3CR2A

X-ray structure of bovine zn(2+),ca(2+)-s100b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divalent metal ion complexes of S100B in the absence and presence of pentamidine.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords Protein S100-B
total genus 29
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cr2A00
1A2XA 1EXRA 2RGIA 1OOJA 1UWOA 1SL8A 1TNWA 2FCDA 3I5GB 2KQ6A 2L0PA 1M39A 3VRPA 1NPQA 2OTGC 2JU0A 2NCPA 1CFDA 2BCXA 3TUYB 1YUTA 2GGZA 1QVIY 1BR4B 2PALA 1ZACA 3CWGA 4A4BA 4HSZA 2WORA 1FBVA 1LVCD 1WRZA 1N2DA 3BQ3A 5HLVA 2FJUB 1KFUL 1NCZA 1PALA 1YVLA 2KBIA 2KI6C 3EK8A 5HKWA 4PE0A 1QV1A 4QJ5B 1U5IA 2K7OA 2VRGA 2LMTA 4M2PA 2Y4QA 1B4CA 1C7VA 2CXJA 2EHBA 2M7LA 4PHJA 1KSOA 3GK2A 2L4HA 2ZFDA 2K7CA 2L5XB 1K94A 1S5GY 2SCPA 1RWYA 1KFUS 4D1EA 3KHEA 1Y6WA 1C7WA 3GK1A 4DRWA 3LK0A 4XJKA 1G33A 2GGMA 2KBMA 4XJKB 2JWWA 3SIAA 1KCYA 1PULA 1BU3A 1MHOA 1PRWA 1V1FA 2LC5A 4P2YB 1CKKA 4I5LB 3I5FC 1PK0D 1WDCC 1LA3A 2HQWA 3HCMA 2JTTA 3PFVA 1F4OA 1R2UA 1YX8A 4N1FA 1YURA 1IKUA 1UP5A 2F2OA 4JQ0D 2MBXA 1WDCB 4YGAA 5AFPA 5JOLA 4ETOA 2L98A 1XO5A 4GPLB 1NIWA 1UHNA 4E68A 2M3WA 1IWQA 4GNKB 4MN0A 2GV5A 2WOSA 1NUBA 1CMFA 1SY9A 3I5IC 3AKBA 3DF0A 1OMDA 1B8CA 1J7RA 1CTRA 4MVFA 3JVTB 1KK8C 5K89A 1YRUB 2WC8A 3OP0A 1L2OB 2HETA 2PVBA 3BUNB 1IRJA 4AQIA 1DT7B 1YVHA 1ALWA 1SL7A 1SW8A 5D7FA 3GOFA 1SCVA 1MUXA 3JVTC 1SK6D 1SBJA 2BE6A 1K8UA 2LVVA 3OB1B 1ALVA 1CM4A 1SCMB 1TTXA 1K96A 4MZJA 3EVUA 1JF2A 4OCIA 3MSEB 1MF8B 3NSLA 2CT9A 2H61A 4AOMA 4DUQA 3ICBA 1XFXO 5J3XA 2CBLA 3FWCA 2LV7A 3CTNA 1OQPA 1JFKA 1MXLC 1B47A 1DJIA 2JXLA 2QACA 1A4PA 1NX2A 5B8IB 1DGVA 1F8HA 2K61A 3CR5X 1IJ5A 4R1EA 2NXQA 3BOWB 1A29A 1KSMA 1OMVA 2M1KB 4I5KA 3ZWHA 1SNLA 2MHHA 3SG6A 2K0JA 5FYXA 1IQ5A 1AHRA 3AAKA 3BUXB 1DJYA 2MLEC 4WQ2A 3BUWB 2JTZA 4WRIA 2O5GA 1LXFC 1KFXS 1CDLA 1N0YA 1NX3A 5KTYA 2FCEA 5I2LA 1H8BA 1DVIA 1L2OC 4M2QA 1DJWA 1G8IA 2ZKMX 2WNDA 1QASA 4I5JA 5BPJA 2QPTA 2M29A 4DCKA 1AUIB 2COLB 4JWQA 2KI4B 1XK4A 1YX7A 2M8UA 2BE4A 1QS7A 1PSRA 4PE1A 1YRTB 2ZRSA 4I5NB 4YI8A 3IF7A 3LK1A 1WRKA 4YGDB 2BECA 2KI6D 2H61C 3WNXB 1XA5A 2LUCA 1XYDA 5CSFA 3EK4A 3KF9A 3WHUB 3KEVA 3DF0B 1FI6A 2LP3A 1S26D 1ZFSA 1B9AA 2IS9A 1DJZA 2K7DA 4MBEA 3PALA 4ZCVA 1FF1A 1LKJA 2WCFA 3FWBA 1TIZA 1CDPA 2LUXA 4QJ4B 4PHMA 1NP8A 3VRQA 1SKTA 1QIVA 1Y1XA 3PN7B 4GAOA 2AAOA 4MZLA 1GGZA 1U5IB 1CLMA 3AKAA 4PCWA 1MXEA 1UHIA 2JT0A 2BBNA 2LCPA 2L50A 4GGNA 3DVEA 2JNXA 2ZN9A 3TZ1A 2FOTA 1L7ZA 2OPOA 1KK7Y 1QX2A 2M7NA 3O6BA 1CMGA 2MA2A 1D1OA 4NDDA 2LMVA 2NLNA 1BG1A 3IQOA 1JBAA 2L2EA 1NSHA 1IH0A 5AANA 1K90D 1F71A 5HKZA 1QLKA 3SG2A 1PVBA 4YBHB 4BY4A 2KQYA 1CDMA 1EH2A 2K8MB 1UURA 1BF5A 2PMYA 3EVRA 2KI4C 2Y1NA 1HT9A 3TS5B 4FQOA 2HF5A 1S36A 1FI5A 1JUOA 3EVVA 1DMOA 1IG5A 3BUOB 3O78A 2JT3A 5CSIA 3I5FB 1B7TY 1XFVO 4C0LA 5I8NA 2K7BA 1BMOA 1WY9A 1KFXL 3DVJA 1DF0A 5CSJA 1XFYO 1K2HA 1F4QA 1UUSA 2BKIB 3BUMB 3LLEA 2SASA 4C0JA 1NX0A 1F70A 2A4JA 1UHKA 4ICBA 2MJWB 1XFWO 3D10A 4OV2A 1CB1A 4NDBA 4DIRA 1SPYA 3SG7A 1WLMA 2BKHB 1KWOC 1N65A 1NX1A 2LNKA 3SJSA 2KGRA 1PSBA 1HQVA 1TCOB 2LM5A 5DKQA 1K9UA 3H4SE 1CM1A 2MLFC 4GGFC 2F8PA 4PE7A 2MRDA 4HRHA 4TNCA 1S6CA 1CFPA 4N1GA 1RK9A 1DTLA 4PHKA 4YI9A 4MZKA 4GBAA 3F45A 3CLNA 2KNEA 5HKYA 2H2KA 1JF0A 1S3PA 2Y1MA 2I18A 4NQGA 4PDZA 3WHTB 5AEQA 2M9GA 4MRYA 1IQ3A 2NCOA 2BBMA 1S5GZ 1RROA 2JNFA 2KYCA 4GUKA 1QX5B 2LVIA 1LINA 3NSKA 1SR6B 2LE9B 1AP4A 2KYFA 1J55A 2I7AA 1TOPA 1RFJA 2LHIA 2KFFA 1F54A 1GGWA 3SG5A 4OKHA 3VGOA 1B8LA 1QIWA 1GQMA 2JPTA 3IQQA 1M46A 1MWNA 1ZUZA 4HREE 1Y1UA 1C07A 5I2OA 1A75B 1M31A 1OZOA 1QVIZ 1TNQA 1JSAA 1TN4A 1QV0A 4PE4A 2JULA 1RECA 2KDHA 3PATA 5HYDA 2D8NA 2K2AA 3CZTX 2F33A 2M49B 3BXKA 2KAYA 1BJFA 1OE9B 4HRGA 5CPVA 1SL9A 2BCAA 3WXAA 2BCBA 2OS8B 1WLZA 3NSOA 3OHMB 3A8RA 4ORBB 1E8AA 3LCPC 1R6PA 3D0YA 1H4BA 5DKNA 4UPGA 3I5HB 2LAPA 1BT6A 1TNPA 2CNPA 2F2PA 3QRXA 3RLZA 2KFGA 5DKRA 1YUSA 2E6WA 2Q4UA 1NWDA 1DGUA 1QATA 2ZNEA 3EKJA 3JTDC 1J1EA 1M45A 3C1VA 1CLLA 2M1UA 5G08A 1J1DA 2E30A 2ZRTA 1KQVA 2LHLA 1V1GA 3CGAA 1A03A 4YRUA 3TUYC 1SR6C 2P6BB 2B1UA 3SG4A 2I2RE 4MRXA 3KO0A 1B8RA 1QX7A 2LLTA 3BOWA 4YGBB 4GFTA 2Q91A 1S6JA 1ZOTB 1MQ1A 1TRFA 2NZ0A 1XFUO 2JOJA 2L51A 3DVMA 1QXPA 3OX5A 1AJ4A 3VRNA 2M97A 4PALA 1EL4A 4XYNA 1BOCA 1FPWA 4DS7A 3I5HC 1M63B 4FTGA 2KOTA 2LLSA 3E3RA 2LLUA 4AQJA 1BLQA 2M0RA 3CR2A 3OX6A 1QJTA 3PM8A 2CCMA 5HLOA 1J7OA 3TDIA 3EKHA 1F55A 1G4YR 1TCFA 2G9BA 2KAVA 2EC6B 3SG3A 3ZNIA 2AMIA 1NYAA 1CFFA 1Y1AA 1S1EA 2BL0C 2EC6C 2LVKA 1W7IB 3PSRA 5KSZA 4F0ZB 1DJGA 4U8DA 3O2PA 3VRRA 3I5GC 5AXIA 1PVAA 5D69A 4MLWA 4CLNA 1NCYA 1ODBA 3BYAA 1DJHA 4ORCB 3VROA 4GGFA 1YTZC 2BL0B 3NXAA 4M2OA 1ZMZA 1JWDA 5TNCA 5CSNA 1CLBA 2JZIA 2OTGB 4L9MA 1SCMC 1J7QA 4MEWA 5IBWA 2KSPA 1IJ6A 2HQ8A 3KPXA 3TDUA 4CIDA 1X02A 1S6IA 1XFZO 1B1GA 1A75A 1GJYA 1YR5A 4PHNA 1QLSA 5AERA 1JFJA 3HX4A 2JQ6A 1KK8B 1AK8A 1UHHA 1OMRA 1EG3A 4Q04A 2KHNA 4OR9B 4CFRA 1BR1B 1CDNA 2K2FA 4A4CA 1SYMA 2OS8C 2ZNDA 1EG4A 2KAXA 1IGVA 3AAJA 4YGEB 4NDCA 1YUUA 2KGBC 2LANA 4C0KA 3DVKA 5ER4X 3PN7C 2G2BA 4CFQA 4QJ3B 1LA0A 4CPVA 3NSIA 2WCBA 1W7JB 2F3YA 4WQ3A 2R2IA 3SIBA 4P5OE 2PASA 2CTNA 1CNPA 3FS7A 4USLA 3O4YA 1KWOB 2AUCA 1NCXA 2MAZA 3OB2B 2KFHA 3M0WA 2I94A 3CR4X 5I2QA 2L4IA 2JXCA 1Y0VH 4BY5A 1K93D 2Y5IA 1AVSA 3JTDB 1JC2A 3I5IB 4YGCB 2ZN8A 3RM1A 3A4UB 4N5XA 1SMGA 1SRAA 3GK4X 1WRLA 5ER5A 5GQQC 1OZSA 1OSAA 4JPZB 1K9KA 2DOQA 1DJXA 1B7TZ 1Q80A 2JC2A 2F3ZA 2LP2A 2LVJA 3K21A 1TNXA 2TN4A 4MSPA 5PALA 1BODA 1MR8A 3D0YB 3LL8B 3TS5C 4ORAB 1RTP1 5F6TA 2LMUA 2V53A 2PSRA 1K9PA 2O60A 3PLFB 1VRKA 3FIAA 1QTXA 1AJ5A 4ZCUA 5KU1A 3CS1A 1FW4A 1UHJA 5JJGA 1RJVA 1KQMC 4IL1A 3EK7A 1XVJA 1DF0B 1KQMB 2ISDA 1CFCA 2WCEA 2HPSA 2PRUA 2JRFA 2EGDA 4OVNF 1KK7Z 2JT8A 1J7PA 3TDZA 3DD4A 1XK4C 1K95A 1EJ3A
chains in the Genus database with same CATH superfamily
1A2XA 1EXRA 2RGIA 1OOJA 1UWOA 1SL8A 1SSEB 1TNWA 2FCDA 2ERBA 2KLDA 3I5GB 2KQ6A 2L0PA 1M39A 3CDNA 3VRPA 1NPQA 2OTGC 4OZDA 2JU0A 2NCPA 1CFDA 2BCXA 3TUYB 1YUTA 2GGZA 1QVIY 3R1OA 1BR4B 2PALA 1ZACA 1DEKA 3CWGA 5FI2A 4A4BA 4HSZA 2WORA 1FBVA 1LVCD 1WRZA 1N2DA 3BQ3A 5HLVA 2FJUB 1KFUL 1NCZA 1PALA 1YVLA 2KBIA 2KI6C 3EK8A 5HKWA 4PE0A 1QV1A 4QJ5B 1U5IA 2K7OA 2VRGA 1TWOA 2LMTA 4M2PA 2Y4QA 1B4CA 1C7VA 1C3ZA 2CXJA 2EHBA 1Z4HA 4PHJA 1KSOA 3GK2A 2L4HA 5DICA 2M7LA 2ZFDA 3PJIA 2K7CA 2L5XB 1K94A 1S5GY 2QEVA 1RWYA 1KFUS 2QEBA 2SCPA 3O4XA 3D74A 4D1EA 3KHEA 1Y6WA 1C7WA 3GK1A 4DRWA 3LK0A 4XJKA 1G33A 2GGMA 3BFAA 2KBMA 4XJKB 2JWWA 3SIAA 1KCYA 1PULA 1C3YA 2FJYA 1BU3A 1MHOA 1PRWA 1V1FA 2LC5A 4P2YB 3CABA 1CKKA 4I5LB 3I5FC 1PK0D 1WDCC 1LA3A 2HQWA 3HCMA 2JTTA 3PFVA 1F4OA 1R2UA 1YX8A 2WC6A 2WCJA 4N1FA 1YURA 1IKUA 1UP5A 2F2OA 4JQ0D 2MBXA 1WDCB 2WC5A 4YGAA 5AFPA 5JOLA 4ETOA 2L98A 1XO5A 3Q8IA 1NIWA 2PQLA 1UHNA 4GPLB 5EL2A 4E68A 2M3WA 1IWQA 2P70A 4GNKB 2GV5A 4MN0A 2WOSA 1NUBA 1CMFA 1SY9A 3I5IC 3CZ1A 3AKBA 3DF0A 1OMDA 1B8CA 1DQEA 1J7RA 1CTRA 1OOGA 4MVFA 3JVTB 3SS5A 1KK8C 5K89A 1YRUB 2WC8A 3OP0A 1L2OB 3EG5B 2HETA 2PVBA 3BUNB 1IRJA 4AQIA 1DT7B 1YVHA 1ALWA 1SL7A 1SW8A 2YGUA 3GOFA 5D7FA 1SCVA 1MUXA 2WCHA 1SK6D 3JVTC 1SBJA 2BE6A 1K8UA 2LVVA 3OB1B 1ALVA 1CM4A 1SCMB 1TTXA 1K96A 4MZJA 3EVUA 1JF2A 4OCIA 3MSEB 1MF8B 3NSLA 2CT9A 2H61A 4AOMA 4DUQA 3ICBA 1XFXO 3D75A 1IIOA 5J3XA 2CBLA 3FWCA 2LV7A 3CTNA 4F7FA 1OQPA 1JFKA 1MXLC 1B47A 1DJIA 1ORGA 2JXLA 4FQTA 2QACA 1A4PA 1NX2A 5B8IB 1DGVA 1F8HA 2K61A 3R1VA 3BFBA 3CR5X 1IJ5A 4R1EA 2NXQA 3BOWB 1A29A 1KSMA 3FE8A 1OMVA 2M1KB 4I5KA 3ZWHA 1SNLA 2MHHA 3SG6A 2K0JA 5FYXA 3L4AA 1IQ5A 1AHRA 3AAKA 3BUXB 1DJYA 2MLEC 4WQ2A 2WCLA 3BUWB 2JTZA 4WRIA 2O5GA 1LXFC 1KFXS 1CDLA 1N0YA 1NX3A 5KTYA 2FCEA 5I2LA 1H8BA 1DVIA 1L2OC 4M2QA 1DJWA 1G8IA 2ZKMX 2WNDA 1QASA 3D73A 4I5JA 5BPJA 2QPTA 2M29A 4DCKA 1AUIB 2COLB 4JWQA 2KI4B 1DELA 1XK4A 1YX7A 2M8UA 2BE4A 4JD9A 1QS7A 1PSRA 4PE1A 1YRTB 2ZRSA 4I5NB 1QWVA 4YI8A 3IF7A 3LK1A 1WRKA 4YGDB 2BECA 2KI6D 2H61C 3B86A 3WNXB 1XA5A 2LUCA 1XYDA 5CSFA 3EK4A 3KF9A 3WHUB 3KEVA 3DF0B 5I94A 1FI6A 2LP3A 3D77A 1S26D 1ZFSA 2BNXA 1B9AA 2IS9A 1DJZA 2K7DA 4MBEA 3PALA 4ZCVA 1FF1A 1LKJA 2WCFA 3FWBA 1TIZA 1CDPA 3N7HA 2LUXA 4QJ4B 4PHMA 1NP8A 3VRQA 1SKTA 1QIVA 1Y1XA 3IVTA 3PN7B 2AAOA 4GAOA 4MZLA 1GGZA 1U5IB 1CLMA 3AKAA 4PCWA 1MXEA 1UHIA 1DC1A 2JT0A 2BBNA 2LCPA 2L50A 3K1EA 4GGNA 3DVEA 2JNXA 2ZN9A 3OBVA 3TZ1A 2FOTA 1L7ZA 2OPOA 1KK7Y 1QX2A 2M7NA 3O6BA 1CMGA 2MA2A 1D1OA 4NDDA 2LMVA 2NLNA 4KYNA 1BG1A 3IQOA 5D3OA 2L2EA 3RZSA 1JBAA 1NSHA 1IH0A 5AANA 1K90D 1F71A 5HKZA 1QLKA 3SG2A 1PVBA 2QDIA 4YBHB 4BY4A 2KQYA 1CDMA 1EH2A 2K8MB 1UURA 1BF5A 2PMYA 3D78A 3EVRA 2KI4C 2Y1NA 1HT9A 3TS5B 4FQOA 2HF5A 1S36A 1FI5A 1JUOA 2PYQA 3EVVA 3OGNA 2WCKA 1DMOA 1IG5A 3BUOB 3O78A 2JT3A 5CSIA 3I5FB 1B7TY 1XFVO 3UNWA 4C0LA 5I8NA 2K7BA 1BMOA 1WY9A 1KFXL 3DVJA 1DF0A 5CSJA 1XFYO 1K2HA 1F4QA 1UUSA 2BKIB 3BUMB 3LLEA 1GM0A 2SASA 4C0JA 1NX0A 1F70A 2A4JA 1UHKA 4ICBA 2MJWB 1XFWO 3D10A 4OV2A 1CB1A 4NDBA 4DIRA 1SPYA 3SG7A 1WLMA 2BKHB 1KWOC 1N65A 1NX1A 2LNKA 3SJSA 3R72A 2KGRA 1PSBA 3CZ2A 1HQVA 1TCOB 2LM5A 2KPHA 5DKQA 1K9UA 3V2LA 3H4SE 1CM1A 2MLFC 4GGFC 2F8PA 2JPOA 4PE7A 2MRDA 4HRHA 4TNCA 1S6CA 1CFPA 4N1GA 1RK9A 1DTLA 4PHKA 4YI9A 4MZKA 4GBAA 3F45A 3CLNA 2KNEA 5HKYA 2H2KA 3S0FA 3FE9A 1JF0A 1S3PA 2Y1MA 5FI7A 2I18A 4NQGA 4PDZA 3WHTB 5AEQA 2M9GA 2K60A 4MRYA 1OW4A 4PT1A 1IQ3A 2NCOA 2BBMA 1S5GZ 1RROA 2JNFA 2KYCA 4GUKA 1QX5B 2LVIA 1LINA 3NSKA 1SR6B 2LE9B 1AP4A 2KYFA 1J55A 2I7AA 1TOPA 1RFJA 2LHIA 2KFFA 1F54A 1GGWA 3SG5A 4OKHA 3VGOA 2QEHA 1B8LA 1QIWA 2GTEA 1GQMA 2JPTA 3S0AA 3IQQA 1M46A 1MWNA 1ZUZA 4HREE 1Y1UA 1C07A 5I2OA 1A75B 1M31A 1OZOA 1QVIZ 1TNQA 3L47A 1TN4A 1W9ZA 1JSAA 1QV0A 4PE4A 2JULA 1RECA 2KDHA 3PATA 5HYDA 2D8NA 2K2AA 3CZTX 2F33A 2M49B 3BXKA 2KAYA 1BJFA 1OE9B 4HRGA 5CPVA 1SL9A 2BCAA 3WXAA 3B87A 4IJ7A 2BCBA 1OOFA 2OS8B 3DYEA 1WLZA 3NSOA 3OHMB 3A8RA 3NHIA 4ORBB 1E8AA 3LCPC 1R6PA 3D0YA 1H4BA 5DKNA 4UPGA 3I5HB 2LAPA 1BT6A 1TNPA 2CNPA 2F2PA 3QRXA 3DXLA 3RLZA 2KFGA 5DKRA 1YUSA 2E6WA 2Q4UA 1NWDA 2KLEA 1DGUA 1QATA 2ZNEA 3EKJA 3JTDC 3SS4A 1J1EA 3DY9A 1M45A 3C1VA 3FE6A 1CLLA 2M1UA 5G08A 1J1DA 2E30A 2ZRTA 1KQVA 2LHLA 1V1GA 2WCMA 3CGAA 3R1PA 4YRUA 1A03A 3TUYC 1SR6C 2P6BB 2B1UA 3SG4A 3SS3A 2I2RE 4MRXA 3NHTA 3B88A 3KO0A 1B8RA 1QX7A 2LLTA 3BOWA 3CZ0A 4YGBB 3S0GA 1LS8A 2Q91A 4GFTA 1S6JA 1ZOTB 1MQ1A 1TRFA 2NZ0A 1XFUO 2JOJA 2L51A 3DVMA 1QXPA 3B6XA 1AJ4A 3OX5A 3VRNA 2M97A 4PALA 1EL4A 1OOIX 4XYNA 1BOCA 1TUJA 1FPWA 2BAPA 4DS7A 3I5HC 1M63B 4FTGA 2KOTA 2LLSA 3E3RA 2LLUA 4AQJA 1BLQA 2M0RA 1T14A 3CR2A 3OX6A 1OOHA 1QJTA 3PM8A 2CCMA 3CYZA 2L2CA 5HLOA 1J7OA 3TDIA 3S0DA 3EKHA 1F55A 1G4YR 1TCFA 2G9BA 1Z2CB 2KAVA 2EC6B 3SG3A 3ZNIA 2AMIA 1NYAA 3UO9A 1CFFA 1Y1AA 1S1EA 2BL0C 2EC6C 2LVKA 1W7IB 3PSRA 5KSZA 4F0ZB 1DJGA 3L4LA 4U8DA 3O2PA 3VRRA 3I5GC 5AXIA 1PVAA 5D69A 4MLWA 4CLNA 3NGVA 5HL1A 1NCYA 1ODBA 3BYAA 1DJHA 4ORCB 3S0EA 3VROA 4GGFA 1YTZC 2BL0B 3NXAA 4M2OA 1ZMZA 1JWDA 5TNCA 5CSNA 1CLBA 2JZIA 2OTGB 4L9MA 1SCMC 1J7QA 4MEWA 5IBWA 2KSPA 1IJ6A 2HQ8A 3KPXA 3TDUA 4CIDA 1X02A 1S6IA 3VB1A 1XFZO 1B1GA 1A75A 1GJYA 1YR5A 4PHNA 1QLSA 5AERA 1JFJA 3HX4A 2JQ6A 1KK8B 1AK8A 1UHHA 1OMRA 2H8VA 1EG3A 4Q04A 2KHNA 3DZTA 4OR9B 1BR1B 4CFRA 1CDNA 1P28A 2K2FA 4A4CA 1SYMA 2OS8C 2ZNDA 1EG4A 2KAXA 1IGVA 3AAJA 4YGEB 4NDCA 1YUUA 2KGBC 2LANA 4C0KA 3DVKA 5ER4X 3PN7C 2G2BA 4CFQA 4QJ3B 1LA0A 4CPVA 3NSIA 2WCBA 3BFHA 1W7JB 2F3YA 4WQ3A 2R2IA 3SIBA 4P5OE 2PASA 3S0BA 2CTNA 3BJHA 3PM2A 3FS7A 1CNPA 4USLA 3O4YA 1KWOB 2AUCA 1NCXA 2MAZA 3OB2B 2KFHA 3M0WA 2I94A 3CR4X 5I2QA 2L4IA 2JXCA 1Y0VH 4BY5A 1K93D 2Y5IA 1AVSA 3JTDB 1JC2A 3I5IB 4YGCB 2ZN8A 3RM1A 3A4UB 4N5XA 1SMGA 1SRAA 3D76A 1WRLA 3GK4X 5ER5A 5GQQC 1OZSA 1OSAA 4JPZB 1K9KA 2DOQA 1DJXA 1B7TZ 1Q80A 2JC2A 2F3ZA 2LP2A 4JKTA 2LVJA 3K21A 1TNXA 2TN4A 4MSPA 5PALA 4INWA 1MR8A 3D0YB 3LL8B 3QMEA 1BODA 3TS5C 4ORAB 1RTP1 5F6TA 3B7AA 2LMUA 2QEOA 2V53A 2PSRA 5FI6A 2L5YA 1K9PA 2O60A 3PLFB 1VRKA 3FIAA 1QTXA 1AJ5A 4ZCUA 2P71A 3CS1A 5KU1A 1FW4A 1UHJA 5JJGA 1RJVA 1KQMC 4IL1A 3EK7A 1XVJA 1DF0B 1KQMB 2ISDA 1CFCA 2WCEA 2HPSA 1XFRA 2PRUA 2JRFA 2EGDA 4OVNF 1KK7Z 2JT8A 1J7PA 3TDZA 3DD4A 1XK4C 1K95A 4INXA 1TUZA 1EJ3A
chains in the Genus database with same CATH topology
1A2XA 1EXRA 2RGIA 1OOJA 1UWOA 1SL8A 1TNWA 2FCDA 3I5GB 2KQ6A 2L0PA 1M39A 3VRPA 1NPQA 2OTGC 2JU0A 2NCPA 1CFDA 2BCXA 3TUYB 1YUTA 2GGZA 1QVIY 1BR4B 2PALA 1ZACA 3CWGA 4A4BA 4HSZA 2WORA 1FBVA 1LVCD 1WRZA 1N2DA 3BQ3A 5HLVA 2FJUB 1KFUL 1NCZA 1PALA 1YVLA 2KBIA 2KI6C 3EK8A 5HKWA 4PE0A 1QV1A 4QJ5B 1U5IA 2K7OA 2VRGA 2LMTA 4M2PA 2Y4QA 1B4CA 1C7VA 2CXJA 2EHBA 2M7LA 4PHJA 1KSOA 3GK2A 2L4HA 2ZFDA 2K7CA 2L5XB 1K94A 1S5GY 2SCPA 1RWYA 1KFUS 4D1EA 3KHEA 1Y6WA 1C7WA 3GK1A 4DRWA 3LK0A 4XJKA 1G33A 2GGMA 2KBMA 4XJKB 2JWWA 3SIAA 1KCYA 1PULA 1BU3A 1MHOA 1PRWA 1V1FA 2LC5A 4P2YB 1CKKA 4I5LB 3I5FC 1PK0D 1WDCC 1LA3A 2HQWA 3HCMA 2JTTA 3PFVA 1F4OA 1R2UA 1YX8A 4N1FA 1YURA 1IKUA 1UP5A 2F2OA 4JQ0D 2MBXA 1WDCB 4YGAA 5AFPA 5JOLA 4ETOA 2L98A 1XO5A 4GPLB 1NIWA 1UHNA 4E68A 2M3WA 1IWQA 4GNKB 4MN0A 2GV5A 2WOSA 1NUBA 1CMFA 1SY9A 3I5IC 3AKBA 3DF0A 1OMDA 1B8CA 1J7RA 1CTRA 4MVFA 3JVTB 1KK8C 5K89A 1YRUB 2WC8A 3OP0A 1L2OB 2HETA 2PVBA 3BUNB 1IRJA 4AQIA 1DT7B 1YVHA 1ALWA 1SL7A 1SW8A 5D7FA 3GOFA 1SCVA 1MUXA 3JVTC 1SK6D 1SBJA 2BE6A 1K8UA 2LVVA 3OB1B 1ALVA 1CM4A 1SCMB 1TTXA 1K96A 4MZJA 3EVUA 1JF2A 4OCIA 3MSEB 1MF8B 3NSLA 2CT9A 2H61A 4AOMA 4DUQA 3ICBA 1XFXO 5J3XA 2CBLA 3FWCA 2LV7A 3CTNA 1OQPA 1JFKA 1MXLC 1B47A 1DJIA 2JXLA 2QACA 1A4PA 1NX2A 5B8IB 1DGVA 1F8HA 2K61A 3CR5X 1IJ5A 4R1EA 2NXQA 3BOWB 1A29A 1KSMA 1OMVA 2M1KB 4I5KA 3ZWHA 1SNLA 2MHHA 3SG6A 2K0JA 5FYXA 1IQ5A 1AHRA 3AAKA 3BUXB 1DJYA 2MLEC 4WQ2A 3BUWB 2JTZA 4WRIA 2O5GA 1LXFC 1KFXS 1CDLA 1N0YA 1NX3A 5KTYA 2FCEA 5I2LA 1H8BA 1DVIA 1L2OC 4M2QA 1DJWA 1G8IA 2ZKMX 2WNDA 1QASA 4I5JA 5BPJA 2QPTA 2M29A 4DCKA 1AUIB 2COLB 4JWQA 2KI4B 1XK4A 1YX7A 2M8UA 2BE4A 1QS7A 1PSRA 4PE1A 1YRTB 2ZRSA 4I5NB 4YI8A 3IF7A 3LK1A 1WRKA 4YGDB 2BECA 2KI6D 2H61C 3WNXB 1XA5A 2LUCA 1XYDA 5CSFA 3EK4A 3KF9A 3WHUB 3KEVA 3DF0B 1FI6A 2LP3A 1S26D 1ZFSA 1B9AA 2IS9A 1DJZA 2K7DA 4MBEA 3PALA 4ZCVA 1FF1A 1LKJA 2WCFA 3FWBA 1TIZA 1CDPA 2LUXA 4QJ4B 4PHMA 1NP8A 3VRQA 1SKTA 1QIVA 1Y1XA 3PN7B 4GAOA 2AAOA 4MZLA 1GGZA 1U5IB 1CLMA 3AKAA 4PCWA 1MXEA 1UHIA 2JT0A 2BBNA 2LCPA 2L50A 4GGNA 3DVEA 2JNXA 2ZN9A 3TZ1A 2FOTA 1L7ZA 2OPOA 1KK7Y 1QX2A 2M7NA 3O6BA 1CMGA 2MA2A 1D1OA 4NDDA 2LMVA 2NLNA 1BG1A 3IQOA 1JBAA 2L2EA 1NSHA 1IH0A 5AANA 1K90D 1F71A 5HKZA 1QLKA 3SG2A 1PVBA 4YBHB 4BY4A 2KQYA 1CDMA 1EH2A 2K8MB 1UURA 1BF5A 2PMYA 3EVRA 2KI4C 2Y1NA 1HT9A 3TS5B 4FQOA 2HF5A 1S36A 1FI5A 1JUOA 3EVVA 1DMOA 1IG5A 3BUOB 3O78A 2JT3A 5CSIA 3I5FB 1B7TY 1XFVO 4C0LA 5I8NA 2K7BA 1BMOA 1WY9A 1KFXL 3DVJA 1DF0A 5CSJA 1XFYO 1K2HA 1F4QA 1UUSA 2BKIB 3BUMB 3LLEA 2SASA 4C0JA 1NX0A 1F70A 2A4JA 1UHKA 4ICBA 2MJWB 1XFWO 3D10A 4OV2A 1CB1A 4NDBA 4DIRA 1SPYA 3SG7A 1WLMA 2BKHB 1KWOC 1N65A 1NX1A 2LNKA 3SJSA 2KGRA 1PSBA 1HQVA 1TCOB 2LM5A 5DKQA 1K9UA 3H4SE 1CM1A 2MLFC 4GGFC 2F8PA 4PE7A 2MRDA 4HRHA 4TNCA 1S6CA 1CFPA 4N1GA 1RK9A 1DTLA 4PHKA 4YI9A 4MZKA 4GBAA 3F45A 3CLNA 2KNEA 5HKYA 2H2KA 1JF0A 1S3PA 2Y1MA 2I18A 4NQGA 4PDZA 3WHTB 5AEQA 2M9GA 4MRYA 1IQ3A 2NCOA 2BBMA 1S5GZ 1RROA 2JNFA 2KYCA 4GUKA 1QX5B 2LVIA 1LINA 3NSKA 1SR6B 2LE9B 1AP4A 2KYFA 1J55A 2I7AA 1TOPA 1RFJA 2LHIA 2KFFA 1F54A 1GGWA 3SG5A 4OKHA 3VGOA 1B8LA 1QIWA 1GQMA 2JPTA 3IQQA 1M46A 1MWNA 1ZUZA 4HREE 1Y1UA 1C07A 5I2OA 1A75B 1M31A 1OZOA 1QVIZ 1TNQA 1JSAA 1TN4A 1QV0A 4PE4A 2JULA 1RECA 2KDHA 3PATA 5HYDA 2D8NA 2K2AA 3CZTX 2F33A 2M49B 3BXKA 2KAYA 1BJFA 1OE9B 4HRGA 5CPVA 1SL9A 2BCAA 3WXAA 2BCBA 2OS8B 1WLZA 3NSOA 3OHMB 3A8RA 4ORBB 1E8AA 3LCPC 1R6PA 3D0YA 1H4BA 5DKNA 4UPGA 3I5HB 2LAPA 1BT6A 1TNPA 2CNPA 2F2PA 3QRXA 3RLZA 2KFGA 5DKRA 1YUSA 2E6WA 2Q4UA 1NWDA 1DGUA 1QATA 2ZNEA 3EKJA 3JTDC 1J1EA 1M45A 3C1VA 1CLLA 2M1UA 5G08A 1J1DA 2E30A 2ZRTA 1KQVA 2LHLA 1V1GA 3CGAA 1A03A 4YRUA 3TUYC 1SR6C 2P6BB 2B1UA 3SG4A 2I2RE 4MRXA 3KO0A 1B8RA 1QX7A 2LLTA 3BOWA 4YGBB 4GFTA 2Q91A 1S6JA 1ZOTB 1MQ1A 1TRFA 2NZ0A 1XFUO 2JOJA 2L51A 3DVMA 1QXPA 3OX5A 1AJ4A 3VRNA 2M97A 4PALA 1EL4A 4XYNA 1BOCA 1FPWA 4DS7A 3I5HC 1M63B 4FTGA 2KOTA 2LLSA 3E3RA 2LLUA 4AQJA 1BLQA 2M0RA 3CR2A 3OX6A 1QJTA 3PM8A 2CCMA 5HLOA 1J7OA 3TDIA 3EKHA 1F55A 1G4YR 1TCFA 2G9BA 2KAVA 2EC6B 3SG3A 3ZNIA 2AMIA 1NYAA 1CFFA 1Y1AA 1S1EA 2BL0C 2EC6C 2LVKA 1W7IB 3PSRA 5KSZA 4F0ZB 1DJGA 4U8DA 3O2PA 3VRRA 3I5GC 5AXIA 1PVAA 5D69A 4MLWA 4CLNA 1NCYA 1ODBA 3BYAA 1DJHA 4ORCB 3VROA 4GGFA 1YTZC 2BL0B 3NXAA 4M2OA 1ZMZA 1JWDA 5TNCA 5CSNA 1CLBA 2JZIA 2OTGB 4L9MA 1SCMC 1J7QA 4MEWA 5IBWA 2KSPA 1IJ6A 2HQ8A 3KPXA 3TDUA 4CIDA 1X02A 1S6IA 1XFZO 1B1GA 1A75A 1GJYA 1YR5A 4PHNA 1QLSA 5AERA 1JFJA 3HX4A 2JQ6A 1KK8B 1AK8A 1UHHA 1OMRA 1EG3A 4Q04A 2KHNA 4OR9B 4CFRA 1BR1B 1CDNA 2K2FA 4A4CA 1SYMA 2OS8C 2ZNDA 1EG4A 2KAXA 1IGVA 3AAJA 4YGEB 4NDCA 1YUUA 2KGBC 2LANA 4C0KA 3DVKA 5ER4X 3PN7C 2G2BA 4CFQA 4QJ3B 1LA0A 4CPVA 3NSIA 2WCBA 1W7JB 2F3YA 4WQ3A 2R2IA 3SIBA 4P5OE 2PASA 2CTNA 1CNPA 3FS7A 4USLA 3O4YA 1KWOB 2AUCA 1NCXA 2MAZA 3OB2B 2KFHA 3M0WA 2I94A 3CR4X 5I2QA 2L4IA 2JXCA 1Y0VH 4BY5A 1K93D 2Y5IA 1AVSA 3JTDB 1JC2A 3I5IB 4YGCB 2ZN8A 3RM1A 3A4UB 4N5XA 1SMGA 1SRAA 3GK4X 1WRLA 5ER5A 5GQQC 1OZSA 1OSAA 4JPZB 1K9KA 2DOQA 1DJXA 1B7TZ 1Q80A 2JC2A 2F3ZA 2LP2A 2LVJA 3K21A 1TNXA 2TN4A 4MSPA 5PALA 1BODA 1MR8A 3D0YB 3LL8B 3TS5C 4ORAB 1RTP1 5F6TA 2LMUA 2V53A 2PSRA 1K9PA 2O60A 3PLFB 1VRKA 3FIAA 1QTXA 1AJ5A 4ZCUA 5KU1A 3CS1A 1FW4A 1UHJA 5JJGA 1RJVA 1KQMC 4IL1A 3EK7A 1XVJA 1DF0B 1KQMB 2ISDA 1CFCA 2WCEA 2HPSA 2PRUA 2JRFA 2EGDA 4OVNF 1KK7Z 2JT8A 1J7PA 3TDZA 3DD4A 1XK4C 1K95A 1EJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2X A;  1EXR A;  2RGI A;  1OOJ A;  1UWO A;  1SL8 A;  1TNW A;  2FCD A;  3I5G B;  2KQ6 A;  2L0P A;  1M39 A;  3VRP A;  1NPQ A;  2OTG C;  2JU0 A;  2NCP A;  1CFD A;  2BCX A;  3TUY B;  1YUT A;  2GGZ A;  1QVI Y;  1BR4 B;  2PAL A;  1ZAC A;  3CWG A;  4A4B A;  4HSZ A;  2WOR A;  1FBV A;  1LVC D;  1WRZ A;  1N2D A;  3BQ3 A;  5HLV A;  2FJU B;  1KFU L;  1NCZ A;  1PAL A;  1YVL A;  2KBI A;  2KI6 C;  3EK8 A;  5HKW A;  4PE0 A;  1QV1 A;  4QJ5 B;  1U5I A;  2K7O A;  2VRG A;  2LMT A;  4M2P A;  2Y4Q A;  1B4C A;  1C7V A;  2CXJ A;  2EHB A;  2M7L A;  4PHJ A;  1KSO A;  3GK2 A;  2L4H A;  2ZFD A;  2K7C A;  2L5X B;  1K94 A;  1S5G Y;  2SCP A;  1RWY A;  1KFU S;  4D1E A;  3KHE A;  1Y6W A;  1C7W A;  3GK1 A;  4DRW A;  3LK0 A;  4XJK A;  1G33 A;  2GGM A;  2KBM A;  4XJK B;  2JWW A;  3SIA A;  1KCY A;  1PUL A;  1BU3 A;  1MHO A;  1PRW A;  1V1F A;  2LC5 A;  4P2Y B;  1CKK A;  4I5L B;  3I5F C;  1PK0 D;  1WDC C;  1LA3 A;  2HQW A;  3HCM A;  2JTT A;  3PFV A;  1F4O A;  1R2U A;  1YX8 A;  4N1F A;  1YUR A;  1IKU A;  1UP5 A;  2F2O A;  4JQ0 D;  2MBX A;  1WDC B;  4YGA A;  5AFP A;  5JOL A;  4ETO A;  2L98 A;  1XO5 A;  4GPL B;  1NIW A;  1UHN A;  4E68 A;  2M3W A;  1IWQ A;  4GNK B;  4MN0 A;  2GV5 A;  2WOS A;  1NUB A;  1CMF A;  1SY9 A;  3I5I C;  3AKB A;  3DF0 A;  1OMD A;  1B8C A;  1J7R A;  1CTR A;  4MVF A;  3JVT B;  1KK8 C;  5K89 A;  1YRU B;  2WC8 A;  3OP0 A;  1L2O B;  2HET A;  2PVB A;  3BUN B;  1IRJ A;  4AQI A;  1DT7 B;  1YVH A;  1ALW A;  1SL7 A;  1SW8 A;  5D7F A;  3GOF A;  1SCV A;  1MUX A;  3JVT C;  1SK6 D;  1SBJ A;  2BE6 A;  1K8U A;  2LVV A;  3OB1 B;  1ALV A;  1CM4 A;  1SCM B;  1TTX A;  1K96 A;  4MZJ A;  3EVU A;  1JF2 A;  4OCI A;  3MSE B;  1MF8 B;  3NSL A;  2CT9 A;  2H61 A;  4AOM A;  4DUQ A;  3ICB A;  1XFX O;  5J3X A;  2CBL A;  3FWC A;  2LV7 A;  3CTN A;  1OQP A;  1JFK A;  1MXL C;  1B47 A;  1DJI A;  2JXL A;  2QAC A;  1A4P A;  1NX2 A;  5B8I B;  1DGV A;  1F8H A;  2K61 A;  3CR5 X;  1IJ5 A;  4R1E A;  2NXQ A;  3BOW B;  1A29 A;  1KSM A;  1OMV A;  2M1K B;  4I5K A;  3ZWH A;  1SNL A;  2MHH A;  3SG6 A;  2K0J A;  5FYX A;  1IQ5 A;  1AHR A;  3AAK A;  3BUX B;  1DJY A;  2MLE C;  4WQ2 A;  3BUW B;  2JTZ A;  4WRI A;  2O5G A;  1LXF C;  1KFX S;  1CDL A;  1N0Y A;  1NX3 A;  5KTY A;  2FCE A;  5I2L A;  1H8B A;  1DVI A;  1L2O C;  4M2Q A;  1DJW A;  1G8I A;  2ZKM X;  2WND A;  1QAS A;  4I5J A;  5BPJ A;  2QPT A;  2M29 A;  4DCK A;  1AUI B;  2COL B;  4JWQ A;  2KI4 B;  1XK4 A;  1YX7 A;  2M8U A;  2BE4 A;  1QS7 A;  1PSR A;  4PE1 A;  1YRT B;  2ZRS A;  4I5N B;  4YI8 A;  3IF7 A;  3LK1 A;  1WRK A;  4YGD B;  2BEC A;  2KI6 D;  2H61 C;  3WNX B;  1XA5 A;  2LUC A;  1XYD A;  5CSF A;  3EK4 A;  3KF9 A;  3WHU B;  3KEV A;  3DF0 B;  1FI6 A;  2LP3 A;  1S26 D;  1ZFS A;  1B9A A;  2IS9 A;  1DJZ A;  2K7D A;  4MBE A;  3PAL A;  4ZCV A;  1FF1 A;  1LKJ A;  2WCF A;  3FWB A;  1TIZ A;  1CDP A;  2LUX A;  4QJ4 B;  4PHM A;  1NP8 A;  3VRQ A;  1SKT A;  1QIV A;  1Y1X A;  3PN7 B;  4GAO A;  2AAO A;  4MZL A;  1GGZ A;  1U5I B;  1CLM A;  3AKA A;  4PCW A;  1MXE A;  1UHI A;  2JT0 A;  2BBN A;  2LCP A;  2L50 A;  4GGN A;  3DVE A;  2JNX A;  2ZN9 A;  3TZ1 A;  2FOT A;  1L7Z A;  2OPO A;  1KK7 Y;  1QX2 A;  2M7N A;  3O6B A;  1CMG A;  2MA2 A;  1D1O A;  4NDD A;  2LMV A;  2NLN A;  1BG1 A;  3IQO A;  1JBA A;  2L2E A;  1NSH A;  1IH0 A;  5AAN A;  1K90 D;  1F71 A;  5HKZ A;  1QLK A;  3SG2 A;  1PVB A;  4YBH B;  4BY4 A;  2KQY A;  1CDM A;  1EH2 A;  2K8M B;  1UUR A;  1BF5 A;  2PMY A;  3EVR A;  2KI4 C;  2Y1N A;  1HT9 A;  3TS5 B;  4FQO A;  2HF5 A;  1S36 A;  1FI5 A;  1JUO A;  3EVV A;  1DMO A;  1IG5 A;  3BUO B;  3O78 A;  2JT3 A;  5CSI A;  3I5F B;  1B7T Y;  1XFV O;  4C0L A;  5I8N A;  2K7B A;  1BMO A;  1WY9 A;  1KFX L;  3DVJ A;  1DF0 A;  5CSJ A;  1XFY O;  1K2H A;  1F4Q A;  1UUS A;  2BKI B;  3BUM B;  3LLE A;  2SAS A;  4C0J A;  1NX0 A;  1F70 A;  2A4J A;  1UHK A;  4ICB A;  2MJW B;  1XFW O;  3D10 A;  4OV2 A;  1CB1 A;  4NDB A;  4DIR A;  1SPY A;  3SG7 A;  1WLM A;  2BKH B;  1KWO C;  1N65 A;  1NX1 A;  2LNK A;  3SJS A;  2KGR A;  1PSB A;  1HQV A;  1TCO B;  2LM5 A;  5DKQ A;  1K9U A;  3H4S E;  1CM1 A;  2MLF C;  4GGF C;  2F8P A;  4PE7 A;  2MRD A;  4HRH A;  4TNC A;  1S6C A;  1CFP A;  4N1G A;  1RK9 A;  1DTL A;  4PHK A;  4YI9 A;  4MZK A;  4GBA A;  3F45 A;  3CLN A;  2KNE A;  5HKY A;  2H2K A;  1JF0 A;  1S3P A;  2Y1M A;  2I18 A;  4NQG A;  4PDZ A;  3WHT B;  5AEQ A;  2M9G A;  4MRY A;  1IQ3 A;  2NCO A;  2BBM A;  1S5G Z;  1RRO A;  2JNF A;  2KYC A;  4GUK A;  1QX5 B;  2LVI A;  1LIN A;  3NSK A;  1SR6 B;  2LE9 B;  1AP4 A;  2KYF A;  1J55 A;  2I7A A;  1TOP A;  1RFJ A;  2LHI A;  2KFF A;  1F54 A;  1GGW A;  3SG5 A;  4OKH A;  3VGO A;  1B8L A;  1QIW A;  1GQM A;  2JPT A;  3IQQ A;  1M46 A;  1MWN A;  1ZUZ A;  4HRE E;  1Y1U A;  1C07 A;  5I2O A;  1A75 B;  1M31 A;  1OZO A;  1QVI Z;  1TNQ A;  1JSA A;  1TN4 A;  1QV0 A;  4PE4 A;  2JUL A;  1REC A;  2KDH A;  3PAT A;  5HYD A;  2D8N A;  2K2A A;  3CZT X;  2F33 A;  2M49 B;  3BXK A;  2KAY A;  1BJF A;  1OE9 B;  4HRG A;  5CPV A;  1SL9 A;  2BCA A;  3WXA A;  2BCB A;  2OS8 B;  1WLZ A;  3NSO A;  3OHM B;  3A8R A;  4ORB B;  1E8A A;  3LCP C;  1R6P A;  3D0Y A;  1H4B A;  5DKN A;  4UPG A;  3I5H B;  2LAP A;  1BT6 A;  1TNP A;  2CNP A;  2F2P A;  3QRX A;  3RLZ A;  2KFG A;  5DKR A;  1YUS A;  2E6W A;  2Q4U A;  1NWD A;  1DGU A;  1QAT A;  2ZNE A;  3EKJ A;  3JTD C;  1J1E A;  1M45 A;  3C1V A;  1CLL A;  2M1U A;  5G08 A;  1J1D A;  2E30 A;  2ZRT A;  1KQV A;  2LHL A;  1V1G A;  3CGA A;  1A03 A;  4YRU A;  3TUY C;  1SR6 C;  2P6B B;  2B1U A;  3SG4 A;  2I2R E;  4MRX A;  3KO0 A;  1B8R A;  1QX7 A;  2LLT A;  3BOW A;  4YGB B;  4GFT A;  2Q91 A;  1S6J A;  1ZOT B;  1MQ1 A;  1TRF A;  2NZ0 A;  1XFU O;  2JOJ A;  2L51 A;  3DVM A;  1QXP A;  3OX5 A;  1AJ4 A;  3VRN A;  2M97 A;  4PAL A;  1EL4 A;  4XYN A;  1BOC A;  1FPW A;  4DS7 A;  3I5H C;  1M63 B;  4FTG A;  2KOT A;  2LLS A;  3E3R A;  2LLU A;  4AQJ A;  1BLQ A;  2M0R A;  3CR2 A;  3OX6 A;  1QJT A;  3PM8 A;  2CCM A;  5HLO A;  1J7O A;  3TDI A;  3EKH A;  1F55 A;  1G4Y R;  1TCF A;  2G9B A;  2KAV A;  2EC6 B;  3SG3 A;  3ZNI A;  2AMI A;  1NYA A;  1CFF A;  1Y1A A;  1S1E A;  2BL0 C;  2EC6 C;  2LVK A;  1W7I B;  3PSR A;  5KSZ A;  4F0Z B;  1DJG A;  4U8D A;  3O2P A;  3VRR A;  3I5G C;  5AXI A;  1PVA A;  5D69 A;  4MLW A;  4CLN A;  1NCY A;  1ODB A;  3BYA A;  1DJH A;  4ORC B;  3VRO A;  4GGF A;  1YTZ C;  2BL0 B;  3NXA A;  4M2O A;  1ZMZ A;  1JWD A;  5TNC A;  5CSN A;  1CLB A;  2JZI A;  2OTG B;  4L9M A;  1SCM C;  1J7Q A;  4MEW A;  5IBW A;  2KSP A;  1IJ6 A;  2HQ8 A;  3KPX A;  3TDU A;  4CID A;  1X02 A;  1S6I A;  1XFZ O;  1B1G A;  1A75 A;  1GJY A;  1YR5 A;  4PHN A;  1QLS A;  5AER A;  1JFJ A;  3HX4 A;  2JQ6 A;  1KK8 B;  1AK8 A;  1UHH A;  1OMR A;  1EG3 A;  4Q04 A;  2KHN A;  4OR9 B;  4CFR A;  1BR1 B;  1CDN A;  2K2F A;  4A4C A;  1SYM A;  2OS8 C;  2ZND A;  1EG4 A;  2KAX A;  1IGV A;  3AAJ A;  4YGE B;  4NDC A;  1YUU A;  2KGB C;  2LAN A;  4C0K A;  3DVK A;  5ER4 X;  3PN7 C;  2G2B A;  4CFQ A;  4QJ3 B;  1LA0 A;  4CPV A;  3NSI A;  2WCB A;  1W7J B;  2F3Y A;  4WQ3 A;  2R2I A;  3SIB A;  4P5O E;  2PAS A;  2CTN A;  1CNP A;  3FS7 A;  4USL A;  3O4Y A;  1KWO B;  2AUC A;  1NCX A;  2MAZ A;  3OB2 B;  2KFH A;  3M0W A;  2I94 A;  3CR4 X;  5I2Q A;  2L4I A;  2JXC A;  1Y0V H;  4BY5 A;  1K93 D;  2Y5I A;  1AVS A;  3JTD B;  1JC2 A;  3I5I B;  4YGC B;  2ZN8 A;  3RM1 A;  3A4U B;  4N5X A;  1SMG A;  1SRA A;  3GK4 X;  1WRL A;  5ER5 A;  5GQQ C;  1OZS A;  1OSA A;  4JPZ B;  1K9K A;  2DOQ A;  1DJX A;  1B7T Z;  1Q80 A;  2JC2 A;  2F3Z A;  2LP2 A;  2LVJ A;  3K21 A;  1TNX A;  2TN4 A;  4MSP A;  5PAL A;  1BOD A;  1MR8 A;  3D0Y B;  3LL8 B;  3TS5 C;  4ORA B;  1RTP 1;  5F6T A;  2LMU A;  2V53 A;  2PSR A;  1K9P A;  2O60 A;  3PLF B;  1VRK A;  3FIA A;  1QTX A;  1AJ5 A;  4ZCU A;  5KU1 A;  3CS1 A;  1FW4 A;  1UHJ A;  5JJG A;  1RJV A;  1KQM C;  4IL1 A;  3EK7 A;  1XVJ A;  1DF0 B;  1KQM B;  2ISD A;  1CFC A;  2WCE A;  2HPS A;  2PRU A;  2JRF A;  2EGD A;  4OVN F;  1KK7 Z;  2JT8 A;  1J7P A;  3TDZ A;  3DD4 A;  1XK4 C;  1K95 A;  1EJ3 A; 
#chains in the Genus database with same CATH topology
 1A2X A;  1EXR A;  2RGI A;  1OOJ A;  1UWO A;  1SL8 A;  1SSE B;  1TNW A;  2FCD A;  2ERB A;  2KLD A;  3I5G B;  2KQ6 A;  2L0P A;  1M39 A;  3CDN A;  3VRP A;  1NPQ A;  2OTG C;  4OZD A;  2JU0 A;  2NCP A;  1CFD A;  2BCX A;  3TUY B;  1YUT A;  2GGZ A;  1QVI Y;  3R1O A;  1BR4 B;  2PAL A;  1ZAC A;  1DEK A;  3CWG A;  5FI2 A;  4A4B A;  4HSZ A;  2WOR A;  1FBV A;  1LVC D;  1WRZ A;  1N2D A;  3BQ3 A;  5HLV A;  2FJU B;  1KFU L;  1NCZ A;  1PAL A;  1YVL A;  2KBI A;  2KI6 C;  3EK8 A;  5HKW A;  4PE0 A;  1QV1 A;  4QJ5 B;  1U5I A;  2K7O A;  2VRG A;  1TWO A;  2LMT A;  4M2P A;  2Y4Q A;  1B4C A;  1C7V A;  1C3Z A;  2CXJ A;  2EHB A;  1Z4H A;  4PHJ A;  1KSO A;  3GK2 A;  2L4H A;  5DIC A;  2M7L A;  2ZFD A;  3PJI A;  2K7C A;  2L5X B;  1K94 A;  1S5G Y;  2QEV A;  1RWY A;  1KFU S;  2QEB A;  2SCP A;  3O4X A;  3D74 A;  4D1E A;  3KHE A;  1Y6W A;  1C7W A;  3GK1 A;  4DRW A;  3LK0 A;  4XJK A;  1G33 A;  2GGM A;  3BFA A;  2KBM A;  4XJK B;  2JWW A;  3SIA A;  1KCY A;  1PUL A;  1C3Y A;  2FJY A;  1BU3 A;  1MHO A;  1PRW A;  1V1F A;  2LC5 A;  4P2Y B;  3CAB A;  1CKK A;  4I5L B;  3I5F C;  1PK0 D;  1WDC C;  1LA3 A;  2HQW A;  3HCM A;  2JTT A;  3PFV A;  1F4O A;  1R2U A;  1YX8 A;  2WC6 A;  2WCJ A;  4N1F A;  1YUR A;  1IKU A;  1UP5 A;  2F2O A;  4JQ0 D;  2MBX A;  1WDC B;  2WC5 A;  4YGA A;  5AFP A;  5JOL A;  4ETO A;  2L98 A;  1XO5 A;  3Q8I A;  1NIW A;  2PQL A;  1UHN A;  4GPL B;  5EL2 A;  4E68 A;  2M3W A;  1IWQ A;  2P70 A;  4GNK B;  2GV5 A;  4MN0 A;  2WOS A;  1NUB A;  1CMF A;  1SY9 A;  3I5I C;  3CZ1 A;  3AKB A;  3DF0 A;  1OMD A;  1B8C A;  1DQE A;  1J7R A;  1CTR A;  1OOG A;  4MVF A;  3JVT B;  3SS5 A;  1KK8 C;  5K89 A;  1YRU B;  2WC8 A;  3OP0 A;  1L2O B;  3EG5 B;  2HET A;  2PVB A;  3BUN B;  1IRJ A;  4AQI A;  1DT7 B;  1YVH A;  1ALW A;  1SL7 A;  1SW8 A;  2YGU A;  3GOF A;  5D7F A;  1SCV A;  1MUX A;  2WCH A;  1SK6 D;  3JVT C;  1SBJ A;  2BE6 A;  1K8U A;  2LVV A;  3OB1 B;  1ALV A;  1CM4 A;  1SCM B;  1TTX A;  1K96 A;  4MZJ A;  3EVU A;  1JF2 A;  4OCI A;  3MSE B;  1MF8 B;  3NSL A;  2CT9 A;  2H61 A;  4AOM A;  4DUQ A;  3ICB A;  1XFX O;  3D75 A;  1IIO A;  5J3X A;  2CBL A;  3FWC A;  2LV7 A;  3CTN A;  4F7F A;  1OQP A;  1JFK A;  1MXL C;  1B47 A;  1DJI A;  1ORG A;  2JXL A;  4FQT A;  2QAC A;  1A4P A;  1NX2 A;  5B8I B;  1DGV A;  1F8H A;  2K61 A;  3R1V A;  3BFB A;  3CR5 X;  1IJ5 A;  4R1E A;  2NXQ A;  3BOW B;  1A29 A;  1KSM A;  3FE8 A;  1OMV A;  2M1K B;  4I5K A;  3ZWH A;  1SNL A;  2MHH A;  3SG6 A;  2K0J A;  5FYX A;  3L4A A;  1IQ5 A;  1AHR A;  3AAK A;  3BUX B;  1DJY A;  2MLE C;  4WQ2 A;  2WCL A;  3BUW B;  2JTZ A;  4WRI A;  2O5G A;  1LXF C;  1KFX S;  1CDL A;  1N0Y A;  1NX3 A;  5KTY A;  2FCE A;  5I2L A;  1H8B A;  1DVI A;  1L2O C;  4M2Q A;  1DJW A;  1G8I A;  2ZKM X;  2WND A;  1QAS A;  3D73 A;  4I5J A;  5BPJ A;  2QPT A;  2M29 A;  4DCK A;  1AUI B;  2COL B;  4JWQ A;  2KI4 B;  1DEL A;  1XK4 A;  1YX7 A;  2M8U A;  2BE4 A;  4JD9 A;  1QS7 A;  1PSR A;  4PE1 A;  1YRT B;  2ZRS A;  4I5N B;  1QWV A;  4YI8 A;  3IF7 A;  3LK1 A;  1WRK A;  4YGD B;  2BEC A;  2KI6 D;  2H61 C;  3B86 A;  3WNX B;  1XA5 A;  2LUC A;  1XYD A;  5CSF A;  3EK4 A;  3KF9 A;  3WHU B;  3KEV A;  3DF0 B;  5I94 A;  1FI6 A;  2LP3 A;  3D77 A;  1S26 D;  1ZFS A;  2BNX A;  1B9A A;  2IS9 A;  1DJZ A;  2K7D A;  4MBE A;  3PAL A;  4ZCV A;  1FF1 A;  1LKJ A;  2WCF A;  3FWB A;  1TIZ A;  1CDP A;  3N7H A;  2LUX A;  4QJ4 B;  4PHM A;  1NP8 A;  3VRQ A;  1SKT A;  1QIV A;  1Y1X A;  3IVT A;  3PN7 B;  2AAO A;  4GAO A;  4MZL A;  1GGZ A;  1U5I B;  1CLM A;  3AKA A;  4PCW A;  1MXE A;  1UHI A;  1DC1 A;  2JT0 A;  2BBN A;  2LCP A;  2L50 A;  3K1E A;  4GGN A;  3DVE A;  2JNX A;  2ZN9 A;  3OBV A;  3TZ1 A;  2FOT A;  1L7Z A;  2OPO A;  1KK7 Y;  1QX2 A;  2M7N A;  3O6B A;  1CMG A;  2MA2 A;  1D1O A;  4NDD A;  2LMV A;  2NLN A;  4KYN A;  1BG1 A;  3IQO A;  5D3O A;  2L2E A;  3RZS A;  1JBA A;  1NSH A;  1IH0 A;  5AAN A;  1K90 D;  1F71 A;  5HKZ A;  1QLK A;  3SG2 A;  1PVB A;  2QDI A;  4YBH B;  4BY4 A;  2KQY A;  1CDM A;  1EH2 A;  2K8M B;  1UUR A;  1BF5 A;  2PMY A;  3D78 A;  3EVR A;  2KI4 C;  2Y1N A;  1HT9 A;  3TS5 B;  4FQO A;  2HF5 A;  1S36 A;  1FI5 A;  1JUO A;  2PYQ A;  3EVV A;  3OGN A;  2WCK A;  1DMO A;  1IG5 A;  3BUO B;  3O78 A;  2JT3 A;  5CSI A;  3I5F B;  1B7T Y;  1XFV O;  3UNW A;  4C0L A;  5I8N A;  2K7B A;  1BMO A;  1WY9 A;  1KFX L;  3DVJ A;  1DF0 A;  5CSJ A;  1XFY O;  1K2H A;  1F4Q A;  1UUS A;  2BKI B;  3BUM B;  3LLE A;  1GM0 A;  2SAS A;  4C0J A;  1NX0 A;  1F70 A;  2A4J A;  1UHK A;  4ICB A;  2MJW B;  1XFW O;  3D10 A;  4OV2 A;  1CB1 A;  4NDB A;  4DIR A;  1SPY A;  3SG7 A;  1WLM A;  2BKH B;  1KWO C;  1N65 A;  1NX1 A;  2LNK A;  3SJS A;  3R72 A;  2KGR A;  1PSB A;  3CZ2 A;  1HQV A;  1TCO B;  2LM5 A;  2KPH A;  5DKQ A;  1K9U A;  3V2L A;  3H4S E;  1CM1 A;  2MLF C;  4GGF C;  2F8P A;  2JPO A;  4PE7 A;  2MRD A;  4HRH A;  4TNC A;  1S6C A;  1CFP A;  4N1G A;  1RK9 A;  1DTL A;  4PHK A;  4YI9 A;  4MZK A;  4GBA A;  3F45 A;  3CLN A;  2KNE A;  5HKY A;  2H2K A;  3S0F A;  3FE9 A;  1JF0 A;  1S3P A;  2Y1M A;  5FI7 A;  2I18 A;  4NQG A;  4PDZ A;  3WHT B;  5AEQ A;  2M9G A;  2K60 A;  4MRY A;  1OW4 A;  4PT1 A;  1IQ3 A;  2NCO A;  2BBM A;  1S5G Z;  1RRO A;  2JNF A;  2KYC A;  4GUK A;  1QX5 B;  2LVI A;  1LIN A;  3NSK A;  1SR6 B;  2LE9 B;  1AP4 A;  2KYF A;  1J55 A;  2I7A A;  1TOP A;  1RFJ A;  2LHI A;  2KFF A;  1F54 A;  1GGW A;  3SG5 A;  4OKH A;  3VGO A;  2QEH A;  1B8L A;  1QIW A;  2GTE A;  1GQM A;  2JPT A;  3S0A A;  3IQQ A;  1M46 A;  1MWN A;  1ZUZ A;  4HRE E;  1Y1U A;  1C07 A;  5I2O A;  1A75 B;  1M31 A;  1OZO A;  1QVI Z;  1TNQ A;  3L47 A;  1TN4 A;  1W9Z A;  1JSA A;  1QV0 A;  4PE4 A;  2JUL A;  1REC A;  2KDH A;  3PAT A;  5HYD A;  2D8N A;  2K2A A;  3CZT X;  2F33 A;  2M49 B;  3BXK A;  2KAY A;  1BJF A;  1OE9 B;  4HRG A;  5CPV A;  1SL9 A;  2BCA A;  3WXA A;  3B87 A;  4IJ7 A;  2BCB A;  1OOF A;  2OS8 B;  3DYE A;  1WLZ A;  3NSO A;  3OHM B;  3A8R A;  3NHI A;  4ORB B;  1E8A A;  3LCP C;  1R6P A;  3D0Y A;  1H4B A;  5DKN A;  4UPG A;  3I5H B;  2LAP A;  1BT6 A;  1TNP A;  2CNP A;  2F2P A;  3QRX A;  3DXL A;  3RLZ A;  2KFG A;  5DKR A;  1YUS A;  2E6W A;  2Q4U A;  1NWD A;  2KLE A;  1DGU A;  1QAT A;  2ZNE A;  3EKJ A;  3JTD C;  3SS4 A;  1J1E A;  3DY9 A;  1M45 A;  3C1V A;  3FE6 A;  1CLL A;  2M1U A;  5G08 A;  1J1D A;  2E30 A;  2ZRT A;  1KQV A;  2LHL A;  1V1G A;  2WCM A;  3CGA A;  3R1P A;  4YRU A;  1A03 A;  3TUY C;  1SR6 C;  2P6B B;  2B1U A;  3SG4 A;  3SS3 A;  2I2R E;  4MRX A;  3NHT A;  3B88 A;  3KO0 A;  1B8R A;  1QX7 A;  2LLT A;  3BOW A;  3CZ0 A;  4YGB B;  3S0G A;  1LS8 A;  2Q91 A;  4GFT A;  1S6J A;  1ZOT B;  1MQ1 A;  1TRF A;  2NZ0 A;  1XFU O;  2JOJ A;  2L51 A;  3DVM A;  1QXP A;  3B6X A;  1AJ4 A;  3OX5 A;  3VRN A;  2M97 A;  4PAL A;  1EL4 A;  1OOI X;  4XYN A;  1BOC A;  1TUJ A;  1FPW A;  2BAP A;  4DS7 A;  3I5H C;  1M63 B;  4FTG A;  2KOT A;  2LLS A;  3E3R A;  2LLU A;  4AQJ A;  1BLQ A;  2M0R A;  1T14 A;  3CR2 A;  3OX6 A;  1OOH A;  1QJT A;  3PM8 A;  2CCM A;  3CYZ A;  2L2C A;  5HLO A;  1J7O A;  3TDI A;  3S0D A;  3EKH A;  1F55 A;  1G4Y R;  1TCF A;  2G9B A;  1Z2C B;  2KAV A;  2EC6 B;  3SG3 A;  3ZNI A;  2AMI A;  1NYA A;  3UO9 A;  1CFF A;  1Y1A A;  1S1E A;  2BL0 C;  2EC6 C;  2LVK A;  1W7I B;  3PSR A;  5KSZ A;  4F0Z B;  1DJG A;  3L4L A;  4U8D A;  3O2P A;  3VRR A;  3I5G C;  5AXI A;  1PVA A;  5D69 A;  4MLW A;  4CLN A;  3NGV A;  5HL1 A;  1NCY A;  1ODB A;  3BYA A;  1DJH A;  4ORC B;  3S0E A;  3VRO A;  4GGF A;  1YTZ C;  2BL0 B;  3NXA A;  4M2O A;  1ZMZ A;  1JWD A;  5TNC A;  5CSN A;  1CLB A;  2JZI A;  2OTG B;  4L9M A;  1SCM C;  1J7Q A;  4MEW A;  5IBW A;  2KSP A;  1IJ6 A;  2HQ8 A;  3KPX A;  3TDU A;  4CID A;  1X02 A;  1S6I A;  3VB1 A;  1XFZ O;  1B1G A;  1A75 A;  1GJY A;  1YR5 A;  4PHN A;  1QLS A;  5AER A;  1JFJ A;  3HX4 A;  2JQ6 A;  1KK8 B;  1AK8 A;  1UHH A;  1OMR A;  2H8V A;  1EG3 A;  4Q04 A;  2KHN A;  3DZT A;  4OR9 B;  1BR1 B;  4CFR A;  1CDN A;  1P28 A;  2K2F A;  4A4C A;  1SYM A;  2OS8 C;  2ZND A;  1EG4 A;  2KAX A;  1IGV A;  3AAJ A;  4YGE B;  4NDC A;  1YUU A;  2KGB C;  2LAN A;  4C0K A;  3DVK A;  5ER4 X;  3PN7 C;  2G2B A;  4CFQ A;  4QJ3 B;  1LA0 A;  4CPV A;  3NSI A;  2WCB A;  3BFH A;  1W7J B;  2F3Y A;  4WQ3 A;  2R2I A;  3SIB A;  4P5O E;  2PAS A;  3S0B A;  2CTN A;  3BJH A;  3PM2 A;  3FS7 A;  1CNP A;  4USL A;  3O4Y A;  1KWO B;  2AUC A;  1NCX A;  2MAZ A;  3OB2 B;  2KFH A;  3M0W A;  2I94 A;  3CR4 X;  5I2Q A;  2L4I A;  2JXC A;  1Y0V H;  4BY5 A;  1K93 D;  2Y5I A;  1AVS A;  3JTD B;  1JC2 A;  3I5I B;  4YGC B;  2ZN8 A;  3RM1 A;  3A4U B;  4N5X A;  1SMG A;  1SRA A;  3D76 A;  1WRL A;  3GK4 X;  5ER5 A;  5GQQ C;  1OZS A;  1OSA A;  4JPZ B;  1K9K A;  2DOQ A;  1DJX A;  1B7T Z;  1Q80 A;  2JC2 A;  2F3Z A;  2LP2 A;  4JKT A;  2LVJ A;  3K21 A;  1TNX A;  2TN4 A;  4MSP A;  5PAL A;  4INW A;  1MR8 A;  3D0Y B;  3LL8 B;  3QME A;  1BOD A;  3TS5 C;  4ORA B;  1RTP 1;  5F6T A;  3B7A A;  2LMU A;  2QEO A;  2V53 A;  2PSR A;  5FI6 A;  2L5Y A;  1K9P A;  2O60 A;  3PLF B;  1VRK A;  3FIA A;  1QTX A;  1AJ5 A;  4ZCU A;  2P71 A;  3CS1 A;  5KU1 A;  1FW4 A;  1UHJ A;  5JJG A;  1RJV A;  1KQM C;  4IL1 A;  3EK7 A;  1XVJ A;  1DF0 B;  1KQM B;  2ISD A;  1CFC A;  2WCE A;  2HPS A;  1XFR A;  2PRU A;  2JRF A;  2EGD A;  4OVN F;  1KK7 Z;  2JT8 A;  1J7P A;  3TDZ A;  3DD4 A;  1XK4 C;  1K95 A;  4INX A;  1TUZ A;  1EJ3 A; 
#chains in the Genus database with same CATH homology
 1A2X A;  1EXR A;  2RGI A;  1OOJ A;  1UWO A;  1SL8 A;  1TNW A;  2FCD A;  3I5G B;  2KQ6 A;  2L0P A;  1M39 A;  3VRP A;  1NPQ A;  2OTG C;  2JU0 A;  2NCP A;  1CFD A;  2BCX A;  3TUY B;  1YUT A;  2GGZ A;  1QVI Y;  1BR4 B;  2PAL A;  1ZAC A;  3CWG A;  4A4B A;  4HSZ A;  2WOR A;  1FBV A;  1LVC D;  1WRZ A;  1N2D A;  3BQ3 A;  5HLV A;  2FJU B;  1KFU L;  1NCZ A;  1PAL A;  1YVL A;  2KBI A;  2KI6 C;  3EK8 A;  5HKW A;  4PE0 A;  1QV1 A;  4QJ5 B;  1U5I A;  2K7O A;  2VRG A;  2LMT A;  4M2P A;  2Y4Q A;  1B4C A;  1C7V A;  2CXJ A;  2EHB A;  2M7L A;  4PHJ A;  1KSO A;  3GK2 A;  2L4H A;  2ZFD A;  2K7C A;  2L5X B;  1K94 A;  1S5G Y;  2SCP A;  1RWY A;  1KFU S;  4D1E A;  3KHE A;  1Y6W A;  1C7W A;  3GK1 A;  4DRW A;  3LK0 A;  4XJK A;  1G33 A;  2GGM A;  2KBM A;  4XJK B;  2JWW A;  3SIA A;  1KCY A;  1PUL A;  1BU3 A;  1MHO A;  1PRW A;  1V1F A;  2LC5 A;  4P2Y B;  1CKK A;  4I5L B;  3I5F C;  1PK0 D;  1WDC C;  1LA3 A;  2HQW A;  3HCM A;  2JTT A;  3PFV A;  1F4O A;  1R2U A;  1YX8 A;  4N1F A;  1YUR A;  1IKU A;  1UP5 A;  2F2O A;  4JQ0 D;  2MBX A;  1WDC B;  4YGA A;  5AFP A;  5JOL A;  4ETO A;  2L98 A;  1XO5 A;  4GPL B;  1NIW A;  1UHN A;  4E68 A;  2M3W A;  1IWQ A;  4GNK B;  4MN0 A;  2GV5 A;  2WOS A;  1NUB A;  1CMF A;  1SY9 A;  3I5I C;  3AKB A;  3DF0 A;  1OMD A;  1B8C A;  1J7R A;  1CTR A;  4MVF A;  3JVT B;  1KK8 C;  5K89 A;  1YRU B;  2WC8 A;  3OP0 A;  1L2O B;  2HET A;  2PVB A;  3BUN B;  1IRJ A;  4AQI A;  1DT7 B;  1YVH A;  1ALW A;  1SL7 A;  1SW8 A;  5D7F A;  3GOF A;  1SCV A;  1MUX A;  3JVT C;  1SK6 D;  1SBJ A;  2BE6 A;  1K8U A;  2LVV A;  3OB1 B;  1ALV A;  1CM4 A;  1SCM B;  1TTX A;  1K96 A;  4MZJ A;  3EVU A;  1JF2 A;  4OCI A;  3MSE B;  1MF8 B;  3NSL A;  2CT9 A;  2H61 A;  4AOM A;  4DUQ A;  3ICB A;  1XFX O;  5J3X A;  2CBL A;  3FWC A;  2LV7 A;  3CTN A;  1OQP A;  1JFK A;  1MXL C;  1B47 A;  1DJI A;  2JXL A;  2QAC A;  1A4P A;  1NX2 A;  5B8I B;  1DGV A;  1F8H A;  2K61 A;  3CR5 X;  1IJ5 A;  4R1E A;  2NXQ A;  3BOW B;  1A29 A;  1KSM A;  1OMV A;  2M1K B;  4I5K A;  3ZWH A;  1SNL A;  2MHH A;  3SG6 A;  2K0J A;  5FYX A;  1IQ5 A;  1AHR A;  3AAK A;  3BUX B;  1DJY A;  2MLE C;  4WQ2 A;  3BUW B;  2JTZ A;  4WRI A;  2O5G A;  1LXF C;  1KFX S;  1CDL A;  1N0Y A;  1NX3 A;  5KTY A;  2FCE A;  5I2L A;  1H8B A;  1DVI A;  1L2O C;  4M2Q A;  1DJW A;  1G8I A;  2ZKM X;  2WND A;  1QAS A;  4I5J A;  5BPJ A;  2QPT A;  2M29 A;  4DCK A;  1AUI B;  2COL B;  4JWQ A;  2KI4 B;  1XK4 A;  1YX7 A;  2M8U A;  2BE4 A;  1QS7 A;  1PSR A;  4PE1 A;  1YRT B;  2ZRS A;  4I5N B;  4YI8 A;  3IF7 A;  3LK1 A;  1WRK A;  4YGD B;  2BEC A;  2KI6 D;  2H61 C;  3WNX B;  1XA5 A;  2LUC A;  1XYD A;  5CSF A;  3EK4 A;  3KF9 A;  3WHU B;  3KEV A;  3DF0 B;  1FI6 A;  2LP3 A;  1S26 D;  1ZFS A;  1B9A A;  2IS9 A;  1DJZ A;  2K7D A;  4MBE A;  3PAL A;  4ZCV A;  1FF1 A;  1LKJ A;  2WCF A;  3FWB A;  1TIZ A;  1CDP A;  2LUX A;  4QJ4 B;  4PHM A;  1NP8 A;  3VRQ A;  1SKT A;  1QIV A;  1Y1X A;  3PN7 B;  4GAO A;  2AAO A;  4MZL A;  1GGZ A;  1U5I B;  1CLM A;  3AKA A;  4PCW A;  1MXE A;  1UHI A;  2JT0 A;  2BBN A;  2LCP A;  2L50 A;  4GGN A;  3DVE A;  2JNX A;  2ZN9 A;  3TZ1 A;  2FOT A;  1L7Z A;  2OPO A;  1KK7 Y;  1QX2 A;  2M7N A;  3O6B A;  1CMG A;  2MA2 A;  1D1O A;  4NDD A;  2LMV A;  2NLN A;  1BG1 A;  3IQO A;  1JBA A;  2L2E A;  1NSH A;  1IH0 A;  5AAN A;  1K90 D;  1F71 A;  5HKZ A;  1QLK A;  3SG2 A;  1PVB A;  4YBH B;  4BY4 A;  2KQY A;  1CDM A;  1EH2 A;  2K8M B;  1UUR A;  1BF5 A;  2PMY A;  3EVR A;  2KI4 C;  2Y1N A;  1HT9 A;  3TS5 B;  4FQO A;  2HF5 A;  1S36 A;  1FI5 A;  1JUO A;  3EVV A;  1DMO A;  1IG5 A;  3BUO B;  3O78 A;  2JT3 A;  5CSI A;  3I5F B;  1B7T Y;  1XFV O;  4C0L A;  5I8N A;  2K7B A;  1BMO A;  1WY9 A;  1KFX L;  3DVJ A;  1DF0 A;  5CSJ A;  1XFY O;  1K2H A;  1F4Q A;  1UUS A;  2BKI B;  3BUM B;  3LLE A;  2SAS A;  4C0J A;  1NX0 A;  1F70 A;  2A4J A;  1UHK A;  4ICB A;  2MJW B;  1XFW O;  3D10 A;  4OV2 A;  1CB1 A;  4NDB A;  4DIR A;  1SPY A;  3SG7 A;  1WLM A;  2BKH B;  1KWO C;  1N65 A;  1NX1 A;  2LNK A;  3SJS A;  2KGR A;  1PSB A;  1HQV A;  1TCO B;  2LM5 A;  5DKQ A;  1K9U A;  3H4S E;  1CM1 A;  2MLF C;  4GGF C;  2F8P A;  4PE7 A;  2MRD A;  4HRH A;  4TNC A;  1S6C A;  1CFP A;  4N1G A;  1RK9 A;  1DTL A;  4PHK A;  4YI9 A;  4MZK A;  4GBA A;  3F45 A;  3CLN A;  2KNE A;  5HKY A;  2H2K A;  1JF0 A;  1S3P A;  2Y1M A;  2I18 A;  4NQG A;  4PDZ A;  3WHT B;  5AEQ A;  2M9G A;  4MRY A;  1IQ3 A;  2NCO A;  2BBM A;  1S5G Z;  1RRO A;  2JNF A;  2KYC A;  4GUK A;  1QX5 B;  2LVI A;  1LIN A;  3NSK A;  1SR6 B;  2LE9 B;  1AP4 A;  2KYF A;  1J55 A;  2I7A A;  1TOP A;  1RFJ A;  2LHI A;  2KFF A;  1F54 A;  1GGW A;  3SG5 A;  4OKH A;  3VGO A;  1B8L A;  1QIW A;  1GQM A;  2JPT A;  3IQQ A;  1M46 A;  1MWN A;  1ZUZ A;  4HRE E;  1Y1U A;  1C07 A;  5I2O A;  1A75 B;  1M31 A;  1OZO A;  1QVI Z;  1TNQ A;  1JSA A;  1TN4 A;  1QV0 A;  4PE4 A;  2JUL A;  1REC A;  2KDH A;  3PAT A;  5HYD A;  2D8N A;  2K2A A;  3CZT X;  2F33 A;  2M49 B;  3BXK A;  2KAY A;  1BJF A;  1OE9 B;  4HRG A;  5CPV A;  1SL9 A;  2BCA A;  3WXA A;  2BCB A;  2OS8 B;  1WLZ A;  3NSO A;  3OHM B;  3A8R A;  4ORB B;  1E8A A;  3LCP C;  1R6P A;  3D0Y A;  1H4B A;  5DKN A;  4UPG A;  3I5H B;  2LAP A;  1BT6 A;  1TNP A;  2CNP A;  2F2P A;  3QRX A;  3RLZ A;  2KFG A;  5DKR A;  1YUS A;  2E6W A;  2Q4U A;  1NWD A;  1DGU A;  1QAT A;  2ZNE A;  3EKJ A;  3JTD C;  1J1E A;  1M45 A;  3C1V A;  1CLL A;  2M1U A;  5G08 A;  1J1D A;  2E30 A;  2ZRT A;  1KQV A;  2LHL A;  1V1G A;  3CGA A;  1A03 A;  4YRU A;  3TUY C;  1SR6 C;  2P6B B;  2B1U A;  3SG4 A;  2I2R E;  4MRX A;  3KO0 A;  1B8R A;  1QX7 A;  2LLT A;  3BOW A;  4YGB B;  4GFT A;  2Q91 A;  1S6J A;  1ZOT B;  1MQ1 A;  1TRF A;  2NZ0 A;  1XFU O;  2JOJ A;  2L51 A;  3DVM A;  1QXP A;  3OX5 A;  1AJ4 A;  3VRN A;  2M97 A;  4PAL A;  1EL4 A;  4XYN A;  1BOC A;  1FPW A;  4DS7 A;  3I5H C;  1M63 B;  4FTG A;  2KOT A;  2LLS A;  3E3R A;  2LLU A;  4AQJ A;  1BLQ A;  2M0R A;  3CR2 A;  3OX6 A;  1QJT A;  3PM8 A;  2CCM A;  5HLO A;  1J7O A;  3TDI A;  3EKH A;  1F55 A;  1G4Y R;  1TCF A;  2G9B A;  2KAV A;  2EC6 B;  3SG3 A;  3ZNI A;  2AMI A;  1NYA A;  1CFF A;  1Y1A A;  1S1E A;  2BL0 C;  2EC6 C;  2LVK A;  1W7I B;  3PSR A;  5KSZ A;  4F0Z B;  1DJG A;  4U8D A;  3O2P A;  3VRR A;  3I5G C;  5AXI A;  1PVA A;  5D69 A;  4MLW A;  4CLN A;  1NCY A;  1ODB A;  3BYA A;  1DJH A;  4ORC B;  3VRO A;  4GGF A;  1YTZ C;  2BL0 B;  3NXA A;  4M2O A;  1ZMZ A;  1JWD A;  5TNC A;  5CSN A;  1CLB A;  2JZI A;  2OTG B;  4L9M A;  1SCM C;  1J7Q A;  4MEW A;  5IBW A;  2KSP A;  1IJ6 A;  2HQ8 A;  3KPX A;  3TDU A;  4CID A;  1X02 A;  1S6I A;  1XFZ O;  1B1G A;  1A75 A;  1GJY A;  1YR5 A;  4PHN A;  1QLS A;  5AER A;  1JFJ A;  3HX4 A;  2JQ6 A;  1KK8 B;  1AK8 A;  1UHH A;  1OMR A;  1EG3 A;  4Q04 A;  2KHN A;  4OR9 B;  4CFR A;  1BR1 B;  1CDN A;  2K2F A;  4A4C A;  1SYM A;  2OS8 C;  2ZND A;  1EG4 A;  2KAX A;  1IGV A;  3AAJ A;  4YGE B;  4NDC A;  1YUU A;  2KGB C;  2LAN A;  4C0K A;  3DVK A;  5ER4 X;  3PN7 C;  2G2B A;  4CFQ A;  4QJ3 B;  1LA0 A;  4CPV A;  3NSI A;  2WCB A;  1W7J B;  2F3Y A;  4WQ3 A;  2R2I A;  3SIB A;  4P5O E;  2PAS A;  2CTN A;  1CNP A;  3FS7 A;  4USL A;  3O4Y A;  1KWO B;  2AUC A;  1NCX A;  2MAZ A;  3OB2 B;  2KFH A;  3M0W A;  2I94 A;  3CR4 X;  5I2Q A;  2L4I A;  2JXC A;  1Y0V H;  4BY5 A;  1K93 D;  2Y5I A;  1AVS A;  3JTD B;  1JC2 A;  3I5I B;  4YGC B;  2ZN8 A;  3RM1 A;  3A4U B;  4N5X A;  1SMG A;  1SRA A;  3GK4 X;  1WRL A;  5ER5 A;  5GQQ C;  1OZS A;  1OSA A;  4JPZ B;  1K9K A;  2DOQ A;  1DJX A;  1B7T Z;  1Q80 A;  2JC2 A;  2F3Z A;  2LP2 A;  2LVJ A;  3K21 A;  1TNX A;  2TN4 A;  4MSP A;  5PAL A;  1BOD A;  1MR8 A;  3D0Y B;  3LL8 B;  3TS5 C;  4ORA B;  1RTP 1;  5F6T A;  2LMU A;  2V53 A;  2PSR A;  1K9P A;  2O60 A;  3PLF B;  1VRK A;  3FIA A;  1QTX A;  1AJ5 A;  4ZCU A;  5KU1 A;  3CS1 A;  1FW4 A;  1UHJ A;  5JJG A;  1RJV A;  1KQM C;  4IL1 A;  3EK7 A;  1XVJ A;  1DF0 B;  1KQM B;  2ISD A;  1CFC A;  2WCE A;  2HPS A;  2PRU A;  2JRF A;  2EGD A;  4OVN F;  1KK7 Z;  2JT8 A;  1J7P A;  3TDZ A;  3DD4 A;  1XK4 C;  1K95 A;  1EJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...