3CR2A

X-ray structure of bovine zn(2+),ca(2+)-s100b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
90
structure length
90
Chain Sequence
b'MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Divalent metal ion complexes of S100B in the absence and presence of pentamidine.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 29
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cr2A00
2ZNDA 1EL4A 1B8CA 2L4IA 4CFRA 2PMYA 3SG4A 2AAOA 2LC5A 1NX1A 1M45A 3LL8B 1S6JA 1XFWO 1S1EA 2F2OA 1A4PA 2FJUB 2K8MB 4P2YB 2LVJA 1TIZA 3K21A 2WCFA 2KOTA 5HKWA 1F54A 1WY9A 4GUKA 1S6IA 4MLWA 4PCWA 2H61C 2K7CA 5TNCA 4USLA 3PLFB 2Y5IA 1TRFA 3FS7A 1RECA 1MWNA 1CB1A 1U5IB 2KAYA 4GAOA 1RJVA 3CR2A 1PSRA 3VGOA 4F0ZB 4AQJA 2G9BA 1SKTA 1QLSA 2KAXA 4WQ2A 1QLKA 2CT9A 4OR9B 2WOSA 1KFUL 4GBAA 4QJ3B 3SG5A 1UURA 1H4BA 2SCPA 3PSRA 1CFFA 1SMGA 1A75A 1R6PA 1DGVA 1WRKA 2K2AA 1CLBA 1QTXA 2M97A 4CIDA 5B8IB 1SL7A 4GNKB 4JQ0D 3HX4A 1DJHA 4N5XA 3BOWB 2MBXA 1AHRA 1K90D 4PALA 1QV0A 5D7FA 4HSZA 4Q04A 1QS7A 1OSAA 2KHNA 4FTGA 1A03A 2JXLA 4MRYA 3RM1A 3DD4A 3SG6A 1FPWA 1S26D 1J7OA 2KSPA 1UHKA 1F4QA 2LVKA 2LM5A 2M3WA 3ICBA 1NX2A 1W7IB 4BY5A 1NX0A 5AANA 1BR1B 1JFJA 4CPVA 2BECA 1SNLA 1S6CA 3KF9A 4PHJA 2LCPA 1NCYA 1KQMB 4M2QA 1UHNA 1QASA 3LK0A 1H8BA 1CDLA 1YUSA 3CTNA 4YGAA 2HETA 2NCPA 1CFDA 1BT6A 3MSEB 1DGUA 5I8NA 2NCOA 3EKHA 3VRRA 1JSAA 1KCYA 4GGFA 2GGZA 3NSIA 4YGDB 3TS5B 2K61A 1QX5B 1ZOTB 1JUOA 5BPJA 4DRWA 1CKKA 1QVIZ 2JU0A 2KFHA 1Y1XA 3PFVA 3I5GC 1J1EA 3TUYB 1M63B 3NSLA 4GGFC 1JBAA 3PATA 1K8UA 1TNQA 1PVAA 2LUCA 1KQMC 1KFXL 5CSNA 5ER4X 4A4BA 1GQMA 2ZRTA 1JWDA 1DTLA 5HLVA 1L2OC 1LVCD 4QJ4B 1XK4C 1XYDA 1BF5A 1S5GY 3OX5A 4C0KA 1SYMA 3CR5X 2JOJA 1K9KA 2SASA 1CFCA 4GFTA 2GV5A 3GK1A 3OX6A 4PE0A 4ZCUA 1NIWA 1YVHA 3LCPC 2F3YA 1HT9A 1QVIY 1HQVA 1XFXO 1VRKA 1DJYA 1OE9B 1WDCC 1CLMA 3LK1A 4YGCB 3EK8A 5AERA 1CFPA 2LLSA 1IH0A 1J7RA 1AP4A 1X02A 3H4SE 5HLOA 4MZKA 2M1UA 4XYNA 4AQIA 4MSPA 1CMFA 2LVIA 1J55A 1KWOB 2HQWA 1XA5A 2TN4A 1NX3A 4OKHA 5PALA 3EVUA 1XFYO 2WCBA 4DS7A 1K9PA 1CM1A 1LA3A 2EGDA 4P5OE 2M7LA 2F8PA 2KNEA 1YVLA 1QXPA 3CR4X 1PRWA 4ORBB 2H61A 2CXJA 2LLUA 3I5HC 3FWCA 1BR4B 1JFKA 1EXRA 1GJYA 3DVEA 3IF7A 3GOFA 3PN7B 5GQQC 3DVMA 1WRLA 3EK7A 2ISDA 1SY9A 2LMTA 3NSOA 1B8RA 5F6TA 4ORAB 1IRJA 2JNXA 1UHJA 2I94A 1V1FA 2KYCA 1MF8B 1K94A 1AJ5A 1LINA 2JPTA 2NXQA 1WLZA 1IKUA 1XO5A 1Y6WA 3KHEA 2LUXA 1PSBA 4MBEA 1KWOC 1ZACA 2ZNEA 1GGWA 2LP3A 4R1EA 1C7VA 1G8IA 4PHMA 3D0YA 2JWWA 1AJ4A 1RROA 2EC6B 2I18A 4MZJA 5AXIA 4ZCVA 2FOTA 2GGMA 2BE6A 2LLTA 2M8UA 1KSOA 2OS8B 1RK9A 1UUSA 1A75B 2LV7A 2RGIA 4OV2A 5CSIA 1F8HA 2EHBA 3I5IB 2L2EA 5IBWA 4D1EA 1BJFA 2Q91A 5DKNA 2WC8A 3JTDB 1G4YR 2VRGA 1AK8A 1YTZC 1J7QA 3O2PA 5HKZA 2COLB 3BUXB 3AAJA 1MQ1A 3KPXA 1ALVA 1PULA 3D10A 3DVKA 3TDUA 1CDNA 2LMVA 1CTRA 2P6BB 3DF0A 1MHOA 2F33A 4N1FA 2HF5A 4C0JA 1SW8A 3BUWB 1SBJA 4I5KA 1YURA 1YX7A 1B4CA 3BOWA 1NCXA 4I5LB 1XVJA 3JVTB 2HQ8A 1YX8A 2A4JA 2JT3A 3I5IC 2KI4B 5K89A 3IQOA 4AOMA 1B8LA 2NLNA 1SRAA 1NUBA 4PE4A 2CNPA 3JTDC 1YRUB 1CM4A 1QATA 1UP5A 4BY4A 1K96A 1NWDA 4MEWA 1V1GA 3LLEA 2V53A 4MN0A 1ALWA 3CWGA 1FF1A 1NP8A 1SL9A 1D1OA 5HKYA 1OOJA 3DVJA 1DF0B 3TDZA 2OTGB 1R2UA 1TNPA 2KI6C 3ZNIA 4NDBA 4MVFA 1XK4A 1C7WA 2L5XB 1ZUZA 4L9MA 1UWOA 2K7BA 4GGNA 1M31A 1SCVA 2BKHB 1DJGA 1KK8B 3EVRA 4OCIA 2KI4C 2K0JA 1NYAA 3AKBA 3ZWHA 2JTTA 1XFVO 2JULA 3I5FB 3QRXA 3OB1B 3WNXB 1KQVA 2BBNA 1MUXA 3GK4X 2KBIA 2MAZA 2BL0B 4YI8A 4XJKB 1AUIB 1B1GA 4OVNF 2KDHA 1N65A 1XFUO 4NDDA 1BG1A 3A8RA 2LHIA 1Y0VH 1QX2A 1SR6B 3SG2A 4PE1A 4ORCB 1IQ5A 5CPVA 1OZSA 3TS5C 2MLFC 2O60A 1DJXA 3FWBA 2BE4A 2OTGC 2BBMA 2KFGA 1QV1A 5ER5A 1DJWA 1DJIA 1IG5A 2KQYA 2KFFA 2KBMA 1KK7Z 3EK4A 3TUYC 2MA2A 2LHLA 4DCKA 1WRZA 1TN4A 4FQOA 1YR5A 1CNPA 2E30A 2Y4QA 2ZN8A 1K95A 2E6WA 4JWQA 3NXAA 1IJ6A 1YRTB 3I5FC 1CMGA 1K2HA 1UHIA 1LA0A 1XFZO 2M9GA 3KO0A 1TTXA 1LKJA 3WHTB 1FI5A 1QJTA 1K9UA 2WORA 2JT8A 3GK2A 1WLMA 2LVVA 2QPTA 3VROA 3WXAA 4GPLB 1W7JB 2WCEA 2AMIA 2IS9A 1KSMA 4YGEB 1A29A 1SR6C 1TCOB 1TCFA 2JRFA 1B9AA 1KK7Y 3BQ3A 2LMUA 1S36A 3HCMA 3C1VA 3BUNB 2D8NA 2PSRA 1M39A 2JNFA 1UHHA 3TDIA 1TNXA 3AAKA 1QX7A 2L50A 3VRNA 3SIAA 3EKJA 1RTP1 5CSJA 2MHHA 1FI6A 2I2RE 2WNDA 5G08A 1C07A 1SL8A 3BYAA 4WRIA 2BCAA 3D0YB 3NSKA 2M49B 4TNCA 3CGAA 4ICBA 2JQ6A 1B47A 2JXCA 2KI6D 3BUOB 1IWQA 5JJGA 2JT0A 1IQ3A 1BOCA 4HRGA 2ZFDA 3OHMB 3PN7C 2L0PA 1U5IA 4PE7A 2LAPA 1SPYA 1OMRA 2LP2A 1Y1UA 4QJ5B 4YBHB 5J3XA 3A4UB 1DT7B 3KEVA 4YI9A 5CSFA 3VRPA 2JZIA 2Q4UA 4N1GA 2B1UA 3CZTX 1YUTA 4CFQA 1TOPA 4M2OA 3VRQA 3EVVA 5DKRA 4MRXA 3O78A 2MRDA 1EG3A 2CCMA 1KFUS 1M46A 2LE9B 2BCBA 1JF0A 3O6BA 2FCDA 1PK0D 3OB2B 3DF0B 1J7PA 1GGZA 5AEQA 2ZN9A 2MJWB 1OMDA 1Q80A 1A2XA 2EC6C 1EH2A 1F71A 1PVBA 5HYDA 4DIRA 1EG4A 3IQQA 1K93D 4DUQA 2CTNA 2K2FA 2OS8C 1OMVA 3FIAA 1FBVA 4I5JA 2PRUA 2Y1NA 4U8DA 1E8AA 1BU3A 3CS1A 3WHUB 1NPQA 1TNWA 4E68A 2HPSA 5KTYA 4YRUA 4UPGA 1IJ5A 1BMOA 2KYFA 3SG3A 2L4HA 1F4OA 4HREE 1MXEA 2L51A 1JC2A 3CLNA 2BCXA 3I5GB 2MLEC 1F70A 1QIVA 2LANA 3SG7A 4C0LA 2F3ZA 2KAVA 5AFPA 1BODA 1F55A 2K7DA 2OPOA 2LNKA 1L2OB 1Y1AA 1SCMB 1L7ZA 2M1KB 3JVTC 2AUCA 3SJSA 2FCEA 4JPZB 3BUMB 2DOQA 3RLZA 3PALA 4PHNA 1S5GZ 4A4CA 5D69A 1N2DA 1PALA 2M0RA 4HRHA 5I2LA 3SIBA 2L98A 1S3PA 1SK6D 3O4YA 4M2PA 4CLNA 1DMOA 2Y1MA 2M7NA 1WDCB 1OZOA 1DF0A 2ZKMX 5KU1A 3PM8A 4ETOA 1JF2A 3OP0A 1FW4A 3TZ1A 2KQ6A 2KGBC 2QACA 1IGVA 1B7TZ 1CDPA 1N0YA 1BLQA 2CBLA 4MZLA 1G33A 1KFXS 1CLLA 1CDMA 1RWYA 1NSHA 5KSZA 2H2KA 1NCZA 5JOLA 1AVSA 1MR8A 1SCMC 4PDZA 4WQ3A 2K7OA 3BXKA 2NZ0A 1OQPA 1LXFC 2M29A 1QIWA 1KK8C 2JTZA 3I5HB 4XJKA 3E3RA 1DVIA 2KGRA 4YGBB 2PALA 3M0WA 1EJ3A 5FYXA 5I2OA 2PVBA 1YUUA 2BKIB 3F45A 2G2BA 2JC2A 4PHKA 1DJZA 2PASA 4NQGA 2BL0C 2F2PA 5I2QA 1B7TY 1MXLC 2R2IA 3AKAA 1ODBA 1ZFSA 2ZRSA 4IL1A 1RFJA 1ZMZA 1J1DA 4NDCA 5DKQA 2O5GA 2I7AA 4I5NB
chains in the Genus database with same CATH superfamily
2ZNDA 1EL4A 1B8CA 2L4IA 4CFRA 2PMYA 3DY9A 2AAOA 2LC5A 1NX1A 1M45A 1TUJA 3LL8B 1S6JA 3SG4A 1XFWO 1S1EA 2F2OA 1A4PA 2FJUB 2K8MB 4P2YB 2LVJA 1TIZA 3K21A 2WCFA 2KOTA 5HKWA 1F54A 1WY9A 4GUKA 1S6IA 5FI2A 5D3OA 4MLWA 4PCWA 2H61C 2K7CA 5TNCA 4USLA 3PLFB 2Y5IA 1TRFA 3FS7A 3D76A 1RECA 1MWNA 3NHIA 3RZSA 1CB1A 1U5IB 2KAYA 4GAOA 1RJVA 3CR2A 1PSRA 3VGOA 3R1VA 4F0ZB 4AQJA 2G9BA 1SKTA 1QLSA 2KAXA 4WQ2A 1QLKA 2CT9A 4OR9B 2WOSA 1KFUL 4GBAA 4QJ3B 1XFRA 1SSEB 1UURA 3SG5A 1H4BA 3S0AA 2SCPA 3PSRA 1CFFA 1SMGA 1A75A 1R6PA 1DGVA 1WRKA 2K2AA 1CLBA 1QTXA 2M97A 4CIDA 5B8IB 1DEKA 1SL7A 4GNKB 4JQ0D 3HX4A 1DJHA 4N5XA 3BOWB 2MBXA 1AHRA 4F7FA 1K90D 4PALA 1QV0A 3NGVA 2KLEA 5D7FA 3FE6A 4HSZA 4Q04A 5DICA 1QS7A 1OSAA 2KHNA 4FTGA 1A03A 2JXLA 4MRYA 1W9ZA 3RM1A 3DD4A 3O4XA 3SG6A 1FPWA 1S26D 3UNWA 2KSPA 1J7OA 1UHKA 1F4QA 2LVKA 2LM5A 2M3WA 3ICBA 1NX2A 1W7IB 3L4AA 4BY5A 1NX0A 3D77A 5AANA 1BR1B 1JFJA 4CPVA 2BECA 1SNLA 1S6CA 3KF9A 4PT1A 2P70A 4PHJA 2LCPA 1NCYA 1KQMB 4M2QA 1UHNA 1QASA 3LK0A 1H8BA 1CDLA 1YUSA 2QEBA 2WCHA 3CTNA 4YGAA 2HETA 2NCPA 1IIOA 1CFDA 1BT6A 3MSEB 1DGUA 2P71A 5I8NA 2NCOA 3EKHA 3VRRA 1JSAA 1KCYA 3CYZA 5FI7A 4GGFA 2GGZA 3NSIA 4YGDB 1DC1A 3TS5B 2K61A 1QX5B 1ZOTB 1JUOA 3D78A 5BPJA 4DRWA 1CKKA 1QVIZ 2JU0A 3BFHA 2KFHA 3EG5B 3S0FA 4INXA 1Y1XA 3PFVA 3I5GC 1J1EA 3TUYB 1M63B 3NSLA 4GGFC 1JBAA 3PM2A 3PATA 1K8UA 1TNQA 1PVAA 2LUCA 1KQMC 1KFXL 5CSNA 5EL2A 5ER4X 1GQMA 4A4BA 2ZRTA 5FI6A 1JWDA 1DTLA 5HLVA 3VRPA 1L2OC 1LVCD 4QJ4B 1XK4C 1XYDA 1BF5A 1S5GY 3OX5A 4OZDA 4C0KA 1SYMA 1T14A 3CR5X 2JOJA 1K9KA 2SASA 3CDNA 1CFCA 4GFTA 2GV5A 3GK1A 3OX6A 4PE0A 4ZCUA 1NIWA 1YVHA 3LCPC 2F3YA 1HT9A 1QVIY 1HQVA 1XFXO 1VRKA 1DJYA 1OE9B 1WDCC 1CLMA 3LK1A 4YGCB 3EK8A 5AERA 1CFPA 2LLSA 2KPHA 3UO9A 1IH0A 1J7RA 3R72A 1AP4A 1X02A 3H4SE 5HLOA 4MZKA 2M1UA 4XYNA 4AQIA 1DELA 4MSPA 1CMFA 2LVIA 1J55A 1KWOB 2HQWA 3B87A 1XA5A 2TN4A 1NX3A 4OKHA 3BFAA 3EVUA 4INWA 1XFYO 2WCBA 5PALA 1K9PA 4DS7A 1CM1A 1LA3A 2EGDA 4P5OE 2M7LA 2F8PA 1P28A 2KNEA 1YVLA 1QXPA 3CR4X 1PRWA 4ORBB 2H61A 3Q8IA 2CXJA 2LLUA 3I5HC 4FQTA 3FE9A 3FWCA 2K60A 1BR4B 1JFKA 1EXRA 1GJYA 3DVEA 3IF7A 3GOFA 3PN7B 5GQQC 3DVMA 1WRLA 3EK7A 2ISDA 1SY9A 2LMTA 3NSOA 1B8RA 5F6TA 3QMEA 4ORAB 1IRJA 2JNXA 1UHJA 2I94A 1V1FA 2ERBA 2KYCA 1MF8B 1K94A 1AJ5A 1LINA 2JPTA 2NXQA 1WLZA 1IKUA 1XO5A 1Y6WA 3KHEA 2LUXA 1PSBA 4MBEA 1KWOC 1ZACA 2ZNEA 1GGWA 2LP3A 4R1EA 1C7VA 1G8IA 4PHMA 3D0YA 2JWWA 1AJ4A 1RROA 2EC6B 2I18A 4MZJA 5AXIA 2H8VA 2YGUA 4ZCVA 2FOTA 3S0EA 2GGMA 2BE6A 2LLTA 2M8UA 1KSOA 2OS8B 1RK9A 1UUSA 1A75B 2LV7A 2GTEA 2RGIA 4OV2A 5CSIA 3VB1A 2EHBA 3I5IB 1F8HA 2L2EA 2QEOA 5IBWA 4D1EA 1TWOA 1TUZA 1BJFA 2Q91A 5DKNA 2WC8A 3JTDB 2QDIA 1G4YR 2VRGA 1AK8A 1YTZC 1J7QA 3O2PA 5HKZA 2COLB 3S0BA 1LS8A 3BUXB 3AAJA 3IVTA 1MQ1A 3KPXA 1ALVA 1PULA 3D10A 3DVKA 3TDUA 1CDNA 2LMVA 1CTRA 2P6BB 3DF0A 1MHOA 2F33A 4N1FA 2HF5A 3DXLA 4C0JA 1SW8A 3BUWB 1SBJA 4I5KA 1YURA 1YX7A 1B4CA 3BOWA 1NCXA 4I5LB 1XVJA 3JVTB 2HQ8A 1YX8A 2A4JA 2JT3A 2WC6A 3I5IC 2KI4B 5K89A 3IQOA 4AOMA 2WCJA 1B8LA 2NLNA 4KYNA 1SRAA 1NUBA 3B7AA 4PE4A 1QWVA 2CNPA 3JTDC 1YRUB 1CM4A 1QATA 1UP5A 4BY4A 2JPOA 1K96A 1NWDA 4MEWA 1V1GA 3B6XA 2V53A 3LLEA 4MN0A 1ALWA 4JD9A 3CWGA 1FF1A 1NP8A 1SL9A 1D1OA 5HKYA 1OOJA 3DVJA 1DF0B 3TDZA 2OTGB 1R2UA 1TNPA 2KI6C 3ZNIA 4NDBA 4MVFA 1XK4A 1C7WA 2L5XB 1ZUZA 4L9MA 1UWOA 2K7BA 4CFQA 4GGNA 1M31A 1SCVA 2BKHB 2WCKA 2L5YA 1DJGA 1KK8B 3EVRA 4OCIA 2KI4C 3OGNA 2K0JA 1NYAA 3AKBA 3ZWHA 2JTTA 1XFVO 2JULA 3I5FB 3QRXA 2KLDA 3OB1B 3WNXB 1KQVA 2BBNA 1MUXA 3GK4X 3CZ1A 2KBIA 2MAZA 2BL0B 4YI8A 4XJKB 1AUIB 1B1GA 1OOFA 4OVNF 2KDHA 1N65A 1XFUO 4NDDA 1BG1A 3A8RA 3D73A 2LHIA 1Y0VH 1QX2A 1SR6B 2WC5A 3SG2A 3D74A 4PE1A 4ORCB 1IQ5A 5CPVA 1OZSA 3TS5C 2MLFC 2O60A 1DJXA 3FWBA 2BE4A 2OTGC 2BBMA 2KFGA 3DYEA 1QV1A 5ER5A 1DJWA 1DJIA 1IG5A 2KQYA 2KFFA 2KBMA 1KK7Z 2QEHA 3B86A 3EK4A 4IJ7A 3TUYC 2MA2A 2LHLA 4DCKA 1WRZA 1TN4A 4FQOA 1YR5A 1CNPA 2E30A 2Y4QA 2ZN8A 1K95A 2E6WA 4JWQA 3NXAA 1IJ6A 1YRTB 3I5FC 1CMGA 1K2HA 1GM0A 1UHIA 1LA0A 1XFZO 2M9GA 2QEVA 1TTXA 1LKJA 1Z2CB 3KO0A 1QJTA 1K9UA 2WORA 2JT8A 3GK2A 3L47A 3WHTB 1WLMA 2LVVA 2QPTA 3VROA 4JKTA 3DZTA 3WXAA 4GPLB 1W7JB 2WCEA 2AMIA 2IS9A 1KSMA 4YGEB 1A29A 1SR6C 1TCOB 1TCFA 2JRFA 1B9AA 1KK7Y 3BQ3A 2LMUA 1S36A 3HCMA 3C1VA 3BUNB 2D8NA 2PSRA 1M39A 3R1OA 2JNFA 1UHHA 3TDIA 1TNXA 3AAKA 1QX7A 3R1PA 2L50A 3VRNA 3SIAA 3EKJA 1RTP1 5CSJA 2MHHA 1FI6A 2I2RE 2WNDA 5G08A 1C07A 1SL8A 3BFBA 3BYAA 4WRIA 2BCAA 3D0YB 3NSKA 2M49B 4TNCA 3CGAA 4ICBA 2JQ6A 1B47A 2JXCA 2KI6D 3BUOB 2PYQA 1IWQA 5JJGA 2JT0A 1IQ3A 1BOCA 1OOGA 4HRGA 2ZFDA 1OOHA 3OHMB 3PN7C 2L0PA 1U5IA 4PE7A 2LAPA 1SPYA 1OMRA 2LP2A 3CZ0A 1Y1UA 4QJ5B 4YBHB 5J3XA 3A4UB 2FJYA 3KEVA 4YI9A 5CSFA 1DT7B 3CABA 2L2CA 2JZIA 2Q4UA 2BAPA 4N1GA 2B1UA 3CZTX 1YUTA 3N7HA 1TOPA 2PQLA 4M2OA 3SS5A 3VRQA 1OOIX 3EVVA 5DKRA 4MRXA 3O78A 2MRDA 1EG3A 2CCMA 1KFUS 1M46A 2LE9B 2BCBA 1JF0A 2WCLA 3O6BA 2FCDA 1PK0D 3OB2B 3DF0B 1J7PA 1GGZA 2BNXA 5AEQA 2ZN9A 2MJWB 1OMDA 3D75A 1Q80A 1A2XA 2EC6C 1EH2A 1F71A 1PVBA 5HYDA 4DIRA 1EG4A 3IQQA 3S0DA 1K93D 4DUQA 2CTNA 2K2FA 2OS8C 1OMVA 3FIAA 1C3ZA 1FBVA 4I5JA 2PRUA 2Y1NA 4U8DA 1E8AA 1BU3A 3CS1A 3V2LA 3WHUB 1NPQA 1TNWA 4E68A 2HPSA 5KTYA 4YRUA 1OW4A 1IJ5A 1BMOA 3OBVA 2KYFA 4UPGA 1Z4HA 3SG3A 2L4HA 1F4OA 4HREE 1MXEA 2L51A 1JC2A 3B88A 3CLNA 2BCXA 3I5GB 2MLEC 1F70A 1QIVA 2LANA 3SG7A 4C0LA 2F3ZA 2KAVA 3NHTA 5AFPA 1BODA 1F55A 3CZ2A 2K7DA 3S0GA 2OPOA 2LNKA 1L2OB 1Y1AA 1SCMB 1L7ZA 2M1KB 3JVTC 2AUCA 3PJIA 3SJSA 2FCEA 4JPZB 3BUMB 2DOQA 3L4LA 2WCMA 3RLZA 3PALA 4PHNA 1S5GZ 4A4CA 5D69A 1N2DA 1PALA 2M0RA 4HRHA 5I2LA 3SIBA 2L98A 1S3PA 1SK6D 3O4YA 4M2PA 4CLNA 1DMOA 2Y1MA 1C3YA 2M7NA 1WDCB 1OZOA 1DF0A 2ZKMX 5KU1A 1ORGA 3PM8A 4ETOA 1JF2A 3OP0A 1FW4A 3TZ1A 2KQ6A 3K1EA 2KGBC 2QACA 5I94A 1IGVA 1B7TZ 1CDPA 1N0YA 1BLQA 2CBLA 4MZLA 1G33A 1KFXS 1CLLA 1CDMA 1RWYA 1NSHA 5KSZA 2H2KA 1NCZA 5JOLA 1AVSA 1MR8A 1SCMC 4PDZA 4WQ3A 3FE8A 2K7OA 3BXKA 2NZ0A 3SS3A 1OQPA 3SS4A 1LXFC 2M29A 1QIWA 1KK8C 2JTZA 3I5HB 4XJKA 3E3RA 1DVIA 2KGRA 4YGBB 2PALA 3M0WA 1EJ3A 5FYXA 5I2OA 2PVBA 1YUUA 2BKIB 3F45A 2G2BA 2JC2A 4PHKA 1DJZA 2PASA 4NQGA 2BL0C 2F2PA 5I2QA 1B7TY 1FI5A 1MXLC 2R2IA 3AKAA 5HL1A 1ODBA 1ZFSA 2ZRSA 4IL1A 3BJHA 1RFJA 1ZMZA 1J1DA 4NDCA 5DKQA 2O5GA 2I7AA 1DQEA 4I5NB
chains in the Genus database with same CATH topology
2ZNDA 1EL4A 1B8CA 2L4IA 4CFRA 2PMYA 3SG4A 2AAOA 2LC5A 1NX1A 1M45A 3LL8B 1S6JA 1XFWO 1S1EA 2F2OA 1A4PA 2FJUB 2K8MB 4P2YB 2LVJA 1TIZA 3K21A 2WCFA 2KOTA 5HKWA 1F54A 1WY9A 4GUKA 1S6IA 4MLWA 4PCWA 2H61C 2K7CA 5TNCA 4USLA 3PLFB 2Y5IA 1TRFA 3FS7A 1RECA 1MWNA 1CB1A 1U5IB 2KAYA 4GAOA 1RJVA 3CR2A 1PSRA 3VGOA 4F0ZB 4AQJA 2G9BA 1SKTA 1QLSA 2KAXA 4WQ2A 1QLKA 2CT9A 4OR9B 2WOSA 1KFUL 4GBAA 4QJ3B 3SG5A 1UURA 1H4BA 2SCPA 3PSRA 1CFFA 1SMGA 1A75A 1R6PA 1DGVA 1WRKA 2K2AA 1CLBA 1QTXA 2M97A 4CIDA 5B8IB 1SL7A 4GNKB 4JQ0D 3HX4A 1DJHA 4N5XA 3BOWB 2MBXA 1AHRA 1K90D 4PALA 1QV0A 5D7FA 4HSZA 4Q04A 1QS7A 1OSAA 2KHNA 4FTGA 1A03A 2JXLA 4MRYA 3RM1A 3DD4A 3SG6A 1FPWA 1S26D 1J7OA 2KSPA 1UHKA 1F4QA 2LVKA 2LM5A 2M3WA 3ICBA 1NX2A 1W7IB 4BY5A 1NX0A 5AANA 1BR1B 1JFJA 4CPVA 2BECA 1SNLA 1S6CA 3KF9A 4PHJA 2LCPA 1NCYA 1KQMB 4M2QA 1UHNA 1QASA 3LK0A 1H8BA 1CDLA 1YUSA 3CTNA 4YGAA 2HETA 2NCPA 1CFDA 1BT6A 3MSEB 1DGUA 5I8NA 2NCOA 3EKHA 3VRRA 1JSAA 1KCYA 4GGFA 2GGZA 3NSIA 4YGDB 3TS5B 2K61A 1QX5B 1ZOTB 1JUOA 5BPJA 4DRWA 1CKKA 1QVIZ 2JU0A 2KFHA 1Y1XA 3PFVA 3I5GC 1J1EA 3TUYB 1M63B 3NSLA 4GGFC 1JBAA 3PATA 1K8UA 1TNQA 1PVAA 2LUCA 1KQMC 1KFXL 5CSNA 5ER4X 4A4BA 1GQMA 2ZRTA 1JWDA 1DTLA 5HLVA 1L2OC 1LVCD 4QJ4B 1XK4C 1XYDA 1BF5A 1S5GY 3OX5A 4C0KA 1SYMA 3CR5X 2JOJA 1K9KA 2SASA 1CFCA 4GFTA 2GV5A 3GK1A 3OX6A 4PE0A 4ZCUA 1NIWA 1YVHA 3LCPC 2F3YA 1HT9A 1QVIY 1HQVA 1XFXO 1VRKA 1DJYA 1OE9B 1WDCC 1CLMA 3LK1A 4YGCB 3EK8A 5AERA 1CFPA 2LLSA 1IH0A 1J7RA 1AP4A 1X02A 3H4SE 5HLOA 4MZKA 2M1UA 4XYNA 4AQIA 4MSPA 1CMFA 2LVIA 1J55A 1KWOB 2HQWA 1XA5A 2TN4A 1NX3A 4OKHA 5PALA 3EVUA 1XFYO 2WCBA 4DS7A 1K9PA 1CM1A 1LA3A 2EGDA 4P5OE 2M7LA 2F8PA 2KNEA 1YVLA 1QXPA 3CR4X 1PRWA 4ORBB 2H61A 2CXJA 2LLUA 3I5HC 3FWCA 1BR4B 1JFKA 1EXRA 1GJYA 3DVEA 3IF7A 3GOFA 3PN7B 5GQQC 3DVMA 1WRLA 3EK7A 2ISDA 1SY9A 2LMTA 3NSOA 1B8RA 5F6TA 4ORAB 1IRJA 2JNXA 1UHJA 2I94A 1V1FA 2KYCA 1MF8B 1K94A 1AJ5A 1LINA 2JPTA 2NXQA 1WLZA 1IKUA 1XO5A 1Y6WA 3KHEA 2LUXA 1PSBA 4MBEA 1KWOC 1ZACA 2ZNEA 1GGWA 2LP3A 4R1EA 1C7VA 1G8IA 4PHMA 3D0YA 2JWWA 1AJ4A 1RROA 2EC6B 2I18A 4MZJA 5AXIA 4ZCVA 2FOTA 2GGMA 2BE6A 2LLTA 2M8UA 1KSOA 2OS8B 1RK9A 1UUSA 1A75B 2LV7A 2RGIA 4OV2A 5CSIA 1F8HA 2EHBA 3I5IB 2L2EA 5IBWA 4D1EA 1BJFA 2Q91A 5DKNA 2WC8A 3JTDB 1G4YR 2VRGA 1AK8A 1YTZC 1J7QA 3O2PA 5HKZA 2COLB 3BUXB 3AAJA 1MQ1A 3KPXA 1ALVA 1PULA 3D10A 3DVKA 3TDUA 1CDNA 2LMVA 1CTRA 2P6BB 3DF0A 1MHOA 2F33A 4N1FA 2HF5A 4C0JA 1SW8A 3BUWB 1SBJA 4I5KA 1YURA 1YX7A 1B4CA 3BOWA 1NCXA 4I5LB 1XVJA 3JVTB 2HQ8A 1YX8A 2A4JA 2JT3A 3I5IC 2KI4B 5K89A 3IQOA 4AOMA 1B8LA 2NLNA 1SRAA 1NUBA 4PE4A 2CNPA 3JTDC 1YRUB 1CM4A 1QATA 1UP5A 4BY4A 1K96A 1NWDA 4MEWA 1V1GA 3LLEA 2V53A 4MN0A 1ALWA 3CWGA 1FF1A 1NP8A 1SL9A 1D1OA 5HKYA 1OOJA 3DVJA 1DF0B 3TDZA 2OTGB 1R2UA 1TNPA 2KI6C 3ZNIA 4NDBA 4MVFA 1XK4A 1C7WA 2L5XB 1ZUZA 4L9MA 1UWOA 2K7BA 4GGNA 1M31A 1SCVA 2BKHB 1DJGA 1KK8B 3EVRA 4OCIA 2KI4C 2K0JA 1NYAA 3AKBA 3ZWHA 2JTTA 1XFVO 2JULA 3I5FB 3QRXA 3OB1B 3WNXB 1KQVA 2BBNA 1MUXA 3GK4X 2KBIA 2MAZA 2BL0B 4YI8A 4XJKB 1AUIB 1B1GA 4OVNF 2KDHA 1N65A 1XFUO 4NDDA 1BG1A 3A8RA 2LHIA 1Y0VH 1QX2A 1SR6B 3SG2A 4PE1A 4ORCB 1IQ5A 5CPVA 1OZSA 3TS5C 2MLFC 2O60A 1DJXA 3FWBA 2BE4A 2OTGC 2BBMA 2KFGA 1QV1A 5ER5A 1DJWA 1DJIA 1IG5A 2KQYA 2KFFA 2KBMA 1KK7Z 3EK4A 3TUYC 2MA2A 2LHLA 4DCKA 1WRZA 1TN4A 4FQOA 1YR5A 1CNPA 2E30A 2Y4QA 2ZN8A 1K95A 2E6WA 4JWQA 3NXAA 1IJ6A 1YRTB 3I5FC 1CMGA 1K2HA 1UHIA 1LA0A 1XFZO 2M9GA 3KO0A 1TTXA 1LKJA 3WHTB 1FI5A 1QJTA 1K9UA 2WORA 2JT8A 3GK2A 1WLMA 2LVVA 2QPTA 3VROA 3WXAA 4GPLB 1W7JB 2WCEA 2AMIA 2IS9A 1KSMA 4YGEB 1A29A 1SR6C 1TCOB 1TCFA 2JRFA 1B9AA 1KK7Y 3BQ3A 2LMUA 1S36A 3HCMA 3C1VA 3BUNB 2D8NA 2PSRA 1M39A 2JNFA 1UHHA 3TDIA 1TNXA 3AAKA 1QX7A 2L50A 3VRNA 3SIAA 3EKJA 1RTP1 5CSJA 2MHHA 1FI6A 2I2RE 2WNDA 5G08A 1C07A 1SL8A 3BYAA 4WRIA 2BCAA 3D0YB 3NSKA 2M49B 4TNCA 3CGAA 4ICBA 2JQ6A 1B47A 2JXCA 2KI6D 3BUOB 1IWQA 5JJGA 2JT0A 1IQ3A 1BOCA 4HRGA 2ZFDA 3OHMB 3PN7C 2L0PA 1U5IA 4PE7A 2LAPA 1SPYA 1OMRA 2LP2A 1Y1UA 4QJ5B 4YBHB 5J3XA 3A4UB 1DT7B 3KEVA 4YI9A 5CSFA 3VRPA 2JZIA 2Q4UA 4N1GA 2B1UA 3CZTX 1YUTA 4CFQA 1TOPA 4M2OA 3VRQA 3EVVA 5DKRA 4MRXA 3O78A 2MRDA 1EG3A 2CCMA 1KFUS 1M46A 2LE9B 2BCBA 1JF0A 3O6BA 2FCDA 1PK0D 3OB2B 3DF0B 1J7PA 1GGZA 5AEQA 2ZN9A 2MJWB 1OMDA 1Q80A 1A2XA 2EC6C 1EH2A 1F71A 1PVBA 5HYDA 4DIRA 1EG4A 3IQQA 1K93D 4DUQA 2CTNA 2K2FA 2OS8C 1OMVA 3FIAA 1FBVA 4I5JA 2PRUA 2Y1NA 4U8DA 1E8AA 1BU3A 3CS1A 3WHUB 1NPQA 1TNWA 4E68A 2HPSA 5KTYA 4YRUA 4UPGA 1IJ5A 1BMOA 2KYFA 3SG3A 2L4HA 1F4OA 4HREE 1MXEA 2L51A 1JC2A 3CLNA 2BCXA 3I5GB 2MLEC 1F70A 1QIVA 2LANA 3SG7A 4C0LA 2F3ZA 2KAVA 5AFPA 1BODA 1F55A 2K7DA 2OPOA 2LNKA 1L2OB 1Y1AA 1SCMB 1L7ZA 2M1KB 3JVTC 2AUCA 3SJSA 2FCEA 4JPZB 3BUMB 2DOQA 3RLZA 3PALA 4PHNA 1S5GZ 4A4CA 5D69A 1N2DA 1PALA 2M0RA 4HRHA 5I2LA 3SIBA 2L98A 1S3PA 1SK6D 3O4YA 4M2PA 4CLNA 1DMOA 2Y1MA 2M7NA 1WDCB 1OZOA 1DF0A 2ZKMX 5KU1A 3PM8A 4ETOA 1JF2A 3OP0A 1FW4A 3TZ1A 2KQ6A 2KGBC 2QACA 1IGVA 1B7TZ 1CDPA 1N0YA 1BLQA 2CBLA 4MZLA 1G33A 1KFXS 1CLLA 1CDMA 1RWYA 1NSHA 5KSZA 2H2KA 1NCZA 5JOLA 1AVSA 1MR8A 1SCMC 4PDZA 4WQ3A 2K7OA 3BXKA 2NZ0A 1OQPA 1LXFC 2M29A 1QIWA 1KK8C 2JTZA 3I5HB 4XJKA 3E3RA 1DVIA 2KGRA 4YGBB 2PALA 3M0WA 1EJ3A 5FYXA 5I2OA 2PVBA 1YUUA 2BKIB 3F45A 2G2BA 2JC2A 4PHKA 1DJZA 2PASA 4NQGA 2BL0C 2F2PA 5I2QA 1B7TY 1MXLC 2R2IA 3AKAA 1ODBA 1ZFSA 2ZRSA 4IL1A 1RFJA 1ZMZA 1J1DA 4NDCA 5DKQA 2O5GA 2I7AA 4I5NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZND A;  1EL4 A;  1B8C A;  2L4I A;  4CFR A;  2PMY A;  3SG4 A;  2AAO A;  2LC5 A;  1NX1 A;  1M45 A;  3LL8 B;  1S6J A;  1XFW O;  1S1E A;  2F2O A;  1A4P A;  2FJU B;  2K8M B;  4P2Y B;  2LVJ A;  1TIZ A;  3K21 A;  2WCF A;  2KOT A;  5HKW A;  1F54 A;  1WY9 A;  4GUK A;  1S6I A;  4MLW A;  4PCW A;  2H61 C;  2K7C A;  5TNC A;  4USL A;  3PLF B;  2Y5I A;  1TRF A;  3FS7 A;  1REC A;  1MWN A;  1CB1 A;  1U5I B;  2KAY A;  4GAO A;  1RJV A;  3CR2 A;  1PSR A;  3VGO A;  4F0Z B;  4AQJ A;  2G9B A;  1SKT A;  1QLS A;  2KAX A;  4WQ2 A;  1QLK A;  2CT9 A;  4OR9 B;  2WOS A;  1KFU L;  4GBA A;  4QJ3 B;  3SG5 A;  1UUR A;  1H4B A;  2SCP A;  3PSR A;  1CFF A;  1SMG A;  1A75 A;  1R6P A;  1DGV A;  1WRK A;  2K2A A;  1CLB A;  1QTX A;  2M97 A;  4CID A;  5B8I B;  1SL7 A;  4GNK B;  4JQ0 D;  3HX4 A;  1DJH A;  4N5X A;  3BOW B;  2MBX A;  1AHR A;  1K90 D;  4PAL A;  1QV0 A;  5D7F A;  4HSZ A;  4Q04 A;  1QS7 A;  1OSA A;  2KHN A;  4FTG A;  1A03 A;  2JXL A;  4MRY A;  3RM1 A;  3DD4 A;  3SG6 A;  1FPW A;  1S26 D;  1J7O A;  2KSP A;  1UHK A;  1F4Q A;  2LVK A;  2LM5 A;  2M3W A;  3ICB A;  1NX2 A;  1W7I B;  4BY5 A;  1NX0 A;  5AAN A;  1BR1 B;  1JFJ A;  4CPV A;  2BEC A;  1SNL A;  1S6C A;  3KF9 A;  4PHJ A;  2LCP A;  1NCY A;  1KQM B;  4M2Q A;  1UHN A;  1QAS A;  3LK0 A;  1H8B A;  1CDL A;  1YUS A;  3CTN A;  4YGA A;  2HET A;  2NCP A;  1CFD A;  1BT6 A;  3MSE B;  1DGU A;  5I8N A;  2NCO A;  3EKH A;  3VRR A;  1JSA A;  1KCY A;  4GGF A;  2GGZ A;  3NSI A;  4YGD B;  3TS5 B;  2K61 A;  1QX5 B;  1ZOT B;  1JUO A;  5BPJ A;  4DRW A;  1CKK A;  1QVI Z;  2JU0 A;  2KFH A;  1Y1X A;  3PFV A;  3I5G C;  1J1E A;  3TUY B;  1M63 B;  3NSL A;  4GGF C;  1JBA A;  3PAT A;  1K8U A;  1TNQ A;  1PVA A;  2LUC A;  1KQM C;  1KFX L;  5CSN A;  5ER4 X;  4A4B A;  1GQM A;  2ZRT A;  1JWD A;  1DTL A;  5HLV A;  1L2O C;  1LVC D;  4QJ4 B;  1XK4 C;  1XYD A;  1BF5 A;  1S5G Y;  3OX5 A;  4C0K A;  1SYM A;  3CR5 X;  2JOJ A;  1K9K A;  2SAS A;  1CFC A;  4GFT A;  2GV5 A;  3GK1 A;  3OX6 A;  4PE0 A;  4ZCU A;  1NIW A;  1YVH A;  3LCP C;  2F3Y A;  1HT9 A;  1QVI Y;  1HQV A;  1XFX O;  1VRK A;  1DJY A;  1OE9 B;  1WDC C;  1CLM A;  3LK1 A;  4YGC B;  3EK8 A;  5AER A;  1CFP A;  2LLS A;  1IH0 A;  1J7R A;  1AP4 A;  1X02 A;  3H4S E;  5HLO A;  4MZK A;  2M1U A;  4XYN A;  4AQI A;  4MSP A;  1CMF A;  2LVI A;  1J55 A;  1KWO B;  2HQW A;  1XA5 A;  2TN4 A;  1NX3 A;  4OKH A;  5PAL A;  3EVU A;  1XFY O;  2WCB A;  4DS7 A;  1K9P A;  1CM1 A;  1LA3 A;  2EGD A;  4P5O E;  2M7L A;  2F8P A;  2KNE A;  1YVL A;  1QXP A;  3CR4 X;  1PRW A;  4ORB B;  2H61 A;  2CXJ A;  2LLU A;  3I5H C;  3FWC A;  1BR4 B;  1JFK A;  1EXR A;  1GJY A;  3DVE A;  3IF7 A;  3GOF A;  3PN7 B;  5GQQ C;  3DVM A;  1WRL A;  3EK7 A;  2ISD A;  1SY9 A;  2LMT A;  3NSO A;  1B8R A;  5F6T A;  4ORA B;  1IRJ A;  2JNX A;  1UHJ A;  2I94 A;  1V1F A;  2KYC A;  1MF8 B;  1K94 A;  1AJ5 A;  1LIN A;  2JPT A;  2NXQ A;  1WLZ A;  1IKU A;  1XO5 A;  1Y6W A;  3KHE A;  2LUX A;  1PSB A;  4MBE A;  1KWO C;  1ZAC A;  2ZNE A;  1GGW A;  2LP3 A;  4R1E A;  1C7V A;  1G8I A;  4PHM A;  3D0Y A;  2JWW A;  1AJ4 A;  1RRO A;  2EC6 B;  2I18 A;  4MZJ A;  5AXI A;  4ZCV A;  2FOT A;  2GGM A;  2BE6 A;  2LLT A;  2M8U A;  1KSO A;  2OS8 B;  1RK9 A;  1UUS A;  1A75 B;  2LV7 A;  2RGI A;  4OV2 A;  5CSI A;  1F8H A;  2EHB A;  3I5I B;  2L2E A;  5IBW A;  4D1E A;  1BJF A;  2Q91 A;  5DKN A;  2WC8 A;  3JTD B;  1G4Y R;  2VRG A;  1AK8 A;  1YTZ C;  1J7Q A;  3O2P A;  5HKZ A;  2COL B;  3BUX B;  3AAJ A;  1MQ1 A;  3KPX A;  1ALV A;  1PUL A;  3D10 A;  3DVK A;  3TDU A;  1CDN A;  2LMV A;  1CTR A;  2P6B B;  3DF0 A;  1MHO A;  2F33 A;  4N1F A;  2HF5 A;  4C0J A;  1SW8 A;  3BUW B;  1SBJ A;  4I5K A;  1YUR A;  1YX7 A;  1B4C A;  3BOW A;  1NCX A;  4I5L B;  1XVJ A;  3JVT B;  2HQ8 A;  1YX8 A;  2A4J A;  2JT3 A;  3I5I C;  2KI4 B;  5K89 A;  3IQO A;  4AOM A;  1B8L A;  2NLN A;  1SRA A;  1NUB A;  4PE4 A;  2CNP A;  3JTD C;  1YRU B;  1CM4 A;  1QAT A;  1UP5 A;  4BY4 A;  1K96 A;  1NWD A;  4MEW A;  1V1G A;  3LLE A;  2V53 A;  4MN0 A;  1ALW A;  3CWG A;  1FF1 A;  1NP8 A;  1SL9 A;  1D1O A;  5HKY A;  1OOJ A;  3DVJ A;  1DF0 B;  3TDZ A;  2OTG B;  1R2U A;  1TNP A;  2KI6 C;  3ZNI A;  4NDB A;  4MVF A;  1XK4 A;  1C7W A;  2L5X B;  1ZUZ A;  4L9M A;  1UWO A;  2K7B A;  4GGN A;  1M31 A;  1SCV A;  2BKH B;  1DJG A;  1KK8 B;  3EVR A;  4OCI A;  2KI4 C;  2K0J A;  1NYA A;  3AKB A;  3ZWH A;  2JTT A;  1XFV O;  2JUL A;  3I5F B;  3QRX A;  3OB1 B;  3WNX B;  1KQV A;  2BBN A;  1MUX A;  3GK4 X;  2KBI A;  2MAZ A;  2BL0 B;  4YI8 A;  4XJK B;  1AUI B;  1B1G A;  4OVN F;  2KDH A;  1N65 A;  1XFU O;  4NDD A;  1BG1 A;  3A8R A;  2LHI A;  1Y0V H;  1QX2 A;  1SR6 B;  3SG2 A;  4PE1 A;  4ORC B;  1IQ5 A;  5CPV A;  1OZS A;  3TS5 C;  2MLF C;  2O60 A;  1DJX A;  3FWB A;  2BE4 A;  2OTG C;  2BBM A;  2KFG A;  1QV1 A;  5ER5 A;  1DJW A;  1DJI A;  1IG5 A;  2KQY A;  2KFF A;  2KBM A;  1KK7 Z;  3EK4 A;  3TUY C;  2MA2 A;  2LHL A;  4DCK A;  1WRZ A;  1TN4 A;  4FQO A;  1YR5 A;  1CNP A;  2E30 A;  2Y4Q A;  2ZN8 A;  1K95 A;  2E6W A;  4JWQ A;  3NXA A;  1IJ6 A;  1YRT B;  3I5F C;  1CMG A;  1K2H A;  1UHI A;  1LA0 A;  1XFZ O;  2M9G A;  3KO0 A;  1TTX A;  1LKJ A;  3WHT B;  1FI5 A;  1QJT A;  1K9U A;  2WOR A;  2JT8 A;  3GK2 A;  1WLM A;  2LVV A;  2QPT A;  3VRO A;  3WXA A;  4GPL B;  1W7J B;  2WCE A;  2AMI A;  2IS9 A;  1KSM A;  4YGE B;  1A29 A;  1SR6 C;  1TCO B;  1TCF A;  2JRF A;  1B9A A;  1KK7 Y;  3BQ3 A;  2LMU A;  1S36 A;  3HCM A;  3C1V A;  3BUN B;  2D8N A;  2PSR A;  1M39 A;  2JNF A;  1UHH A;  3TDI A;  1TNX A;  3AAK A;  1QX7 A;  2L50 A;  3VRN A;  3SIA A;  3EKJ A;  1RTP 1;  5CSJ A;  2MHH A;  1FI6 A;  2I2R E;  2WND A;  5G08 A;  1C07 A;  1SL8 A;  3BYA A;  4WRI A;  2BCA A;  3D0Y B;  3NSK A;  2M49 B;  4TNC A;  3CGA A;  4ICB A;  2JQ6 A;  1B47 A;  2JXC A;  2KI6 D;  3BUO B;  1IWQ A;  5JJG A;  2JT0 A;  1IQ3 A;  1BOC A;  4HRG A;  2ZFD A;  3OHM B;  3PN7 C;  2L0P A;  1U5I A;  4PE7 A;  2LAP A;  1SPY A;  1OMR A;  2LP2 A;  1Y1U A;  4QJ5 B;  4YBH B;  5J3X A;  3A4U B;  1DT7 B;  3KEV A;  4YI9 A;  5CSF A;  3VRP A;  2JZI A;  2Q4U A;  4N1G A;  2B1U A;  3CZT X;  1YUT A;  4CFQ A;  1TOP A;  4M2O A;  3VRQ A;  3EVV A;  5DKR A;  4MRX A;  3O78 A;  2MRD A;  1EG3 A;  2CCM A;  1KFU S;  1M46 A;  2LE9 B;  2BCB A;  1JF0 A;  3O6B A;  2FCD A;  1PK0 D;  3OB2 B;  3DF0 B;  1J7P A;  1GGZ A;  5AEQ A;  2ZN9 A;  2MJW B;  1OMD A;  1Q80 A;  1A2X A;  2EC6 C;  1EH2 A;  1F71 A;  1PVB A;  5HYD A;  4DIR A;  1EG4 A;  3IQQ A;  1K93 D;  4DUQ A;  2CTN A;  2K2F A;  2OS8 C;  1OMV A;  3FIA A;  1FBV A;  4I5J A;  2PRU A;  2Y1N A;  4U8D A;  1E8A A;  1BU3 A;  3CS1 A;  3WHU B;  1NPQ A;  1TNW A;  4E68 A;  2HPS A;  5KTY A;  4YRU A;  4UPG A;  1IJ5 A;  1BMO A;  2KYF A;  3SG3 A;  2L4H A;  1F4O A;  4HRE E;  1MXE A;  2L51 A;  1JC2 A;  3CLN A;  2BCX A;  3I5G B;  2MLE C;  1F70 A;  1QIV A;  2LAN A;  3SG7 A;  4C0L A;  2F3Z A;  2KAV A;  5AFP A;  1BOD A;  1F55 A;  2K7D A;  2OPO A;  2LNK A;  1L2O B;  1Y1A A;  1SCM B;  1L7Z A;  2M1K B;  3JVT C;  2AUC A;  3SJS A;  2FCE A;  4JPZ B;  3BUM B;  2DOQ A;  3RLZ A;  3PAL A;  4PHN A;  1S5G Z;  4A4C A;  5D69 A;  1N2D A;  1PAL A;  2M0R A;  4HRH A;  5I2L A;  3SIB A;  2L98 A;  1S3P A;  1SK6 D;  3O4Y A;  4M2P A;  4CLN A;  1DMO A;  2Y1M A;  2M7N A;  1WDC B;  1OZO A;  1DF0 A;  2ZKM X;  5KU1 A;  3PM8 A;  4ETO A;  1JF2 A;  3OP0 A;  1FW4 A;  3TZ1 A;  2KQ6 A;  2KGB C;  2QAC A;  1IGV A;  1B7T Z;  1CDP A;  1N0Y A;  1BLQ A;  2CBL A;  4MZL A;  1G33 A;  1KFX S;  1CLL A;  1CDM A;  1RWY A;  1NSH A;  5KSZ A;  2H2K A;  1NCZ A;  5JOL A;  1AVS A;  1MR8 A;  1SCM C;  4PDZ A;  4WQ3 A;  2K7O A;  3BXK A;  2NZ0 A;  1OQP A;  1LXF C;  2M29 A;  1QIW A;  1KK8 C;  2JTZ A;  3I5H B;  4XJK A;  3E3R A;  1DVI A;  2KGR A;  4YGB B;  2PAL A;  3M0W A;  1EJ3 A;  5FYX A;  5I2O A;  2PVB A;  1YUU A;  2BKI B;  3F45 A;  2G2B A;  2JC2 A;  4PHK A;  1DJZ A;  2PAS A;  4NQG A;  2BL0 C;  2F2P A;  5I2Q A;  1B7T Y;  1MXL C;  2R2I A;  3AKA A;  1ODB A;  1ZFS A;  2ZRS A;  4IL1 A;  1RFJ A;  1ZMZ A;  1J1D A;  4NDC A;  5DKQ A;  2O5G A;  2I7A A;  4I5N B; 
#chains in the Genus database with same CATH topology
 2ZND A;  1EL4 A;  1B8C A;  2L4I A;  4CFR A;  2PMY A;  3DY9 A;  2AAO A;  2LC5 A;  1NX1 A;  1M45 A;  1TUJ A;  3LL8 B;  1S6J A;  3SG4 A;  1XFW O;  1S1E A;  2F2O A;  1A4P A;  2FJU B;  2K8M B;  4P2Y B;  2LVJ A;  1TIZ A;  3K21 A;  2WCF A;  2KOT A;  5HKW A;  1F54 A;  1WY9 A;  4GUK A;  1S6I A;  5FI2 A;  5D3O A;  4MLW A;  4PCW A;  2H61 C;  2K7C A;  5TNC A;  4USL A;  3PLF B;  2Y5I A;  1TRF A;  3FS7 A;  3D76 A;  1REC A;  1MWN A;  3NHI A;  3RZS A;  1CB1 A;  1U5I B;  2KAY A;  4GAO A;  1RJV A;  3CR2 A;  1PSR A;  3VGO A;  3R1V A;  4F0Z B;  4AQJ A;  2G9B A;  1SKT A;  1QLS A;  2KAX A;  4WQ2 A;  1QLK A;  2CT9 A;  4OR9 B;  2WOS A;  1KFU L;  4GBA A;  4QJ3 B;  1XFR A;  1SSE B;  1UUR A;  3SG5 A;  1H4B A;  3S0A A;  2SCP A;  3PSR A;  1CFF A;  1SMG A;  1A75 A;  1R6P A;  1DGV A;  1WRK A;  2K2A A;  1CLB A;  1QTX A;  2M97 A;  4CID A;  5B8I B;  1DEK A;  1SL7 A;  4GNK B;  4JQ0 D;  3HX4 A;  1DJH A;  4N5X A;  3BOW B;  2MBX A;  1AHR A;  4F7F A;  1K90 D;  4PAL A;  1QV0 A;  3NGV A;  2KLE A;  5D7F A;  3FE6 A;  4HSZ A;  4Q04 A;  5DIC A;  1QS7 A;  1OSA A;  2KHN A;  4FTG A;  1A03 A;  2JXL A;  4MRY A;  1W9Z A;  3RM1 A;  3DD4 A;  3O4X A;  3SG6 A;  1FPW A;  1S26 D;  3UNW A;  2KSP A;  1J7O A;  1UHK A;  1F4Q A;  2LVK A;  2LM5 A;  2M3W A;  3ICB A;  1NX2 A;  1W7I B;  3L4A A;  4BY5 A;  1NX0 A;  3D77 A;  5AAN A;  1BR1 B;  1JFJ A;  4CPV A;  2BEC A;  1SNL A;  1S6C A;  3KF9 A;  4PT1 A;  2P70 A;  4PHJ A;  2LCP A;  1NCY A;  1KQM B;  4M2Q A;  1UHN A;  1QAS A;  3LK0 A;  1H8B A;  1CDL A;  1YUS A;  2QEB A;  2WCH A;  3CTN A;  4YGA A;  2HET A;  2NCP A;  1IIO A;  1CFD A;  1BT6 A;  3MSE B;  1DGU A;  2P71 A;  5I8N A;  2NCO A;  3EKH A;  3VRR A;  1JSA A;  1KCY A;  3CYZ A;  5FI7 A;  4GGF A;  2GGZ A;  3NSI A;  4YGD B;  1DC1 A;  3TS5 B;  2K61 A;  1QX5 B;  1ZOT B;  1JUO A;  3D78 A;  5BPJ A;  4DRW A;  1CKK A;  1QVI Z;  2JU0 A;  3BFH A;  2KFH A;  3EG5 B;  3S0F A;  4INX A;  1Y1X A;  3PFV A;  3I5G C;  1J1E A;  3TUY B;  1M63 B;  3NSL A;  4GGF C;  1JBA A;  3PM2 A;  3PAT A;  1K8U A;  1TNQ A;  1PVA A;  2LUC A;  1KQM C;  1KFX L;  5CSN A;  5EL2 A;  5ER4 X;  1GQM A;  4A4B A;  2ZRT A;  5FI6 A;  1JWD A;  1DTL A;  5HLV A;  3VRP A;  1L2O C;  1LVC D;  4QJ4 B;  1XK4 C;  1XYD A;  1BF5 A;  1S5G Y;  3OX5 A;  4OZD A;  4C0K A;  1SYM A;  1T14 A;  3CR5 X;  2JOJ A;  1K9K A;  2SAS A;  3CDN A;  1CFC A;  4GFT A;  2GV5 A;  3GK1 A;  3OX6 A;  4PE0 A;  4ZCU A;  1NIW A;  1YVH A;  3LCP C;  2F3Y A;  1HT9 A;  1QVI Y;  1HQV A;  1XFX O;  1VRK A;  1DJY A;  1OE9 B;  1WDC C;  1CLM A;  3LK1 A;  4YGC B;  3EK8 A;  5AER A;  1CFP A;  2LLS A;  2KPH A;  3UO9 A;  1IH0 A;  1J7R A;  3R72 A;  1AP4 A;  1X02 A;  3H4S E;  5HLO A;  4MZK A;  2M1U A;  4XYN A;  4AQI A;  1DEL A;  4MSP A;  1CMF A;  2LVI A;  1J55 A;  1KWO B;  2HQW A;  3B87 A;  1XA5 A;  2TN4 A;  1NX3 A;  4OKH A;  3BFA A;  3EVU A;  4INW A;  1XFY O;  2WCB A;  5PAL A;  1K9P A;  4DS7 A;  1CM1 A;  1LA3 A;  2EGD A;  4P5O E;  2M7L A;  2F8P A;  1P28 A;  2KNE A;  1YVL A;  1QXP A;  3CR4 X;  1PRW A;  4ORB B;  2H61 A;  3Q8I A;  2CXJ A;  2LLU A;  3I5H C;  4FQT A;  3FE9 A;  3FWC A;  2K60 A;  1BR4 B;  1JFK A;  1EXR A;  1GJY A;  3DVE A;  3IF7 A;  3GOF A;  3PN7 B;  5GQQ C;  3DVM A;  1WRL A;  3EK7 A;  2ISD A;  1SY9 A;  2LMT A;  3NSO A;  1B8R A;  5F6T A;  3QME A;  4ORA B;  1IRJ A;  2JNX A;  1UHJ A;  2I94 A;  1V1F A;  2ERB A;  2KYC A;  1MF8 B;  1K94 A;  1AJ5 A;  1LIN A;  2JPT A;  2NXQ A;  1WLZ A;  1IKU A;  1XO5 A;  1Y6W A;  3KHE A;  2LUX A;  1PSB A;  4MBE A;  1KWO C;  1ZAC A;  2ZNE A;  1GGW A;  2LP3 A;  4R1E A;  1C7V A;  1G8I A;  4PHM A;  3D0Y A;  2JWW A;  1AJ4 A;  1RRO A;  2EC6 B;  2I18 A;  4MZJ A;  5AXI A;  2H8V A;  2YGU A;  4ZCV A;  2FOT A;  3S0E A;  2GGM A;  2BE6 A;  2LLT A;  2M8U A;  1KSO A;  2OS8 B;  1RK9 A;  1UUS A;  1A75 B;  2LV7 A;  2GTE A;  2RGI A;  4OV2 A;  5CSI A;  3VB1 A;  2EHB A;  3I5I B;  1F8H A;  2L2E A;  2QEO A;  5IBW A;  4D1E A;  1TWO A;  1TUZ A;  1BJF A;  2Q91 A;  5DKN A;  2WC8 A;  3JTD B;  2QDI A;  1G4Y R;  2VRG A;  1AK8 A;  1YTZ C;  1J7Q A;  3O2P A;  5HKZ A;  2COL B;  3S0B A;  1LS8 A;  3BUX B;  3AAJ A;  3IVT A;  1MQ1 A;  3KPX A;  1ALV A;  1PUL A;  3D10 A;  3DVK A;  3TDU A;  1CDN A;  2LMV A;  1CTR A;  2P6B B;  3DF0 A;  1MHO A;  2F33 A;  4N1F A;  2HF5 A;  3DXL A;  4C0J A;  1SW8 A;  3BUW B;  1SBJ A;  4I5K A;  1YUR A;  1YX7 A;  1B4C A;  3BOW A;  1NCX A;  4I5L B;  1XVJ A;  3JVT B;  2HQ8 A;  1YX8 A;  2A4J A;  2JT3 A;  2WC6 A;  3I5I C;  2KI4 B;  5K89 A;  3IQO A;  4AOM A;  2WCJ A;  1B8L A;  2NLN A;  4KYN A;  1SRA A;  1NUB A;  3B7A A;  4PE4 A;  1QWV A;  2CNP A;  3JTD C;  1YRU B;  1CM4 A;  1QAT A;  1UP5 A;  4BY4 A;  2JPO A;  1K96 A;  1NWD A;  4MEW A;  1V1G A;  3B6X A;  2V53 A;  3LLE A;  4MN0 A;  1ALW A;  4JD9 A;  3CWG A;  1FF1 A;  1NP8 A;  1SL9 A;  1D1O A;  5HKY A;  1OOJ A;  3DVJ A;  1DF0 B;  3TDZ A;  2OTG B;  1R2U A;  1TNP A;  2KI6 C;  3ZNI A;  4NDB A;  4MVF A;  1XK4 A;  1C7W A;  2L5X B;  1ZUZ A;  4L9M A;  1UWO A;  2K7B A;  4CFQ A;  4GGN A;  1M31 A;  1SCV A;  2BKH B;  2WCK A;  2L5Y A;  1DJG A;  1KK8 B;  3EVR A;  4OCI A;  2KI4 C;  3OGN A;  2K0J A;  1NYA A;  3AKB A;  3ZWH A;  2JTT A;  1XFV O;  2JUL A;  3I5F B;  3QRX A;  2KLD A;  3OB1 B;  3WNX B;  1KQV A;  2BBN A;  1MUX A;  3GK4 X;  3CZ1 A;  2KBI A;  2MAZ A;  2BL0 B;  4YI8 A;  4XJK B;  1AUI B;  1B1G A;  1OOF A;  4OVN F;  2KDH A;  1N65 A;  1XFU O;  4NDD A;  1BG1 A;  3A8R A;  3D73 A;  2LHI A;  1Y0V H;  1QX2 A;  1SR6 B;  2WC5 A;  3SG2 A;  3D74 A;  4PE1 A;  4ORC B;  1IQ5 A;  5CPV A;  1OZS A;  3TS5 C;  2MLF C;  2O60 A;  1DJX A;  3FWB A;  2BE4 A;  2OTG C;  2BBM A;  2KFG A;  3DYE A;  1QV1 A;  5ER5 A;  1DJW A;  1DJI A;  1IG5 A;  2KQY A;  2KFF A;  2KBM A;  1KK7 Z;  2QEH A;  3B86 A;  3EK4 A;  4IJ7 A;  3TUY C;  2MA2 A;  2LHL A;  4DCK A;  1WRZ A;  1TN4 A;  4FQO A;  1YR5 A;  1CNP A;  2E30 A;  2Y4Q A;  2ZN8 A;  1K95 A;  2E6W A;  4JWQ A;  3NXA A;  1IJ6 A;  1YRT B;  3I5F C;  1CMG A;  1K2H A;  1GM0 A;  1UHI A;  1LA0 A;  1XFZ O;  2M9G A;  2QEV A;  1TTX A;  1LKJ A;  1Z2C B;  3KO0 A;  1QJT A;  1K9U A;  2WOR A;  2JT8 A;  3GK2 A;  3L47 A;  3WHT B;  1WLM A;  2LVV A;  2QPT A;  3VRO A;  4JKT A;  3DZT A;  3WXA A;  4GPL B;  1W7J B;  2WCE A;  2AMI A;  2IS9 A;  1KSM A;  4YGE B;  1A29 A;  1SR6 C;  1TCO B;  1TCF A;  2JRF A;  1B9A A;  1KK7 Y;  3BQ3 A;  2LMU A;  1S36 A;  3HCM A;  3C1V A;  3BUN B;  2D8N A;  2PSR A;  1M39 A;  3R1O A;  2JNF A;  1UHH A;  3TDI A;  1TNX A;  3AAK A;  1QX7 A;  3R1P A;  2L50 A;  3VRN A;  3SIA A;  3EKJ A;  1RTP 1;  5CSJ A;  2MHH A;  1FI6 A;  2I2R E;  2WND A;  5G08 A;  1C07 A;  1SL8 A;  3BFB A;  3BYA A;  4WRI A;  2BCA A;  3D0Y B;  3NSK A;  2M49 B;  4TNC A;  3CGA A;  4ICB A;  2JQ6 A;  1B47 A;  2JXC A;  2KI6 D;  3BUO B;  2PYQ A;  1IWQ A;  5JJG A;  2JT0 A;  1IQ3 A;  1BOC A;  1OOG A;  4HRG A;  2ZFD A;  1OOH A;  3OHM B;  3PN7 C;  2L0P A;  1U5I A;  4PE7 A;  2LAP A;  1SPY A;  1OMR A;  2LP2 A;  3CZ0 A;  1Y1U A;  4QJ5 B;  4YBH B;  5J3X A;  3A4U B;  2FJY A;  3KEV A;  4YI9 A;  5CSF A;  1DT7 B;  3CAB A;  2L2C A;  2JZI A;  2Q4U A;  2BAP A;  4N1G A;  2B1U A;  3CZT X;  1YUT A;  3N7H A;  1TOP A;  2PQL A;  4M2O A;  3SS5 A;  3VRQ A;  1OOI X;  3EVV A;  5DKR A;  4MRX A;  3O78 A;  2MRD A;  1EG3 A;  2CCM A;  1KFU S;  1M46 A;  2LE9 B;  2BCB A;  1JF0 A;  2WCL A;  3O6B A;  2FCD A;  1PK0 D;  3OB2 B;  3DF0 B;  1J7P A;  1GGZ A;  2BNX A;  5AEQ A;  2ZN9 A;  2MJW B;  1OMD A;  3D75 A;  1Q80 A;  1A2X A;  2EC6 C;  1EH2 A;  1F71 A;  1PVB A;  5HYD A;  4DIR A;  1EG4 A;  3IQQ A;  3S0D A;  1K93 D;  4DUQ A;  2CTN A;  2K2F A;  2OS8 C;  1OMV A;  3FIA A;  1C3Z A;  1FBV A;  4I5J A;  2PRU A;  2Y1N A;  4U8D A;  1E8A A;  1BU3 A;  3CS1 A;  3V2L A;  3WHU B;  1NPQ A;  1TNW A;  4E68 A;  2HPS A;  5KTY A;  4YRU A;  1OW4 A;  1IJ5 A;  1BMO A;  3OBV A;  2KYF A;  4UPG A;  1Z4H A;  3SG3 A;  2L4H A;  1F4O A;  4HRE E;  1MXE A;  2L51 A;  1JC2 A;  3B88 A;  3CLN A;  2BCX A;  3I5G B;  2MLE C;  1F70 A;  1QIV A;  2LAN A;  3SG7 A;  4C0L A;  2F3Z A;  2KAV A;  3NHT A;  5AFP A;  1BOD A;  1F55 A;  3CZ2 A;  2K7D A;  3S0G A;  2OPO A;  2LNK A;  1L2O B;  1Y1A A;  1SCM B;  1L7Z A;  2M1K B;  3JVT C;  2AUC A;  3PJI A;  3SJS A;  2FCE A;  4JPZ B;  3BUM B;  2DOQ A;  3L4L A;  2WCM A;  3RLZ A;  3PAL A;  4PHN A;  1S5G Z;  4A4C A;  5D69 A;  1N2D A;  1PAL A;  2M0R A;  4HRH A;  5I2L A;  3SIB A;  2L98 A;  1S3P A;  1SK6 D;  3O4Y A;  4M2P A;  4CLN A;  1DMO A;  2Y1M A;  1C3Y A;  2M7N A;  1WDC B;  1OZO A;  1DF0 A;  2ZKM X;  5KU1 A;  1ORG A;  3PM8 A;  4ETO A;  1JF2 A;  3OP0 A;  1FW4 A;  3TZ1 A;  2KQ6 A;  3K1E A;  2KGB C;  2QAC A;  5I94 A;  1IGV A;  1B7T Z;  1CDP A;  1N0Y A;  1BLQ A;  2CBL A;  4MZL A;  1G33 A;  1KFX S;  1CLL A;  1CDM A;  1RWY A;  1NSH A;  5KSZ A;  2H2K A;  1NCZ A;  5JOL A;  1AVS A;  1MR8 A;  1SCM C;  4PDZ A;  4WQ3 A;  3FE8 A;  2K7O A;  3BXK A;  2NZ0 A;  3SS3 A;  1OQP A;  3SS4 A;  1LXF C;  2M29 A;  1QIW A;  1KK8 C;  2JTZ A;  3I5H B;  4XJK A;  3E3R A;  1DVI A;  2KGR A;  4YGB B;  2PAL A;  3M0W A;  1EJ3 A;  5FYX A;  5I2O A;  2PVB A;  1YUU A;  2BKI B;  3F45 A;  2G2B A;  2JC2 A;  4PHK A;  1DJZ A;  2PAS A;  4NQG A;  2BL0 C;  2F2P A;  5I2Q A;  1B7T Y;  1FI5 A;  1MXL C;  2R2I A;  3AKA A;  5HL1 A;  1ODB A;  1ZFS A;  2ZRS A;  4IL1 A;  3BJH A;  1RFJ A;  1ZMZ A;  1J1D A;  4NDC A;  5DKQ A;  2O5G A;  2I7A A;  1DQE A;  4I5N B; 
#chains in the Genus database with same CATH homology
 2ZND A;  1EL4 A;  1B8C A;  2L4I A;  4CFR A;  2PMY A;  3SG4 A;  2AAO A;  2LC5 A;  1NX1 A;  1M45 A;  3LL8 B;  1S6J A;  1XFW O;  1S1E A;  2F2O A;  1A4P A;  2FJU B;  2K8M B;  4P2Y B;  2LVJ A;  1TIZ A;  3K21 A;  2WCF A;  2KOT A;  5HKW A;  1F54 A;  1WY9 A;  4GUK A;  1S6I A;  4MLW A;  4PCW A;  2H61 C;  2K7C A;  5TNC A;  4USL A;  3PLF B;  2Y5I A;  1TRF A;  3FS7 A;  1REC A;  1MWN A;  1CB1 A;  1U5I B;  2KAY A;  4GAO A;  1RJV A;  3CR2 A;  1PSR A;  3VGO A;  4F0Z B;  4AQJ A;  2G9B A;  1SKT A;  1QLS A;  2KAX A;  4WQ2 A;  1QLK A;  2CT9 A;  4OR9 B;  2WOS A;  1KFU L;  4GBA A;  4QJ3 B;  3SG5 A;  1UUR A;  1H4B A;  2SCP A;  3PSR A;  1CFF A;  1SMG A;  1A75 A;  1R6P A;  1DGV A;  1WRK A;  2K2A A;  1CLB A;  1QTX A;  2M97 A;  4CID A;  5B8I B;  1SL7 A;  4GNK B;  4JQ0 D;  3HX4 A;  1DJH A;  4N5X A;  3BOW B;  2MBX A;  1AHR A;  1K90 D;  4PAL A;  1QV0 A;  5D7F A;  4HSZ A;  4Q04 A;  1QS7 A;  1OSA A;  2KHN A;  4FTG A;  1A03 A;  2JXL A;  4MRY A;  3RM1 A;  3DD4 A;  3SG6 A;  1FPW A;  1S26 D;  1J7O A;  2KSP A;  1UHK A;  1F4Q A;  2LVK A;  2LM5 A;  2M3W A;  3ICB A;  1NX2 A;  1W7I B;  4BY5 A;  1NX0 A;  5AAN A;  1BR1 B;  1JFJ A;  4CPV A;  2BEC A;  1SNL A;  1S6C A;  3KF9 A;  4PHJ A;  2LCP A;  1NCY A;  1KQM B;  4M2Q A;  1UHN A;  1QAS A;  3LK0 A;  1H8B A;  1CDL A;  1YUS A;  3CTN A;  4YGA A;  2HET A;  2NCP A;  1CFD A;  1BT6 A;  3MSE B;  1DGU A;  5I8N A;  2NCO A;  3EKH A;  3VRR A;  1JSA A;  1KCY A;  4GGF A;  2GGZ A;  3NSI A;  4YGD B;  3TS5 B;  2K61 A;  1QX5 B;  1ZOT B;  1JUO A;  5BPJ A;  4DRW A;  1CKK A;  1QVI Z;  2JU0 A;  2KFH A;  1Y1X A;  3PFV A;  3I5G C;  1J1E A;  3TUY B;  1M63 B;  3NSL A;  4GGF C;  1JBA A;  3PAT A;  1K8U A;  1TNQ A;  1PVA A;  2LUC A;  1KQM C;  1KFX L;  5CSN A;  5ER4 X;  4A4B A;  1GQM A;  2ZRT A;  1JWD A;  1DTL A;  5HLV A;  1L2O C;  1LVC D;  4QJ4 B;  1XK4 C;  1XYD A;  1BF5 A;  1S5G Y;  3OX5 A;  4C0K A;  1SYM A;  3CR5 X;  2JOJ A;  1K9K A;  2SAS A;  1CFC A;  4GFT A;  2GV5 A;  3GK1 A;  3OX6 A;  4PE0 A;  4ZCU A;  1NIW A;  1YVH A;  3LCP C;  2F3Y A;  1HT9 A;  1QVI Y;  1HQV A;  1XFX O;  1VRK A;  1DJY A;  1OE9 B;  1WDC C;  1CLM A;  3LK1 A;  4YGC B;  3EK8 A;  5AER A;  1CFP A;  2LLS A;  1IH0 A;  1J7R A;  1AP4 A;  1X02 A;  3H4S E;  5HLO A;  4MZK A;  2M1U A;  4XYN A;  4AQI A;  4MSP A;  1CMF A;  2LVI A;  1J55 A;  1KWO B;  2HQW A;  1XA5 A;  2TN4 A;  1NX3 A;  4OKH A;  5PAL A;  3EVU A;  1XFY O;  2WCB A;  4DS7 A;  1K9P A;  1CM1 A;  1LA3 A;  2EGD A;  4P5O E;  2M7L A;  2F8P A;  2KNE A;  1YVL A;  1QXP A;  3CR4 X;  1PRW A;  4ORB B;  2H61 A;  2CXJ A;  2LLU A;  3I5H C;  3FWC A;  1BR4 B;  1JFK A;  1EXR A;  1GJY A;  3DVE A;  3IF7 A;  3GOF A;  3PN7 B;  5GQQ C;  3DVM A;  1WRL A;  3EK7 A;  2ISD A;  1SY9 A;  2LMT A;  3NSO A;  1B8R A;  5F6T A;  4ORA B;  1IRJ A;  2JNX A;  1UHJ A;  2I94 A;  1V1F A;  2KYC A;  1MF8 B;  1K94 A;  1AJ5 A;  1LIN A;  2JPT A;  2NXQ A;  1WLZ A;  1IKU A;  1XO5 A;  1Y6W A;  3KHE A;  2LUX A;  1PSB A;  4MBE A;  1KWO C;  1ZAC A;  2ZNE A;  1GGW A;  2LP3 A;  4R1E A;  1C7V A;  1G8I A;  4PHM A;  3D0Y A;  2JWW A;  1AJ4 A;  1RRO A;  2EC6 B;  2I18 A;  4MZJ A;  5AXI A;  4ZCV A;  2FOT A;  2GGM A;  2BE6 A;  2LLT A;  2M8U A;  1KSO A;  2OS8 B;  1RK9 A;  1UUS A;  1A75 B;  2LV7 A;  2RGI A;  4OV2 A;  5CSI A;  1F8H A;  2EHB A;  3I5I B;  2L2E A;  5IBW A;  4D1E A;  1BJF A;  2Q91 A;  5DKN A;  2WC8 A;  3JTD B;  1G4Y R;  2VRG A;  1AK8 A;  1YTZ C;  1J7Q A;  3O2P A;  5HKZ A;  2COL B;  3BUX B;  3AAJ A;  1MQ1 A;  3KPX A;  1ALV A;  1PUL A;  3D10 A;  3DVK A;  3TDU A;  1CDN A;  2LMV A;  1CTR A;  2P6B B;  3DF0 A;  1MHO A;  2F33 A;  4N1F A;  2HF5 A;  4C0J A;  1SW8 A;  3BUW B;  1SBJ A;  4I5K A;  1YUR A;  1YX7 A;  1B4C A;  3BOW A;  1NCX A;  4I5L B;  1XVJ A;  3JVT B;  2HQ8 A;  1YX8 A;  2A4J A;  2JT3 A;  3I5I C;  2KI4 B;  5K89 A;  3IQO A;  4AOM A;  1B8L A;  2NLN A;  1SRA A;  1NUB A;  4PE4 A;  2CNP A;  3JTD C;  1YRU B;  1CM4 A;  1QAT A;  1UP5 A;  4BY4 A;  1K96 A;  1NWD A;  4MEW A;  1V1G A;  3LLE A;  2V53 A;  4MN0 A;  1ALW A;  3CWG A;  1FF1 A;  1NP8 A;  1SL9 A;  1D1O A;  5HKY A;  1OOJ A;  3DVJ A;  1DF0 B;  3TDZ A;  2OTG B;  1R2U A;  1TNP A;  2KI6 C;  3ZNI A;  4NDB A;  4MVF A;  1XK4 A;  1C7W A;  2L5X B;  1ZUZ A;  4L9M A;  1UWO A;  2K7B A;  4GGN A;  1M31 A;  1SCV A;  2BKH B;  1DJG A;  1KK8 B;  3EVR A;  4OCI A;  2KI4 C;  2K0J A;  1NYA A;  3AKB A;  3ZWH A;  2JTT A;  1XFV O;  2JUL A;  3I5F B;  3QRX A;  3OB1 B;  3WNX B;  1KQV A;  2BBN A;  1MUX A;  3GK4 X;  2KBI A;  2MAZ A;  2BL0 B;  4YI8 A;  4XJK B;  1AUI B;  1B1G A;  4OVN F;  2KDH A;  1N65 A;  1XFU O;  4NDD A;  1BG1 A;  3A8R A;  2LHI A;  1Y0V H;  1QX2 A;  1SR6 B;  3SG2 A;  4PE1 A;  4ORC B;  1IQ5 A;  5CPV A;  1OZS A;  3TS5 C;  2MLF C;  2O60 A;  1DJX A;  3FWB A;  2BE4 A;  2OTG C;  2BBM A;  2KFG A;  1QV1 A;  5ER5 A;  1DJW A;  1DJI A;  1IG5 A;  2KQY A;  2KFF A;  2KBM A;  1KK7 Z;  3EK4 A;  3TUY C;  2MA2 A;  2LHL A;  4DCK A;  1WRZ A;  1TN4 A;  4FQO A;  1YR5 A;  1CNP A;  2E30 A;  2Y4Q A;  2ZN8 A;  1K95 A;  2E6W A;  4JWQ A;  3NXA A;  1IJ6 A;  1YRT B;  3I5F C;  1CMG A;  1K2H A;  1UHI A;  1LA0 A;  1XFZ O;  2M9G A;  3KO0 A;  1TTX A;  1LKJ A;  3WHT B;  1FI5 A;  1QJT A;  1K9U A;  2WOR A;  2JT8 A;  3GK2 A;  1WLM A;  2LVV A;  2QPT A;  3VRO A;  3WXA A;  4GPL B;  1W7J B;  2WCE A;  2AMI A;  2IS9 A;  1KSM A;  4YGE B;  1A29 A;  1SR6 C;  1TCO B;  1TCF A;  2JRF A;  1B9A A;  1KK7 Y;  3BQ3 A;  2LMU A;  1S36 A;  3HCM A;  3C1V A;  3BUN B;  2D8N A;  2PSR A;  1M39 A;  2JNF A;  1UHH A;  3TDI A;  1TNX A;  3AAK A;  1QX7 A;  2L50 A;  3VRN A;  3SIA A;  3EKJ A;  1RTP 1;  5CSJ A;  2MHH A;  1FI6 A;  2I2R E;  2WND A;  5G08 A;  1C07 A;  1SL8 A;  3BYA A;  4WRI A;  2BCA A;  3D0Y B;  3NSK A;  2M49 B;  4TNC A;  3CGA A;  4ICB A;  2JQ6 A;  1B47 A;  2JXC A;  2KI6 D;  3BUO B;  1IWQ A;  5JJG A;  2JT0 A;  1IQ3 A;  1BOC A;  4HRG A;  2ZFD A;  3OHM B;  3PN7 C;  2L0P A;  1U5I A;  4PE7 A;  2LAP A;  1SPY A;  1OMR A;  2LP2 A;  1Y1U A;  4QJ5 B;  4YBH B;  5J3X A;  3A4U B;  1DT7 B;  3KEV A;  4YI9 A;  5CSF A;  3VRP A;  2JZI A;  2Q4U A;  4N1G A;  2B1U A;  3CZT X;  1YUT A;  4CFQ A;  1TOP A;  4M2O A;  3VRQ A;  3EVV A;  5DKR A;  4MRX A;  3O78 A;  2MRD A;  1EG3 A;  2CCM A;  1KFU S;  1M46 A;  2LE9 B;  2BCB A;  1JF0 A;  3O6B A;  2FCD A;  1PK0 D;  3OB2 B;  3DF0 B;  1J7P A;  1GGZ A;  5AEQ A;  2ZN9 A;  2MJW B;  1OMD A;  1Q80 A;  1A2X A;  2EC6 C;  1EH2 A;  1F71 A;  1PVB A;  5HYD A;  4DIR A;  1EG4 A;  3IQQ A;  1K93 D;  4DUQ A;  2CTN A;  2K2F A;  2OS8 C;  1OMV A;  3FIA A;  1FBV A;  4I5J A;  2PRU A;  2Y1N A;  4U8D A;  1E8A A;  1BU3 A;  3CS1 A;  3WHU B;  1NPQ A;  1TNW A;  4E68 A;  2HPS A;  5KTY A;  4YRU A;  4UPG A;  1IJ5 A;  1BMO A;  2KYF A;  3SG3 A;  2L4H A;  1F4O A;  4HRE E;  1MXE A;  2L51 A;  1JC2 A;  3CLN A;  2BCX A;  3I5G B;  2MLE C;  1F70 A;  1QIV A;  2LAN A;  3SG7 A;  4C0L A;  2F3Z A;  2KAV A;  5AFP A;  1BOD A;  1F55 A;  2K7D A;  2OPO A;  2LNK A;  1L2O B;  1Y1A A;  1SCM B;  1L7Z A;  2M1K B;  3JVT C;  2AUC A;  3SJS A;  2FCE A;  4JPZ B;  3BUM B;  2DOQ A;  3RLZ A;  3PAL A;  4PHN A;  1S5G Z;  4A4C A;  5D69 A;  1N2D A;  1PAL A;  2M0R A;  4HRH A;  5I2L A;  3SIB A;  2L98 A;  1S3P A;  1SK6 D;  3O4Y A;  4M2P A;  4CLN A;  1DMO A;  2Y1M A;  2M7N A;  1WDC B;  1OZO A;  1DF0 A;  2ZKM X;  5KU1 A;  3PM8 A;  4ETO A;  1JF2 A;  3OP0 A;  1FW4 A;  3TZ1 A;  2KQ6 A;  2KGB C;  2QAC A;  1IGV A;  1B7T Z;  1CDP A;  1N0Y A;  1BLQ A;  2CBL A;  4MZL A;  1G33 A;  1KFX S;  1CLL A;  1CDM A;  1RWY A;  1NSH A;  5KSZ A;  2H2K A;  1NCZ A;  5JOL A;  1AVS A;  1MR8 A;  1SCM C;  4PDZ A;  4WQ3 A;  2K7O A;  3BXK A;  2NZ0 A;  1OQP A;  1LXF C;  2M29 A;  1QIW A;  1KK8 C;  2JTZ A;  3I5H B;  4XJK A;  3E3R A;  1DVI A;  2KGR A;  4YGB B;  2PAL A;  3M0W A;  1EJ3 A;  5FYX A;  5I2O A;  2PVB A;  1YUU A;  2BKI B;  3F45 A;  2G2B A;  2JC2 A;  4PHK A;  1DJZ A;  2PAS A;  4NQG A;  2BL0 C;  2F2P A;  5I2Q A;  1B7T Y;  1MXL C;  2R2I A;  3AKA A;  1ODB A;  1ZFS A;  2ZRS A;  4IL1 A;  1RFJ A;  1ZMZ A;  1J1D A;  4NDC A;  5DKQ A;  2O5G A;  2I7A A;  4I5N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...