2H8VA

Structure of empty pheromone binding protein asp1 from the honeybee apis mellifera l
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Pheromone-binding protein ASP1
publication title Conformational Changes of the Pheromone Binding Protein ASP1 from the Honeybee Apis mellifera L upon Ligand Binding
rcsb
source organism Apis mellifera
total genus 42
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2006-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2h8vA00
4JD9A 3L47A 3FE6A 2P70A 2KPHA 4OZDA 3D74A 3N7HA 2FJYA 3CYZA 3L4AA 2ERBA 5EL2A 1C3YA 2H8VA 3B88A 3V2LA 2QEHA 4FQTA 1TWOA 1XFRA 3R1OA 1GM0A 3D73A 1LS8A 2WCHA 2QEVA 4INXA 3PJIA 3D77A 3QMEA 3BFAA 3CZ1A 3S0EA 2QEBA 2L2CA 2WCJA 3BFBA 3BJHA 2WC5A 3B86A 3D78A 2GTEA 3S0BA 2WCKA 3DXLA 2PQLA 2QEOA 3S0FA 3CABA 3B87A 3Q8IA 1OW4A 3CZ2A 3D76A 3L4LA 3NHIA 2P71A 3DZTA 3K1EA 1OOIX 2WCMA 1TUJA 2WCLA 3OGNA 3DYEA 4INWA 1ORGA 1QWVA 1OOGA 3FE8A 4F7FA 5DICA 3D75A 2WC6A 2QDIA 3DY9A 3R72A 1P28A 1C3ZA 3R1VA 1OOFA 1T14A 4PT1A 3FE9A 3VB1A 3S0AA 3S0DA 3CDNA 3R1PA 3B7AA 1DQEA 3CZ0A 1OOHA 3S0GA 3RZSA 3NGVA 3NHTA 3B6XA 2JPOA 3BFHA
chains in the Genus database with same CATH superfamily
1LA3A 2I94A 4YGEB 5DKQA 2EHBA 1NX3A 3GK4X 4PHNA 2L4IA 3DF0A 3I5HB 3LK0A 5ER5A 3WXAA 1CDLA 2KBIA 1YUUA 1SL9A 2LUCA 3VRRA 1FI5A 3WHUB 1PVBA 1WLZA 2KPHA 1S36A 4OZDA 3EKJA 2KLEA 3JTDC 3CYZA 3L4AA 1RFJA 2AAOA 4ORCB 1YRTB 1TUZA 3C1VA 4AQJA 4DS7A 1ZMZA 5JOLA 2KYFA 2NLNA 2H8VA 2O60A 3IF7A 3LL8B 1NSHA 2K8MB 3V2LA 2ZNDA 2WORA 2LMUA 3D0YB 2LV7A 1WLMA 1OOJA 2BBMA 1M45A 2GV5A 2O5GA 2K61A 3GK2A 2F3ZA 1DF0A 1GM0A 4R1EA 2K60A 1Y1AA 2KLDA 2ISDA 3ICBA 1SYMA 1BJFA 1NX2A 5TNCA 1S6IA 2OPOA 1A75A 1SL8A 2CXJA 2QPTA 2JTTA 1YURA 4ICBA 4DRWA 3AAJA 1KQMC 1SBJA 1SK6D 2G2BA 1Y0VH 2LHLA 2MLFC 2MLEC 4I5JA 4IL1A 1XA5A 4ORBB 3S0EA 3WHTB 2LM5A 1F4QA 3BFBA 5I8NA 4GAOA 1ZFSA 1S6CA 1Y1XA 2OTGB 4WQ3A 4M2QA 2L5XB 1YTZC 1H8BA 1DEKA 3MSEB 3OB2B 1K2HA 2PQLA 1IG5A 1UUSA 1GGWA 1KCYA 2JRFA 1BLQA 3BXKA 3SG2A 1FI6A 4MSPA 4P2YB 4NDBA 2KGRA 1DGUA 1NCYA 2M8UA 3Q8IA 1SY9A 2A4JA 3BUMB 4OV2A 3SS5A 1KFXL 1F4OA 1TCFA 2ZRTA 3BUOB 2Y4QA 3L4LA 5I2QA 3H4SE 3PSRA 3DZTA 2LLUA 2LCPA 3AKBA 2K7BA 3I5HC 3PM8A 5HKWA 3PN7B 1OOIX 1ZUZA 1BODA 1FBVA 1QIWA 2KDHA 2LE9B 3OGNA 1B4CA 1TNQA 2JC2A 1KWOB 3ZNIA 3DYEA 1YVHA 1BR1B 2JWWA 3DVJA 1U5IB 1ORGA 1BU3A 4OR9B 1S5GY 2LLTA 1OOGA 4M2PA 1CDNA 3D75A 2EC6B 2WC6A 1WRLA 3A8RA 3DY9A 2E30A 2AUCA 1BR4B 1SPYA 3LCPC 1KFUL 1J1EA 1F71A 1PRWA 1QVIY 2H61A 3R1VA 4GGFC 3DVEA 2LVJA 3EK8A 3PFVA 1QX5B 1JUOA 1YVLA 4PT1A 5BPJA 2FCEA 5KTYA 1CFFA 5FI2A 4GUKA 2ZKMX 3IQQA 1EG3A 2GGMA 1F70A 1B9AA 5D7FA 1DF0B 2M3WA 3CDNA 3R1PA 1XFZO 4WQ2A 1WDCB 1JFKA 2LVKA 4PHKA 1M46A 1ALWA 2LUXA 4ZCUA 4A4BA 4PALA 3O6BA 2CT9A 1DQEA 1E8AA 1N0YA 2NCPA 2L2EA 1DC1A 4MLWA 1QIVA 1CFDA 2M7NA 2BE6A 1GQMA 1UHJA 2L51A 4CIDA 4U8DA 1LINA 2KQYA 3KO0A 4C0JA 3SIAA 3CR4X 3VROA 1Y6WA 2OS8B 2SCPA 1NIWA 3VRNA 4QJ4B 2L5YA 3FS7A 3UNWA 1Z2CB 1Z4HA 2LAPA 4YBHB 2P6BB 1CM1A 4MRYA 3N7HA 1K94A 5K89A 2FJUB 2LVIA 1TTXA 5EL2A 1C3YA 2PASA 1CTRA 2BL0C 2JT0A 2QEHA 4MZJA 1IJ5A 3I5IB 2L98A 1YR5A 3PM2A 4FQTA 5DKNA 1KWOC 1XFRA 1L2OC 2M97A 4MEWA 1SR6C 3D10A 3D73A 3KPXA 1DJGA 4UPGA 3SG3A 2M7LA 1M39A 5AXIA 1K95A 1BOCA 1BG1A 1AJ5A 1B8CA 2LP3A 1DGVA 2F33A 1OSAA 3BOWB 3O4XA 4M2OA 4XJKA 4YGDB 2EC6C 2JPTA 3SG4A 1EL4A 1X02A 3JVTC 1NX1A 3TUYB 5AERA 2HQWA 2KSPA 3A4UB 2WCJA 5B8IB 1JFJA 1AHRA 2WC5A 3OB1B 2KFGA 1S26D 1NX0A 1IQ5A 2JXLA 4E68A 1PSRA 1F55A 2MHHA 3KHEA 1DJZA 3KF9A 2BCAA 4Q04A 1KK7Y 2K7CA 3OHMB 5D3OA 1M31A 2K2FA 3S0BA 1ZOTB 2JNFA 3BUNB 3HCMA 4PHMA 4D1EA 4YRUA 3CGAA 2KBMA 1GGZA 2M0RA 2Y5IA 4F0ZB 1UHIA 1HQVA 1OW4A 1PALA 4I5NB 3UO9A 3D76A 1B7TY 2I7AA 3CR2A 2KAVA 1W7JB 2JU0A 4PE0A 4PCWA 4PE1A 3VRPA 1S5GZ 4CFQA 1NCXA 2CNPA 1NPQA 2OS8C 1A03A 1AVSA 4YGAA 1BMOA 1QS7A 2WCMA 1XYDA 2PYQA 1F8HA 1TUJA 2WCFA 4FQOA 5KU1A 1QTXA 2NZ0A 3I5FC 1TRFA 1TNWA 1JSAA 1OMRA 1G4YR 3OBVA 1Y1UA 1PVAA 1TNXA 4YI8A 5DICA 1HT9A 1AK8A 3OX5A 3R72A 3CR5X 2KFFA 3GK1A 2BKIB 4QJ5B 2IS9A 4YGBB 1DJWA 1EXRA 4JQ0D 2KYCA 5FI6A 1KFXS 2BCXA 5CSIA 4CLNA 1T14A 1FPWA 4GFTA 2BBNA 1DMOA 2M1UA 1SMGA 4ORAB 2LMVA 3O4YA 4MBEA 2WCEA 4L9MA 5FI7A 3S0DA 5F6TA 1J7OA 1UP5A 1D1OA 4DIRA 1CNPA 2PMYA 2ZN9A 3CZ0A 2CBLA 1OOHA 3S0GA 1A2XA 4XJKB 3DF0B 3LK1A 3NHTA 4BY5A 1KK8B 3BFHA 4MVFA 5HYDA 1CLLA 2WNDA 4PE4A 1NCZA 1QX7A 1W9ZA 2WOSA 1TNPA 2Y1NA 3HX4A 1TN4A 3L47A 1MF8B 4PHJA 2P70A 1BF5A 1XK4C 5JJGA 2H2KA 4BY4A 1IQ3A 2L0PA 1J7RA 1DJYA 2NCOA 4QJ3B 1OMVA 3I5GB 1JF2A 1PK0D 2F3YA 2QACA 3IVTA 1JBAA 2HETA 5CPVA 4GBAA 2ERBA 1FW4A 1K9KA 3NSOA 4JWQA 2PALA 1RWYA 2MBXA 2JQ6A 1DJHA 1CM4A 4IJ7A 1N2DA 3NSLA 1Q80A 2BKHB 4OCIA 1K8UA 3RLZA 2MA2A 2CTNA 1KSMA 2NXQA 1R2UA 1TWOA 1A75B 5I2LA 4DCKA 1A4PA 2OTGC 3R1OA 2LLSA 1OZOA 1LS8A 1CDMA 1KQVA 2QEVA 3BYAA 5CSFA 4TNCA 4HREE 3D0YA 1CFCA 2KI4B 4INXA 1YX7A 3JTDB 1IJ6A 1YUTA 4HRHA 1KK7Z 3NXAA 3BUXB 1L7ZA 1SNLA 4GGFA 2RGIA 1QATA 1S6JA 2HPSA 1IGVA 3BFAA 3CZ1A 3BJHA 2AMIA 1XFWO 2HQ8A 2JT8A 3D78A 3NSIA 1LVCD 3TDUA 4PE7A 1M63B 1SW8A 1B7TZ 5CSJA 2PVBA 2GTEA 4HRGA 2WCKA 4CFRA 4C0LA 2Q4UA 4YI9A 1CMFA 3PN7C 3SG5A 2QEOA 2EGDA 1AP4A 3S0FA 1K9UA 3TZ1A 3TDZA 1K96A 5ER4X 2SASA 2B1UA 2YGUA 1W7IB 2M49B 1XFYO 1MXLC 4I5LB 2JOJA 1TOPA 3CZ2A 3AKAA 1ODBA 2KAXA 1S3PA 1EH2A 3KEVA 4XYNA 1J1DA 1KK8C 1CMGA 5PALA 3NHIA 3EVUA 2MJWB 1BT6A 1XVJA 5FYXA 4WRIA 2M9GA 3EK4A 1QASA 3VGOA 1SL7A 4OKHA 3AAKA 3SG7A 5I94A 1J7PA 4CPVA 1QV0A 1C07A 2WCLA 1ZACA 2ZRSA 5HL1A 1CB1A 3WNXB 1N65A 3CZTX 2LP2A 1MHOA 1WY9A 2KHNA 1K90D 1SRAA 2KNEA 1NYAA 1CLMA 1QWVA 1MQ1A 1IH0A 3FE8A 4F7FA 2KOTA 2GGZA 1WDCC 5AANA 2K2AA 3PATA 1DELA 1YUSA 1OQPA 3ZWHA 1U5IA 1IRJA 4AQIA 2COLB 1C3ZA 1J55A 1XFVO 4JPZB 1PSBA 2KQ6A 1OOFA 2I18A 1MWNA 3FIAA 3M0WA 2LANA 1JWDA 2KI4C 1UURA 1SCVA 4PDZA 2JNXA 2PRUA 2BE4A 1QJTA 2BNXA 3PLFB 5HLVA 4C0KA 3VB1A 2F2PA 2JULA 1SCMB 1K93D 4GGNA 2ZN8A 2ZFDA 5HKYA 4N1FA 1LKJA 1NWDA 2G9BA 4MRXA 1EJ3A 1QVIZ 4N5XA 4NDDA 3RZSA 4FTGA 3FWBA 1JF0A 4MZKA 1V1GA 1NP8A 2DOQA 2JPOA 3F45A 1F54A 3TS5B 1SKTA 3CTNA 5CSNA 2LNKA 1EG4A 4JD9A 1FF1A 2V53A 3GOFA 3I5IC 1UHHA 1SSEB 1QLSA 2KAYA 3FE6A 3NSKA 2K7OA 4KYNA 4HSZA 5HKZA 2PSRA 2MRDA 1TIZA 3D74A 3O78A 2FJYA 4MZLA 3PALA 1S1EA 4I5KA 3QRXA 1DTLA 3B88A 2TN4A 3TUYC 1B8RA 2JZIA 2K0JA 3SIBA 2LHIA 3BUWB 1OE9B 1DT7B 2WCHA 1IKUA 1YRUB 1UWOA 2F8PA 1RTP1 4NDCA 1QV1A 1TCOB 2KI6C 2H61C 4GPLB 1KSOA 3PJIA 2LMTA 3CWGA 1IIOA 2M1KB 1KFUS 3D77A 3QMEA 5AEQA 1CDPA 2BL0B 3K21A 3CLNA 2ZNEA 2JT3A 1B1GA 2QEBA 2L2CA 1MR8A 3BOWA 4AOMA 1XFUO 3B86A 4A4CA 2FCDA 1LXFC 2WC8A 4NQGA 1L2OB 3DD4A 4YGCB 1CKKA 1PULA 1SR6B 1RECA 3OP0A 1YX8A 3EKHA 4OVNF 5I2OA 2F2OA 1LA0A 2I2RE 2KFHA 3DXLA 3SJSA 5AFPA 1J7QA 2LC5A 1SCMC 2E6WA 3CS1A 3DVKA 2R2IA 3CABA 2M29A 4JKTA 2L50A 1H4BA 3OX6A 1VRKA 3B87A 1QX2A 3JVTB 2BAPA 1B8LA 1CFPA 1QLKA 2K7DA 5D69A 1B47A 1RJVA 1UHNA 4ETOA 1C7VA 2Y1MA 1XK4A 3TS5C 2P71A 3LLEA 4DUQA 3K1EA 1CLBA 1WRZA 1K9PA 2KI6D 2WCBA 4P5OE 1V1FA 3EG5B 4N1GA 5GQQC 1DVIA 3SS4A 2KGBC 4INWA 1G33A 1OMDA 3SG6A 2L4HA 2JXCA 1RROA 1AUIB 1DJXA 2BCBA 1AJ4A 4MN0A 1G8IA 2QDIA 4ZCVA 1KQMB 1P28A 1RK9A 2FOTA 3IQOA 5DKRA 1DJIA 2BECA 3RM1A 5KSZA 2LVVA 3EVVA 3SS3A 1JC2A 1UHKA 2JTZA 3E3RA 3I5FB 1MUXA 1NUBA 3DVMA 1QXPA 1OZSA 2HF5A 3EVRA 1R6PA 3FWCA 1A29A 1GJYA 3FE9A 5G08A 3EK7A 3S0AA 5J3XA 3TDIA 4USLA 3O2PA 1IWQA 1XFXO 3B7AA 3I5GC 2VRGA 4GNKB 2MAZA 3BQ3A 5HLOA 2Q91A 5IBWA 2D8NA 1C7WA 1WRKA 1XO5A 3NGVA 2CCMA 1ALVA 3VRQA 3B6XA 1MXEA
chains in the Genus database with same CATH topology
4JD9A 3L47A 3FE6A 2P70A 2KPHA 4OZDA 3D74A 3N7HA 2FJYA 3CYZA 3L4AA 2ERBA 5EL2A 1C3YA 2H8VA 3B88A 3V2LA 2QEHA 4FQTA 1TWOA 1XFRA 3R1OA 1GM0A 3D73A 1LS8A 2WCHA 2QEVA 4INXA 3PJIA 3D77A 3QMEA 3BFAA 3CZ1A 3S0EA 2QEBA 2L2CA 2WCJA 3BFBA 3BJHA 2WC5A 3B86A 3D78A 2GTEA 3S0BA 2WCKA 3DXLA 2PQLA 2QEOA 3S0FA 3CABA 3B87A 3Q8IA 1OW4A 3CZ2A 3D76A 3L4LA 3NHIA 2P71A 3DZTA 3K1EA 1OOIX 2WCMA 1TUJA 2WCLA 3OGNA 3DYEA 4INWA 1ORGA 1QWVA 1OOGA 3FE8A 4F7FA 5DICA 3D75A 2WC6A 2QDIA 3DY9A 3R72A 1P28A 1C3ZA 3R1VA 1OOFA 1T14A 4PT1A 3FE9A 3VB1A 3S0AA 3S0DA 3CDNA 3R1PA 3B7AA 1DQEA 3CZ0A 1OOHA 3S0GA 3RZSA 3NGVA 3NHTA 3B6XA 2JPOA 3BFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JD9 A;  3L47 A;  3FE6 A;  2P70 A;  2KPH A;  4OZD A;  3D74 A;  3N7H A;  2FJY A;  3CYZ A;  3L4A A;  2ERB A;  5EL2 A;  1C3Y A;  2H8V A;  3B88 A;  3V2L A;  2QEH A;  4FQT A;  1TWO A;  1XFR A;  3R1O A;  1GM0 A;  3D73 A;  1LS8 A;  2WCH A;  2QEV A;  4INX A;  3PJI A;  3D77 A;  3QME A;  3BFA A;  3CZ1 A;  3S0E A;  2QEB A;  2L2C A;  2WCJ A;  3BFB A;  3BJH A;  2WC5 A;  3B86 A;  3D78 A;  2GTE A;  3S0B A;  2WCK A;  3DXL A;  2PQL A;  2QEO A;  3S0F A;  3CAB A;  3B87 A;  3Q8I A;  1OW4 A;  3CZ2 A;  3D76 A;  3L4L A;  3NHI A;  2P71 A;  3DZT A;  3K1E A;  1OOI X;  2WCM A;  1TUJ A;  2WCL A;  3OGN A;  3DYE A;  4INW A;  1ORG A;  1QWV A;  1OOG A;  3FE8 A;  4F7F A;  5DIC A;  3D75 A;  2WC6 A;  2QDI A;  3DY9 A;  3R72 A;  1P28 A;  1C3Z A;  3R1V A;  1OOF A;  1T14 A;  4PT1 A;  3FE9 A;  3VB1 A;  3S0A A;  3S0D A;  3CDN A;  3R1P A;  3B7A A;  1DQE A;  3CZ0 A;  1OOH A;  3S0G A;  3RZS A;  3NGV A;  3NHT A;  3B6X A;  2JPO A;  3BFH A; 
#chains in the Genus database with same CATH topology
 1LA3 A;  2I94 A;  4YGE B;  5DKQ A;  2EHB A;  1NX3 A;  3GK4 X;  4PHN A;  2L4I A;  3DF0 A;  3I5H B;  3LK0 A;  5ER5 A;  3WXA A;  1CDL A;  2KBI A;  1YUU A;  1SL9 A;  2LUC A;  3VRR A;  1FI5 A;  3WHU B;  1PVB A;  1WLZ A;  2KPH A;  1S36 A;  4OZD A;  3EKJ A;  2KLE A;  3JTD C;  3CYZ A;  3L4A A;  1RFJ A;  2AAO A;  4ORC B;  1YRT B;  1TUZ A;  3C1V A;  4AQJ A;  4DS7 A;  1ZMZ A;  5JOL A;  2KYF A;  2NLN A;  2H8V A;  2O60 A;  3IF7 A;  3LL8 B;  1NSH A;  2K8M B;  3V2L A;  2ZND A;  2WOR A;  2LMU A;  3D0Y B;  2LV7 A;  1WLM A;  1OOJ A;  2BBM A;  1M45 A;  2GV5 A;  2O5G A;  2K61 A;  3GK2 A;  2F3Z A;  1DF0 A;  1GM0 A;  4R1E A;  2K60 A;  1Y1A A;  2KLD A;  2ISD A;  3ICB A;  1SYM A;  1BJF A;  1NX2 A;  5TNC A;  1S6I A;  2OPO A;  1A75 A;  1SL8 A;  2CXJ A;  2QPT A;  2JTT A;  1YUR A;  4ICB A;  4DRW A;  3AAJ A;  1KQM C;  1SBJ A;  1SK6 D;  2G2B A;  1Y0V H;  2LHL A;  2MLF C;  2MLE C;  4I5J A;  4IL1 A;  1XA5 A;  4ORB B;  3S0E A;  3WHT B;  2LM5 A;  1F4Q A;  3BFB A;  5I8N A;  4GAO A;  1ZFS A;  1S6C A;  1Y1X A;  2OTG B;  4WQ3 A;  4M2Q A;  2L5X B;  1YTZ C;  1H8B A;  1DEK A;  3MSE B;  3OB2 B;  1K2H A;  2PQL A;  1IG5 A;  1UUS A;  1GGW A;  1KCY A;  2JRF A;  1BLQ A;  3BXK A;  3SG2 A;  1FI6 A;  4MSP A;  4P2Y B;  4NDB A;  2KGR A;  1DGU A;  1NCY A;  2M8U A;  3Q8I A;  1SY9 A;  2A4J A;  3BUM B;  4OV2 A;  3SS5 A;  1KFX L;  1F4O A;  1TCF A;  2ZRT A;  3BUO B;  2Y4Q A;  3L4L A;  5I2Q A;  3H4S E;  3PSR A;  3DZT A;  2LLU A;  2LCP A;  3AKB A;  2K7B A;  3I5H C;  3PM8 A;  5HKW A;  3PN7 B;  1OOI X;  1ZUZ A;  1BOD A;  1FBV A;  1QIW A;  2KDH A;  2LE9 B;  3OGN A;  1B4C A;  1TNQ A;  2JC2 A;  1KWO B;  3ZNI A;  3DYE A;  1YVH A;  1BR1 B;  2JWW A;  3DVJ A;  1U5I B;  1ORG A;  1BU3 A;  4OR9 B;  1S5G Y;  2LLT A;  1OOG A;  4M2P A;  1CDN A;  3D75 A;  2EC6 B;  2WC6 A;  1WRL A;  3A8R A;  3DY9 A;  2E30 A;  2AUC A;  1BR4 B;  1SPY A;  3LCP C;  1KFU L;  1J1E A;  1F71 A;  1PRW A;  1QVI Y;  2H61 A;  3R1V A;  4GGF C;  3DVE A;  2LVJ A;  3EK8 A;  3PFV A;  1QX5 B;  1JUO A;  1YVL A;  4PT1 A;  5BPJ A;  2FCE A;  5KTY A;  1CFF A;  5FI2 A;  4GUK A;  2ZKM X;  3IQQ A;  1EG3 A;  2GGM A;  1F70 A;  1B9A A;  5D7F A;  1DF0 B;  2M3W A;  3CDN A;  3R1P A;  1XFZ O;  4WQ2 A;  1WDC B;  1JFK A;  2LVK A;  4PHK A;  1M46 A;  1ALW A;  2LUX A;  4ZCU A;  4A4B A;  4PAL A;  3O6B A;  2CT9 A;  1DQE A;  1E8A A;  1N0Y A;  2NCP A;  2L2E A;  1DC1 A;  4MLW A;  1QIV A;  1CFD A;  2M7N A;  2BE6 A;  1GQM A;  1UHJ A;  2L51 A;  4CID A;  4U8D A;  1LIN A;  2KQY A;  3KO0 A;  4C0J A;  3SIA A;  3CR4 X;  3VRO A;  1Y6W A;  2OS8 B;  2SCP A;  1NIW A;  3VRN A;  4QJ4 B;  2L5Y A;  3FS7 A;  3UNW A;  1Z2C B;  1Z4H A;  2LAP A;  4YBH B;  2P6B B;  1CM1 A;  4MRY A;  3N7H A;  1K94 A;  5K89 A;  2FJU B;  2LVI A;  1TTX A;  5EL2 A;  1C3Y A;  2PAS A;  1CTR A;  2BL0 C;  2JT0 A;  2QEH A;  4MZJ A;  1IJ5 A;  3I5I B;  2L98 A;  1YR5 A;  3PM2 A;  4FQT A;  5DKN A;  1KWO C;  1XFR A;  1L2O C;  2M97 A;  4MEW A;  1SR6 C;  3D10 A;  3D73 A;  3KPX A;  1DJG A;  4UPG A;  3SG3 A;  2M7L A;  1M39 A;  5AXI A;  1K95 A;  1BOC A;  1BG1 A;  1AJ5 A;  1B8C A;  2LP3 A;  1DGV A;  2F33 A;  1OSA A;  3BOW B;  3O4X A;  4M2O A;  4XJK A;  4YGD B;  2EC6 C;  2JPT A;  3SG4 A;  1EL4 A;  1X02 A;  3JVT C;  1NX1 A;  3TUY B;  5AER A;  2HQW A;  2KSP A;  3A4U B;  2WCJ A;  5B8I B;  1JFJ A;  1AHR A;  2WC5 A;  3OB1 B;  2KFG A;  1S26 D;  1NX0 A;  1IQ5 A;  2JXL A;  4E68 A;  1PSR A;  1F55 A;  2MHH A;  3KHE A;  1DJZ A;  3KF9 A;  2BCA A;  4Q04 A;  1KK7 Y;  2K7C A;  3OHM B;  5D3O A;  1M31 A;  2K2F A;  3S0B A;  1ZOT B;  2JNF A;  3BUN B;  3HCM A;  4PHM A;  4D1E A;  4YRU A;  3CGA A;  2KBM A;  1GGZ A;  2M0R A;  2Y5I A;  4F0Z B;  1UHI A;  1HQV A;  1OW4 A;  1PAL A;  4I5N B;  3UO9 A;  3D76 A;  1B7T Y;  2I7A A;  3CR2 A;  2KAV A;  1W7J B;  2JU0 A;  4PE0 A;  4PCW A;  4PE1 A;  3VRP A;  1S5G Z;  4CFQ A;  1NCX A;  2CNP A;  1NPQ A;  2OS8 C;  1A03 A;  1AVS A;  4YGA A;  1BMO A;  1QS7 A;  2WCM A;  1XYD A;  2PYQ A;  1F8H A;  1TUJ A;  2WCF A;  4FQO A;  5KU1 A;  1QTX A;  2NZ0 A;  3I5F C;  1TRF A;  1TNW A;  1JSA A;  1OMR A;  1G4Y R;  3OBV A;  1Y1U A;  1PVA A;  1TNX A;  4YI8 A;  5DIC A;  1HT9 A;  1AK8 A;  3OX5 A;  3R72 A;  3CR5 X;  2KFF A;  3GK1 A;  2BKI B;  4QJ5 B;  2IS9 A;  4YGB B;  1DJW A;  1EXR A;  4JQ0 D;  2KYC A;  5FI6 A;  1KFX S;  2BCX A;  5CSI A;  4CLN A;  1T14 A;  1FPW A;  4GFT A;  2BBN A;  1DMO A;  2M1U A;  1SMG A;  4ORA B;  2LMV A;  3O4Y A;  4MBE A;  2WCE A;  4L9M A;  5FI7 A;  3S0D A;  5F6T A;  1J7O A;  1UP5 A;  1D1O A;  4DIR A;  1CNP A;  2PMY A;  2ZN9 A;  3CZ0 A;  2CBL A;  1OOH A;  3S0G A;  1A2X A;  4XJK B;  3DF0 B;  3LK1 A;  3NHT A;  4BY5 A;  1KK8 B;  3BFH A;  4MVF A;  5HYD A;  1CLL A;  2WND A;  4PE4 A;  1NCZ A;  1QX7 A;  1W9Z A;  2WOS A;  1TNP A;  2Y1N A;  3HX4 A;  1TN4 A;  3L47 A;  1MF8 B;  4PHJ A;  2P70 A;  1BF5 A;  1XK4 C;  5JJG A;  2H2K A;  4BY4 A;  1IQ3 A;  2L0P A;  1J7R A;  1DJY A;  2NCO A;  4QJ3 B;  1OMV A;  3I5G B;  1JF2 A;  1PK0 D;  2F3Y A;  2QAC A;  3IVT A;  1JBA A;  2HET A;  5CPV A;  4GBA A;  2ERB A;  1FW4 A;  1K9K A;  3NSO A;  4JWQ A;  2PAL A;  1RWY A;  2MBX A;  2JQ6 A;  1DJH A;  1CM4 A;  4IJ7 A;  1N2D A;  3NSL A;  1Q80 A;  2BKH B;  4OCI A;  1K8U A;  3RLZ A;  2MA2 A;  2CTN A;  1KSM A;  2NXQ A;  1R2U A;  1TWO A;  1A75 B;  5I2L A;  4DCK A;  1A4P A;  2OTG C;  3R1O A;  2LLS A;  1OZO A;  1LS8 A;  1CDM A;  1KQV A;  2QEV A;  3BYA A;  5CSF A;  4TNC A;  4HRE E;  3D0Y A;  1CFC A;  2KI4 B;  4INX A;  1YX7 A;  3JTD B;  1IJ6 A;  1YUT A;  4HRH A;  1KK7 Z;  3NXA A;  3BUX B;  1L7Z A;  1SNL A;  4GGF A;  2RGI A;  1QAT A;  1S6J A;  2HPS A;  1IGV A;  3BFA A;  3CZ1 A;  3BJH A;  2AMI A;  1XFW O;  2HQ8 A;  2JT8 A;  3D78 A;  3NSI A;  1LVC D;  3TDU A;  4PE7 A;  1M63 B;  1SW8 A;  1B7T Z;  5CSJ A;  2PVB A;  2GTE A;  4HRG A;  2WCK A;  4CFR A;  4C0L A;  2Q4U A;  4YI9 A;  1CMF A;  3PN7 C;  3SG5 A;  2QEO A;  2EGD A;  1AP4 A;  3S0F A;  1K9U A;  3TZ1 A;  3TDZ A;  1K96 A;  5ER4 X;  2SAS A;  2B1U A;  2YGU A;  1W7I B;  2M49 B;  1XFY O;  1MXL C;  4I5L B;  2JOJ A;  1TOP A;  3CZ2 A;  3AKA A;  1ODB A;  2KAX A;  1S3P A;  1EH2 A;  3KEV A;  4XYN A;  1J1D A;  1KK8 C;  1CMG A;  5PAL A;  3NHI A;  3EVU A;  2MJW B;  1BT6 A;  1XVJ A;  5FYX A;  4WRI A;  2M9G A;  3EK4 A;  1QAS A;  3VGO A;  1SL7 A;  4OKH A;  3AAK A;  3SG7 A;  5I94 A;  1J7P A;  4CPV A;  1QV0 A;  1C07 A;  2WCL A;  1ZAC A;  2ZRS A;  5HL1 A;  1CB1 A;  3WNX B;  1N65 A;  3CZT X;  2LP2 A;  1MHO A;  1WY9 A;  2KHN A;  1K90 D;  1SRA A;  2KNE A;  1NYA A;  1CLM A;  1QWV A;  1MQ1 A;  1IH0 A;  3FE8 A;  4F7F A;  2KOT A;  2GGZ A;  1WDC C;  5AAN A;  2K2A A;  3PAT A;  1DEL A;  1YUS A;  1OQP A;  3ZWH A;  1U5I A;  1IRJ A;  4AQI A;  2COL B;  1C3Z A;  1J55 A;  1XFV O;  4JPZ B;  1PSB A;  2KQ6 A;  1OOF A;  2I18 A;  1MWN A;  3FIA A;  3M0W A;  2LAN A;  1JWD A;  2KI4 C;  1UUR A;  1SCV A;  4PDZ A;  2JNX A;  2PRU A;  2BE4 A;  1QJT A;  2BNX A;  3PLF B;  5HLV A;  4C0K A;  3VB1 A;  2F2P A;  2JUL A;  1SCM B;  1K93 D;  4GGN A;  2ZN8 A;  2ZFD A;  5HKY A;  4N1F A;  1LKJ A;  1NWD A;  2G9B A;  4MRX A;  1EJ3 A;  1QVI Z;  4N5X A;  4NDD A;  3RZS A;  4FTG A;  3FWB A;  1JF0 A;  4MZK A;  1V1G A;  1NP8 A;  2DOQ A;  2JPO A;  3F45 A;  1F54 A;  3TS5 B;  1SKT A;  3CTN A;  5CSN A;  2LNK A;  1EG4 A;  4JD9 A;  1FF1 A;  2V53 A;  3GOF A;  3I5I C;  1UHH A;  1SSE B;  1QLS A;  2KAY A;  3FE6 A;  3NSK A;  2K7O A;  4KYN A;  4HSZ A;  5HKZ A;  2PSR A;  2MRD A;  1TIZ A;  3D74 A;  3O78 A;  2FJY A;  4MZL A;  3PAL A;  1S1E A;  4I5K A;  3QRX A;  1DTL A;  3B88 A;  2TN4 A;  3TUY C;  1B8R A;  2JZI A;  2K0J A;  3SIB A;  2LHI A;  3BUW B;  1OE9 B;  1DT7 B;  2WCH A;  1IKU A;  1YRU B;  1UWO A;  2F8P A;  1RTP 1;  4NDC A;  1QV1 A;  1TCO B;  2KI6 C;  2H61 C;  4GPL B;  1KSO A;  3PJI A;  2LMT A;  3CWG A;  1IIO A;  2M1K B;  1KFU S;  3D77 A;  3QME A;  5AEQ A;  1CDP A;  2BL0 B;  3K21 A;  3CLN A;  2ZNE A;  2JT3 A;  1B1G A;  2QEB A;  2L2C A;  1MR8 A;  3BOW A;  4AOM A;  1XFU O;  3B86 A;  4A4C A;  2FCD A;  1LXF C;  2WC8 A;  4NQG A;  1L2O B;  3DD4 A;  4YGC B;  1CKK A;  1PUL A;  1SR6 B;  1REC A;  3OP0 A;  1YX8 A;  3EKH A;  4OVN F;  5I2O A;  2F2O A;  1LA0 A;  2I2R E;  2KFH A;  3DXL A;  3SJS A;  5AFP A;  1J7Q A;  2LC5 A;  1SCM C;  2E6W A;  3CS1 A;  3DVK A;  2R2I A;  3CAB A;  2M29 A;  4JKT A;  2L50 A;  1H4B A;  3OX6 A;  1VRK A;  3B87 A;  1QX2 A;  3JVT B;  2BAP A;  1B8L A;  1CFP A;  1QLK A;  2K7D A;  5D69 A;  1B47 A;  1RJV A;  1UHN A;  4ETO A;  1C7V A;  2Y1M A;  1XK4 A;  3TS5 C;  2P71 A;  3LLE A;  4DUQ A;  3K1E A;  1CLB A;  1WRZ A;  1K9P A;  2KI6 D;  2WCB A;  4P5O E;  1V1F A;  3EG5 B;  4N1G A;  5GQQ C;  1DVI A;  3SS4 A;  2KGB C;  4INW A;  1G33 A;  1OMD A;  3SG6 A;  2L4H A;  2JXC A;  1RRO A;  1AUI B;  1DJX A;  2BCB A;  1AJ4 A;  4MN0 A;  1G8I A;  2QDI A;  4ZCV A;  1KQM B;  1P28 A;  1RK9 A;  2FOT A;  3IQO A;  5DKR A;  1DJI A;  2BEC A;  3RM1 A;  5KSZ A;  2LVV A;  3EVV A;  3SS3 A;  1JC2 A;  1UHK A;  2JTZ A;  3E3R A;  3I5F B;  1MUX A;  1NUB A;  3DVM A;  1QXP A;  1OZS A;  2HF5 A;  3EVR A;  1R6P A;  3FWC A;  1A29 A;  1GJY A;  3FE9 A;  5G08 A;  3EK7 A;  3S0A A;  5J3X A;  3TDI A;  4USL A;  3O2P A;  1IWQ A;  1XFX O;  3B7A A;  3I5G C;  2VRG A;  4GNK B;  2MAZ A;  3BQ3 A;  5HLO A;  2Q91 A;  5IBW A;  2D8N A;  1C7W A;  1WRK A;  1XO5 A;  3NGV A;  2CCM A;  1ALV A;  3VRQ A;  3B6X A;  1MXE A; 
#chains in the Genus database with same CATH homology
 4JD9 A;  3L47 A;  3FE6 A;  2P70 A;  2KPH A;  4OZD A;  3D74 A;  3N7H A;  2FJY A;  3CYZ A;  3L4A A;  2ERB A;  5EL2 A;  1C3Y A;  2H8V A;  3B88 A;  3V2L A;  2QEH A;  4FQT A;  1TWO A;  1XFR A;  3R1O A;  1GM0 A;  3D73 A;  1LS8 A;  2WCH A;  2QEV A;  4INX A;  3PJI A;  3D77 A;  3QME A;  3BFA A;  3CZ1 A;  3S0E A;  2QEB A;  2L2C A;  2WCJ A;  3BFB A;  3BJH A;  2WC5 A;  3B86 A;  3D78 A;  2GTE A;  3S0B A;  2WCK A;  3DXL A;  2PQL A;  2QEO A;  3S0F A;  3CAB A;  3B87 A;  3Q8I A;  1OW4 A;  3CZ2 A;  3D76 A;  3L4L A;  3NHI A;  2P71 A;  3DZT A;  3K1E A;  1OOI X;  2WCM A;  1TUJ A;  2WCL A;  3OGN A;  3DYE A;  4INW A;  1ORG A;  1QWV A;  1OOG A;  3FE8 A;  4F7F A;  5DIC A;  3D75 A;  2WC6 A;  2QDI A;  3DY9 A;  3R72 A;  1P28 A;  1C3Z A;  3R1V A;  1OOF A;  1T14 A;  4PT1 A;  3FE9 A;  3VB1 A;  3S0A A;  3S0D A;  3CDN A;  3R1P A;  3B7A A;  1DQE A;  3CZ0 A;  1OOH A;  3S0G A;  3RZS A;  3NGV A;  3NHT A;  3B6X A;  2JPO A;  3BFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...