3CGAA

Crystal structure of metastasis-associated protein s100a4 in the active, calcium-bound form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
87
structure length
87
Chain Sequence
PLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A4
publication title Crystal structure of metastasis-associated protein S100A4 in the active calcium-bound form
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cgaA00
1WDCC 4PE7A 1DGVA 3BUNB 1K8UA 5AXIA 3CZTX 2JOJA 4MEWA 1IQ3A 4Q04A 5KTYA 1SCMB 4HSZA 2ZNDA 5JOLA 4MBEA 3TS5B 3CLNA 1F71A 2WOSA 4R1EA 1QIWA 1LA3A 3BYAA 2HF5A 3WXAA 3D0YA 1DJYA 4AOMA 1YUUA 5D7FA 4OR9B 1KQMC 1K95A 2CCMA 1N65A 3GK2A 1ODBA 4GAOA 3SG5A 1SRAA 1IJ5A 5HLVA 1XFUO 2L4HA 2EC6B 1J7RA 4U8DA 2NCOA 3EKHA 1B8LA 1CTRA 2CNPA 2F3ZA 4N1FA 3SIAA 2JT3A 1AHRA 1M39A 1MWNA 4MZKA 5HKYA 2GV5A 1J55A 1YX8A 3JVTB 1BODA 3O2PA 4ZCVA 1XK4A 1YR5A 1EG3A 1L7ZA 3DF0A 2ZNEA 2WCEA 2KFHA 2KI6D 2MA2A 4MLWA 1TRFA 1UUSA 1DJHA 3FS7A 1K90D 3SG4A 5I8NA 1NWDA 1QLKA 1KK7Z 2HETA 2KI4C 2LE9B 2KAYA 1SL9A 1B7TZ 2L2EA 3A4UB 1JSAA 2M1UA 1SL8A 2CT9A 2KI6C 1A75A 4I5JA 1DJZA 4BY5A 3D0YB 2KGBC 3FWCA 1MQ1A 1DVIA 4CLNA 2LP2A 5J3XA 1NX2A 1YUTA 2KI4B 5HKWA 4ICBA 1J7QA 1ZOTB 1CLLA 1KFXL 1XK4C 1YVLA 1J7OA 4GUKA 3EK4A 1BR1B 2DOQA 3BOWA 1DT7B 1OMDA 2M29A 4C0JA 3OB1B 2JC2A 2BKIB 2LUXA 1YX7A 5HYDA 2M0RA 2L5XB 1J1EA 3PFVA 1RK9A 1RECA 3VRPA 1FF1A 2R2IA 2I18A 1XFYO 2K2AA 3O4YA 4A4CA 4PHNA 3DF0B 1AP4A 1GGWA 1S3PA 1CLBA 4UPGA 5AFPA 3QRXA 1PSRA 4MRXA 3RM1A 3LL8B 2HQ8A 1NCXA 1ZUZA 2O60A 2COLB 3I5IC 1JC2A 1KQVA 2JRFA 2M9GA 3FWBA 1BJFA 2JT0A 2K8MB 3KEVA 2MAZA 2P6BB 4M2OA 1S36A 1AUIB 1A75B 1V1GA 1F4OA 1PALA 5ER4X 1IWQA 1OE9B 1WRKA 2JNFA 2EHBA 2Y4QA 4HRGA 2H61A 1BF5A 3LK1A 1IRJA 2F8PA 2JWWA 1NP8A 2AAOA 1AK8A 1F4QA 1B9AA 2I7AA 1S5GZ 2L4IA 3BOWB 1E8AA 2LNKA 1UHKA 2OS8C 2ZN9A 4DS7A 2M97A 2HQWA 5BPJA 2NLNA 2LHIA 1G33A 1XA5A 1EL4A 1DJIA 3PN7C 4L9MA 1PSBA 3LCPC 4PCWA 1CMFA 1UHJA 1CDMA 2KDHA 1NX3A 1QATA 1KK8C 1Y1AA 3WHUB 4JWQA 1F55A 4M2QA 1Y1XA 3A8RA 2K7OA 1SNLA 3AKBA 1JUOA 1L2OC 2LANA 3PN7B 3CTNA 4OVNF 1ZFSA 1LINA 5CPVA 1DMOA 1HT9A 2FJUB 1TNPA 3HCMA 1KK8B 4YRUA 5CSFA 1SR6B 1NSHA 4MSPA 3OX5A 5I2QA 1D1OA 3ZWHA 1SMGA 1WRZA 3CR2A 2G2BA 1UHIA 1KFUS 2KNEA 2M8UA 4OKHA 2MRDA 4QJ5B 1OZOA 1YVHA 1K2HA 1CB1A 3AKAA 4PE4A 1ALVA 2IS9A 2I2RE 1WDCB 1ZMZA 1AJ4A 4JQ0D 1PVBA 5DKRA 2K7BA 2Y1NA 1K94A 1KSMA 4XYNA 3KO0A 5AERA 1BMOA 1TNQA 4MRYA 3TUYC 2BL0C 2L50A 3K21A 3IQQA 3OHMB 3H4SE 4QJ3B 1N2DA 1DF0A 4DCKA 1IJ6A 2OTGC 3F45A 1B8CA 1UHHA 1RROA 4ZCUA 2M7NA 4NDCA 2LV7A 2M3WA 2SCPA 3JTDC 3PM8A 4GNKB 3SIBA 3TUYB 2B1UA 2PVBA 5F6TA 3DVEA 2G9BA 1KQMB 2F2PA 4YI8A 3TDUA 2JPTA 2OTGB 2JNXA 3I5HC 4IL1A 1KK7Y 5AEQA 2LVJA 2JT8A 1EXRA 1B7TY 1NUBA 2CTNA 2HPSA 2M1KB 2LVKA 3JTDB 5KU1A 1G4YR 1OMRA 1DJGA 1K9KA 3C1VA 2ZRTA 2L51A 4P2YB 1BU3A 2MJWB 3I5HB 1B4CA 2KQYA 2TN4A 1ZACA 3GK4X 1B47A 4N5XA 3CR4X 1EG4A 2M7LA 1QVIZ 2BKHB 3MSEB 1LA0A 1QS7A 1DF0B 1YURA 3WNXB 1U5IA 3CS1A 2SASA 1TCOB 1M45A 2CBLA 2PSRA 5GQQC 2PRUA 3BUWB 4AQJA 1WLZA 5JJGA 4C0LA 1NIWA 1IQ5A 1SBJA 4DRWA 1BT6A 1CDLA 1DJXA 2ZN8A 1CM1A 2JU0A 1CKKA 2LLUA 1CFFA 1QX2A 1RTP1 2O5GA 2OPOA 2LHLA 1B8RA 3OB2B 4USLA 1YUSA 2BE6A 1S6IA 1H8BA 2L98A 2GGZA 5B8IB 3SG6A 2AUCA 5G08A 3D10A 3DVKA 4M2PA 2K7CA 1EJ3A 2ZFDA 1FI6A 1R2UA 1S5GY 3TZ1A 3TDIA 1K93D 4GGFC 3I5IB 5TNCA 2F33A 3SG7A 1U5IB 2JULA 3EVRA 5I2OA 1NX0A 1JBAA 2MBXA 3I5GC 4ORBB 1CDNA 3PATA 1C07A 3VROA 1RFJA 2BCBA 3IQOA 4MZLA 3BUXB 2FCEA 3EK7A 1LVCD 1QASA 1QTXA 4PDZA 4E68A 2PMYA 4WQ3A 1K9PA 2LMTA 1QX7A 1WRLA 1YRTB 2PASA 3I5GB 1Q80A 2VRGA 1JF2A 1W7JB 1GGZA 2OS8B 3DVMA 3I5FC 4ORAB 2Q4UA 2WCBA 1M31A 4YGDB 1JWDA 2BE4A 2Y5IA 4HRHA 4ORCB 2MHHA 1F70A 1KFUL 2LLSA 1S1EA 1AJ5A 1UP5A 3NXAA 1ALWA 2PALA 4YGAA 3I5FB 1TCFA 2JTZA 2BBNA 2LP3A 3M0WA 2KHNA 2KYFA 1QX5B 1WY9A 1OOJA 3BQ3A 2K7DA 3KHEA 4I5NB 2E30A 1Y1UA 1XO5A 3NSOA 2MLEC 1NYAA 2QACA 4NQGA 2WC8A 4QJ4B 1S26D 1L2OB 2BCAA 2F3YA 2M49B 4YBHB 1CFPA 3NSKA 4A4BA 5I2LA 2LVVA 1SPYA 1FPWA 4I5LB 1IKUA 1X02A 3NSLA 1M46A 1FW4A 1MXLC 3O78A 2F2OA 1XFVO 2FOTA 2I94A 1MF8B 2LMUA 1SW8A 3SG2A 3IF7A 4XJKA 1CLMA 2KFFA 1CNPA 1NX1A 1XFXO 4PE1A 3TS5C 5HKZA 2KAXA 4OCIA 1WLMA 2E6WA 2KAVA 2WORA 3VRQA 1QJTA 1W7IB 4ETOA 2K2FA 1XVJA 3EVUA 2LMVA 2JZIA 1KCYA 2BL0B 4PALA 1OQPA 4P5OE 4DIRA 3TDZA 1HQVA 2BBMA 4GGNA 2EC6C 1EH2A 1SL7A 1UHNA 2K0JA 1CDPA 3GK1A 5AANA 2NCPA 4NDBA 3OX6A 4CFRA 1LKJA 1H4BA 4YGCB 1QV1A 1QIVA 2FCDA 1FBVA 1UWOA 3LLEA 2NZ0A 1TOPA 1QVIY 3JVTC 1DGUA 1A4PA 1MXEA 1YRUB 1RWYA 3FIAA 2ISDA 1TTXA 1JFJA 1BR4B 4PHJA 2QPTA 2KBIA 2L0PA 3WHTB 5DKNA 1SYMA 4MZJA 1TN4A 5FYXA 4YGEB 1S6JA 2GGMA 4YI9A 4GBAA 2LLTA 1JF0A 4XJKB 1NCZA 4C0KA 2JQ6A 2H2KA 1Y6WA 1NPQA 1MUXA 1K96A 3E3RA 1N0YA 3LK0A 1BG1A 1C7WA 1CM4A 4DUQA 5HLOA 5IBWA 2LAPA 1F8HA 1KSOA 4GGFA 3HX4A 4TNCA 1DJWA 1PULA 1SCVA 3EK8A 2BECA 4YGBB 2KOTA 3GOFA 4NDDA 2KSPA 3PLFB 4I5KA 1PK0D 4FQOA 3SJSA 2KFGA 3VRRA 3SG3A 4F0ZB 1RJVA 4HREE 1QXPA 2LC5A 4CIDA 5ER5A 3CWGA 2RGIA 1FI5A 2AMIA 5CSNA 1C7VA 1MR8A 1J7PA 4PE0A 2LCPA 3VGOA 5K89A 1LXFC 1GJYA 1XYDA 2MLFC 5CSIA 1JFKA 3DVJA 2V53A 1IH0A 2Y1MA 1DTLA 4MVFA 3RLZA 2WNDA 1M63B 1BLQA 2LUCA 4BY4A 1KFXS 3PALA 4PHKA 5D69A 3BUOB 3PSRA 1IG5A 1VRKA 1TNXA 1GQMA 1KWOC 3BUMB 2JXLA 2KGRA 2BCXA 3CR5X 1A29A 4CPVA 3DD4A 2Q91A 3ZNIA 1UURA 2EGDA 2KYCA 1MHOA 1QV0A 3NSIA 3KPXA 4WRIA 1KWOB 5KSZA 1XFZO 3OP0A 3EKJA 3CGAA 1OMVA 1AVSA 1NCYA 3AAJA 4AQIA 3O6BA 1K9UA 4MN0A 1CFDA 1BOCA 1QLSA 1A2XA 1CFCA 1OZSA 1Y0VH 3EVVA 1XFWO 1A03A 2KBMA 5PALA 1IGVA 3KF9A 2LVIA 2KQ6A 1CMGA 1SK6D 4GPLB 2WCFA 2ZKMX 5CSJA 1TNWA 2NXQA 3AAKA 1YTZC 4GFTA 1G8IA 1R6PA 2CXJA 1S6CA 2A4JA 3ICBA 4PHMA 2JTTA 4D1EA 1PRWA 1TIZA 1V1FA 1F54A 1SR6C 4OV2A 4WQ2A 1B1GA 1J1DA 2H61C 3BXKA 1SKTA 5DKQA 2JXCA 3VRNA 4N1GA 4JPZB 2LM5A 2ZRSA 1SY9A 1OSAA 2K61A 4FTGA 4CFQA 2D8NA 1SCMC 1PVAA
chains in the Genus database with same CATH superfamily
1WDCC 4PE7A 1DGVA 3BUNB 1SSEB 1OW4A 1K8UA 5AXIA 3CZTX 2JOJA 4MEWA 1IQ3A 4Q04A 5KTYA 1SCMB 4HSZA 2ZNDA 5JOLA 4MBEA 3TS5B 3CLNA 1F71A 2WOSA 4R1EA 1QIWA 1LA3A 3BYAA 2HF5A 3WXAA 3D0YA 1DJYA 5FI7A 2WCMA 4AOMA 1YUUA 5D7FA 4OR9B 1KQMC 1K95A 2CCMA 1N65A 3GK2A 1ODBA 4GAOA 3SG5A 1SRAA 1IJ5A 5HLVA 1XFUO 2L4HA 2EC6B 1J7RA 4U8DA 2P71A 2NCOA 3EKHA 1B8LA 1CTRA 2ERBA 2CNPA 2F3ZA 4N1FA 3SIAA 2JT3A 1AHRA 1M39A 1MWNA 3FE8A 4MZKA 5HKYA 2GV5A 1J55A 1ORGA 1YX8A 3JVTB 1BODA 3O2PA 4ZCVA 1XK4A 1YR5A 1EG3A 5HL1A 1T14A 1L7ZA 3DF0A 2ZNEA 2WCEA 2KFHA 2KI6D 2MA2A 4MLWA 1TRFA 1UUSA 1DJHA 3FS7A 1K90D 3SG4A 5I8NA 3RZSA 1NWDA 1QLKA 1KK7Z 2HETA 2KI4C 2LE9B 2KAYA 3L47A 1SL9A 1B7TZ 2L2EA 3A4UB 3B88A 1JSAA 2M1UA 3V2LA 1SL8A 2CT9A 2KI6C 1A75A 4I5JA 1DJZA 4BY5A 3D0YB 2KGBC 3FWCA 1MQ1A 1DVIA 4CLNA 2LP2A 5J3XA 1NX2A 3D74A 1YUTA 1DELA 2KI4B 5HKWA 4ICBA 1J7QA 1ZOTB 1CLLA 2BAPA 1KFXL 1XK4C 1YVLA 5EL2A 1J7OA 4GUKA 3IVTA 3D75A 3EK4A 1BR1B 2DOQA 3BOWA 1DT7B 1OMDA 2WC5A 3SS4A 2M29A 4C0JA 3B6XA 3OB1B 2JC2A 2BKIB 2LUXA 1YX7A 5HYDA 2M0RA 2L5XB 1J1EA 3PFVA 1RK9A 1RECA 3B87A 3VRPA 3FE9A 2R2IA 2I18A 1XFYO 2K2AA 3O4YA 4A4CA 4PHNA 3DF0B 1AP4A 1GGWA 1S3PA 1CLBA 4UPGA 5AFPA 3QRXA 1PSRA 4MRXA 3RM1A 3LL8B 2HQ8A 1NCXA 1ZUZA 2O60A 2COLB 3I5IC 3DZTA 1JC2A 1KQVA 2JRFA 2M9GA 3FWBA 1BJFA 2JT0A 2K8MB 3KEVA 2MAZA 2P6BB 4M2OA 1S36A 1AUIB 1A75B 1V1GA 1F4OA 1PALA 5ER4X 1IWQA 1OE9B 1WRKA 2JNFA 2EHBA 2Y4QA 4HRGA 2H61A 3PJIA 3LK1A 1IRJA 2F8PA 1BF5A 2JWWA 1NP8A 2AAOA 5DICA 1AK8A 1F4QA 1B9AA 2I7AA 1S5GZ 2L4IA 3BOWB 1E8AA 2LNKA 1UHKA 2OS8C 2ZN9A 2BNXA 4DS7A 2M97A 2HQWA 1TUJA 5BPJA 2NLNA 2LHIA 1G33A 1XA5A 1EL4A 2QEOA 3BFBA 1DJIA 1Z2CB 3PN7C 4PT1A 4L9MA 1PSBA 3LCPC 4PCWA 1CMFA 1UHJA 1CDMA 2KDHA 1NX3A 1QATA 1KK8C 1Y1AA 3WHUB 4JWQA 1F55A 4M2QA 1Y1XA 3A8RA 2K7OA 3DXLA 4JKTA 1SNLA 3AKBA 3Q8IA 1JUOA 1L2OC 2LANA 3PN7B 3CTNA 4OVNF 1ZFSA 4FQTA 1LINA 5CPVA 1DMOA 1HT9A 2FJUB 1TNPA 3DYEA 1KK8B 3HCMA 3EG5B 4YRUA 5CSFA 1SR6B 1NSHA 4MSPA 3OX5A 5I2QA 1D1OA 2GTEA 3ZWHA 1FF1A 1SMGA 1WRZA 3CR2A 1OOIX 2G2BA 1UHIA 1KFUS 2KNEA 2M8UA 4OKHA 2MRDA 4QJ5B 1OZOA 1YVHA 1K2HA 1CB1A 3AKAA 4PE4A 1ALVA 2IS9A 2I2RE 1WDCB 1ZMZA 1AJ4A 4JQ0D 1PVBA 2QEVA 5DKRA 2K7BA 3VB1A 2Y1NA 1K94A 1KSMA 4XYNA 3KO0A 3R72A 4F7FA 5AERA 1BMOA 1TNQA 2K60A 4MRYA 2BL0C 2L50A 3K21A 3TUYC 3IQQA 3OHMB 3H4SE 4QJ3B 1N2DA 1DF0A 4DCKA 1IJ6A 2OTGC 3F45A 1B8CA 1UHHA 2KPHA 1RROA 4ZCUA 2M7NA 4NDCA 2LV7A 2M3WA 2SCPA 3JTDC 3PM8A 4GNKB 3SIBA 3TUYB 2B1UA 2PVBA 5F6TA 3DVEA 2G9BA 1KQMB 2F2PA 4YI8A 3TDUA 1QWVA 2JPTA 2OTGB 2QEHA 2JNXA 4JD9A 3CYZA 3I5HC 4IL1A 1KK7Y 4INWA 5AEQA 2LVJA 2JT8A 1EXRA 1B7TY 1NUBA 2CTNA 2HPSA 2K61A 2LVKA 2M1KB 3CZ0A 5KU1A 1G4YR 3S0DA 1OMRA 1DJGA 1K9KA 3C1VA 2ZRTA 2L51A 4P2YB 1BU3A 2MJWB 3I5HB 3SS3A 1B4CA 2KQYA 2TN4A 1ZACA 1Z4HA 3FE6A 1B47A 1DQEA 3CR4X 1EG4A 3GK4X 4N5XA 2M7LA 1DEKA 1QVIZ 3D73A 2BKHB 1C3ZA 3MSEB 1LA0A 1QS7A 1DF0B 1YURA 3WNXB 1U5IA 3CS1A 2SASA 1TCOB 1M45A 2CBLA 2PSRA 3CDNA 5GQQC 3NGVA 2PRUA 3BUWB 3D76A 4AQJA 1WLZA 5JJGA 4C0LA 1NIWA 1IQ5A 1SBJA 3B86A 4DRWA 1BT6A 1CDLA 1DJXA 2ZN8A 1CM1A 2JU0A 1CKKA 2LLUA 1CFFA 1QX2A 1RTP1 2O5GA 2OPOA 2LHLA 1B8RA 3OB2B 4USLA 1OOGA 1YUSA 2BE6A 1S6IA 1H8BA 2L98A 2GGZA 5B8IB 3SG6A 2AUCA 5G08A 3D10A 3DVKA 4M2PA 2K7CA 1OOHA 1EJ3A 2ZFDA 1FI6A 1R2UA 1S5GY 3TZ1A 3TDIA 3S0BA 1K93D 4GGFC 3CABA 3I5IB 3R1VA 5TNCA 2F33A 3SG7A 1U5IB 2JULA 3EVRA 5I2OA 1NX0A 1JBAA 2MBXA 3I5GC 4ORBB 1CDNA 3NHIA 3PATA 1C07A 3VROA 1RFJA 2BCBA 2QEBA 3IQOA 4MZLA 3BUXB 2FCEA 3EK7A 1LVCD 1QASA 1QTXA 4PDZA 4E68A 1W9ZA 2PMYA 4WQ3A 3S0FA 1K9PA 2JPOA 2LMTA 1QX7A 1WRLA 1YRTB 2PASA 3I5GB 1C3YA 1Q80A 2VRGA 3D78A 1JF2A 1W7JB 1GGZA 2OS8B 3DVMA 3I5FC 4ORAB 2Q4UA 2WCBA 1M31A 4YGDB 1JWDA 2BE4A 2WCLA 2Y5IA 4HRHA 4ORCB 2MHHA 5D3OA 1KFUL 2LLSA 1F70A 1S1EA 1AJ5A 1UP5A 3NXAA 1ALWA 2PALA 4YGAA 3I5FB 3L4LA 1TCFA 2JTZA 2BBNA 2LP3A 3M0WA 2KHNA 2KYFA 1QX5B 1WY9A 1OOJA 3BQ3A 2K7DA 3KHEA 4I5NB 3UO9A 2E30A 1Y1UA 1XO5A 3NSOA 3S0GA 2MLEC 1NYAA 2QACA 4NQGA 2WC8A 4QJ4B 1S26D 1L2OB 2BCAA 2F3YA 2M49B 4YBHB 1CFPA 3NSKA 4A4BA 5I2LA 2LVVA 1OOFA 1SPYA 1FPWA 2YGUA 4I5LB 1IKUA 1X02A 3NSLA 1M46A 2WCJA 5FI6A 1FW4A 1MXLC 3O78A 3R1OA 2F2OA 3BFAA 3NHTA 1XFVO 2H8VA 2FOTA 2I94A 1MF8B 2LMUA 1SW8A 3SG2A 3UNWA 3IF7A 4XJKA 3R1PA 1CLMA 2FJYA 2KFFA 1CNPA 1NX1A 1XFXO 4PE1A 3TS5C 5HKZA 4IJ7A 3B7AA 2KAXA 4OCIA 1WLMA 2E6WA 2KAVA 2WORA 3VRQA 1QJTA 1W7IB 4ETOA 2K2FA 1XVJA 3EVUA 2LMVA 2JZIA 1KCYA 2BL0B 4PALA 1OQPA 3N7HA 2WCKA 4P5OE 3L4AA 4DIRA 3TDZA 1HQVA 2BBMA 4GGNA 3DY9A 2EC6C 1EH2A 1SL7A 1UHNA 2K0JA 1CDPA 3GK1A 5AANA 2NCPA 4NDBA 3OX6A 4CFRA 1LKJA 1DC1A 1H4BA 3SS5A 4YGCB 1QV1A 1QIVA 2FCDA 1FBVA 1UWOA 3LLEA 2NZ0A 1TOPA 1QVIY 3JVTC 1DGUA 1A4PA 1MXEA 1TWOA 1RWYA 1YRUB 1LS8A 3FIAA 2ISDA 1TTXA 1JFJA 2WCHA 1BR4B 4PHJA 2QPTA 2KBIA 2L0PA 2L5YA 3WHTB 5DKNA 1SYMA 4MZJA 1TN4A 5FYXA 4YGEB 1S6JA 2GGMA 4YI9A 4GBAA 2LLTA 1JF0A 4XJKB 1NCZA 4C0KA 2JQ6A 2H2KA 3PM2A 1Y6WA 1NPQA 3BFHA 1MUXA 1K96A 3E3RA 3OBVA 1N0YA 3LK0A 1BG1A 1C7WA 1CM4A 2PQLA 4DUQA 5HLOA 5IBWA 4INXA 1IIOA 2LAPA 1F8HA 1KSOA 4GGFA 3HX4A 4TNCA 1DJWA 1P28A 1PULA 1SCVA 2BECA 3EK8A 3S0AA 4YGBB 2KOTA 3GOFA 4NDDA 2KSPA 3PLFB 4I5KA 1PK0D 4FQOA 3SJSA 2KFGA 3VRRA 3SG3A 4F0ZB 1RJVA 4HREE 1QXPA 2LC5A 2QDIA 4CIDA 5ER5A 1GM0A 3CWGA 2RGIA 3CZ2A 3JTDB 1FI5A 2AMIA 3BJHA 5CSNA 2KLDA 1C7VA 1MR8A 1J7PA 2P70A 2LCPA 4PE0A 3VGOA 5K89A 1LXFC 1GJYA 1XYDA 2MLFC 4KYNA 5CSIA 1JFKA 3DVJA 2V53A 1IH0A 2Y1MA 1DTLA 4MVFA 3RLZA 2WC6A 2WNDA 1M63B 2L2CA 1BLQA 2LUCA 3O4XA 4BY4A 1KFXS 3PALA 4PHKA 5D69A 3BUOB 3PSRA 3QMEA 1IG5A 1VRKA 1TNXA 3CZ1A 1GQMA 1KWOC 3BUMB 2JXLA 3OGNA 2KGRA 2BCXA 3CR5X 1A29A 3S0EA 4CPVA 3DD4A 2Q91A 3ZNIA 1UURA 1TUZA 2EGDA 2KYCA 1MHOA 1QV0A 3D77A 3KPXA 3NSIA 4WRIA 1KWOB 5KSZA 1XFZO 3OP0A 3EKJA 3CGAA 2KLEA 1OMVA 5FI2A 1AVSA 1NCYA 3AAJA 4AQIA 3O6BA 1K9UA 4MN0A 1CFDA 1BOCA 1QLSA 1A2XA 1CFCA 4OZDA 1OZSA 1Y0VH 3EVVA 1XFWO 1A03A 2KBMA 5PALA 1IGVA 3KF9A 2LVIA 2KQ6A 1CMGA 1SK6D 4GPLB 2WCFA 2ZKMX 5CSJA 1TNWA 2NXQA 3AAKA 1YTZC 4GFTA 1G8IA 1R6PA 2CXJA 1S6CA 2A4JA 3ICBA 4PHMA 2JTTA 4D1EA 1PRWA 1TIZA 2PYQA 1V1FA 1F54A 1SR6C 4OV2A 4WQ2A 1B1GA 1J1DA 2H61C 3BXKA 1SKTA 5DKQA 2JXCA 3VRNA 5I94A 3K1EA 4N1GA 4JPZB 2LM5A 2ZRSA 1SY9A 1OSAA 1XFRA 4FTGA 4CFQA 2D8NA 1SCMC 1PVAA
chains in the Genus database with same CATH topology
1WDCC 4PE7A 1DGVA 3BUNB 1K8UA 5AXIA 3CZTX 2JOJA 4MEWA 1IQ3A 4Q04A 5KTYA 1SCMB 4HSZA 2ZNDA 5JOLA 4MBEA 3TS5B 3CLNA 1F71A 2WOSA 4R1EA 1QIWA 1LA3A 3BYAA 2HF5A 3WXAA 3D0YA 1DJYA 4AOMA 1YUUA 5D7FA 4OR9B 1KQMC 1K95A 2CCMA 1N65A 3GK2A 1ODBA 4GAOA 3SG5A 1SRAA 1IJ5A 5HLVA 1XFUO 2L4HA 2EC6B 1J7RA 4U8DA 2NCOA 3EKHA 1B8LA 1CTRA 2CNPA 2F3ZA 4N1FA 3SIAA 2JT3A 1AHRA 1M39A 1MWNA 4MZKA 5HKYA 2GV5A 1J55A 1YX8A 3JVTB 1BODA 3O2PA 4ZCVA 1XK4A 1YR5A 1EG3A 1L7ZA 3DF0A 2ZNEA 2WCEA 2KFHA 2KI6D 2MA2A 4MLWA 1TRFA 1UUSA 1DJHA 3FS7A 1K90D 3SG4A 5I8NA 1NWDA 1QLKA 1KK7Z 2HETA 2KI4C 2LE9B 2KAYA 1SL9A 1B7TZ 2L2EA 3A4UB 1JSAA 2M1UA 1SL8A 2CT9A 2KI6C 1A75A 4I5JA 1DJZA 4BY5A 3D0YB 2KGBC 3FWCA 1MQ1A 1DVIA 4CLNA 2LP2A 5J3XA 1NX2A 1YUTA 2KI4B 5HKWA 4ICBA 1J7QA 1ZOTB 1CLLA 1KFXL 1XK4C 1YVLA 1J7OA 4GUKA 3EK4A 1BR1B 2DOQA 3BOWA 1DT7B 1OMDA 2M29A 4C0JA 3OB1B 2JC2A 2BKIB 2LUXA 1YX7A 5HYDA 2M0RA 2L5XB 1J1EA 3PFVA 1RK9A 1RECA 3VRPA 1FF1A 2R2IA 2I18A 1XFYO 2K2AA 3O4YA 4A4CA 4PHNA 3DF0B 1AP4A 1GGWA 1S3PA 1CLBA 4UPGA 5AFPA 3QRXA 1PSRA 4MRXA 3RM1A 3LL8B 2HQ8A 1NCXA 1ZUZA 2O60A 2COLB 3I5IC 1JC2A 1KQVA 2JRFA 2M9GA 3FWBA 1BJFA 2JT0A 2K8MB 3KEVA 2MAZA 2P6BB 4M2OA 1S36A 1AUIB 1A75B 1V1GA 1F4OA 1PALA 5ER4X 1IWQA 1OE9B 1WRKA 2JNFA 2EHBA 2Y4QA 4HRGA 2H61A 1BF5A 3LK1A 1IRJA 2F8PA 2JWWA 1NP8A 2AAOA 1AK8A 1F4QA 1B9AA 2I7AA 1S5GZ 2L4IA 3BOWB 1E8AA 2LNKA 1UHKA 2OS8C 2ZN9A 4DS7A 2M97A 2HQWA 5BPJA 2NLNA 2LHIA 1G33A 1XA5A 1EL4A 1DJIA 3PN7C 4L9MA 1PSBA 3LCPC 4PCWA 1CMFA 1UHJA 1CDMA 2KDHA 1NX3A 1QATA 1KK8C 1Y1AA 3WHUB 4JWQA 1F55A 4M2QA 1Y1XA 3A8RA 2K7OA 1SNLA 3AKBA 1JUOA 1L2OC 2LANA 3PN7B 3CTNA 4OVNF 1ZFSA 1LINA 5CPVA 1DMOA 1HT9A 2FJUB 1TNPA 3HCMA 1KK8B 4YRUA 5CSFA 1SR6B 1NSHA 4MSPA 3OX5A 5I2QA 1D1OA 3ZWHA 1SMGA 1WRZA 3CR2A 2G2BA 1UHIA 1KFUS 2KNEA 2M8UA 4OKHA 2MRDA 4QJ5B 1OZOA 1YVHA 1K2HA 1CB1A 3AKAA 4PE4A 1ALVA 2IS9A 2I2RE 1WDCB 1ZMZA 1AJ4A 4JQ0D 1PVBA 5DKRA 2K7BA 2Y1NA 1K94A 1KSMA 4XYNA 3KO0A 5AERA 1BMOA 1TNQA 4MRYA 3TUYC 2BL0C 2L50A 3K21A 3IQQA 3OHMB 3H4SE 4QJ3B 1N2DA 1DF0A 4DCKA 1IJ6A 2OTGC 3F45A 1B8CA 1UHHA 1RROA 4ZCUA 2M7NA 4NDCA 2LV7A 2M3WA 2SCPA 3JTDC 3PM8A 4GNKB 3SIBA 3TUYB 2B1UA 2PVBA 5F6TA 3DVEA 2G9BA 1KQMB 2F2PA 4YI8A 3TDUA 2JPTA 2OTGB 2JNXA 3I5HC 4IL1A 1KK7Y 5AEQA 2LVJA 2JT8A 1EXRA 1B7TY 1NUBA 2CTNA 2HPSA 2M1KB 2LVKA 3JTDB 5KU1A 1G4YR 1OMRA 1DJGA 1K9KA 3C1VA 2ZRTA 2L51A 4P2YB 1BU3A 2MJWB 3I5HB 1B4CA 2KQYA 2TN4A 1ZACA 3GK4X 1B47A 4N5XA 3CR4X 1EG4A 2M7LA 1QVIZ 2BKHB 3MSEB 1LA0A 1QS7A 1DF0B 1YURA 3WNXB 1U5IA 3CS1A 2SASA 1TCOB 1M45A 2CBLA 2PSRA 5GQQC 2PRUA 3BUWB 4AQJA 1WLZA 5JJGA 4C0LA 1NIWA 1IQ5A 1SBJA 4DRWA 1BT6A 1CDLA 1DJXA 2ZN8A 1CM1A 2JU0A 1CKKA 2LLUA 1CFFA 1QX2A 1RTP1 2O5GA 2OPOA 2LHLA 1B8RA 3OB2B 4USLA 1YUSA 2BE6A 1S6IA 1H8BA 2L98A 2GGZA 5B8IB 3SG6A 2AUCA 5G08A 3D10A 3DVKA 4M2PA 2K7CA 1EJ3A 2ZFDA 1FI6A 1R2UA 1S5GY 3TZ1A 3TDIA 1K93D 4GGFC 3I5IB 5TNCA 2F33A 3SG7A 1U5IB 2JULA 3EVRA 5I2OA 1NX0A 1JBAA 2MBXA 3I5GC 4ORBB 1CDNA 3PATA 1C07A 3VROA 1RFJA 2BCBA 3IQOA 4MZLA 3BUXB 2FCEA 3EK7A 1LVCD 1QASA 1QTXA 4PDZA 4E68A 2PMYA 4WQ3A 1K9PA 2LMTA 1QX7A 1WRLA 1YRTB 2PASA 3I5GB 1Q80A 2VRGA 1JF2A 1W7JB 1GGZA 2OS8B 3DVMA 3I5FC 4ORAB 2Q4UA 2WCBA 1M31A 4YGDB 1JWDA 2BE4A 2Y5IA 4HRHA 4ORCB 2MHHA 1F70A 1KFUL 2LLSA 1S1EA 1AJ5A 1UP5A 3NXAA 1ALWA 2PALA 4YGAA 3I5FB 1TCFA 2JTZA 2BBNA 2LP3A 3M0WA 2KHNA 2KYFA 1QX5B 1WY9A 1OOJA 3BQ3A 2K7DA 3KHEA 4I5NB 2E30A 1Y1UA 1XO5A 3NSOA 2MLEC 1NYAA 2QACA 4NQGA 2WC8A 4QJ4B 1S26D 1L2OB 2BCAA 2F3YA 2M49B 4YBHB 1CFPA 3NSKA 4A4BA 5I2LA 2LVVA 1SPYA 1FPWA 4I5LB 1IKUA 1X02A 3NSLA 1M46A 1FW4A 1MXLC 3O78A 2F2OA 1XFVO 2FOTA 2I94A 1MF8B 2LMUA 1SW8A 3SG2A 3IF7A 4XJKA 1CLMA 2KFFA 1CNPA 1NX1A 1XFXO 4PE1A 3TS5C 5HKZA 2KAXA 4OCIA 1WLMA 2E6WA 2KAVA 2WORA 3VRQA 1QJTA 1W7IB 4ETOA 2K2FA 1XVJA 3EVUA 2LMVA 2JZIA 1KCYA 2BL0B 4PALA 1OQPA 4P5OE 4DIRA 3TDZA 1HQVA 2BBMA 4GGNA 2EC6C 1EH2A 1SL7A 1UHNA 2K0JA 1CDPA 3GK1A 5AANA 2NCPA 4NDBA 3OX6A 4CFRA 1LKJA 1H4BA 4YGCB 1QV1A 1QIVA 2FCDA 1FBVA 1UWOA 3LLEA 2NZ0A 1TOPA 1QVIY 3JVTC 1DGUA 1A4PA 1MXEA 1YRUB 1RWYA 3FIAA 2ISDA 1TTXA 1JFJA 1BR4B 4PHJA 2QPTA 2KBIA 2L0PA 3WHTB 5DKNA 1SYMA 4MZJA 1TN4A 5FYXA 4YGEB 1S6JA 2GGMA 4YI9A 4GBAA 2LLTA 1JF0A 4XJKB 1NCZA 4C0KA 2JQ6A 2H2KA 1Y6WA 1NPQA 1MUXA 1K96A 3E3RA 1N0YA 3LK0A 1BG1A 1C7WA 1CM4A 4DUQA 5HLOA 5IBWA 2LAPA 1F8HA 1KSOA 4GGFA 3HX4A 4TNCA 1DJWA 1PULA 1SCVA 3EK8A 2BECA 4YGBB 2KOTA 3GOFA 4NDDA 2KSPA 3PLFB 4I5KA 1PK0D 4FQOA 3SJSA 2KFGA 3VRRA 3SG3A 4F0ZB 1RJVA 4HREE 1QXPA 2LC5A 4CIDA 5ER5A 3CWGA 2RGIA 1FI5A 2AMIA 5CSNA 1C7VA 1MR8A 1J7PA 4PE0A 2LCPA 3VGOA 5K89A 1LXFC 1GJYA 1XYDA 2MLFC 5CSIA 1JFKA 3DVJA 2V53A 1IH0A 2Y1MA 1DTLA 4MVFA 3RLZA 2WNDA 1M63B 1BLQA 2LUCA 4BY4A 1KFXS 3PALA 4PHKA 5D69A 3BUOB 3PSRA 1IG5A 1VRKA 1TNXA 1GQMA 1KWOC 3BUMB 2JXLA 2KGRA 2BCXA 3CR5X 1A29A 4CPVA 3DD4A 2Q91A 3ZNIA 1UURA 2EGDA 2KYCA 1MHOA 1QV0A 3NSIA 3KPXA 4WRIA 1KWOB 5KSZA 1XFZO 3OP0A 3EKJA 3CGAA 1OMVA 1AVSA 1NCYA 3AAJA 4AQIA 3O6BA 1K9UA 4MN0A 1CFDA 1BOCA 1QLSA 1A2XA 1CFCA 1OZSA 1Y0VH 3EVVA 1XFWO 1A03A 2KBMA 5PALA 1IGVA 3KF9A 2LVIA 2KQ6A 1CMGA 1SK6D 4GPLB 2WCFA 2ZKMX 5CSJA 1TNWA 2NXQA 3AAKA 1YTZC 4GFTA 1G8IA 1R6PA 2CXJA 1S6CA 2A4JA 3ICBA 4PHMA 2JTTA 4D1EA 1PRWA 1TIZA 1V1FA 1F54A 1SR6C 4OV2A 4WQ2A 1B1GA 1J1DA 2H61C 3BXKA 1SKTA 5DKQA 2JXCA 3VRNA 4N1GA 4JPZB 2LM5A 2ZRSA 1SY9A 1OSAA 2K61A 4FTGA 4CFQA 2D8NA 1SCMC 1PVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WDC C;  4PE7 A;  1DGV A;  3BUN B;  1K8U A;  5AXI A;  3CZT X;  2JOJ A;  4MEW A;  1IQ3 A;  4Q04 A;  5KTY A;  1SCM B;  4HSZ A;  2ZND A;  5JOL A;  4MBE A;  3TS5 B;  3CLN A;  1F71 A;  2WOS A;  4R1E A;  1QIW A;  1LA3 A;  3BYA A;  2HF5 A;  3WXA A;  3D0Y A;  1DJY A;  4AOM A;  1YUU A;  5D7F A;  4OR9 B;  1KQM C;  1K95 A;  2CCM A;  1N65 A;  3GK2 A;  1ODB A;  4GAO A;  3SG5 A;  1SRA A;  1IJ5 A;  5HLV A;  1XFU O;  2L4H A;  2EC6 B;  1J7R A;  4U8D A;  2NCO A;  3EKH A;  1B8L A;  1CTR A;  2CNP A;  2F3Z A;  4N1F A;  3SIA A;  2JT3 A;  1AHR A;  1M39 A;  1MWN A;  4MZK A;  5HKY A;  2GV5 A;  1J55 A;  1YX8 A;  3JVT B;  1BOD A;  3O2P A;  4ZCV A;  1XK4 A;  1YR5 A;  1EG3 A;  1L7Z A;  3DF0 A;  2ZNE A;  2WCE A;  2KFH A;  2KI6 D;  2MA2 A;  4MLW A;  1TRF A;  1UUS A;  1DJH A;  3FS7 A;  1K90 D;  3SG4 A;  5I8N A;  1NWD A;  1QLK A;  1KK7 Z;  2HET A;  2KI4 C;  2LE9 B;  2KAY A;  1SL9 A;  1B7T Z;  2L2E A;  3A4U B;  1JSA A;  2M1U A;  1SL8 A;  2CT9 A;  2KI6 C;  1A75 A;  4I5J A;  1DJZ A;  4BY5 A;  3D0Y B;  2KGB C;  3FWC A;  1MQ1 A;  1DVI A;  4CLN A;  2LP2 A;  5J3X A;  1NX2 A;  1YUT A;  2KI4 B;  5HKW A;  4ICB A;  1J7Q A;  1ZOT B;  1CLL A;  1KFX L;  1XK4 C;  1YVL A;  1J7O A;  4GUK A;  3EK4 A;  1BR1 B;  2DOQ A;  3BOW A;  1DT7 B;  1OMD A;  2M29 A;  4C0J A;  3OB1 B;  2JC2 A;  2BKI B;  2LUX A;  1YX7 A;  5HYD A;  2M0R A;  2L5X B;  1J1E A;  3PFV A;  1RK9 A;  1REC A;  3VRP A;  1FF1 A;  2R2I A;  2I18 A;  1XFY O;  2K2A A;  3O4Y A;  4A4C A;  4PHN A;  3DF0 B;  1AP4 A;  1GGW A;  1S3P A;  1CLB A;  4UPG A;  5AFP A;  3QRX A;  1PSR A;  4MRX A;  3RM1 A;  3LL8 B;  2HQ8 A;  1NCX A;  1ZUZ A;  2O60 A;  2COL B;  3I5I C;  1JC2 A;  1KQV A;  2JRF A;  2M9G A;  3FWB A;  1BJF A;  2JT0 A;  2K8M B;  3KEV A;  2MAZ A;  2P6B B;  4M2O A;  1S36 A;  1AUI B;  1A75 B;  1V1G A;  1F4O A;  1PAL A;  5ER4 X;  1IWQ A;  1OE9 B;  1WRK A;  2JNF A;  2EHB A;  2Y4Q A;  4HRG A;  2H61 A;  1BF5 A;  3LK1 A;  1IRJ A;  2F8P A;  2JWW A;  1NP8 A;  2AAO A;  1AK8 A;  1F4Q A;  1B9A A;  2I7A A;  1S5G Z;  2L4I A;  3BOW B;  1E8A A;  2LNK A;  1UHK A;  2OS8 C;  2ZN9 A;  4DS7 A;  2M97 A;  2HQW A;  5BPJ A;  2NLN A;  2LHI A;  1G33 A;  1XA5 A;  1EL4 A;  1DJI A;  3PN7 C;  4L9M A;  1PSB A;  3LCP C;  4PCW A;  1CMF A;  1UHJ A;  1CDM A;  2KDH A;  1NX3 A;  1QAT A;  1KK8 C;  1Y1A A;  3WHU B;  4JWQ A;  1F55 A;  4M2Q A;  1Y1X A;  3A8R A;  2K7O A;  1SNL A;  3AKB A;  1JUO A;  1L2O C;  2LAN A;  3PN7 B;  3CTN A;  4OVN F;  1ZFS A;  1LIN A;  5CPV A;  1DMO A;  1HT9 A;  2FJU B;  1TNP A;  3HCM A;  1KK8 B;  4YRU A;  5CSF A;  1SR6 B;  1NSH A;  4MSP A;  3OX5 A;  5I2Q A;  1D1O A;  3ZWH A;  1SMG A;  1WRZ A;  3CR2 A;  2G2B A;  1UHI A;  1KFU S;  2KNE A;  2M8U A;  4OKH A;  2MRD A;  4QJ5 B;  1OZO A;  1YVH A;  1K2H A;  1CB1 A;  3AKA A;  4PE4 A;  1ALV A;  2IS9 A;  2I2R E;  1WDC B;  1ZMZ A;  1AJ4 A;  4JQ0 D;  1PVB A;  5DKR A;  2K7B A;  2Y1N A;  1K94 A;  1KSM A;  4XYN A;  3KO0 A;  5AER A;  1BMO A;  1TNQ A;  4MRY A;  3TUY C;  2BL0 C;  2L50 A;  3K21 A;  3IQQ A;  3OHM B;  3H4S E;  4QJ3 B;  1N2D A;  1DF0 A;  4DCK A;  1IJ6 A;  2OTG C;  3F45 A;  1B8C A;  1UHH A;  1RRO A;  4ZCU A;  2M7N A;  4NDC A;  2LV7 A;  2M3W A;  2SCP A;  3JTD C;  3PM8 A;  4GNK B;  3SIB A;  3TUY B;  2B1U A;  2PVB A;  5F6T A;  3DVE A;  2G9B A;  1KQM B;  2F2P A;  4YI8 A;  3TDU A;  2JPT A;  2OTG B;  2JNX A;  3I5H C;  4IL1 A;  1KK7 Y;  5AEQ A;  2LVJ A;  2JT8 A;  1EXR A;  1B7T Y;  1NUB A;  2CTN A;  2HPS A;  2M1K B;  2LVK A;  3JTD B;  5KU1 A;  1G4Y R;  1OMR A;  1DJG A;  1K9K A;  3C1V A;  2ZRT A;  2L51 A;  4P2Y B;  1BU3 A;  2MJW B;  3I5H B;  1B4C A;  2KQY A;  2TN4 A;  1ZAC A;  3GK4 X;  1B47 A;  4N5X A;  3CR4 X;  1EG4 A;  2M7L A;  1QVI Z;  2BKH B;  3MSE B;  1LA0 A;  1QS7 A;  1DF0 B;  1YUR A;  3WNX B;  1U5I A;  3CS1 A;  2SAS A;  1TCO B;  1M45 A;  2CBL A;  2PSR A;  5GQQ C;  2PRU A;  3BUW B;  4AQJ A;  1WLZ A;  5JJG A;  4C0L A;  1NIW A;  1IQ5 A;  1SBJ A;  4DRW A;  1BT6 A;  1CDL A;  1DJX A;  2ZN8 A;  1CM1 A;  2JU0 A;  1CKK A;  2LLU A;  1CFF A;  1QX2 A;  1RTP 1;  2O5G A;  2OPO A;  2LHL A;  1B8R A;  3OB2 B;  4USL A;  1YUS A;  2BE6 A;  1S6I A;  1H8B A;  2L98 A;  2GGZ A;  5B8I B;  3SG6 A;  2AUC A;  5G08 A;  3D10 A;  3DVK A;  4M2P A;  2K7C A;  1EJ3 A;  2ZFD A;  1FI6 A;  1R2U A;  1S5G Y;  3TZ1 A;  3TDI A;  1K93 D;  4GGF C;  3I5I B;  5TNC A;  2F33 A;  3SG7 A;  1U5I B;  2JUL A;  3EVR A;  5I2O A;  1NX0 A;  1JBA A;  2MBX A;  3I5G C;  4ORB B;  1CDN A;  3PAT A;  1C07 A;  3VRO A;  1RFJ A;  2BCB A;  3IQO A;  4MZL A;  3BUX B;  2FCE A;  3EK7 A;  1LVC D;  1QAS A;  1QTX A;  4PDZ A;  4E68 A;  2PMY A;  4WQ3 A;  1K9P A;  2LMT A;  1QX7 A;  1WRL A;  1YRT B;  2PAS A;  3I5G B;  1Q80 A;  2VRG A;  1JF2 A;  1W7J B;  1GGZ A;  2OS8 B;  3DVM A;  3I5F C;  4ORA B;  2Q4U A;  2WCB A;  1M31 A;  4YGD B;  1JWD A;  2BE4 A;  2Y5I A;  4HRH A;  4ORC B;  2MHH A;  1F70 A;  1KFU L;  2LLS A;  1S1E A;  1AJ5 A;  1UP5 A;  3NXA A;  1ALW A;  2PAL A;  4YGA A;  3I5F B;  1TCF A;  2JTZ A;  2BBN A;  2LP3 A;  3M0W A;  2KHN A;  2KYF A;  1QX5 B;  1WY9 A;  1OOJ A;  3BQ3 A;  2K7D A;  3KHE A;  4I5N B;  2E30 A;  1Y1U A;  1XO5 A;  3NSO A;  2MLE C;  1NYA A;  2QAC A;  4NQG A;  2WC8 A;  4QJ4 B;  1S26 D;  1L2O B;  2BCA A;  2F3Y A;  2M49 B;  4YBH B;  1CFP A;  3NSK A;  4A4B A;  5I2L A;  2LVV A;  1SPY A;  1FPW A;  4I5L B;  1IKU A;  1X02 A;  3NSL A;  1M46 A;  1FW4 A;  1MXL C;  3O78 A;  2F2O A;  1XFV O;  2FOT A;  2I94 A;  1MF8 B;  2LMU A;  1SW8 A;  3SG2 A;  3IF7 A;  4XJK A;  1CLM A;  2KFF A;  1CNP A;  1NX1 A;  1XFX O;  4PE1 A;  3TS5 C;  5HKZ A;  2KAX A;  4OCI A;  1WLM A;  2E6W A;  2KAV A;  2WOR A;  3VRQ A;  1QJT A;  1W7I B;  4ETO A;  2K2F A;  1XVJ A;  3EVU A;  2LMV A;  2JZI A;  1KCY A;  2BL0 B;  4PAL A;  1OQP A;  4P5O E;  4DIR A;  3TDZ A;  1HQV A;  2BBM A;  4GGN A;  2EC6 C;  1EH2 A;  1SL7 A;  1UHN A;  2K0J A;  1CDP A;  3GK1 A;  5AAN A;  2NCP A;  4NDB A;  3OX6 A;  4CFR A;  1LKJ A;  1H4B A;  4YGC B;  1QV1 A;  1QIV A;  2FCD A;  1FBV A;  1UWO A;  3LLE A;  2NZ0 A;  1TOP A;  1QVI Y;  3JVT C;  1DGU A;  1A4P A;  1MXE A;  1YRU B;  1RWY A;  3FIA A;  2ISD A;  1TTX A;  1JFJ A;  1BR4 B;  4PHJ A;  2QPT A;  2KBI A;  2L0P A;  3WHT B;  5DKN A;  1SYM A;  4MZJ A;  1TN4 A;  5FYX A;  4YGE B;  1S6J A;  2GGM A;  4YI9 A;  4GBA A;  2LLT A;  1JF0 A;  4XJK B;  1NCZ A;  4C0K A;  2JQ6 A;  2H2K A;  1Y6W A;  1NPQ A;  1MUX A;  1K96 A;  3E3R A;  1N0Y A;  3LK0 A;  1BG1 A;  1C7W A;  1CM4 A;  4DUQ A;  5HLO A;  5IBW A;  2LAP A;  1F8H A;  1KSO A;  4GGF A;  3HX4 A;  4TNC A;  1DJW A;  1PUL A;  1SCV A;  3EK8 A;  2BEC A;  4YGB B;  2KOT A;  3GOF A;  4NDD A;  2KSP A;  3PLF B;  4I5K A;  1PK0 D;  4FQO A;  3SJS A;  2KFG A;  3VRR A;  3SG3 A;  4F0Z B;  1RJV A;  4HRE E;  1QXP A;  2LC5 A;  4CID A;  5ER5 A;  3CWG A;  2RGI A;  1FI5 A;  2AMI A;  5CSN A;  1C7V A;  1MR8 A;  1J7P A;  4PE0 A;  2LCP A;  3VGO A;  5K89 A;  1LXF C;  1GJY A;  1XYD A;  2MLF C;  5CSI A;  1JFK A;  3DVJ A;  2V53 A;  1IH0 A;  2Y1M A;  1DTL A;  4MVF A;  3RLZ A;  2WND A;  1M63 B;  1BLQ A;  2LUC A;  4BY4 A;  1KFX S;  3PAL A;  4PHK A;  5D69 A;  3BUO B;  3PSR A;  1IG5 A;  1VRK A;  1TNX A;  1GQM A;  1KWO C;  3BUM B;  2JXL A;  2KGR A;  2BCX A;  3CR5 X;  1A29 A;  4CPV A;  3DD4 A;  2Q91 A;  3ZNI A;  1UUR A;  2EGD A;  2KYC A;  1MHO A;  1QV0 A;  3NSI A;  3KPX A;  4WRI A;  1KWO B;  5KSZ A;  1XFZ O;  3OP0 A;  3EKJ A;  3CGA A;  1OMV A;  1AVS A;  1NCY A;  3AAJ A;  4AQI A;  3O6B A;  1K9U A;  4MN0 A;  1CFD A;  1BOC A;  1QLS A;  1A2X A;  1CFC A;  1OZS A;  1Y0V H;  3EVV A;  1XFW O;  1A03 A;  2KBM A;  5PAL A;  1IGV A;  3KF9 A;  2LVI A;  2KQ6 A;  1CMG A;  1SK6 D;  4GPL B;  2WCF A;  2ZKM X;  5CSJ A;  1TNW A;  2NXQ A;  3AAK A;  1YTZ C;  4GFT A;  1G8I A;  1R6P A;  2CXJ A;  1S6C A;  2A4J A;  3ICB A;  4PHM A;  2JTT A;  4D1E A;  1PRW A;  1TIZ A;  1V1F A;  1F54 A;  1SR6 C;  4OV2 A;  4WQ2 A;  1B1G A;  1J1D A;  2H61 C;  3BXK A;  1SKT A;  5DKQ A;  2JXC A;  3VRN A;  4N1G A;  4JPZ B;  2LM5 A;  2ZRS A;  1SY9 A;  1OSA A;  2K61 A;  4FTG A;  4CFQ A;  2D8N A;  1SCM C;  1PVA A; 
#chains in the Genus database with same CATH topology
 1WDC C;  4PE7 A;  1DGV A;  3BUN B;  1SSE B;  1OW4 A;  1K8U A;  5AXI A;  3CZT X;  2JOJ A;  4MEW A;  1IQ3 A;  4Q04 A;  5KTY A;  1SCM B;  4HSZ A;  2ZND A;  5JOL A;  4MBE A;  3TS5 B;  3CLN A;  1F71 A;  2WOS A;  4R1E A;  1QIW A;  1LA3 A;  3BYA A;  2HF5 A;  3WXA A;  3D0Y A;  1DJY A;  5FI7 A;  2WCM A;  4AOM A;  1YUU A;  5D7F A;  4OR9 B;  1KQM C;  1K95 A;  2CCM A;  1N65 A;  3GK2 A;  1ODB A;  4GAO A;  3SG5 A;  1SRA A;  1IJ5 A;  5HLV A;  1XFU O;  2L4H A;  2EC6 B;  1J7R A;  4U8D A;  2P71 A;  2NCO A;  3EKH A;  1B8L A;  1CTR A;  2ERB A;  2CNP A;  2F3Z A;  4N1F A;  3SIA A;  2JT3 A;  1AHR A;  1M39 A;  1MWN A;  3FE8 A;  4MZK A;  5HKY A;  2GV5 A;  1J55 A;  1ORG A;  1YX8 A;  3JVT B;  1BOD A;  3O2P A;  4ZCV A;  1XK4 A;  1YR5 A;  1EG3 A;  5HL1 A;  1T14 A;  1L7Z A;  3DF0 A;  2ZNE A;  2WCE A;  2KFH A;  2KI6 D;  2MA2 A;  4MLW A;  1TRF A;  1UUS A;  1DJH A;  3FS7 A;  1K90 D;  3SG4 A;  5I8N A;  3RZS A;  1NWD A;  1QLK A;  1KK7 Z;  2HET A;  2KI4 C;  2LE9 B;  2KAY A;  3L47 A;  1SL9 A;  1B7T Z;  2L2E A;  3A4U B;  3B88 A;  1JSA A;  2M1U A;  3V2L A;  1SL8 A;  2CT9 A;  2KI6 C;  1A75 A;  4I5J A;  1DJZ A;  4BY5 A;  3D0Y B;  2KGB C;  3FWC A;  1MQ1 A;  1DVI A;  4CLN A;  2LP2 A;  5J3X A;  1NX2 A;  3D74 A;  1YUT A;  1DEL A;  2KI4 B;  5HKW A;  4ICB A;  1J7Q A;  1ZOT B;  1CLL A;  2BAP A;  1KFX L;  1XK4 C;  1YVL A;  5EL2 A;  1J7O A;  4GUK A;  3IVT A;  3D75 A;  3EK4 A;  1BR1 B;  2DOQ A;  3BOW A;  1DT7 B;  1OMD A;  2WC5 A;  3SS4 A;  2M29 A;  4C0J A;  3B6X A;  3OB1 B;  2JC2 A;  2BKI B;  2LUX A;  1YX7 A;  5HYD A;  2M0R A;  2L5X B;  1J1E A;  3PFV A;  1RK9 A;  1REC A;  3B87 A;  3VRP A;  3FE9 A;  2R2I A;  2I18 A;  1XFY O;  2K2A A;  3O4Y A;  4A4C A;  4PHN A;  3DF0 B;  1AP4 A;  1GGW A;  1S3P A;  1CLB A;  4UPG A;  5AFP A;  3QRX A;  1PSR A;  4MRX A;  3RM1 A;  3LL8 B;  2HQ8 A;  1NCX A;  1ZUZ A;  2O60 A;  2COL B;  3I5I C;  3DZT A;  1JC2 A;  1KQV A;  2JRF A;  2M9G A;  3FWB A;  1BJF A;  2JT0 A;  2K8M B;  3KEV A;  2MAZ A;  2P6B B;  4M2O A;  1S36 A;  1AUI B;  1A75 B;  1V1G A;  1F4O A;  1PAL A;  5ER4 X;  1IWQ A;  1OE9 B;  1WRK A;  2JNF A;  2EHB A;  2Y4Q A;  4HRG A;  2H61 A;  3PJI A;  3LK1 A;  1IRJ A;  2F8P A;  1BF5 A;  2JWW A;  1NP8 A;  2AAO A;  5DIC A;  1AK8 A;  1F4Q A;  1B9A A;  2I7A A;  1S5G Z;  2L4I A;  3BOW B;  1E8A A;  2LNK A;  1UHK A;  2OS8 C;  2ZN9 A;  2BNX A;  4DS7 A;  2M97 A;  2HQW A;  1TUJ A;  5BPJ A;  2NLN A;  2LHI A;  1G33 A;  1XA5 A;  1EL4 A;  2QEO A;  3BFB A;  1DJI A;  1Z2C B;  3PN7 C;  4PT1 A;  4L9M A;  1PSB A;  3LCP C;  4PCW A;  1CMF A;  1UHJ A;  1CDM A;  2KDH A;  1NX3 A;  1QAT A;  1KK8 C;  1Y1A A;  3WHU B;  4JWQ A;  1F55 A;  4M2Q A;  1Y1X A;  3A8R A;  2K7O A;  3DXL A;  4JKT A;  1SNL A;  3AKB A;  3Q8I A;  1JUO A;  1L2O C;  2LAN A;  3PN7 B;  3CTN A;  4OVN F;  1ZFS A;  4FQT A;  1LIN A;  5CPV A;  1DMO A;  1HT9 A;  2FJU B;  1TNP A;  3DYE A;  1KK8 B;  3HCM A;  3EG5 B;  4YRU A;  5CSF A;  1SR6 B;  1NSH A;  4MSP A;  3OX5 A;  5I2Q A;  1D1O A;  2GTE A;  3ZWH A;  1FF1 A;  1SMG A;  1WRZ A;  3CR2 A;  1OOI X;  2G2B A;  1UHI A;  1KFU S;  2KNE A;  2M8U A;  4OKH A;  2MRD A;  4QJ5 B;  1OZO A;  1YVH A;  1K2H A;  1CB1 A;  3AKA A;  4PE4 A;  1ALV A;  2IS9 A;  2I2R E;  1WDC B;  1ZMZ A;  1AJ4 A;  4JQ0 D;  1PVB A;  2QEV A;  5DKR A;  2K7B A;  3VB1 A;  2Y1N A;  1K94 A;  1KSM A;  4XYN A;  3KO0 A;  3R72 A;  4F7F A;  5AER A;  1BMO A;  1TNQ A;  2K60 A;  4MRY A;  2BL0 C;  2L50 A;  3K21 A;  3TUY C;  3IQQ A;  3OHM B;  3H4S E;  4QJ3 B;  1N2D A;  1DF0 A;  4DCK A;  1IJ6 A;  2OTG C;  3F45 A;  1B8C A;  1UHH A;  2KPH A;  1RRO A;  4ZCU A;  2M7N A;  4NDC A;  2LV7 A;  2M3W A;  2SCP A;  3JTD C;  3PM8 A;  4GNK B;  3SIB A;  3TUY B;  2B1U A;  2PVB A;  5F6T A;  3DVE A;  2G9B A;  1KQM B;  2F2P A;  4YI8 A;  3TDU A;  1QWV A;  2JPT A;  2OTG B;  2QEH A;  2JNX A;  4JD9 A;  3CYZ A;  3I5H C;  4IL1 A;  1KK7 Y;  4INW A;  5AEQ A;  2LVJ A;  2JT8 A;  1EXR A;  1B7T Y;  1NUB A;  2CTN A;  2HPS A;  2K61 A;  2LVK A;  2M1K B;  3CZ0 A;  5KU1 A;  1G4Y R;  3S0D A;  1OMR A;  1DJG A;  1K9K A;  3C1V A;  2ZRT A;  2L51 A;  4P2Y B;  1BU3 A;  2MJW B;  3I5H B;  3SS3 A;  1B4C A;  2KQY A;  2TN4 A;  1ZAC A;  1Z4H A;  3FE6 A;  1B47 A;  1DQE A;  3CR4 X;  1EG4 A;  3GK4 X;  4N5X A;  2M7L A;  1DEK A;  1QVI Z;  3D73 A;  2BKH B;  1C3Z A;  3MSE B;  1LA0 A;  1QS7 A;  1DF0 B;  1YUR A;  3WNX B;  1U5I A;  3CS1 A;  2SAS A;  1TCO B;  1M45 A;  2CBL A;  2PSR A;  3CDN A;  5GQQ C;  3NGV A;  2PRU A;  3BUW B;  3D76 A;  4AQJ A;  1WLZ A;  5JJG A;  4C0L A;  1NIW A;  1IQ5 A;  1SBJ A;  3B86 A;  4DRW A;  1BT6 A;  1CDL A;  1DJX A;  2ZN8 A;  1CM1 A;  2JU0 A;  1CKK A;  2LLU A;  1CFF A;  1QX2 A;  1RTP 1;  2O5G A;  2OPO A;  2LHL A;  1B8R A;  3OB2 B;  4USL A;  1OOG A;  1YUS A;  2BE6 A;  1S6I A;  1H8B A;  2L98 A;  2GGZ A;  5B8I B;  3SG6 A;  2AUC A;  5G08 A;  3D10 A;  3DVK A;  4M2P A;  2K7C A;  1OOH A;  1EJ3 A;  2ZFD A;  1FI6 A;  1R2U A;  1S5G Y;  3TZ1 A;  3TDI A;  3S0B A;  1K93 D;  4GGF C;  3CAB A;  3I5I B;  3R1V A;  5TNC A;  2F33 A;  3SG7 A;  1U5I B;  2JUL A;  3EVR A;  5I2O A;  1NX0 A;  1JBA A;  2MBX A;  3I5G C;  4ORB B;  1CDN A;  3NHI A;  3PAT A;  1C07 A;  3VRO A;  1RFJ A;  2BCB A;  2QEB A;  3IQO A;  4MZL A;  3BUX B;  2FCE A;  3EK7 A;  1LVC D;  1QAS A;  1QTX A;  4PDZ A;  4E68 A;  1W9Z A;  2PMY A;  4WQ3 A;  3S0F A;  1K9P A;  2JPO A;  2LMT A;  1QX7 A;  1WRL A;  1YRT B;  2PAS A;  3I5G B;  1C3Y A;  1Q80 A;  2VRG A;  3D78 A;  1JF2 A;  1W7J B;  1GGZ A;  2OS8 B;  3DVM A;  3I5F C;  4ORA B;  2Q4U A;  2WCB A;  1M31 A;  4YGD B;  1JWD A;  2BE4 A;  2WCL A;  2Y5I A;  4HRH A;  4ORC B;  2MHH A;  5D3O A;  1KFU L;  2LLS A;  1F70 A;  1S1E A;  1AJ5 A;  1UP5 A;  3NXA A;  1ALW A;  2PAL A;  4YGA A;  3I5F B;  3L4L A;  1TCF A;  2JTZ A;  2BBN A;  2LP3 A;  3M0W A;  2KHN A;  2KYF A;  1QX5 B;  1WY9 A;  1OOJ A;  3BQ3 A;  2K7D A;  3KHE A;  4I5N B;  3UO9 A;  2E30 A;  1Y1U A;  1XO5 A;  3NSO A;  3S0G A;  2MLE C;  1NYA A;  2QAC A;  4NQG A;  2WC8 A;  4QJ4 B;  1S26 D;  1L2O B;  2BCA A;  2F3Y A;  2M49 B;  4YBH B;  1CFP A;  3NSK A;  4A4B A;  5I2L A;  2LVV A;  1OOF A;  1SPY A;  1FPW A;  2YGU A;  4I5L B;  1IKU A;  1X02 A;  3NSL A;  1M46 A;  2WCJ A;  5FI6 A;  1FW4 A;  1MXL C;  3O78 A;  3R1O A;  2F2O A;  3BFA A;  3NHT A;  1XFV O;  2H8V A;  2FOT A;  2I94 A;  1MF8 B;  2LMU A;  1SW8 A;  3SG2 A;  3UNW A;  3IF7 A;  4XJK A;  3R1P A;  1CLM A;  2FJY A;  2KFF A;  1CNP A;  1NX1 A;  1XFX O;  4PE1 A;  3TS5 C;  5HKZ A;  4IJ7 A;  3B7A A;  2KAX A;  4OCI A;  1WLM A;  2E6W A;  2KAV A;  2WOR A;  3VRQ A;  1QJT A;  1W7I B;  4ETO A;  2K2F A;  1XVJ A;  3EVU A;  2LMV A;  2JZI A;  1KCY A;  2BL0 B;  4PAL A;  1OQP A;  3N7H A;  2WCK A;  4P5O E;  3L4A A;  4DIR A;  3TDZ A;  1HQV A;  2BBM A;  4GGN A;  3DY9 A;  2EC6 C;  1EH2 A;  1SL7 A;  1UHN A;  2K0J A;  1CDP A;  3GK1 A;  5AAN A;  2NCP A;  4NDB A;  3OX6 A;  4CFR A;  1LKJ A;  1DC1 A;  1H4B A;  3SS5 A;  4YGC B;  1QV1 A;  1QIV A;  2FCD A;  1FBV A;  1UWO A;  3LLE A;  2NZ0 A;  1TOP A;  1QVI Y;  3JVT C;  1DGU A;  1A4P A;  1MXE A;  1TWO A;  1RWY A;  1YRU B;  1LS8 A;  3FIA A;  2ISD A;  1TTX A;  1JFJ A;  2WCH A;  1BR4 B;  4PHJ A;  2QPT A;  2KBI A;  2L0P A;  2L5Y A;  3WHT B;  5DKN A;  1SYM A;  4MZJ A;  1TN4 A;  5FYX A;  4YGE B;  1S6J A;  2GGM A;  4YI9 A;  4GBA A;  2LLT A;  1JF0 A;  4XJK B;  1NCZ A;  4C0K A;  2JQ6 A;  2H2K A;  3PM2 A;  1Y6W A;  1NPQ A;  3BFH A;  1MUX A;  1K96 A;  3E3R A;  3OBV A;  1N0Y A;  3LK0 A;  1BG1 A;  1C7W A;  1CM4 A;  2PQL A;  4DUQ A;  5HLO A;  5IBW A;  4INX A;  1IIO A;  2LAP A;  1F8H A;  1KSO A;  4GGF A;  3HX4 A;  4TNC A;  1DJW A;  1P28 A;  1PUL A;  1SCV A;  2BEC A;  3EK8 A;  3S0A A;  4YGB B;  2KOT A;  3GOF A;  4NDD A;  2KSP A;  3PLF B;  4I5K A;  1PK0 D;  4FQO A;  3SJS A;  2KFG A;  3VRR A;  3SG3 A;  4F0Z B;  1RJV A;  4HRE E;  1QXP A;  2LC5 A;  2QDI A;  4CID A;  5ER5 A;  1GM0 A;  3CWG A;  2RGI A;  3CZ2 A;  3JTD B;  1FI5 A;  2AMI A;  3BJH A;  5CSN A;  2KLD A;  1C7V A;  1MR8 A;  1J7P A;  2P70 A;  2LCP A;  4PE0 A;  3VGO A;  5K89 A;  1LXF C;  1GJY A;  1XYD A;  2MLF C;  4KYN A;  5CSI A;  1JFK A;  3DVJ A;  2V53 A;  1IH0 A;  2Y1M A;  1DTL A;  4MVF A;  3RLZ A;  2WC6 A;  2WND A;  1M63 B;  2L2C A;  1BLQ A;  2LUC A;  3O4X A;  4BY4 A;  1KFX S;  3PAL A;  4PHK A;  5D69 A;  3BUO B;  3PSR A;  3QME A;  1IG5 A;  1VRK A;  1TNX A;  3CZ1 A;  1GQM A;  1KWO C;  3BUM B;  2JXL A;  3OGN A;  2KGR A;  2BCX A;  3CR5 X;  1A29 A;  3S0E A;  4CPV A;  3DD4 A;  2Q91 A;  3ZNI A;  1UUR A;  1TUZ A;  2EGD A;  2KYC A;  1MHO A;  1QV0 A;  3D77 A;  3KPX A;  3NSI A;  4WRI A;  1KWO B;  5KSZ A;  1XFZ O;  3OP0 A;  3EKJ A;  3CGA A;  2KLE A;  1OMV A;  5FI2 A;  1AVS A;  1NCY A;  3AAJ A;  4AQI A;  3O6B A;  1K9U A;  4MN0 A;  1CFD A;  1BOC A;  1QLS A;  1A2X A;  1CFC A;  4OZD A;  1OZS A;  1Y0V H;  3EVV A;  1XFW O;  1A03 A;  2KBM A;  5PAL A;  1IGV A;  3KF9 A;  2LVI A;  2KQ6 A;  1CMG A;  1SK6 D;  4GPL B;  2WCF A;  2ZKM X;  5CSJ A;  1TNW A;  2NXQ A;  3AAK A;  1YTZ C;  4GFT A;  1G8I A;  1R6P A;  2CXJ A;  1S6C A;  2A4J A;  3ICB A;  4PHM A;  2JTT A;  4D1E A;  1PRW A;  1TIZ A;  2PYQ A;  1V1F A;  1F54 A;  1SR6 C;  4OV2 A;  4WQ2 A;  1B1G A;  1J1D A;  2H61 C;  3BXK A;  1SKT A;  5DKQ A;  2JXC A;  3VRN A;  5I94 A;  3K1E A;  4N1G A;  4JPZ B;  2LM5 A;  2ZRS A;  1SY9 A;  1OSA A;  1XFR A;  4FTG A;  4CFQ A;  2D8N A;  1SCM C;  1PVA A; 
#chains in the Genus database with same CATH homology
 1WDC C;  4PE7 A;  1DGV A;  3BUN B;  1K8U A;  5AXI A;  3CZT X;  2JOJ A;  4MEW A;  1IQ3 A;  4Q04 A;  5KTY A;  1SCM B;  4HSZ A;  2ZND A;  5JOL A;  4MBE A;  3TS5 B;  3CLN A;  1F71 A;  2WOS A;  4R1E A;  1QIW A;  1LA3 A;  3BYA A;  2HF5 A;  3WXA A;  3D0Y A;  1DJY A;  4AOM A;  1YUU A;  5D7F A;  4OR9 B;  1KQM C;  1K95 A;  2CCM A;  1N65 A;  3GK2 A;  1ODB A;  4GAO A;  3SG5 A;  1SRA A;  1IJ5 A;  5HLV A;  1XFU O;  2L4H A;  2EC6 B;  1J7R A;  4U8D A;  2NCO A;  3EKH A;  1B8L A;  1CTR A;  2CNP A;  2F3Z A;  4N1F A;  3SIA A;  2JT3 A;  1AHR A;  1M39 A;  1MWN A;  4MZK A;  5HKY A;  2GV5 A;  1J55 A;  1YX8 A;  3JVT B;  1BOD A;  3O2P A;  4ZCV A;  1XK4 A;  1YR5 A;  1EG3 A;  1L7Z A;  3DF0 A;  2ZNE A;  2WCE A;  2KFH A;  2KI6 D;  2MA2 A;  4MLW A;  1TRF A;  1UUS A;  1DJH A;  3FS7 A;  1K90 D;  3SG4 A;  5I8N A;  1NWD A;  1QLK A;  1KK7 Z;  2HET A;  2KI4 C;  2LE9 B;  2KAY A;  1SL9 A;  1B7T Z;  2L2E A;  3A4U B;  1JSA A;  2M1U A;  1SL8 A;  2CT9 A;  2KI6 C;  1A75 A;  4I5J A;  1DJZ A;  4BY5 A;  3D0Y B;  2KGB C;  3FWC A;  1MQ1 A;  1DVI A;  4CLN A;  2LP2 A;  5J3X A;  1NX2 A;  1YUT A;  2KI4 B;  5HKW A;  4ICB A;  1J7Q A;  1ZOT B;  1CLL A;  1KFX L;  1XK4 C;  1YVL A;  1J7O A;  4GUK A;  3EK4 A;  1BR1 B;  2DOQ A;  3BOW A;  1DT7 B;  1OMD A;  2M29 A;  4C0J A;  3OB1 B;  2JC2 A;  2BKI B;  2LUX A;  1YX7 A;  5HYD A;  2M0R A;  2L5X B;  1J1E A;  3PFV A;  1RK9 A;  1REC A;  3VRP A;  1FF1 A;  2R2I A;  2I18 A;  1XFY O;  2K2A A;  3O4Y A;  4A4C A;  4PHN A;  3DF0 B;  1AP4 A;  1GGW A;  1S3P A;  1CLB A;  4UPG A;  5AFP A;  3QRX A;  1PSR A;  4MRX A;  3RM1 A;  3LL8 B;  2HQ8 A;  1NCX A;  1ZUZ A;  2O60 A;  2COL B;  3I5I C;  1JC2 A;  1KQV A;  2JRF A;  2M9G A;  3FWB A;  1BJF A;  2JT0 A;  2K8M B;  3KEV A;  2MAZ A;  2P6B B;  4M2O A;  1S36 A;  1AUI B;  1A75 B;  1V1G A;  1F4O A;  1PAL A;  5ER4 X;  1IWQ A;  1OE9 B;  1WRK A;  2JNF A;  2EHB A;  2Y4Q A;  4HRG A;  2H61 A;  1BF5 A;  3LK1 A;  1IRJ A;  2F8P A;  2JWW A;  1NP8 A;  2AAO A;  1AK8 A;  1F4Q A;  1B9A A;  2I7A A;  1S5G Z;  2L4I A;  3BOW B;  1E8A A;  2LNK A;  1UHK A;  2OS8 C;  2ZN9 A;  4DS7 A;  2M97 A;  2HQW A;  5BPJ A;  2NLN A;  2LHI A;  1G33 A;  1XA5 A;  1EL4 A;  1DJI A;  3PN7 C;  4L9M A;  1PSB A;  3LCP C;  4PCW A;  1CMF A;  1UHJ A;  1CDM A;  2KDH A;  1NX3 A;  1QAT A;  1KK8 C;  1Y1A A;  3WHU B;  4JWQ A;  1F55 A;  4M2Q A;  1Y1X A;  3A8R A;  2K7O A;  1SNL A;  3AKB A;  1JUO A;  1L2O C;  2LAN A;  3PN7 B;  3CTN A;  4OVN F;  1ZFS A;  1LIN A;  5CPV A;  1DMO A;  1HT9 A;  2FJU B;  1TNP A;  3HCM A;  1KK8 B;  4YRU A;  5CSF A;  1SR6 B;  1NSH A;  4MSP A;  3OX5 A;  5I2Q A;  1D1O A;  3ZWH A;  1SMG A;  1WRZ A;  3CR2 A;  2G2B A;  1UHI A;  1KFU S;  2KNE A;  2M8U A;  4OKH A;  2MRD A;  4QJ5 B;  1OZO A;  1YVH A;  1K2H A;  1CB1 A;  3AKA A;  4PE4 A;  1ALV A;  2IS9 A;  2I2R E;  1WDC B;  1ZMZ A;  1AJ4 A;  4JQ0 D;  1PVB A;  5DKR A;  2K7B A;  2Y1N A;  1K94 A;  1KSM A;  4XYN A;  3KO0 A;  5AER A;  1BMO A;  1TNQ A;  4MRY A;  3TUY C;  2BL0 C;  2L50 A;  3K21 A;  3IQQ A;  3OHM B;  3H4S E;  4QJ3 B;  1N2D A;  1DF0 A;  4DCK A;  1IJ6 A;  2OTG C;  3F45 A;  1B8C A;  1UHH A;  1RRO A;  4ZCU A;  2M7N A;  4NDC A;  2LV7 A;  2M3W A;  2SCP A;  3JTD C;  3PM8 A;  4GNK B;  3SIB A;  3TUY B;  2B1U A;  2PVB A;  5F6T A;  3DVE A;  2G9B A;  1KQM B;  2F2P A;  4YI8 A;  3TDU A;  2JPT A;  2OTG B;  2JNX A;  3I5H C;  4IL1 A;  1KK7 Y;  5AEQ A;  2LVJ A;  2JT8 A;  1EXR A;  1B7T Y;  1NUB A;  2CTN A;  2HPS A;  2M1K B;  2LVK A;  3JTD B;  5KU1 A;  1G4Y R;  1OMR A;  1DJG A;  1K9K A;  3C1V A;  2ZRT A;  2L51 A;  4P2Y B;  1BU3 A;  2MJW B;  3I5H B;  1B4C A;  2KQY A;  2TN4 A;  1ZAC A;  3GK4 X;  1B47 A;  4N5X A;  3CR4 X;  1EG4 A;  2M7L A;  1QVI Z;  2BKH B;  3MSE B;  1LA0 A;  1QS7 A;  1DF0 B;  1YUR A;  3WNX B;  1U5I A;  3CS1 A;  2SAS A;  1TCO B;  1M45 A;  2CBL A;  2PSR A;  5GQQ C;  2PRU A;  3BUW B;  4AQJ A;  1WLZ A;  5JJG A;  4C0L A;  1NIW A;  1IQ5 A;  1SBJ A;  4DRW A;  1BT6 A;  1CDL A;  1DJX A;  2ZN8 A;  1CM1 A;  2JU0 A;  1CKK A;  2LLU A;  1CFF A;  1QX2 A;  1RTP 1;  2O5G A;  2OPO A;  2LHL A;  1B8R A;  3OB2 B;  4USL A;  1YUS A;  2BE6 A;  1S6I A;  1H8B A;  2L98 A;  2GGZ A;  5B8I B;  3SG6 A;  2AUC A;  5G08 A;  3D10 A;  3DVK A;  4M2P A;  2K7C A;  1EJ3 A;  2ZFD A;  1FI6 A;  1R2U A;  1S5G Y;  3TZ1 A;  3TDI A;  1K93 D;  4GGF C;  3I5I B;  5TNC A;  2F33 A;  3SG7 A;  1U5I B;  2JUL A;  3EVR A;  5I2O A;  1NX0 A;  1JBA A;  2MBX A;  3I5G C;  4ORB B;  1CDN A;  3PAT A;  1C07 A;  3VRO A;  1RFJ A;  2BCB A;  3IQO A;  4MZL A;  3BUX B;  2FCE A;  3EK7 A;  1LVC D;  1QAS A;  1QTX A;  4PDZ A;  4E68 A;  2PMY A;  4WQ3 A;  1K9P A;  2LMT A;  1QX7 A;  1WRL A;  1YRT B;  2PAS A;  3I5G B;  1Q80 A;  2VRG A;  1JF2 A;  1W7J B;  1GGZ A;  2OS8 B;  3DVM A;  3I5F C;  4ORA B;  2Q4U A;  2WCB A;  1M31 A;  4YGD B;  1JWD A;  2BE4 A;  2Y5I A;  4HRH A;  4ORC B;  2MHH A;  1F70 A;  1KFU L;  2LLS A;  1S1E A;  1AJ5 A;  1UP5 A;  3NXA A;  1ALW A;  2PAL A;  4YGA A;  3I5F B;  1TCF A;  2JTZ A;  2BBN A;  2LP3 A;  3M0W A;  2KHN A;  2KYF A;  1QX5 B;  1WY9 A;  1OOJ A;  3BQ3 A;  2K7D A;  3KHE A;  4I5N B;  2E30 A;  1Y1U A;  1XO5 A;  3NSO A;  2MLE C;  1NYA A;  2QAC A;  4NQG A;  2WC8 A;  4QJ4 B;  1S26 D;  1L2O B;  2BCA A;  2F3Y A;  2M49 B;  4YBH B;  1CFP A;  3NSK A;  4A4B A;  5I2L A;  2LVV A;  1SPY A;  1FPW A;  4I5L B;  1IKU A;  1X02 A;  3NSL A;  1M46 A;  1FW4 A;  1MXL C;  3O78 A;  2F2O A;  1XFV O;  2FOT A;  2I94 A;  1MF8 B;  2LMU A;  1SW8 A;  3SG2 A;  3IF7 A;  4XJK A;  1CLM A;  2KFF A;  1CNP A;  1NX1 A;  1XFX O;  4PE1 A;  3TS5 C;  5HKZ A;  2KAX A;  4OCI A;  1WLM A;  2E6W A;  2KAV A;  2WOR A;  3VRQ A;  1QJT A;  1W7I B;  4ETO A;  2K2F A;  1XVJ A;  3EVU A;  2LMV A;  2JZI A;  1KCY A;  2BL0 B;  4PAL A;  1OQP A;  4P5O E;  4DIR A;  3TDZ A;  1HQV A;  2BBM A;  4GGN A;  2EC6 C;  1EH2 A;  1SL7 A;  1UHN A;  2K0J A;  1CDP A;  3GK1 A;  5AAN A;  2NCP A;  4NDB A;  3OX6 A;  4CFR A;  1LKJ A;  1H4B A;  4YGC B;  1QV1 A;  1QIV A;  2FCD A;  1FBV A;  1UWO A;  3LLE A;  2NZ0 A;  1TOP A;  1QVI Y;  3JVT C;  1DGU A;  1A4P A;  1MXE A;  1YRU B;  1RWY A;  3FIA A;  2ISD A;  1TTX A;  1JFJ A;  1BR4 B;  4PHJ A;  2QPT A;  2KBI A;  2L0P A;  3WHT B;  5DKN A;  1SYM A;  4MZJ A;  1TN4 A;  5FYX A;  4YGE B;  1S6J A;  2GGM A;  4YI9 A;  4GBA A;  2LLT A;  1JF0 A;  4XJK B;  1NCZ A;  4C0K A;  2JQ6 A;  2H2K A;  1Y6W A;  1NPQ A;  1MUX A;  1K96 A;  3E3R A;  1N0Y A;  3LK0 A;  1BG1 A;  1C7W A;  1CM4 A;  4DUQ A;  5HLO A;  5IBW A;  2LAP A;  1F8H A;  1KSO A;  4GGF A;  3HX4 A;  4TNC A;  1DJW A;  1PUL A;  1SCV A;  3EK8 A;  2BEC A;  4YGB B;  2KOT A;  3GOF A;  4NDD A;  2KSP A;  3PLF B;  4I5K A;  1PK0 D;  4FQO A;  3SJS A;  2KFG A;  3VRR A;  3SG3 A;  4F0Z B;  1RJV A;  4HRE E;  1QXP A;  2LC5 A;  4CID A;  5ER5 A;  3CWG A;  2RGI A;  1FI5 A;  2AMI A;  5CSN A;  1C7V A;  1MR8 A;  1J7P A;  4PE0 A;  2LCP A;  3VGO A;  5K89 A;  1LXF C;  1GJY A;  1XYD A;  2MLF C;  5CSI A;  1JFK A;  3DVJ A;  2V53 A;  1IH0 A;  2Y1M A;  1DTL A;  4MVF A;  3RLZ A;  2WND A;  1M63 B;  1BLQ A;  2LUC A;  4BY4 A;  1KFX S;  3PAL A;  4PHK A;  5D69 A;  3BUO B;  3PSR A;  1IG5 A;  1VRK A;  1TNX A;  1GQM A;  1KWO C;  3BUM B;  2JXL A;  2KGR A;  2BCX A;  3CR5 X;  1A29 A;  4CPV A;  3DD4 A;  2Q91 A;  3ZNI A;  1UUR A;  2EGD A;  2KYC A;  1MHO A;  1QV0 A;  3NSI A;  3KPX A;  4WRI A;  1KWO B;  5KSZ A;  1XFZ O;  3OP0 A;  3EKJ A;  3CGA A;  1OMV A;  1AVS A;  1NCY A;  3AAJ A;  4AQI A;  3O6B A;  1K9U A;  4MN0 A;  1CFD A;  1BOC A;  1QLS A;  1A2X A;  1CFC A;  1OZS A;  1Y0V H;  3EVV A;  1XFW O;  1A03 A;  2KBM A;  5PAL A;  1IGV A;  3KF9 A;  2LVI A;  2KQ6 A;  1CMG A;  1SK6 D;  4GPL B;  2WCF A;  2ZKM X;  5CSJ A;  1TNW A;  2NXQ A;  3AAK A;  1YTZ C;  4GFT A;  1G8I A;  1R6P A;  2CXJ A;  1S6C A;  2A4J A;  3ICB A;  4PHM A;  2JTT A;  4D1E A;  1PRW A;  1TIZ A;  1V1F A;  1F54 A;  1SR6 C;  4OV2 A;  4WQ2 A;  1B1G A;  1J1D A;  2H61 C;  3BXK A;  1SKT A;  5DKQ A;  2JXC A;  3VRN A;  4N1G A;  4JPZ B;  2LM5 A;  2ZRS A;  1SY9 A;  1OSA A;  2K61 A;  4FTG A;  4CFQ A;  2D8N A;  1SCM C;  1PVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...