3CR2A

X-ray structure of bovine zn(2+),ca(2+)-s100b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Divalent metal ion complexes of S100B in the absence and presence of pentamidine.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 29
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cr2A00
4PE7A 2JNFA 1M45A 2AAOA 3FWBA 1AHRA 4XJKA 4XJKB 1CFDA 1SMGA 1B8CA 1F55A 1TOPA 5F6TA 2KQ6A 4M2QA 1AJ5A 4A4BA 2P6BB 4HSZA 2LMTA 1XYDA 1UWOA 2KSPA 1WDCC 2L4IA 1CDMA 4P5OE 2LVJA 1K8UA 1K95A 2GGMA 1IQ5A 1RFJA 1G4YR 1SBJA 3I5HB 4PE4A 2MRDA 2LMVA 1TNQA 3H4SE 4MZLA 3BOWA 1B9AA 3BOWB 1R2UA 2HETA 3A8RA 3PM8A 1NCZA 3JTDB 1J1EA 2F8PA 1JFJA 1QIWA 3OB1B 3GK1A 2Q91A 3ICBA 1DJHA 1PVBA 2WC8A 1XO5A 1YRTB 1A2XA 3CR5X 4YGBB 1IGVA 1NWDA 3BUWB 5HKWA 3SG3A 1KK8C 1ZFSA 4ICBA 4DUQA 1KSMA 3BUOB 4NDCA 1JC2A 5CSJA 2LC5A 2JTZA 4JQ0D 2BKHB 1WLMA 2KI6D 3CLNA 3O2PA 2KFHA 1TTXA 1IJ5A 1GGWA 2A4JA 2JPTA 1KCYA 2H2KA 3LCPC 4PALA 1V1GA 1LINA 1GGZA 1NCYA 3KEVA 1J7OA 1NCXA 1QX7A 5J3XA 1YR5A 2LVIA 1TCFA 1TNWA 2ISDA 1D1OA 2GV5A 2HF5A 1SR6C 1UHIA 2KBIA 3AAKA 2TN4A 3BUXB 2K0JA 4NQGA 1FBVA 1S5GY 2Y1MA 2L50A 2MAZA 3GK4X 3VGOA 1ALWA 3BQ3A 2L0PA 2LANA 1J55A 1DVIA 1CB1A 3EKJA 2KI6C 5I8NA 2F2OA 4ORCB 5I2OA 2EC6C 2WCEA 1TN4A 1S6CA 4I5LB 3TZ1A 4MRYA 2O60A 1M63B 3KF9A 1WRKA 2JNXA 4CPVA 2SCPA 1Y1UA 1XFVO 1ZMZA 1XFWO 2M9GA 1OZOA 3AAJA 4QJ4B 2GGZA 1IH0A 1Y1AA 1UP5A 1J7QA 3I5FB 1MQ1A 4N1GA 2QACA 1JFKA 3EKHA 2M3WA 3OP0A 3O78A 3AKBA 1YRUB 2BL0C 2M1UA 1DT7B 1JF2A 1QLKA 1SK6D 1UHKA 1Q80A 1QLSA 1IJ6A 1N2DA 3DD4A 2KI4B 2WORA 1CNPA 1IRJA 4DS7A 1RK9A 1SY9A 1UURA 2K2AA 2QPTA 1J1DA 5TNCA 4DRWA 1QX5B 2NCPA 1K90D 2E30A 3I5IB 2KOTA 3CZTX 3RM1A 5DKNA 1LXFC 2LHLA 2OS8C 5FYXA 1FPWA 1CKKA 3SG2A 1KSOA 1QV0A 3CTNA 5AEQA 3SG5A 1SL7A 1C7VA 3CR2A 3SIBA 2CBLA 3EVUA 3ZWHA 1L2OB 2NCOA 2LVKA 1TRFA 1F4OA 1VRKA 2VRGA 5CSIA 4C0LA 1OZSA 3IQQA 5IBWA 1OOJA 1KFUL 1DGVA 4ORAB 3FIAA 3IQOA 5BPJA 2LVVA 2WCFA 4N1FA 2KDHA 2LLTA 3JVTB 1EJ3A 1W7IB 4M2PA 3NSKA 3GK2A 3D10A 2K2FA 5CSNA 2ZNEA 3I5GC 3EVRA 3KO0A 1J7RA 4GUKA 1XK4C 2M29A 1DJWA 1NSHA 1OMVA 1SL9A 3PN7C 1B7TY 1AUIB 1CTRA 2BCAA 2PRUA 2L51A 4TNCA 5DKRA 3SG7A 1H8BA 3BXKA 1ODBA 1KWOC 2BBMA 4MRXA 1SCMB 4R1EA 1CFFA 1SRAA 2K7CA 2CCMA 5ER5A 3C1VA 5GQQC 1YUTA 1EXRA 1JF0A 1DF0A 1S6IA 1E8AA 1DF0B 1U5IA 1U5IB 1SL8A 1F4QA 2K7BA 3PLFB 5PALA 1BR4B 1AVSA 4P2YB 2O5GA 1K9KA 4GGFA 1OSAA 1NX1A 2LM5A 1LA0A 1QV1A 1ZUZA 1HQVA 2F33A 2FJUB 3SG4A 1KK7Y 1CMFA 1CMGA 1X02A 2OTGC 4YGCB 2KHNA 1SNLA 2FCDA 2LHIA 1EG3A 4DCKA 4WQ3A 3BYAA 5CSFA 4GFTA 1RROA 3OX6A 4N5XA 3LK0A 4MZKA 1Y6WA 2K8MB 3TUYB 5CPVA 1KK7Z 5I2QA 4YGEB 4CLNA 1WLZA 4JWQA 2I18A 2KAYA 2HPSA 1B4CA 2LLSA 1RWYA 1QVIY 2SASA 1CDLA 2LAPA 2F3YA 4YGAA 1QASA 4D1EA 2KI4C 2ZKMX 4QJ5B 1F70A 3TS5B 3DF0A 2BE4A 1OQPA 2Y4QA 4PDZA 3RLZA 1CLBA 2KNEA 1EH2A 1CDPA 2PMYA 1IQ3A 2JTTA 4PHJA 1DMOA 2IS9A 1SCVA 4QJ3B 1LKJA 1CLMA 3SIAA 4ZCUA 4BY4A 1A4PA 3M0WA 5I2LA 1B47A 1UHJA 2M1KB 1DGUA 2PVBA 3LL8B 4OV2A 1OMDA 1KQMB 1WY9A 1Y1XA 1S5GZ 2KYCA 4OCIA 1PRWA 4GBAA 2ZNDA 4DIRA 3PALA 3FWCA 3DVKA 2V53A 2Y1NA 2LP2A 2ZN8A 2RGIA 1G8IA 1A03A 4JPZB 2KYFA 1A75A 1A75B 2LUXA 3AKAA 4XYNA 2EHBA 1WDCB 2FOTA 4HRHA 2LLUA 2G2BA 1JBAA 3KPXA 2L2EA 1WRZA 1KQVA 1PULA 2MJWB 4IL1A 1CM1A 1TIZA 3BUNB 2I7AA 1AP4A 4MLWA 2M7NA 1SKTA 1A29A 1K96A 4E68A 3I5HC 1ZOTB 5HKYA 1ALVA 2WCBA 1KK8B 5AXIA 1K2HA 1BR1B 1UHHA 1PSBA 1QJTA 3NXAA 1DJGA 3PFVA 3JTDC 1KFXL 1QIVA 2JT8A 4NDDA 1B8LA 4HREE 4M2OA 1F54A 5HYDA 4GNKB 1IWQA 1JUOA 5G08A 2BCXA 2CTNA 4YRUA 1GQMA 1RECA 1CFCA 1SYMA 1YUUA 3EK8A 3MSEB 5KU1A 1FI5A 1LA3A 2JC2A 2LP3A 1BJFA 1MF8B 1N0YA 2KAVA 3DVMA 2PASA 2DOQA 1M31A 3F45A 1RTP1 3TUYC 1R6PA 4WQ2A 4MN0A 5DKQA 2HQWA 1CDNA 1K94A 1KFUS 4UPGA 4ZCVA 3CWGA 3E3RA 1PK0D 1SR6B 4OR9B 4PHKA 2JXLA 1YUSA 3VRNA 2KFFA 4GAOA 3TS5C 1FI6A 5KSZA 1LVCD 1M39A 2KQYA 2G9BA 2E6WA 3WNXB 1H4BA 4USLA 2F2PA 3IF7A 3VRRA 1BMOA 1QTXA 1G33A 2JOJA 1AJ4A 1NPQA 1BOCA 4YI9A 1XFXO 2AMIA 2JRFA 2EC6B 1YTZC 2NXQA 3WHUB 2AUCA 1BT6A 4OKHA 1B7TZ 1PSRA 2M8UA 1KQMC 1OMRA 1SPYA 2B1UA 2R2IA 3EK7A 1RJVA 4HRGA 2M7LA 2KAXA 1TNXA 2M97A 1C7WA 2CXJA 3TDIA 2JQ6A 2LMUA 2Y5IA 1CLLA 2NLNA 1NYAA 3OHMB 4Q04A 1F71A 4PHNA 1Y0VH 3CGAA 4YGDB 4AQIA 1K93D 3TDUA 1BF5A 4U8DA 2BL0B 2L98A 3I5FC 1HT9A 4MBEA 2PALA 1EL4A 4WRIA 1MUXA 1S6JA 1TCOB 5JJGA 1IKUA 3O6BA 4F0ZB 3GOFA 4YI8A 1NUBA 1NX3A 3O4YA 3OB2B 5AANA 3WXAA 3ZNIA 1CFPA 4L9MA 2OS8B 1BLQA 3DF0B 5B8IB 1QVIZ 1XVJA 4ORBB 5HLVA 2M0RA 1NP8A 1QX2A 3A4UB 3BUMB 2F3ZA 1DTLA 1UHNA 2JT3A 3I5IC 4PE0A 4C0JA 1IG5A 5HKZA 1MHOA 2JXCA 1BG1A 2H61C 2M49B 2COLB 2ZRSA 2KGRA 1FF1A 5HLOA 2K7OA 1DJXA 4MEWA 1B1GA 2ZN9A 5JOLA 1L2OC 2KBMA 4CFRA 2JWWA 1S36A 2NZ0A 4CIDA 1FW4A 1NX2A 5AERA 4PCWA 2JT0A 2BKIB 3I5GB 2LUCA 1XK4A 1M46A 3NSIA 2CNPA 4GGNA 1UUSA 3PN7B 3WHTB 5ER4X 2K61A 3LK1A 1BU3A 3JVTC 3HCMA 3OX5A 4FTGA 1KWOB 1GJYA 3CS1A 2ZFDA 3HX4A 5D69A 4PHMA 4I5JA 4MSPA 3SJSA 1V1FA 1MR8A 5D7FA 4C0KA 2KFGA 2LNKA 1DJYA 3VRPA 5KTYA 1SCMC 4A4CA 1YX7A 2WNDA 2LCPA 2KGBC 1QS7A 1XFUO 1CM4A 2BCBA 2Q4UA 3EK4A 1QXPA 1BODA 2I2RE 2OTGB 1YURA 1NX0A 2L5XB 1L7ZA 3PSRA 3LLEA 4FQOA 1KFXS 2LE9B 4GGFC 1S1EA 3TDZA 1MXEA 1XFZO 2CT9A 2JULA 1OE9B 2I94A 4PE1A 2JZIA 2MA2A 2MLFC 2FCEA 1DJZA 2EGDA 4MVFA 3SG6A 1B8RA 2ZRTA 4AQJA 1QATA 1XA5A 3VROA 3K21A 2HQ8A 3FS7A 2LV7A 3DVEA 1W7JB 4YBHB 1S26D 2MLEC 2OPOA 2K7DA 4ETOA 3D0YA 2WOSA 1YVLA 3D0YB 3PATA 1JSAA 1YX8A 1YVHA 3KHEA 2JU0A 1AK8A 3QRXA 3VRQA 1PVAA 4BY5A 1WRLA 3EVVA 5AFPA 4MZJA 1J7PA 3DVJA 1NIWA 4I5NB 3NSOA 4I5KA 1MXLC 2PSRA 4OVNF 1K9UA 2H61A 4NDBA 2BBNA 2MBXA 1MWNA 1PALA 1EG4A 2BECA 1S3PA 4AOMA 4CFQA 1TNPA 1C07A 1F8HA 1JWDA 5K89A 2L4HA 1XFYO 1DJIA 4GPLB 2D8NA 1N65A 3CR4X 3NSLA 1K9PA 1ZACA 2BE6A 1SW8A 2MHHA
chains in the Genus database with same CATH superfamily
4PE7A 2JNFA 2QDIA 1M45A 2AAOA 3FWBA 1AHRA 2KPHA 4XJKA 4XJKB 1CFDA 1SMGA 1B8CA 2H8VA 1F55A 1TOPA 1GM0A 1DEKA 5F6TA 3DZTA 2KQ6A 4M2QA 1AJ5A 4A4BA 2P6BB 4HSZA 2LMTA 1XYDA 1UWOA 2KSPA 1WDCC 2L4IA 1CDMA 3D76A 2LVJA 1K8UA 1K95A 2GGMA 4P5OE 1IQ5A 1RFJA 1G4YR 1SBJA 3I5HB 3R1PA 2MRDA 3FE8A 4PE4A 2LMVA 1TNQA 3H4SE 4MZLA 3BOWA 1OOFA 1B9AA 3BOWB 1R2UA 2HETA 3A8RA 1TWOA 1NCZA 3JTDB 3PM8A 1J1EA 2F8PA 1JFJA 1QIWA 3OB1B 3GK1A 2Q91A 3ICBA 1DJHA 1PVBA 2WC8A 5EL2A 1XO5A 1YRTB 1A2XA 3CR5X 4YGBB 1IGVA 1NWDA 3BUWB 5HKWA 3SG3A 1KK8C 4F7FA 1ZFSA 1C3YA 4ICBA 4DUQA 1DC1A 1KSMA 3BUOB 4NDCA 1DQEA 1JC2A 5CSJA 2LC5A 2JTZA 2BAPA 4JQ0D 1C3ZA 1WLMA 2BKHB 2KI6D 3CLNA 3O2PA 2KFHA 1TTXA 1IJ5A 1GGWA 2A4JA 2WCKA 2JPTA 2QEOA 2BNXA 1KCYA 2H2KA 3B87A 3LCPC 4PALA 1V1GA 1LINA 1GGZA 1NCYA 3KEVA 1J7OA 1NCXA 1QX7A 4OZDA 1YR5A 5J3XA 2LVIA 3R72A 1TCFA 1TNWA 2ISDA 1D1OA 2GV5A 2HF5A 1SR6C 1UHIA 3RZSA 2KBIA 3AAKA 3S0EA 2TN4A 3BUXB 2K0JA 4NQGA 1FBVA 1S5GY 2Y1MA 2L50A 2MAZA 3GK4X 3VGOA 1ALWA 3BQ3A 2L0PA 2LANA 1J55A 1DVIA 3K1EA 3EKJA 2KI6C 1CB1A 5I8NA 3CABA 3S0DA 2F2OA 4ORCB 5I2OA 2EC6C 2WCJA 2WCEA 1TN4A 1S6CA 4I5LB 3TZ1A 4MRYA 2O60A 1M63B 3KF9A 1WRKA 2JNXA 4CPVA 2SCPA 1Y1UA 1XFVO 1ZMZA 1XFWO 3D75A 2M9GA 2L2CA 2WCHA 1OZOA 3AAJA 5HL1A 4QJ4B 2GGZA 1IH0A 1Y1AA 1UP5A 1J7QA 3I5FB 1MQ1A 4N1GA 3L47A 2QACA 1JFKA 1QWVA 3EKHA 2M3WA 3OP0A 3O78A 3AKBA 1YRUB 3CZ1A 2BL0C 2M1UA 1DT7B 1JF2A 1QLKA 1SK6D 1UHKA 1Q80A 1QLSA 3BFHA 3SS3A 1IJ6A 1N2DA 3DD4A 2KI4B 2WORA 1CNPA 1IRJA 4DS7A 1RK9A 1SY9A 1UURA 2K2AA 2QPTA 1J1DA 4FQTA 5TNCA 4DRWA 1QX5B 2NCPA 1K90D 2E30A 3I5IB 2KOTA 3CZTX 3RM1A 2QEHA 5DKNA 1LXFC 2LHLA 2OS8C 5FYXA 1FPWA 5FI6A 1CKKA 3SG2A 1KSOA 1QV0A 3NHTA 3CTNA 4JD9A 5AEQA 2K60A 2KLEA 3SG5A 1SL7A 1C7VA 3CR2A 3SIBA 2CBLA 3EVUA 3ZWHA 1L2OB 2NCOA 2LVKA 1TRFA 4IJ7A 1F4OA 1VRKA 2VRGA 5CSIA 4PT1A 1OZSA 4C0LA 3IQQA 5IBWA 1OOJA 1KFUL 1DGVA 3FE9A 4ORAB 3FIAA 3IQOA 5BPJA 3SG7A 2LVVA 2WCFA 4N1FA 2KDHA 2LLTA 3JVTB 1EJ3A 1W7IB 4M2PA 3NSKA 3GK2A 3D10A 2K2FA 5CSNA 2ZNEA 3I5GC 3EVRA 3KO0A 1J7RA 4GUKA 1XK4C 2M29A 1DJWA 1NSHA 1OMVA 1SL9A 1TUZA 3PN7C 1B7TY 1AUIB 1CTRA 2BCAA 2PRUA 2L51A 2PYQA 4TNCA 5DKRA 1H8BA 3BXKA 1ODBA 1KWOC 2BBMA 4MRXA 1DELA 1SCMB 4R1EA 1CFFA 1SRAA 2K7CA 2CCMA 5ER5A 3C1VA 3R1OA 1YUTA 5GQQC 1EXRA 1JF0A 1DF0A 1S6IA 1E8AA 1DF0B 1U5IA 1U5IB 1SL8A 1F4QA 2K7BA 3PLFB 5PALA 1BR4B 1AVSA 4P2YB 2O5GA 1K9KA 4GGFA 1OSAA 1NX1A 2LM5A 1LA0A 1QV1A 1ZUZA 1HQVA 2KLDA 2F33A 2FJUB 3SG4A 1KK7Y 1CMFA 1CMGA 1X02A 2OTGC 4YGCB 2KHNA 1SNLA 2FCDA 2LHIA 1EG3A 4DCKA 4WQ3A 3BYAA 3IVTA 5CSFA 4GFTA 1RROA 3OX6A 4N5XA 3LK0A 4MZKA 1Y6WA 2K8MB 2PQLA 3TUYB 5CPVA 1KK7Z 5I2QA 2WCLA 4YGEB 4CLNA 1WLZA 4JWQA 2I18A 2KAYA 2HPSA 1B4CA 2LLSA 1RWYA 1QVIY 3SS5A 2SASA 1T14A 1CDLA 2LAPA 2F3YA 4YGAA 1QASA 4D1EA 2KI4C 2ZKMX 4QJ5B 1F70A 3TS5B 3DF0A 2BE4A 1OQPA 2Y4QA 4PDZA 3RLZA 1CLBA 2KNEA 1EH2A 1CDPA 2PMYA 1IQ3A 2JTTA 4PHJA 1DMOA 2IS9A 2P71A 1SCVA 4QJ3B 1LKJA 1CLMA 3NHIA 2WC6A 2GTEA 3SIAA 4ZCUA 4BY4A 1A4PA 3M0WA 5I2LA 1B47A 1UHJA 2M1KB 1DGUA 2PVBA 3LL8B 4OV2A 1OMDA 1KQMB 1WY9A 3BFBA 1Y1XA 1S5GZ 2KYCA 3DXLA 4OCIA 1PRWA 4GBAA 1SSEB 2ZNDA 4DIRA 3R1VA 3PALA 3FWCA 3DVKA 2V53A 2Y1NA 2LP2A 2ZN8A 2RGIA 1G8IA 1A03A 4JPZB 2KYFA 1A75A 1A75B 2LUXA 3AKAA 4XYNA 2EHBA 1WDCB 2FOTA 4HRHA 2LLUA 2G2BA 1JBAA 3KPXA 2L2EA 1WRZA 1KQVA 1PULA 2MJWB 3CDNA 3DYEA 4IL1A 1CM1A 1TIZA 3BUNB 2I7AA 1AP4A 4KYNA 4MLWA 2M7NA 3FE6A 1SKTA 1A29A 1K96A 4E68A 3I5HC 1ZOTB 5HKYA 1ALVA 2WCBA 3B6XA 5FI7A 1KK8B 5AXIA 1K2HA 1BR1B 1UHHA 3B7AA 1PSBA 1QJTA 3NXAA 1DJGA 3PFVA 3JTDC 1KFXL 1QIVA 2JT8A 4NDDA 1B8LA 3B88A 4HREE 4M2OA 3S0GA 4JKTA 5HYDA 1F54A 4GNKB 5FI2A 1IWQA 1JUOA 5G08A 2BCXA 2QEBA 3D74A 2CTNA 4YRUA 1GQMA 1RECA 3PJIA 1CFCA 1SYMA 1YUUA 3EK8A 3MSEB 5KU1A 1FI5A 1LA3A 2JC2A 2LP3A 1BJFA 1MF8B 1N0YA 2KAVA 3DVMA 2PASA 2DOQA 1M31A 3F45A 1RTP1 3TUYC 1R6PA 4WQ2A 4MN0A 3NGVA 5DKQA 3S0BA 2HQWA 1CDNA 1K94A 1KFUS 4UPGA 4ZCVA 3CWGA 3E3RA 1PK0D 1SR6B 2QEVA 4OR9B 3B86A 2JXLA 1YUSA 4PHKA 3VRNA 2KFFA 3BJHA 4GAOA 3TS5C 1FI6A 5KSZA 1LVCD 5D3OA 1M39A 2KQYA 2G9BA 1ORGA 2E6WA 3WNXB 1H4BA 4USLA 2F2PA 3IF7A 3VRRA 1BMOA 1QTXA 1G33A 2JOJA 1AJ4A 1NPQA 1BOCA 4YI9A 1OOGA 1XFXO 2AMIA 2JRFA 2EC6B 1YTZC 2NXQA 3WHUB 2AUCA 1BT6A 3EG5B 4OKHA 1B7TZ 1PSRA 2M8UA 1KQMC 1OMRA 1SPYA 2B1UA 2R2IA 3EK7A 1RJVA 4HRGA 2M7LA 2KAXA 1TNXA 2M97A 1C7WA 2CXJA 3TDIA 2JQ6A 2LMUA 2Y5IA 1CLLA 2NLNA 1NYAA 3OHMB 4Q04A 1F71A 2FJYA 4PHNA 3VB1A 1OOIX 2WCMA 3UNWA 1Y0VH 3CGAA 4YGDB 4AQIA 1K93D 3TDUA 1BF5A 4U8DA 2BL0B 3S0AA 2L98A 3I5FC 4INWA 1HT9A 4MBEA 2PALA 1EL4A 3V2LA 4WRIA 1MUXA 1S6JA 1TCOB 5JJGA 3CZ2A 3O6BA 1IKUA 4F0ZB 3GOFA 4YI8A 1NUBA 1NX3A 3DY9A 3O4YA 3OB2B 5AANA 3WXAA 3ZNIA 1CFPA 3OBVA 4L9MA 2OS8B 1BLQA 3DF0B 5B8IB 1QVIZ 1XVJA 4ORBB 5I94A 5HLVA 2M0RA 3Q8IA 4INXA 1NP8A 1QX2A 3A4UB 3BUMB 2F3ZA 1DTLA 1TUJA 1UHNA 2JT3A 3I5IC 4PE0A 2L5YA 3L4AA 4C0JA 1IG5A 3D77A 5HKZA 3S0FA 1MHOA 1P28A 2JXCA 2H61C 2M49B 1BG1A 2COLB 2ZRSA 2KGRA 1FF1A 5HLOA 2K7OA 1DJXA 4MEWA 1B1GA 2ZN9A 5JOLA 1L2OC 2KBMA 4CFRA 2JWWA 1S36A 2NZ0A 4CIDA 1FW4A 1NX2A 1XFRA 5AERA 4PCWA 3D73A 2JT0A 2BKIB 3I5GB 2LUCA 1XK4A 1M46A 3NSIA 2CNPA 4GGNA 1UUSA 3PN7B 3WHTB 5ER4X 2K61A 3LK1A 1BU3A 3JVTC 3HCMA 3OX5A 3D78A 2P70A 4FTGA 1KWOB 1GJYA 2JPOA 3BFAA 3CS1A 1J7PA 2ZFDA 3HX4A 5D69A 5DICA 4PHMA 4I5JA 3UO9A 4MSPA 3SJSA 1V1FA 1MR8A 5D7FA 4C0KA 1OOHA 2KFGA 2LNKA 1DJYA 3VRPA 5KTYA 3OGNA 1OW4A 1SCMC 4A4CA 1YX7A 2WNDA 3CZ0A 2LCPA 2KGBC 2YGUA 1QS7A 1XFUO 1CM4A 2BCBA 2Q4UA 3EK4A 1QXPA 1Z4HA 1BODA 2I2RE 2OTGB 1YURA 1NX0A 2L5XB 1L7ZA 3PSRA 3LLEA 4FQOA 1KFXS 2LE9B 4GGFC 3PM2A 1S1EA 3TDZA 1MXEA 1XFZO 2CT9A 3SS4A 2JULA 1OE9B 2I94A 4PE1A 2JZIA 2MA2A 2MLFC 3L4LA 2FCEA 1DJZA 2EGDA 4MVFA 3QMEA 1B8RA 2ZRTA 3SG6A 1QATA 4AQJA 1XA5A 3VROA 3O4XA 3K21A 2HQ8A 3FS7A 2LV7A 3DVEA 1W7JB 1Z2CB 4YBHB 1S26D 2MLEC 2OPOA 2K7DA 4ETOA 3D0YA 2WOSA 1YVLA 3D0YB 3PATA 1JSAA 1YX8A 1YVHA 3KHEA 2JU0A 1AK8A 3QRXA 3VRQA 1PVAA 4BY5A 1WRLA 3EVVA 5AFPA 2ERBA 4MZJA 3DVJA 1NIWA 4I5NB 3NSOA 1W9ZA 4I5KA 1MXLC 2PSRA 4OVNF 1K9UA 2H61A 4NDBA 2BBNA 3N7HA 1MWNA 2MBXA 1PALA 1EG4A 2BECA 2WC5A 1S3PA 4AOMA 1LS8A 4CFQA 1TNPA 1C07A 1F8HA 1JWDA 5K89A 2L4HA 1XFYO 1DJIA 4GPLB 2D8NA 1IIOA 1N65A 3CR4X 3NSLA 1K9PA 1ZACA 2BE6A 3CYZA 1SW8A 2MHHA
chains in the Genus database with same CATH topology
4PE7A 2JNFA 1M45A 2AAOA 3FWBA 1AHRA 4XJKA 4XJKB 1CFDA 1SMGA 1B8CA 1F55A 1TOPA 5F6TA 2KQ6A 4M2QA 1AJ5A 4A4BA 2P6BB 4HSZA 2LMTA 1XYDA 1UWOA 2KSPA 1WDCC 2L4IA 1CDMA 4P5OE 2LVJA 1K8UA 1K95A 2GGMA 1IQ5A 1RFJA 1G4YR 1SBJA 3I5HB 4PE4A 2MRDA 2LMVA 1TNQA 3H4SE 4MZLA 3BOWA 1B9AA 3BOWB 1R2UA 2HETA 3A8RA 3PM8A 1NCZA 3JTDB 1J1EA 2F8PA 1JFJA 1QIWA 3OB1B 3GK1A 2Q91A 3ICBA 1DJHA 1PVBA 2WC8A 1XO5A 1YRTB 1A2XA 3CR5X 4YGBB 1IGVA 1NWDA 3BUWB 5HKWA 3SG3A 1KK8C 1ZFSA 4ICBA 4DUQA 1KSMA 3BUOB 4NDCA 1JC2A 5CSJA 2LC5A 2JTZA 4JQ0D 2BKHB 1WLMA 2KI6D 3CLNA 3O2PA 2KFHA 1TTXA 1IJ5A 1GGWA 2A4JA 2JPTA 1KCYA 2H2KA 3LCPC 4PALA 1V1GA 1LINA 1GGZA 1NCYA 3KEVA 1J7OA 1NCXA 1QX7A 5J3XA 1YR5A 2LVIA 1TCFA 1TNWA 2ISDA 1D1OA 2GV5A 2HF5A 1SR6C 1UHIA 2KBIA 3AAKA 2TN4A 3BUXB 2K0JA 4NQGA 1FBVA 1S5GY 2Y1MA 2L50A 2MAZA 3GK4X 3VGOA 1ALWA 3BQ3A 2L0PA 2LANA 1J55A 1DVIA 1CB1A 3EKJA 2KI6C 5I8NA 2F2OA 4ORCB 5I2OA 2EC6C 2WCEA 1TN4A 1S6CA 4I5LB 3TZ1A 4MRYA 2O60A 1M63B 3KF9A 1WRKA 2JNXA 4CPVA 2SCPA 1Y1UA 1XFVO 1ZMZA 1XFWO 2M9GA 1OZOA 3AAJA 4QJ4B 2GGZA 1IH0A 1Y1AA 1UP5A 1J7QA 3I5FB 1MQ1A 4N1GA 2QACA 1JFKA 3EKHA 2M3WA 3OP0A 3O78A 3AKBA 1YRUB 2BL0C 2M1UA 1DT7B 1JF2A 1QLKA 1SK6D 1UHKA 1Q80A 1QLSA 1IJ6A 1N2DA 3DD4A 2KI4B 2WORA 1CNPA 1IRJA 4DS7A 1RK9A 1SY9A 1UURA 2K2AA 2QPTA 1J1DA 5TNCA 4DRWA 1QX5B 2NCPA 1K90D 2E30A 3I5IB 2KOTA 3CZTX 3RM1A 5DKNA 1LXFC 2LHLA 2OS8C 5FYXA 1FPWA 1CKKA 3SG2A 1KSOA 1QV0A 3CTNA 5AEQA 3SG5A 1SL7A 1C7VA 3CR2A 3SIBA 2CBLA 3EVUA 3ZWHA 1L2OB 2NCOA 2LVKA 1TRFA 1F4OA 1VRKA 2VRGA 5CSIA 4C0LA 1OZSA 3IQQA 5IBWA 1OOJA 1KFUL 1DGVA 4ORAB 3FIAA 3IQOA 5BPJA 2LVVA 2WCFA 4N1FA 2KDHA 2LLTA 3JVTB 1EJ3A 1W7IB 4M2PA 3NSKA 3GK2A 3D10A 2K2FA 5CSNA 2ZNEA 3I5GC 3EVRA 3KO0A 1J7RA 4GUKA 1XK4C 2M29A 1DJWA 1NSHA 1OMVA 1SL9A 3PN7C 1B7TY 1AUIB 1CTRA 2BCAA 2PRUA 2L51A 4TNCA 5DKRA 3SG7A 1H8BA 3BXKA 1ODBA 1KWOC 2BBMA 4MRXA 1SCMB 4R1EA 1CFFA 1SRAA 2K7CA 2CCMA 5ER5A 3C1VA 5GQQC 1YUTA 1EXRA 1JF0A 1DF0A 1S6IA 1E8AA 1DF0B 1U5IA 1U5IB 1SL8A 1F4QA 2K7BA 3PLFB 5PALA 1BR4B 1AVSA 4P2YB 2O5GA 1K9KA 4GGFA 1OSAA 1NX1A 2LM5A 1LA0A 1QV1A 1ZUZA 1HQVA 2F33A 2FJUB 3SG4A 1KK7Y 1CMFA 1CMGA 1X02A 2OTGC 4YGCB 2KHNA 1SNLA 2FCDA 2LHIA 1EG3A 4DCKA 4WQ3A 3BYAA 5CSFA 4GFTA 1RROA 3OX6A 4N5XA 3LK0A 4MZKA 1Y6WA 2K8MB 3TUYB 5CPVA 1KK7Z 5I2QA 4YGEB 4CLNA 1WLZA 4JWQA 2I18A 2KAYA 2HPSA 1B4CA 2LLSA 1RWYA 1QVIY 2SASA 1CDLA 2LAPA 2F3YA 4YGAA 1QASA 4D1EA 2KI4C 2ZKMX 4QJ5B 1F70A 3TS5B 3DF0A 2BE4A 1OQPA 2Y4QA 4PDZA 3RLZA 1CLBA 2KNEA 1EH2A 1CDPA 2PMYA 1IQ3A 2JTTA 4PHJA 1DMOA 2IS9A 1SCVA 4QJ3B 1LKJA 1CLMA 3SIAA 4ZCUA 4BY4A 1A4PA 3M0WA 5I2LA 1B47A 1UHJA 2M1KB 1DGUA 2PVBA 3LL8B 4OV2A 1OMDA 1KQMB 1WY9A 1Y1XA 1S5GZ 2KYCA 4OCIA 1PRWA 4GBAA 2ZNDA 4DIRA 3PALA 3FWCA 3DVKA 2V53A 2Y1NA 2LP2A 2ZN8A 2RGIA 1G8IA 1A03A 4JPZB 2KYFA 1A75A 1A75B 2LUXA 3AKAA 4XYNA 2EHBA 1WDCB 2FOTA 4HRHA 2LLUA 2G2BA 1JBAA 3KPXA 2L2EA 1WRZA 1KQVA 1PULA 2MJWB 4IL1A 1CM1A 1TIZA 3BUNB 2I7AA 1AP4A 4MLWA 2M7NA 1SKTA 1A29A 1K96A 4E68A 3I5HC 1ZOTB 5HKYA 1ALVA 2WCBA 1KK8B 5AXIA 1K2HA 1BR1B 1UHHA 1PSBA 1QJTA 3NXAA 1DJGA 3PFVA 3JTDC 1KFXL 1QIVA 2JT8A 4NDDA 1B8LA 4HREE 4M2OA 1F54A 5HYDA 4GNKB 1IWQA 1JUOA 5G08A 2BCXA 2CTNA 4YRUA 1GQMA 1RECA 1CFCA 1SYMA 1YUUA 3EK8A 3MSEB 5KU1A 1FI5A 1LA3A 2JC2A 2LP3A 1BJFA 1MF8B 1N0YA 2KAVA 3DVMA 2PASA 2DOQA 1M31A 3F45A 1RTP1 3TUYC 1R6PA 4WQ2A 4MN0A 5DKQA 2HQWA 1CDNA 1K94A 1KFUS 4UPGA 4ZCVA 3CWGA 3E3RA 1PK0D 1SR6B 4OR9B 4PHKA 2JXLA 1YUSA 3VRNA 2KFFA 4GAOA 3TS5C 1FI6A 5KSZA 1LVCD 1M39A 2KQYA 2G9BA 2E6WA 3WNXB 1H4BA 4USLA 2F2PA 3IF7A 3VRRA 1BMOA 1QTXA 1G33A 2JOJA 1AJ4A 1NPQA 1BOCA 4YI9A 1XFXO 2AMIA 2JRFA 2EC6B 1YTZC 2NXQA 3WHUB 2AUCA 1BT6A 4OKHA 1B7TZ 1PSRA 2M8UA 1KQMC 1OMRA 1SPYA 2B1UA 2R2IA 3EK7A 1RJVA 4HRGA 2M7LA 2KAXA 1TNXA 2M97A 1C7WA 2CXJA 3TDIA 2JQ6A 2LMUA 2Y5IA 1CLLA 2NLNA 1NYAA 3OHMB 4Q04A 1F71A 4PHNA 1Y0VH 3CGAA 4YGDB 4AQIA 1K93D 3TDUA 1BF5A 4U8DA 2BL0B 2L98A 3I5FC 1HT9A 4MBEA 2PALA 1EL4A 4WRIA 1MUXA 1S6JA 1TCOB 5JJGA 1IKUA 3O6BA 4F0ZB 3GOFA 4YI8A 1NUBA 1NX3A 3O4YA 3OB2B 5AANA 3WXAA 3ZNIA 1CFPA 4L9MA 2OS8B 1BLQA 3DF0B 5B8IB 1QVIZ 1XVJA 4ORBB 5HLVA 2M0RA 1NP8A 1QX2A 3A4UB 3BUMB 2F3ZA 1DTLA 1UHNA 2JT3A 3I5IC 4PE0A 4C0JA 1IG5A 5HKZA 1MHOA 2JXCA 1BG1A 2H61C 2M49B 2COLB 2ZRSA 2KGRA 1FF1A 5HLOA 2K7OA 1DJXA 4MEWA 1B1GA 2ZN9A 5JOLA 1L2OC 2KBMA 4CFRA 2JWWA 1S36A 2NZ0A 4CIDA 1FW4A 1NX2A 5AERA 4PCWA 2JT0A 2BKIB 3I5GB 2LUCA 1XK4A 1M46A 3NSIA 2CNPA 4GGNA 1UUSA 3PN7B 3WHTB 5ER4X 2K61A 3LK1A 1BU3A 3JVTC 3HCMA 3OX5A 4FTGA 1KWOB 1GJYA 3CS1A 2ZFDA 3HX4A 5D69A 4PHMA 4I5JA 4MSPA 3SJSA 1V1FA 1MR8A 5D7FA 4C0KA 2KFGA 2LNKA 1DJYA 3VRPA 5KTYA 1SCMC 4A4CA 1YX7A 2WNDA 2LCPA 2KGBC 1QS7A 1XFUO 1CM4A 2BCBA 2Q4UA 3EK4A 1QXPA 1BODA 2I2RE 2OTGB 1YURA 1NX0A 2L5XB 1L7ZA 3PSRA 3LLEA 4FQOA 1KFXS 2LE9B 4GGFC 1S1EA 3TDZA 1MXEA 1XFZO 2CT9A 2JULA 1OE9B 2I94A 4PE1A 2JZIA 2MA2A 2MLFC 2FCEA 1DJZA 2EGDA 4MVFA 3SG6A 1B8RA 2ZRTA 4AQJA 1QATA 1XA5A 3VROA 3K21A 2HQ8A 3FS7A 2LV7A 3DVEA 1W7JB 4YBHB 1S26D 2MLEC 2OPOA 2K7DA 4ETOA 3D0YA 2WOSA 1YVLA 3D0YB 3PATA 1JSAA 1YX8A 1YVHA 3KHEA 2JU0A 1AK8A 3QRXA 3VRQA 1PVAA 4BY5A 1WRLA 3EVVA 5AFPA 4MZJA 1J7PA 3DVJA 1NIWA 4I5NB 3NSOA 4I5KA 1MXLC 2PSRA 4OVNF 1K9UA 2H61A 4NDBA 2BBNA 2MBXA 1MWNA 1PALA 1EG4A 2BECA 1S3PA 4AOMA 4CFQA 1TNPA 1C07A 1F8HA 1JWDA 5K89A 2L4HA 1XFYO 1DJIA 4GPLB 2D8NA 1N65A 3CR4X 3NSLA 1K9PA 1ZACA 2BE6A 1SW8A 2MHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PE7 A;  2JNF A;  1M45 A;  2AAO A;  3FWB A;  1AHR A;  4XJK A;  4XJK B;  1CFD A;  1SMG A;  1B8C A;  1F55 A;  1TOP A;  5F6T A;  2KQ6 A;  4M2Q A;  1AJ5 A;  4A4B A;  2P6B B;  4HSZ A;  2LMT A;  1XYD A;  1UWO A;  2KSP A;  1WDC C;  2L4I A;  1CDM A;  4P5O E;  2LVJ A;  1K8U A;  1K95 A;  2GGM A;  1IQ5 A;  1RFJ A;  1G4Y R;  1SBJ A;  3I5H B;  4PE4 A;  2MRD A;  2LMV A;  1TNQ A;  3H4S E;  4MZL A;  3BOW A;  1B9A A;  3BOW B;  1R2U A;  2HET A;  3A8R A;  3PM8 A;  1NCZ A;  3JTD B;  1J1E A;  2F8P A;  1JFJ A;  1QIW A;  3OB1 B;  3GK1 A;  2Q91 A;  3ICB A;  1DJH A;  1PVB A;  2WC8 A;  1XO5 A;  1YRT B;  1A2X A;  3CR5 X;  4YGB B;  1IGV A;  1NWD A;  3BUW B;  5HKW A;  3SG3 A;  1KK8 C;  1ZFS A;  4ICB A;  4DUQ A;  1KSM A;  3BUO B;  4NDC A;  1JC2 A;  5CSJ A;  2LC5 A;  2JTZ A;  4JQ0 D;  2BKH B;  1WLM A;  2KI6 D;  3CLN A;  3O2P A;  2KFH A;  1TTX A;  1IJ5 A;  1GGW A;  2A4J A;  2JPT A;  1KCY A;  2H2K A;  3LCP C;  4PAL A;  1V1G A;  1LIN A;  1GGZ A;  1NCY A;  3KEV A;  1J7O A;  1NCX A;  1QX7 A;  5J3X A;  1YR5 A;  2LVI A;  1TCF A;  1TNW A;  2ISD A;  1D1O A;  2GV5 A;  2HF5 A;  1SR6 C;  1UHI A;  2KBI A;  3AAK A;  2TN4 A;  3BUX B;  2K0J A;  4NQG A;  1FBV A;  1S5G Y;  2Y1M A;  2L50 A;  2MAZ A;  3GK4 X;  3VGO A;  1ALW A;  3BQ3 A;  2L0P A;  2LAN A;  1J55 A;  1DVI A;  1CB1 A;  3EKJ A;  2KI6 C;  5I8N A;  2F2O A;  4ORC B;  5I2O A;  2EC6 C;  2WCE A;  1TN4 A;  1S6C A;  4I5L B;  3TZ1 A;  4MRY A;  2O60 A;  1M63 B;  3KF9 A;  1WRK A;  2JNX A;  4CPV A;  2SCP A;  1Y1U A;  1XFV O;  1ZMZ A;  1XFW O;  2M9G A;  1OZO A;  3AAJ A;  4QJ4 B;  2GGZ A;  1IH0 A;  1Y1A A;  1UP5 A;  1J7Q A;  3I5F B;  1MQ1 A;  4N1G A;  2QAC A;  1JFK A;  3EKH A;  2M3W A;  3OP0 A;  3O78 A;  3AKB A;  1YRU B;  2BL0 C;  2M1U A;  1DT7 B;  1JF2 A;  1QLK A;  1SK6 D;  1UHK A;  1Q80 A;  1QLS A;  1IJ6 A;  1N2D A;  3DD4 A;  2KI4 B;  2WOR A;  1CNP A;  1IRJ A;  4DS7 A;  1RK9 A;  1SY9 A;  1UUR A;  2K2A A;  2QPT A;  1J1D A;  5TNC A;  4DRW A;  1QX5 B;  2NCP A;  1K90 D;  2E30 A;  3I5I B;  2KOT A;  3CZT X;  3RM1 A;  5DKN A;  1LXF C;  2LHL A;  2OS8 C;  5FYX A;  1FPW A;  1CKK A;  3SG2 A;  1KSO A;  1QV0 A;  3CTN A;  5AEQ A;  3SG5 A;  1SL7 A;  1C7V A;  3CR2 A;  3SIB A;  2CBL A;  3EVU A;  3ZWH A;  1L2O B;  2NCO A;  2LVK A;  1TRF A;  1F4O A;  1VRK A;  2VRG A;  5CSI A;  4C0L A;  1OZS A;  3IQQ A;  5IBW A;  1OOJ A;  1KFU L;  1DGV A;  4ORA B;  3FIA A;  3IQO A;  5BPJ A;  2LVV A;  2WCF A;  4N1F A;  2KDH A;  2LLT A;  3JVT B;  1EJ3 A;  1W7I B;  4M2P A;  3NSK A;  3GK2 A;  3D10 A;  2K2F A;  5CSN A;  2ZNE A;  3I5G C;  3EVR A;  3KO0 A;  1J7R A;  4GUK A;  1XK4 C;  2M29 A;  1DJW A;  1NSH A;  1OMV A;  1SL9 A;  3PN7 C;  1B7T Y;  1AUI B;  1CTR A;  2BCA A;  2PRU A;  2L51 A;  4TNC A;  5DKR A;  3SG7 A;  1H8B A;  3BXK A;  1ODB A;  1KWO C;  2BBM A;  4MRX A;  1SCM B;  4R1E A;  1CFF A;  1SRA A;  2K7C A;  2CCM A;  5ER5 A;  3C1V A;  5GQQ C;  1YUT A;  1EXR A;  1JF0 A;  1DF0 A;  1S6I A;  1E8A A;  1DF0 B;  1U5I A;  1U5I B;  1SL8 A;  1F4Q A;  2K7B A;  3PLF B;  5PAL A;  1BR4 B;  1AVS A;  4P2Y B;  2O5G A;  1K9K A;  4GGF A;  1OSA A;  1NX1 A;  2LM5 A;  1LA0 A;  1QV1 A;  1ZUZ A;  1HQV A;  2F33 A;  2FJU B;  3SG4 A;  1KK7 Y;  1CMF A;  1CMG A;  1X02 A;  2OTG C;  4YGC B;  2KHN A;  1SNL A;  2FCD A;  2LHI A;  1EG3 A;  4DCK A;  4WQ3 A;  3BYA A;  5CSF A;  4GFT A;  1RRO A;  3OX6 A;  4N5X A;  3LK0 A;  4MZK A;  1Y6W A;  2K8M B;  3TUY B;  5CPV A;  1KK7 Z;  5I2Q A;  4YGE B;  4CLN A;  1WLZ A;  4JWQ A;  2I18 A;  2KAY A;  2HPS A;  1B4C A;  2LLS A;  1RWY A;  1QVI Y;  2SAS A;  1CDL A;  2LAP A;  2F3Y A;  4YGA A;  1QAS A;  4D1E A;  2KI4 C;  2ZKM X;  4QJ5 B;  1F70 A;  3TS5 B;  3DF0 A;  2BE4 A;  1OQP A;  2Y4Q A;  4PDZ A;  3RLZ A;  1CLB A;  2KNE A;  1EH2 A;  1CDP A;  2PMY A;  1IQ3 A;  2JTT A;  4PHJ A;  1DMO A;  2IS9 A;  1SCV A;  4QJ3 B;  1LKJ A;  1CLM A;  3SIA A;  4ZCU A;  4BY4 A;  1A4P A;  3M0W A;  5I2L A;  1B47 A;  1UHJ A;  2M1K B;  1DGU A;  2PVB A;  3LL8 B;  4OV2 A;  1OMD A;  1KQM B;  1WY9 A;  1Y1X A;  1S5G Z;  2KYC A;  4OCI A;  1PRW A;  4GBA A;  2ZND A;  4DIR A;  3PAL A;  3FWC A;  3DVK A;  2V53 A;  2Y1N A;  2LP2 A;  2ZN8 A;  2RGI A;  1G8I A;  1A03 A;  4JPZ B;  2KYF A;  1A75 A;  1A75 B;  2LUX A;  3AKA A;  4XYN A;  2EHB A;  1WDC B;  2FOT A;  4HRH A;  2LLU A;  2G2B A;  1JBA A;  3KPX A;  2L2E A;  1WRZ A;  1KQV A;  1PUL A;  2MJW B;  4IL1 A;  1CM1 A;  1TIZ A;  3BUN B;  2I7A A;  1AP4 A;  4MLW A;  2M7N A;  1SKT A;  1A29 A;  1K96 A;  4E68 A;  3I5H C;  1ZOT B;  5HKY A;  1ALV A;  2WCB A;  1KK8 B;  5AXI A;  1K2H A;  1BR1 B;  1UHH A;  1PSB A;  1QJT A;  3NXA A;  1DJG A;  3PFV A;  3JTD C;  1KFX L;  1QIV A;  2JT8 A;  4NDD A;  1B8L A;  4HRE E;  4M2O A;  1F54 A;  5HYD A;  4GNK B;  1IWQ A;  1JUO A;  5G08 A;  2BCX A;  2CTN A;  4YRU A;  1GQM A;  1REC A;  1CFC A;  1SYM A;  1YUU A;  3EK8 A;  3MSE B;  5KU1 A;  1FI5 A;  1LA3 A;  2JC2 A;  2LP3 A;  1BJF A;  1MF8 B;  1N0Y A;  2KAV A;  3DVM A;  2PAS A;  2DOQ A;  1M31 A;  3F45 A;  1RTP 1;  3TUY C;  1R6P A;  4WQ2 A;  4MN0 A;  5DKQ A;  2HQW A;  1CDN A;  1K94 A;  1KFU S;  4UPG A;  4ZCV A;  3CWG A;  3E3R A;  1PK0 D;  1SR6 B;  4OR9 B;  4PHK A;  2JXL A;  1YUS A;  3VRN A;  2KFF A;  4GAO A;  3TS5 C;  1FI6 A;  5KSZ A;  1LVC D;  1M39 A;  2KQY A;  2G9B A;  2E6W A;  3WNX B;  1H4B A;  4USL A;  2F2P A;  3IF7 A;  3VRR A;  1BMO A;  1QTX A;  1G33 A;  2JOJ A;  1AJ4 A;  1NPQ A;  1BOC A;  4YI9 A;  1XFX O;  2AMI A;  2JRF A;  2EC6 B;  1YTZ C;  2NXQ A;  3WHU B;  2AUC A;  1BT6 A;  4OKH A;  1B7T Z;  1PSR A;  2M8U A;  1KQM C;  1OMR A;  1SPY A;  2B1U A;  2R2I A;  3EK7 A;  1RJV A;  4HRG A;  2M7L A;  2KAX A;  1TNX A;  2M97 A;  1C7W A;  2CXJ A;  3TDI A;  2JQ6 A;  2LMU A;  2Y5I A;  1CLL A;  2NLN A;  1NYA A;  3OHM B;  4Q04 A;  1F71 A;  4PHN A;  1Y0V H;  3CGA A;  4YGD B;  4AQI A;  1K93 D;  3TDU A;  1BF5 A;  4U8D A;  2BL0 B;  2L98 A;  3I5F C;  1HT9 A;  4MBE A;  2PAL A;  1EL4 A;  4WRI A;  1MUX A;  1S6J A;  1TCO B;  5JJG A;  1IKU A;  3O6B A;  4F0Z B;  3GOF A;  4YI8 A;  1NUB A;  1NX3 A;  3O4Y A;  3OB2 B;  5AAN A;  3WXA A;  3ZNI A;  1CFP A;  4L9M A;  2OS8 B;  1BLQ A;  3DF0 B;  5B8I B;  1QVI Z;  1XVJ A;  4ORB B;  5HLV A;  2M0R A;  1NP8 A;  1QX2 A;  3A4U B;  3BUM B;  2F3Z A;  1DTL A;  1UHN A;  2JT3 A;  3I5I C;  4PE0 A;  4C0J A;  1IG5 A;  5HKZ A;  1MHO A;  2JXC A;  1BG1 A;  2H61 C;  2M49 B;  2COL B;  2ZRS A;  2KGR A;  1FF1 A;  5HLO A;  2K7O A;  1DJX A;  4MEW A;  1B1G A;  2ZN9 A;  5JOL A;  1L2O C;  2KBM A;  4CFR A;  2JWW A;  1S36 A;  2NZ0 A;  4CID A;  1FW4 A;  1NX2 A;  5AER A;  4PCW A;  2JT0 A;  2BKI B;  3I5G B;  2LUC A;  1XK4 A;  1M46 A;  3NSI A;  2CNP A;  4GGN A;  1UUS A;  3PN7 B;  3WHT B;  5ER4 X;  2K61 A;  3LK1 A;  1BU3 A;  3JVT C;  3HCM A;  3OX5 A;  4FTG A;  1KWO B;  1GJY A;  3CS1 A;  2ZFD A;  3HX4 A;  5D69 A;  4PHM A;  4I5J A;  4MSP A;  3SJS A;  1V1F A;  1MR8 A;  5D7F A;  4C0K A;  2KFG A;  2LNK A;  1DJY A;  3VRP A;  5KTY A;  1SCM C;  4A4C A;  1YX7 A;  2WND A;  2LCP A;  2KGB C;  1QS7 A;  1XFU O;  1CM4 A;  2BCB A;  2Q4U A;  3EK4 A;  1QXP A;  1BOD A;  2I2R E;  2OTG B;  1YUR A;  1NX0 A;  2L5X B;  1L7Z A;  3PSR A;  3LLE A;  4FQO A;  1KFX S;  2LE9 B;  4GGF C;  1S1E A;  3TDZ A;  1MXE A;  1XFZ O;  2CT9 A;  2JUL A;  1OE9 B;  2I94 A;  4PE1 A;  2JZI A;  2MA2 A;  2MLF C;  2FCE A;  1DJZ A;  2EGD A;  4MVF A;  3SG6 A;  1B8R A;  2ZRT A;  4AQJ A;  1QAT A;  1XA5 A;  3VRO A;  3K21 A;  2HQ8 A;  3FS7 A;  2LV7 A;  3DVE A;  1W7J B;  4YBH B;  1S26 D;  2MLE C;  2OPO A;  2K7D A;  4ETO A;  3D0Y A;  2WOS A;  1YVL A;  3D0Y B;  3PAT A;  1JSA A;  1YX8 A;  1YVH A;  3KHE A;  2JU0 A;  1AK8 A;  3QRX A;  3VRQ A;  1PVA A;  4BY5 A;  1WRL A;  3EVV A;  5AFP A;  4MZJ A;  1J7P A;  3DVJ A;  1NIW A;  4I5N B;  3NSO A;  4I5K A;  1MXL C;  2PSR A;  4OVN F;  1K9U A;  2H61 A;  4NDB A;  2BBN A;  2MBX A;  1MWN A;  1PAL A;  1EG4 A;  2BEC A;  1S3P A;  4AOM A;  4CFQ A;  1TNP A;  1C07 A;  1F8H A;  1JWD A;  5K89 A;  2L4H A;  1XFY O;  1DJI A;  4GPL B;  2D8N A;  1N65 A;  3CR4 X;  3NSL A;  1K9P A;  1ZAC A;  2BE6 A;  1SW8 A;  2MHH A; 
#chains in the Genus database with same CATH topology
 4PE7 A;  2JNF A;  2QDI A;  1M45 A;  2AAO A;  3FWB A;  1AHR A;  2KPH A;  4XJK A;  4XJK B;  1CFD A;  1SMG A;  1B8C A;  2H8V A;  1F55 A;  1TOP A;  1GM0 A;  1DEK A;  5F6T A;  3DZT A;  2KQ6 A;  4M2Q A;  1AJ5 A;  4A4B A;  2P6B B;  4HSZ A;  2LMT A;  1XYD A;  1UWO A;  2KSP A;  1WDC C;  2L4I A;  1CDM A;  3D76 A;  2LVJ A;  1K8U A;  1K95 A;  2GGM A;  4P5O E;  1IQ5 A;  1RFJ A;  1G4Y R;  1SBJ A;  3I5H B;  3R1P A;  2MRD A;  3FE8 A;  4PE4 A;  2LMV A;  1TNQ A;  3H4S E;  4MZL A;  3BOW A;  1OOF A;  1B9A A;  3BOW B;  1R2U A;  2HET A;  3A8R A;  1TWO A;  1NCZ A;  3JTD B;  3PM8 A;  1J1E A;  2F8P A;  1JFJ A;  1QIW A;  3OB1 B;  3GK1 A;  2Q91 A;  3ICB A;  1DJH A;  1PVB A;  2WC8 A;  5EL2 A;  1XO5 A;  1YRT B;  1A2X A;  3CR5 X;  4YGB B;  1IGV A;  1NWD A;  3BUW B;  5HKW A;  3SG3 A;  1KK8 C;  4F7F A;  1ZFS A;  1C3Y A;  4ICB A;  4DUQ A;  1DC1 A;  1KSM A;  3BUO B;  4NDC A;  1DQE A;  1JC2 A;  5CSJ A;  2LC5 A;  2JTZ A;  2BAP A;  4JQ0 D;  1C3Z A;  1WLM A;  2BKH B;  2KI6 D;  3CLN A;  3O2P A;  2KFH A;  1TTX A;  1IJ5 A;  1GGW A;  2A4J A;  2WCK A;  2JPT A;  2QEO A;  2BNX A;  1KCY A;  2H2K A;  3B87 A;  3LCP C;  4PAL A;  1V1G A;  1LIN A;  1GGZ A;  1NCY A;  3KEV A;  1J7O A;  1NCX A;  1QX7 A;  4OZD A;  1YR5 A;  5J3X A;  2LVI A;  3R72 A;  1TCF A;  1TNW A;  2ISD A;  1D1O A;  2GV5 A;  2HF5 A;  1SR6 C;  1UHI A;  3RZS A;  2KBI A;  3AAK A;  3S0E A;  2TN4 A;  3BUX B;  2K0J A;  4NQG A;  1FBV A;  1S5G Y;  2Y1M A;  2L50 A;  2MAZ A;  3GK4 X;  3VGO A;  1ALW A;  3BQ3 A;  2L0P A;  2LAN A;  1J55 A;  1DVI A;  3K1E A;  3EKJ A;  2KI6 C;  1CB1 A;  5I8N A;  3CAB A;  3S0D A;  2F2O A;  4ORC B;  5I2O A;  2EC6 C;  2WCJ A;  2WCE A;  1TN4 A;  1S6C A;  4I5L B;  3TZ1 A;  4MRY A;  2O60 A;  1M63 B;  3KF9 A;  1WRK A;  2JNX A;  4CPV A;  2SCP A;  1Y1U A;  1XFV O;  1ZMZ A;  1XFW O;  3D75 A;  2M9G A;  2L2C A;  2WCH A;  1OZO A;  3AAJ A;  5HL1 A;  4QJ4 B;  2GGZ A;  1IH0 A;  1Y1A A;  1UP5 A;  1J7Q A;  3I5F B;  1MQ1 A;  4N1G A;  3L47 A;  2QAC A;  1JFK A;  1QWV A;  3EKH A;  2M3W A;  3OP0 A;  3O78 A;  3AKB A;  1YRU B;  3CZ1 A;  2BL0 C;  2M1U A;  1DT7 B;  1JF2 A;  1QLK A;  1SK6 D;  1UHK A;  1Q80 A;  1QLS A;  3BFH A;  3SS3 A;  1IJ6 A;  1N2D A;  3DD4 A;  2KI4 B;  2WOR A;  1CNP A;  1IRJ A;  4DS7 A;  1RK9 A;  1SY9 A;  1UUR A;  2K2A A;  2QPT A;  1J1D A;  4FQT A;  5TNC A;  4DRW A;  1QX5 B;  2NCP A;  1K90 D;  2E30 A;  3I5I B;  2KOT A;  3CZT X;  3RM1 A;  2QEH A;  5DKN A;  1LXF C;  2LHL A;  2OS8 C;  5FYX A;  1FPW A;  5FI6 A;  1CKK A;  3SG2 A;  1KSO A;  1QV0 A;  3NHT A;  3CTN A;  4JD9 A;  5AEQ A;  2K60 A;  2KLE A;  3SG5 A;  1SL7 A;  1C7V A;  3CR2 A;  3SIB A;  2CBL A;  3EVU A;  3ZWH A;  1L2O B;  2NCO A;  2LVK A;  1TRF A;  4IJ7 A;  1F4O A;  1VRK A;  2VRG A;  5CSI A;  4PT1 A;  1OZS A;  4C0L A;  3IQQ A;  5IBW A;  1OOJ A;  1KFU L;  1DGV A;  3FE9 A;  4ORA B;  3FIA A;  3IQO A;  5BPJ A;  3SG7 A;  2LVV A;  2WCF A;  4N1F A;  2KDH A;  2LLT A;  3JVT B;  1EJ3 A;  1W7I B;  4M2P A;  3NSK A;  3GK2 A;  3D10 A;  2K2F A;  5CSN A;  2ZNE A;  3I5G C;  3EVR A;  3KO0 A;  1J7R A;  4GUK A;  1XK4 C;  2M29 A;  1DJW A;  1NSH A;  1OMV A;  1SL9 A;  1TUZ A;  3PN7 C;  1B7T Y;  1AUI B;  1CTR A;  2BCA A;  2PRU A;  2L51 A;  2PYQ A;  4TNC A;  5DKR A;  1H8B A;  3BXK A;  1ODB A;  1KWO C;  2BBM A;  4MRX A;  1DEL A;  1SCM B;  4R1E A;  1CFF A;  1SRA A;  2K7C A;  2CCM A;  5ER5 A;  3C1V A;  3R1O A;  1YUT A;  5GQQ C;  1EXR A;  1JF0 A;  1DF0 A;  1S6I A;  1E8A A;  1DF0 B;  1U5I A;  1U5I B;  1SL8 A;  1F4Q A;  2K7B A;  3PLF B;  5PAL A;  1BR4 B;  1AVS A;  4P2Y B;  2O5G A;  1K9K A;  4GGF A;  1OSA A;  1NX1 A;  2LM5 A;  1LA0 A;  1QV1 A;  1ZUZ A;  1HQV A;  2KLD A;  2F33 A;  2FJU B;  3SG4 A;  1KK7 Y;  1CMF A;  1CMG A;  1X02 A;  2OTG C;  4YGC B;  2KHN A;  1SNL A;  2FCD A;  2LHI A;  1EG3 A;  4DCK A;  4WQ3 A;  3BYA A;  3IVT A;  5CSF A;  4GFT A;  1RRO A;  3OX6 A;  4N5X A;  3LK0 A;  4MZK A;  1Y6W A;  2K8M B;  2PQL A;  3TUY B;  5CPV A;  1KK7 Z;  5I2Q A;  2WCL A;  4YGE B;  4CLN A;  1WLZ A;  4JWQ A;  2I18 A;  2KAY A;  2HPS A;  1B4C A;  2LLS A;  1RWY A;  1QVI Y;  3SS5 A;  2SAS A;  1T14 A;  1CDL A;  2LAP A;  2F3Y A;  4YGA A;  1QAS A;  4D1E A;  2KI4 C;  2ZKM X;  4QJ5 B;  1F70 A;  3TS5 B;  3DF0 A;  2BE4 A;  1OQP A;  2Y4Q A;  4PDZ A;  3RLZ A;  1CLB A;  2KNE A;  1EH2 A;  1CDP A;  2PMY A;  1IQ3 A;  2JTT A;  4PHJ A;  1DMO A;  2IS9 A;  2P71 A;  1SCV A;  4QJ3 B;  1LKJ A;  1CLM A;  3NHI A;  2WC6 A;  2GTE A;  3SIA A;  4ZCU A;  4BY4 A;  1A4P A;  3M0W A;  5I2L A;  1B47 A;  1UHJ A;  2M1K B;  1DGU A;  2PVB A;  3LL8 B;  4OV2 A;  1OMD A;  1KQM B;  1WY9 A;  3BFB A;  1Y1X A;  1S5G Z;  2KYC A;  3DXL A;  4OCI A;  1PRW A;  4GBA A;  1SSE B;  2ZND A;  4DIR A;  3R1V A;  3PAL A;  3FWC A;  3DVK A;  2V53 A;  2Y1N A;  2LP2 A;  2ZN8 A;  2RGI A;  1G8I A;  1A03 A;  4JPZ B;  2KYF A;  1A75 A;  1A75 B;  2LUX A;  3AKA A;  4XYN A;  2EHB A;  1WDC B;  2FOT A;  4HRH A;  2LLU A;  2G2B A;  1JBA A;  3KPX A;  2L2E A;  1WRZ A;  1KQV A;  1PUL A;  2MJW B;  3CDN A;  3DYE A;  4IL1 A;  1CM1 A;  1TIZ A;  3BUN B;  2I7A A;  1AP4 A;  4KYN A;  4MLW A;  2M7N A;  3FE6 A;  1SKT A;  1A29 A;  1K96 A;  4E68 A;  3I5H C;  1ZOT B;  5HKY A;  1ALV A;  2WCB A;  3B6X A;  5FI7 A;  1KK8 B;  5AXI A;  1K2H A;  1BR1 B;  1UHH A;  3B7A A;  1PSB A;  1QJT A;  3NXA A;  1DJG A;  3PFV A;  3JTD C;  1KFX L;  1QIV A;  2JT8 A;  4NDD A;  1B8L A;  3B88 A;  4HRE E;  4M2O A;  3S0G A;  4JKT A;  5HYD A;  1F54 A;  4GNK B;  5FI2 A;  1IWQ A;  1JUO A;  5G08 A;  2BCX A;  2QEB A;  3D74 A;  2CTN A;  4YRU A;  1GQM A;  1REC A;  3PJI A;  1CFC A;  1SYM A;  1YUU A;  3EK8 A;  3MSE B;  5KU1 A;  1FI5 A;  1LA3 A;  2JC2 A;  2LP3 A;  1BJF A;  1MF8 B;  1N0Y A;  2KAV A;  3DVM A;  2PAS A;  2DOQ A;  1M31 A;  3F45 A;  1RTP 1;  3TUY C;  1R6P A;  4WQ2 A;  4MN0 A;  3NGV A;  5DKQ A;  3S0B A;  2HQW A;  1CDN A;  1K94 A;  1KFU S;  4UPG A;  4ZCV A;  3CWG A;  3E3R A;  1PK0 D;  1SR6 B;  2QEV A;  4OR9 B;  3B86 A;  2JXL A;  1YUS A;  4PHK A;  3VRN A;  2KFF A;  3BJH A;  4GAO A;  3TS5 C;  1FI6 A;  5KSZ A;  1LVC D;  5D3O A;  1M39 A;  2KQY A;  2G9B A;  1ORG A;  2E6W A;  3WNX B;  1H4B A;  4USL A;  2F2P A;  3IF7 A;  3VRR A;  1BMO A;  1QTX A;  1G33 A;  2JOJ A;  1AJ4 A;  1NPQ A;  1BOC A;  4YI9 A;  1OOG A;  1XFX O;  2AMI A;  2JRF A;  2EC6 B;  1YTZ C;  2NXQ A;  3WHU B;  2AUC A;  1BT6 A;  3EG5 B;  4OKH A;  1B7T Z;  1PSR A;  2M8U A;  1KQM C;  1OMR A;  1SPY A;  2B1U A;  2R2I A;  3EK7 A;  1RJV A;  4HRG A;  2M7L A;  2KAX A;  1TNX A;  2M97 A;  1C7W A;  2CXJ A;  3TDI A;  2JQ6 A;  2LMU A;  2Y5I A;  1CLL A;  2NLN A;  1NYA A;  3OHM B;  4Q04 A;  1F71 A;  2FJY A;  4PHN A;  3VB1 A;  1OOI X;  2WCM A;  3UNW A;  1Y0V H;  3CGA A;  4YGD B;  4AQI A;  1K93 D;  3TDU A;  1BF5 A;  4U8D A;  2BL0 B;  3S0A A;  2L98 A;  3I5F C;  4INW A;  1HT9 A;  4MBE A;  2PAL A;  1EL4 A;  3V2L A;  4WRI A;  1MUX A;  1S6J A;  1TCO B;  5JJG A;  3CZ2 A;  3O6B A;  1IKU A;  4F0Z B;  3GOF A;  4YI8 A;  1NUB A;  1NX3 A;  3DY9 A;  3O4Y A;  3OB2 B;  5AAN A;  3WXA A;  3ZNI A;  1CFP A;  3OBV A;  4L9M A;  2OS8 B;  1BLQ A;  3DF0 B;  5B8I B;  1QVI Z;  1XVJ A;  4ORB B;  5I94 A;  5HLV A;  2M0R A;  3Q8I A;  4INX A;  1NP8 A;  1QX2 A;  3A4U B;  3BUM B;  2F3Z A;  1DTL A;  1TUJ A;  1UHN A;  2JT3 A;  3I5I C;  4PE0 A;  2L5Y A;  3L4A A;  4C0J A;  1IG5 A;  3D77 A;  5HKZ A;  3S0F A;  1MHO A;  1P28 A;  2JXC A;  2H61 C;  2M49 B;  1BG1 A;  2COL B;  2ZRS A;  2KGR A;  1FF1 A;  5HLO A;  2K7O A;  1DJX A;  4MEW A;  1B1G A;  2ZN9 A;  5JOL A;  1L2O C;  2KBM A;  4CFR A;  2JWW A;  1S36 A;  2NZ0 A;  4CID A;  1FW4 A;  1NX2 A;  1XFR A;  5AER A;  4PCW A;  3D73 A;  2JT0 A;  2BKI B;  3I5G B;  2LUC A;  1XK4 A;  1M46 A;  3NSI A;  2CNP A;  4GGN A;  1UUS A;  3PN7 B;  3WHT B;  5ER4 X;  2K61 A;  3LK1 A;  1BU3 A;  3JVT C;  3HCM A;  3OX5 A;  3D78 A;  2P70 A;  4FTG A;  1KWO B;  1GJY A;  2JPO A;  3BFA A;  3CS1 A;  1J7P A;  2ZFD A;  3HX4 A;  5D69 A;  5DIC A;  4PHM A;  4I5J A;  3UO9 A;  4MSP A;  3SJS A;  1V1F A;  1MR8 A;  5D7F A;  4C0K A;  1OOH A;  2KFG A;  2LNK A;  1DJY A;  3VRP A;  5KTY A;  3OGN A;  1OW4 A;  1SCM C;  4A4C A;  1YX7 A;  2WND A;  3CZ0 A;  2LCP A;  2KGB C;  2YGU A;  1QS7 A;  1XFU O;  1CM4 A;  2BCB A;  2Q4U A;  3EK4 A;  1QXP A;  1Z4H A;  1BOD A;  2I2R E;  2OTG B;  1YUR A;  1NX0 A;  2L5X B;  1L7Z A;  3PSR A;  3LLE A;  4FQO A;  1KFX S;  2LE9 B;  4GGF C;  3PM2 A;  1S1E A;  3TDZ A;  1MXE A;  1XFZ O;  2CT9 A;  3SS4 A;  2JUL A;  1OE9 B;  2I94 A;  4PE1 A;  2JZI A;  2MA2 A;  2MLF C;  3L4L A;  2FCE A;  1DJZ A;  2EGD A;  4MVF A;  3QME A;  1B8R A;  2ZRT A;  3SG6 A;  1QAT A;  4AQJ A;  1XA5 A;  3VRO A;  3O4X A;  3K21 A;  2HQ8 A;  3FS7 A;  2LV7 A;  3DVE A;  1W7J B;  1Z2C B;  4YBH B;  1S26 D;  2MLE C;  2OPO A;  2K7D A;  4ETO A;  3D0Y A;  2WOS A;  1YVL A;  3D0Y B;  3PAT A;  1JSA A;  1YX8 A;  1YVH A;  3KHE A;  2JU0 A;  1AK8 A;  3QRX A;  3VRQ A;  1PVA A;  4BY5 A;  1WRL A;  3EVV A;  5AFP A;  2ERB A;  4MZJ A;  3DVJ A;  1NIW A;  4I5N B;  3NSO A;  1W9Z A;  4I5K A;  1MXL C;  2PSR A;  4OVN F;  1K9U A;  2H61 A;  4NDB A;  2BBN A;  3N7H A;  1MWN A;  2MBX A;  1PAL A;  1EG4 A;  2BEC A;  2WC5 A;  1S3P A;  4AOM A;  1LS8 A;  4CFQ A;  1TNP A;  1C07 A;  1F8H A;  1JWD A;  5K89 A;  2L4H A;  1XFY O;  1DJI A;  4GPL B;  2D8N A;  1IIO A;  1N65 A;  3CR4 X;  3NSL A;  1K9P A;  1ZAC A;  2BE6 A;  3CYZ A;  1SW8 A;  2MHH A; 
#chains in the Genus database with same CATH homology
 4PE7 A;  2JNF A;  1M45 A;  2AAO A;  3FWB A;  1AHR A;  4XJK A;  4XJK B;  1CFD A;  1SMG A;  1B8C A;  1F55 A;  1TOP A;  5F6T A;  2KQ6 A;  4M2Q A;  1AJ5 A;  4A4B A;  2P6B B;  4HSZ A;  2LMT A;  1XYD A;  1UWO A;  2KSP A;  1WDC C;  2L4I A;  1CDM A;  4P5O E;  2LVJ A;  1K8U A;  1K95 A;  2GGM A;  1IQ5 A;  1RFJ A;  1G4Y R;  1SBJ A;  3I5H B;  4PE4 A;  2MRD A;  2LMV A;  1TNQ A;  3H4S E;  4MZL A;  3BOW A;  1B9A A;  3BOW B;  1R2U A;  2HET A;  3A8R A;  3PM8 A;  1NCZ A;  3JTD B;  1J1E A;  2F8P A;  1JFJ A;  1QIW A;  3OB1 B;  3GK1 A;  2Q91 A;  3ICB A;  1DJH A;  1PVB A;  2WC8 A;  1XO5 A;  1YRT B;  1A2X A;  3CR5 X;  4YGB B;  1IGV A;  1NWD A;  3BUW B;  5HKW A;  3SG3 A;  1KK8 C;  1ZFS A;  4ICB A;  4DUQ A;  1KSM A;  3BUO B;  4NDC A;  1JC2 A;  5CSJ A;  2LC5 A;  2JTZ A;  4JQ0 D;  2BKH B;  1WLM A;  2KI6 D;  3CLN A;  3O2P A;  2KFH A;  1TTX A;  1IJ5 A;  1GGW A;  2A4J A;  2JPT A;  1KCY A;  2H2K A;  3LCP C;  4PAL A;  1V1G A;  1LIN A;  1GGZ A;  1NCY A;  3KEV A;  1J7O A;  1NCX A;  1QX7 A;  5J3X A;  1YR5 A;  2LVI A;  1TCF A;  1TNW A;  2ISD A;  1D1O A;  2GV5 A;  2HF5 A;  1SR6 C;  1UHI A;  2KBI A;  3AAK A;  2TN4 A;  3BUX B;  2K0J A;  4NQG A;  1FBV A;  1S5G Y;  2Y1M A;  2L50 A;  2MAZ A;  3GK4 X;  3VGO A;  1ALW A;  3BQ3 A;  2L0P A;  2LAN A;  1J55 A;  1DVI A;  1CB1 A;  3EKJ A;  2KI6 C;  5I8N A;  2F2O A;  4ORC B;  5I2O A;  2EC6 C;  2WCE A;  1TN4 A;  1S6C A;  4I5L B;  3TZ1 A;  4MRY A;  2O60 A;  1M63 B;  3KF9 A;  1WRK A;  2JNX A;  4CPV A;  2SCP A;  1Y1U A;  1XFV O;  1ZMZ A;  1XFW O;  2M9G A;  1OZO A;  3AAJ A;  4QJ4 B;  2GGZ A;  1IH0 A;  1Y1A A;  1UP5 A;  1J7Q A;  3I5F B;  1MQ1 A;  4N1G A;  2QAC A;  1JFK A;  3EKH A;  2M3W A;  3OP0 A;  3O78 A;  3AKB A;  1YRU B;  2BL0 C;  2M1U A;  1DT7 B;  1JF2 A;  1QLK A;  1SK6 D;  1UHK A;  1Q80 A;  1QLS A;  1IJ6 A;  1N2D A;  3DD4 A;  2KI4 B;  2WOR A;  1CNP A;  1IRJ A;  4DS7 A;  1RK9 A;  1SY9 A;  1UUR A;  2K2A A;  2QPT A;  1J1D A;  5TNC A;  4DRW A;  1QX5 B;  2NCP A;  1K90 D;  2E30 A;  3I5I B;  2KOT A;  3CZT X;  3RM1 A;  5DKN A;  1LXF C;  2LHL A;  2OS8 C;  5FYX A;  1FPW A;  1CKK A;  3SG2 A;  1KSO A;  1QV0 A;  3CTN A;  5AEQ A;  3SG5 A;  1SL7 A;  1C7V A;  3CR2 A;  3SIB A;  2CBL A;  3EVU A;  3ZWH A;  1L2O B;  2NCO A;  2LVK A;  1TRF A;  1F4O A;  1VRK A;  2VRG A;  5CSI A;  4C0L A;  1OZS A;  3IQQ A;  5IBW A;  1OOJ A;  1KFU L;  1DGV A;  4ORA B;  3FIA A;  3IQO A;  5BPJ A;  2LVV A;  2WCF A;  4N1F A;  2KDH A;  2LLT A;  3JVT B;  1EJ3 A;  1W7I B;  4M2P A;  3NSK A;  3GK2 A;  3D10 A;  2K2F A;  5CSN A;  2ZNE A;  3I5G C;  3EVR A;  3KO0 A;  1J7R A;  4GUK A;  1XK4 C;  2M29 A;  1DJW A;  1NSH A;  1OMV A;  1SL9 A;  3PN7 C;  1B7T Y;  1AUI B;  1CTR A;  2BCA A;  2PRU A;  2L51 A;  4TNC A;  5DKR A;  3SG7 A;  1H8B A;  3BXK A;  1ODB A;  1KWO C;  2BBM A;  4MRX A;  1SCM B;  4R1E A;  1CFF A;  1SRA A;  2K7C A;  2CCM A;  5ER5 A;  3C1V A;  5GQQ C;  1YUT A;  1EXR A;  1JF0 A;  1DF0 A;  1S6I A;  1E8A A;  1DF0 B;  1U5I A;  1U5I B;  1SL8 A;  1F4Q A;  2K7B A;  3PLF B;  5PAL A;  1BR4 B;  1AVS A;  4P2Y B;  2O5G A;  1K9K A;  4GGF A;  1OSA A;  1NX1 A;  2LM5 A;  1LA0 A;  1QV1 A;  1ZUZ A;  1HQV A;  2F33 A;  2FJU B;  3SG4 A;  1KK7 Y;  1CMF A;  1CMG A;  1X02 A;  2OTG C;  4YGC B;  2KHN A;  1SNL A;  2FCD A;  2LHI A;  1EG3 A;  4DCK A;  4WQ3 A;  3BYA A;  5CSF A;  4GFT A;  1RRO A;  3OX6 A;  4N5X A;  3LK0 A;  4MZK A;  1Y6W A;  2K8M B;  3TUY B;  5CPV A;  1KK7 Z;  5I2Q A;  4YGE B;  4CLN A;  1WLZ A;  4JWQ A;  2I18 A;  2KAY A;  2HPS A;  1B4C A;  2LLS A;  1RWY A;  1QVI Y;  2SAS A;  1CDL A;  2LAP A;  2F3Y A;  4YGA A;  1QAS A;  4D1E A;  2KI4 C;  2ZKM X;  4QJ5 B;  1F70 A;  3TS5 B;  3DF0 A;  2BE4 A;  1OQP A;  2Y4Q A;  4PDZ A;  3RLZ A;  1CLB A;  2KNE A;  1EH2 A;  1CDP A;  2PMY A;  1IQ3 A;  2JTT A;  4PHJ A;  1DMO A;  2IS9 A;  1SCV A;  4QJ3 B;  1LKJ A;  1CLM A;  3SIA A;  4ZCU A;  4BY4 A;  1A4P A;  3M0W A;  5I2L A;  1B47 A;  1UHJ A;  2M1K B;  1DGU A;  2PVB A;  3LL8 B;  4OV2 A;  1OMD A;  1KQM B;  1WY9 A;  1Y1X A;  1S5G Z;  2KYC A;  4OCI A;  1PRW A;  4GBA A;  2ZND A;  4DIR A;  3PAL A;  3FWC A;  3DVK A;  2V53 A;  2Y1N A;  2LP2 A;  2ZN8 A;  2RGI A;  1G8I A;  1A03 A;  4JPZ B;  2KYF A;  1A75 A;  1A75 B;  2LUX A;  3AKA A;  4XYN A;  2EHB A;  1WDC B;  2FOT A;  4HRH A;  2LLU A;  2G2B A;  1JBA A;  3KPX A;  2L2E A;  1WRZ A;  1KQV A;  1PUL A;  2MJW B;  4IL1 A;  1CM1 A;  1TIZ A;  3BUN B;  2I7A A;  1AP4 A;  4MLW A;  2M7N A;  1SKT A;  1A29 A;  1K96 A;  4E68 A;  3I5H C;  1ZOT B;  5HKY A;  1ALV A;  2WCB A;  1KK8 B;  5AXI A;  1K2H A;  1BR1 B;  1UHH A;  1PSB A;  1QJT A;  3NXA A;  1DJG A;  3PFV A;  3JTD C;  1KFX L;  1QIV A;  2JT8 A;  4NDD A;  1B8L A;  4HRE E;  4M2O A;  1F54 A;  5HYD A;  4GNK B;  1IWQ A;  1JUO A;  5G08 A;  2BCX A;  2CTN A;  4YRU A;  1GQM A;  1REC A;  1CFC A;  1SYM A;  1YUU A;  3EK8 A;  3MSE B;  5KU1 A;  1FI5 A;  1LA3 A;  2JC2 A;  2LP3 A;  1BJF A;  1MF8 B;  1N0Y A;  2KAV A;  3DVM A;  2PAS A;  2DOQ A;  1M31 A;  3F45 A;  1RTP 1;  3TUY C;  1R6P A;  4WQ2 A;  4MN0 A;  5DKQ A;  2HQW A;  1CDN A;  1K94 A;  1KFU S;  4UPG A;  4ZCV A;  3CWG A;  3E3R A;  1PK0 D;  1SR6 B;  4OR9 B;  4PHK A;  2JXL A;  1YUS A;  3VRN A;  2KFF A;  4GAO A;  3TS5 C;  1FI6 A;  5KSZ A;  1LVC D;  1M39 A;  2KQY A;  2G9B A;  2E6W A;  3WNX B;  1H4B A;  4USL A;  2F2P A;  3IF7 A;  3VRR A;  1BMO A;  1QTX A;  1G33 A;  2JOJ A;  1AJ4 A;  1NPQ A;  1BOC A;  4YI9 A;  1XFX O;  2AMI A;  2JRF A;  2EC6 B;  1YTZ C;  2NXQ A;  3WHU B;  2AUC A;  1BT6 A;  4OKH A;  1B7T Z;  1PSR A;  2M8U A;  1KQM C;  1OMR A;  1SPY A;  2B1U A;  2R2I A;  3EK7 A;  1RJV A;  4HRG A;  2M7L A;  2KAX A;  1TNX A;  2M97 A;  1C7W A;  2CXJ A;  3TDI A;  2JQ6 A;  2LMU A;  2Y5I A;  1CLL A;  2NLN A;  1NYA A;  3OHM B;  4Q04 A;  1F71 A;  4PHN A;  1Y0V H;  3CGA A;  4YGD B;  4AQI A;  1K93 D;  3TDU A;  1BF5 A;  4U8D A;  2BL0 B;  2L98 A;  3I5F C;  1HT9 A;  4MBE A;  2PAL A;  1EL4 A;  4WRI A;  1MUX A;  1S6J A;  1TCO B;  5JJG A;  1IKU A;  3O6B A;  4F0Z B;  3GOF A;  4YI8 A;  1NUB A;  1NX3 A;  3O4Y A;  3OB2 B;  5AAN A;  3WXA A;  3ZNI A;  1CFP A;  4L9M A;  2OS8 B;  1BLQ A;  3DF0 B;  5B8I B;  1QVI Z;  1XVJ A;  4ORB B;  5HLV A;  2M0R A;  1NP8 A;  1QX2 A;  3A4U B;  3BUM B;  2F3Z A;  1DTL A;  1UHN A;  2JT3 A;  3I5I C;  4PE0 A;  4C0J A;  1IG5 A;  5HKZ A;  1MHO A;  2JXC A;  1BG1 A;  2H61 C;  2M49 B;  2COL B;  2ZRS A;  2KGR A;  1FF1 A;  5HLO A;  2K7O A;  1DJX A;  4MEW A;  1B1G A;  2ZN9 A;  5JOL A;  1L2O C;  2KBM A;  4CFR A;  2JWW A;  1S36 A;  2NZ0 A;  4CID A;  1FW4 A;  1NX2 A;  5AER A;  4PCW A;  2JT0 A;  2BKI B;  3I5G B;  2LUC A;  1XK4 A;  1M46 A;  3NSI A;  2CNP A;  4GGN A;  1UUS A;  3PN7 B;  3WHT B;  5ER4 X;  2K61 A;  3LK1 A;  1BU3 A;  3JVT C;  3HCM A;  3OX5 A;  4FTG A;  1KWO B;  1GJY A;  3CS1 A;  2ZFD A;  3HX4 A;  5D69 A;  4PHM A;  4I5J A;  4MSP A;  3SJS A;  1V1F A;  1MR8 A;  5D7F A;  4C0K A;  2KFG A;  2LNK A;  1DJY A;  3VRP A;  5KTY A;  1SCM C;  4A4C A;  1YX7 A;  2WND A;  2LCP A;  2KGB C;  1QS7 A;  1XFU O;  1CM4 A;  2BCB A;  2Q4U A;  3EK4 A;  1QXP A;  1BOD A;  2I2R E;  2OTG B;  1YUR A;  1NX0 A;  2L5X B;  1L7Z A;  3PSR A;  3LLE A;  4FQO A;  1KFX S;  2LE9 B;  4GGF C;  1S1E A;  3TDZ A;  1MXE A;  1XFZ O;  2CT9 A;  2JUL A;  1OE9 B;  2I94 A;  4PE1 A;  2JZI A;  2MA2 A;  2MLF C;  2FCE A;  1DJZ A;  2EGD A;  4MVF A;  3SG6 A;  1B8R A;  2ZRT A;  4AQJ A;  1QAT A;  1XA5 A;  3VRO A;  3K21 A;  2HQ8 A;  3FS7 A;  2LV7 A;  3DVE A;  1W7J B;  4YBH B;  1S26 D;  2MLE C;  2OPO A;  2K7D A;  4ETO A;  3D0Y A;  2WOS A;  1YVL A;  3D0Y B;  3PAT A;  1JSA A;  1YX8 A;  1YVH A;  3KHE A;  2JU0 A;  1AK8 A;  3QRX A;  3VRQ A;  1PVA A;  4BY5 A;  1WRL A;  3EVV A;  5AFP A;  4MZJ A;  1J7P A;  3DVJ A;  1NIW A;  4I5N B;  3NSO A;  4I5K A;  1MXL C;  2PSR A;  4OVN F;  1K9U A;  2H61 A;  4NDB A;  2BBN A;  2MBX A;  1MWN A;  1PAL A;  1EG4 A;  2BEC A;  1S3P A;  4AOM A;  4CFQ A;  1TNP A;  1C07 A;  1F8H A;  1JWD A;  5K89 A;  2L4H A;  1XFY O;  1DJI A;  4GPL B;  2D8N A;  1N65 A;  3CR4 X;  3NSL A;  1K9P A;  1ZAC A;  2BE6 A;  1SW8 A;  2MHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...