3CGAA

Crystal structure of metastasis-associated protein s100a4 in the active, calcium-bound form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
87
structure length
87
Chain Sequence
PLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A4
publication title Crystal structure of metastasis-associated protein S100A4 in the active calcium-bound form
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 27
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cgaA00
2I94A 1LKJA 2KSPA 5DKNA 2BBNA 1J7RA 1K8UA 1F4QA 4MRYA 2BCBA 3FS7A 4GGFA 2Y1NA 3I5IB 1MXLC 1DJGA 1JFKA 3RM1A 1KFUL 1B1GA 1ALWA 3BXKA 5CSIA 3SJSA 4MZLA 1C7VA 5J3XA 1CMGA 2CTNA 2AAOA 3EVVA 1D1OA 1A2XA 3PSRA 2BECA 1J55A 1WRKA 4MBEA 2MLEC 4MRXA 2LVIA 1YUSA 1KFUS 3TUYB 1YX7A 2NLNA 4I5JA 5HKWA 2H61C 2I7AA 1J7QA 2KFGA 1UUSA 2M97A 4ORBB 2WCFA 5HKYA 2MHHA 3GK1A 2ISDA 1WLMA 3VRNA 2DOQA 2G9BA 2H2KA 3AKBA 4BY4A 2L5XB 1Y1AA 2KAXA 1SCVA 5CSNA 1NX2A 2KI6D 1IKUA 2BE4A 1UHIA 4NDDA 1C7WA 1KK7Y 2BKHB 4C0KA 1OQPA 2R2IA 1NPQA 1CDLA 1WRZA 1XFUO 1SR6C 4PE0A 4YI9A 2LVVA 3TUYC 3D10A 1MR8A 1YUUA 4CIDA 2KI4B 2HQ8A 2MBXA 5PALA 1NYAA 3K21A 5HLOA 5HLVA 4C0LA 4GBAA 1BODA 1CMFA 1N2DA 1TN4A 2LE9B 2L98A 1BLQA 3PALA 4MEWA 2LP3A 1EL4A 2OS8C 1UHHA 2JULA 1YVLA 2KQ6A 4F0ZB 1QVIZ 4M2QA 1BG1A 1PVAA 1QX5B 1UHNA 3PLFB 1L2OC 3I5FB 1M46A 2KBIA 3SG7A 2VRGA 1AJ4A 4M2OA 2LAPA 2MLFC 2KI4C 1WRLA 2JTZA 2TN4A 1XK4A 1YRTB 4HRHA 1QLSA 3PFVA 1FI6A 2ZRTA 4ZCUA 1S5GZ 2FCEA 2M1KB 4YBHB 2CBLA 1FF1A 1LA0A 1IQ5A 3BUNB 1A4PA 2KYFA 1SPYA 1B7TY 1DF0B 1QATA 2M7NA 4ZCVA 1XYDA 3SIBA 1C07A 1RK9A 5KSZA 4FTGA 1U5IA 1QS7A 1CB1A 1OMDA 2F2OA 2LLUA 3O2PA 4DRWA 2L51A 1NCXA 1NCZA 4AQJA 1DVIA 2EHBA 3TDZA 2ZNEA 4IL1A 1MHOA 2A4JA 3GK2A 1YURA 3DVMA 1JSAA 1GJYA 3TDIA 1SL7A 2IS9A 3E3RA 4JPZB 1DJWA 1HQVA 2KOTA 4GNKB 1B8LA 1QASA 3F45A 3LL8B 3CS1A 4OVNF 1CKKA 1JC2A 2BCXA 1DJYA 4PALA 1IRJA 5AXIA 2PASA 1K2HA 2GGMA 1KQVA 4YGCB 4Q04A 2PMYA 2HPSA 1TOPA 3FIAA 2KQYA 4YGDB 3LLEA 4OV2A 1OSAA 5CPVA 1CFPA 1Y1XA 1TTXA 2Q91A 1CFFA 4PHNA 1ZMZA 1IWQA 5DKRA 3CZTX 3RLZA 2BBMA 3GK4X 1GQMA 2L2EA 5D7FA 3WXAA 1PSBA 2MAZA 4R1EA 1SW8A 2OPOA 3M0WA 1RECA 1KK8C 1S1EA 2KBMA 3FWBA 2LMVA 3VGOA 1EG3A 2GGZA 2EC6C 1A75B 1NUBA 4GFTA 1BMOA 1CFCA 3KEVA 1SNLA 4GPLB 4N5XA 2Q4UA 1UURA 2KI6C 1SKTA 2LV7A 1KSMA 1QIWA 1QX2A 1SCMC 3QRXA 4WQ3A 3CR5X 1DMOA 2M1UA 1RROA 1UHJA 3KPXA 2LP2A 4PHMA 4NDBA 1K90D 2BL0C 3OX5A 4PHKA 1SR6B 4YI8A 2M9GA 2JRFA 2JPTA 1F4OA 2L50A 3AAJA 1MWNA 1TRFA 2JXCA 2ZNDA 3I5HC 2M7LA 2KGRA 3PN7C 2NXQA 4PE1A 4A4BA 2E30A 3TDUA 3O6BA 1K93D 2ZFDA 1CDNA 4YGAA 1W7JB 1A29A 2OS8B 1CFDA 1IGVA 3SG5A 1BJFA 1QX7A 1W7IB 3WNXB 5ER5A 1RWYA 1K95A 1SL8A 2OTGB 1XFVO 4I5KA 1V1FA 2E6WA 2LC5A 2GV5A 3O78A 1L2OB 3WHTB 1B4CA 1F55A 4XJKB 2KDHA 1YUTA 3NSIA 3OB2B 1JF2A 2ZKMX 3LK0A 3IQOA 1M63B 1S6IA 3BOWB 2V53A 4PHJA 4BY5A 5AEQA 2JNXA 1JF0A 2H61A 2M49B 1YX8A 3CR2A 3TS5C 1ALVA 1M31A 1UHKA 3CTNA 4HRGA 3SG2A 1Q80A 3JTDB 4NQGA 1VRKA 4DS7A 4WRIA 3OP0A 4P5OE 1AK8A 1H8BA 2K61A 1NX3A 4CLNA 1OE9B 1YTZC 2JT3A 2OTGC 3A4UB 1EG4A 4L9MA 1PK0D 1B9AA 5HYDA 2K7OA 4MVFA 3VRQA 3C1VA 1QV1A 1XVJA 1NX1A 1NX0A 2LUCA 2PSRA 1DTLA 1J7PA 3EK7A 2KAYA 2L4IA 2WC8A 4HSZA 4MZJA 5IBWA 2Y1MA 1QVIY 1XO5A 2JXLA 3VRRA 1JUOA 3EVUA 2LLSA 1LXFC 2JNFA 1G33A 1A03A 3AKAA 3NSLA 2G2BA 3ZNIA 2LM5A 3JTDC 1S36A 1BU3A 4OKHA 2ZRSA 2MA2A 3OX6A 1KCYA 1KSOA 5CSFA 1YR5A 1X02A 2NCPA 2LANA 1HT9A 1IQ3A 1K94A 1AHRA 1S5GY 2CT9A 3CWGA 3EK4A 3EVRA 1JFJA 1V1GA 1N65A 1IG5A 2F8PA 1PRWA 4P2YB 3ZWHA 3NSOA 2L4HA 1M45A 4E68A 1TNXA 1R6PA 2O60A 1AP4A 4YGEB 3MSEB 2K2FA 4GGNA 4I5NB 2JU0A 3BUWB 2KAVA 3BYAA 5BPJA 1BR4B 1DT7B 5I2LA 1S26D 2I18A 4JQ0D 1QV0A 1RTP1 1KK8B 2L0PA 4ORCB 1YVHA 3VROA 1CDPA 2PALA 2COLB 1F71A 1XFXO 2EC6B 1PULA 2ZN9A 4D1EA 1BOCA 2AUCA 2Y4QA 4ICBA 5AANA 2K2AA 2QPTA 1SMGA 2WORA 2QACA 1PSRA 4TNCA 3DVKA 1RJVA 3CLNA 1GGWA 1ODBA 1SCMB 3BUMB 1DGVA 2JT8A 4AQIA 2BL0B 2M3WA 1QLKA 4USLA 3GOFA 4I5LB 2JT0A 5GQQC 1Y0VH 2FJUB 3I5HB 1B8RA 4GGFC 1CTRA 2JTTA 3OB1B 3PN7B 1SBJA 2SASA 1ZUZA 4UPGA 2WCEA 1ZOTB 1EJ3A 3WHUB 3TZ1A 4YGBB 1CLBA 2CCMA 3D0YB 4GUKA 1DF0A 3SG4A 1S6JA 3DVEA 2F3YA 4MSPA 4DCKA 5I2OA 1EH2A 1FPWA 1IJ6A 1TIZA 5ER4X 1UWOA 1KWOC 4QJ4B 1GGZA 3I5GC 1CDMA 1S3PA 2I2RE 4XYNA 2M0RA 3SIAA 4CFRA 1AUIB 3AAKA 1BF5A 1QJTA 2BKIB 2RGIA 5I2QA 4HREE 2LMUA 2EGDA 4DUQA 4WQ2A 1OZOA 3H4SE 1Y6WA 2JWWA 2K7DA 3TS5B 1KQMB 4PE4A 1TNQA 2HQWA 1F70A 1LA3A 1TCFA 1EXRA 2KNEA 1TCOB 3NSKA 2AMIA 1F54A 5D69A 5TNCA 5KTYA 1CM4A 2FOTA 3PM8A 1XA5A 3FWCA 4MN0A 5F6TA 1WDCC 2K0JA 1KK7Z 3DF0B 3BUXB 1XFWO 1CNPA 1R2UA 1LINA 1K96A 5I8NA 4NDCA 1DJZA 2NZ0A 1NCYA 1SRAA 1TNPA 3PATA 2O5GA 1DJIA 1KQMC 1U5IB 5DKQA 1DJHA 3I5IC 1ZACA 3NXAA 5JOLA 4ORAB 2B1UA 2JC2A 3SG3A 2PRUA 5AFPA 1K9KA 1CLLA 1F8HA 3OHMB 1M39A 2FCDA 3D0YA 1NP8A 2LHLA 1A75A 2BE6A 5JJGA 1XK4C 2KFHA 2LVKA 1J1EA 4PE7A 2HETA 3HCMA 3IF7A 2MRDA 1BR1B 2SCPA 2LMTA 3BUOB 2JQ6A 2F33A 2KYCA 2WOSA 4QJ3B 4FQOA 1MXEA 4QJ5B 2JOJA 2LLTA 3EKHA 2PVBA 1MQ1A 1G4YR 1JBAA 1G8IA 2LHIA 1PALA 2KGBC 2LVJA 5FYXA 4MZKA 3VRPA 2K7CA 1OOJA 1TNWA 4CPVA 1MUXA 1B7TZ 1H4BA 2HF5A 3CR4X 2F3ZA 4XJKA 3ICBA 1NSHA 4AOMA 1QIVA 2WCBA 2LUXA 1FBVA 4OR9B 3DF0A 1KFXL 1OMRA 3BQ3A 3BOWA 1XFYO 2M8UA 2CXJA 4DIRA 4C0JA 1QXPA 1OZSA 1BT6A 2ZN8A 1KFXS 1NWDA 3I5FC 1SY9A 2KHNA 3DD4A 1Y1UA 3KHEA 1S6CA 3A8RA 3KF9A 1FW4A 1JWDA 4OCIA 4U8DA 4A4CA 2LCPA 1CM1A 1AVSA 1K9UA 2WNDA 4CFQA 1K9PA 4PDZA 1YRUB 4N1FA 3CGAA 1KWOB 2MJWB 5KU1A 1J1DA 1QTXA 3I5GB 3LCPC 1PVBA 2BCAA 1DGUA 5HKZA 3JVTB 1SL9A 2Y5IA 4ETOA 1L7ZA 4YRUA 2K7BA 5CSJA 1B8CA 1LVCD 1ZFSA 1RFJA 1E8AA 4JWQA 5K89A 1WY9A 1N0YA 2JZIA 4GAOA 5B8IB 1B47A 1OMVA 1XFZO 1IH0A 4M2PA 2P6BB 2LNKA 1SK6D 3HX4A 1IJ5A 5G08A 3DVJA 3EKJA 4MLWA 2CNPA 1WLZA 1J7OA 2D8NA 1SYMA 3O4YA 5AERA 2KFFA 2M29A 3EK8A 3KO0A 3SG6A 1AJ5A 4PCWA 1CLMA 3JVTC 3LK1A 1WDCB 2K8MB 2NCOA 4N1GA 3IQQA 1NIWA 1FI5A 1MF8B 1UP5A 1DJXA 2F2PA
chains in the Genus database with same CATH superfamily
2I94A 1LKJA 2KSPA 5DKNA 2BBNA 1J7RA 1K8UA 1F4QA 4MRYA 2BCBA 3FS7A 4GGFA 2K60A 2Y1NA 3O4XA 3I5IB 1MXLC 1DJGA 1JFKA 3RM1A 3DXLA 2FJYA 1KFUL 2QEHA 1B1GA 1ALWA 3BXKA 5CSIA 3SJSA 4MZLA 1C7VA 5J3XA 1CMGA 2CTNA 2AAOA 3EVVA 1D1OA 1A2XA 3PSRA 2BECA 1J55A 1WRKA 4MBEA 2MLEC 4MRXA 2LVIA 1YUSA 1KFUS 3TUYB 1YX7A 2NLNA 4I5JA 5HKWA 2H61C 2I7AA 1J7QA 3D73A 2KFGA 3L4AA 1UUSA 2M97A 5EL2A 4ORBB 2WCFA 5HKYA 2MHHA 3GK1A 2ISDA 1QWVA 1WLMA 3VRNA 2DOQA 2G9BA 2H2KA 3AKBA 4BY4A 3S0AA 3CZ1A 2L5XB 1Y1AA 2KAXA 1SCVA 5CSNA 1NX2A 3N7HA 2KI6D 1IIOA 1IKUA 1UHIA 2BE4A 4NDDA 1C7WA 1KK7Y 2BKHB 4C0KA 1OQPA 2R2IA 1NPQA 1CDLA 1WRZA 1XFUO 1SR6C 4PE0A 4YI9A 2LVVA 3TUYC 1ORGA 3D10A 1MR8A 1YUUA 4CIDA 2KI4B 2HQ8A 3CZ2A 2MBXA 5PALA 1NYAA 1OW4A 3K21A 5HLOA 5HLVA 4C0LA 4GBAA 1BODA 1CMFA 1N2DA 1TN4A 2LE9B 2L98A 1GM0A 1BLQA 3PALA 4MEWA 2LP3A 1EL4A 2OS8C 1UHHA 2JULA 1YVLA 2KQ6A 4F0ZB 1QVIZ 4M2QA 1BG1A 1PVAA 1QX5B 1UHNA 1XFRA 1L2OC 3PLFB 3I5FB 1M46A 2KBIA 3UNWA 3SG7A 2VRGA 3VB1A 1AJ4A 4M2OA 3Q8IA 2LAPA 3EG5B 2MLFC 1DQEA 2KI4C 1WRLA 2JTZA 2TN4A 1XK4A 1YRTB 4HRHA 1QLSA 3PFVA 1FI6A 2ZRTA 4ZCUA 1S5GZ 2FCEA 2M1KB 4YBHB 2CBLA 1FF1A 1LA0A 1IQ5A 3BUNB 1A4PA 2KYFA 1SPYA 3K1EA 1B7TY 1DF0B 1QATA 2M7NA 4ZCVA 1XYDA 3SIBA 1C07A 1RK9A 5KSZA 4FTGA 1U5IA 5HL1A 1QS7A 1CB1A 5D3OA 1OMDA 2F2OA 2LLUA 3O2PA 4DRWA 2L51A 1NCXA 1NCZA 3CDNA 4AQJA 1DVIA 2EHBA 3BFHA 3TDZA 2ZNEA 4IL1A 1MHOA 2A4JA 3GK2A 1YURA 3DVMA 1JSAA 1GJYA 3TDIA 1SL7A 2IS9A 3E3RA 4JPZB 1DJWA 1HQVA 1OOIX 2KOTA 4GNKB 1B8LA 1QASA 3F45A 3LL8B 3CS1A 4OVNF 1CKKA 3D76A 1JC2A 2BCXA 1DJYA 4PALA 1IRJA 5AXIA 2PASA 1K2HA 2GGMA 3S0FA 1KQVA 4YGCB 4Q04A 2PMYA 3DYEA 2HPSA 1TOPA 3FIAA 2KQYA 4YGDB 1DELA 3LLEA 3B87A 4JKTA 4OV2A 1OSAA 5CPVA 1CFPA 1Y1XA 1TTXA 2Q91A 1CFFA 3PJIA 4PHNA 1ZMZA 1IWQA 3R1VA 5DKRA 2H8VA 3CZTX 2BBMA 3NHIA 3RLZA 3R1PA 3GK4X 1GQMA 2L2EA 5D7FA 3WXAA 1PSBA 2MAZA 4R1EA 1SW8A 2OPOA 3M0WA 1RECA 1KK8C 1S1EA 2KBMA 3FWBA 2LMVA 3CZ0A 3VGOA 1EG3A 2GGZA 2EC6C 1SSEB 2L5YA 1A75B 1NUBA 4GFTA 1BMOA 1CFCA 3KEVA 1SNLA 4GPLB 4N5XA 2Q4UA 1UURA 2KI6C 1SKTA 2LV7A 2PYQA 1KSMA 1QIWA 1QX2A 3CYZA 4PT1A 1SCMC 4JD9A 3QRXA 4WQ3A 3CR5X 5FI6A 2M1UA 1RROA 1UHJA 3KPXA 1DMOA 2LP2A 4PHMA 2KPHA 4NDBA 1K90D 2BL0C 3OX5A 4PHKA 1SR6B 4YI8A 2M9GA 2JRFA 2JPTA 1F4OA 2L50A 3AAJA 1MWNA 1TRFA 2JXCA 2ZNDA 2WCMA 3I5HC 4KYNA 2M7LA 2KGRA 3PN7C 2NXQA 4PE1A 3UO9A 2E30A 4A4BA 3TDUA 2JPOA 3O6BA 1K93D 2ZFDA 1CDNA 4YGAA 1W7JB 1A29A 2OS8B 1CFDA 1IGVA 1T14A 1BJFA 1W7IB 1QX7A 3OBVA 3SG5A 3WNXB 5ER5A 1RWYA 1K95A 1SL8A 2OTGB 1XFVO 4I5KA 1V1FA 2E6WA 2LC5A 2GV5A 2WC5A 1L2OB 3O78A 3WHTB 1B4CA 1F55A 4XJKB 2KDHA 1YUTA 3NSIA 3OB2B 1JF2A 2ZKMX 3FE8A 3LK0A 3IQOA 1M63B 1S6IA 3S0BA 3RZSA 3BOWB 2V53A 4PHJA 4BY5A 5AEQA 2JNXA 1JF0A 2H61A 2M49B 1YX8A 3CR2A 3TS5C 1ALVA 4IJ7A 1M31A 1UHKA 3CTNA 4HRGA 3SG2A 1Q80A 3JTDB 4NQGA 1VRKA 4DS7A 4WRIA 3OP0A 4P5OE 1AK8A 1H8BA 5DICA 2K61A 1NX3A 4CLNA 1OE9B 1YTZC 2JT3A 2OTGC 3A4UB 1EG4A 3L47A 1PK0D 1B9AA 4L9MA 2K7OA 5HYDA 4MVFA 3VRQA 3C1VA 1QV1A 1XVJA 1NX1A 1NX0A 2LUCA 3DY9A 5FI2A 2WCKA 2PSRA 1DTLA 1J7PA 2KLEA 3EK7A 2KAYA 2L4IA 2WC8A 4HSZA 4MZJA 5IBWA 2Y1MA 1QVIY 1XO5A 2JXLA 3VRRA 1JUOA 3EVUA 2LLSA 1LXFC 2JNFA 1G33A 1A03A 3AKAA 3NSLA 3B6XA 2G2BA 1OOGA 3ZNIA 2LM5A 3JTDC 1S36A 1OOFA 1BU3A 4OKHA 3V2LA 2ZRSA 2MA2A 3OX6A 1KCYA 1C3ZA 3D74A 1KSOA 5CSFA 1YR5A 1X02A 2NCPA 1TUZA 2LANA 1HT9A 1IQ3A 1K94A 1AHRA 1S5GY 2CT9A 2PQLA 3CWGA 3EK4A 3EVRA 1JFJA 1V1GA 1N65A 1IG5A 2F8PA 1PRWA 4P2YB 2QEBA 3NSOA 3ZWHA 2L4HA 1M45A 4E68A 1TNXA 1R6PA 2O60A 2KLDA 1AP4A 4YGEB 3MSEB 2K2FA 4GGNA 3SS3A 4I5NB 2JU0A 3BUWB 2KAVA 3SS4A 3BYAA 5I94A 5BPJA 1BR4B 1DT7B 5I2LA 1S26D 1DEKA 2I18A 1QV0A 1RTP1 4JQ0D 3FE6A 1KK8B 2L0PA 4ORCB 1YVHA 3VROA 1CDPA 2PALA 2COLB 1F71A 1XFXO 2EC6B 1PULA 2ZN9A 4OZDA 4D1EA 1BOCA 2AUCA 2Y4QA 4ICBA 5AANA 2K2AA 2QPTA 3NGVA 1SMGA 2WORA 2QACA 1PSRA 3FE9A 4TNCA 3DVKA 1RJVA 3CLNA 1GGWA 1ODBA 1SCMB 3BUMB 1DGVA 2JT8A 2BAPA 4AQIA 2BL0B 2M3WA 1QLKA 4USLA 1Z2CB 3GOFA 4I5LB 2JT0A 3OGNA 5GQQC 1Y0VH 2ERBA 2FJUB 1B8RA 3I5HB 4GGFC 1CTRA 2JTTA 3OB1B 3PN7B 1SBJA 2SASA 1ZUZA 4UPGA 2WCEA 1Z4HA 1ZOTB 1EJ3A 3WHUB 3TZ1A 4YGBB 1CLBA 2CCMA 3D0YB 4GUKA 1DF0A 3SG4A 1S6JA 5FI7A 3DVEA 2F3YA 4MSPA 4DCKA 3CABA 5I2OA 3L4LA 1EH2A 1IJ6A 1FPWA 1TIZA 5ER4X 1UWOA 3S0GA 1KWOC 2GTEA 4QJ4B 1GGZA 1TWOA 3I5GC 3R72A 1CDMA 1S3PA 2I2RE 4XYNA 2M0RA 3SIAA 2P70A 4CFRA 1AUIB 3AAKA 1BF5A 3S0DA 1QJTA 2BKIB 2RGIA 5I2QA 4HREE 2LMUA 2EGDA 4DUQA 4WQ2A 1OZOA 3H4SE 1DC1A 1Y6WA 2JWWA 3D78A 2K7DA 2L2CA 3PM2A 3TS5B 2BNXA 1KQMB 4PE4A 1TNQA 2HQWA 1F70A 1LS8A 1LA3A 1TCFA 1EXRA 2KNEA 1TCOB 3NSKA 2AMIA 1F54A 3DZTA 5D69A 5TNCA 5KTYA 1CM4A 2FOTA 3R1OA 3PM8A 1XA5A 1OOHA 3FWCA 3IVTA 4MN0A 5F6TA 1WDCC 2K0JA 1KK7Z 3DF0B 2WCJA 3BUXB 1XFWO 4INXA 1CNPA 1R2UA 1LINA 1K96A 5I8NA 2WC6A 4NDCA 1DJZA 2NZ0A 1NCYA 1SRAA 1TNPA 3PATA 2O5GA 1DJIA 1KQMC 1U5IB 5DKQA 1DJHA 3I5IC 1ZACA 3NXAA 1C3YA 5JOLA 4ORAB 2B1UA 2JC2A 3BFAA 3SG3A 2PRUA 5AFPA 1K9KA 1CLLA 1F8HA 3OHMB 1M39A 2FCDA 2QEOA 3D0YA 1NP8A 2LHLA 1A75A 2BE6A 5JJGA 3SS5A 1XK4C 2KFHA 2LVKA 1J1EA 4PE7A 2HETA 3HCMA 3IF7A 2MRDA 1BR1B 2SCPA 3BFBA 3D75A 2LMTA 3BUOB 2JQ6A 2F33A 4F7FA 1W9ZA 2KYCA 2WOSA 4QJ3B 4FQOA 1MXEA 4QJ5B 2JOJA 2LLTA 3EKHA 2PVBA 1MQ1A 1G4YR 1JBAA 1G8IA 2LHIA 1PALA 2KGBC 2LVJA 5FYXA 4MZKA 3NHTA 3VRPA 2K7CA 1OOJA 1TNWA 4CPVA 3QMEA 1MUXA 1B7TZ 4FQTA 1H4BA 2HF5A 3CR4X 2F3ZA 4XJKA 3ICBA 1TUJA 1NSHA 4AOMA 1QIVA 2WCBA 2LUXA 1FBVA 4OR9B 3DF0A 3D77A 1KFXL 1OMRA 3B88A 3BQ3A 1XFYO 2M8UA 3BOWA 2P71A 2CXJA 1P28A 4DIRA 4C0JA 1QXPA 1OZSA 1BT6A 2ZN8A 4INWA 1KFXS 1NWDA 3I5FC 1SY9A 2KHNA 3DD4A 2WCLA 1Y1UA 3KHEA 1S6CA 3A8RA 3KF9A 1FW4A 1JWDA 4OCIA 4U8DA 4A4CA 2LCPA 1CM1A 1AVSA 1K9UA 2WNDA 4CFQA 1K9PA 4PDZA 1YRUB 4N1FA 3CGAA 1KWOB 2MJWB 5KU1A 1J1DA 1QTXA 3I5GB 3LCPC 1PVBA 2BCAA 1DGUA 5HKZA 3JVTB 1SL9A 2Y5IA 4ETOA 1L7ZA 4YRUA 2K7BA 5CSJA 1B8CA 1LVCD 1ZFSA 1RFJA 1E8AA 4JWQA 5K89A 1WY9A 1N0YA 2JZIA 2WCHA 4GAOA 5B8IB 1B47A 1OMVA 1XFZO 1IH0A 4M2PA 2P6BB 2LNKA 2QEVA 2QDIA 1SK6D 3HX4A 1IJ5A 3BJHA 5G08A 3DVJA 2YGUA 3EKJA 4MLWA 2CNPA 1WLZA 1J7OA 2D8NA 1SYMA 3O4YA 5AERA 2KFFA 2M29A 3EK8A 3KO0A 3SG6A 1AJ5A 4PCWA 1CLMA 3JVTC 3LK1A 1WDCB 2K8MB 2NCOA 3S0EA 4N1GA 3IQQA 1NIWA 1FI5A 1MF8B 3B7AA 1UP5A 1DJXA 2F2PA 3B86A
chains in the Genus database with same CATH topology
2I94A 1LKJA 2KSPA 5DKNA 2BBNA 1J7RA 1K8UA 1F4QA 4MRYA 2BCBA 3FS7A 4GGFA 2Y1NA 3I5IB 1MXLC 1DJGA 1JFKA 3RM1A 1KFUL 1B1GA 1ALWA 3BXKA 5CSIA 3SJSA 4MZLA 1C7VA 5J3XA 1CMGA 2CTNA 2AAOA 3EVVA 1D1OA 1A2XA 3PSRA 2BECA 1J55A 1WRKA 4MBEA 2MLEC 4MRXA 2LVIA 1YUSA 1KFUS 3TUYB 1YX7A 2NLNA 4I5JA 5HKWA 2H61C 2I7AA 1J7QA 2KFGA 1UUSA 2M97A 4ORBB 2WCFA 5HKYA 2MHHA 3GK1A 2ISDA 1WLMA 3VRNA 2DOQA 2G9BA 2H2KA 3AKBA 4BY4A 2L5XB 1Y1AA 2KAXA 1SCVA 5CSNA 1NX2A 2KI6D 1IKUA 2BE4A 1UHIA 4NDDA 1C7WA 1KK7Y 2BKHB 4C0KA 1OQPA 2R2IA 1NPQA 1CDLA 1WRZA 1XFUO 1SR6C 4PE0A 4YI9A 2LVVA 3TUYC 3D10A 1MR8A 1YUUA 4CIDA 2KI4B 2HQ8A 2MBXA 5PALA 1NYAA 3K21A 5HLOA 5HLVA 4C0LA 4GBAA 1BODA 1CMFA 1N2DA 1TN4A 2LE9B 2L98A 1BLQA 3PALA 4MEWA 2LP3A 1EL4A 2OS8C 1UHHA 2JULA 1YVLA 2KQ6A 4F0ZB 1QVIZ 4M2QA 1BG1A 1PVAA 1QX5B 1UHNA 3PLFB 1L2OC 3I5FB 1M46A 2KBIA 3SG7A 2VRGA 1AJ4A 4M2OA 2LAPA 2MLFC 2KI4C 1WRLA 2JTZA 2TN4A 1XK4A 1YRTB 4HRHA 1QLSA 3PFVA 1FI6A 2ZRTA 4ZCUA 1S5GZ 2FCEA 2M1KB 4YBHB 2CBLA 1FF1A 1LA0A 1IQ5A 3BUNB 1A4PA 2KYFA 1SPYA 1B7TY 1DF0B 1QATA 2M7NA 4ZCVA 1XYDA 3SIBA 1C07A 1RK9A 5KSZA 4FTGA 1U5IA 1QS7A 1CB1A 1OMDA 2F2OA 2LLUA 3O2PA 4DRWA 2L51A 1NCXA 1NCZA 4AQJA 1DVIA 2EHBA 3TDZA 2ZNEA 4IL1A 1MHOA 2A4JA 3GK2A 1YURA 3DVMA 1JSAA 1GJYA 3TDIA 1SL7A 2IS9A 3E3RA 4JPZB 1DJWA 1HQVA 2KOTA 4GNKB 1B8LA 1QASA 3F45A 3LL8B 3CS1A 4OVNF 1CKKA 1JC2A 2BCXA 1DJYA 4PALA 1IRJA 5AXIA 2PASA 1K2HA 2GGMA 1KQVA 4YGCB 4Q04A 2PMYA 2HPSA 1TOPA 3FIAA 2KQYA 4YGDB 3LLEA 4OV2A 1OSAA 5CPVA 1CFPA 1Y1XA 1TTXA 2Q91A 1CFFA 4PHNA 1ZMZA 1IWQA 5DKRA 3CZTX 3RLZA 2BBMA 3GK4X 1GQMA 2L2EA 5D7FA 3WXAA 1PSBA 2MAZA 4R1EA 1SW8A 2OPOA 3M0WA 1RECA 1KK8C 1S1EA 2KBMA 3FWBA 2LMVA 3VGOA 1EG3A 2GGZA 2EC6C 1A75B 1NUBA 4GFTA 1BMOA 1CFCA 3KEVA 1SNLA 4GPLB 4N5XA 2Q4UA 1UURA 2KI6C 1SKTA 2LV7A 1KSMA 1QIWA 1QX2A 1SCMC 3QRXA 4WQ3A 3CR5X 1DMOA 2M1UA 1RROA 1UHJA 3KPXA 2LP2A 4PHMA 4NDBA 1K90D 2BL0C 3OX5A 4PHKA 1SR6B 4YI8A 2M9GA 2JRFA 2JPTA 1F4OA 2L50A 3AAJA 1MWNA 1TRFA 2JXCA 2ZNDA 3I5HC 2M7LA 2KGRA 3PN7C 2NXQA 4PE1A 4A4BA 2E30A 3TDUA 3O6BA 1K93D 2ZFDA 1CDNA 4YGAA 1W7JB 1A29A 2OS8B 1CFDA 1IGVA 3SG5A 1BJFA 1QX7A 1W7IB 3WNXB 5ER5A 1RWYA 1K95A 1SL8A 2OTGB 1XFVO 4I5KA 1V1FA 2E6WA 2LC5A 2GV5A 3O78A 1L2OB 3WHTB 1B4CA 1F55A 4XJKB 2KDHA 1YUTA 3NSIA 3OB2B 1JF2A 2ZKMX 3LK0A 3IQOA 1M63B 1S6IA 3BOWB 2V53A 4PHJA 4BY5A 5AEQA 2JNXA 1JF0A 2H61A 2M49B 1YX8A 3CR2A 3TS5C 1ALVA 1M31A 1UHKA 3CTNA 4HRGA 3SG2A 1Q80A 3JTDB 4NQGA 1VRKA 4DS7A 4WRIA 3OP0A 4P5OE 1AK8A 1H8BA 2K61A 1NX3A 4CLNA 1OE9B 1YTZC 2JT3A 2OTGC 3A4UB 1EG4A 4L9MA 1PK0D 1B9AA 5HYDA 2K7OA 4MVFA 3VRQA 3C1VA 1QV1A 1XVJA 1NX1A 1NX0A 2LUCA 2PSRA 1DTLA 1J7PA 3EK7A 2KAYA 2L4IA 2WC8A 4HSZA 4MZJA 5IBWA 2Y1MA 1QVIY 1XO5A 2JXLA 3VRRA 1JUOA 3EVUA 2LLSA 1LXFC 2JNFA 1G33A 1A03A 3AKAA 3NSLA 2G2BA 3ZNIA 2LM5A 3JTDC 1S36A 1BU3A 4OKHA 2ZRSA 2MA2A 3OX6A 1KCYA 1KSOA 5CSFA 1YR5A 1X02A 2NCPA 2LANA 1HT9A 1IQ3A 1K94A 1AHRA 1S5GY 2CT9A 3CWGA 3EK4A 3EVRA 1JFJA 1V1GA 1N65A 1IG5A 2F8PA 1PRWA 4P2YB 3ZWHA 3NSOA 2L4HA 1M45A 4E68A 1TNXA 1R6PA 2O60A 1AP4A 4YGEB 3MSEB 2K2FA 4GGNA 4I5NB 2JU0A 3BUWB 2KAVA 3BYAA 5BPJA 1BR4B 1DT7B 5I2LA 1S26D 2I18A 4JQ0D 1QV0A 1RTP1 1KK8B 2L0PA 4ORCB 1YVHA 3VROA 1CDPA 2PALA 2COLB 1F71A 1XFXO 2EC6B 1PULA 2ZN9A 4D1EA 1BOCA 2AUCA 2Y4QA 4ICBA 5AANA 2K2AA 2QPTA 1SMGA 2WORA 2QACA 1PSRA 4TNCA 3DVKA 1RJVA 3CLNA 1GGWA 1ODBA 1SCMB 3BUMB 1DGVA 2JT8A 4AQIA 2BL0B 2M3WA 1QLKA 4USLA 3GOFA 4I5LB 2JT0A 5GQQC 1Y0VH 2FJUB 3I5HB 1B8RA 4GGFC 1CTRA 2JTTA 3OB1B 3PN7B 1SBJA 2SASA 1ZUZA 4UPGA 2WCEA 1ZOTB 1EJ3A 3WHUB 3TZ1A 4YGBB 1CLBA 2CCMA 3D0YB 4GUKA 1DF0A 3SG4A 1S6JA 3DVEA 2F3YA 4MSPA 4DCKA 5I2OA 1EH2A 1FPWA 1IJ6A 1TIZA 5ER4X 1UWOA 1KWOC 4QJ4B 1GGZA 3I5GC 1CDMA 1S3PA 2I2RE 4XYNA 2M0RA 3SIAA 4CFRA 1AUIB 3AAKA 1BF5A 1QJTA 2BKIB 2RGIA 5I2QA 4HREE 2LMUA 2EGDA 4DUQA 4WQ2A 1OZOA 3H4SE 1Y6WA 2JWWA 2K7DA 3TS5B 1KQMB 4PE4A 1TNQA 2HQWA 1F70A 1LA3A 1TCFA 1EXRA 2KNEA 1TCOB 3NSKA 2AMIA 1F54A 5D69A 5TNCA 5KTYA 1CM4A 2FOTA 3PM8A 1XA5A 3FWCA 4MN0A 5F6TA 1WDCC 2K0JA 1KK7Z 3DF0B 3BUXB 1XFWO 1CNPA 1R2UA 1LINA 1K96A 5I8NA 4NDCA 1DJZA 2NZ0A 1NCYA 1SRAA 1TNPA 3PATA 2O5GA 1DJIA 1KQMC 1U5IB 5DKQA 1DJHA 3I5IC 1ZACA 3NXAA 5JOLA 4ORAB 2B1UA 2JC2A 3SG3A 2PRUA 5AFPA 1K9KA 1CLLA 1F8HA 3OHMB 1M39A 2FCDA 3D0YA 1NP8A 2LHLA 1A75A 2BE6A 5JJGA 1XK4C 2KFHA 2LVKA 1J1EA 4PE7A 2HETA 3HCMA 3IF7A 2MRDA 1BR1B 2SCPA 2LMTA 3BUOB 2JQ6A 2F33A 2KYCA 2WOSA 4QJ3B 4FQOA 1MXEA 4QJ5B 2JOJA 2LLTA 3EKHA 2PVBA 1MQ1A 1G4YR 1JBAA 1G8IA 2LHIA 1PALA 2KGBC 2LVJA 5FYXA 4MZKA 3VRPA 2K7CA 1OOJA 1TNWA 4CPVA 1MUXA 1B7TZ 1H4BA 2HF5A 3CR4X 2F3ZA 4XJKA 3ICBA 1NSHA 4AOMA 1QIVA 2WCBA 2LUXA 1FBVA 4OR9B 3DF0A 1KFXL 1OMRA 3BQ3A 3BOWA 1XFYO 2M8UA 2CXJA 4DIRA 4C0JA 1QXPA 1OZSA 1BT6A 2ZN8A 1KFXS 1NWDA 3I5FC 1SY9A 2KHNA 3DD4A 1Y1UA 3KHEA 1S6CA 3A8RA 3KF9A 1FW4A 1JWDA 4OCIA 4U8DA 4A4CA 2LCPA 1CM1A 1AVSA 1K9UA 2WNDA 4CFQA 1K9PA 4PDZA 1YRUB 4N1FA 3CGAA 1KWOB 2MJWB 5KU1A 1J1DA 1QTXA 3I5GB 3LCPC 1PVBA 2BCAA 1DGUA 5HKZA 3JVTB 1SL9A 2Y5IA 4ETOA 1L7ZA 4YRUA 2K7BA 5CSJA 1B8CA 1LVCD 1ZFSA 1RFJA 1E8AA 4JWQA 5K89A 1WY9A 1N0YA 2JZIA 4GAOA 5B8IB 1B47A 1OMVA 1XFZO 1IH0A 4M2PA 2P6BB 2LNKA 1SK6D 3HX4A 1IJ5A 5G08A 3DVJA 3EKJA 4MLWA 2CNPA 1WLZA 1J7OA 2D8NA 1SYMA 3O4YA 5AERA 2KFFA 2M29A 3EK8A 3KO0A 3SG6A 1AJ5A 4PCWA 1CLMA 3JVTC 3LK1A 1WDCB 2K8MB 2NCOA 4N1GA 3IQQA 1NIWA 1FI5A 1MF8B 1UP5A 1DJXA 2F2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I94 A;  1LKJ A;  2KSP A;  5DKN A;  2BBN A;  1J7R A;  1K8U A;  1F4Q A;  4MRY A;  2BCB A;  3FS7 A;  4GGF A;  2Y1N A;  3I5I B;  1MXL C;  1DJG A;  1JFK A;  3RM1 A;  1KFU L;  1B1G A;  1ALW A;  3BXK A;  5CSI A;  3SJS A;  4MZL A;  1C7V A;  5J3X A;  1CMG A;  2CTN A;  2AAO A;  3EVV A;  1D1O A;  1A2X A;  3PSR A;  2BEC A;  1J55 A;  1WRK A;  4MBE A;  2MLE C;  4MRX A;  2LVI A;  1YUS A;  1KFU S;  3TUY B;  1YX7 A;  2NLN A;  4I5J A;  5HKW A;  2H61 C;  2I7A A;  1J7Q A;  2KFG A;  1UUS A;  2M97 A;  4ORB B;  2WCF A;  5HKY A;  2MHH A;  3GK1 A;  2ISD A;  1WLM A;  3VRN A;  2DOQ A;  2G9B A;  2H2K A;  3AKB A;  4BY4 A;  2L5X B;  1Y1A A;  2KAX A;  1SCV A;  5CSN A;  1NX2 A;  2KI6 D;  1IKU A;  2BE4 A;  1UHI A;  4NDD A;  1C7W A;  1KK7 Y;  2BKH B;  4C0K A;  1OQP A;  2R2I A;  1NPQ A;  1CDL A;  1WRZ A;  1XFU O;  1SR6 C;  4PE0 A;  4YI9 A;  2LVV A;  3TUY C;  3D10 A;  1MR8 A;  1YUU A;  4CID A;  2KI4 B;  2HQ8 A;  2MBX A;  5PAL A;  1NYA A;  3K21 A;  5HLO A;  5HLV A;  4C0L A;  4GBA A;  1BOD A;  1CMF A;  1N2D A;  1TN4 A;  2LE9 B;  2L98 A;  1BLQ A;  3PAL A;  4MEW A;  2LP3 A;  1EL4 A;  2OS8 C;  1UHH A;  2JUL A;  1YVL A;  2KQ6 A;  4F0Z B;  1QVI Z;  4M2Q A;  1BG1 A;  1PVA A;  1QX5 B;  1UHN A;  3PLF B;  1L2O C;  3I5F B;  1M46 A;  2KBI A;  3SG7 A;  2VRG A;  1AJ4 A;  4M2O A;  2LAP A;  2MLF C;  2KI4 C;  1WRL A;  2JTZ A;  2TN4 A;  1XK4 A;  1YRT B;  4HRH A;  1QLS A;  3PFV A;  1FI6 A;  2ZRT A;  4ZCU A;  1S5G Z;  2FCE A;  2M1K B;  4YBH B;  2CBL A;  1FF1 A;  1LA0 A;  1IQ5 A;  3BUN B;  1A4P A;  2KYF A;  1SPY A;  1B7T Y;  1DF0 B;  1QAT A;  2M7N A;  4ZCV A;  1XYD A;  3SIB A;  1C07 A;  1RK9 A;  5KSZ A;  4FTG A;  1U5I A;  1QS7 A;  1CB1 A;  1OMD A;  2F2O A;  2LLU A;  3O2P A;  4DRW A;  2L51 A;  1NCX A;  1NCZ A;  4AQJ A;  1DVI A;  2EHB A;  3TDZ A;  2ZNE A;  4IL1 A;  1MHO A;  2A4J A;  3GK2 A;  1YUR A;  3DVM A;  1JSA A;  1GJY A;  3TDI A;  1SL7 A;  2IS9 A;  3E3R A;  4JPZ B;  1DJW A;  1HQV A;  2KOT A;  4GNK B;  1B8L A;  1QAS A;  3F45 A;  3LL8 B;  3CS1 A;  4OVN F;  1CKK A;  1JC2 A;  2BCX A;  1DJY A;  4PAL A;  1IRJ A;  5AXI A;  2PAS A;  1K2H A;  2GGM A;  1KQV A;  4YGC B;  4Q04 A;  2PMY A;  2HPS A;  1TOP A;  3FIA A;  2KQY A;  4YGD B;  3LLE A;  4OV2 A;  1OSA A;  5CPV A;  1CFP A;  1Y1X A;  1TTX A;  2Q91 A;  1CFF A;  4PHN A;  1ZMZ A;  1IWQ A;  5DKR A;  3CZT X;  3RLZ A;  2BBM A;  3GK4 X;  1GQM A;  2L2E A;  5D7F A;  3WXA A;  1PSB A;  2MAZ A;  4R1E A;  1SW8 A;  2OPO A;  3M0W A;  1REC A;  1KK8 C;  1S1E A;  2KBM A;  3FWB A;  2LMV A;  3VGO A;  1EG3 A;  2GGZ A;  2EC6 C;  1A75 B;  1NUB A;  4GFT A;  1BMO A;  1CFC A;  3KEV A;  1SNL A;  4GPL B;  4N5X A;  2Q4U A;  1UUR A;  2KI6 C;  1SKT A;  2LV7 A;  1KSM A;  1QIW A;  1QX2 A;  1SCM C;  3QRX A;  4WQ3 A;  3CR5 X;  1DMO A;  2M1U A;  1RRO A;  1UHJ A;  3KPX A;  2LP2 A;  4PHM A;  4NDB A;  1K90 D;  2BL0 C;  3OX5 A;  4PHK A;  1SR6 B;  4YI8 A;  2M9G A;  2JRF A;  2JPT A;  1F4O A;  2L50 A;  3AAJ A;  1MWN A;  1TRF A;  2JXC A;  2ZND A;  3I5H C;  2M7L A;  2KGR A;  3PN7 C;  2NXQ A;  4PE1 A;  4A4B A;  2E30 A;  3TDU A;  3O6B A;  1K93 D;  2ZFD A;  1CDN A;  4YGA A;  1W7J B;  1A29 A;  2OS8 B;  1CFD A;  1IGV A;  3SG5 A;  1BJF A;  1QX7 A;  1W7I B;  3WNX B;  5ER5 A;  1RWY A;  1K95 A;  1SL8 A;  2OTG B;  1XFV O;  4I5K A;  1V1F A;  2E6W A;  2LC5 A;  2GV5 A;  3O78 A;  1L2O B;  3WHT B;  1B4C A;  1F55 A;  4XJK B;  2KDH A;  1YUT A;  3NSI A;  3OB2 B;  1JF2 A;  2ZKM X;  3LK0 A;  3IQO A;  1M63 B;  1S6I A;  3BOW B;  2V53 A;  4PHJ A;  4BY5 A;  5AEQ A;  2JNX A;  1JF0 A;  2H61 A;  2M49 B;  1YX8 A;  3CR2 A;  3TS5 C;  1ALV A;  1M31 A;  1UHK A;  3CTN A;  4HRG A;  3SG2 A;  1Q80 A;  3JTD B;  4NQG A;  1VRK A;  4DS7 A;  4WRI A;  3OP0 A;  4P5O E;  1AK8 A;  1H8B A;  2K61 A;  1NX3 A;  4CLN A;  1OE9 B;  1YTZ C;  2JT3 A;  2OTG C;  3A4U B;  1EG4 A;  4L9M A;  1PK0 D;  1B9A A;  5HYD A;  2K7O A;  4MVF A;  3VRQ A;  3C1V A;  1QV1 A;  1XVJ A;  1NX1 A;  1NX0 A;  2LUC A;  2PSR A;  1DTL A;  1J7P A;  3EK7 A;  2KAY A;  2L4I A;  2WC8 A;  4HSZ A;  4MZJ A;  5IBW A;  2Y1M A;  1QVI Y;  1XO5 A;  2JXL A;  3VRR A;  1JUO A;  3EVU A;  2LLS A;  1LXF C;  2JNF A;  1G33 A;  1A03 A;  3AKA A;  3NSL A;  2G2B A;  3ZNI A;  2LM5 A;  3JTD C;  1S36 A;  1BU3 A;  4OKH A;  2ZRS A;  2MA2 A;  3OX6 A;  1KCY A;  1KSO A;  5CSF A;  1YR5 A;  1X02 A;  2NCP A;  2LAN A;  1HT9 A;  1IQ3 A;  1K94 A;  1AHR A;  1S5G Y;  2CT9 A;  3CWG A;  3EK4 A;  3EVR A;  1JFJ A;  1V1G A;  1N65 A;  1IG5 A;  2F8P A;  1PRW A;  4P2Y B;  3ZWH A;  3NSO A;  2L4H A;  1M45 A;  4E68 A;  1TNX A;  1R6P A;  2O60 A;  1AP4 A;  4YGE B;  3MSE B;  2K2F A;  4GGN A;  4I5N B;  2JU0 A;  3BUW B;  2KAV A;  3BYA A;  5BPJ A;  1BR4 B;  1DT7 B;  5I2L A;  1S26 D;  2I18 A;  4JQ0 D;  1QV0 A;  1RTP 1;  1KK8 B;  2L0P A;  4ORC B;  1YVH A;  3VRO A;  1CDP A;  2PAL A;  2COL B;  1F71 A;  1XFX O;  2EC6 B;  1PUL A;  2ZN9 A;  4D1E A;  1BOC A;  2AUC A;  2Y4Q A;  4ICB A;  5AAN A;  2K2A A;  2QPT A;  1SMG A;  2WOR A;  2QAC A;  1PSR A;  4TNC A;  3DVK A;  1RJV A;  3CLN A;  1GGW A;  1ODB A;  1SCM B;  3BUM B;  1DGV A;  2JT8 A;  4AQI A;  2BL0 B;  2M3W A;  1QLK A;  4USL A;  3GOF A;  4I5L B;  2JT0 A;  5GQQ C;  1Y0V H;  2FJU B;  3I5H B;  1B8R A;  4GGF C;  1CTR A;  2JTT A;  3OB1 B;  3PN7 B;  1SBJ A;  2SAS A;  1ZUZ A;  4UPG A;  2WCE A;  1ZOT B;  1EJ3 A;  3WHU B;  3TZ1 A;  4YGB B;  1CLB A;  2CCM A;  3D0Y B;  4GUK A;  1DF0 A;  3SG4 A;  1S6J A;  3DVE A;  2F3Y A;  4MSP A;  4DCK A;  5I2O A;  1EH2 A;  1FPW A;  1IJ6 A;  1TIZ A;  5ER4 X;  1UWO A;  1KWO C;  4QJ4 B;  1GGZ A;  3I5G C;  1CDM A;  1S3P A;  2I2R E;  4XYN A;  2M0R A;  3SIA A;  4CFR A;  1AUI B;  3AAK A;  1BF5 A;  1QJT A;  2BKI B;  2RGI A;  5I2Q A;  4HRE E;  2LMU A;  2EGD A;  4DUQ A;  4WQ2 A;  1OZO A;  3H4S E;  1Y6W A;  2JWW A;  2K7D A;  3TS5 B;  1KQM B;  4PE4 A;  1TNQ A;  2HQW A;  1F70 A;  1LA3 A;  1TCF A;  1EXR A;  2KNE A;  1TCO B;  3NSK A;  2AMI A;  1F54 A;  5D69 A;  5TNC A;  5KTY A;  1CM4 A;  2FOT A;  3PM8 A;  1XA5 A;  3FWC A;  4MN0 A;  5F6T A;  1WDC C;  2K0J A;  1KK7 Z;  3DF0 B;  3BUX B;  1XFW O;  1CNP A;  1R2U A;  1LIN A;  1K96 A;  5I8N A;  4NDC A;  1DJZ A;  2NZ0 A;  1NCY A;  1SRA A;  1TNP A;  3PAT A;  2O5G A;  1DJI A;  1KQM C;  1U5I B;  5DKQ A;  1DJH A;  3I5I C;  1ZAC A;  3NXA A;  5JOL A;  4ORA B;  2B1U A;  2JC2 A;  3SG3 A;  2PRU A;  5AFP A;  1K9K A;  1CLL A;  1F8H A;  3OHM B;  1M39 A;  2FCD A;  3D0Y A;  1NP8 A;  2LHL A;  1A75 A;  2BE6 A;  5JJG A;  1XK4 C;  2KFH A;  2LVK A;  1J1E A;  4PE7 A;  2HET A;  3HCM A;  3IF7 A;  2MRD A;  1BR1 B;  2SCP A;  2LMT A;  3BUO B;  2JQ6 A;  2F33 A;  2KYC A;  2WOS A;  4QJ3 B;  4FQO A;  1MXE A;  4QJ5 B;  2JOJ A;  2LLT A;  3EKH A;  2PVB A;  1MQ1 A;  1G4Y R;  1JBA A;  1G8I A;  2LHI A;  1PAL A;  2KGB C;  2LVJ A;  5FYX A;  4MZK A;  3VRP A;  2K7C A;  1OOJ A;  1TNW A;  4CPV A;  1MUX A;  1B7T Z;  1H4B A;  2HF5 A;  3CR4 X;  2F3Z A;  4XJK A;  3ICB A;  1NSH A;  4AOM A;  1QIV A;  2WCB A;  2LUX A;  1FBV A;  4OR9 B;  3DF0 A;  1KFX L;  1OMR A;  3BQ3 A;  3BOW A;  1XFY O;  2M8U A;  2CXJ A;  4DIR A;  4C0J A;  1QXP A;  1OZS A;  1BT6 A;  2ZN8 A;  1KFX S;  1NWD A;  3I5F C;  1SY9 A;  2KHN A;  3DD4 A;  1Y1U A;  3KHE A;  1S6C A;  3A8R A;  3KF9 A;  1FW4 A;  1JWD A;  4OCI A;  4U8D A;  4A4C A;  2LCP A;  1CM1 A;  1AVS A;  1K9U A;  2WND A;  4CFQ A;  1K9P A;  4PDZ A;  1YRU B;  4N1F A;  3CGA A;  1KWO B;  2MJW B;  5KU1 A;  1J1D A;  1QTX A;  3I5G B;  3LCP C;  1PVB A;  2BCA A;  1DGU A;  5HKZ A;  3JVT B;  1SL9 A;  2Y5I A;  4ETO A;  1L7Z A;  4YRU A;  2K7B A;  5CSJ A;  1B8C A;  1LVC D;  1ZFS A;  1RFJ A;  1E8A A;  4JWQ A;  5K89 A;  1WY9 A;  1N0Y A;  2JZI A;  4GAO A;  5B8I B;  1B47 A;  1OMV A;  1XFZ O;  1IH0 A;  4M2P A;  2P6B B;  2LNK A;  1SK6 D;  3HX4 A;  1IJ5 A;  5G08 A;  3DVJ A;  3EKJ A;  4MLW A;  2CNP A;  1WLZ A;  1J7O A;  2D8N A;  1SYM A;  3O4Y A;  5AER A;  2KFF A;  2M29 A;  3EK8 A;  3KO0 A;  3SG6 A;  1AJ5 A;  4PCW A;  1CLM A;  3JVT C;  3LK1 A;  1WDC B;  2K8M B;  2NCO A;  4N1G A;  3IQQ A;  1NIW A;  1FI5 A;  1MF8 B;  1UP5 A;  1DJX A;  2F2P A; 
#chains in the Genus database with same CATH topology
 2I94 A;  1LKJ A;  2KSP A;  5DKN A;  2BBN A;  1J7R A;  1K8U A;  1F4Q A;  4MRY A;  2BCB A;  3FS7 A;  4GGF A;  2K60 A;  2Y1N A;  3O4X A;  3I5I B;  1MXL C;  1DJG A;  1JFK A;  3RM1 A;  3DXL A;  2FJY A;  1KFU L;  2QEH A;  1B1G A;  1ALW A;  3BXK A;  5CSI A;  3SJS A;  4MZL A;  1C7V A;  5J3X A;  1CMG A;  2CTN A;  2AAO A;  3EVV A;  1D1O A;  1A2X A;  3PSR A;  2BEC A;  1J55 A;  1WRK A;  4MBE A;  2MLE C;  4MRX A;  2LVI A;  1YUS A;  1KFU S;  3TUY B;  1YX7 A;  2NLN A;  4I5J A;  5HKW A;  2H61 C;  2I7A A;  1J7Q A;  3D73 A;  2KFG A;  3L4A A;  1UUS A;  2M97 A;  5EL2 A;  4ORB B;  2WCF A;  5HKY A;  2MHH A;  3GK1 A;  2ISD A;  1QWV A;  1WLM A;  3VRN A;  2DOQ A;  2G9B A;  2H2K A;  3AKB A;  4BY4 A;  3S0A A;  3CZ1 A;  2L5X B;  1Y1A A;  2KAX A;  1SCV A;  5CSN A;  1NX2 A;  3N7H A;  2KI6 D;  1IIO A;  1IKU A;  1UHI A;  2BE4 A;  4NDD A;  1C7W A;  1KK7 Y;  2BKH B;  4C0K A;  1OQP A;  2R2I A;  1NPQ A;  1CDL A;  1WRZ A;  1XFU O;  1SR6 C;  4PE0 A;  4YI9 A;  2LVV A;  3TUY C;  1ORG A;  3D10 A;  1MR8 A;  1YUU A;  4CID A;  2KI4 B;  2HQ8 A;  3CZ2 A;  2MBX A;  5PAL A;  1NYA A;  1OW4 A;  3K21 A;  5HLO A;  5HLV A;  4C0L A;  4GBA A;  1BOD A;  1CMF A;  1N2D A;  1TN4 A;  2LE9 B;  2L98 A;  1GM0 A;  1BLQ A;  3PAL A;  4MEW A;  2LP3 A;  1EL4 A;  2OS8 C;  1UHH A;  2JUL A;  1YVL A;  2KQ6 A;  4F0Z B;  1QVI Z;  4M2Q A;  1BG1 A;  1PVA A;  1QX5 B;  1UHN A;  1XFR A;  1L2O C;  3PLF B;  3I5F B;  1M46 A;  2KBI A;  3UNW A;  3SG7 A;  2VRG A;  3VB1 A;  1AJ4 A;  4M2O A;  3Q8I A;  2LAP A;  3EG5 B;  2MLF C;  1DQE A;  2KI4 C;  1WRL A;  2JTZ A;  2TN4 A;  1XK4 A;  1YRT B;  4HRH A;  1QLS A;  3PFV A;  1FI6 A;  2ZRT A;  4ZCU A;  1S5G Z;  2FCE A;  2M1K B;  4YBH B;  2CBL A;  1FF1 A;  1LA0 A;  1IQ5 A;  3BUN B;  1A4P A;  2KYF A;  1SPY A;  3K1E A;  1B7T Y;  1DF0 B;  1QAT A;  2M7N A;  4ZCV A;  1XYD A;  3SIB A;  1C07 A;  1RK9 A;  5KSZ A;  4FTG A;  1U5I A;  5HL1 A;  1QS7 A;  1CB1 A;  5D3O A;  1OMD A;  2F2O A;  2LLU A;  3O2P A;  4DRW A;  2L51 A;  1NCX A;  1NCZ A;  3CDN A;  4AQJ A;  1DVI A;  2EHB A;  3BFH A;  3TDZ A;  2ZNE A;  4IL1 A;  1MHO A;  2A4J A;  3GK2 A;  1YUR A;  3DVM A;  1JSA A;  1GJY A;  3TDI A;  1SL7 A;  2IS9 A;  3E3R A;  4JPZ B;  1DJW A;  1HQV A;  1OOI X;  2KOT A;  4GNK B;  1B8L A;  1QAS A;  3F45 A;  3LL8 B;  3CS1 A;  4OVN F;  1CKK A;  3D76 A;  1JC2 A;  2BCX A;  1DJY A;  4PAL A;  1IRJ A;  5AXI A;  2PAS A;  1K2H A;  2GGM A;  3S0F A;  1KQV A;  4YGC B;  4Q04 A;  2PMY A;  3DYE A;  2HPS A;  1TOP A;  3FIA A;  2KQY A;  4YGD B;  1DEL A;  3LLE A;  3B87 A;  4JKT A;  4OV2 A;  1OSA A;  5CPV A;  1CFP A;  1Y1X A;  1TTX A;  2Q91 A;  1CFF A;  3PJI A;  4PHN A;  1ZMZ A;  1IWQ A;  3R1V A;  5DKR A;  2H8V A;  3CZT X;  2BBM A;  3NHI A;  3RLZ A;  3R1P A;  3GK4 X;  1GQM A;  2L2E A;  5D7F A;  3WXA A;  1PSB A;  2MAZ A;  4R1E A;  1SW8 A;  2OPO A;  3M0W A;  1REC A;  1KK8 C;  1S1E A;  2KBM A;  3FWB A;  2LMV A;  3CZ0 A;  3VGO A;  1EG3 A;  2GGZ A;  2EC6 C;  1SSE B;  2L5Y A;  1A75 B;  1NUB A;  4GFT A;  1BMO A;  1CFC A;  3KEV A;  1SNL A;  4GPL B;  4N5X A;  2Q4U A;  1UUR A;  2KI6 C;  1SKT A;  2LV7 A;  2PYQ A;  1KSM A;  1QIW A;  1QX2 A;  3CYZ A;  4PT1 A;  1SCM C;  4JD9 A;  3QRX A;  4WQ3 A;  3CR5 X;  5FI6 A;  2M1U A;  1RRO A;  1UHJ A;  3KPX A;  1DMO A;  2LP2 A;  4PHM A;  2KPH A;  4NDB A;  1K90 D;  2BL0 C;  3OX5 A;  4PHK A;  1SR6 B;  4YI8 A;  2M9G A;  2JRF A;  2JPT A;  1F4O A;  2L50 A;  3AAJ A;  1MWN A;  1TRF A;  2JXC A;  2ZND A;  2WCM A;  3I5H C;  4KYN A;  2M7L A;  2KGR A;  3PN7 C;  2NXQ A;  4PE1 A;  3UO9 A;  2E30 A;  4A4B A;  3TDU A;  2JPO A;  3O6B A;  1K93 D;  2ZFD A;  1CDN A;  4YGA A;  1W7J B;  1A29 A;  2OS8 B;  1CFD A;  1IGV A;  1T14 A;  1BJF A;  1W7I B;  1QX7 A;  3OBV A;  3SG5 A;  3WNX B;  5ER5 A;  1RWY A;  1K95 A;  1SL8 A;  2OTG B;  1XFV O;  4I5K A;  1V1F A;  2E6W A;  2LC5 A;  2GV5 A;  2WC5 A;  1L2O B;  3O78 A;  3WHT B;  1B4C A;  1F55 A;  4XJK B;  2KDH A;  1YUT A;  3NSI A;  3OB2 B;  1JF2 A;  2ZKM X;  3FE8 A;  3LK0 A;  3IQO A;  1M63 B;  1S6I A;  3S0B A;  3RZS A;  3BOW B;  2V53 A;  4PHJ A;  4BY5 A;  5AEQ A;  2JNX A;  1JF0 A;  2H61 A;  2M49 B;  1YX8 A;  3CR2 A;  3TS5 C;  1ALV A;  4IJ7 A;  1M31 A;  1UHK A;  3CTN A;  4HRG A;  3SG2 A;  1Q80 A;  3JTD B;  4NQG A;  1VRK A;  4DS7 A;  4WRI A;  3OP0 A;  4P5O E;  1AK8 A;  1H8B A;  5DIC A;  2K61 A;  1NX3 A;  4CLN A;  1OE9 B;  1YTZ C;  2JT3 A;  2OTG C;  3A4U B;  1EG4 A;  3L47 A;  1PK0 D;  1B9A A;  4L9M A;  2K7O A;  5HYD A;  4MVF A;  3VRQ A;  3C1V A;  1QV1 A;  1XVJ A;  1NX1 A;  1NX0 A;  2LUC A;  3DY9 A;  5FI2 A;  2WCK A;  2PSR A;  1DTL A;  1J7P A;  2KLE A;  3EK7 A;  2KAY A;  2L4I A;  2WC8 A;  4HSZ A;  4MZJ A;  5IBW A;  2Y1M A;  1QVI Y;  1XO5 A;  2JXL A;  3VRR A;  1JUO A;  3EVU A;  2LLS A;  1LXF C;  2JNF A;  1G33 A;  1A03 A;  3AKA A;  3NSL A;  3B6X A;  2G2B A;  1OOG A;  3ZNI A;  2LM5 A;  3JTD C;  1S36 A;  1OOF A;  1BU3 A;  4OKH A;  3V2L A;  2ZRS A;  2MA2 A;  3OX6 A;  1KCY A;  1C3Z A;  3D74 A;  1KSO A;  5CSF A;  1YR5 A;  1X02 A;  2NCP A;  1TUZ A;  2LAN A;  1HT9 A;  1IQ3 A;  1K94 A;  1AHR A;  1S5G Y;  2CT9 A;  2PQL A;  3CWG A;  3EK4 A;  3EVR A;  1JFJ A;  1V1G A;  1N65 A;  1IG5 A;  2F8P A;  1PRW A;  4P2Y B;  2QEB A;  3NSO A;  3ZWH A;  2L4H A;  1M45 A;  4E68 A;  1TNX A;  1R6P A;  2O60 A;  2KLD A;  1AP4 A;  4YGE B;  3MSE B;  2K2F A;  4GGN A;  3SS3 A;  4I5N B;  2JU0 A;  3BUW B;  2KAV A;  3SS4 A;  3BYA A;  5I94 A;  5BPJ A;  1BR4 B;  1DT7 B;  5I2L A;  1S26 D;  1DEK A;  2I18 A;  1QV0 A;  1RTP 1;  4JQ0 D;  3FE6 A;  1KK8 B;  2L0P A;  4ORC B;  1YVH A;  3VRO A;  1CDP A;  2PAL A;  2COL B;  1F71 A;  1XFX O;  2EC6 B;  1PUL A;  2ZN9 A;  4OZD A;  4D1E A;  1BOC A;  2AUC A;  2Y4Q A;  4ICB A;  5AAN A;  2K2A A;  2QPT A;  3NGV A;  1SMG A;  2WOR A;  2QAC A;  1PSR A;  3FE9 A;  4TNC A;  3DVK A;  1RJV A;  3CLN A;  1GGW A;  1ODB A;  1SCM B;  3BUM B;  1DGV A;  2JT8 A;  2BAP A;  4AQI A;  2BL0 B;  2M3W A;  1QLK A;  4USL A;  1Z2C B;  3GOF A;  4I5L B;  2JT0 A;  3OGN A;  5GQQ C;  1Y0V H;  2ERB A;  2FJU B;  1B8R A;  3I5H B;  4GGF C;  1CTR A;  2JTT A;  3OB1 B;  3PN7 B;  1SBJ A;  2SAS A;  1ZUZ A;  4UPG A;  2WCE A;  1Z4H A;  1ZOT B;  1EJ3 A;  3WHU B;  3TZ1 A;  4YGB B;  1CLB A;  2CCM A;  3D0Y B;  4GUK A;  1DF0 A;  3SG4 A;  1S6J A;  5FI7 A;  3DVE A;  2F3Y A;  4MSP A;  4DCK A;  3CAB A;  5I2O A;  3L4L A;  1EH2 A;  1IJ6 A;  1FPW A;  1TIZ A;  5ER4 X;  1UWO A;  3S0G A;  1KWO C;  2GTE A;  4QJ4 B;  1GGZ A;  1TWO A;  3I5G C;  3R72 A;  1CDM A;  1S3P A;  2I2R E;  4XYN A;  2M0R A;  3SIA A;  2P70 A;  4CFR A;  1AUI B;  3AAK A;  1BF5 A;  3S0D A;  1QJT A;  2BKI B;  2RGI A;  5I2Q A;  4HRE E;  2LMU A;  2EGD A;  4DUQ A;  4WQ2 A;  1OZO A;  3H4S E;  1DC1 A;  1Y6W A;  2JWW A;  3D78 A;  2K7D A;  2L2C A;  3PM2 A;  3TS5 B;  2BNX A;  1KQM B;  4PE4 A;  1TNQ A;  2HQW A;  1F70 A;  1LS8 A;  1LA3 A;  1TCF A;  1EXR A;  2KNE A;  1TCO B;  3NSK A;  2AMI A;  1F54 A;  3DZT A;  5D69 A;  5TNC A;  5KTY A;  1CM4 A;  2FOT A;  3R1O A;  3PM8 A;  1XA5 A;  1OOH A;  3FWC A;  3IVT A;  4MN0 A;  5F6T A;  1WDC C;  2K0J A;  1KK7 Z;  3DF0 B;  2WCJ A;  3BUX B;  1XFW O;  4INX A;  1CNP A;  1R2U A;  1LIN A;  1K96 A;  5I8N A;  2WC6 A;  4NDC A;  1DJZ A;  2NZ0 A;  1NCY A;  1SRA A;  1TNP A;  3PAT A;  2O5G A;  1DJI A;  1KQM C;  1U5I B;  5DKQ A;  1DJH A;  3I5I C;  1ZAC A;  3NXA A;  1C3Y A;  5JOL A;  4ORA B;  2B1U A;  2JC2 A;  3BFA A;  3SG3 A;  2PRU A;  5AFP A;  1K9K A;  1CLL A;  1F8H A;  3OHM B;  1M39 A;  2FCD A;  2QEO A;  3D0Y A;  1NP8 A;  2LHL A;  1A75 A;  2BE6 A;  5JJG A;  3SS5 A;  1XK4 C;  2KFH A;  2LVK A;  1J1E A;  4PE7 A;  2HET A;  3HCM A;  3IF7 A;  2MRD A;  1BR1 B;  2SCP A;  3BFB A;  3D75 A;  2LMT A;  3BUO B;  2JQ6 A;  2F33 A;  4F7F A;  1W9Z A;  2KYC A;  2WOS A;  4QJ3 B;  4FQO A;  1MXE A;  4QJ5 B;  2JOJ A;  2LLT A;  3EKH A;  2PVB A;  1MQ1 A;  1G4Y R;  1JBA A;  1G8I A;  2LHI A;  1PAL A;  2KGB C;  2LVJ A;  5FYX A;  4MZK A;  3NHT A;  3VRP A;  2K7C A;  1OOJ A;  1TNW A;  4CPV A;  3QME A;  1MUX A;  1B7T Z;  4FQT A;  1H4B A;  2HF5 A;  3CR4 X;  2F3Z A;  4XJK A;  3ICB A;  1TUJ A;  1NSH A;  4AOM A;  1QIV A;  2WCB A;  2LUX A;  1FBV A;  4OR9 B;  3DF0 A;  3D77 A;  1KFX L;  1OMR A;  3B88 A;  3BQ3 A;  1XFY O;  2M8U A;  3BOW A;  2P71 A;  2CXJ A;  1P28 A;  4DIR A;  4C0J A;  1QXP A;  1OZS A;  1BT6 A;  2ZN8 A;  4INW A;  1KFX S;  1NWD A;  3I5F C;  1SY9 A;  2KHN A;  3DD4 A;  2WCL A;  1Y1U A;  3KHE A;  1S6C A;  3A8R A;  3KF9 A;  1FW4 A;  1JWD A;  4OCI A;  4U8D A;  4A4C A;  2LCP A;  1CM1 A;  1AVS A;  1K9U A;  2WND A;  4CFQ A;  1K9P A;  4PDZ A;  1YRU B;  4N1F A;  3CGA A;  1KWO B;  2MJW B;  5KU1 A;  1J1D A;  1QTX A;  3I5G B;  3LCP C;  1PVB A;  2BCA A;  1DGU A;  5HKZ A;  3JVT B;  1SL9 A;  2Y5I A;  4ETO A;  1L7Z A;  4YRU A;  2K7B A;  5CSJ A;  1B8C A;  1LVC D;  1ZFS A;  1RFJ A;  1E8A A;  4JWQ A;  5K89 A;  1WY9 A;  1N0Y A;  2JZI A;  2WCH A;  4GAO A;  5B8I B;  1B47 A;  1OMV A;  1XFZ O;  1IH0 A;  4M2P A;  2P6B B;  2LNK A;  2QEV A;  2QDI A;  1SK6 D;  3HX4 A;  1IJ5 A;  3BJH A;  5G08 A;  3DVJ A;  2YGU A;  3EKJ A;  4MLW A;  2CNP A;  1WLZ A;  1J7O A;  2D8N A;  1SYM A;  3O4Y A;  5AER A;  2KFF A;  2M29 A;  3EK8 A;  3KO0 A;  3SG6 A;  1AJ5 A;  4PCW A;  1CLM A;  3JVT C;  3LK1 A;  1WDC B;  2K8M B;  2NCO A;  3S0E A;  4N1G A;  3IQQ A;  1NIW A;  1FI5 A;  1MF8 B;  3B7A A;  1UP5 A;  1DJX A;  2F2P A;  3B86 A; 
#chains in the Genus database with same CATH homology
 2I94 A;  1LKJ A;  2KSP A;  5DKN A;  2BBN A;  1J7R A;  1K8U A;  1F4Q A;  4MRY A;  2BCB A;  3FS7 A;  4GGF A;  2Y1N A;  3I5I B;  1MXL C;  1DJG A;  1JFK A;  3RM1 A;  1KFU L;  1B1G A;  1ALW A;  3BXK A;  5CSI A;  3SJS A;  4MZL A;  1C7V A;  5J3X A;  1CMG A;  2CTN A;  2AAO A;  3EVV A;  1D1O A;  1A2X A;  3PSR A;  2BEC A;  1J55 A;  1WRK A;  4MBE A;  2MLE C;  4MRX A;  2LVI A;  1YUS A;  1KFU S;  3TUY B;  1YX7 A;  2NLN A;  4I5J A;  5HKW A;  2H61 C;  2I7A A;  1J7Q A;  2KFG A;  1UUS A;  2M97 A;  4ORB B;  2WCF A;  5HKY A;  2MHH A;  3GK1 A;  2ISD A;  1WLM A;  3VRN A;  2DOQ A;  2G9B A;  2H2K A;  3AKB A;  4BY4 A;  2L5X B;  1Y1A A;  2KAX A;  1SCV A;  5CSN A;  1NX2 A;  2KI6 D;  1IKU A;  2BE4 A;  1UHI A;  4NDD A;  1C7W A;  1KK7 Y;  2BKH B;  4C0K A;  1OQP A;  2R2I A;  1NPQ A;  1CDL A;  1WRZ A;  1XFU O;  1SR6 C;  4PE0 A;  4YI9 A;  2LVV A;  3TUY C;  3D10 A;  1MR8 A;  1YUU A;  4CID A;  2KI4 B;  2HQ8 A;  2MBX A;  5PAL A;  1NYA A;  3K21 A;  5HLO A;  5HLV A;  4C0L A;  4GBA A;  1BOD A;  1CMF A;  1N2D A;  1TN4 A;  2LE9 B;  2L98 A;  1BLQ A;  3PAL A;  4MEW A;  2LP3 A;  1EL4 A;  2OS8 C;  1UHH A;  2JUL A;  1YVL A;  2KQ6 A;  4F0Z B;  1QVI Z;  4M2Q A;  1BG1 A;  1PVA A;  1QX5 B;  1UHN A;  3PLF B;  1L2O C;  3I5F B;  1M46 A;  2KBI A;  3SG7 A;  2VRG A;  1AJ4 A;  4M2O A;  2LAP A;  2MLF C;  2KI4 C;  1WRL A;  2JTZ A;  2TN4 A;  1XK4 A;  1YRT B;  4HRH A;  1QLS A;  3PFV A;  1FI6 A;  2ZRT A;  4ZCU A;  1S5G Z;  2FCE A;  2M1K B;  4YBH B;  2CBL A;  1FF1 A;  1LA0 A;  1IQ5 A;  3BUN B;  1A4P A;  2KYF A;  1SPY A;  1B7T Y;  1DF0 B;  1QAT A;  2M7N A;  4ZCV A;  1XYD A;  3SIB A;  1C07 A;  1RK9 A;  5KSZ A;  4FTG A;  1U5I A;  1QS7 A;  1CB1 A;  1OMD A;  2F2O A;  2LLU A;  3O2P A;  4DRW A;  2L51 A;  1NCX A;  1NCZ A;  4AQJ A;  1DVI A;  2EHB A;  3TDZ A;  2ZNE A;  4IL1 A;  1MHO A;  2A4J A;  3GK2 A;  1YUR A;  3DVM A;  1JSA A;  1GJY A;  3TDI A;  1SL7 A;  2IS9 A;  3E3R A;  4JPZ B;  1DJW A;  1HQV A;  2KOT A;  4GNK B;  1B8L A;  1QAS A;  3F45 A;  3LL8 B;  3CS1 A;  4OVN F;  1CKK A;  1JC2 A;  2BCX A;  1DJY A;  4PAL A;  1IRJ A;  5AXI A;  2PAS A;  1K2H A;  2GGM A;  1KQV A;  4YGC B;  4Q04 A;  2PMY A;  2HPS A;  1TOP A;  3FIA A;  2KQY A;  4YGD B;  3LLE A;  4OV2 A;  1OSA A;  5CPV A;  1CFP A;  1Y1X A;  1TTX A;  2Q91 A;  1CFF A;  4PHN A;  1ZMZ A;  1IWQ A;  5DKR A;  3CZT X;  3RLZ A;  2BBM A;  3GK4 X;  1GQM A;  2L2E A;  5D7F A;  3WXA A;  1PSB A;  2MAZ A;  4R1E A;  1SW8 A;  2OPO A;  3M0W A;  1REC A;  1KK8 C;  1S1E A;  2KBM A;  3FWB A;  2LMV A;  3VGO A;  1EG3 A;  2GGZ A;  2EC6 C;  1A75 B;  1NUB A;  4GFT A;  1BMO A;  1CFC A;  3KEV A;  1SNL A;  4GPL B;  4N5X A;  2Q4U A;  1UUR A;  2KI6 C;  1SKT A;  2LV7 A;  1KSM A;  1QIW A;  1QX2 A;  1SCM C;  3QRX A;  4WQ3 A;  3CR5 X;  1DMO A;  2M1U A;  1RRO A;  1UHJ A;  3KPX A;  2LP2 A;  4PHM A;  4NDB A;  1K90 D;  2BL0 C;  3OX5 A;  4PHK A;  1SR6 B;  4YI8 A;  2M9G A;  2JRF A;  2JPT A;  1F4O A;  2L50 A;  3AAJ A;  1MWN A;  1TRF A;  2JXC A;  2ZND A;  3I5H C;  2M7L A;  2KGR A;  3PN7 C;  2NXQ A;  4PE1 A;  4A4B A;  2E30 A;  3TDU A;  3O6B A;  1K93 D;  2ZFD A;  1CDN A;  4YGA A;  1W7J B;  1A29 A;  2OS8 B;  1CFD A;  1IGV A;  3SG5 A;  1BJF A;  1QX7 A;  1W7I B;  3WNX B;  5ER5 A;  1RWY A;  1K95 A;  1SL8 A;  2OTG B;  1XFV O;  4I5K A;  1V1F A;  2E6W A;  2LC5 A;  2GV5 A;  3O78 A;  1L2O B;  3WHT B;  1B4C A;  1F55 A;  4XJK B;  2KDH A;  1YUT A;  3NSI A;  3OB2 B;  1JF2 A;  2ZKM X;  3LK0 A;  3IQO A;  1M63 B;  1S6I A;  3BOW B;  2V53 A;  4PHJ A;  4BY5 A;  5AEQ A;  2JNX A;  1JF0 A;  2H61 A;  2M49 B;  1YX8 A;  3CR2 A;  3TS5 C;  1ALV A;  1M31 A;  1UHK A;  3CTN A;  4HRG A;  3SG2 A;  1Q80 A;  3JTD B;  4NQG A;  1VRK A;  4DS7 A;  4WRI A;  3OP0 A;  4P5O E;  1AK8 A;  1H8B A;  2K61 A;  1NX3 A;  4CLN A;  1OE9 B;  1YTZ C;  2JT3 A;  2OTG C;  3A4U B;  1EG4 A;  4L9M A;  1PK0 D;  1B9A A;  5HYD A;  2K7O A;  4MVF A;  3VRQ A;  3C1V A;  1QV1 A;  1XVJ A;  1NX1 A;  1NX0 A;  2LUC A;  2PSR A;  1DTL A;  1J7P A;  3EK7 A;  2KAY A;  2L4I A;  2WC8 A;  4HSZ A;  4MZJ A;  5IBW A;  2Y1M A;  1QVI Y;  1XO5 A;  2JXL A;  3VRR A;  1JUO A;  3EVU A;  2LLS A;  1LXF C;  2JNF A;  1G33 A;  1A03 A;  3AKA A;  3NSL A;  2G2B A;  3ZNI A;  2LM5 A;  3JTD C;  1S36 A;  1BU3 A;  4OKH A;  2ZRS A;  2MA2 A;  3OX6 A;  1KCY A;  1KSO A;  5CSF A;  1YR5 A;  1X02 A;  2NCP A;  2LAN A;  1HT9 A;  1IQ3 A;  1K94 A;  1AHR A;  1S5G Y;  2CT9 A;  3CWG A;  3EK4 A;  3EVR A;  1JFJ A;  1V1G A;  1N65 A;  1IG5 A;  2F8P A;  1PRW A;  4P2Y B;  3ZWH A;  3NSO A;  2L4H A;  1M45 A;  4E68 A;  1TNX A;  1R6P A;  2O60 A;  1AP4 A;  4YGE B;  3MSE B;  2K2F A;  4GGN A;  4I5N B;  2JU0 A;  3BUW B;  2KAV A;  3BYA A;  5BPJ A;  1BR4 B;  1DT7 B;  5I2L A;  1S26 D;  2I18 A;  4JQ0 D;  1QV0 A;  1RTP 1;  1KK8 B;  2L0P A;  4ORC B;  1YVH A;  3VRO A;  1CDP A;  2PAL A;  2COL B;  1F71 A;  1XFX O;  2EC6 B;  1PUL A;  2ZN9 A;  4D1E A;  1BOC A;  2AUC A;  2Y4Q A;  4ICB A;  5AAN A;  2K2A A;  2QPT A;  1SMG A;  2WOR A;  2QAC A;  1PSR A;  4TNC A;  3DVK A;  1RJV A;  3CLN A;  1GGW A;  1ODB A;  1SCM B;  3BUM B;  1DGV A;  2JT8 A;  4AQI A;  2BL0 B;  2M3W A;  1QLK A;  4USL A;  3GOF A;  4I5L B;  2JT0 A;  5GQQ C;  1Y0V H;  2FJU B;  3I5H B;  1B8R A;  4GGF C;  1CTR A;  2JTT A;  3OB1 B;  3PN7 B;  1SBJ A;  2SAS A;  1ZUZ A;  4UPG A;  2WCE A;  1ZOT B;  1EJ3 A;  3WHU B;  3TZ1 A;  4YGB B;  1CLB A;  2CCM A;  3D0Y B;  4GUK A;  1DF0 A;  3SG4 A;  1S6J A;  3DVE A;  2F3Y A;  4MSP A;  4DCK A;  5I2O A;  1EH2 A;  1FPW A;  1IJ6 A;  1TIZ A;  5ER4 X;  1UWO A;  1KWO C;  4QJ4 B;  1GGZ A;  3I5G C;  1CDM A;  1S3P A;  2I2R E;  4XYN A;  2M0R A;  3SIA A;  4CFR A;  1AUI B;  3AAK A;  1BF5 A;  1QJT A;  2BKI B;  2RGI A;  5I2Q A;  4HRE E;  2LMU A;  2EGD A;  4DUQ A;  4WQ2 A;  1OZO A;  3H4S E;  1Y6W A;  2JWW A;  2K7D A;  3TS5 B;  1KQM B;  4PE4 A;  1TNQ A;  2HQW A;  1F70 A;  1LA3 A;  1TCF A;  1EXR A;  2KNE A;  1TCO B;  3NSK A;  2AMI A;  1F54 A;  5D69 A;  5TNC A;  5KTY A;  1CM4 A;  2FOT A;  3PM8 A;  1XA5 A;  3FWC A;  4MN0 A;  5F6T A;  1WDC C;  2K0J A;  1KK7 Z;  3DF0 B;  3BUX B;  1XFW O;  1CNP A;  1R2U A;  1LIN A;  1K96 A;  5I8N A;  4NDC A;  1DJZ A;  2NZ0 A;  1NCY A;  1SRA A;  1TNP A;  3PAT A;  2O5G A;  1DJI A;  1KQM C;  1U5I B;  5DKQ A;  1DJH A;  3I5I C;  1ZAC A;  3NXA A;  5JOL A;  4ORA B;  2B1U A;  2JC2 A;  3SG3 A;  2PRU A;  5AFP A;  1K9K A;  1CLL A;  1F8H A;  3OHM B;  1M39 A;  2FCD A;  3D0Y A;  1NP8 A;  2LHL A;  1A75 A;  2BE6 A;  5JJG A;  1XK4 C;  2KFH A;  2LVK A;  1J1E A;  4PE7 A;  2HET A;  3HCM A;  3IF7 A;  2MRD A;  1BR1 B;  2SCP A;  2LMT A;  3BUO B;  2JQ6 A;  2F33 A;  2KYC A;  2WOS A;  4QJ3 B;  4FQO A;  1MXE A;  4QJ5 B;  2JOJ A;  2LLT A;  3EKH A;  2PVB A;  1MQ1 A;  1G4Y R;  1JBA A;  1G8I A;  2LHI A;  1PAL A;  2KGB C;  2LVJ A;  5FYX A;  4MZK A;  3VRP A;  2K7C A;  1OOJ A;  1TNW A;  4CPV A;  1MUX A;  1B7T Z;  1H4B A;  2HF5 A;  3CR4 X;  2F3Z A;  4XJK A;  3ICB A;  1NSH A;  4AOM A;  1QIV A;  2WCB A;  2LUX A;  1FBV A;  4OR9 B;  3DF0 A;  1KFX L;  1OMR A;  3BQ3 A;  3BOW A;  1XFY O;  2M8U A;  2CXJ A;  4DIR A;  4C0J A;  1QXP A;  1OZS A;  1BT6 A;  2ZN8 A;  1KFX S;  1NWD A;  3I5F C;  1SY9 A;  2KHN A;  3DD4 A;  1Y1U A;  3KHE A;  1S6C A;  3A8R A;  3KF9 A;  1FW4 A;  1JWD A;  4OCI A;  4U8D A;  4A4C A;  2LCP A;  1CM1 A;  1AVS A;  1K9U A;  2WND A;  4CFQ A;  1K9P A;  4PDZ A;  1YRU B;  4N1F A;  3CGA A;  1KWO B;  2MJW B;  5KU1 A;  1J1D A;  1QTX A;  3I5G B;  3LCP C;  1PVB A;  2BCA A;  1DGU A;  5HKZ A;  3JVT B;  1SL9 A;  2Y5I A;  4ETO A;  1L7Z A;  4YRU A;  2K7B A;  5CSJ A;  1B8C A;  1LVC D;  1ZFS A;  1RFJ A;  1E8A A;  4JWQ A;  5K89 A;  1WY9 A;  1N0Y A;  2JZI A;  4GAO A;  5B8I B;  1B47 A;  1OMV A;  1XFZ O;  1IH0 A;  4M2P A;  2P6B B;  2LNK A;  1SK6 D;  3HX4 A;  1IJ5 A;  5G08 A;  3DVJ A;  3EKJ A;  4MLW A;  2CNP A;  1WLZ A;  1J7O A;  2D8N A;  1SYM A;  3O4Y A;  5AER A;  2KFF A;  2M29 A;  3EK8 A;  3KO0 A;  3SG6 A;  1AJ5 A;  4PCW A;  1CLM A;  3JVT C;  3LK1 A;  1WDC B;  2K8M B;  2NCO A;  4N1G A;  3IQQ A;  1NIW A;  1FI5 A;  1MF8 B;  1UP5 A;  1DJX A;  2F2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...