2H8VA

Structure of empty pheromone binding protein asp1 from the honeybee apis mellifera l
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Conformational Changes of the Pheromone Binding Protein ASP1 from the Honeybee Apis mellifera L upon Ligand Binding
rcsb
source organism Apis mellifera
molecule tags Transport protein
total genus 42
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2006-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2h8vA00
2WCMA 3BJHA 3R72A 3FE8A 3S0FA 2ERBA 1OOFA 3PJIA 3D77A 3L4AA 3CYZA 3CABA 1XFRA 4FQTA 2P70A 2PQLA 3DY9A 3S0DA 3D73A 3BFBA 4JD9A 2WC6A 2JPOA 3B7AA 3D74A 1OOGA 3V2LA 3B6XA 3S0AA 1GM0A 3CZ0A 4PT1A 2FJYA 5DICA 2QEHA 3D75A 1C3ZA 1DQEA 3BFAA 3B87A 3B88A 2WCJA 3DXLA 1P28A 2QDIA 3K1EA 3RZSA 3BFHA 1QWVA 2WCHA 3NHTA 3NHIA 1TUJA 3R1VA 2GTEA 3FE6A 3S0BA 1OOHA 2L2CA 3N7HA 2H8VA 2WC5A 1LS8A 4F7FA 1TWOA 3R1PA 2P71A 1T14A 1ORGA 3S0EA 3FE9A 2KPHA 3R1OA 3QMEA 2QEBA 4INXA 3DZTA 3S0GA 1C3YA 3L47A 4OZDA 3OGNA 3CDNA 3NGVA 3Q8IA 2QEVA 3L4LA 3B86A 1OW4A 3D78A 3CZ1A 2WCLA 3DYEA 3CZ2A 3VB1A 1OOIX 2WCKA 2QEOA 5EL2A 3D76A 4INWA
chains in the Genus database with same CATH superfamily
2WOSA 1SPYA 3AAJA 2MBXA 3IVTA 1BJFA 2KOTA 2LVIA 3R72A 5DKQA 2ERBA 1CLBA 1QASA 1YVHA 1FI6A 1EJ3A 3L4AA 1KWOC 3CYZA 4XYNA 1SL8A 2BE6A 5KSZA 1KK8B 1S3PA 1DJHA 1TCFA 2Y5IA 2KDHA 4FQTA 1SKTA 2P70A 2QACA 1QTXA 1BODA 1G33A 1TTXA 2F2OA 2BBMA 3DY9A 1YUUA 4JQ0D 1PRWA 2OS8C 2AAOA 1DJZA 1MXEA 2QPTA 1SR6B 2ZN9A 1NSHA 1J7PA 1OOGA 2TN4A 1S5GZ 3V2LA 1M46A 3B6XA 3S0AA 1PVBA 1ZUZA 2JPTA 3GK1A 1RTP1 2FJYA 5TNCA 2QEHA 2LC5A 3SG4A 3TZ1A 4UPGA 3KF9A 3D75A 1F55A 1JC2A 1OQPA 1WLMA 3LLEA 2PALA 1LINA 5CSJA 3TDIA 1JBAA 1DJYA 4ORCB 5AXIA 5HYDA 3ZWHA 1FPWA 1CM4A 3TUYB 1OZOA 1XO5A 1ALWA 1XVJA 4F0ZB 3B87A 2MHHA 2KAXA 1J1DA 2WCJA 2K60A 4C0KA 2JT3A 4N1FA 2KBIA 3SS5A 1CMFA 3DVJA 3EVUA 2O5GA 4IJ7A 3EVRA 2I2RE 1M45A 2M7NA 4PDZA 1OMDA 1DF0A 1SYMA 2KI4C 1FW4A 5AERA 1IQ5A 3RZSA 1BLQA 3ICBA 2H2KA 2JRFA 3BUMB 1NCYA 1N2DA 1YUTA 3R1VA 4BY5A 1JFJA 2K8MB 3FE6A 3JTDC 3MSEB 4PE4A 2M7LA 2KGRA 2HQWA 5HLVA 1S5GY 2OPOA 1GGZA 4JWQA 3R1PA 1KQMB 3CWGA 3FS7A 2JU0A 3HCMA 4AQJA 1CDMA 2L2EA 3OB1B 1ORGA 5CSIA 2F3YA 2BL0C 3I5HC 2OTGC 3TS5C 2Q91A 2GV5A 2M8UA 1S6CA 4GPLB 2K7OA 3R1OA 1C07A 2QEBA 3KPXA 3SG7A 1K93D 1AJ5A 2JQ6A 2K2AA 2L5YA 4INXA 1EXRA 2HETA 5CPVA 5HL1A 1BT6A 2BAPA 2KI6C 1KK7Z 1A03A 2AMIA 2L4HA 3CR5X 4I5JA 3PLFB 4OR9B 3NSOA 1CFFA 4ORAB 4PHJA 4QJ3B 2SCPA 2K0JA 3OGNA 5D3OA 5AANA 1WY9A 3SG2A 1JF0A 4C0LA 3CDNA 1MHOA 2SASA 1KFXL 3K21A 3CGAA 4HRGA 1IH0A 1GJYA 1D1OA 5PALA 3D78A 1S26D 1DF0B 2KAYA 1VRKA 1BOCA 1QX5B 2WCEA 3EK8A 2CTNA 2H61A 3RLZA 4DCKA 4MBEA 3EK7A 5FI2A 1SCVA 3LK1A 3A4UB 4P2YB 2F2PA 5KTYA 1B8RA 4Q04A 1KCYA 2WCKA 1QS7A 1TN4A 1QX7A 1DVIA 2KLEA 1W7JB 2HF5A 4YI8A 4MRYA 4YGCB 1XK4C 2JWWA 2LVKA 3FWCA 4NDDA 1OOFA 2MA2A 4DIRA 1IQ3A 2IS9A 2LUCA 4CIDA 4CLNA 3OBVA 4MN0A 1S1EA 1SBJA 4AOMA 5D69A 2BECA 2LP2A 4ETOA 3IQQA 1NP8A 1QXPA 1LVCD 4N5XA 1IGVA 3FIAA 4PHKA 3S0DA 3D73A 3BFBA 2KFGA 2WC6A 3BUOB 3NSKA 3WHUB 3JVTB 4OVNF 1E8AA 2KGBC 2P6BB 1PULA 2M1UA 1WLZA 2ZRTA 2MLEC 1EL4A 2ZKMX 3D74A 3WHTB 1UP5A 2M9GA 1AJ4A 2EC6B 1RWYA 1IWQA 1NYAA 4DRWA 1UWOA 1N65A 1JFKA 4JPZB 1GM0A 2LHLA 2NCPA 4CFQA 3BOWA 1R6PA 2LE9B 4PE7A 1QX2A 2KFHA 3EKJA 1LA3A 2WCFA 2B1UA 1K9PA 1L2OB 2Y4QA 1NWDA 5HLOA 1G8IA 4MEWA 2CBLA 2PASA 2L51A 4MRXA 2KI6D 4PE0A 1WDCC 3DXLA 3PN7B 4QJ4B 3E3RA 2FCEA 1FI5A 2PYQA 1LKJA 1FF1A 4PE1A 2ZNEA 2K2FA 1A4PA 3I5FC 1DGUA 4OCIA 4WQ2A 1SRAA 3K1EA 4E68A 1OMRA 1NUBA 3GOFA 1CLMA 3BUWB 3OHMB 3BFHA 3WXAA 2MRDA 1AVSA 1UURA 2MLFC 1CDPA 4ZCUA 2COLB 2LVJA 3DVEA 3S0BA 3SIBA 2OTGB 1K95A 3N7HA 1N0YA 1NCZA 2H8VA 4WRIA 3TS5B 1CFCA 1TWOA 3CTNA 4YRUA 1ZOTB 1J1EA 1S6JA 3PALA 1BG1A 2L98A 1XFUO 3AKAA 4GGFC 3PSRA 2P71A 2LM5A 4GNKB 1DTLA 1OMVA 1T14A 3SS4A 2M1KB 3VROA 3KEVA 5JJGA 1OZSA 1OOJA 4GAOA 2F3ZA 2MJWB 3BOWB 3SG3A 4MZJA 2KLDA 1F71A 1B9AA 1TRFA 5I8NA 2KHNA 2LUXA 3D10A 1H8BA 1XFYO 1BMOA 2V53A 2ZNDA 3I5GC 3PATA 2BNXA 1B8CA 3TDZA 1OE9B 4YGEB 2DOQA 2BE4A 3VRQA 5I2OA 4CFRA 4I5KA 1CKKA 4GGNA 4M2OA 1IG5A 1QLSA 1K96A 5BPJA 3CZ1A 2KQ6A 4GUKA 1XFWO 2JTZA 2WCLA 1KK8C 3O4XA 2M0RA 5IBWA 3GK2A 1F4QA 2JXLA 3CR2A 3H4SE 2K61A 3M0WA 1IIOA 3VB1A 1NX3A 4A4CA 3O4YA 5B8IB 1OOIX 1QLKA 1ZFSA 1W7IB 4PHMA 3A8RA 5EL2A 4FTGA 4NDBA 4INWA 1YRUB 5CSFA 5HKYA 2WCMA 4DUQA 3I5IC 3FE8A 3OX5A 2WNDA 2D8NA 3S0FA 1IRJA 2L50A 3PJIA 2CCMA 1J55A 3D77A 3IF7A 3CABA 3DD4A 2LLTA 1IJ5A 4ZCVA 5I2QA 2EHBA 4U8DA 1XFZO 2PSRA 2PQLA 1DC1A 1Z2CB 1J7OA 1WRKA 1GQMA 2AUCA 1K90D 2NZ0A 1XYDA 4JD9A 1IJ6A 1F70A 4YGBB 3LCPC 1KQVA 3CZTX 1UHHA 1DMOA 2LVVA 1B8LA 3B7AA 3TUYC 1J7RA 3BUNB 1UHIA 3FWBA 3NXAA 1QVIZ 1TCOB 1QJTA 2WCBA 1KWOB 5F6TA 2CNPA 1Y6WA 2HQ8A 2LMTA 3BUXB 2NXQA 4M2PA 2EGDA 1TIZA 2I94A 1F4OA 1M39A 1ALVA 1MUXA 1YX7A 2JNFA 2PRUA 3KHEA 1XFVO 4PHNA 3TDUA 1WRLA 1XFXO 1C3ZA 2OS8B 1CDLA 1SNLA 1DQEA 3BFAA 3RM1A 3QRXA 4XJKA 3SS3A 3AAKA 3I5FB 3OB2B 4YGAA 1DEKA 1CNPA 1K94A 3O78A 1NX1A 3BXKA 2QDIA 2KYFA 2M49B 1MF8B 2KQYA 2BCBA 5K89A 5CSNA 4IL1A 1L7ZA 2FJUB 4P5OE 3HX4A 3VGOA 1DJXA 1KSOA 1K2HA 3KO0A 3CR4X 5FYXA 1QWVA 2WCHA 1SL7A 3NHTA 3NHIA 1QATA 4MVFA 1TUJA 1MR8A 5DKNA 1TUZA 5JOLA 1PSRA 2PVBA 1A75A 3DF0A 1BU3A 1NCXA 1U5IA 2WC8A 1QVIY 1OOHA 1RFJA 2A4JA 2F33A 2L2CA 1MWNA 1LS8A 1Y0VH 2FCDA 2BKHB 2E30A 2KI4B 4M2QA 1JF2A 1CTRA 1Y1XA 1UHNA 1KSMA 1PSBA 1XA5A 2KAVA 3SG5A 2NCOA 3EKHA 1NX0A 1SK6D 4HSZA 3LK0A 2L0PA 1V1FA 2KPHA 4CPVA 1YVLA 3JTDB 1PALA 1DJWA 2Y1NA 3QMEA 2YGUA 1XK4A 2ISDA 5FI6A 1K9KA 1KFUS 3DZTA 2CT9A 1TNXA 5FI7A 3SG6A 3L47A 4OZDA 4XJKB 2FOTA 2Y1MA 2M97A 2LMUA 4I5LB 1B4CA 3D0YA 1QIWA 1EG3A 5HKWA 3NGVA 2BL0B 3Q8IA 1CFDA 3I5HB 3L4LA 3ZNIA 4KYNA 1YRTB 2JULA 1OSAA 4MSPA 3B86A 3PM2A 2LP3A 1SCMC 1ZACA 3VRRA 1TNQA 3WNXB 5KU1A 3F45A 1GGWA 2JOJA 5GQQC 1BF5A 1YURA 5AEQA 1B7TZ 1NPQA 3I5IB 1M63B 4PALA 3UO9A 2CXJA 1YR5A 4MZLA 2HPSA 2QEOA 5J3XA 4QJ5B 5I94A 3JVTC 2G9BA 2LNKA 3BJHA 1A75B 3DF0B 1DJGA 2LV7A 3AKBA 4TNCA 1PVAA 1U5IB 2R2IA 2L5XB 1Y1AA 2I7AA 2EC6C 4FQOA 4YGDB 1XFRA 3PM8A 1RK9A 1HT9A 4PCWA 1LA0A 2I18A 1LXFC 2M29A 3EK4A 1S36A 2JZIA 2JPOA 3DVMA 1UUSA 4GBAA 1L2OC 3NSIA 2Q4UA 1MXLC 4HRHA 1MQ1A 1UHJA 3SJSA 2H61C 2PMYA 3NSLA 1SW8A 1C7WA 3O2PA 3PN7C 1S6IA 1X02A 1BR1B 5G08A 2LCPA 1DT7B 3CZ0A 3PFVA 2WORA 4PT1A 2BKIB 5DICA 5ER4X 1SR6C 5HKZA 1AP4A 2NLNA 1B7TY 1CM1A 1SMGA 3D0YB 2K7DA 1R2UA 2JXCA 2JT8A 1WRZA 4A4BA 1AUIB 2JNXA 3DVKA 2ZFDA 3UNWA 4MLWA 1V1GA 4BY4A 1F8HA 2JTTA 3C1VA 3OX6A 4GGFA 4NQGA 1IKUA 1CFPA 3BQ3A 3B88A 1Y1UA 1P28A 2LHIA 1DELA 3SIAA 5D7FA 1Q80A 4WQ3A 1K9UA 1DGVA 2JT0A 4ICBA 4I5NB 1K8UA 1G4YR 2ZN8A 3BYAA 3OP0A 2K7CA 4AQIA 1AK8A 1TNWA 1ZMZA 2BBNA 1C7VA 2BCXA 1AHRA 2GTEA 1EH2A 1WDCB 2VRGA 3EVVA 4C0JA 1QV0A 1A2XA 1NX2A 1NIWA 4N1GA 4USLA 1Z4HA 2BCAA 3EG5B 1CB1A 3IQOA 4F7FA 1QV1A 1DJIA 2WC5A 4GFTA 2JC2A 4ORBB 2LAPA 5AFPA 3O6BA 1RJVA 1B47A 1HQVA 1M31A 1YX8A 3LL8B 1ODBA 4NDCA 2ZRSA 1KFUL 3S0EA 3FE9A 1SL9A 2O60A 4L9MA 1RROA 1PK0D 2KNEA 2LLUA 1KQMC 1UHKA 2K7BA 1J7QA 1CMGA 2LANA 4HREE 4DS7A 3GK4X 2LLSA 3S0GA 1TOPA 1SCMB 2GGZA 1JUOA 1C3YA 4R1EA 1A29A 4MZKA 4OKHA 1W9ZA 1YTZC 4JKTA 4YBHB 3VRNA 2RGIA 1F54A 1SY9A 3VRPA 4D1EA 1RECA 5DKRA 2QEVA 2E6WA 2G2BA 3CLNA 1EG4A 1FBVA 2KBMA 4OV2A 1KK7Y 1BR4B 1OW4A 1JWDA 1SSEB 2GGMA 2MAZA 3CS1A 2LMVA 1QIVA 1KFXS 5ER5A 2F8PA 2KYCA 1CDNA 1TNPA 2KSPA 1YUSA 2M3WA 3CZ2A 3DYEA 1H4BA 3I5GB 1JSAA 2KFFA 4YI9A 1CLLA 2L4IA 3D76A 1B1GA 5I2LA
chains in the Genus database with same CATH topology
2WCMA 3BJHA 3R72A 3FE8A 3S0FA 2ERBA 1OOFA 3PJIA 3D77A 3L4AA 3CYZA 3CABA 1XFRA 4FQTA 2P70A 2PQLA 3DY9A 3S0DA 3D73A 3BFBA 4JD9A 2WC6A 2JPOA 3B7AA 3D74A 1OOGA 3V2LA 3B6XA 3S0AA 1GM0A 3CZ0A 4PT1A 2FJYA 5DICA 2QEHA 3D75A 1C3ZA 1DQEA 3BFAA 3B87A 3B88A 2WCJA 3DXLA 1P28A 2QDIA 3K1EA 3RZSA 3BFHA 1QWVA 2WCHA 3NHTA 3NHIA 1TUJA 3R1VA 2GTEA 3FE6A 3S0BA 1OOHA 2L2CA 3N7HA 2H8VA 2WC5A 1LS8A 4F7FA 1TWOA 3R1PA 2P71A 1T14A 1ORGA 3S0EA 3FE9A 2KPHA 3R1OA 3QMEA 2QEBA 4INXA 3DZTA 3S0GA 1C3YA 3L47A 4OZDA 3OGNA 3CDNA 3NGVA 3Q8IA 2QEVA 3L4LA 3B86A 1OW4A 3D78A 3CZ1A 2WCLA 3DYEA 3CZ2A 3VB1A 1OOIX 2WCKA 2QEOA 5EL2A 3D76A 4INWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCM A;  3BJH A;  3R72 A;  3FE8 A;  3S0F A;  2ERB A;  1OOF A;  3PJI A;  3D77 A;  3L4A A;  3CYZ A;  3CAB A;  1XFR A;  4FQT A;  2P70 A;  2PQL A;  3DY9 A;  3S0D A;  3D73 A;  3BFB A;  4JD9 A;  2WC6 A;  2JPO A;  3B7A A;  3D74 A;  1OOG A;  3V2L A;  3B6X A;  3S0A A;  1GM0 A;  3CZ0 A;  4PT1 A;  2FJY A;  5DIC A;  2QEH A;  3D75 A;  1C3Z A;  1DQE A;  3BFA A;  3B87 A;  3B88 A;  2WCJ A;  3DXL A;  1P28 A;  2QDI A;  3K1E A;  3RZS A;  3BFH A;  1QWV A;  2WCH A;  3NHT A;  3NHI A;  1TUJ A;  3R1V A;  2GTE A;  3FE6 A;  3S0B A;  1OOH A;  2L2C A;  3N7H A;  2H8V A;  2WC5 A;  1LS8 A;  4F7F A;  1TWO A;  3R1P A;  2P71 A;  1T14 A;  1ORG A;  3S0E A;  3FE9 A;  2KPH A;  3R1O A;  3QME A;  2QEB A;  4INX A;  3DZT A;  3S0G A;  1C3Y A;  3L47 A;  4OZD A;  3OGN A;  3CDN A;  3NGV A;  3Q8I A;  2QEV A;  3L4L A;  3B86 A;  1OW4 A;  3D78 A;  3CZ1 A;  2WCL A;  3DYE A;  3CZ2 A;  3VB1 A;  1OOI X;  2WCK A;  2QEO A;  5EL2 A;  3D76 A;  4INW A; 
#chains in the Genus database with same CATH topology
 2WOS A;  1SPY A;  3AAJ A;  2MBX A;  3IVT A;  1BJF A;  2KOT A;  2LVI A;  3R72 A;  5DKQ A;  2ERB A;  1CLB A;  1QAS A;  1YVH A;  1FI6 A;  1EJ3 A;  3L4A A;  1KWO C;  3CYZ A;  4XYN A;  1SL8 A;  2BE6 A;  5KSZ A;  1KK8 B;  1S3P A;  1DJH A;  1TCF A;  2Y5I A;  2KDH A;  4FQT A;  1SKT A;  2P70 A;  2QAC A;  1QTX A;  1BOD A;  1G33 A;  1TTX A;  2F2O A;  2BBM A;  3DY9 A;  1YUU A;  4JQ0 D;  1PRW A;  2OS8 C;  2AAO A;  1DJZ A;  1MXE A;  2QPT A;  1SR6 B;  2ZN9 A;  1NSH A;  1J7P A;  1OOG A;  2TN4 A;  1S5G Z;  3V2L A;  1M46 A;  3B6X A;  3S0A A;  1PVB A;  1ZUZ A;  2JPT A;  3GK1 A;  1RTP 1;  2FJY A;  5TNC A;  2QEH A;  2LC5 A;  3SG4 A;  3TZ1 A;  4UPG A;  3KF9 A;  3D75 A;  1F55 A;  1JC2 A;  1OQP A;  1WLM A;  3LLE A;  2PAL A;  1LIN A;  5CSJ A;  3TDI A;  1JBA A;  1DJY A;  4ORC B;  5AXI A;  5HYD A;  3ZWH A;  1FPW A;  1CM4 A;  3TUY B;  1OZO A;  1XO5 A;  1ALW A;  1XVJ A;  4F0Z B;  3B87 A;  2MHH A;  2KAX A;  1J1D A;  2WCJ A;  2K60 A;  4C0K A;  2JT3 A;  4N1F A;  2KBI A;  3SS5 A;  1CMF A;  3DVJ A;  3EVU A;  2O5G A;  4IJ7 A;  3EVR A;  2I2R E;  1M45 A;  2M7N A;  4PDZ A;  1OMD A;  1DF0 A;  1SYM A;  2KI4 C;  1FW4 A;  5AER A;  1IQ5 A;  3RZS A;  1BLQ A;  3ICB A;  2H2K A;  2JRF A;  3BUM B;  1NCY A;  1N2D A;  1YUT A;  3R1V A;  4BY5 A;  1JFJ A;  2K8M B;  3FE6 A;  3JTD C;  3MSE B;  4PE4 A;  2M7L A;  2KGR A;  2HQW A;  5HLV A;  1S5G Y;  2OPO A;  1GGZ A;  4JWQ A;  3R1P A;  1KQM B;  3CWG A;  3FS7 A;  2JU0 A;  3HCM A;  4AQJ A;  1CDM A;  2L2E A;  3OB1 B;  1ORG A;  5CSI A;  2F3Y A;  2BL0 C;  3I5H C;  2OTG C;  3TS5 C;  2Q91 A;  2GV5 A;  2M8U A;  1S6C A;  4GPL B;  2K7O A;  3R1O A;  1C07 A;  2QEB A;  3KPX A;  3SG7 A;  1K93 D;  1AJ5 A;  2JQ6 A;  2K2A A;  2L5Y A;  4INX A;  1EXR A;  2HET A;  5CPV A;  5HL1 A;  1BT6 A;  2BAP A;  2KI6 C;  1KK7 Z;  1A03 A;  2AMI A;  2L4H A;  3CR5 X;  4I5J A;  3PLF B;  4OR9 B;  3NSO A;  1CFF A;  4ORA B;  4PHJ A;  4QJ3 B;  2SCP A;  2K0J A;  3OGN A;  5D3O A;  5AAN A;  1WY9 A;  3SG2 A;  1JF0 A;  4C0L A;  3CDN A;  1MHO A;  2SAS A;  1KFX L;  3K21 A;  3CGA A;  4HRG A;  1IH0 A;  1GJY A;  1D1O A;  5PAL A;  3D78 A;  1S26 D;  1DF0 B;  2KAY A;  1VRK A;  1BOC A;  1QX5 B;  2WCE A;  3EK8 A;  2CTN A;  2H61 A;  3RLZ A;  4DCK A;  4MBE A;  3EK7 A;  5FI2 A;  1SCV A;  3LK1 A;  3A4U B;  4P2Y B;  2F2P A;  5KTY A;  1B8R A;  4Q04 A;  1KCY A;  2WCK A;  1QS7 A;  1TN4 A;  1QX7 A;  1DVI A;  2KLE A;  1W7J B;  2HF5 A;  4YI8 A;  4MRY A;  4YGC B;  1XK4 C;  2JWW A;  2LVK A;  3FWC A;  4NDD A;  1OOF A;  2MA2 A;  4DIR A;  1IQ3 A;  2IS9 A;  2LUC A;  4CID A;  4CLN A;  3OBV A;  4MN0 A;  1S1E A;  1SBJ A;  4AOM A;  5D69 A;  2BEC A;  2LP2 A;  4ETO A;  3IQQ A;  1NP8 A;  1QXP A;  1LVC D;  4N5X A;  1IGV A;  3FIA A;  4PHK A;  3S0D A;  3D73 A;  3BFB A;  2KFG A;  2WC6 A;  3BUO B;  3NSK A;  3WHU B;  3JVT B;  4OVN F;  1E8A A;  2KGB C;  2P6B B;  1PUL A;  2M1U A;  1WLZ A;  2ZRT A;  2MLE C;  1EL4 A;  2ZKM X;  3D74 A;  3WHT B;  1UP5 A;  2M9G A;  1AJ4 A;  2EC6 B;  1RWY A;  1IWQ A;  1NYA A;  4DRW A;  1UWO A;  1N65 A;  1JFK A;  4JPZ B;  1GM0 A;  2LHL A;  2NCP A;  4CFQ A;  3BOW A;  1R6P A;  2LE9 B;  4PE7 A;  1QX2 A;  2KFH A;  3EKJ A;  1LA3 A;  2WCF A;  2B1U A;  1K9P A;  1L2O B;  2Y4Q A;  1NWD A;  5HLO A;  1G8I A;  4MEW A;  2CBL A;  2PAS A;  2L51 A;  4MRX A;  2KI6 D;  4PE0 A;  1WDC C;  3DXL A;  3PN7 B;  4QJ4 B;  3E3R A;  2FCE A;  1FI5 A;  2PYQ A;  1LKJ A;  1FF1 A;  4PE1 A;  2ZNE A;  2K2F A;  1A4P A;  3I5F C;  1DGU A;  4OCI A;  4WQ2 A;  1SRA A;  3K1E A;  4E68 A;  1OMR A;  1NUB A;  3GOF A;  1CLM A;  3BUW B;  3OHM B;  3BFH A;  3WXA A;  2MRD A;  1AVS A;  1UUR A;  2MLF C;  1CDP A;  4ZCU A;  2COL B;  2LVJ A;  3DVE A;  3S0B A;  3SIB A;  2OTG B;  1K95 A;  3N7H A;  1N0Y A;  1NCZ A;  2H8V A;  4WRI A;  3TS5 B;  1CFC A;  1TWO A;  3CTN A;  4YRU A;  1ZOT B;  1J1E A;  1S6J A;  3PAL A;  1BG1 A;  2L98 A;  1XFU O;  3AKA A;  4GGF C;  3PSR A;  2P71 A;  2LM5 A;  4GNK B;  1DTL A;  1OMV A;  1T14 A;  3SS4 A;  2M1K B;  3VRO A;  3KEV A;  5JJG A;  1OZS A;  1OOJ A;  4GAO A;  2F3Z A;  2MJW B;  3BOW B;  3SG3 A;  4MZJ A;  2KLD A;  1F71 A;  1B9A A;  1TRF A;  5I8N A;  2KHN A;  2LUX A;  3D10 A;  1H8B A;  1XFY O;  1BMO A;  2V53 A;  2ZND A;  3I5G C;  3PAT A;  2BNX A;  1B8C A;  3TDZ A;  1OE9 B;  4YGE B;  2DOQ A;  2BE4 A;  3VRQ A;  5I2O A;  4CFR A;  4I5K A;  1CKK A;  4GGN A;  4M2O A;  1IG5 A;  1QLS A;  1K96 A;  5BPJ A;  3CZ1 A;  2KQ6 A;  4GUK A;  1XFW O;  2JTZ A;  2WCL A;  1KK8 C;  3O4X A;  2M0R A;  5IBW A;  3GK2 A;  1F4Q A;  2JXL A;  3CR2 A;  3H4S E;  2K61 A;  3M0W A;  1IIO A;  3VB1 A;  1NX3 A;  4A4C A;  3O4Y A;  5B8I B;  1OOI X;  1QLK A;  1ZFS A;  1W7I B;  4PHM A;  3A8R A;  5EL2 A;  4FTG A;  4NDB A;  4INW A;  1YRU B;  5CSF A;  5HKY A;  2WCM A;  4DUQ A;  3I5I C;  3FE8 A;  3OX5 A;  2WND A;  2D8N A;  3S0F A;  1IRJ A;  2L50 A;  3PJI A;  2CCM A;  1J55 A;  3D77 A;  3IF7 A;  3CAB A;  3DD4 A;  2LLT A;  1IJ5 A;  4ZCV A;  5I2Q A;  2EHB A;  4U8D A;  1XFZ O;  2PSR A;  2PQL A;  1DC1 A;  1Z2C B;  1J7O A;  1WRK A;  1GQM A;  2AUC A;  1K90 D;  2NZ0 A;  1XYD A;  4JD9 A;  1IJ6 A;  1F70 A;  4YGB B;  3LCP C;  1KQV A;  3CZT X;  1UHH A;  1DMO A;  2LVV A;  1B8L A;  3B7A A;  3TUY C;  1J7R A;  3BUN B;  1UHI A;  3FWB A;  3NXA A;  1QVI Z;  1TCO B;  1QJT A;  2WCB A;  1KWO B;  5F6T A;  2CNP A;  1Y6W A;  2HQ8 A;  2LMT A;  3BUX B;  2NXQ A;  4M2P A;  2EGD A;  1TIZ A;  2I94 A;  1F4O A;  1M39 A;  1ALV A;  1MUX A;  1YX7 A;  2JNF A;  2PRU A;  3KHE A;  1XFV O;  4PHN A;  3TDU A;  1WRL A;  1XFX O;  1C3Z A;  2OS8 B;  1CDL A;  1SNL A;  1DQE A;  3BFA A;  3RM1 A;  3QRX A;  4XJK A;  3SS3 A;  3AAK A;  3I5F B;  3OB2 B;  4YGA A;  1DEK A;  1CNP A;  1K94 A;  3O78 A;  1NX1 A;  3BXK A;  2QDI A;  2KYF A;  2M49 B;  1MF8 B;  2KQY A;  2BCB A;  5K89 A;  5CSN A;  4IL1 A;  1L7Z A;  2FJU B;  4P5O E;  3HX4 A;  3VGO A;  1DJX A;  1KSO A;  1K2H A;  3KO0 A;  3CR4 X;  5FYX A;  1QWV A;  2WCH A;  1SL7 A;  3NHT A;  3NHI A;  1QAT A;  4MVF A;  1TUJ A;  1MR8 A;  5DKN A;  1TUZ A;  5JOL A;  1PSR A;  2PVB A;  1A75 A;  3DF0 A;  1BU3 A;  1NCX A;  1U5I A;  2WC8 A;  1QVI Y;  1OOH A;  1RFJ A;  2A4J A;  2F33 A;  2L2C A;  1MWN A;  1LS8 A;  1Y0V H;  2FCD A;  2BKH B;  2E30 A;  2KI4 B;  4M2Q A;  1JF2 A;  1CTR A;  1Y1X A;  1UHN A;  1KSM A;  1PSB A;  1XA5 A;  2KAV A;  3SG5 A;  2NCO A;  3EKH A;  1NX0 A;  1SK6 D;  4HSZ A;  3LK0 A;  2L0P A;  1V1F A;  2KPH A;  4CPV A;  1YVL A;  3JTD B;  1PAL A;  1DJW A;  2Y1N A;  3QME A;  2YGU A;  1XK4 A;  2ISD A;  5FI6 A;  1K9K A;  1KFU S;  3DZT A;  2CT9 A;  1TNX A;  5FI7 A;  3SG6 A;  3L47 A;  4OZD A;  4XJK B;  2FOT A;  2Y1M A;  2M97 A;  2LMU A;  4I5L B;  1B4C A;  3D0Y A;  1QIW A;  1EG3 A;  5HKW A;  3NGV A;  2BL0 B;  3Q8I A;  1CFD A;  3I5H B;  3L4L A;  3ZNI A;  4KYN A;  1YRT B;  2JUL A;  1OSA A;  4MSP A;  3B86 A;  3PM2 A;  2LP3 A;  1SCM C;  1ZAC A;  3VRR A;  1TNQ A;  3WNX B;  5KU1 A;  3F45 A;  1GGW A;  2JOJ A;  5GQQ C;  1BF5 A;  1YUR A;  5AEQ A;  1B7T Z;  1NPQ A;  3I5I B;  1M63 B;  4PAL A;  3UO9 A;  2CXJ A;  1YR5 A;  4MZL A;  2HPS A;  2QEO A;  5J3X A;  4QJ5 B;  5I94 A;  3JVT C;  2G9B A;  2LNK A;  3BJH A;  1A75 B;  3DF0 B;  1DJG A;  2LV7 A;  3AKB A;  4TNC A;  1PVA A;  1U5I B;  2R2I A;  2L5X B;  1Y1A A;  2I7A A;  2EC6 C;  4FQO A;  4YGD B;  1XFR A;  3PM8 A;  1RK9 A;  1HT9 A;  4PCW A;  1LA0 A;  2I18 A;  1LXF C;  2M29 A;  3EK4 A;  1S36 A;  2JZI A;  2JPO A;  3DVM A;  1UUS A;  4GBA A;  1L2O C;  3NSI A;  2Q4U A;  1MXL C;  4HRH A;  1MQ1 A;  1UHJ A;  3SJS A;  2H61 C;  2PMY A;  3NSL A;  1SW8 A;  1C7W A;  3O2P A;  3PN7 C;  1S6I A;  1X02 A;  1BR1 B;  5G08 A;  2LCP A;  1DT7 B;  3CZ0 A;  3PFV A;  2WOR A;  4PT1 A;  2BKI B;  5DIC A;  5ER4 X;  1SR6 C;  5HKZ A;  1AP4 A;  2NLN A;  1B7T Y;  1CM1 A;  1SMG A;  3D0Y B;  2K7D A;  1R2U A;  2JXC A;  2JT8 A;  1WRZ A;  4A4B A;  1AUI B;  2JNX A;  3DVK A;  2ZFD A;  3UNW A;  4MLW A;  1V1G A;  4BY4 A;  1F8H A;  2JTT A;  3C1V A;  3OX6 A;  4GGF A;  4NQG A;  1IKU A;  1CFP A;  3BQ3 A;  3B88 A;  1Y1U A;  1P28 A;  2LHI A;  1DEL A;  3SIA A;  5D7F A;  1Q80 A;  4WQ3 A;  1K9U A;  1DGV A;  2JT0 A;  4ICB A;  4I5N B;  1K8U A;  1G4Y R;  2ZN8 A;  3BYA A;  3OP0 A;  2K7C A;  4AQI A;  1AK8 A;  1TNW A;  1ZMZ A;  2BBN A;  1C7V A;  2BCX A;  1AHR A;  2GTE A;  1EH2 A;  1WDC B;  2VRG A;  3EVV A;  4C0J A;  1QV0 A;  1A2X A;  1NX2 A;  1NIW A;  4N1G A;  4USL A;  1Z4H A;  2BCA A;  3EG5 B;  1CB1 A;  3IQO A;  4F7F A;  1QV1 A;  1DJI A;  2WC5 A;  4GFT A;  2JC2 A;  4ORB B;  2LAP A;  5AFP A;  3O6B A;  1RJV A;  1B47 A;  1HQV A;  1M31 A;  1YX8 A;  3LL8 B;  1ODB A;  4NDC A;  2ZRS A;  1KFU L;  3S0E A;  3FE9 A;  1SL9 A;  2O60 A;  4L9M A;  1RRO A;  1PK0 D;  2KNE A;  2LLU A;  1KQM C;  1UHK A;  2K7B A;  1J7Q A;  1CMG A;  2LAN A;  4HRE E;  4DS7 A;  3GK4 X;  2LLS A;  3S0G A;  1TOP A;  1SCM B;  2GGZ A;  1JUO A;  1C3Y A;  4R1E A;  1A29 A;  4MZK A;  4OKH A;  1W9Z A;  1YTZ C;  4JKT A;  4YBH B;  3VRN A;  2RGI A;  1F54 A;  1SY9 A;  3VRP A;  4D1E A;  1REC A;  5DKR A;  2QEV A;  2E6W A;  2G2B A;  3CLN A;  1EG4 A;  1FBV A;  2KBM A;  4OV2 A;  1KK7 Y;  1BR4 B;  1OW4 A;  1JWD A;  1SSE B;  2GGM A;  2MAZ A;  3CS1 A;  2LMV A;  1QIV A;  1KFX S;  5ER5 A;  2F8P A;  2KYC A;  1CDN A;  1TNP A;  2KSP A;  1YUS A;  2M3W A;  3CZ2 A;  3DYE A;  1H4B A;  3I5G B;  1JSA A;  2KFF A;  4YI9 A;  1CLL A;  2L4I A;  3D76 A;  1B1G A;  5I2L A; 
#chains in the Genus database with same CATH homology
 2WCM A;  3BJH A;  3R72 A;  3FE8 A;  3S0F A;  2ERB A;  1OOF A;  3PJI A;  3D77 A;  3L4A A;  3CYZ A;  3CAB A;  1XFR A;  4FQT A;  2P70 A;  2PQL A;  3DY9 A;  3S0D A;  3D73 A;  3BFB A;  4JD9 A;  2WC6 A;  2JPO A;  3B7A A;  3D74 A;  1OOG A;  3V2L A;  3B6X A;  3S0A A;  1GM0 A;  3CZ0 A;  4PT1 A;  2FJY A;  5DIC A;  2QEH A;  3D75 A;  1C3Z A;  1DQE A;  3BFA A;  3B87 A;  3B88 A;  2WCJ A;  3DXL A;  1P28 A;  2QDI A;  3K1E A;  3RZS A;  3BFH A;  1QWV A;  2WCH A;  3NHT A;  3NHI A;  1TUJ A;  3R1V A;  2GTE A;  3FE6 A;  3S0B A;  1OOH A;  2L2C A;  3N7H A;  2H8V A;  2WC5 A;  1LS8 A;  4F7F A;  1TWO A;  3R1P A;  2P71 A;  1T14 A;  1ORG A;  3S0E A;  3FE9 A;  2KPH A;  3R1O A;  3QME A;  2QEB A;  4INX A;  3DZT A;  3S0G A;  1C3Y A;  3L47 A;  4OZD A;  3OGN A;  3CDN A;  3NGV A;  3Q8I A;  2QEV A;  3L4L A;  3B86 A;  1OW4 A;  3D78 A;  3CZ1 A;  2WCL A;  3DYE A;  3CZ2 A;  3VB1 A;  1OOI X;  2WCK A;  2QEO A;  5EL2 A;  3D76 A;  4INW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...