2H8VA

Structure of empty pheromone binding protein asp1 from the honeybee apis mellifera l
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Conformational Changes of the Pheromone Binding Protein ASP1 from the Honeybee Apis mellifera L upon Ligand Binding
rcsb
source organism Apis mellifera
molecule tags Transport protein
total genus 42
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2006-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2h8vA00
2WCMA 3D77A 1OW4A 1TUJA 2QEOA 3S0FA 1TWOA 3QMEA 3DY9A 3CZ2A 3S0AA 1C3ZA 3L4LA 3N7HA 3L47A 3D76A 5DICA 2WC5A 3K1EA 3Q8IA 2L2CA 2P70A 2QEVA 4PT1A 2WC6A 1OOGA 2WCHA 3B7AA 3BFBA 3BFAA 3D75A 2WCKA 2QEHA 2JPOA 3S0EA 3BFHA 2WCJA 3NHIA 1DQEA 3S0DA 2P71A 4INWA 3DYEA 3S0GA 2ERBA 3CYZA 4JD9A 3D78A 3B86A 1QWVA 3B6XA 3R1PA 3S0BA 3FE9A 1OOFA 1LS8A 2H8VA 3VB1A 2QEBA 3L4AA 1GM0A 3B88A 3R72A 1OOHA 1P28A 3DZTA 2WCLA 3FE8A 3DXLA 3BJHA 3V2LA 3NHTA 3NGVA 3FE6A 4FQTA 1OOIX 4INXA 2QDIA 3B87A 2PQLA 4OZDA 3OGNA 1T14A 1XFRA 3R1VA 3RZSA 3CZ0A 5EL2A 1ORGA 2GTEA 4F7FA 3CDNA 3R1OA 1C3YA 3D74A 3PJIA 3D73A 2KPHA 3CZ1A 3CABA 2FJYA
chains in the Genus database with same CATH superfamily
4GGFC 2VRGA 5I2QA 2WCMA 4CIDA 3RLZA 1CNPA 2M1KB 3SG4A 3LK1A 1F4OA 1Z2CB 1NCZA 5DKRA 2LP3A 2ZNDA 1GGZA 4QJ3B 1ODBA 1JBAA 1ALWA 1QV0A 5IBWA 2H61C 3CZ2A 1M45A 1W7JB 1KFUS 1JUOA 1KSMA 3S0AA 1ZFSA 1XA5A 1TNPA 1C7WA 2LMVA 1PULA 1S26D 1SL9A 2HF5A 5KSZA 1C3ZA 3I5GB 1CLLA 3L4LA 5ER5A 3E3RA 2EC6B 1A2XA 1B8RA 1QX5B 2IS9A 1OOJA 5DICA 3TS5B 1J7RA 3K1EA 2PMYA 3CS1A 1CDNA 2FCEA 1OMVA 3GK4X 1QATA 3NXAA 2CTNA 1CFPA 3B7AA 2I7AA 1D1OA 1PSBA 1OMDA 1XFZO 3PN7B 1FF1A 4GPLB 2MJWB 3EVVA 2JQ6A 2K2FA 2WCKA 4MN0A 1NWDA 1SYMA 3OB1B 1TUZA 1CDLA 1NP8A 2B1UA 1B7TZ 4PHNA 5AXIA 3JTDB 1KQMB 4QJ5B 4MLWA 1YUTA 3I5FB 2K0JA 2KI4C 1DJXA 1Y1UA 3S0DA 1AK8A 1MXLC 3DYEA 1N0YA 4WRIA 3S0GA 4CFQA 5I2LA 4M2PA 3A8RA 2KAXA 3BOWA 4ZCUA 1K96A 1KFXS 3TUYC 2I2RE 3HX4A 3I5IB 3NSLA 1S5GZ 1SR6B 2WORA 2Y1MA 1QLKA 3KF9A 1WLMA 5F6TA 2KI6C 5J3XA 2LVIA 2LUXA 2K7OA 1GM0A 1QVIZ 1SPYA 1CB1A 1IGVA 3O2PA 1OOHA 1SKTA 4GBAA 2L4IA 2WCLA 4L9MA 1XFVO 3IQQA 1PVAA 1Z4HA 4DUQA 2Y5IA 3CR5X 2F3YA 3SG7A 1X02A 3WHTB 4FQTA 4PCWA 2P6BB 2K7DA 3IF7A 2COLB 2NLNA 1SL7A 4INXA 3BQ3A 2QDIA 1Y6WA 2JU0A 3F45A 2KFGA 3CR4X 1KK7Y 3SS3A 2L51A 3OGNA 1ALVA 5G08A 3SS4A 1XFRA 1C07A 3R1VA 4N1FA 1TNWA 2ZRTA 1TCFA 3CLNA 3VRNA 2GTEA 2K61A 2I94A 2EHBA 2LCPA 3O78A 2I18A 3LLEA 1SCMC 5KTYA 1IQ3A 1PRWA 3PLFB 2KFFA 3CDNA 4P2YB 4WQ3A 3WXAA 1L2OC 1F71A 2LP2A 2M97A 1QIVA 4YI9A 5DKQA 2BE4A 4OR9B 3PJIA 1KWOC 2KHNA 1GJYA 1RK9A 2M3WA 1XK4C 2KPHA 2F2OA 3PM8A 1HQVA 2KLEA 4ZCVA 2D8NA 3NSOA 3OHMB 1AVSA 4GGFA 2JT3A 4MEWA 1SRAA 2JT8A 1KFUL 3D77A 3OX5A 5CSJA 1NX1A 3BOWB 2JOJA 2NCOA 1SK6D 1YUSA 2QEOA 3PM2A 1UHNA 3HCMA 1TWOA 4CFRA 1TTXA 3S0FA 2H61A 1B4CA 3WHUB 4MSPA 1IIOA 1CDMA 5DKNA 1TNXA 4MZLA 1LINA 1H8BA 3BXKA 3N7HA 1XVJA 1F4QA 5HL1A 1IKUA 1LXFC 1TOPA 3SIAA 3O4XA 1EL4A 1UHHA 4OKHA 2WC5A 2KBMA 2V53A 4AQIA 4GAOA 5FI7A 2P70A 2QEVA 3OBVA 1YTZC 3EVRA 4PT1A 3BFBA 1LKJA 3VGOA 1OE9B 1MXEA 1M31A 1YX7A 3OP0A 4YGAA 4PE4A 3D75A 3M0WA 1KQVA 2LVKA 3I5GC 1CLMA 1LVCD 1QTXA 4YI8A 5HKZA 2OTGB 1YUUA 3SG3A 3ZNIA 1DEKA 1TNQA 2PALA 1YRUB 4M2OA 1DJIA 3LCPC 2JRFA 4XJKA 1FPWA 1B8CA 2JTZA 1DQEA 3H4SE 1WRKA 5D3OA 3PN7C 2H2KA 3SG5A 2F8PA 1IG5A 1V1GA 2LVJA 1NX3A 4JD9A 3D78A 3EK8A 4A4CA 3DVKA 1QWVA 5HKWA 2ZNEA 1L7ZA 5CSIA 1BOCA 4Q04A 3B6XA 2MLEC 1S6JA 3FE9A 3DVMA 3O6BA 1ZMZA 4FTGA 3SG2A 2L98A 2QEBA 4PDZA 2M49B 3DD4A 3L4AA 1K2HA 2NZ0A 3I5FC 5TNCA 2BL0B 1F55A 3I5HB 1RJVA 2WCFA 4OV2A 1WY9A 2Y1NA 3PALA 4OCIA 2OS8C 3B88A 1LA3A 4D1EA 2MRDA 1R6PA 3ZWHA 3EK7A 1XFXO 2LMTA 1TCOB 3I5IC 1UHIA 3BUWB 3FE8A 3SIBA 2F33A 1YVHA 1J1DA 2BKHB 2E30A 3V2LA 3FWBA 1QX7A 1MWNA 1NYAA 4PHKA 4YGEB 4N5XA 3FE6A 2FOTA 1K90D 5AFPA 2YGUA 1ZOTB 1BJFA 1QS7A 1DJGA 2BNXA 3B87A 4GNKB 3O4YA 1UP5A 2G2BA 3VRPA 4TNCA 3RZSA 3CZ0A 2MA2A 1XFUO 2ZN9A 1K8UA 1SNLA 4I5KA 3KHEA 1SCVA 1MR8A 3CZTX 2PASA 5AANA 2PSRA 1XO5A 2FCDA 4IL1A 1IH0A 2JXCA 3D73A 3RM1A 1FBVA 1EJ3A 3CZ1A 4XJKB 2BECA 1Y1XA 4MVFA 4N1GA 1JC2A 1PALA 2KI4B 2SCPA 3CABA 3FIAA 3ICBA 2F3ZA 1B47A 2LHLA 3JVTC 3DVEA 1IQ5A 1TUJA 4BY4A 5I2OA 4QJ4B 4DRWA 3TUYB 1DJZA 1XFYO 3OX6A 3SS5A 2WNDA 2JTTA 3DY9A 1B9AA 5PALA 4HREE 4BY5A 1S36A 2LE9B 4NDBA 2O5GA 1SL8A 2CCMA 2Y4QA 1OSAA 1AUIB 3AAJA 1A75A 3AKAA 2FJUB 4GUKA 5CSFA 1QIWA 2ZFDA 2LHIA 4C0LA 1WDCB 1NUBA 3PSRA 2HQ8A 2LANA 1H4BA 1AP4A 1UUSA 1SMGA 3Q8IA 1KK7Z 2L2CA 1DJWA 2GGZA 4MRXA 4U8DA 3UNWA 1BR1B 3EK4A 2Q4UA 1OOGA 2LC5A 3IVTA 3NSIA 4I5LB 4MBEA 4WQ2A 5D7FA 1JF2A 3BFAA 4M2QA 1ZACA 1HT9A 5AERA 1BR4B 2LMUA 3SJSA 3GOFA 2QEHA 1QXPA 1TRFA 2PYQA 2KBIA 3AKBA 1K94A 2JC2A 2LV7A 3DF0A 4JKTA 2DOQA 2HPSA 4OVNF 1XYDA 2QACA 3D10A 2L5XB 5FI6A 2BCXA 1YR5A 4PE7A 2L4HA 2PVBA 1BMOA 1G4YR 2RGIA 4MZKA 3S0EA 2WCJA 4JQ0D 4CPVA 2WOSA 1RWYA 5JJGA 1SW8A 2K2AA 2P71A 1PK0D 1NIWA 2LLSA 3GK1A 2ERBA 3PFVA 3EKHA 1S3PA 2KQYA 1SCMB 3EG5B 4ORCB 5CPVA 1A4PA 2CXJA 1L2OB 2F2PA 2KI6D 1K95A 1JSAA 2HETA 1DJYA 1K9KA 2K60A 1CKKA 1AHRA 1RROA 4UPGA 1KK8B 1OOFA 2L50A 2H8VA 1MUXA 3CTNA 2M7LA 2BBNA 2OPOA 3KEVA 3VB1A 1CMGA 2ZN8A 1JWDA 2K7CA 5ER4X 4CLNA 4HRHA 1BG1A 4JPZB 2EC6C 2KAYA 5I94A 1WRLA 1WRZA 1CFFA 1DGVA 2K7BA 1DELA 1A29A 3TS5C 1S6IA 2AUCA 3R72A 5HKYA 1F54A 4MRYA 1UHKA 1U5IA 4DIRA 3DZTA 1SBJA 4C0KA 3AAKA 2KYCA 1C7VA 2LLTA 2SASA 3DXLA 1KFXL 1OZOA 2G9BA 3KPXA 1B8LA 1LA0A 2L0PA 2MAZA 3NGVA 3BUOB 1GGWA 2A4JA 2M9GA 5AEQA 5GQQC 4JWQA 5HLOA 4USLA 2BL0C 4KYNA 3NSKA 3QRXA 1J7OA 1A75B 2BCAA 3FS7A 1NX0A 1Y0VH 2HQWA 4ETOA 1CDPA 2PQLA 3TDZA 3JTDC 1BODA 2O60A 1KQMC 4OZDA 1PSRA 1G8IA 1T14A 3K21A 4ORBB 1FW4A 1SSEB 2CBLA 1K9PA 4FQOA 1DF0A 1ORGA 1BF5A 1BLQA 2MLFC 3EKJA 1CMFA 1CM1A 1CLBA 2WC8A 5HYDA 1DJHA 1FI5A 2KGBC 2JZIA 3MSEB 2K8MB 4F7FA 1EH2A 1PVBA 2BCBA 3DF0B 2KAVA 1YURA 1SR6C 1EXRA 3GK2A 1S6CA 1B7TY 4MZJA 3D74A 4PE0A 1B1GA 2KYFA 3TDUA 4P5OE 2JWWA 1NCYA 1QV1A 1OMRA 4YBHB 5CSNA 3PATA 5FYXA 1CFCA 1JF0A 2FJYA 1DVIA 1G33A 3LK0A 4YGBB 2M29A 1OW4A 4NQGA 1S5GY 2KQ6A 3SG6A 3CGAA 3EVUA 5K89A 3LL8B 1NSHA 2BBMA 1RFJA 3BUNB 3QMEA 2ISDA 1KSOA 2JT0A 2L5YA 2WCEA 3D0YA 4IJ7A 4NDDA 1M63B 2AMIA 1F70A 2M0RA 1QVIY 5I8NA 2M8UA 3L47A 2M1UA 3BUMB 3WNXB 3D76A 2OS8B 1IJ5A 1N65A 1QLSA 3A4UB 1XK4A 2Q91A 3TDIA 1E8AA 2BE6A 4PHMA 1CTRA 1U5IB 1QJTA 5JOLA 1M39A 4AOMA 4C0JA 2WC6A 1F8HA 2CT9A 2WCHA 4R1EA 1W7IB 4XYNA 2L2EA 2NXQA 2LUCA 2KSPA 1EG3A 2R2IA 2MHHA 1IJ6A 1K93D 1SY9A 1Q80A 2TN4A 1W9ZA 1RECA 2E6WA 1WDCC 1UWOA 2BAPA 1CFDA 2JPOA 4F0ZB 2ZKMX 3BFHA 3NHIA 3VROA 4ICBA 4I5NB 1QASA 4A4BA 2QPTA 1TIZA 1OQPA 3KO0A 3OB2B 5BPJA 4INWA 1DF0B 1GQMA 4PALA 3CYZA 1UURA 2LM5A 2LLUA 3B86A 1JFJA 1DTLA 3R1PA 1YRTB 3S0BA 5B8IB 1A03A 3DVJA 1Y1AA 1LS8A 1YX8A 1KCYA 2M7NA 4HRGA 2PRUA 2JULA 3CR2A 3VRQA 1J1EA 5FI2A 2BKIB 4YGDB 3JVTB 1P28A 2KLDA 5D69A 1J7PA 1UHJA 2LNKA 1NX2A 3FWCA 1DC1A 1DMOA 4PHJA 4DCKA 3BJHA 2JNFA 2KFHA 4YGCB 1KK8C 3NHTA 2KOTA 1MF8B 1YVLA 1AJ4A 1JFKA 4PE1A 3D0YB 1RTP1 2OTGC 1IRJA 3UO9A 1NPQA 3CWGA 1R2UA 2ZRSA 3TZ1A 1OOIX 1CM4A 1V1FA 1J7QA 2LAPA 4YRUA 4GGNA 1XFWO 4E68A 1KWOB 2NCPA 4ORAB 1DT7B 1WLZA 2EGDA 2KGRA 2KNEA 3C1VA 2MBXA 1VRKA 1BU3A 2JPTA 4NDCA 2GV5A 5HLVA 5EL2A 2AAOA 1EG4A 1TN4A 1J55A 1BT6A 2JXLA 1AJ5A 3BYAA 1QX2A 3R1OA 1C3YA 2CNPA 2KDHA 2GGMA 2LVVA 3BUXB 1NCXA 1S1EA 1IWQA 4AQJA 2WCBA 1K9UA 1M46A 1MHOA 3IQOA 3VRRA 1ZUZA 4GFTA 1N2DA 4HSZA 1MQ1A 3I5HC 1DGUA 1OZSA 4DS7A 2JNXA 4I5JA 1FI6A 5KU1A
chains in the Genus database with same CATH topology
2WCMA 3D77A 1OW4A 1TUJA 2QEOA 3S0FA 1TWOA 3QMEA 3DY9A 3CZ2A 3S0AA 1C3ZA 3L4LA 3N7HA 3L47A 3D76A 5DICA 2WC5A 3K1EA 3Q8IA 2L2CA 2P70A 2QEVA 4PT1A 2WC6A 1OOGA 2WCHA 3B7AA 3BFBA 3BFAA 3D75A 2WCKA 2QEHA 2JPOA 3S0EA 3BFHA 2WCJA 3NHIA 1DQEA 3S0DA 2P71A 4INWA 3DYEA 3S0GA 2ERBA 3CYZA 4JD9A 3D78A 3B86A 1QWVA 3B6XA 3R1PA 3S0BA 3FE9A 1OOFA 1LS8A 2H8VA 3VB1A 2QEBA 3L4AA 1GM0A 3B88A 3R72A 1OOHA 1P28A 3DZTA 2WCLA 3FE8A 3DXLA 3BJHA 3V2LA 3NHTA 3NGVA 3FE6A 4FQTA 1OOIX 4INXA 2QDIA 3B87A 2PQLA 4OZDA 3OGNA 1T14A 1XFRA 3R1VA 3RZSA 3CZ0A 5EL2A 1ORGA 2GTEA 4F7FA 3CDNA 3R1OA 1C3YA 3D74A 3PJIA 3D73A 2KPHA 3CZ1A 3CABA 2FJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCM A;  3D77 A;  1OW4 A;  1TUJ A;  2QEO A;  3S0F A;  1TWO A;  3QME A;  3DY9 A;  3CZ2 A;  3S0A A;  1C3Z A;  3L4L A;  3N7H A;  3L47 A;  3D76 A;  5DIC A;  2WC5 A;  3K1E A;  3Q8I A;  2L2C A;  2P70 A;  2QEV A;  4PT1 A;  2WC6 A;  1OOG A;  2WCH A;  3B7A A;  3BFB A;  3BFA A;  3D75 A;  2WCK A;  2QEH A;  2JPO A;  3S0E A;  3BFH A;  2WCJ A;  3NHI A;  1DQE A;  3S0D A;  2P71 A;  4INW A;  3DYE A;  3S0G A;  2ERB A;  3CYZ A;  4JD9 A;  3D78 A;  3B86 A;  1QWV A;  3B6X A;  3R1P A;  3S0B A;  3FE9 A;  1OOF A;  1LS8 A;  2H8V A;  3VB1 A;  2QEB A;  3L4A A;  1GM0 A;  3B88 A;  3R72 A;  1OOH A;  1P28 A;  3DZT A;  2WCL A;  3FE8 A;  3DXL A;  3BJH A;  3V2L A;  3NHT A;  3NGV A;  3FE6 A;  4FQT A;  1OOI X;  4INX A;  2QDI A;  3B87 A;  2PQL A;  4OZD A;  3OGN A;  1T14 A;  1XFR A;  3R1V A;  3RZS A;  3CZ0 A;  5EL2 A;  1ORG A;  2GTE A;  4F7F A;  3CDN A;  3R1O A;  1C3Y A;  3D74 A;  3PJI A;  3D73 A;  2KPH A;  3CZ1 A;  3CAB A;  2FJY A; 
#chains in the Genus database with same CATH topology
 4GGF C;  2VRG A;  5I2Q A;  2WCM A;  4CID A;  3RLZ A;  1CNP A;  2M1K B;  3SG4 A;  3LK1 A;  1F4O A;  1Z2C B;  1NCZ A;  5DKR A;  2LP3 A;  2ZND A;  1GGZ A;  4QJ3 B;  1ODB A;  1JBA A;  1ALW A;  1QV0 A;  5IBW A;  2H61 C;  3CZ2 A;  1M45 A;  1W7J B;  1KFU S;  1JUO A;  1KSM A;  3S0A A;  1ZFS A;  1XA5 A;  1TNP A;  1C7W A;  2LMV A;  1PUL A;  1S26 D;  1SL9 A;  2HF5 A;  5KSZ A;  1C3Z A;  3I5G B;  1CLL A;  3L4L A;  5ER5 A;  3E3R A;  2EC6 B;  1A2X A;  1B8R A;  1QX5 B;  2IS9 A;  1OOJ A;  5DIC A;  3TS5 B;  1J7R A;  3K1E A;  2PMY A;  3CS1 A;  1CDN A;  2FCE A;  1OMV A;  3GK4 X;  1QAT A;  3NXA A;  2CTN A;  1CFP A;  3B7A A;  2I7A A;  1D1O A;  1PSB A;  1OMD A;  1XFZ O;  3PN7 B;  1FF1 A;  4GPL B;  2MJW B;  3EVV A;  2JQ6 A;  2K2F A;  2WCK A;  4MN0 A;  1NWD A;  1SYM A;  3OB1 B;  1TUZ A;  1CDL A;  1NP8 A;  2B1U A;  1B7T Z;  4PHN A;  5AXI A;  3JTD B;  1KQM B;  4QJ5 B;  4MLW A;  1YUT A;  3I5F B;  2K0J A;  2KI4 C;  1DJX A;  1Y1U A;  3S0D A;  1AK8 A;  1MXL C;  3DYE A;  1N0Y A;  4WRI A;  3S0G A;  4CFQ A;  5I2L A;  4M2P A;  3A8R A;  2KAX A;  3BOW A;  4ZCU A;  1K96 A;  1KFX S;  3TUY C;  2I2R E;  3HX4 A;  3I5I B;  3NSL A;  1S5G Z;  1SR6 B;  2WOR A;  2Y1M A;  1QLK A;  3KF9 A;  1WLM A;  5F6T A;  2KI6 C;  5J3X A;  2LVI A;  2LUX A;  2K7O A;  1GM0 A;  1QVI Z;  1SPY A;  1CB1 A;  1IGV A;  3O2P A;  1OOH A;  1SKT A;  4GBA A;  2L4I A;  2WCL A;  4L9M A;  1XFV O;  3IQQ A;  1PVA A;  1Z4H A;  4DUQ A;  2Y5I A;  3CR5 X;  2F3Y A;  3SG7 A;  1X02 A;  3WHT B;  4FQT A;  4PCW A;  2P6B B;  2K7D A;  3IF7 A;  2COL B;  2NLN A;  1SL7 A;  4INX A;  3BQ3 A;  2QDI A;  1Y6W A;  2JU0 A;  3F45 A;  2KFG A;  3CR4 X;  1KK7 Y;  3SS3 A;  2L51 A;  3OGN A;  1ALV A;  5G08 A;  3SS4 A;  1XFR A;  1C07 A;  3R1V A;  4N1F A;  1TNW A;  2ZRT A;  1TCF A;  3CLN A;  3VRN A;  2GTE A;  2K61 A;  2I94 A;  2EHB A;  2LCP A;  3O78 A;  2I18 A;  3LLE A;  1SCM C;  5KTY A;  1IQ3 A;  1PRW A;  3PLF B;  2KFF A;  3CDN A;  4P2Y B;  4WQ3 A;  3WXA A;  1L2O C;  1F71 A;  2LP2 A;  2M97 A;  1QIV A;  4YI9 A;  5DKQ A;  2BE4 A;  4OR9 B;  3PJI A;  1KWO C;  2KHN A;  1GJY A;  1RK9 A;  2M3W A;  1XK4 C;  2KPH A;  2F2O A;  3PM8 A;  1HQV A;  2KLE A;  4ZCV A;  2D8N A;  3NSO A;  3OHM B;  1AVS A;  4GGF A;  2JT3 A;  4MEW A;  1SRA A;  2JT8 A;  1KFU L;  3D77 A;  3OX5 A;  5CSJ A;  1NX1 A;  3BOW B;  2JOJ A;  2NCO A;  1SK6 D;  1YUS A;  2QEO A;  3PM2 A;  1UHN A;  3HCM A;  1TWO A;  4CFR A;  1TTX A;  3S0F A;  2H61 A;  1B4C A;  3WHU B;  4MSP A;  1IIO A;  1CDM A;  5DKN A;  1TNX A;  4MZL A;  1LIN A;  1H8B A;  3BXK A;  3N7H A;  1XVJ A;  1F4Q A;  5HL1 A;  1IKU A;  1LXF C;  1TOP A;  3SIA A;  3O4X A;  1EL4 A;  1UHH A;  4OKH A;  2WC5 A;  2KBM A;  2V53 A;  4AQI A;  4GAO A;  5FI7 A;  2P70 A;  2QEV A;  3OBV A;  1YTZ C;  3EVR A;  4PT1 A;  3BFB A;  1LKJ A;  3VGO A;  1OE9 B;  1MXE A;  1M31 A;  1YX7 A;  3OP0 A;  4YGA A;  4PE4 A;  3D75 A;  3M0W A;  1KQV A;  2LVK A;  3I5G C;  1CLM A;  1LVC D;  1QTX A;  4YI8 A;  5HKZ A;  2OTG B;  1YUU A;  3SG3 A;  3ZNI A;  1DEK A;  1TNQ A;  2PAL A;  1YRU B;  4M2O A;  1DJI A;  3LCP C;  2JRF A;  4XJK A;  1FPW A;  1B8C A;  2JTZ A;  1DQE A;  3H4S E;  1WRK A;  5D3O A;  3PN7 C;  2H2K A;  3SG5 A;  2F8P A;  1IG5 A;  1V1G A;  2LVJ A;  1NX3 A;  4JD9 A;  3D78 A;  3EK8 A;  4A4C A;  3DVK A;  1QWV A;  5HKW A;  2ZNE A;  1L7Z A;  5CSI A;  1BOC A;  4Q04 A;  3B6X A;  2MLE C;  1S6J A;  3FE9 A;  3DVM A;  3O6B A;  1ZMZ A;  4FTG A;  3SG2 A;  2L98 A;  2QEB A;  4PDZ A;  2M49 B;  3DD4 A;  3L4A A;  1K2H A;  2NZ0 A;  3I5F C;  5TNC A;  2BL0 B;  1F55 A;  3I5H B;  1RJV A;  2WCF A;  4OV2 A;  1WY9 A;  2Y1N A;  3PAL A;  4OCI A;  2OS8 C;  3B88 A;  1LA3 A;  4D1E A;  2MRD A;  1R6P A;  3ZWH A;  3EK7 A;  1XFX O;  2LMT A;  1TCO B;  3I5I C;  1UHI A;  3BUW B;  3FE8 A;  3SIB A;  2F33 A;  1YVH A;  1J1D A;  2BKH B;  2E30 A;  3V2L A;  3FWB A;  1QX7 A;  1MWN A;  1NYA A;  4PHK A;  4YGE B;  4N5X A;  3FE6 A;  2FOT A;  1K90 D;  5AFP A;  2YGU A;  1ZOT B;  1BJF A;  1QS7 A;  1DJG A;  2BNX A;  3B87 A;  4GNK B;  3O4Y A;  1UP5 A;  2G2B A;  3VRP A;  4TNC A;  3RZS A;  3CZ0 A;  2MA2 A;  1XFU O;  2ZN9 A;  1K8U A;  1SNL A;  4I5K A;  3KHE A;  1SCV A;  1MR8 A;  3CZT X;  2PAS A;  5AAN A;  2PSR A;  1XO5 A;  2FCD A;  4IL1 A;  1IH0 A;  2JXC A;  3D73 A;  3RM1 A;  1FBV A;  1EJ3 A;  3CZ1 A;  4XJK B;  2BEC A;  1Y1X A;  4MVF A;  4N1G A;  1JC2 A;  1PAL A;  2KI4 B;  2SCP A;  3CAB A;  3FIA A;  3ICB A;  2F3Z A;  1B47 A;  2LHL A;  3JVT C;  3DVE A;  1IQ5 A;  1TUJ A;  4BY4 A;  5I2O A;  4QJ4 B;  4DRW A;  3TUY B;  1DJZ A;  1XFY O;  3OX6 A;  3SS5 A;  2WND A;  2JTT A;  3DY9 A;  1B9A A;  5PAL A;  4HRE E;  4BY5 A;  1S36 A;  2LE9 B;  4NDB A;  2O5G A;  1SL8 A;  2CCM A;  2Y4Q A;  1OSA A;  1AUI B;  3AAJ A;  1A75 A;  3AKA A;  2FJU B;  4GUK A;  5CSF A;  1QIW A;  2ZFD A;  2LHI A;  4C0L A;  1WDC B;  1NUB A;  3PSR A;  2HQ8 A;  2LAN A;  1H4B A;  1AP4 A;  1UUS A;  1SMG A;  3Q8I A;  1KK7 Z;  2L2C A;  1DJW A;  2GGZ A;  4MRX A;  4U8D A;  3UNW A;  1BR1 B;  3EK4 A;  2Q4U A;  1OOG A;  2LC5 A;  3IVT A;  3NSI A;  4I5L B;  4MBE A;  4WQ2 A;  5D7F A;  1JF2 A;  3BFA A;  4M2Q A;  1ZAC A;  1HT9 A;  5AER A;  1BR4 B;  2LMU A;  3SJS A;  3GOF A;  2QEH A;  1QXP A;  1TRF A;  2PYQ A;  2KBI A;  3AKB A;  1K94 A;  2JC2 A;  2LV7 A;  3DF0 A;  4JKT A;  2DOQ A;  2HPS A;  4OVN F;  1XYD A;  2QAC A;  3D10 A;  2L5X B;  5FI6 A;  2BCX A;  1YR5 A;  4PE7 A;  2L4H A;  2PVB A;  1BMO A;  1G4Y R;  2RGI A;  4MZK A;  3S0E A;  2WCJ A;  4JQ0 D;  4CPV A;  2WOS A;  1RWY A;  5JJG A;  1SW8 A;  2K2A A;  2P71 A;  1PK0 D;  1NIW A;  2LLS A;  3GK1 A;  2ERB A;  3PFV A;  3EKH A;  1S3P A;  2KQY A;  1SCM B;  3EG5 B;  4ORC B;  5CPV A;  1A4P A;  2CXJ A;  1L2O B;  2F2P A;  2KI6 D;  1K95 A;  1JSA A;  2HET A;  1DJY A;  1K9K A;  2K60 A;  1CKK A;  1AHR A;  1RRO A;  4UPG A;  1KK8 B;  1OOF A;  2L50 A;  2H8V A;  1MUX A;  3CTN A;  2M7L A;  2BBN A;  2OPO A;  3KEV A;  3VB1 A;  1CMG A;  2ZN8 A;  1JWD A;  2K7C A;  5ER4 X;  4CLN A;  4HRH A;  1BG1 A;  4JPZ B;  2EC6 C;  2KAY A;  5I94 A;  1WRL A;  1WRZ A;  1CFF A;  1DGV A;  2K7B A;  1DEL A;  1A29 A;  3TS5 C;  1S6I A;  2AUC A;  3R72 A;  5HKY A;  1F54 A;  4MRY A;  1UHK A;  1U5I A;  4DIR A;  3DZT A;  1SBJ A;  4C0K A;  3AAK A;  2KYC A;  1C7V A;  2LLT A;  2SAS A;  3DXL A;  1KFX L;  1OZO A;  2G9B A;  3KPX A;  1B8L A;  1LA0 A;  2L0P A;  2MAZ A;  3NGV A;  3BUO B;  1GGW A;  2A4J A;  2M9G A;  5AEQ A;  5GQQ C;  4JWQ A;  5HLO A;  4USL A;  2BL0 C;  4KYN A;  3NSK A;  3QRX A;  1J7O A;  1A75 B;  2BCA A;  3FS7 A;  1NX0 A;  1Y0V H;  2HQW A;  4ETO A;  1CDP A;  2PQL A;  3TDZ A;  3JTD C;  1BOD A;  2O60 A;  1KQM C;  4OZD A;  1PSR A;  1G8I A;  1T14 A;  3K21 A;  4ORB B;  1FW4 A;  1SSE B;  2CBL A;  1K9P A;  4FQO A;  1DF0 A;  1ORG A;  1BF5 A;  1BLQ A;  2MLF C;  3EKJ A;  1CMF A;  1CM1 A;  1CLB A;  2WC8 A;  5HYD A;  1DJH A;  1FI5 A;  2KGB C;  2JZI A;  3MSE B;  2K8M B;  4F7F A;  1EH2 A;  1PVB A;  2BCB A;  3DF0 B;  2KAV A;  1YUR A;  1SR6 C;  1EXR A;  3GK2 A;  1S6C A;  1B7T Y;  4MZJ A;  3D74 A;  4PE0 A;  1B1G A;  2KYF A;  3TDU A;  4P5O E;  2JWW A;  1NCY A;  1QV1 A;  1OMR A;  4YBH B;  5CSN A;  3PAT A;  5FYX A;  1CFC A;  1JF0 A;  2FJY A;  1DVI A;  1G33 A;  3LK0 A;  4YGB B;  2M29 A;  1OW4 A;  4NQG A;  1S5G Y;  2KQ6 A;  3SG6 A;  3CGA A;  3EVU A;  5K89 A;  3LL8 B;  1NSH A;  2BBM A;  1RFJ A;  3BUN B;  3QME A;  2ISD A;  1KSO A;  2JT0 A;  2L5Y A;  2WCE A;  3D0Y A;  4IJ7 A;  4NDD A;  1M63 B;  2AMI A;  1F70 A;  2M0R A;  1QVI Y;  5I8N A;  2M8U A;  3L47 A;  2M1U A;  3BUM B;  3WNX B;  3D76 A;  2OS8 B;  1IJ5 A;  1N65 A;  1QLS A;  3A4U B;  1XK4 A;  2Q91 A;  3TDI A;  1E8A A;  2BE6 A;  4PHM A;  1CTR A;  1U5I B;  1QJT A;  5JOL A;  1M39 A;  4AOM A;  4C0J A;  2WC6 A;  1F8H A;  2CT9 A;  2WCH A;  4R1E A;  1W7I B;  4XYN A;  2L2E A;  2NXQ A;  2LUC A;  2KSP A;  1EG3 A;  2R2I A;  2MHH A;  1IJ6 A;  1K93 D;  1SY9 A;  1Q80 A;  2TN4 A;  1W9Z A;  1REC A;  2E6W A;  1WDC C;  1UWO A;  2BAP A;  1CFD A;  2JPO A;  4F0Z B;  2ZKM X;  3BFH A;  3NHI A;  3VRO A;  4ICB A;  4I5N B;  1QAS A;  4A4B A;  2QPT A;  1TIZ A;  1OQP A;  3KO0 A;  3OB2 B;  5BPJ A;  4INW A;  1DF0 B;  1GQM A;  4PAL A;  3CYZ A;  1UUR A;  2LM5 A;  2LLU A;  3B86 A;  1JFJ A;  1DTL A;  3R1P A;  1YRT B;  3S0B A;  5B8I B;  1A03 A;  3DVJ A;  1Y1A A;  1LS8 A;  1YX8 A;  1KCY A;  2M7N A;  4HRG A;  2PRU A;  2JUL A;  3CR2 A;  3VRQ A;  1J1E A;  5FI2 A;  2BKI B;  4YGD B;  3JVT B;  1P28 A;  2KLD A;  5D69 A;  1J7P A;  1UHJ A;  2LNK A;  1NX2 A;  3FWC A;  1DC1 A;  1DMO A;  4PHJ A;  4DCK A;  3BJH A;  2JNF A;  2KFH A;  4YGC B;  1KK8 C;  3NHT A;  2KOT A;  1MF8 B;  1YVL A;  1AJ4 A;  1JFK A;  4PE1 A;  3D0Y B;  1RTP 1;  2OTG C;  1IRJ A;  3UO9 A;  1NPQ A;  3CWG A;  1R2U A;  2ZRS A;  3TZ1 A;  1OOI X;  1CM4 A;  1V1F A;  1J7Q A;  2LAP A;  4YRU A;  4GGN A;  1XFW O;  4E68 A;  1KWO B;  2NCP A;  4ORA B;  1DT7 B;  1WLZ A;  2EGD A;  2KGR A;  2KNE A;  3C1V A;  2MBX A;  1VRK A;  1BU3 A;  2JPT A;  4NDC A;  2GV5 A;  5HLV A;  5EL2 A;  2AAO A;  1EG4 A;  1TN4 A;  1J55 A;  1BT6 A;  2JXL A;  1AJ5 A;  3BYA A;  1QX2 A;  3R1O A;  1C3Y A;  2CNP A;  2KDH A;  2GGM A;  2LVV A;  3BUX B;  1NCX A;  1S1E A;  1IWQ A;  4AQJ A;  2WCB A;  1K9U A;  1M46 A;  1MHO A;  3IQO A;  3VRR A;  1ZUZ A;  4GFT A;  1N2D A;  4HSZ A;  1MQ1 A;  3I5H C;  1DGU A;  1OZS A;  4DS7 A;  2JNX A;  4I5J A;  1FI6 A;  5KU1 A; 
#chains in the Genus database with same CATH homology
 2WCM A;  3D77 A;  1OW4 A;  1TUJ A;  2QEO A;  3S0F A;  1TWO A;  3QME A;  3DY9 A;  3CZ2 A;  3S0A A;  1C3Z A;  3L4L A;  3N7H A;  3L47 A;  3D76 A;  5DIC A;  2WC5 A;  3K1E A;  3Q8I A;  2L2C A;  2P70 A;  2QEV A;  4PT1 A;  2WC6 A;  1OOG A;  2WCH A;  3B7A A;  3BFB A;  3BFA A;  3D75 A;  2WCK A;  2QEH A;  2JPO A;  3S0E A;  3BFH A;  2WCJ A;  3NHI A;  1DQE A;  3S0D A;  2P71 A;  4INW A;  3DYE A;  3S0G A;  2ERB A;  3CYZ A;  4JD9 A;  3D78 A;  3B86 A;  1QWV A;  3B6X A;  3R1P A;  3S0B A;  3FE9 A;  1OOF A;  1LS8 A;  2H8V A;  3VB1 A;  2QEB A;  3L4A A;  1GM0 A;  3B88 A;  3R72 A;  1OOH A;  1P28 A;  3DZT A;  2WCL A;  3FE8 A;  3DXL A;  3BJH A;  3V2L A;  3NHT A;  3NGV A;  3FE6 A;  4FQT A;  1OOI X;  4INX A;  2QDI A;  3B87 A;  2PQL A;  4OZD A;  3OGN A;  1T14 A;  1XFR A;  3R1V A;  3RZS A;  3CZ0 A;  5EL2 A;  1ORG A;  2GTE A;  4F7F A;  3CDN A;  3R1O A;  1C3Y A;  3D74 A;  3PJI A;  3D73 A;  2KPH A;  3CZ1 A;  3CAB A;  2FJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...