC 1DJXA 1IG5A 2COLB 2JT3A 2VRGA 3PATA 1BLQA 3H4SE 1K94A 1J7PA 1XFZO 4BY5A 4NQGA 1OMDA 1GGZA 3R72A 1BODA 1DGUA 1S36A 5EL2A 2V53A 1SL8A 2BKIB 2M29A 1B47A 2F2PA 1YX7A 1QXPA 2HETA 4DS7A 4P2YB 1SL9A 1J55A 5D3OA 2WCJA 1K9UA 1OOHA 1KSMA 1W7JB 2LP3A 2LE9B 3OX5A 2JT0A 4DUQA 1ZACA 1L7ZA 2KHNA 3D10A 4MEWA 1G4YR 1HT9A 1A75A 1EL4A 1QX7A 2LMTA 1FW4A 2NCPA 2RGIA 1XFUO 3D76A 4MZKA 1F70A 1KFUL 2LC5A 1C3YA 3FIAA 1K93D 1DQEA 4CFRA 1RFJA 3DVKA 2F33A 1FPWA 1V1GA 3PSRA 4INXA 5D7FA 1B8LA 1SCVA 2K61A 5FYXA 5IBWA 1C3ZA 2GGZA 1QATA 1KCYA 5CSNA 3I5FB 2LMUA 3I5IC 4ICBA 2JU0A 4YBHB 3BUMB 1Z4HA 1SYMA 1WRKA 1XVJA 2H61A 2M0RA 2O5GA 1RWYA 3L4LA 5HLOA 2BL0C 2TN4A 1CB1A 2BCAA 2E30A 1B4CA 5I94A 4PE4A 2PSRA 3O4XA 3BFHA 2KFFA 1IRJA 4PHNA 1OE9B 1QJTA 1F4OA 1IGVA 2LVJA 2JNFA 2PRUA 4PCWA 1TUJA 4IJ7A 1VRKA 4ORBB 5CSIA 1KK8C 2WCFA 2LNKA 1Y0VH 1IQ3A 1MWNA 2QEBA 1IIOA 1NPQA 1SRAA 5I8NA 1WLZA 2KPHA 3VRNA 1C7VA 1B7TY 2H8VA 3QMEA 2WCMA 2KBIA 2YGUA 3BOWB 1B7TZ 4GGFA 1NSHA 2LVVA 1QS7A 4YI8A 2QPTA 1XFRA 1QASA 1XYDA 3PALA 2D8NA 4MBEA 4M2OA 3LLEA 5KTYA 1AVSA 1Y1XA 2JXCA 3TS5C 3BQ3A 1AK8A 1K96A 1BMOA 4L9MA 2LCPA 2LHIA 3KF9A 3SG3A 2M8UA 2L2CA 4GGNA 1BG1A 4MLWA 1F8HA 2WCEA 1ZUZA 5D69A 2KGBC 1TOPA 3DF0B 2BCXA 1CKKA 1NX2A 1QLSA 3D77A 1JBAA 1KWOB 3IVTA 2L5XB 1M63B 3BUXB 1TN4A 1IQ5A 1W9ZA 3E3RA 4JKTA 2H61C 3I5HC 4I5KA 3WHTB 1OMRA 3DZTA 1ZMZA 3B86A 1KK7Y 2JXLA 2Y5IA 3L47A 1DJGA 1SBJA 4YGAA 3SG5A 3TDZA 4HSZA 1CLMA 3CTNA 3S0BA 2WCKA 5DKQA 1NUBA 1B1GA 2B1UA 1M31A 3BOWA 4OV2A 3OBVA 2KGRA 1SKTA 2JZIA 3D74A 2FOTA 5AXIA 2M7LA 1KFXS 3QRXA 2BE4A 2JWWA 2CTNA 1TTXA 2LHLA 5B8IB 2NCOA 2LLUA 4N1GA 1J1DA 4ORAB 5FI6A 2LANA 1S5GY 1YUSA 2OPOA 2LVIA 2Y1MA 4GGFC 3FE6A 3JTDB 3JVTC 1S5GZ 1YUTA 1PK0D 2F2OA 1J1EA 1NX3A 1DVIA 2K8MB 1AJ5A 2OTGB 4R1EA 1DJHA 1RK9A 1P28A 3DF0A 3KO0A 5DKRA 1SMGA 2JQ6A 3BUWB 1ORGA 3FS7A 3R1VA 1LS8A 1IKUA 3I5FC 1XFWO 2OS8B 3LK1A 1OOIX 1S3PA 3CGAA 3S0DA 1B9AA 4USLA 4OKHA 2KI6C 2I7AA 4I5JA 2CBLA 1UHNA 1TNQA 2KI4C 2JTZA 3GOFA 1Z2CB 1DF0B 1DTLA 1AHRA 2QEOA 4JQ0D 1B8RA 1G8IA 1RTP1 3O2PA 4MVFA 4OVNF 4WQ3A 2FCDA 4BY4A 1ALVA 2P71A 3TDUA 1TCFA 1PVBA 3EKJA 3NHTA 1KQMB 2QACA 4GFTA 2BNXA 1OZSA 1H4BA 1AUIB 2KDHA 2KAVA 5ER5A 2K2FA 1A4PA 1WRLA 3BJHA 2K7OA 2DOQA 1U5IB 4INWA 3HCMA 3RZSA 4KYNA 1K8UA 3EVVA 3SIBA 1A2XA 2K7DA 2P70A 4Q04A 1QX5B 1WRZA 2FJUB 2NZ0A 3PM2A 1YVLA 1M45A 3OX6A 2LV7A 4CIDA 1JFKA 5HL1A 1FBVA 1J7OA 4QJ5B 1PULA 3SS3A 1QWVA 3R1PA 4YGBB 3D73A 2KQ6A 1N0YA 2I2RE 4HRHA 2MBXA 1A29A 3EVUA 1OQPA 3PFVA 4XYNA 1DT7B 2L4IA 4AOMA 4FQTA 4A4BA 1WY9A 3BUNB 5AERA 2Y4QA 1M39A 1YRTB 2FJYA 3AKBA 3AKAA 1NCYA 3SG7A 3WNXB 4QJ4B 1QIVA 2JRFA 1UP5A 3LK0A 2GGMA 3I5GB 1DF0A 3SS5A 3OP0A 2P6BB 2MLEC 1MHOA 4FQOA 3OHMB 3TDIA 5I2QA 1SCMB 1BR4B 1DELA 4ZCUA 1CFFA 1K90D 3VB1A 1LA3A 4GUKA 3S0AA 2PYQA 2KQYA 3BXKA 3CLNA 3NSIA 3NSKA 1V1FA 3EK4A 1SR6C 1U5IA 1NCXA 2M7NA 2R2IA 3S0GA 3KPXA 3SIAA 1AP4A 1UHHA 3IQQA 1B8CA 3TUYC 4YRUA 1XK4A 1X02A 1BOCA 3B88A 4N5XA 2KFHA 1EXRA 1DJIA 1CM1A 1N2DA 1EH2A 1RECA 2LAPA 2KYCA 3JTDC 4HRGA 4JWQA 1OOJA 3OGNA 1S6IA 2M1UA 2BBMA 2LLSA 3GK2A 3O78A 4PHJA 4OR9B 3FE8A 3PM8A 2OTGC 3UNWA 4MRXA 1FI5A 4PHKA 1UURA 4ZCVA 1CLLA 1XFXO 3OB1B 1FF1A 2OS8C 2LUCA 3I5IB 2F8PA 3VRRA 2AMIA 1TUZA 2L51A 2NXQA 2LVKA 2Y1NA 2CT9A 4WRIA 4YI9A 4WQ2A 2K60A 1TWOA 2BL0B 3AAJA 3BFAA 1GJYA 1JC2A 2SCPA 3A4UB 3HX4A 4M2QA 1Y6WA 2L98A 3LCPC 2IS9A 3L4AA 4PE1A 3S0FA 1XFVO 5HLVA 2EGDA 3DVJA 1F4QA 1SNLA 1YR5A 2KAXA 4P5OE 2KSPA 1OMVA 1ALWA 1MQ1A 1SPYA 2CXJA 4XJKB 2EC6B 1KQMC 4U8DA 1CDPA 1QIWA 1SW8A 2AUCA 2PVBA 2Q4UA 1K95A 1KK8B 1TNPA 1C07A 2CNPA 5TNCA 1F71A 3CR4X 1IWQA 2GV5A 1WDCB 1YUUA 2M9GA 3A8RA 3SG2A 3PN7B 2WCLA 2KOTA 1XO5A 4DCKA
chains in the Genus database with same CATH topology
2L2EA 1AJ4A 5HYDA 1LA0A 1XK4C 2NLNA 2I94A 2E6WA 4N1FA 2MAZA 5DKNA 3WHUB 4DRWA 3RLZA 1J7RA 1PRWA 2ZRSA 5HKZA 1CTRA 3NXAA 1TNWA 1S1EA 4PDZA 1NCZA 1H8BA 1R2UA 1QLKA 1YURA 2KI6D 2M49B 1KFUS 2ZKMX 1KSOA 5AEQA 3WXAA 3FWBA 1KQVA 3CWGA 2MJWB 2A4JA 3K21A 4CLNA 1DMOA 2ZN9A 1YX8A 3EK7A 2JULA 2K7CA 1KFXL 1BJFA 3MSEB 3I5HB 4MZJA 2ZFDA 1W7IB 4NDBA 2FCEA 1WLMA 2HQWA 4PE7A 1JSAA 5HKYA 1ZFSA 2CCMA 5KU1A 4ETOA 1PVAA 3SG4A 1EG3A 4UPGA 1CFDA 3F45A 1S26D 2F3YA 1BU3A 2JC2A 1RROA 2JOJA 5I2OA 1CLBA 4I5LB 2ISDA 2K7BA 4C0JA 1JUOA 2BKHB 1QTXA 1QV1A 2LP2A 2BBNA 3RM1A 4GBAA 1L2OB 2H2KA 2HQ8A 3JVTB 3SG6A 2M97A 1CNPA 2O60A 1QVIY 2MA2A 4HREE 3EKHA 1DGVA 1K9PA 1NIWA 3VGOA 1QVIZ 1Q80A 4A4CA 1KWOC 4YGCB 3D0YB 3SJSA 4C0KA 1LVCD 4PALA 1OSAA 5I2LA 1UWOA 5ER4X 4I5NB 2ZRTA 1Y1AA 4PHMA 2K0JA 1CFPA 1LXFC 5GQQC 4QJ3B 1MR8A 1HQVA 1XA5A 5G08A 1BR1B 2KI4B 2M3WA 1YTZC 4D1EA 1PSBA 2KAYA 4ORCB 1YRUB 1PALA 4YGEB 4IL1A 1MF8B 1K2HA 3DVMA 3O4YA 1A03A 5JJGA 1MXEA 1S6JA 2KFGA 3EVRA 1UHJA 4MSPA 1BT6A 2EC6C 2WOSA 1NWDA 2LLTA 1SY9A 2LM5A 4PE0A 1CDLA 5BPJA 2WCBA 3KEVA 4GNKB 5JOLA 1WDCC 2I18A 3KHEA 4YGDB 2G2BA 2WNDA 2M1KB 3PN7C 1DJZA 3EK8A 1ZOTB 1CMGA 3NSLA 4MN0A 1TRFA 2MLFC 1CMFA 2BCBA 2Q91A 2ZNEA 5PALA 1NP8A 2L0PA 2WORA 2KNEA 1SL7A 5K89A 3BYAA 3ZWHA 4E68A 1ODBA 3NSOA 1XFYO 1TIZA 3CZTX 3GK1A 2JT8A 3D0YA 1C7WA 1RJVA 4JPZB 1K9KA 1R6PA 4DIRA 4TNCA 2L4HA 4GAOA 1TNXA 2SASA 2MRDA 4OCIA 3VRQA 4AQJA 2PASA 1UUSA 1IJ5A 1SK6D 1E8AA 1M46A 1MXLC 2JNXA 1DJWA 2ZNDA 3CR2A 3ZNIA 1GGWA 3C1VA 4MRYA 4CPVA 1CDNA 1UHIA 3BUOB 1DJYA 3DVEA 5CPVA 3ICBA 1EG4A 1JF2A 4C0LA 5AANA 2LMVA 1PSRA 5F6TA 1LINA 1NX1A 1LKJA 3AAKA 5J3XA 1KK7Z 2EHBA 3LL8B 2BECA 1D1OA 2MHHA 2PMYA 1J7QA 1NYAA 4M2PA 4NDCA 1BF5A 2ZN8A 4FTGA 2KBMA 1IH0A 2JTTA 1SR6B 2LUXA 2AAOA 2HPSA 1CFCA 1F55A 1IJ6A 1QX2A 2PALA 2KYFA 1OZOA 1JF0A 3IF7A 3TUYB 3TS5B 1A75B 5CSFA 1GQMA 1FI6A 1S6CA 1TCOB 2BE6A 4MZLA 1EJ3A 1MUXA 2F3ZA 1L2OC 3VROA 3DD4A 4NDDA 4GPLB 3GK4X 1JWDA 3TZ1A 1G33A 1CDMA 2WC8A 2HF5A 5CSJA 4F0ZB 5AFPA 2JPTA 3PLFB 3OB2B 3IQOA 3CR5X 1CM4A 1YVHA 3CS1A 1JFJA 3I5GC 2G9BA 4CFQA 4AQIA 5KSZA 2K2AA 3M0WA 2L50A 3FWCA 1N65A 1NX0A 1UHKA 1Y1UA 5HKWA 3O6BA 3VRPA 4XJKA 1QV0A 1F54A 1SCMC 2COLB 1DJXA 1IG5A 2JT3A 2VRGA 3PATA 1BLQA 3H4SE 1K94A 1J7PA 1XFZO 4BY5A 4NQGA 1OMDA 1GGZA 1BODA 1DGUA 1S36A 2V53A 1SL8A 2BKIB 2M29A 1B47A 2F2PA 1YX7A 1QXPA 2HETA 4DS7A 4P2YB 1SL9A 1J55A 1K9UA 1KSMA 1W7JB 2LP3A 2LE9B 3OX5A 2JT0A 4DUQA 1ZACA 1L7ZA 2KHNA 3D10A 4MEWA 1G4YR 1HT9A 1A75A 1EL4A 1QX7A 2LMTA 1FW4A 2NCPA 2RGIA 1XFUO 4MZKA 1F70A 1KFUL 2LC5A 3FIAA 1K93D 4CFRA 1RFJA 3DVKA 2F33A 1FPWA 1V1GA 3PSRA 5D7FA 1B8LA 1SCVA 2K61A 5FYXA 5IBWA 2GGZA 1QATA 1KCYA 5CSNA 3I5FB 2LMUA 3I5IC 4ICBA 2JU0A 4YBHB 3BUMB 2M0RA 1SYMA 1WRKA 1XVJA 2H61A 2O5GA 5HLOA 1RWYA 2BL0C 2TN4A 1CB1A 2BCAA 2E30A 1B4CA 4PE4A 2PSRA 2KFFA 1IRJA 4PHNA 1OE9B 1QJTA 1F4OA 1IGVA 2LVJA 2JNFA 2PRUA 4PCWA 1VRKA 4ORBB 5CSIA 1KK8C 2WCFA 2LNKA 1Y0VH 1IQ3A 1MWNA 1NPQA 1SRAA 5I8NA 1WLZA 3VRNA 1C7VA 1B7TY 2KBIA 3BOWB 1B7TZ 4GGFA 1NSHA 2LVVA 1QS7A 4YI8A 2QPTA 4MBEA 1QASA 1XYDA 3PALA 2D8NA 4M2OA 3LLEA 5KTYA 1AVSA 1Y1XA 2JXCA 3TS5C 3BQ3A 1AK8A 1K96A 1BMOA 4L9MA 2LCPA 2LHIA 3KF9A 3SG3A 2M8UA 4GGNA 1BG1A 4MLWA 1F8HA 2WCEA 1ZUZA 5D69A 2KGBC 1TOPA 3DF0B 2BCXA 1CKKA 1NX2A 1QLSA 1JBAA 1KWOB 2L5XB 1M63B 3BUXB 1TN4A 1IQ5A 3E3RA 2H61C 3I5HC 4I5KA 3WHTB 1OMRA 1ZMZA 1KK7Y 2JXLA 2Y5IA 1DJGA 1SBJA 4YGAA 3SG5A 3TDZA 4HSZA 1CLMA 3CTNA 5DKQA 1NUBA 1B1GA 2B1UA 1M31A 3BOWA 4OV2A 2KGRA 1SKTA 2JZIA 2FOTA 5AXIA 2M7LA 1KFXS 3QRXA 2BE4A 2JWWA 2CTNA 1TTXA 2LHLA 5B8IB 2NCOA 2LLUA 4N1GA 1J1DA 4ORAB 2LANA 1S5GY 1YUSA 2OPOA 2LVIA 2Y1MA 4GGFC 3JTDB 3JVTC 1S5GZ 1YUTA 1PK0D 2F2OA 1J1EA 1NX3A 1DVIA 2K8MB 1AJ5A 2OTGB 4R1EA 1DJHA 1RK9A 3DF0A 3KO0A 5DKRA 1SMGA 2JQ6A 3BUWB 3FS7A 1IKUA 3I5FC 1XFWO 2OS8B 3LK1A 3CGAA 1S3PA 1B9AA 4USLA 4OKHA 2KI6C 2I7AA 4I5JA 2CBLA 1UHNA 1TNQA 2KI4C 2JTZA 3GOFA 1DF0B 1DTLA 1AHRA 4JQ0D 1B8RA 1G8IA 1RTP1 3O2PA 4MVFA 4OVNF 4WQ3A 2FCDA 4BY4A 1ALVA 3TDUA 1TCFA 1PVBA 3EKJA 1KQMB 2QACA 4GFTA 1OZSA 1H4BA 1AUIB 2KDHA 2KAVA 5ER5A 2K2FA 1A4PA 1WRLA 2K7OA 2DOQA 1U5IB 3HCMA 1K8UA 3EVVA 3SIBA 1A2XA 2K7DA 4Q04A 1QX5B 1WRZA 2FJUB 2NZ0A 1YVLA 1M45A 3OX6A 2LV7A 4CIDA 1JFKA 1FBVA 1J7OA 4QJ5B 1PULA 4YGBB 2KQ6A 1N0YA 2I2RE 4HRHA 2MBXA 1A29A 3EVUA 1OQPA 3PFVA 4XYNA 1DT7B 2L4IA 4AOMA 4A4BA 1WY9A 3BUNB 5AERA 2Y4QA 1M39A 1YRTB 3AKBA 3AKAA 1NCYA 3SG7A 3WNXB 4QJ4B 1QIVA 2JRFA 1UP5A 3LK0A 2GGMA 3I5GB 1DF0A 3OP0A 2P6BB 2MLEC 1MHOA 4FQOA 3OHMB 3TDIA 5I2QA 1SCMB 1BR4B 4ZCUA 1CFFA 1K90D 1LA3A 4GUKA 2KQYA 3BXKA 3CLNA 3NSIA 3NSKA 1V1FA 3EK4A 1SR6C 1U5IA 1NCXA 2M7NA 2R2IA 1AP4A 3KPXA 3SIAA 1UHHA 3IQQA 1B8CA 3TUYC 4YRUA 1XK4A 1X02A 1BOCA 4N5XA 2KFHA 1EXRA 1DJIA 1CM1A 1N2DA 1EH2A 1RECA 2LAPA 2KYCA 3JTDC 4HRGA 4JWQA 1OOJA 1S6IA 2M1UA 2BBMA 2LLSA 3GK2A 3O78A 4PHJA 4OR9B 3PM8A 2OTGC 4MRXA 1FI5A 4PHKA 1UURA 4ZCVA 1CLLA 1XFXO 3OB1B 1FF1A 2OS8C 2LUCA 3I5IB 2F8PA 3VRRA 2AMIA 2L51A 2NXQA 2LVKA 2Y1NA 2CT9A 4WRIA 4YI9A 4WQ2A 3AAJA 2BL0B 1JC2A 1GJYA 2SCPA 3A4UB 3HX4A 4M2QA 1Y6WA 2L98A 3LCPC 2IS9A 4PE1A 1XFVO 5HLVA 2EGDA 3DVJA 1F4QA 1SNLA 1YR5A 2KAXA 4P5OE 2KSPA 1OMVA 1ALWA 1MQ1A 1SPYA 2CXJA 4XJKB 2EC6B 1KQMC 4U8DA 1CDPA 1QIWA 1SW8A 2AUCA 2PVBA 2Q4UA 1K95A 1KK8B 1TNPA 1C07A 2CNPA 5TNCA 1F71A 3CR4X 1IWQA 2GV5A 1WDCB 1YUUA 2M9GA 3A8RA 3SG2A 3PN7B 2KOTA 1XO5A 4DCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2E A;  1AJ4 A;  5HYD A;  1LA0 A;  1XK4 C;  2NLN A;  2I94 A;  2E6W A;  4N1F A;  2MAZ A;  5DKN A;  3WHU B;  4DRW A;  3RLZ A;  1J7R A;  1PRW A;  2ZRS A;  5HKZ A;  1CTR A;  3NXA A;  1TNW A;  1S1E A;  4PDZ A;  1NCZ A;  1H8B A;  1R2U A;  1QLK A;  1YUR A;  2KI6 D;  2M49 B;  1KFU S;  2ZKM X;  1KSO A;  5AEQ A;  3WXA A;  3FWB A;  1KQV A;  3CWG A;  2MJW B;  2A4J A;  3K21 A;  4CLN A;  1DMO A;  2ZN9 A;  1YX8 A;  3EK7 A;  2JUL A;  2K7C A;  1KFX L;  1BJF A;  3MSE B;  3I5H B;  4MZJ A;  2ZFD A;  1W7I B;  4NDB A;  2FCE A;  1WLM A;  2HQW A;  4PE7 A;  1JSA A;  5HKY A;  1ZFS A;  2CCM A;  5KU1 A;  4ETO A;  1PVA A;  3SG4 A;  1EG3 A;  4UPG A;  1CFD A;  3F45 A;  1S26 D;  2F3Y A;  1BU3 A;  2JC2 A;  1RRO A;  2JOJ A;  5I2O A;  1CLB A;  4I5L B;  2ISD A;  2K7B A;  4C0J A;  1JUO A;  2BKH B;  1QTX A;  1QV1 A;  2LP2 A;  2BBN A;  3RM1 A;  4GBA A;  1L2O B;  2H2K A;  2HQ8 A;  3JVT B;  3SG6 A;  2M97 A;  1CNP A;  2O60 A;  1QVI Y;  2MA2 A;  4HRE E;  3EKH A;  1DGV A;  1K9P A;  1NIW A;  3VGO A;  1QVI Z;  1Q80 A;  4A4C A;  1KWO C;  4YGC B;  3D0Y B;  3SJS A;  4C0K A;  1LVC D;  4PAL A;  1OSA A;  5I2L A;  1UWO A;  5ER4 X;  4I5N B;  2ZRT A;  1Y1A A;  4PHM A;  2K0J A;  1CFP A;  1LXF C;  5GQQ C;  4QJ3 B;  1MR8 A;  1HQV A;  1XA5 A;  5G08 A;  1BR1 B;  2KI4 B;  2M3W A;  1YTZ C;  4D1E A;  1PSB A;  2KAY A;  4ORC B;  1YRU B;  1PAL A;  4YGE B;  4IL1 A;  1MF8 B;  1K2H A;  3DVM A;  3O4Y A;  1A03 A;  5JJG A;  1MXE A;  1S6J A;  2KFG A;  3EVR A;  1UHJ A;  4MSP A;  1BT6 A;  2EC6 C;  2WOS A;  1NWD A;  2LLT A;  1SY9 A;  2LM5 A;  4PE0 A;  1CDL A;  5BPJ A;  2WCB A;  3KEV A;  4GNK B;  5JOL A;  1WDC C;  2I18 A;  3KHE A;  4YGD B;  2G2B A;  2WND A;  2M1K B;  3PN7 C;  1DJZ A;  3EK8 A;  1ZOT B;  1CMG A;  3NSL A;  4MN0 A;  1TRF A;  2MLF C;  1CMF A;  2BCB A;  2Q91 A;  2ZNE A;  5PAL A;  1NP8 A;  2L0P A;  2WOR A;  2KNE A;  1SL7 A;  5K89 A;  3BYA A;  3ZWH A;  4E68 A;  1ODB A;  3NSO A;  1XFY O;  1TIZ A;  3CZT X;  3GK1 A;  2JT8 A;  3D0Y A;  1C7W A;  1RJV A;  4JPZ B;  1K9K A;  1R6P A;  4DIR A;  4TNC A;  2L4H A;  4GAO A;  1TNX A;  2SAS A;  2MRD A;  4OCI A;  3VRQ A;  4AQJ A;  2PAS A;  1UUS A;  1IJ5 A;  1SK6 D;  1E8A A;  1M46 A;  1MXL C;  2JNX A;  1DJW A;  2ZND A;  3CR2 A;  3ZNI A;  1GGW A;  3C1V A;  4MRY A;  4CPV A;  1CDN A;  1UHI A;  3BUO B;  1DJY A;  3DVE A;  5CPV A;  3ICB A;  1EG4 A;  1JF2 A;  4C0L A;  5AAN A;  2LMV A;  1PSR A;  5F6T A;  1LIN A;  1NX1 A;  1LKJ A;  3AAK A;  5J3X A;  1KK7 Z;  2EHB A;  3LL8 B;  2BEC A;  1D1O A;  2MHH A;  2PMY A;  1J7Q A;  1NYA A;  4M2P A;  4NDC A;  1BF5 A;  2ZN8 A;  4FTG A;  2KBM A;  1IH0 A;  2JTT A;  1SR6 B;  2LUX A;  2AAO A;  2HPS A;  1CFC A;  1F55 A;  1IJ6 A;  1QX2 A;  2PAL A;  2KYF A;  1OZO A;  1JF0 A;  3IF7 A;  3TUY B;  3TS5 B;  1A75 B;  5CSF A;  1GQM A;  1FI6 A;  1S6C A;  1TCO B;  2BE6 A;  4MZL A;  1EJ3 A;  1MUX A;  2F3Z A;  1L2O C;  3VRO A;  3DD4 A;  4NDD A;  4GPL B;  3GK4 X;  1JWD A;  3TZ1 A;  1G33 A;  1CDM A;  2WC8 A;  2HF5 A;  5CSJ A;  4F0Z B;  5AFP A;  2JPT A;  3PLF B;  3OB2 B;  3IQO A;  3CR5 X;  1CM4 A;  1YVH A;  3CS1 A;  1JFJ A;  3I5G C;  2G9B A;  4CFQ A;  4AQI A;  5KSZ A;  2K2A A;  3M0W A;  2L50 A;  3FWC A;  1N65 A;  1NX0 A;  1UHK A;  1Y1U A;  5HKW A;  3O6B A;  3VRP A;  4XJK A;  1QV0 A;  1F54 A;  1SCM C;  2COL B;  1DJX A;  1IG5 A;  2JT3 A;  2VRG A;  3PAT A;  1BLQ A;  3H4S E;  1K94 A;  1J7P A;  1XFZ O;  4BY5 A;  4NQG A;  1OMD A;  1GGZ A;  1BOD A;  1DGU A;  1S36 A;  2V53 A;  1SL8 A;  2BKI B;  2M29 A;  1B47 A;  2F2P A;  1YX7 A;  1QXP A;  2HET A;  4DS7 A;  4P2Y B;  1SL9 A;  1J55 A;  1K9U A;  1KSM A;  1W7J B;  2LP3 A;  2LE9 B;  3OX5 A;  2JT0 A;  4DUQ A;  1ZAC A;  1L7Z A;  2KHN A;  3D10 A;  4MEW A;  1G4Y R;  1HT9 A;  1A75 A;  1EL4 A;  1QX7 A;  2LMT A;  1FW4 A;  2NCP A;  2RGI A;  1XFU O;  4MZK A;  1F70 A;  1KFU L;  2LC5 A;  3FIA A;  1K93 D;  4CFR A;  1RFJ A;  3DVK A;  2F33 A;  1FPW A;  1V1G A;  3PSR A;  5D7F A;  1B8L A;  1SCV A;  2K61 A;  5FYX A;  5IBW A;  2GGZ A;  1QAT A;  1KCY A;  5CSN A;  3I5F B;  2LMU A;  3I5I C;  4ICB A;  2JU0 A;  4YBH B;  3BUM B;  2M0R A;  1SYM A;  1WRK A;  1XVJ A;  2H61 A;  2O5G A;  5HLO A;  1RWY A;  2BL0 C;  2TN4 A;  1CB1 A;  2BCA A;  2E30 A;  1B4C A;  4PE4 A;  2PSR A;  2KFF A;  1IRJ A;  4PHN A;  1OE9 B;  1QJT A;  1F4O A;  1IGV A;  2LVJ A;  2JNF A;  2PRU A;  4PCW A;  1VRK A;  4ORB B;  5CSI A;  1KK8 C;  2WCF A;  2LNK A;  1Y0V H;  1IQ3 A;  1MWN A;  1NPQ A;  1SRA A;  5I8N A;  1WLZ A;  3VRN A;  1C7V A;  1B7T Y;  2KBI A;  3BOW B;  1B7T Z;  4GGF A;  1NSH A;  2LVV A;  1QS7 A;  4YI8 A;  2QPT A;  4MBE A;  1QAS A;  1XYD A;  3PAL A;  2D8N A;  4M2O A;  3LLE A;  5KTY A;  1AVS A;  1Y1X A;  2JXC A;  3TS5 C;  3BQ3 A;  1AK8 A;  1K96 A;  1BMO A;  4L9M A;  2LCP A;  2LHI A;  3KF9 A;  3SG3 A;  2M8U A;  4GGN A;  1BG1 A;  4MLW A;  1F8H A;  2WCE A;  1ZUZ A;  5D69 A;  2KGB C;  1TOP A;  3DF0 B;  2BCX A;  1CKK A;  1NX2 A;  1QLS A;  1JBA A;  1KWO B;  2L5X B;  1M63 B;  3BUX B;  1TN4 A;  1IQ5 A;  3E3R A;  2H61 C;  3I5H C;  4I5K A;  3WHT B;  1OMR A;  1ZMZ A;  1KK7 Y;  2JXL A;  2Y5I A;  1DJG A;  1SBJ A;  4YGA A;  3SG5 A;  3TDZ A;  4HSZ A;  1CLM A;  3CTN A;  5DKQ A;  1NUB A;  1B1G A;  2B1U A;  1M31 A;  3BOW A;  4OV2 A;  2KGR A;  1SKT A;  2JZI A;  2FOT A;  5AXI A;  2M7L A;  1KFX S;  3QRX A;  2BE4 A;  2JWW A;  2CTN A;  1TTX A;  2LHL A;  5B8I B;  2NCO A;  2LLU A;  4N1G A;  1J1D A;  4ORA B;  2LAN A;  1S5G Y;  1YUS A;  2OPO A;  2LVI A;  2Y1M A;  4GGF C;  3JTD B;  3JVT C;  1S5G Z;  1YUT A;  1PK0 D;  2F2O A;  1J1E A;  1NX3 A;  1DVI A;  2K8M B;  1AJ5 A;  2OTG B;  4R1E A;  1DJH A;  1RK9 A;  3DF0 A;  3KO0 A;  5DKR A;  1SMG A;  2JQ6 A;  3BUW B;  3FS7 A;  1IKU A;  3I5F C;  1XFW O;  2OS8 B;  3LK1 A;  3CGA A;  1S3P A;  1B9A A;  4USL A;  4OKH A;  2KI6 C;  2I7A A;  4I5J A;  2CBL A;  1UHN A;  1TNQ A;  2KI4 C;  2JTZ A;  3GOF A;  1DF0 B;  1DTL A;  1AHR A;  4JQ0 D;  1B8R A;  1G8I A;  1RTP 1;  3O2P A;  4MVF A;  4OVN F;  4WQ3 A;  2FCD A;  4BY4 A;  1ALV A;  3TDU A;  1TCF A;  1PVB A;  3EKJ A;  1KQM B;  2QAC A;  4GFT A;  1OZS A;  1H4B A;  1AUI B;  2KDH A;  2KAV A;  5ER5 A;  2K2F A;  1A4P A;  1WRL A;  2K7O A;  2DOQ A;  1U5I B;  3HCM A;  1K8U A;  3EVV A;  3SIB A;  1A2X A;  2K7D A;  4Q04 A;  1QX5 B;  1WRZ A;  2FJU B;  2NZ0 A;  1YVL A;  1M45 A;  3OX6 A;  2LV7 A;  4CID A;  1JFK A;  1FBV A;  1J7O A;  4QJ5 B;  1PUL A;  4YGB B;  2KQ6 A;  1N0Y A;  2I2R E;  4HRH A;  2MBX A;  1A29 A;  3EVU A;  1OQP A;  3PFV A;  4XYN A;  1DT7 B;  2L4I A;  4AOM A;  4A4B A;  1WY9 A;  3BUN B;  5AER A;  2Y4Q A;  1M39 A;  1YRT B;  3AKB A;  3AKA A;  1NCY A;  3SG7 A;  3WNX B;  4QJ4 B;  1QIV A;  2JRF A;  1UP5 A;  3LK0 A;  2GGM A;  3I5G B;  1DF0 A;  3OP0 A;  2P6B B;  2MLE C;  1MHO A;  4FQO A;  3OHM B;  3TDI A;  5I2Q A;  1SCM B;  1BR4 B;  4ZCU A;  1CFF A;  1K90 D;  1LA3 A;  4GUK A;  2KQY A;  3BXK A;  3CLN A;  3NSI A;  3NSK A;  1V1F A;  3EK4 A;  1SR6 C;  1U5I A;  1NCX A;  2M7N A;  2R2I A;  1AP4 A;  3KPX A;  3SIA A;  1UHH A;  3IQQ A;  1B8C A;  3TUY C;  4YRU A;  1XK4 A;  1X02 A;  1BOC A;  4N5X A;  2KFH A;  1EXR A;  1DJI A;  1CM1 A;  1N2D A;  1EH2 A;  1REC A;  2LAP A;  2KYC A;  3JTD C;  4HRG A;  4JWQ A;  1OOJ A;  1S6I A;  2M1U A;  2BBM A;  2LLS A;  3GK2 A;  3O78 A;  4PHJ A;  4OR9 B;  3PM8 A;  2OTG C;  4MRX A;  1FI5 A;  4PHK A;  1UUR A;  4ZCV A;  1CLL A;  1XFX O;  3OB1 B;  1FF1 A;  2OS8 C;  2LUC A;  3I5I B;  2F8P A;  3VRR A;  2AMI A;  2L51 A;  2NXQ A;  2LVK A;  2Y1N A;  2CT9 A;  4WRI A;  4YI9 A;  4WQ2 A;  3AAJ A;  2BL0 B;  1JC2 A;  1GJY A;  2SCP A;  3A4U B;  3HX4 A;  4M2Q A;  1Y6W A;  2L98 A;  3LCP C;  2IS9 A;  4PE1 A;  1XFV O;  5HLV A;  2EGD A;  3DVJ A;  1F4Q A;  1SNL A;  1YR5 A;  2KAX A;  4P5O E;  2KSP A;  1OMV A;  1ALW A;  1MQ1 A;  1SPY A;  2CXJ A;  4XJK B;  2EC6 B;  1KQM C;  4U8D A;  1CDP A;  1QIW A;  1SW8 A;  2AUC A;  2PVB A;  2Q4U A;  1K95 A;  1KK8 B;  1TNP A;  1C07 A;  2CNP A;  5TNC A;  1F71 A;  3CR4 X;  1IWQ A;  2GV5 A;  1WDC B;  1YUU A;  2M9G A;  3A8R A;  3SG2 A;  3PN7 B;  2KOT A;  1XO5 A;  4DCK A; 
#chains in the Genus database with same CATH topology
 2JPO A;  2L2E A;  1AJ4 A;  5HYD A;  1LA0 A;  3D78 A;  1XK4 C;  2NLN A;  2I94 A;  2E6W A;  4PT1 A;  4N1F A;  2MAZ A;  5DKN A;  2KLE A;  3WHU B;  4DRW A;  5DIC A;  3RLZ A;  1J7R A;  1OOF A;  1PRW A;  2ZRS A;  1CTR A;  3NXA A;  5HKZ A;  2GTE A;  1TNW A;  1S1E A;  4PDZ A;  1NCZ A;  1H8B A;  1R2U A;  1QLK A;  1YUR A;  2KI6 D;  2M49 B;  1KFU S;  2ZKM X;  1KSO A;  5AEQ A;  3WXA A;  3FWB A;  4OZD A;  1KQV A;  3CWG A;  2MJW B;  2A4J A;  3K21 A;  4CLN A;  1DMO A;  2ZN9 A;  1YX8 A;  2QDI A;  3EK7 A;  2JUL A;  2K7C A;  1KFX L;  1BJF A;  3MSE B;  3I5H B;  4MZJ A;  2ZFD A;  1W7I B;  4NDB A;  4JD9 A;  2FCE A;  1WLM A;  2HQW A;  3K1E A;  4PE7 A;  1JSA A;  5HKY A;  1ZFS A;  2CCM A;  3EG5 B;  5KU1 A;  3UO9 A;  4ETO A;  1PVA A;  3SG4 A;  3CZ2 A;  1EG3 A;  4UPG A;  1CFD A;  1OOG A;  3F45 A;  1S26 D;  2F3Y A;  3CDN A;  1BU3 A;  2JC2 A;  1RRO A;  2JOJ A;  5I2O A;  1CLB A;  4I5L B;  2ISD A;  2K7B A;  4C0J A;  1JUO A;  2BKH B;  1QTX A;  1QV1 A;  2LP2 A;  2BBN A;  3RM1 A;  4GBA A;  1L2O B;  2H2K A;  2HQ8 A;  3JVT B;  3SG6 A;  2M97 A;  5FI7 A;  2O60 A;  1QVI Y;  4F7F A;  2MA2 A;  4HRE E;  1CNP A;  3EKH A;  3CYZ A;  1DGV A;  1K9P A;  1NIW A;  3VGO A;  1QVI Z;  1Q80 A;  4A4C A;  1KWO C;  4YGC B;  3D0Y B;  3SS4 A;  3SJS A;  4C0K A;  1LVC D;  4PAL A;  1OSA A;  5I2L A;  3V2L A;  1UWO A;  3S0E A;  5ER4 X;  4I5N B;  2ZRT A;  1Y1A A;  4PHM A;  2K0J A;  1CFP A;  1LXF C;  5GQQ C;  4QJ3 B;  1MR8 A;  1HQV A;  1XA5 A;  5G08 A;  1BR1 B;  2KI4 B;  2M3W A;  1YTZ C;  4D1E A;  1PSB A;  2KAY A;  4ORC B;  1YRU B;  1SSE B;  1PAL A;  4YGE B;  4IL1 A;  1MF8 B;  1K2H A;  3DVM A;  3O4Y A;  1A03 A;  5JJG A;  1MXE A;  1S6J A;  2KFG A;  3EVR A;  1UHJ A;  4MSP A;  1BT6 A;  2EC6 C;  3DXL A;  2QEV A;  3NHI A;  2WOS A;  1NWD A;  2LLT A;  1SY9 A;  2LM5 A;  4PE0 A;  1CDL A;  5BPJ A;  2WCB A;  3KEV A;  4GNK B;  5JOL A;  1WDC C;  2I18 A;  3KHE A;  4YGD B;  2G2B A;  2WND A;  2M1K B;  3PN7 C;  1DJZ A;  3EK8 A;  1ZOT B;  1CMG A;  3NSL A;  4MN0 A;  1TRF A;  2MLF C;  1CMF A;  2BCB A;  2Q91 A;  2ZNE A;  5PAL A;  1NP8 A;  1JFJ A;  2L0P A;  2WOR A;  2KNE A;  3DY9 A;  1SL7 A;  3R1O A;  5K89 A;  2BAP A;  3BYA A;  3ZWH A;  1ODB A;  3NSO A;  4E68 A;  1XFY O;  1TIZ A;  3CZT X;  3GK1 A;  2JT8 A;  3D0Y A;  1C7W A;  3PJI A;  1RJV A;  4JPZ B;  1K9K A;  1R6P A;  4DIR A;  4TNC A;  2L4H A;  4GAO A;  1TNX A;  3N7H A;  2SAS A;  3CAB A;  2MRD A;  4OCI A;  3VRQ A;  4AQJ A;  2PAS A;  1UUS A;  1OW4 A;  1IJ5 A;  1SK6 D;  1E8A A;  1M46 A;  1MXL C;  2JNX A;  1DJW A;  2ZND A;  3CR2 A;  3D75 A;  3ZNI A;  1GGW A;  3C1V A;  2WCH A;  4MRY A;  4CPV A;  1T14 A;  1CDN A;  1UHI A;  3BUO B;  2PQL A;  1DJY A;  3BFB A;  2ERB A;  3DVE A;  5CPV A;  3ICB A;  1EG4 A;  1JF2 A;  4C0L A;  5AAN A;  2LMV A;  1PSR A;  5F6T A;  1LIN A;  1GM0 A;  1NX1 A;  1LKJ A;  3AAK A;  5FI2 A;  5J3X A;  1KK7 Z;  2EHB A;  3LL8 B;  2BEC A;  1D1O A;  2MHH A;  2PMY A;  1J7Q A;  1NYA A;  4M2P A;  4NDC A;  1BF5 A;  2ZN8 A;  4FTG A;  2KBM A;  2QEH A;  1IH0 A;  2JTT A;  1SR6 B;  2LUX A;  2AAO A;  2HPS A;  1CFC A;  1F55 A;  1IJ6 A;  1QX2 A;  2PAL A;  1DC1 A;  2KYF A;  1OZO A;  1JF0 A;  2WC6 A;  3IF7 A;  3TS5 B;  3TUY B;  3B87 A;  1A75 B;  5CSF A;  1GQM A;  1FI6 A;  1S6C A;  3DYE A;  1TCO B;  2BE6 A;  4MZL A;  3B7A A;  1EJ3 A;  1MUX A;  2F3Z A;  1L2O C;  3FE9 A;  3VRO A;  3DD4 A;  4NDD A;  3NGV A;  4GPL B;  3GK4 X;  1JWD A;  3TZ1 A;  1G33 A;  1CDM A;  2WC8 A;  2HF5 A;  5CSJ A;  4F0Z B;  3CZ0 A;  5AFP A;  2L5Y A;  2JPT A;  3PLF B;  3OB2 B;  3CZ1 A;  3IQO A;  2KLD A;  1CM4 A;  1YVH A;  3CS1 A;  3CR5 X;  3I5G C;  2G9B A;  3Q8I A;  4AQI A;  4CFQ A;  2WC5 A;  5KSZ A;  2K2A A;  3M0W A;  2L50 A;  3FWC A;  1N65 A;  1DEK A;  1NX0 A;  1UHK A;  1Y1U A;  3B6X A;  5HKW A;  3O6B A;  3VRP A;  4XJK A;  1QV0 A;  1F54 A;  1SCM C;  1DJX A;  1IG5 A;  2COL B;  2JT3 A;  2VRG A;  3PAT A;  1BLQ A;  3H4S E;  1K94 A;  1J7P A;  1XFZ O;  4BY5 A;  4NQG A;  1OMD A;  1GGZ A;  3R72 A;  1BOD A;  1DGU A;  1S36 A;  5EL2 A;  2V53 A;  1SL8 A;  2BKI B;  2M29 A;  1B47 A;  2F2P A;  1YX7 A;  1QXP A;  2HET A;  4DS7 A;  4P2Y B;  1SL9 A;  1J55 A;  5D3O A;  2WCJ A;  1K9U A;  1OOH A;  1KSM A;  1W7J B;  2LP3 A;  2LE9 B;  3OX5 A;  2JT0 A;  4DUQ A;  1ZAC A;  1L7Z A;  2KHN A;  3D10 A;  4MEW A;  1G4Y R;  1HT9 A;  1A75 A;  1EL4 A;  1QX7 A;  2LMT A;  1FW4 A;  2NCP A;  2RGI A;  1XFU O;  3D76 A;  4MZK A;  1F70 A;  1KFU L;  2LC5 A;  1C3Y A;  3FIA A;  1K93 D;  1DQE A;  4CFR A;  1RFJ A;  3DVK A;  2F33 A;  1FPW A;  1V1G A;  3PSR A;  4INX A;  5D7F A;  1B8L A;  1SCV A;  2K61 A;  5FYX A;  5IBW A;  1C3Z A;  2GGZ A;  1QAT A;  1KCY A;  5CSN A;  3I5F B;  2LMU A;  3I5I C;  4ICB A;  2JU0 A;  4YBH B;  3BUM B;  1Z4H A;  1SYM A;  1WRK A;  1XVJ A;  2H61 A;  2M0R A;  2O5G A;  1RWY A;  3L4L A;  5HLO A;  2BL0 C;  2TN4 A;  1CB1 A;  2BCA A;  2E30 A;  1B4C A;  5I94 A;  4PE4 A;  2PSR A;  3O4X A;  3BFH A;  2KFF A;  1IRJ A;  4PHN A;  1OE9 B;  1QJT A;  1F4O A;  1IGV A;  2LVJ A;  2JNF A;  2PRU A;  4PCW A;  1TUJ A;  4IJ7 A;  1VRK A;  4ORB B;  5CSI A;  1KK8 C;  2WCF A;  2LNK A;  1Y0V H;  1IQ3 A;  1MWN A;  2QEB A;  1IIO A;  1NPQ A;  1SRA A;  5I8N A;  1WLZ A;  2KPH A;  3VRN A;  1C7V A;  1B7T Y;  2H8V A;  3QME A;  2WCM A;  2KBI A;  2YGU A;  3BOW B;  1B7T Z;  4GGF A;  1NSH A;  2LVV A;  1QS7 A;  4YI8 A;  2QPT A;  1XFR A;  1QAS A;  1XYD A;  3PAL A;  2D8N A;  4MBE A;  4M2O A;  3LLE A;  5KTY A;  1AVS A;  1Y1X A;  2JXC A;  3TS5 C;  3BQ3 A;  1AK8 A;  1K96 A;  1BMO A;  4L9M A;  2LCP A;  2LHI A;  3KF9 A;  3SG3 A;  2M8U A;  2L2C A;  4GGN A;  1BG1 A;  4MLW A;  1F8H A;  2WCE A;  1ZUZ A;  5D69 A;  2KGB C;  1TOP A;  3DF0 B;  2BCX A;  1CKK A;  1NX2 A;  1QLS A;  3D77 A;  1JBA A;  1KWO B;  3IVT A;  2L5X B;  1M63 B;  3BUX B;  1TN4 A;  1IQ5 A;  1W9Z A;  3E3R A;  4JKT A;  2H61 C;  3I5H C;  4I5K A;  3WHT B;  1OMR A;  3DZT A;  1ZMZ A;  3B86 A;  1KK7 Y;  2JXL A;  2Y5I A;  3L47 A;  1DJG A;  1SBJ A;  4YGA A;  3SG5 A;  3TDZ A;  4HSZ A;  1CLM A;  3CTN A;  3S0B A;  2WCK A;  5DKQ A;  1NUB A;  1B1G A;  2B1U A;  1M31 A;  3BOW A;  4OV2 A;  3OBV A;  2KGR A;  1SKT A;  2JZI A;  3D74 A;  2FOT A;  5AXI A;  2M7L A;  1KFX S;  3QRX A;  2BE4 A;  2JWW A;  2CTN A;  1TTX A;  2LHL A;  5B8I B;  2NCO A;  2LLU A;  4N1G A;  1J1D A;  4ORA B;  5FI6 A;  2LAN A;  1S5G Y;  1YUS A;  2OPO A;  2LVI A;  2Y1M A;  4GGF C;  3FE6 A;  3JTD B;  3JVT C;  1S5G Z;  1YUT A;  1PK0 D;  2F2O A;  1J1E A;  1NX3 A;  1DVI A;  2K8M B;  1AJ5 A;  2OTG B;  4R1E A;  1DJH A;  1RK9 A;  1P28 A;  3DF0 A;  3KO0 A;  5DKR A;  1SMG A;  2JQ6 A;  3BUW B;  1ORG A;  3FS7 A;  3R1V A;  1LS8 A;  1IKU A;  3I5F C;  1XFW O;  2OS8 B;  3LK1 A;  1OOI X;  1S3P A;  3CGA A;  3S0D A;  1B9A A;  4USL A;  4OKH A;  2KI6 C;  2I7A A;  4I5J A;  2CBL A;  1UHN A;  1TNQ A;  2KI4 C;  2JTZ A;  3GOF A;  1Z2C B;  1DF0 B;  1DTL A;  1AHR A;  2QEO A;  4JQ0 D;  1B8R A;  1G8I A;  1RTP 1;  3O2P A;  4MVF A;  4OVN F;  4WQ3 A;  2FCD A;  4BY4 A;  1ALV A;  2P71 A;  3TDU A;  1TCF A;  1PVB A;  3EKJ A;  3NHT A;  1KQM B;  2QAC A;  4GFT A;  2BNX A;  1OZS A;  1H4B A;  1AUI B;  2KDH A;  2KAV A;  5ER5 A;  2K2F A;  1A4P A;  1WRL A;  3BJH A;  2K7O A;  2DOQ A;  1U5I B;  4INW A;  3HCM A;  3RZS A;  4KYN A;  1K8U A;  3EVV A;  3SIB A;  1A2X A;  2K7D A;  2P70 A;  4Q04 A;  1QX5 B;  1WRZ A;  2FJU B;  2NZ0 A;  3PM2 A;  1YVL A;  1M45 A;  3OX6 A;  2LV7 A;  4CID A;  1JFK A;  5HL1 A;  1FBV A;  1J7O A;  4QJ5 B;  1PUL A;  3SS3 A;  1QWV A;  3R1P A;  4YGB B;  3D73 A;  2KQ6 A;  1N0Y A;  2I2R E;  4HRH A;  2MBX A;  1A29 A;  3EVU A;  1OQP A;  3PFV A;  4XYN A;  1DT7 B;  2L4I A;  4AOM A;  4FQT A;  4A4B A;  1WY9 A;  3BUN B;  5AER A;  2Y4Q A;  1M39 A;  1YRT B;  2FJY A;  3AKB A;  3AKA A;  1NCY A;  3SG7 A;  3WNX B;  4QJ4 B;  1QIV A;  2JRF A;  1UP5 A;  3LK0 A;  2GGM A;  3I5G B;  1DF0 A;  3SS5 A;  3OP0 A;  2P6B B;  2MLE C;  1MHO A;  4FQO A;  3OHM B;  3TDI A;  5I2Q A;  1SCM B;  1BR4 B;  1DEL A;  4ZCU A;  1CFF A;  1K90 D;  3VB1 A;  1LA3 A;  4GUK A;  3S0A A;  2PYQ A;  2KQY A;  3BXK A;  3CLN A;  3NSI A;  3NSK A;  1V1F A;  3EK4 A;  1SR6 C;  1U5I A;  1NCX A;  2M7N A;  2R2I A;  3S0G A;  3KPX A;  3SIA A;  1AP4 A;  1UHH A;  3IQQ A;  1B8C A;  3TUY C;  4YRU A;  1XK4 A;  1X02 A;  1BOC A;  3B88 A;  4N5X A;  2KFH A;  1EXR A;  1DJI A;  1CM1 A;  1N2D A;  1EH2 A;  1REC A;  2LAP A;  2KYC A;  3JTD C;  4HRG A;  4JWQ A;  1OOJ A;  3OGN A;  1S6I A;  2M1U A;  2BBM A;  2LLS A;  3GK2 A;  3O78 A;  4PHJ A;  4OR9 B;  3FE8 A;  3PM8 A;  2OTG C;  3UNW A;  4MRX A;  1FI5 A;  4PHK A;  1UUR A;  4ZCV A;  1CLL A;  1XFX O;  3OB1 B;  1FF1 A;  2OS8 C;  2LUC A;  3I5I B;  2F8P A;  3VRR A;  2AMI A;  1TUZ A;  2L51 A;  2NXQ A;  2LVK A;  2Y1N A;  2CT9 A;  4WRI A;  4YI9 A;  4WQ2 A;  2K60 A;  1TWO A;  2BL0 B;  3AAJ A;  3BFA A;  1GJY A;  1JC2 A;  2SCP A;  3A4U B;  3HX4 A;  4M2Q A;  1Y6W A;  2L98 A;  3LCP C;  2IS9 A;  3L4A A;  4PE1 A;  3S0F A;  1XFV O;  5HLV A;  2EGD A;  3DVJ A;  1F4Q A;  1SNL A;  1YR5 A;  2KAX A;  4P5O E;  2KSP A;  1OMV A;  1ALW A;  1MQ1 A;  1SPY A;  2CXJ A;  4XJK B;  2EC6 B;  1KQM C;  4U8D A;  1CDP A;  1QIW A;  1SW8 A;  2AUC A;  2PVB A;  2Q4U A;  1K95 A;  1KK8 B;  1TNP A;  1C07 A;  2CNP A;  5TNC A;  1F71 A;  3CR4 X;  1IWQ A;  2GV5 A;  1WDC B;  1YUU A;  2M9G A;  3A8R A;  3SG2 A;  3PN7 B;  2WCL A;  2KOT A;  1XO5 A;  4DCK A; 
#chains in the Genus database with same CATH homology
 2L2E A;  1AJ4 A;  5HYD A;  1LA0 A;  1XK4 C;  2NLN A;  2I94 A;  2E6W A;  4N1F A;  2MAZ A;  5DKN A;  3WHU B;  4DRW A;  3RLZ A;  1J7R A;  1PRW A;  2ZRS A;  5HKZ A;  1CTR A;  3NXA A;  1TNW A;  1S1E A;  4PDZ A;  1NCZ A;  1H8B A;  1R2U A;  1QLK A;  1YUR A;  2KI6 D;  2M49 B;  1KFU S;  2ZKM X;  1KSO A;  5AEQ A;  3WXA A;  3FWB A;  1KQV A;  3CWG A;  2MJW B;  2A4J A;  3K21 A;  4CLN A;  1DMO A;  2ZN9 A;  1YX8 A;  3EK7 A;  2JUL A;  2K7C A;  1KFX L;  1BJF A;  3MSE B;  3I5H B;  4MZJ A;  2ZFD A;  1W7I B;  4NDB A;  2FCE A;  1WLM A;  2HQW A;  4PE7 A;  1JSA A;  5HKY A;  1ZFS A;  2CCM A;  5KU1 A;  4ETO A;  1PVA A;  3SG4 A;  1EG3 A;  4UPG A;  1CFD A;  3F45 A;  1S26 D;  2F3Y A;  1BU3 A;  2JC2 A;  1RRO A;  2JOJ A;  5I2O A;  1CLB A;  4I5L B;  2ISD A;  2K7B A;  4C0J A;  1JUO A;  2BKH B;  1QTX A;  1QV1 A;  2LP2 A;  2BBN A;  3RM1 A;  4GBA A;  1L2O B;  2H2K A;  2HQ8 A;  3JVT B;  3SG6 A;  2M97 A;  1CNP A;  2O60 A;  1QVI Y;  2MA2 A;  4HRE E;  3EKH A;  1DGV A;  1K9P A;  1NIW A;  3VGO A;  1QVI Z;  1Q80 A;  4A4C A;  1KWO C;  4YGC B;  3D0Y B;  3SJS A;  4C0K A;  1LVC D;  4PAL A;  1OSA A;  5I2L A;  1UWO A;  5ER4 X;  4I5N B;  2ZRT A;  1Y1A A;  4PHM A;  2K0J A;  1CFP A;  1LXF C;  5GQQ C;  4QJ3 B;  1MR8 A;  1HQV A;  1XA5 A;  5G08 A;  1BR1 B;  2KI4 B;  2M3W A;  1YTZ C;  4D1E A;  1PSB A;  2KAY A;  4ORC B;  1YRU B;  1PAL A;  4YGE B;  4IL1 A;  1MF8 B;  1K2H A;  3DVM A;  3O4Y A;  1A03 A;  5JJG A;  1MXE A;  1S6J A;  2KFG A;  3EVR A;  1UHJ A;  4MSP A;  1BT6 A;  2EC6 C;  2WOS A;  1NWD A;  2LLT A;  1SY9 A;  2LM5 A;  4PE0 A;  1CDL A;  5BPJ A;  2WCB A;  3KEV A;  4GNK B;  5JOL A;  1WDC C;  2I18 A;  3KHE A;  4YGD B;  2G2B A;  2WND A;  2M1K B;  3PN7 C;  1DJZ A;  3EK8 A;  1ZOT B;  1CMG A;  3NSL A;  4MN0 A;  1TRF A;  2MLF C;  1CMF A;  2BCB A;  2Q91 A;  2ZNE A;  5PAL A;  1NP8 A;  2L0P A;  2WOR A;  2KNE A;  1SL7 A;  5K89 A;  3BYA A;  3ZWH A;  4E68 A;  1ODB A;  3NSO A;  1XFY O;  1TIZ A;  3CZT X;  3GK1 A;  2JT8 A;  3D0Y A;  1C7W A;  1RJV A;  4JPZ B;  1K9K A;  1R6P A;  4DIR A;  4TNC A;  2L4H A;  4GAO A;  1TNX A;  2SAS A;  2MRD A;  4OCI A;  3VRQ A;  4AQJ A;  2PAS A;  1UUS A;  1IJ5 A;  1SK6 D;  1E8A A;  1M46 A;  1MXL C;  2JNX A;  1DJW A;  2ZND A;  3CR2 A;  3ZNI A;  1GGW A;  3C1V A;  4MRY A;  4CPV A;  1CDN A;  1UHI A;  3BUO B;  1DJY A;  3DVE A;  5CPV A;  3ICB A;  1EG4 A;  1JF2 A;  4C0L A;  5AAN A;  2LMV A;  1PSR A;  5F6T A;  1LIN A;  1NX1 A;  1LKJ A;  3AAK A;  5J3X A;  1KK7 Z;  2EHB A;  3LL8 B;  2BEC A;  1D1O A;  2MHH A;  2PMY A;  1J7Q A;  1NYA A;  4M2P A;  4NDC A;  1BF5 A;  2ZN8 A;  4FTG A;  2KBM A;  1IH0 A;  2JTT A;  1SR6 B;  2LUX A;  2AAO A;  2HPS A;  1CFC A;  1F55 A;  1IJ6 A;  1QX2 A;  2PAL A;  2KYF A;  1OZO A;  1JF0 A;  3IF7 A;  3TUY B;  3TS5 B;  1A75 B;  5CSF A;  1GQM A;  1FI6 A;  1S6C A;  1TCO B;  2BE6 A;  4MZL A;  1EJ3 A;  1MUX A;  2F3Z A;  1L2O C;  3VRO A;  3DD4 A;  4NDD A;  4GPL B;  3GK4 X;  1JWD A;  3TZ1 A;  1G33 A;  1CDM A;  2WC8 A;  2HF5 A;  5CSJ A;  4F0Z B;  5AFP A;  2JPT A;  3PLF B;  3OB2 B;  3IQO A;  3CR5 X;  1CM4 A;  1YVH A;  3CS1 A;  1JFJ A;  3I5G C;  2G9B A;  4CFQ A;  4AQI A;  5KSZ A;  2K2A A;  3M0W A;  2L50 A;  3FWC A;  1N65 A;  1NX0 A;  1UHK A;  1Y1U A;  5HKW A;  3O6B A;  3VRP A;  4XJK A;  1QV0 A;  1F54 A;  1SCM C;  2COL B;  1DJX A;  1IG5 A;  2JT3 A;  2VRG A;  3PAT A;  1BLQ A;  3H4S E;  1K94 A;  1J7P A;  1XFZ O;  4BY5 A;  4NQG A;  1OMD A;  1GGZ A;  1BOD A;  1DGU A;  1S36 A;  2V53 A;  1SL8 A;  2BKI B;  2M29 A;  1B47 A;  2F2P A;  1YX7 A;  1QXP A;  2HET A;  4DS7 A;  4P2Y B;  1SL9 A;  1J55 A;  1K9U A;  1KSM A;  1W7J B;  2LP3 A;  2LE9 B;  3OX5 A;  2JT0 A;  4DUQ A;  1ZAC A;  1L7Z A;  2KHN A;  3D10 A;  4MEW A;  1G4Y R;  1HT9 A;  1A75 A;  1EL4 A;  1QX7 A;  2LMT A;  1FW4 A;  2NCP A;  2RGI A;  1XFU O;  4MZK A;  1F70 A;  1KFU L;  2LC5 A;  3FIA A;  1K93 D;  4CFR A;  1RFJ A;  3DVK A;  2F33 A;  1FPW A;  1V1G A;  3PSR A;  5D7F A;  1B8L A;  1SCV A;  2K61 A;  5FYX A;  5IBW A;  2GGZ A;  1QAT A;  1KCY A;  5CSN A;  3I5F B;  2LMU A;  3I5I C;  4ICB A;  2JU0 A;  4YBH B;  3BUM B;  2M0R A;  1SYM A;  1WRK A;  1XVJ A;  2H61 A;  2O5G A;  5HLO A;  1RWY A;  2BL0 C;  2TN4 A;  1CB1 A;  2BCA A;  2E30 A;  1B4C A;  4PE4 A;  2PSR A;  2KFF A;  1IRJ A;  4PHN A;  1OE9 B;  1QJT A;  1F4O A;  1IGV A;  2LVJ A;  2JNF A;  2PRU A;  4PCW A;  1VRK A;  4ORB B;  5CSI A;  1KK8 C;  2WCF A;  2LNK A;  1Y0V H;  1IQ3 A;  1MWN A;  1NPQ A;  1SRA A;  5I8N A;  1WLZ A;  3VRN A;  1C7V A;  1B7T Y;  2KBI A;  3BOW B;  1B7T Z;  4GGF A;  1NSH A;  2LVV A;  1QS7 A;  4YI8 A;  2QPT A;  4MBE A;  1QAS A;  1XYD A;  3PAL A;  2D8N A;  4M2O A;  3LLE A;  5KTY A;  1AVS A;  1Y1X A;  2JXC A;  3TS5 C;  3BQ3 A;  1AK8 A;  1K96 A;  1BMO A;  4L9M A;  2LCP A;  2LHI A;  3KF9 A;  3SG3 A;  2M8U A;  4GGN A;  1BG1 A;  4MLW A;  1F8H A;  2WCE A;  1ZUZ A;  5D69 A;  2KGB C;  1TOP A;  3DF0 B;  2BCX A;  1CKK A;  1NX2 A;  1QLS A;  1JBA A;  1KWO B;  2L5X B;  1M63 B;  3BUX B;  1TN4 A;  1IQ5 A;  3E3R A;  2H61 C;  3I5H C;  4I5K A;  3WHT B;  1OMR A;  1ZMZ A;  1KK7 Y;  2JXL A;  2Y5I A;  1DJG A;  1SBJ A;  4YGA A;  3SG5 A;  3TDZ A;  4HSZ A;  1CLM A;  3CTN A;  5DKQ A;  1NUB A;  1B1G A;  2B1U A;  1M31 A;  3BOW A;  4OV2 A;  2KGR A;  1SKT A;  2JZI A;  2FOT A;  5AXI A;  2M7L A;  1KFX S;  3QRX A;  2BE4 A;  2JWW A;  2CTN A;  1TTX A;  2LHL A;  5B8I B;  2NCO A;  2LLU A;  4N1G A;  1J1D A;  4ORA B;  2LAN A;  1S5G Y;  1YUS A;  2OPO A;  2LVI A;  2Y1M A;  4GGF C;  3JTD B;  3JVT C;  1S5G Z;  1YUT A;  1PK0 D;  2F2O A;  1J1E A;  1NX3 A;  1DVI A;  2K8M B;  1AJ5 A;  2OTG B;  4R1E A;  1DJH A;  1RK9 A;  3DF0 A;  3KO0 A;  5DKR A;  1SMG A;  2JQ6 A;  3BUW B;  3FS7 A;  1IKU A;  3I5F C;  1XFW O;  2OS8 B;  3LK1 A;  3CGA A;  1S3P A;  1B9A A;  4USL A;  4OKH A;  2KI6 C;  2I7A A;  4I5J A;  2CBL A;  1UHN A;  1TNQ A;  2KI4 C;  2JTZ A;  3GOF A;  1DF0 B;  1DTL A;  1AHR A;  4JQ0 D;  1B8R A;  1G8I A;  1RTP 1;  3O2P A;  4MVF A;  4OVN F;  4WQ3 A;  2FCD A;  4BY4 A;  1ALV A;  3TDU A;  1TCF A;  1PVB A;  3EKJ A;  1KQM B;  2QAC A;  4GFT A;  1OZS A;  1H4B A;  1AUI B;  2KDH A;  2KAV A;  5ER5 A;  2K2F A;  1A4P A;  1WRL A;  2K7O A;  2DOQ A;  1U5I B;  3HCM A;  1K8U A;  3EVV A;  3SIB A;  1A2X A;  2K7D A;  4Q04 A;  1QX5 B;  1WRZ A;  2FJU B;  2NZ0 A;  1YVL A;  1M45 A;  3OX6 A;  2LV7 A;  4CID A;  1JFK A;  1FBV A;  1J7O A;  4QJ5 B;  1PUL A;  4YGB B;  2KQ6 A;  1N0Y A;  2I2R E;  4HRH A;  2MBX A;  1A29 A;  3EVU A;  1OQP A;  3PFV A;  4XYN A;  1DT7 B;  2L4I A;  4AOM A;  4A4B A;  1WY9 A;  3BUN B;  5AER A;  2Y4Q A;  1M39 A;  1YRT B;  3AKB A;  3AKA A;  1NCY A;  3SG7 A;  3WNX B;  4QJ4 B;  1QIV A;  2JRF A;  1UP5 A;  3LK0 A;  2GGM A;  3I5G B;  1DF0 A;  3OP0 A;  2P6B B;  2MLE C;  1MHO A;  4FQO A;  3OHM B;  3TDI A;  5I2Q A;  1SCM B;  1BR4 B;  4ZCU A;  1CFF A;  1K90 D;  1LA3 A;  4GUK A;  2KQY A;  3BXK A;  3CLN A;  3NSI A;  3NSK A;  1V1F A;  3EK4 A;  1SR6 C;  1U5I A;  1NCX A;  2M7N A;  2R2I A;  1AP4 A;  3KPX A;  3SIA A;  1UHH A;  3IQQ A;  1B8C A;  3TUY C;  4YRU A;  1XK4 A;  1X02 A;  1BOC A;  4N5X A;  2KFH A;  1EXR A;  1DJI A;  1CM1 A;  1N2D A;  1EH2 A;  1REC A;  2LAP A;  2KYC A;  3JTD C;  4HRG A;  4JWQ A;  1OOJ A;  1S6I A;  2M1U A;  2BBM A;  2LLS A;  3GK2 A;  3O78 A;  4PHJ A;  4OR9 B;  3PM8 A;  2OTG C;  4MRX A;  1FI5 A;  4PHK A;  1UUR A;  4ZCV A;  1CLL A;  1XFX O;  3OB1 B;  1FF1 A;  2OS8 C;  2LUC A;  3I5I B;  2F8P A;  3VRR A;  2AMI A;  2L51 A;  2NXQ A;  2LVK A;  2Y1N A;  2CT9 A;  4WRI A;  4YI9 A;  4WQ2 A;  3AAJ A;  2BL0 B;  1JC2 A;  1GJY A;  2SCP A;  3A4U B;  3HX4 A;  4M2Q A;  1Y6W A;  2L98 A;  3LCP C;  2IS9 A;  4PE1 A;  1XFV O;  5HLV A;  2EGD A;  3DVJ A;  1F4Q A;  1SNL A;  1YR5 A;  2KAX A;  4P5O E;  2KSP A;  1OMV A;  1ALW A;  1MQ1 A;  1SPY A;  2CXJ A;  4XJK B;  2EC6 B;  1KQM C;  4U8D A;  1CDP A;  1QIW A;  1SW8 A;  2AUC A;  2PVB A;  2Q4U A;  1K95 A;  1KK8 B;  1TNP A;  1C07 A;  2CNP A;  5TNC A;  1F71 A;  3CR4 X;  1IWQ A;  2GV5 A;  1WDC B;  1YUU A;  2M9G A;  3A8R A;  3SG2 A;  3PN7 B;  2KOT A;  1XO5 A;  4DCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...