2EC6C

Placopecten striated muscle myosin ii
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
155
structure length
155
Chain Sequence
PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLSGLGERLSDEEVDEIINLTDLQEDLEGNVKYEEFVKKVMAGPYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
publication title Rigor-like structures from muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor.
pubmed doi rcsb
source organism Placopecten magellanicus
molecule tags Contractile protein
total genus 32
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2007-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ec6C01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ec6C02
2BKHB 2I18A 2MHHA 1RTP1 4AQIA 4GBAA 2LLSA 2EC6C 2JXLA 1PULA 3IQOA 2M7LA 1SYMA 2BECA 4U8DA 4PHMA 2BL0C 5K89A 1YVHA 1K93D 3D0YB 1YURA 3DVEA 3SG5A 3OHMB 2LAPA 4OR9B 4XJKA 1AVSA 1KFXS 1NPQA 1MXLC 2SCPA 2K2AA 3TUYB 2KI6C 1U5IB 3VGOA 3TDZA 1S6CA 3FWCA 1SCMC 3HCMA 2EC6B 1FI6A 1CDMA 5FYXA 2L2EA 4GUKA 2ZRTA 1WY9A 3IQQA 3BYAA 1CFFA 1OQPA 2M3WA 1DMOA 3I5FB 2K7BA 1IRJA 1XFYO 1GGZA 1JUOA 1MHOA 2LC5A 3EVRA 2LCPA 2ZNEA 3HX4A 2WCEA 2L4HA 2K0JA 1BOCA 1S26D 4PALA 1QXPA 1CNPA 2HPSA 5KTYA 4PCWA 2PVBA 2I2RE 1IH0A 2K2FA 2KSPA 2NXQA 2WOSA 3JVTB 5HLVA 3CS1A 3FWBA 1LXFC 3VRQA 2WCBA 2LMTA 3H4SE 1KFUL 3TZ1A 1YTZC 5J3XA 2LUCA 3BOWA 1JF2A 4QJ3B 3EKJA 3EK7A 4JQ0D 5G08A 3CTNA 2WORA 1A03A 4MVFA 5D7FA 3O4YA 1KK8B 3NSOA 1YRUB 1Y1AA 2WCFA 1WRKA 3CGAA 1UHIA 4MRYA 1XFVO 4OV2A 1U5IA 4CIDA 1QX7A 3EVUA 1CDPA 1BG1A 3E3RA 4A4BA 2LUXA 5CSJA 4BY4A 1J7OA 1RROA 1FBVA 5AXIA 1BJFA 1CLMA 1QX2A 2I7AA 2OPOA 1S3PA 2JU0A 1Y1XA 3GK1A 1V1GA 1OZOA 1QIWA 3NXAA 3SG4A 1SW8A 4MZLA 5I2OA 2JNXA 2A4JA 1F55A 1YVLA 1CM4A 3DVJA 4BY5A 4GAOA 1K8UA 2L5XB 2M7NA 1V1FA 2LM5A 1SL9A 1B8LA 3GK2A 4GGFC 4HREE 4XJKB 4ZCUA 4WQ2A 2KI4B 1RFJA 3ZNIA 3OX6A 4NDDA 1CKKA 1DVIA 1QV1A 2MA2A 3KHEA 1NX2A 5CSFA 3SG7A 1DF0A 1ZMZA 2BCAA 2COLB 2K8MB 3I5HB 5CSNA 5HKZA 2M1KB 2K7DA 1CDLA 1KQMC 1SL8A 5HKWA 1K9PA 2D8NA 3BUMB 2NZ0A 3LK0A 4I5KA 4YGDB 3SIAA 2B1UA 3AKAA 3NSKA 3C1VA 1J7QA 1K2HA 1QJTA 1NCYA 2M97A 1BLQA 1XO5A 2LVIA 1NCZA 1WLZA 3BUXB 1Y6WA 4NDCA 1AP4A 2LHLA 1F54A 1SMGA 2JT8A 2LNKA 2BBNA 1QVIZ 3BQ3A 2KNEA 2AMIA 3VRNA 1WRLA 1A2XA 2ZFDA 1YX7A 4PE1A 3SG2A 2Y1NA 2H61A 3VROA 5TNCA 5DKRA 2RGIA 2PRUA 2R2IA 1JSAA 3FIAA 1KSMA 2JWWA 2JC2A 2K7CA 3PFVA 3RLZA 3TUYC 3BOWB 4CFQA 1NWDA 5KU1A 1K9UA 4IL1A 4M2OA 2LV7A 1PALA 4PDZA 2KGBC 4R1EA 5HKYA 1EJ3A 1B4CA 4ICBA 4ZCVA 1QVIY 4DIRA 2F2OA 4C0KA 3I5FC 1M39A 1NP8A 2JULA 1DJIA 2KYCA 1AK8A 1JF0A 4WQ3A 4YRUA 5PALA 1B8RA 2HETA 1KCYA 4Q04A 1CFCA 1EG3A 1F4OA 4YGBB 1XVJA 1BR4B 1F8HA 4GNKB 5B8IB 1H8BA 1SK6D 2QPTA 2KI6D 1DJYA 4AOMA 2LLTA 2F3ZA 3JVTC 2HQWA 3PSRA 1EH2A 1KWOB 4YGEB 1NX3A 4YGAA 5AERA 5I2QA 1SCVA 3NSIA 4P2YB 4DRWA 1AUIB 4F0ZB 3LK1A 4MBEA 2CT9A 1KSOA 3OX5A 3GOFA 2BKIB 1F71A 5ER4X 3VRRA 2KGRA 3NSLA 1HQVA 3WHTB 3AKBA 2NCOA 1SR6C 1XFWO 1UP5A 1DF0B 1A75A 1NX0A 1A4PA 1KK8C 2CXJA 4ORAB 2KFGA 2JQ6A 5HYDA 1B47A 1TN4A 3BUNB 3SJSA 1XFZO 1JC2A 2H61C 2LMVA 1OMDA 3EVVA 1IG5A 3A4UB 2LP2A 3BXKA 2OS8C 2MJWB 1SR6B 4WRIA 1YUSA 1KFUS 2KQYA 2KYFA 1ZUZA 4I5JA 2KAXA 2L50A 3I5IB 4JWQA 5BPJA 3SIBA 3CR5X 1XK4A 2M29A 1S6IA 2DOQA 2I94A 4QJ5B 4P5OE 1KK7Z 2F8PA 2V53A 3ZWHA 1L7ZA 2ISDA 2KBIA 1H4BA 1F4QA 1NUBA 1TCFA 2BBMA 3LL8B 1OMRA 1YUUA 3EKHA 3PLFB 4C0JA 1OE9B 1XYDA 2OS8B 3ICBA 2KI4C 2LE9B 3LCPC 3EK8A 4HRGA 2AUCA 4GGNA 2SASA 1SL7A 4YGCB 2JZIA 4MRXA 1TNXA 3CR4X 2PMYA 2FJUB 5DKQA 3I5HC 1MXEA 2GGMA 3O2PA 1UUSA 2WC8A 1GQMA 2L51A 1IJ5A 1KK7Y 4YI8A 1DJZA 1S5GZ 1Y1UA 1JWDA 1J7RA 1A29A 1OZSA 3CWGA 4UPGA 4PE0A 1PVBA 3K21A 4HSZA 1FI5A 4I5LB 2VRGA 1MF8B 1YX8A 4YBHB 1LINA 1CFPA 2F33A 3AAKA 2FCDA 3DF0B 3LLEA 3RM1A 2LVKA 4NQGA 2Q4UA 1CTRA 1J7PA 1TNPA 3AAJA 2KDHA 2PALA 4M2QA 1TRFA 4OVNF 1OMVA 1DGVA 1N0YA 1LA3A 2GGZA 3TDUA 2PSRA 4OKHA 5IBWA 1B7TY 2JT0A 1S5GY 3BUOB 3DVMA 2MLEC 1UWOA 1K94A 1CMGA 1M63B 2K61A 1A75B 3O6BA 2KOTA 2OTGB 2P6BB 1YRTB 1XFUO 2KQ6A 2BCXA 1W7JB 1K9KA 3OB2B 1XA5A 1SRAA 1SNLA 1E8AA 1X02A 1QLKA 1BU3A 2BCBA 2M1UA 4PHNA 5AFPA 3A8RA 1ZACA 1SY9A 4L9MA 1W7IB 2ZKMX 3O78A 1TIZA 1BF5A 1RK9A 1G8IA 1AHRA 3PATA 4I5NB 5AEQA 4GPLB 3SG3A 1BODA 1K90D 1ALWA 1UHKA 1DGUA 1PVAA 2G9BA 3OB1B 3D10A 2CTNA 4YI9A 4DCKA 2EGDA 3CZTX 4QJ4B 1KWOC 1BR1B 1IQ3A 4MLWA 3F45A 1IQ5A 1M45A 2M8UA 2MLFC 4MN0A 5I8NA 5JJGA 3VRPA 1NSHA 2KHNA 3IF7A 4MEWA 1NYAA 1SPYA 2KFFA 4XYNA 4AQJA 1Y0VH 1C7WA 1DJXA 1KFXL 1M31A 2K7OA 1EG4A 2KBMA 2Y4QA 2PASA 1JFJA 4A4CA 4N5XA 1CFDA 3DF0A 2L0PA 1BT6A 1TNWA 2LMUA 3WNXB 4GFTA 1ODBA 1TTXA 3SG6A 1C7VA 1FPWA 1XFXO 3TS5B 1QATA 2ZNDA 3I5GC 1J55A 4DUQA 3CR2A 5JOLA 1J1DA 1C07A 1L2OC 3OP0A 4OCIA 1CM1A 1LA0A 2E30A 2L98A 3I5IC 2BL0B 3QRXA 1CMFA 4DS7A 2KAYA 1DJHA 2L4IA 1MQ1A 2JNFA 4GGFA 2MAZA 4MSPA 2FOTA 4PE4A 1DJGA 1MR8A 1PSRA 2NLNA 4C0LA 3I5GB 4E68A 1QTXA 1HT9A 2ZRSA 3CLNA 1SCMB 1L2OB 1K95A 1UHJA 2F3YA 2KFHA 2QACA 3PALA 1DT7B 1CDNA 1TOPA 1KQVA 2E6WA 2CCMA 1TCOB 1QIVA 1RJVA 1YR5A 1F70A 1NX1A 3DVKA 4JPZB 1GGWA 4N1FA 1CLLA 2MRDA 1VRKA 4MZKA 2JTZA 2EHBA 3KEVA 1WLMA 4N1GA 2JOJA 2LHIA 1QV0A 2M9GA 1G33A 4PHJA 4TNCA 2CBLA 1PRWA 3GK4X 1ZOTB 1PK0D 2HF5A 3FS7A 2Y5IA 2H2KA 1D1OA 1QLSA 2JXCA 1TNQA 1Q80A 1AJ4A 1UHNA 3DD4A 3D0YA 1OOJA 1RECA 2AAOA 2NCPA 5F6TA 5DKNA 3WHUB 1AJ5A 1DTLA 1SKTA 2LLUA 2LP3A 1IJ6A 5KSZA 1B7TZ 2F2PA 2HQ8A 1MUXA 5AANA 3EK4A 4CFRA 4CLNA 2JT3A 2Q91A 5GQQC 2ZN9A 4CPVA 2Y1MA 1FW4A 1S1EA 5ER5A 3TDIA 1WDCC 4PE7A 1MWNA 2BE6A 2TN4A 1EXRA 3KO0A 4FTGA 3MSEB 2KAVA 4ETOA 1IGVA 1BMOA 2BE4A 2OTGC 1M46A 5CPVA 1EL4A 1S36A 2JRFA 1NCXA 2M49B 1K96A 2FCEA 5D69A 1IWQA 3WXAA 1B8CA 1WDCB 5CSIA 1UHHA 4MZJA 3PN7C 1SBJA 4D1EA 1B9AA 1JFKA 3KPXA 1NIWA 1LKJA 1QS7A 1XK4C 2M0RA 1QX5B 2O60A 3M0WA 1GJYA 1B1GA 4FQOA 2IS9A 2WNDA 4NDBA 2JPTA 1DJWA 3KF9A 1PSBA 4PHKA 3PN7B 1R6PA 2LVVA 1CLBA 2LANA 1QASA 3JTDC 4M2PA 5HLOA 1FF1A 2GV5A 1WRZA 1ALVA 1LVCD 1YUTA 2O5GA 1J1EA 1G4YR 1R2UA 4HRHA 2MBXA 1KQMB 2JTTA 1CB1A 2LVJA 1RWYA 1N2DA 1ZFSA 3BUWB 3PM8A 4USLA 5I2LA 2ZN8A 1JBAA 3TS5C 1S6JA 1IKUA 1OSAA 1N65A 2CNPA 4ORCB 3JTDB 2G2BA 1UURA 4ORBB
chains in the Genus database with same CATH superfamily
2BKHB 2I18A 2MHHA 1RTP1 4AQIA 4GBAA 2LLSA 2EC6C 2JXLA 3S0DA 1PULA 3CDNA 3IQOA 2M7LA 1SYMA 2BECA 4U8DA 4PHMA 2BL0C 5K89A 1YVHA 1K93D 3D0YB 4JD9A 1YURA 3DVEA 3SG5A 3OHMB 2LAPA 4OR9B 4XJKA 1AVSA 1KFXS 1NPQA 3R72A 1Z4HA 1MXLC 2SCPA 2K2AA 3TUYB 2KI6C 1U5IB 3VGOA 1W9ZA 4PT1A 3TDZA 3FE6A 1S6CA 3FWCA 1SCMC 3DYEA 2EC6B 3HCMA 1FI6A 1CDMA 5D3OA 5FYXA 3EG5B 2L2EA 1C3YA 4GUKA 2ZRTA 1WY9A 3IQQA 3BYAA 4OZDA 1CFFA 3K1EA 1OQPA 5FI7A 3S0BA 2M3WA 1DMOA 3I5FB 2K7BA 1OOIX 1IRJA 1XFYO 1GGZA 1JUOA 1MHOA 2LC5A 3EVRA 2LCPA 2ZNEA 3HX4A 2WCEA 2L4HA 2K0JA 1OOFA 3NGVA 1BOCA 1S26D 4PALA 1QXPA 1CNPA 2HPSA 5KTYA 4PCWA 2PVBA 2I2RE 1IH0A 2K2FA 2KSPA 2NXQA 3SS5A 2WOSA 2K60A 3JVTB 1ORGA 5HLVA 3CS1A 3FWBA 1LXFC 3VRQA 1C3ZA 2WCBA 2LMTA 3H4SE 1KFUL 3TZ1A 1YTZC 5J3XA 2PQLA 2LUCA 3BOWA 1JF2A 4QJ3B 3EKJA 3EK7A 4JQ0D 5G08A 3CTNA 2WORA 1A03A 4MVFA 5D7FA 3O4YA 1KK8B 3NSOA 1YRUB 1Y1AA 2WCFA 1WRKA 3CGAA 1UHIA 2WCMA 4MRYA 1XFVO 1DQEA 1DELA 3BFBA 3IVTA 4OV2A 1U5IA 4CIDA 1LS8A 1QX7A 3EVUA 1CDPA 1BG1A 3E3RA 4A4BA 2LUXA 5CSJA 4BY4A 1J7OA 1RROA 1GM0A 1FBVA 5AXIA 1BJFA 1CLMA 1QX2A 2I7AA 1QWVA 1S3PA 2JU0A 2OPOA 1Y1XA 3FE8A 3GK1A 1V1GA 3OGNA 1OZOA 1QIWA 3QMEA 3NXAA 3SG4A 1SW8A 2QDIA 4MZLA 5I2OA 3UNWA 3VB1A 2JNXA 2A4JA 1F55A 1YVLA 1CM4A 3DVJA 4BY5A 4GAOA 1K8UA 2L5XB 2M7NA 1V1FA 2LM5A 1SL9A 1B8LA 3GK2A 4GGFC 4HREE 4KYNA 4XJKB 1TUZA 4WQ2A 2KI4B 4ZCUA 1RFJA 3ZNIA 3OX6A 4NDDA 1CKKA 1DVIA 1QV1A 2MA2A 3KHEA 3DY9A 1NX2A 5CSFA 3CZ0A 3SG7A 1DF0A 1ZMZA 2BCAA 2COLB 2K8MB 3I5HB 5CSNA 5HKZA 2M1KB 2K7DA 1CDLA 1KQMC 1SL8A 5HKWA 2QEOA 1K9PA 2D8NA 3BUMB 2NZ0A 3LK0A 1TWOA 4I5KA 4YGDB 3SIAA 2B1UA 3AKAA 3NSKA 3C1VA 1J7QA 1K2HA 1QJTA 1NCYA 2M97A 1BLQA 1XO5A 2L5YA 2LVIA 1NCZA 1WLZA 3BUXB 1Y6WA 4NDCA 2WCHA 2LHLA 2WCLA 1AP4A 1F54A 1SMGA 2JT8A 2LNKA 2BBNA 1QVIZ 3BQ3A 2KNEA 2AMIA 3VRNA 1WRLA 1A2XA 2ZFDA 1YX7A 4PE1A 3SG2A 2Y1NA 2H61A 3VROA 5TNCA 5DKRA 2RGIA 2PRUA 2R2IA 1JSAA 3FIAA 1KSMA 2ERBA 2JWWA 2JC2A 2K7CA 3PFVA 3RLZA 3TUYC 3BOWB 3SS4A 4CFQA 1NWDA 5KU1A 1K9UA 4IL1A 4M2OA 2LV7A 1PALA 4PDZA 2KGBC 4R1EA 5HKYA 3B6XA 1EJ3A 3D73A 1B4CA 3BFAA 3FE9A 4ICBA 1QVIY 4ZCVA 4DIRA 2F2OA 4C0KA 3I5FC 1M39A 1NP8A 2JULA 1DJIA 2KYCA 3NHTA 1AK8A 2WC6A 1JF0A 4WQ3A 4YRUA 5PALA 1B8RA 3N7HA 2HETA 1KCYA 4Q04A 1CFCA 1EG3A 1F4OA 4YGBB 1XVJA 1BR4B 1F8HA 4GNKB 5B8IB 1H8BA 1SK6D 2QPTA 2KI6D 1DJYA 3CZ2A 2LLTA 2F3ZA 3JVTC 2HQWA 3PSRA 1EH2A 1KWOB 4YGEB 1NX3A 4YGAA 5AERA 5I2QA 1SCVA 3NSIA 4P2YB 4DRWA 1AUIB 4F0ZB 3LK1A 4JKTA 4MBEA 2CT9A 1KSOA 3OX5A 3GOFA 2BKIB 1F71A 5ER4X 3VRRA 2KGRA 3NSLA 1HQVA 3WHTB 3AKBA 1P28A 2NCOA 1XFWO 1SR6C 1UP5A 1DF0B 1A75A 1NX0A 1A4PA 1KK8C 2CXJA 4ORAB 2KFGA 2JQ6A 5HYDA 1B47A 1TN4A 3BUNB 3SJSA 1XFZO 1JC2A 2H61C 2LMVA 1OMDA 3EVVA 1IG5A 3A4UB 3BFHA 3RZSA 2LP2A 3BXKA 2OS8C 2MJWB 1SR6B 4WRIA 1YUSA 1KFUS 2KQYA 2KYFA 1ZUZA 4I5JA 1Z2CB 2KAXA 2L50A 3BJHA 3I5IB 3Q8IA 4JWQA 3SIBA 3CR5X 5BPJA 1XK4A 2M29A 1S6IA 2DOQA 2I94A 4QJ5B 3DXLA 4P5OE 1KK7Z 2F8PA 2V53A 3ZWHA 1L7ZA 2ISDA 2KBIA 1H4BA 1F4QA 1NUBA 1TCFA 2BBMA 3LL8B 1OMRA 1YUUA 3EKHA 3PLFB 4C0JA 1OE9B 1XYDA 2OS8B 3ICBA 2KI4C 2LE9B 3LCPC 3EK8A 4HRGA 2AUCA 4GGNA 2SASA 1SL7A 4YGCB 2QEVA 2JZIA 4MRXA 1TNXA 3CR4X 2PMYA 3OBVA 3PJIA 2FJUB 5DKQA 3I5HC 1MXEA 5EL2A 2GGMA 3O2PA 1UUSA 2WC8A 1GQMA 3R1PA 2L51A 1IJ5A 1KK7Y 4YI8A 1DJZA 3CZ1A 1S5GZ 1Y1UA 1JWDA 1J7RA 1A29A 1OZSA 3CWGA 3DZTA 4UPGA 4PE0A 1PVBA 3K21A 3L47A 4HSZA 1FI5A 1TUJA 3L4AA 4I5LB 2VRGA 1MF8B 5HL1A 1YX8A 4YBHB 1LINA 1CFPA 2F33A 3AAKA 2FCDA 3DF0B 2L2CA 3LLEA 3RM1A 2LVKA 3O4XA 4NQGA 3B88A 2Q4UA 1CTRA 2YGUA 1TNPA 2QEHA 1J7PA 3AAJA 2KDHA 2PALA 4M2QA 1TRFA 3B86A 4OVNF 1OMVA 1DGVA 1N0YA 1LA3A 2GGZA 3TDUA 2PSRA 4OKHA 5IBWA 1B7TY 2JT0A 1S5GY 3BUOB 3CABA 3DVMA 2MLEC 1UWOA 1K94A 1CMGA 1M63B 2K61A 1A75B 3O6BA 2KOTA 2OTGB 2P6BB 1YRTB 1XFUO 2KQ6A 2BCXA 1W7JB 1K9KA 3D76A 3OB2B 4AOMA 1DC1A 1XA5A 1SRAA 1SNLA 1E8AA 2GTEA 1X02A 1QLKA 3SS3A 1BU3A 2BCBA 2M1UA 4PHNA 5AFPA 3A8RA 2WC5A 1ZACA 1SY9A 4L9MA 1W7IB 2ZKMX 3O78A 1TIZA 1BF5A 1RK9A 1G8IA 1AHRA 3PATA 4I5NB 5AEQA 4GPLB 3SG3A 1BODA 1K90D 2FJYA 3B7AA 1ALWA 1UHKA 1DGUA 1PVAA 2G9BA 3OB1B 3D10A 2CTNA 4YI9A 4DCKA 2EGDA 3CZTX 4QJ4B 1KWOC 1BR1B 1IQ3A 4MLWA 3F45A 1IQ5A 1M45A 2M8UA 2MLFC 4MN0A 5I8NA 3L4LA 5JJGA 3VRPA 1NSHA 2KHNA 3IF7A 4MEWA 1NYAA 1SPYA 2KFFA 4XYNA 4AQJA 1Y0VH 1C7WA 1DJXA 1KFXL 1M31A 2K7OA 1EG4A 2KBMA 2Y4QA 3NHIA 3S0FA 2PASA 1JFJA 4A4CA 4N5XA 1CFDA 3DF0A 2L0PA 1BT6A 1TNWA 2LMUA 3WNXB 5FI6A 5I94A 4GFTA 1ODBA 1TTXA 3SG6A 1C7VA 1FPWA 1XFXO 3TS5B 1OOGA 1QATA 2PYQA 2ZNDA 3I5GC 1J55A 4DUQA 3CR2A 5JOLA 1J1DA 1C07A 1L2OC 3OP0A 4OCIA 1CM1A 1LA0A 2E30A 2L98A 3I5IC 2BL0B 3QRXA 1CMFA 4DS7A 2KAYA 1DJHA 2L4IA 1MQ1A 1DEKA 2JNFA 4GGFA 2MAZA 4MSPA 2FOTA 4PE4A 1DJGA 1MR8A 1PSRA 2NLNA 4C0LA 3I5GB 4INXA 2P70A 4E68A 1QTXA 1HT9A 3PM2A 2ZRSA 3CLNA 1SCMB 1L2OB 1K95A 1UHJA 2F3YA 2KFHA 2QACA 3PALA 1DT7B 3CYZA 1CDNA 1TOPA 1KQVA 1T14A 2E6WA 2CCMA 1TCOB 1QIVA 2BNXA 1RJVA 1YR5A 1F70A 1NX1A 3DVKA 2WCKA 4JPZB 1GGWA 4N1FA 1CLLA 2MRDA 1VRKA 4MZKA 2JTZA 2EHBA 3KEVA 1WLMA 4N1GA 2JOJA 2LHIA 1QV0A 2M9GA 1G33A 3D77A 4PHJA 4TNCA 2WCJA 2CBLA 1PRWA 3GK4X 1ZOTB 1PK0D 3R1OA 2HF5A 3FS7A 2Y5IA 2H2KA 1D1OA 1QLSA 2JXCA 1TNQA 1Q80A 1AJ4A 1UHNA 3DD4A 3D0YA 1OOJA 1RECA 2AAOA 2NCPA 4INWA 5F6TA 5DKNA 3WHUB 1AJ5A 1DTLA 1SKTA 2LLUA 2LP3A 2P71A 1IJ6A 2KLEA 4FQTA 5KSZA 1B7TZ 2F2PA 2HQ8A 1MUXA 2JPOA 5AANA 3S0GA 2QEBA 3EK4A 4CFRA 4CLNA 2JT3A 2Q91A 5GQQC 2ZN9A 4CPVA 2Y1MA 1FW4A 1S1EA 5ER5A 3TDIA 1WDCC 4PE7A 1MWNA 2BE6A 2TN4A 1EXRA 3KO0A 4FTGA 3MSEB 4IJ7A 2KAVA 4ETOA 1IGVA 1BMOA 2BE4A 2OTGC 1M46A 5CPVA 1EL4A 1S36A 2JRFA 1NCXA 3D78A 2M49B 1K96A 2FCEA 3S0AA 5D69A 1IWQA 3S0EA 4F7FA 3WXAA 1IIOA 1B8CA 1WDCB 5CSIA 1UHHA 4MZJA 3D74A 1SBJA 3PN7C 4D1EA 1B9AA 1JFKA 3KPXA 1NIWA 1OOHA 1LKJA 1QS7A 1XK4C 2BAPA 1QX5B 2H8VA 2M0RA 2O60A 3M0WA 1GJYA 1B1GA 4FQOA 3B87A 5FI2A 2IS9A 2WNDA 4NDBA 2KLDA 2JPTA 1DJWA 3KF9A 2KPHA 1PSBA 4PHKA 3PN7B 1R6PA 2LVVA 1CLBA 2LANA 1SSEB 1QASA 3JTDC 4M2PA 5HLOA 1FF1A 2GV5A 1WRZA 1ALVA 1LVCD 1YUTA 2O5GA 1J1EA 1G4YR 1R2UA 4HRHA 2MBXA 1KQMB 2JTTA 1CB1A 2LVJA 5DICA 1RWYA 3D75A 1N2DA 1ZFSA 3BUWB 3PM8A 4USLA 5I2LA 1XFRA 3R1VA 1OW4A 2ZN8A 1JBAA 3TS5C 1S6JA 1IKUA 1OSAA 1N65A 3V2LA 2CNPA 4ORCB 3UO9A 3JTDB 2G2BA 1UURA 4ORBB
chains in the Genus database with same CATH topology
2BKHB 2I18A 2MHHA 1RTP1 4AQIA 4GBAA 2LLSA 2EC6C 2JXLA 1PULA 3IQOA 2M7LA 1SYMA 2BECA 4U8DA 4PHMA 2BL0C 5K89A 1YVHA 1K93D 3D0YB 1YURA 3DVEA 3SG5A 3OHMB 2LAPA 4OR9B 4XJKA 1AVSA 1KFXS 1NPQA 1MXLC 2SCPA 2K2AA 3TUYB 2KI6C 1U5IB 3VGOA 3TDZA 1S6CA 3FWCA 1SCMC 3HCMA 2EC6B 1FI6A 1CDMA 5FYXA 2L2EA 4GUKA 2ZRTA 1WY9A 3IQQA 3BYAA 1CFFA 1OQPA 2M3WA 1DMOA 3I5FB 2K7BA 1IRJA 1XFYO 1GGZA 1JUOA 1MHOA 2LC5A 3EVRA 2LCPA 2ZNEA 3HX4A 2WCEA 2L4HA 2K0JA 1BOCA 1S26D 4PALA 1QXPA 1CNPA 2HPSA 5KTYA 4PCWA 2PVBA 2I2RE 1IH0A 2K2FA 2KSPA 2NXQA 2WOSA 3JVTB 5HLVA 3CS1A 3FWBA 1LXFC 3VRQA 2WCBA 2LMTA 3H4SE 1KFUL 3TZ1A 1YTZC 5J3XA 2LUCA 3BOWA 1JF2A 4QJ3B 3EKJA 3EK7A 4JQ0D 5G08A 3CTNA 2WORA 1A03A 4MVFA 5D7FA 3O4YA 1KK8B 3NSOA 1YRUB 1Y1AA 2WCFA 1WRKA 3CGAA 1UHIA 4MRYA 1XFVO 4OV2A 1U5IA 4CIDA 1QX7A 3EVUA 1CDPA 1BG1A 3E3RA 4A4BA 2LUXA 5CSJA 4BY4A 1J7OA 1RROA 1FBVA 5AXIA 1BJFA 1CLMA 1QX2A 2I7AA 2OPOA 1S3PA 2JU0A 1Y1XA 3GK1A 1V1GA 1OZOA 1QIWA 3NXAA 3SG4A 1SW8A 4MZLA 5I2OA 2JNXA 2A4JA 1F55A 1YVLA 1CM4A 3DVJA 4BY5A 4GAOA 1K8UA 2L5XB 2M7NA 1V1FA 2LM5A 1SL9A 1B8LA 3GK2A 4GGFC 4HREE 4XJKB 4ZCUA 4WQ2A 2KI4B 1RFJA 3ZNIA 3OX6A 4NDDA 1CKKA 1DVIA 1QV1A 2MA2A 3KHEA 1NX2A 5CSFA 3SG7A 1DF0A 1ZMZA 2BCAA 2COLB 2K8MB 3I5HB 5CSNA 5HKZA 2M1KB 2K7DA 1CDLA 1KQMC 1SL8A 5HKWA 1K9PA 2D8NA 3BUMB 2NZ0A 3LK0A 4I5KA 4YGDB 3SIAA 2B1UA 3AKAA 3NSKA 3C1VA 1J7QA 1K2HA 1QJTA 1NCYA 2M97A 1BLQA 1XO5A 2LVIA 1NCZA 1WLZA 3BUXB 1Y6WA 4NDCA 1AP4A 2LHLA 1F54A 1SMGA 2JT8A 2LNKA 2BBNA 1QVIZ 3BQ3A 2KNEA 2AMIA 3VRNA 1WRLA 1A2XA 2ZFDA 1YX7A 4PE1A 3SG2A 2Y1NA 2H61A 3VROA 5TNCA 5DKRA 2RGIA 2PRUA 2R2IA 1JSAA 3FIAA 1KSMA 2JWWA 2JC2A 2K7CA 3PFVA 3RLZA 3TUYC 3BOWB 4CFQA 1NWDA 5KU1A 1K9UA 4IL1A 4M2OA 2LV7A 1PALA 4PDZA 2KGBC 4R1EA 5HKYA 1EJ3A 1B4CA 4ICBA 4ZCVA 1QVIY 4DIRA 2F2OA 4C0KA 3I5FC 1M39A 1NP8A 2JULA 1DJIA 2KYCA 1AK8A 1JF0A 4WQ3A 4YRUA 5PALA 1B8RA 2HETA 1KCYA 4Q04A 1CFCA 1EG3A 1F4OA 4YGBB 1XVJA 1BR4B 1F8HA 4GNKB 5B8IB 1H8BA 1SK6D 2QPTA 2KI6D 1DJYA 4AOMA 2LLTA 2F3ZA 3JVTC 2HQWA 3PSRA 1EH2A 1KWOB 4YGEB 1NX3A 4YGAA 5AERA 5I2QA 1SCVA 3NSIA 4P2YB 4DRWA 1AUIB 4F0ZB 3LK1A 4MBEA 2CT9A 1KSOA 3OX5A 3GOFA 2BKIB 1F71A 5ER4X 3VRRA 2KGRA 3NSLA 1HQVA 3WHTB 3AKBA 2NCOA 1SR6C 1XFWO 1UP5A 1DF0B 1A75A 1NX0A 1A4PA 1KK8C 2CXJA 4ORAB 2KFGA 2JQ6A 5HYDA 1B47A 1TN4A 3BUNB 3SJSA 1XFZO 1JC2A 2H61C 2LMVA 1OMDA 3EVVA 1IG5A 3A4UB 2LP2A 3BXKA 2OS8C 2MJWB 1SR6B 4WRIA 1YUSA 1KFUS 2KQYA 2KYFA 1ZUZA 4I5JA 2KAXA 2L50A 3I5IB 4JWQA 5BPJA 3SIBA 3CR5X 1XK4A 2M29A 1S6IA 2DOQA 2I94A 4QJ5B 4P5OE 1KK7Z 2F8PA 2V53A 3ZWHA 1L7ZA 2ISDA 2KBIA 1H4BA 1F4QA 1NUBA 1TCFA 2BBMA 3LL8B 1OMRA 1YUUA 3EKHA 3PLFB 4C0JA 1OE9B 1XYDA 2OS8B 3ICBA 2KI4C 2LE9B 3LCPC 3EK8A 4HRGA 2AUCA 4GGNA 2SASA 1SL7A 4YGCB 2JZIA 4MRXA 1TNXA 3CR4X 2PMYA 2FJUB 5DKQA 3I5HC 1MXEA 2GGMA 3O2PA 1UUSA 2WC8A 1GQMA 2L51A 1IJ5A 1KK7Y 4YI8A 1DJZA 1S5GZ 1Y1UA 1JWDA 1J7RA 1A29A 1OZSA 3CWGA 4UPGA 4PE0A 1PVBA 3K21A 4HSZA 1FI5A 4I5LB 2VRGA 1MF8B 1YX8A 4YBHB 1LINA 1CFPA 2F33A 3AAKA 2FCDA 3DF0B 3LLEA 3RM1A 2LVKA 4NQGA 2Q4UA 1CTRA 1J7PA 1TNPA 3AAJA 2KDHA 2PALA 4M2QA 1TRFA 4OVNF 1OMVA 1DGVA 1N0YA 1LA3A 2GGZA 3TDUA 2PSRA 4OKHA 5IBWA 1B7TY 2JT0A 1S5GY 3BUOB 3DVMA 2MLEC 1UWOA 1K94A 1CMGA 1M63B 2K61A 1A75B 3O6BA 2KOTA 2OTGB 2P6BB 1YRTB 1XFUO 2KQ6A 2BCXA 1W7JB 1K9KA 3OB2B 1XA5A 1SRAA 1SNLA 1E8AA 1X02A 1QLKA 1BU3A 2BCBA 2M1UA 4PHNA 5AFPA 3A8RA 1ZACA 1SY9A 4L9MA 1W7IB 2ZKMX 3O78A 1TIZA 1BF5A 1RK9A 1G8IA 1AHRA 3PATA 4I5NB 5AEQA 4GPLB 3SG3A 1BODA 1K90D 1ALWA 1UHKA 1DGUA 1PVAA 2G9BA 3OB1B 3D10A 2CTNA 4YI9A 4DCKA 2EGDA 3CZTX 4QJ4B 1KWOC 1BR1B 1IQ3A 4MLWA 3F45A 1IQ5A 1M45A 2M8UA 2MLFC 4MN0A 5I8NA 5JJGA 3VRPA 1NSHA 2KHNA 3IF7A 4MEWA 1NYAA 1SPYA 2KFFA 4XYNA 4AQJA 1Y0VH 1C7WA 1DJXA 1KFXL 1M31A 2K7OA 1EG4A 2KBMA 2Y4QA 2PASA 1JFJA 4A4CA 4N5XA 1CFDA 3DF0A 2L0PA 1BT6A 1TNWA 2LMUA 3WNXB 4GFTA 1ODBA 1TTXA 3SG6A 1C7VA 1FPWA 1XFXO 3TS5B 1QATA 2ZNDA 3I5GC 1J55A 4DUQA 3CR2A 5JOLA 1J1DA 1C07A 1L2OC 3OP0A 4OCIA 1CM1A 1LA0A 2E30A 2L98A 3I5IC 2BL0B 3QRXA 1CMFA 4DS7A 2KAYA 1DJHA 2L4IA 1MQ1A 2JNFA 4GGFA 2MAZA 4MSPA 2FOTA 4PE4A 1DJGA 1MR8A 1PSRA 2NLNA 4C0LA 3I5GB 4E68A 1QTXA 1HT9A 2ZRSA 3CLNA 1SCMB 1L2OB 1K95A 1UHJA 2F3YA 2KFHA 2QACA 3PALA 1DT7B 1CDNA 1TOPA 1KQVA 2E6WA 2CCMA 1TCOB 1QIVA 1RJVA 1YR5A 1F70A 1NX1A 3DVKA 4JPZB 1GGWA 4N1FA 1CLLA 2MRDA 1VRKA 4MZKA 2JTZA 2EHBA 3KEVA 1WLMA 4N1GA 2JOJA 2LHIA 1QV0A 2M9GA 1G33A 4PHJA 4TNCA 2CBLA 1PRWA 3GK4X 1ZOTB 1PK0D 2HF5A 3FS7A 2Y5IA 2H2KA 1D1OA 1QLSA 2JXCA 1TNQA 1Q80A 1AJ4A 1UHNA 3DD4A 3D0YA 1OOJA 1RECA 2AAOA 2NCPA 5F6TA 5DKNA 3WHUB 1AJ5A 1DTLA 1SKTA 2LLUA 2LP3A 1IJ6A 5KSZA 1B7TZ 2F2PA 2HQ8A 1MUXA 5AANA 3EK4A 4CFRA 4CLNA 2JT3A 2Q91A 5GQQC 2ZN9A 4CPVA 2Y1MA 1FW4A 1S1EA 5ER5A 3TDIA 1WDCC 4PE7A 1MWNA 2BE6A 2TN4A 1EXRA 3KO0A 4FTGA 3MSEB 2KAVA 4ETOA 1IGVA 1BMOA 2BE4A 2OTGC 1M46A 5CPVA 1EL4A 1S36A 2JRFA 1NCXA 2M49B 1K96A 2FCEA 5D69A 1IWQA 3WXAA 1B8CA 1WDCB 5CSIA 1UHHA 4MZJA 3PN7C 1SBJA 4D1EA 1B9AA 1JFKA 3KPXA 1NIWA 1LKJA 1QS7A 1XK4C 2M0RA 1QX5B 2O60A 3M0WA 1GJYA 1B1GA 4FQOA 2IS9A 2WNDA 4NDBA 2JPTA 1DJWA 3KF9A 1PSBA 4PHKA 3PN7B 1R6PA 2LVVA 1CLBA 2LANA 1QASA 3JTDC 4M2PA 5HLOA 1FF1A 2GV5A 1WRZA 1ALVA 1LVCD 1YUTA 2O5GA 1J1EA 1G4YR 1R2UA 4HRHA 2MBXA 1KQMB 2JTTA 1CB1A 2LVJA 1RWYA 1N2DA 1ZFSA 3BUWB 3PM8A 4USLA 5I2LA 2ZN8A 1JBAA 3TS5C 1S6JA 1IKUA 1OSAA 1N65A 2CNPA 4ORCB 3JTDB 2G2BA 1UURA 4ORBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BKH B;  2I18 A;  2MHH A;  1RTP 1;  4AQI A;  4GBA A;  2LLS A;  2EC6 C;  2JXL A;  1PUL A;  3IQO A;  2M7L A;  1SYM A;  2BEC A;  4U8D A;  4PHM A;  2BL0 C;  5K89 A;  1YVH A;  1K93 D;  3D0Y B;  1YUR A;  3DVE A;  3SG5 A;  3OHM B;  2LAP A;  4OR9 B;  4XJK A;  1AVS A;  1KFX S;  1NPQ A;  1MXL C;  2SCP A;  2K2A A;  3TUY B;  2KI6 C;  1U5I B;  3VGO A;  3TDZ A;  1S6C A;  3FWC A;  1SCM C;  3HCM A;  2EC6 B;  1FI6 A;  1CDM A;  5FYX A;  2L2E A;  4GUK A;  2ZRT A;  1WY9 A;  3IQQ A;  3BYA A;  1CFF A;  1OQP A;  2M3W A;  1DMO A;  3I5F B;  2K7B A;  1IRJ A;  1XFY O;  1GGZ A;  1JUO A;  1MHO A;  2LC5 A;  3EVR A;  2LCP A;  2ZNE A;  3HX4 A;  2WCE A;  2L4H A;  2K0J A;  1BOC A;  1S26 D;  4PAL A;  1QXP A;  1CNP A;  2HPS A;  5KTY A;  4PCW A;  2PVB A;  2I2R E;  1IH0 A;  2K2F A;  2KSP A;  2NXQ A;  2WOS A;  3JVT B;  5HLV A;  3CS1 A;  3FWB A;  1LXF C;  3VRQ A;  2WCB A;  2LMT A;  3H4S E;  1KFU L;  3TZ1 A;  1YTZ C;  5J3X A;  2LUC A;  3BOW A;  1JF2 A;  4QJ3 B;  3EKJ A;  3EK7 A;  4JQ0 D;  5G08 A;  3CTN A;  2WOR A;  1A03 A;  4MVF A;  5D7F A;  3O4Y A;  1KK8 B;  3NSO A;  1YRU B;  1Y1A A;  2WCF A;  1WRK A;  3CGA A;  1UHI A;  4MRY A;  1XFV O;  4OV2 A;  1U5I A;  4CID A;  1QX7 A;  3EVU A;  1CDP A;  1BG1 A;  3E3R A;  4A4B A;  2LUX A;  5CSJ A;  4BY4 A;  1J7O A;  1RRO A;  1FBV A;  5AXI A;  1BJF A;  1CLM A;  1QX2 A;  2I7A A;  2OPO A;  1S3P A;  2JU0 A;  1Y1X A;  3GK1 A;  1V1G A;  1OZO A;  1QIW A;  3NXA A;  3SG4 A;  1SW8 A;  4MZL A;  5I2O A;  2JNX A;  2A4J A;  1F55 A;  1YVL A;  1CM4 A;  3DVJ A;  4BY5 A;  4GAO A;  1K8U A;  2L5X B;  2M7N A;  1V1F A;  2LM5 A;  1SL9 A;  1B8L A;  3GK2 A;  4GGF C;  4HRE E;  4XJK B;  4ZCU A;  4WQ2 A;  2KI4 B;  1RFJ A;  3ZNI A;  3OX6 A;  4NDD A;  1CKK A;  1DVI A;  1QV1 A;  2MA2 A;  3KHE A;  1NX2 A;  5CSF A;  3SG7 A;  1DF0 A;  1ZMZ A;  2BCA A;  2COL B;  2K8M B;  3I5H B;  5CSN A;  5HKZ A;  2M1K B;  2K7D A;  1CDL A;  1KQM C;  1SL8 A;  5HKW A;  1K9P A;  2D8N A;  3BUM B;  2NZ0 A;  3LK0 A;  4I5K A;  4YGD B;  3SIA A;  2B1U A;  3AKA A;  3NSK A;  3C1V A;  1J7Q A;  1K2H A;  1QJT A;  1NCY A;  2M97 A;  1BLQ A;  1XO5 A;  2LVI A;  1NCZ A;  1WLZ A;  3BUX B;  1Y6W A;  4NDC A;  1AP4 A;  2LHL A;  1F54 A;  1SMG A;  2JT8 A;  2LNK A;  2BBN A;  1QVI Z;  3BQ3 A;  2KNE A;  2AMI A;  3VRN A;  1WRL A;  1A2X A;  2ZFD A;  1YX7 A;  4PE1 A;  3SG2 A;  2Y1N A;  2H61 A;  3VRO A;  5TNC A;  5DKR A;  2RGI A;  2PRU A;  2R2I A;  1JSA A;  3FIA A;  1KSM A;  2JWW A;  2JC2 A;  2K7C A;  3PFV A;  3RLZ A;  3TUY C;  3BOW B;  4CFQ A;  1NWD A;  5KU1 A;  1K9U A;  4IL1 A;  4M2O A;  2LV7 A;  1PAL A;  4PDZ A;  2KGB C;  4R1E A;  5HKY A;  1EJ3 A;  1B4C A;  4ICB A;  4ZCV A;  1QVI Y;  4DIR A;  2F2O A;  4C0K A;  3I5F C;  1M39 A;  1NP8 A;  2JUL A;  1DJI A;  2KYC A;  1AK8 A;  1JF0 A;  4WQ3 A;  4YRU A;  5PAL A;  1B8R A;  2HET A;  1KCY A;  4Q04 A;  1CFC A;  1EG3 A;  1F4O A;  4YGB B;  1XVJ A;  1BR4 B;  1F8H A;  4GNK B;  5B8I B;  1H8B A;  1SK6 D;  2QPT A;  2KI6 D;  1DJY A;  4AOM A;  2LLT A;  2F3Z A;  3JVT C;  2HQW A;  3PSR A;  1EH2 A;  1KWO B;  4YGE B;  1NX3 A;  4YGA A;  5AER A;  5I2Q A;  1SCV A;  3NSI A;  4P2Y B;  4DRW A;  1AUI B;  4F0Z B;  3LK1 A;  4MBE A;  2CT9 A;  1KSO A;  3OX5 A;  3GOF A;  2BKI B;  1F71 A;  5ER4 X;  3VRR A;  2KGR A;  3NSL A;  1HQV A;  3WHT B;  3AKB A;  2NCO A;  1SR6 C;  1XFW O;  1UP5 A;  1DF0 B;  1A75 A;  1NX0 A;  1A4P A;  1KK8 C;  2CXJ A;  4ORA B;  2KFG A;  2JQ6 A;  5HYD A;  1B47 A;  1TN4 A;  3BUN B;  3SJS A;  1XFZ O;  1JC2 A;  2H61 C;  2LMV A;  1OMD A;  3EVV A;  1IG5 A;  3A4U B;  2LP2 A;  3BXK A;  2OS8 C;  2MJW B;  1SR6 B;  4WRI A;  1YUS A;  1KFU S;  2KQY A;  2KYF A;  1ZUZ A;  4I5J A;  2KAX A;  2L50 A;  3I5I B;  4JWQ A;  5BPJ A;  3SIB A;  3CR5 X;  1XK4 A;  2M29 A;  1S6I A;  2DOQ A;  2I94 A;  4QJ5 B;  4P5O E;  1KK7 Z;  2F8P A;  2V53 A;  3ZWH A;  1L7Z A;  2ISD A;  2KBI A;  1H4B A;  1F4Q A;  1NUB A;  1TCF A;  2BBM A;  3LL8 B;  1OMR A;  1YUU A;  3EKH A;  3PLF B;  4C0J A;  1OE9 B;  1XYD A;  2OS8 B;  3ICB A;  2KI4 C;  2LE9 B;  3LCP C;  3EK8 A;  4HRG A;  2AUC A;  4GGN A;  2SAS A;  1SL7 A;  4YGC B;  2JZI A;  4MRX A;  1TNX A;  3CR4 X;  2PMY A;  2FJU B;  5DKQ A;  3I5H C;  1MXE A;  2GGM A;  3O2P A;  1UUS A;  2WC8 A;  1GQM A;  2L51 A;  1IJ5 A;  1KK7 Y;  4YI8 A;  1DJZ A;  1S5G Z;  1Y1U A;  1JWD A;  1J7R A;  1A29 A;  1OZS A;  3CWG A;  4UPG A;  4PE0 A;  1PVB A;  3K21 A;  4HSZ A;  1FI5 A;  4I5L B;  2VRG A;  1MF8 B;  1YX8 A;  4YBH B;  1LIN A;  1CFP A;  2F33 A;  3AAK A;  2FCD A;  3DF0 B;  3LLE A;  3RM1 A;  2LVK A;  4NQG A;  2Q4U A;  1CTR A;  1J7P A;  1TNP A;  3AAJ A;  2KDH A;  2PAL A;  4M2Q A;  1TRF A;  4OVN F;  1OMV A;  1DGV A;  1N0Y A;  1LA3 A;  2GGZ A;  3TDU A;  2PSR A;  4OKH A;  5IBW A;  1B7T Y;  2JT0 A;  1S5G Y;  3BUO B;  3DVM A;  2MLE C;  1UWO A;  1K94 A;  1CMG A;  1M63 B;  2K61 A;  1A75 B;  3O6B A;  2KOT A;  2OTG B;  2P6B B;  1YRT B;  1XFU O;  2KQ6 A;  2BCX A;  1W7J B;  1K9K A;  3OB2 B;  1XA5 A;  1SRA A;  1SNL A;  1E8A A;  1X02 A;  1QLK A;  1BU3 A;  2BCB A;  2M1U A;  4PHN A;  5AFP A;  3A8R A;  1ZAC A;  1SY9 A;  4L9M A;  1W7I B;  2ZKM X;  3O78 A;  1TIZ A;  1BF5 A;  1RK9 A;  1G8I A;  1AHR A;  3PAT A;  4I5N B;  5AEQ A;  4GPL B;  3SG3 A;  1BOD A;  1K90 D;  1ALW A;  1UHK A;  1DGU A;  1PVA A;  2G9B A;  3OB1 B;  3D10 A;  2CTN A;  4YI9 A;  4DCK A;  2EGD A;  3CZT X;  4QJ4 B;  1KWO C;  1BR1 B;  1IQ3 A;  4MLW A;  3F45 A;  1IQ5 A;  1M45 A;  2M8U A;  2MLF C;  4MN0 A;  5I8N A;  5JJG A;  3VRP A;  1NSH A;  2KHN A;  3IF7 A;  4MEW A;  1NYA A;  1SPY A;  2KFF A;  4XYN A;  4AQJ A;  1Y0V H;  1C7W A;  1DJX A;  1KFX L;  1M31 A;  2K7O A;  1EG4 A;  2KBM A;  2Y4Q A;  2PAS A;  1JFJ A;  4A4C A;  4N5X A;  1CFD A;  3DF0 A;  2L0P A;  1BT6 A;  1TNW A;  2LMU A;  3WNX B;  4GFT A;  1ODB A;  1TTX A;  3SG6 A;  1C7V A;  1FPW A;  1XFX O;  3TS5 B;  1QAT A;  2ZND A;  3I5G C;  1J55 A;  4DUQ A;  3CR2 A;  5JOL A;  1J1D A;  1C07 A;  1L2O C;  3OP0 A;  4OCI A;  1CM1 A;  1LA0 A;  2E30 A;  2L98 A;  3I5I C;  2BL0 B;  3QRX A;  1CMF A;  4DS7 A;  2KAY A;  1DJH A;  2L4I A;  1MQ1 A;  2JNF A;  4GGF A;  2MAZ A;  4MSP A;  2FOT A;  4PE4 A;  1DJG A;  1MR8 A;  1PSR A;  2NLN A;  4C0L A;  3I5G B;  4E68 A;  1QTX A;  1HT9 A;  2ZRS A;  3CLN A;  1SCM B;  1L2O B;  1K95 A;  1UHJ A;  2F3Y A;  2KFH A;  2QAC A;  3PAL A;  1DT7 B;  1CDN A;  1TOP A;  1KQV A;  2E6W A;  2CCM A;  1TCO B;  1QIV A;  1RJV A;  1YR5 A;  1F70 A;  1NX1 A;  3DVK A;  4JPZ B;  1GGW A;  4N1F A;  1CLL A;  2MRD A;  1VRK A;  4MZK A;  2JTZ A;  2EHB A;  3KEV A;  1WLM A;  4N1G A;  2JOJ A;  2LHI A;  1QV0 A;  2M9G A;  1G33 A;  4PHJ A;  4TNC A;  2CBL A;  1PRW A;  3GK4 X;  1ZOT B;  1PK0 D;  2HF5 A;  3FS7 A;  2Y5I A;  2H2K A;  1D1O A;  1QLS A;  2JXC A;  1TNQ A;  1Q80 A;  1AJ4 A;  1UHN A;  3DD4 A;  3D0Y A;  1OOJ A;  1REC A;  2AAO A;  2NCP A;  5F6T A;  5DKN A;  3WHU B;  1AJ5 A;  1DTL A;  1SKT A;  2LLU A;  2LP3 A;  1IJ6 A;  5KSZ A;  1B7T Z;  2F2P A;  2HQ8 A;  1MUX A;  5AAN A;  3EK4 A;  4CFR A;  4CLN A;  2JT3 A;  2Q91 A;  5GQQ C;  2ZN9 A;  4CPV A;  2Y1M A;  1FW4 A;  1S1E A;  5ER5 A;  3TDI A;  1WDC C;  4PE7 A;  1MWN A;  2BE6 A;  2TN4 A;  1EXR A;  3KO0 A;  4FTG A;  3MSE B;  2KAV A;  4ETO A;  1IGV A;  1BMO A;  2BE4 A;  2OTG C;  1M46 A;  5CPV A;  1EL4 A;  1S36 A;  2JRF A;  1NCX A;  2M49 B;  1K96 A;  2FCE A;  5D69 A;  1IWQ A;  3WXA A;  1B8C A;  1WDC B;  5CSI A;  1UHH A;  4MZJ A;  3PN7 C;  1SBJ A;  4D1E A;  1B9A A;  1JFK A;  3KPX A;  1NIW A;  1LKJ A;  1QS7 A;  1XK4 C;  2M0R A;  1QX5 B;  2O60 A;  3M0W A;  1GJY A;  1B1G A;  4FQO A;  2IS9 A;  2WND A;  4NDB A;  2JPT A;  1DJW A;  3KF9 A;  1PSB A;  4PHK A;  3PN7 B;  1R6P A;  2LVV A;  1CLB A;  2LAN A;  1QAS A;  3JTD C;  4M2P A;  5HLO A;  1FF1 A;  2GV5 A;  1WRZ A;  1ALV A;  1LVC D;  1YUT A;  2O5G A;  1J1E A;  1G4Y R;  1R2U A;  4HRH A;  2MBX A;  1KQM B;  2JTT A;  1CB1 A;  2LVJ A;  1RWY A;  1N2D A;  1ZFS A;  3BUW B;  3PM8 A;  4USL A;  5I2L A;  2ZN8 A;  1JBA A;  3TS5 C;  1S6J A;  1IKU A;  1OSA A;  1N65 A;  2CNP A;  4ORC B;  3JTD B;  2G2B A;  1UUR A;  4ORB B; 
#chains in the Genus database with same CATH topology
 2BKH B;  2I18 A;  2MHH A;  1RTP 1;  4AQI A;  4GBA A;  2LLS A;  2EC6 C;  2JXL A;  3S0D A;  1PUL A;  3CDN A;  3IQO A;  2M7L A;  1SYM A;  2BEC A;  4U8D A;  4PHM A;  2BL0 C;  5K89 A;  1YVH A;  1K93 D;  3D0Y B;  4JD9 A;  1YUR A;  3DVE A;  3SG5 A;  3OHM B;  2LAP A;  4OR9 B;  4XJK A;  1AVS A;  1KFX S;  1NPQ A;  3R72 A;  1Z4H A;  1MXL C;  2SCP A;  2K2A A;  3TUY B;  2KI6 C;  1U5I B;  3VGO A;  1W9Z A;  4PT1 A;  3TDZ A;  3FE6 A;  1S6C A;  3FWC A;  1SCM C;  3DYE A;  2EC6 B;  3HCM A;  1FI6 A;  1CDM A;  5D3O A;  5FYX A;  3EG5 B;  2L2E A;  1C3Y A;  4GUK A;  2ZRT A;  1WY9 A;  3IQQ A;  3BYA A;  4OZD A;  1CFF A;  3K1E A;  1OQP A;  5FI7 A;  3S0B A;  2M3W A;  1DMO A;  3I5F B;  2K7B A;  1OOI X;  1IRJ A;  1XFY O;  1GGZ A;  1JUO A;  1MHO A;  2LC5 A;  3EVR A;  2LCP A;  2ZNE A;  3HX4 A;  2WCE A;  2L4H A;  2K0J A;  1OOF A;  3NGV A;  1BOC A;  1S26 D;  4PAL A;  1QXP A;  1CNP A;  2HPS A;  5KTY A;  4PCW A;  2PVB A;  2I2R E;  1IH0 A;  2K2F A;  2KSP A;  2NXQ A;  3SS5 A;  2WOS A;  2K60 A;  3JVT B;  1ORG A;  5HLV A;  3CS1 A;  3FWB A;  1LXF C;  3VRQ A;  1C3Z A;  2WCB A;  2LMT A;  3H4S E;  1KFU L;  3TZ1 A;  1YTZ C;  5J3X A;  2PQL A;  2LUC A;  3BOW A;  1JF2 A;  4QJ3 B;  3EKJ A;  3EK7 A;  4JQ0 D;  5G08 A;  3CTN A;  2WOR A;  1A03 A;  4MVF A;  5D7F A;  3O4Y A;  1KK8 B;  3NSO A;  1YRU B;  1Y1A A;  2WCF A;  1WRK A;  3CGA A;  1UHI A;  2WCM A;  4MRY A;  1XFV O;  1DQE A;  1DEL A;  3BFB A;  3IVT A;  4OV2 A;  1U5I A;  4CID A;  1LS8 A;  1QX7 A;  3EVU A;  1CDP A;  1BG1 A;  3E3R A;  4A4B A;  2LUX A;  5CSJ A;  4BY4 A;  1J7O A;  1RRO A;  1GM0 A;  1FBV A;  5AXI A;  1BJF A;  1CLM A;  1QX2 A;  2I7A A;  1QWV A;  1S3P A;  2JU0 A;  2OPO A;  1Y1X A;  3FE8 A;  3GK1 A;  1V1G A;  3OGN A;  1OZO A;  1QIW A;  3QME A;  3NXA A;  3SG4 A;  1SW8 A;  2QDI A;  4MZL A;  5I2O A;  3UNW A;  3VB1 A;  2JNX A;  2A4J A;  1F55 A;  1YVL A;  1CM4 A;  3DVJ A;  4BY5 A;  4GAO A;  1K8U A;  2L5X B;  2M7N A;  1V1F A;  2LM5 A;  1SL9 A;  1B8L A;  3GK2 A;  4GGF C;  4HRE E;  4KYN A;  4XJK B;  1TUZ A;  4WQ2 A;  2KI4 B;  4ZCU A;  1RFJ A;  3ZNI A;  3OX6 A;  4NDD A;  1CKK A;  1DVI A;  1QV1 A;  2MA2 A;  3KHE A;  3DY9 A;  1NX2 A;  5CSF A;  3CZ0 A;  3SG7 A;  1DF0 A;  1ZMZ A;  2BCA A;  2COL B;  2K8M B;  3I5H B;  5CSN A;  5HKZ A;  2M1K B;  2K7D A;  1CDL A;  1KQM C;  1SL8 A;  5HKW A;  2QEO A;  1K9P A;  2D8N A;  3BUM B;  2NZ0 A;  3LK0 A;  1TWO A;  4I5K A;  4YGD B;  3SIA A;  2B1U A;  3AKA A;  3NSK A;  3C1V A;  1J7Q A;  1K2H A;  1QJT A;  1NCY A;  2M97 A;  1BLQ A;  1XO5 A;  2L5Y A;  2LVI A;  1NCZ A;  1WLZ A;  3BUX B;  1Y6W A;  4NDC A;  2WCH A;  2LHL A;  2WCL A;  1AP4 A;  1F54 A;  1SMG A;  2JT8 A;  2LNK A;  2BBN A;  1QVI Z;  3BQ3 A;  2KNE A;  2AMI A;  3VRN A;  1WRL A;  1A2X A;  2ZFD A;  1YX7 A;  4PE1 A;  3SG2 A;  2Y1N A;  2H61 A;  3VRO A;  5TNC A;  5DKR A;  2RGI A;  2PRU A;  2R2I A;  1JSA A;  3FIA A;  1KSM A;  2ERB A;  2JWW A;  2JC2 A;  2K7C A;  3PFV A;  3RLZ A;  3TUY C;  3BOW B;  3SS4 A;  4CFQ A;  1NWD A;  5KU1 A;  1K9U A;  4IL1 A;  4M2O A;  2LV7 A;  1PAL A;  4PDZ A;  2KGB C;  4R1E A;  5HKY A;  3B6X A;  1EJ3 A;  3D73 A;  1B4C A;  3BFA A;  3FE9 A;  4ICB A;  1QVI Y;  4ZCV A;  4DIR A;  2F2O A;  4C0K A;  3I5F C;  1M39 A;  1NP8 A;  2JUL A;  1DJI A;  2KYC A;  3NHT A;  1AK8 A;  2WC6 A;  1JF0 A;  4WQ3 A;  4YRU A;  5PAL A;  1B8R A;  3N7H A;  2HET A;  1KCY A;  4Q04 A;  1CFC A;  1EG3 A;  1F4O A;  4YGB B;  1XVJ A;  1BR4 B;  1F8H A;  4GNK B;  5B8I B;  1H8B A;  1SK6 D;  2QPT A;  2KI6 D;  1DJY A;  3CZ2 A;  2LLT A;  2F3Z A;  3JVT C;  2HQW A;  3PSR A;  1EH2 A;  1KWO B;  4YGE B;  1NX3 A;  4YGA A;  5AER A;  5I2Q A;  1SCV A;  3NSI A;  4P2Y B;  4DRW A;  1AUI B;  4F0Z B;  3LK1 A;  4JKT A;  4MBE A;  2CT9 A;  1KSO A;  3OX5 A;  3GOF A;  2BKI B;  1F71 A;  5ER4 X;  3VRR A;  2KGR A;  3NSL A;  1HQV A;  3WHT B;  3AKB A;  1P28 A;  2NCO A;  1XFW O;  1SR6 C;  1UP5 A;  1DF0 B;  1A75 A;  1NX0 A;  1A4P A;  1KK8 C;  2CXJ A;  4ORA B;  2KFG A;  2JQ6 A;  5HYD A;  1B47 A;  1TN4 A;  3BUN B;  3SJS A;  1XFZ O;  1JC2 A;  2H61 C;  2LMV A;  1OMD A;  3EVV A;  1IG5 A;  3A4U B;  3BFH A;  3RZS A;  2LP2 A;  3BXK A;  2OS8 C;  2MJW B;  1SR6 B;  4WRI A;  1YUS A;  1KFU S;  2KQY A;  2KYF A;  1ZUZ A;  4I5J A;  1Z2C B;  2KAX A;  2L50 A;  3BJH A;  3I5I B;  3Q8I A;  4JWQ A;  3SIB A;  3CR5 X;  5BPJ A;  1XK4 A;  2M29 A;  1S6I A;  2DOQ A;  2I94 A;  4QJ5 B;  3DXL A;  4P5O E;  1KK7 Z;  2F8P A;  2V53 A;  3ZWH A;  1L7Z A;  2ISD A;  2KBI A;  1H4B A;  1F4Q A;  1NUB A;  1TCF A;  2BBM A;  3LL8 B;  1OMR A;  1YUU A;  3EKH A;  3PLF B;  4C0J A;  1OE9 B;  1XYD A;  2OS8 B;  3ICB A;  2KI4 C;  2LE9 B;  3LCP C;  3EK8 A;  4HRG A;  2AUC A;  4GGN A;  2SAS A;  1SL7 A;  4YGC B;  2QEV A;  2JZI A;  4MRX A;  1TNX A;  3CR4 X;  2PMY A;  3OBV A;  3PJI A;  2FJU B;  5DKQ A;  3I5H C;  1MXE A;  5EL2 A;  2GGM A;  3O2P A;  1UUS A;  2WC8 A;  1GQM A;  3R1P A;  2L51 A;  1IJ5 A;  1KK7 Y;  4YI8 A;  1DJZ A;  3CZ1 A;  1S5G Z;  1Y1U A;  1JWD A;  1J7R A;  1A29 A;  1OZS A;  3CWG A;  3DZT A;  4UPG A;  4PE0 A;  1PVB A;  3K21 A;  3L47 A;  4HSZ A;  1FI5 A;  1TUJ A;  3L4A A;  4I5L B;  2VRG A;  1MF8 B;  5HL1 A;  1YX8 A;  4YBH B;  1LIN A;  1CFP A;  2F33 A;  3AAK A;  2FCD A;  3DF0 B;  2L2C A;  3LLE A;  3RM1 A;  2LVK A;  3O4X A;  4NQG A;  3B88 A;  2Q4U A;  1CTR A;  2YGU A;  1TNP A;  2QEH A;  1J7P A;  3AAJ A;  2KDH A;  2PAL A;  4M2Q A;  1TRF A;  3B86 A;  4OVN F;  1OMV A;  1DGV A;  1N0Y A;  1LA3 A;  2GGZ A;  3TDU A;  2PSR A;  4OKH A;  5IBW A;  1B7T Y;  2JT0 A;  1S5G Y;  3BUO B;  3CAB A;  3DVM A;  2MLE C;  1UWO A;  1K94 A;  1CMG A;  1M63 B;  2K61 A;  1A75 B;  3O6B A;  2KOT A;  2OTG B;  2P6B B;  1YRT B;  1XFU O;  2KQ6 A;  2BCX A;  1W7J B;  1K9K A;  3D76 A;  3OB2 B;  4AOM A;  1DC1 A;  1XA5 A;  1SRA A;  1SNL A;  1E8A A;  2GTE A;  1X02 A;  1QLK A;  3SS3 A;  1BU3 A;  2BCB A;  2M1U A;  4PHN A;  5AFP A;  3A8R A;  2WC5 A;  1ZAC A;  1SY9 A;  4L9M A;  1W7I B;  2ZKM X;  3O78 A;  1TIZ A;  1BF5 A;  1RK9 A;  1G8I A;  1AHR A;  3PAT A;  4I5N B;  5AEQ A;  4GPL B;  3SG3 A;  1BOD A;  1K90 D;  2FJY A;  3B7A A;  1ALW A;  1UHK A;  1DGU A;  1PVA A;  2G9B A;  3OB1 B;  3D10 A;  2CTN A;  4YI9 A;  4DCK A;  2EGD A;  3CZT X;  4QJ4 B;  1KWO C;  1BR1 B;  1IQ3 A;  4MLW A;  3F45 A;  1IQ5 A;  1M45 A;  2M8U A;  2MLF C;  4MN0 A;  5I8N A;  3L4L A;  5JJG A;  3VRP A;  1NSH A;  2KHN A;  3IF7 A;  4MEW A;  1NYA A;  1SPY A;  2KFF A;  4XYN A;  4AQJ A;  1Y0V H;  1C7W A;  1DJX A;  1KFX L;  1M31 A;  2K7O A;  1EG4 A;  2KBM A;  2Y4Q A;  3NHI A;  3S0F A;  2PAS A;  1JFJ A;  4A4C A;  4N5X A;  1CFD A;  3DF0 A;  2L0P A;  1BT6 A;  1TNW A;  2LMU A;  3WNX B;  5FI6 A;  5I94 A;  4GFT A;  1ODB A;  1TTX A;  3SG6 A;  1C7V A;  1FPW A;  1XFX O;  3TS5 B;  1OOG A;  1QAT A;  2PYQ A;  2ZND A;  3I5G C;  1J55 A;  4DUQ A;  3CR2 A;  5JOL A;  1J1D A;  1C07 A;  1L2O C;  3OP0 A;  4OCI A;  1CM1 A;  1LA0 A;  2E30 A;  2L98 A;  3I5I C;  2BL0 B;  3QRX A;  1CMF A;  4DS7 A;  2KAY A;  1DJH A;  2L4I A;  1MQ1 A;  1DEK A;  2JNF A;  4GGF A;  2MAZ A;  4MSP A;  2FOT A;  4PE4 A;  1DJG A;  1MR8 A;  1PSR A;  2NLN A;  4C0L A;  3I5G B;  4INX A;  2P70 A;  4E68 A;  1QTX A;  1HT9 A;  3PM2 A;  2ZRS A;  3CLN A;  1SCM B;  1L2O B;  1K95 A;  1UHJ A;  2F3Y A;  2KFH A;  2QAC A;  3PAL A;  1DT7 B;  3CYZ A;  1CDN A;  1TOP A;  1KQV A;  1T14 A;  2E6W A;  2CCM A;  1TCO B;  1QIV A;  2BNX A;  1RJV A;  1YR5 A;  1F70 A;  1NX1 A;  3DVK A;  2WCK A;  4JPZ B;  1GGW A;  4N1F A;  1CLL A;  2MRD A;  1VRK A;  4MZK A;  2JTZ A;  2EHB A;  3KEV A;  1WLM A;  4N1G A;  2JOJ A;  2LHI A;  1QV0 A;  2M9G A;  1G33 A;  3D77 A;  4PHJ A;  4TNC A;  2WCJ A;  2CBL A;  1PRW A;  3GK4 X;  1ZOT B;  1PK0 D;  3R1O A;  2HF5 A;  3FS7 A;  2Y5I A;  2H2K A;  1D1O A;  1QLS A;  2JXC A;  1TNQ A;  1Q80 A;  1AJ4 A;  1UHN A;  3DD4 A;  3D0Y A;  1OOJ A;  1REC A;  2AAO A;  2NCP A;  4INW A;  5F6T A;  5DKN A;  3WHU B;  1AJ5 A;  1DTL A;  1SKT A;  2LLU A;  2LP3 A;  2P71 A;  1IJ6 A;  2KLE A;  4FQT A;  5KSZ A;  1B7T Z;  2F2P A;  2HQ8 A;  1MUX A;  2JPO A;  5AAN A;  3S0G A;  2QEB A;  3EK4 A;  4CFR A;  4CLN A;  2JT3 A;  2Q91 A;  5GQQ C;  2ZN9 A;  4CPV A;  2Y1M A;  1FW4 A;  1S1E A;  5ER5 A;  3TDI A;  1WDC C;  4PE7 A;  1MWN A;  2BE6 A;  2TN4 A;  1EXR A;  3KO0 A;  4FTG A;  3MSE B;  4IJ7 A;  2KAV A;  4ETO A;  1IGV A;  1BMO A;  2BE4 A;  2OTG C;  1M46 A;  5CPV A;  1EL4 A;  1S36 A;  2JRF A;  1NCX A;  3D78 A;  2M49 B;  1K96 A;  2FCE A;  3S0A A;  5D69 A;  1IWQ A;  3S0E A;  4F7F A;  3WXA A;  1IIO A;  1B8C A;  1WDC B;  5CSI A;  1UHH A;  4MZJ A;  3D74 A;  1SBJ A;  3PN7 C;  4D1E A;  1B9A A;  1JFK A;  3KPX A;  1NIW A;  1OOH A;  1LKJ A;  1QS7 A;  1XK4 C;  2BAP A;  1QX5 B;  2H8V A;  2M0R A;  2O60 A;  3M0W A;  1GJY A;  1B1G A;  4FQO A;  3B87 A;  5FI2 A;  2IS9 A;  2WND A;  4NDB A;  2KLD A;  2JPT A;  1DJW A;  3KF9 A;  2KPH A;  1PSB A;  4PHK A;  3PN7 B;  1R6P A;  2LVV A;  1CLB A;  2LAN A;  1SSE B;  1QAS A;  3JTD C;  4M2P A;  5HLO A;  1FF1 A;  2GV5 A;  1WRZ A;  1ALV A;  1LVC D;  1YUT A;  2O5G A;  1J1E A;  1G4Y R;  1R2U A;  4HRH A;  2MBX A;  1KQM B;  2JTT A;  1CB1 A;  2LVJ A;  5DIC A;  1RWY A;  3D75 A;  1N2D A;  1ZFS A;  3BUW B;  3PM8 A;  4USL A;  5I2L A;  1XFR A;  3R1V A;  1OW4 A;  2ZN8 A;  1JBA A;  3TS5 C;  1S6J A;  1IKU A;  1OSA A;  1N65 A;  3V2L A;  2CNP A;  4ORC B;  3UO9 A;  3JTD B;  2G2B A;  1UUR A;  4ORB B; 
#chains in the Genus database with same CATH homology
 2BKH B;  2I18 A;  2MHH A;  1RTP 1;  4AQI A;  4GBA A;  2LLS A;  2EC6 C;  2JXL A;  1PUL A;  3IQO A;  2M7L A;  1SYM A;  2BEC A;  4U8D A;  4PHM A;  2BL0 C;  5K89 A;  1YVH A;  1K93 D;  3D0Y B;  1YUR A;  3DVE A;  3SG5 A;  3OHM B;  2LAP A;  4OR9 B;  4XJK A;  1AVS A;  1KFX S;  1NPQ A;  1MXL C;  2SCP A;  2K2A A;  3TUY B;  2KI6 C;  1U5I B;  3VGO A;  3TDZ A;  1S6C A;  3FWC A;  1SCM C;  3HCM A;  2EC6 B;  1FI6 A;  1CDM A;  5FYX A;  2L2E A;  4GUK A;  2ZRT A;  1WY9 A;  3IQQ A;  3BYA A;  1CFF A;  1OQP A;  2M3W A;  1DMO A;  3I5F B;  2K7B A;  1IRJ A;  1XFY O;  1GGZ A;  1JUO A;  1MHO A;  2LC5 A;  3EVR A;  2LCP A;  2ZNE A;  3HX4 A;  2WCE A;  2L4H A;  2K0J A;  1BOC A;  1S26 D;  4PAL A;  1QXP A;  1CNP A;  2HPS A;  5KTY A;  4PCW A;  2PVB A;  2I2R E;  1IH0 A;  2K2F A;  2KSP A;  2NXQ A;  2WOS A;  3JVT B;  5HLV A;  3CS1 A;  3FWB A;  1LXF C;  3VRQ A;  2WCB A;  2LMT A;  3H4S E;  1KFU L;  3TZ1 A;  1YTZ C;  5J3X A;  2LUC A;  3BOW A;  1JF2 A;  4QJ3 B;  3EKJ A;  3EK7 A;  4JQ0 D;  5G08 A;  3CTN A;  2WOR A;  1A03 A;  4MVF A;  5D7F A;  3O4Y A;  1KK8 B;  3NSO A;  1YRU B;  1Y1A A;  2WCF A;  1WRK A;  3CGA A;  1UHI A;  4MRY A;  1XFV O;  4OV2 A;  1U5I A;  4CID A;  1QX7 A;  3EVU A;  1CDP A;  1BG1 A;  3E3R A;  4A4B A;  2LUX A;  5CSJ A;  4BY4 A;  1J7O A;  1RRO A;  1FBV A;  5AXI A;  1BJF A;  1CLM A;  1QX2 A;  2I7A A;  2OPO A;  1S3P A;  2JU0 A;  1Y1X A;  3GK1 A;  1V1G A;  1OZO A;  1QIW A;  3NXA A;  3SG4 A;  1SW8 A;  4MZL A;  5I2O A;  2JNX A;  2A4J A;  1F55 A;  1YVL A;  1CM4 A;  3DVJ A;  4BY5 A;  4GAO A;  1K8U A;  2L5X B;  2M7N A;  1V1F A;  2LM5 A;  1SL9 A;  1B8L A;  3GK2 A;  4GGF C;  4HRE E;  4XJK B;  4ZCU A;  4WQ2 A;  2KI4 B;  1RFJ A;  3ZNI A;  3OX6 A;  4NDD A;  1CKK A;  1DVI A;  1QV1 A;  2MA2 A;  3KHE A;  1NX2 A;  5CSF A;  3SG7 A;  1DF0 A;  1ZMZ A;  2BCA A;  2COL B;  2K8M B;  3I5H B;  5CSN A;  5HKZ A;  2M1K B;  2K7D A;  1CDL A;  1KQM C;  1SL8 A;  5HKW A;  1K9P A;  2D8N A;  3BUM B;  2NZ0 A;  3LK0 A;  4I5K A;  4YGD B;  3SIA A;  2B1U A;  3AKA A;  3NSK A;  3C1V A;  1J7Q A;  1K2H A;  1QJT A;  1NCY A;  2M97 A;  1BLQ A;  1XO5 A;  2LVI A;  1NCZ A;  1WLZ A;  3BUX B;  1Y6W A;  4NDC A;  1AP4 A;  2LHL A;  1F54 A;  1SMG A;  2JT8 A;  2LNK A;  2BBN A;  1QVI Z;  3BQ3 A;  2KNE A;  2AMI A;  3VRN A;  1WRL A;  1A2X A;  2ZFD A;  1YX7 A;  4PE1 A;  3SG2 A;  2Y1N A;  2H61 A;  3VRO A;  5TNC A;  5DKR A;  2RGI A;  2PRU A;  2R2I A;  1JSA A;  3FIA A;  1KSM A;  2JWW A;  2JC2 A;  2K7C A;  3PFV A;  3RLZ A;  3TUY C;  3BOW B;  4CFQ A;  1NWD A;  5KU1 A;  1K9U A;  4IL1 A;  4M2O A;  2LV7 A;  1PAL A;  4PDZ A;  2KGB C;  4R1E A;  5HKY A;  1EJ3 A;  1B4C A;  4ICB A;  4ZCV A;  1QVI Y;  4DIR A;  2F2O A;  4C0K A;  3I5F C;  1M39 A;  1NP8 A;  2JUL A;  1DJI A;  2KYC A;  1AK8 A;  1JF0 A;  4WQ3 A;  4YRU A;  5PAL A;  1B8R A;  2HET A;  1KCY A;  4Q04 A;  1CFC A;  1EG3 A;  1F4O A;  4YGB B;  1XVJ A;  1BR4 B;  1F8H A;  4GNK B;  5B8I B;  1H8B A;  1SK6 D;  2QPT A;  2KI6 D;  1DJY A;  4AOM A;  2LLT A;  2F3Z A;  3JVT C;  2HQW A;  3PSR A;  1EH2 A;  1KWO B;  4YGE B;  1NX3 A;  4YGA A;  5AER A;  5I2Q A;  1SCV A;  3NSI A;  4P2Y B;  4DRW A;  1AUI B;  4F0Z B;  3LK1 A;  4MBE A;  2CT9 A;  1KSO A;  3OX5 A;  3GOF A;  2BKI B;  1F71 A;  5ER4 X;  3VRR A;  2KGR A;  3NSL A;  1HQV A;  3WHT B;  3AKB A;  2NCO A;  1SR6 C;  1XFW O;  1UP5 A;  1DF0 B;  1A75 A;  1NX0 A;  1A4P A;  1KK8 C;  2CXJ A;  4ORA B;  2KFG A;  2JQ6 A;  5HYD A;  1B47 A;  1TN4 A;  3BUN B;  3SJS A;  1XFZ O;  1JC2 A;  2H61 C;  2LMV A;  1OMD A;  3EVV A;  1IG5 A;  3A4U B;  2LP2 A;  3BXK A;  2OS8 C;  2MJW B;  1SR6 B;  4WRI A;  1YUS A;  1KFU S;  2KQY A;  2KYF A;  1ZUZ A;  4I5J A;  2KAX A;  2L50 A;  3I5I B;  4JWQ A;  5BPJ A;  3SIB A;  3CR5 X;  1XK4 A;  2M29 A;  1S6I A;  2DOQ A;  2I94 A;  4QJ5 B;  4P5O E;  1KK7 Z;  2F8P A;  2V53 A;  3ZWH A;  1L7Z A;  2ISD A;  2KBI A;  1H4B A;  1F4Q A;  1NUB A;  1TCF A;  2BBM A;  3LL8 B;  1OMR A;  1YUU A;  3EKH A;  3PLF B;  4C0J A;  1OE9 B;  1XYD A;  2OS8 B;  3ICB A;  2KI4 C;  2LE9 B;  3LCP C;  3EK8 A;  4HRG A;  2AUC A;  4GGN A;  2SAS A;  1SL7 A;  4YGC B;  2JZI A;  4MRX A;  1TNX A;  3CR4 X;  2PMY A;  2FJU B;  5DKQ A;  3I5H C;  1MXE A;  2GGM A;  3O2P A;  1UUS A;  2WC8 A;  1GQM A;  2L51 A;  1IJ5 A;  1KK7 Y;  4YI8 A;  1DJZ A;  1S5G Z;  1Y1U A;  1JWD A;  1J7R A;  1A29 A;  1OZS A;  3CWG A;  4UPG A;  4PE0 A;  1PVB A;  3K21 A;  4HSZ A;  1FI5 A;  4I5L B;  2VRG A;  1MF8 B;  1YX8 A;  4YBH B;  1LIN A;  1CFP A;  2F33 A;  3AAK A;  2FCD A;  3DF0 B;  3LLE A;  3RM1 A;  2LVK A;  4NQG A;  2Q4U A;  1CTR A;  1J7P A;  1TNP A;  3AAJ A;  2KDH A;  2PAL A;  4M2Q A;  1TRF A;  4OVN F;  1OMV A;  1DGV A;  1N0Y A;  1LA3 A;  2GGZ A;  3TDU A;  2PSR A;  4OKH A;  5IBW A;  1B7T Y;  2JT0 A;  1S5G Y;  3BUO B;  3DVM A;  2MLE C;  1UWO A;  1K94 A;  1CMG A;  1M63 B;  2K61 A;  1A75 B;  3O6B A;  2KOT A;  2OTG B;  2P6B B;  1YRT B;  1XFU O;  2KQ6 A;  2BCX A;  1W7J B;  1K9K A;  3OB2 B;  1XA5 A;  1SRA A;  1SNL A;  1E8A A;  1X02 A;  1QLK A;  1BU3 A;  2BCB A;  2M1U A;  4PHN A;  5AFP A;  3A8R A;  1ZAC A;  1SY9 A;  4L9M A;  1W7I B;  2ZKM X;  3O78 A;  1TIZ A;  1BF5 A;  1RK9 A;  1G8I A;  1AHR A;  3PAT A;  4I5N B;  5AEQ A;  4GPL B;  3SG3 A;  1BOD A;  1K90 D;  1ALW A;  1UHK A;  1DGU A;  1PVA A;  2G9B A;  3OB1 B;  3D10 A;  2CTN A;  4YI9 A;  4DCK A;  2EGD A;  3CZT X;  4QJ4 B;  1KWO C;  1BR1 B;  1IQ3 A;  4MLW A;  3F45 A;  1IQ5 A;  1M45 A;  2M8U A;  2MLF C;  4MN0 A;  5I8N A;  5JJG A;  3VRP A;  1NSH A;  2KHN A;  3IF7 A;  4MEW A;  1NYA A;  1SPY A;  2KFF A;  4XYN A;  4AQJ A;  1Y0V H;  1C7W A;  1DJX A;  1KFX L;  1M31 A;  2K7O A;  1EG4 A;  2KBM A;  2Y4Q A;  2PAS A;  1JFJ A;  4A4C A;  4N5X A;  1CFD A;  3DF0 A;  2L0P A;  1BT6 A;  1TNW A;  2LMU A;  3WNX B;  4GFT A;  1ODB A;  1TTX A;  3SG6 A;  1C7V A;  1FPW A;  1XFX O;  3TS5 B;  1QAT A;  2ZND A;  3I5G C;  1J55 A;  4DUQ A;  3CR2 A;  5JOL A;  1J1D A;  1C07 A;  1L2O C;  3OP0 A;  4OCI A;  1CM1 A;  1LA0 A;  2E30 A;  2L98 A;  3I5I C;  2BL0 B;  3QRX A;  1CMF A;  4DS7 A;  2KAY A;  1DJH A;  2L4I A;  1MQ1 A;  2JNF A;  4GGF A;  2MAZ A;  4MSP A;  2FOT A;  4PE4 A;  1DJG A;  1MR8 A;  1PSR A;  2NLN A;  4C0L A;  3I5G B;  4E68 A;  1QTX A;  1HT9 A;  2ZRS A;  3CLN A;  1SCM B;  1L2O B;  1K95 A;  1UHJ A;  2F3Y A;  2KFH A;  2QAC A;  3PAL A;  1DT7 B;  1CDN A;  1TOP A;  1KQV A;  2E6W A;  2CCM A;  1TCO B;  1QIV A;  1RJV A;  1YR5 A;  1F70 A;  1NX1 A;  3DVK A;  4JPZ B;  1GGW A;  4N1F A;  1CLL A;  2MRD A;  1VRK A;  4MZK A;  2JTZ A;  2EHB A;  3KEV A;  1WLM A;  4N1G A;  2JOJ A;  2LHI A;  1QV0 A;  2M9G A;  1G33 A;  4PHJ A;  4TNC A;  2CBL A;  1PRW A;  3GK4 X;  1ZOT B;  1PK0 D;  2HF5 A;  3FS7 A;  2Y5I A;  2H2K A;  1D1O A;  1QLS A;  2JXC A;  1TNQ A;  1Q80 A;  1AJ4 A;  1UHN A;  3DD4 A;  3D0Y A;  1OOJ A;  1REC A;  2AAO A;  2NCP A;  5F6T A;  5DKN A;  3WHU B;  1AJ5 A;  1DTL A;  1SKT A;  2LLU A;  2LP3 A;  1IJ6 A;  5KSZ A;  1B7T Z;  2F2P A;  2HQ8 A;  1MUX A;  5AAN A;  3EK4 A;  4CFR A;  4CLN A;  2JT3 A;  2Q91 A;  5GQQ C;  2ZN9 A;  4CPV A;  2Y1M A;  1FW4 A;  1S1E A;  5ER5 A;  3TDI A;  1WDC C;  4PE7 A;  1MWN A;  2BE6 A;  2TN4 A;  1EXR A;  3KO0 A;  4FTG A;  3MSE B;  2KAV A;  4ETO A;  1IGV A;  1BMO A;  2BE4 A;  2OTG C;  1M46 A;  5CPV A;  1EL4 A;  1S36 A;  2JRF A;  1NCX A;  2M49 B;  1K96 A;  2FCE A;  5D69 A;  1IWQ A;  3WXA A;  1B8C A;  1WDC B;  5CSI A;  1UHH A;  4MZJ A;  3PN7 C;  1SBJ A;  4D1E A;  1B9A A;  1JFK A;  3KPX A;  1NIW A;  1LKJ A;  1QS7 A;  1XK4 C;  2M0R A;  1QX5 B;  2O60 A;  3M0W A;  1GJY A;  1B1G A;  4FQO A;  2IS9 A;  2WND A;  4NDB A;  2JPT A;  1DJW A;  3KF9 A;  1PSB A;  4PHK A;  3PN7 B;  1R6P A;  2LVV A;  1CLB A;  2LAN A;  1QAS A;  3JTD C;  4M2P A;  5HLO A;  1FF1 A;  2GV5 A;  1WRZ A;  1ALV A;  1LVC D;  1YUT A;  2O5G A;  1J1E A;  1G4Y R;  1R2U A;  4HRH A;  2MBX A;  1KQM B;  2JTT A;  1CB1 A;  2LVJ A;  1RWY A;  1N2D A;  1ZFS A;  3BUW B;  3PM8 A;  4USL A;  5I2L A;  2ZN8 A;  1JBA A;  3TS5 C;  1S6J A;  1IKU A;  1OSA A;  1N65 A;  2CNP A;  4ORC B;  3JTD B;  2G2B A;  1UUR A;  4ORB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...