3CR2A

X-ray structure of bovine zn(2+),ca(2+)-s100b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divalent metal ion complexes of S100B in the absence and presence of pentamidine.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords Protein S100-B
total genus 29
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cr2A00
5I2QA 4QJ5B 2KGRA 5G08A 2WNDA 1BG1A 3DVJA 3PATA 3TUYB 3CR4X 3HCMA 1V1GA 1UURA 2OPOA 2ZKMX 3KO0A 1KK7Y 3EKHA 1DJHA 4I5LB 1F70A 2COLB 3GK1A 1RTP1 1PVAA 4PHKA 1BF5A 1Y6WA 2KAYA 2H61A 3A8RA 1OZSA 1IKUA 2KNEA 2LC5A 1EG3A 2K7CA 3ZWHA 4N5XA 1R2UA 2KI4B 2L98A 4DUQA 1JC2A 3LLEA 3EK8A 1MWNA 3SG7A 2ZFDA 1E8AA 3BUOB 3TS5B 1EXRA 1NX0A 1WY9A 2JWWA 1YX8A 4M2OA 1ALVA 1MHOA 1SCVA 1F54A 1K9KA 5B8IB 3QRXA 3TDIA 1CFFA 1TNPA 3DVKA 5JOLA 1Y0VH 1KQMC 2BL0C 1MR8A 1WRLA 3OB2B 1MQ1A 1QIWA 5AFPA 1QVIZ 1ZACA 2BE4A 1MF8B 2LP3A 1JSAA 3JTDB 1NUBA 2LAPA 3E3RA 3FS7A 1K8UA 1YRUB 1IGVA 5DKRA 3I5FB 2WCBA 1SNLA 3K21A 1TCOB 3ZNIA 3WHUB 1NYAA 1BMOA 1AUIB 1CFPA 3KHEA 1UHKA 3SJSA 1B9AA 1QS7A 3CZTX 4OR9B 1SRAA 3IQQA 1B7TY 4MLWA 4QJ4B 1KWOB 1S1EA 1SL9A 2Y1MA 1DJYA 1SCMB 1QVIY 1ZMZA 5FYXA 2KGBC 1CKKA 1XA5A 2P6BB 1RROA 2KAVA 2LLSA 3KPXA 4DS7A 2LMVA 1SYMA 3HX4A 1KK7Z 2L4IA 4XJKB 1A03A 1KQVA 5CSFA 1OMVA 4ZCUA 2K2FA 3CLNA 3WXAA 3CGAA 3D0YA 4L9MA 2Y5IA 3PN7C 2BE6A 1B1GA 2AAOA 2HF5A 2JZIA 5AEQA 1AVSA 1TRFA 1LVCD 1NWDA 1RJVA 1IQ3A 1AJ5A 3SG3A 2PSRA 3A4UB 1YUSA 3CR2A 4HRHA 3SG4A 2F33A 1JFJA 3CTNA 1DJGA 5I2OA 4USLA 3O6BA 4C0LA 4I5JA 3M0WA 4JWQA 2EGDA 4P2YB 1FF1A 2LHLA 4JQ0D 5I2LA 1SKTA 2Q4UA 1UP5A 1LKJA 1AK8A 1J7RA 4YGDB 3SG2A 2KI6D 2KYFA 1NCYA 1YX7A 2K7DA 4YRUA 1G8IA 2IS9A 3C1VA 1PK0D 3IF7A 3I5GB 1WDCB 1KK8B 2F8PA 4MVFA 5CPVA 2KFHA 1BOCA 3FIAA 1QJTA 5HKYA 4AQIA 1XYDA 2BCAA 2JXLA 4ZCVA 2Q91A 3LL8B 3WNXB 4IL1A 2KYCA 3DVEA 2OTGC 3MSEB 1K9PA 1IJ5A 1NIWA 3CWGA 1L2OB 2LVVA 3VROA 3DF0B 3SIBA 1QLSA 1K90D 3AKBA 1GJYA 1FBVA 4A4BA 3VRPA 1TNQA 2HQWA 2OTGB 4HRGA 4BY4A 5IBWA 2KBIA 2M0RA 1S26D 1S3PA 1BR1B 2WC8A 3GK4X 1DGVA 5AERA 4PHJA 1YUTA 1XO5A 1OE9B 2GV5A 2JU0A 1D1OA 2GGZA 5CSIA 1QV0A 3KF9A 5HLOA 1KK8C 3SG5A 1ODBA 1NSHA 1OSAA 1YURA 1XFWO 2D8NA 3AKAA 4WQ3A 1S5GY 1UHHA 2CT9A 2M1UA 3BUMB 2CNPA 1W7IB 3BUXB 3EK4A 2K61A 3I5GC 2M9GA 3NXAA 1GGZA 4MZLA 3I5HC 5GQQC 2ISDA 1S6IA 2LMTA 3NSOA 1KFUS 1CMGA 1XFXO 1M31A 4YGBB 2L0PA 3DF0A 1DF0A 2MRDA 3FWCA 4GBAA 1B4CA 1DJIA 1DF0B 1B8LA 1ALWA 2O60A 1F4QA 5F6TA 1PULA 1J55A 1C7VA 1CDNA 4PDZA 2JTZA 5DKNA 1JBAA 3BUNB 5BPJA 2G9BA 5KTYA 1J7PA 2LMUA 4HSZA 3TZ1A 4GGFC 1BLQA 1CDLA 1K9UA 1WRKA 2JT3A 3OP0A 1A29A 5HKWA 2SCPA 2MBXA 3TDZA 1M63B 1OQPA 1QX2A 4UPGA 1AJ4A 3LCPC 1SCMC 2NZ0A 2JOJA 3EK7A 1XFZO 1ZFSA 3O78A 4D1EA 1KWOC 1JF2A 4DCKA 1RFJA 4Q04A 2HQ8A 4YBHB 1ZOTB 2KFGA 1B8CA 1SPYA 3O2PA 1PVBA 3ICBA 1Y1UA 4CFQA 1GGWA 1EL4A 1SK6D 1XK4A 1WLZA 2CBLA 2JRFA 1H4BA 2Y4QA 4WQ2A 1QATA 1SL7A 1XFUO 4N1GA 5ER5A 3I5HB 1F8HA 2F3ZA 2F3YA 1V1FA 2KQ6A 2PALA 2LUXA 2WCEA 3JTDC 3NSKA 3RM1A 2PASA 1J7QA 4GGFA 4OCIA 5AANA 2BBMA 1L2OC 1KQMB 1L7ZA 2LHIA 3EKJA 2G2BA 1B7TZ 3D0YB 1BU3A 1G33A 2LUCA 3PALA 2MAZA 4MRYA 3RLZA 1M46A 1FPWA 1QIVA 2RGIA 1N2DA 1PRWA 1PSRA 2O5GA 1S6CA 2NLNA 1DJXA 2K7OA 3FWBA 3TS5C 3PM8A 1AHRA 5D69A 2QACA 3BUWB 2M7LA 1M39A 1MXLC 2NCOA 1IG5A 1N0YA 3EVVA 2CXJA 1XFVO 3GOFA 3PLFB 2LNKA 3TDUA 3PFVA 1U5IA 2PRUA 5K89A 3EVRA 4TNCA 4DRWA 1KFXL 3PSRA 1HT9A 3IQOA 2LP2A 2LVKA 2SASA 4MZKA 2K7BA 4PHNA 2L51A 2L50A 1CDPA 2PMYA 3I5IC 1C7WA 3CR5X 1DT7B 1NX2A 4C0JA 4CFRA 2M7NA 2PVBA 5JJGA 1FI5A 2ZNEA 4M2PA 3BOWA 2BECA 2NCPA 4N1FA 3NSIA 2KAXA 4ORCB 5PALA 1FI6A 2F2PA 4GUKA 4CLNA 1S6JA 1QTXA 3SG6A 1NX1A 4A4CA 4MZJA 2WORA 2JPTA 2H61C 2K2AA 2CTNA 4P5OE 2FOTA 1TOPA 4QJ3B 1BR4B 1CM4A 1EH2A 2LANA 1BJFA 2KHNA 1SMGA 2F2OA 4F0ZB 3BYAA 1HQVA 5TNCA 3JVTB 4PHMA 5DKQA 1GQMA 1JWDA 1OOJA 4JPZB 1F55A 1SR6C 4FQOA 2R2IA 2I18A 2LVJA 2L2EA 1ZUZA 1XK4C 2I7AA 4PCWA 1YUUA 4NDCA 1YR5A 3AAJA 2WCFA 1BT6A 4CIDA 1CMFA 4ORBB 1IQ5A 1RWYA 1UHJA 1YVHA 4NDBA 1J1DA 1QXPA 1JFKA 1CLLA 1B47A 3I5FC 4PE4A 1IH0A 4ETOA 2LM5A 2OS8C 2DOQA 4GGNA 2KDHA 1S36A 2KBMA 4NQGA 1K94A 1CNPA 4GFTA 3D10A 4FTGA 2FCDA 1NX3A 2MJWB 4PE0A 2ZRSA 1WLMA 2M97A 1IWQA 1IJ6A 4HREE 5KU1A 1BODA 4DIRA 2M1KB 4YI8A 1K93D 2WOSA 5CSNA 5AXIA 2VRGA 1UWOA 2KI4C 4YGCB 1IRJA 1TCFA 1LA3A 1KFUL 2JNFA 3OB1B 4GAOA 2JT8A 1U5IB 4PALA 2BCBA 2BL0B 1QLKA 1C07A 1PSBA 2H2KA 1RK9A 1NCXA 1KSOA 1MUXA 1DMOA 1XFYO 3SIAA 4XYNA 2M8UA 1TN4A 4YGEB 3VGOA 2JC2A 2TN4A 2I2RE 1CM1A 2A4JA 2BBNA 1TNXA 2FJUB 4PE7A 2LVIA 1QX5B 1WDCC 2AUCA 2MA2A 1G4YR 5CSJA 3VRNA 2GGMA 2LV7A 3AAKA 3VRQA 4OKHA 3OHMB 1CDMA 1SL8A 5I8NA 1SBJA 2HETA 2MLFC 4MEWA 4OVNF 3DVMA 3I5IB 4MRXA 1S5GZ 2HPSA 3H4SE 2JXCA 2LE9B 4E68A 2ZN9A 2V53A 1X02A 4AQJA 3F45A 1KCYA 4GPLB 3BXKA 2AMIA 1J7OA 2KFFA 1VRKA 4I5KA 1YRTB 1QV1A 2JQ6A 2ZRTA 1KFXS 5D7FA 4AOMA 1A2XA 3OX6A 1DJZA 2NXQA 3DD4A 3EVUA 3PN7B 1H8BA 2KSPA 2FCEA 3LK0A 2M29A 2BKHB 5HLVA 2L4HA 3NSLA 1SY9A 1CLBA 4NDDA 2ZN8A 2M49B 2K0JA 1FW4A 2EC6B 1K2HA 4YI9A 1CFDA 1OZOA 1Q80A 1K96A 1UHNA 5KSZA 1DVIA 1PALA 5HYDA 1B8RA 1Y1XA 3BOWB 1TIZA 2ZNDA 4YGAA 1CLMA 2LLUA 1JF0A 1OMDA 1QX7A 3WHTB 1JUOA 1A4PA 1DTLA 1A75A 1J1EA 1W7JB 1UHIA 2KOTA 4R1EA 1AP4A 5J3XA 3LK1A 1LINA 4XJKA 1NCZA 2LLTA 4WRIA 1TNWA 2JTTA 2OS8B 1EJ3A 3GK2A 5ER4X 1RECA 2CCMA 4MN0A 2M3WA 2BCXA 1XVJA 1N65A 1TTXA 2MHHA 1CB1A 2B1UA 4M2QA 1OMRA 4MBEA 4C0KA 4OV2A 4I5NB 4GNKB 1CFCA 2KI6C 4BY5A 2KQYA 1YVLA 4MSPA 1UUSA 1CTRA 1QASA 2JT0A 3KEVA 1NPQA 3O4YA 1Y1AA 2EHBA 1LA0A 1YTZC 2E6WA 3CS1A 3VRRA 2LCPA 1WRZA 3JVTC 2L5XB 4U8DA 1R6PA 4PE1A 4CPVA 1SW8A 1SR6B 1EG4A 2K8MB 1A75B 2QPTA 2EC6C 1M45A 2BKIB 1NP8A 1K95A 4ICBA 1LXFC 1DJWA 4ORAB 2MLEC 1F71A 2E30A 2Y1NA 3OX5A 1MXEA 1DGUA 1KSMA 2JNXA 5HKZA 3TUYC 2I94A 3BQ3A 2JULA 1F4OA
chains in the Genus database with same CATH superfamily
5I2QA 4QJ5B 2KGRA 5G08A 2WNDA 1BG1A 3DVJA 3PATA 3TUYB 3CR4X 3HCMA 1V1GA 1UURA 2OPOA 2ZKMX 3KO0A 1KK7Y 3EKHA 1DJHA 4I5LB 1F70A 2COLB 3GK1A 1RTP1 1PVAA 4PHKA 1BF5A 1Y6WA 2KAYA 2H61A 3A8RA 1OZSA 1IKUA 2KNEA 2LC5A 3D78A 1EG3A 2K7CA 2YGUA 3ZWHA 4N5XA 1R2UA 2KI4B 2L98A 4DUQA 1JC2A 3LLEA 3EK8A 1MWNA 3SG7A 2ZFDA 1E8AA 5DICA 3DY9A 3BUOB 3TS5B 1OOGA 1EXRA 1NX0A 1WY9A 2JWWA 1YX8A 4M2OA 1ALVA 1MHOA 1SCVA 1F54A 1K9KA 5B8IB 3QRXA 3D76A 3TDIA 1CFFA 5FI6A 1TNPA 3DVKA 5JOLA 1Y0VH 3D73A 1KQMC 2BL0C 1MR8A 1WRLA 3OB2B 1MQ1A 1QIWA 5AFPA 1QVIZ 1ZACA 2BE4A 1MF8B 2LP3A 1JSAA 3B88A 3L47A 3JTDB 1NUBA 2LAPA 3E3RA 3FS7A 1K8UA 2H8VA 1YRUB 1IGVA 1GM0A 3S0BA 5DKRA 3I5FB 2WCBA 1SNLA 3K21A 1TCOB 3ZNIA 3WHUB 1NYAA 1BMOA 1AUIB 1CFPA 3KHEA 1UHKA 3SJSA 1B9AA 1QS7A 3R1OA 1C3YA 3CZTX 4OR9B 1SRAA 3S0FA 3IQQA 1B7TY 2WCKA 3PM2A 3B86A 4MLWA 4QJ4B 1KWOB 1S1EA 1SL9A 2Y1MA 1DJYA 1SCMB 1QVIY 1ZMZA 5FYXA 2KGBC 1CKKA 1DC1A 1XA5A 4JKTA 2P6BB 1RROA 2KAVA 2LLSA 3KPXA 4DS7A 2LMVA 1SYMA 3HX4A 1KK7Z 2L4IA 4XJKB 1A03A 1KQVA 5CSFA 2P71A 1OMVA 4ZCUA 2K2FA 3CLNA 3WXAA 3CGAA 3Q8IA 3D0YA 4L9MA 2Y5IA 3PN7C 2BE6A 1B1GA 2AAOA 2HF5A 2JZIA 5AEQA 1AVSA 1TRFA 1LVCD 1NWDA 1RJVA 2JPOA 1IQ3A 1AJ5A 3SS5A 3SG3A 2PSRA 3A4UB 2KLDA 1YUSA 3CR2A 4HRHA 3SG4A 2F33A 1JFJA 3CTNA 1DJGA 5I2OA 4USLA 3O6BA 1Z2CB 4C0LA 4I5JA 3M0WA 4JWQA 2EGDA 4P2YB 1FF1A 2LHLA 3DZTA 2QDIA 4JQ0D 5I2LA 1SKTA 2Q4UA 1UP5A 1LKJA 1AK8A 1J7RA 4YGDB 3SG2A 2KI6D 4PT1A 5FI2A 5FI7A 2KYFA 1NCYA 1YX7A 2K7DA 4YRUA 1G8IA 2IS9A 2WCMA 3C1VA 1PK0D 3CABA 3IF7A 3I5GB 1WDCB 1KK8B 2F8PA 2PYQA 4MVFA 5CPVA 2KFHA 3S0DA 1BOCA 3FIAA 1QJTA 5HKYA 4AQIA 1XYDA 2BCAA 2JXLA 4ZCVA 2Q91A 3B6XA 3LL8B 3WNXB 4IL1A 2KYCA 3DVEA 2OTGC 2GTEA 3MSEB 1K9PA 1IJ5A 3BFBA 1NIWA 3CWGA 1L2OB 2LVVA 3CZ1A 3L4LA 3VROA 1QWVA 3DF0B 3SIBA 3V2LA 1QLSA 1K90D 3AKBA 1GJYA 1FBVA 4A4BA 3VRPA 1TNQA 2HQWA 2OTGB 4HRGA 3BFAA 4BY4A 3R1VA 5IBWA 2KBIA 1LS8A 2M0RA 1S26D 1S3PA 1BR1B 2WC8A 3GK4X 1DGVA 5AERA 4PHJA 1YUTA 1XO5A 1OE9B 2GV5A 2JU0A 1D1OA 2GGZA 5CSIA 1QV0A 3KF9A 1C3ZA 3DYEA 5HLOA 1KK8C 3SG5A 1ODBA 1NSHA 1OSAA 1YURA 1XFWO 2D8NA 3AKAA 4WQ3A 1S5GY 1UHHA 2CT9A 2M1UA 5D3OA 3BUMB 2CNPA 2L5YA 3RZSA 1W7IB 3BUXB 3EK4A 2K61A 3I5GC 2M9GA 3NXAA 1GGZA 4MZLA 3I5HC 5GQQC 2ISDA 1S6IA 3CZ0A 2LMTA 3NSOA 1KFUS 3S0EA 1CMGA 3B7AA 1XFXO 1M31A 4YGBB 2L0PA 3DF0A 1DF0A 2MRDA 3FE6A 3FWCA 4GBAA 1B4CA 1DJIA 1DF0B 1B8LA 1ALWA 2O60A 1F4QA 5F6TA 1PULA 1J55A 1C7VA 1CDNA 4PDZA 2JTZA 2WCLA 5DKNA 1JBAA 3BUNB 5BPJA 2G9BA 5KTYA 1J7PA 2LMUA 4HSZA 3TZ1A 4GGFC 4KYNA 1BLQA 1CDLA 1K9UA 1WRKA 2JT3A 3OP0A 1A29A 5HKWA 2SCPA 2MBXA 3TDZA 1M63B 1OQPA 1QX2A 4UPGA 1AJ4A 2P70A 3LCPC 3CZ2A 1SCMC 2NZ0A 2JOJA 3EK7A 1XFZO 1ZFSA 3O78A 4D1EA 1KWOC 2PQLA 1JF2A 3R1PA 4DCKA 4FQTA 1RFJA 4Q04A 3PJIA 1Z4HA 2HQ8A 4YBHB 2KLEA 1ZOTB 2KFGA 1B8CA 1SPYA 3O2PA 1PVBA 3ICBA 1Y1UA 4CFQA 1GGWA 1EL4A 1SK6D 1XK4A 1WLZA 2CBLA 2JRFA 1H4BA 2Y4QA 4WQ2A 1QATA 1SL7A 1XFUO 4N1GA 5ER5A 3I5HB 1F8HA 2F3ZA 4F7FA 2F3YA 1V1FA 2KQ6A 2PALA 2LUXA 2WCEA 3CYZA 3JTDC 3NSKA 3OBVA 2PASA 3RM1A 4GGFA 1J7QA 4OCIA 5AANA 2BBMA 1L2OC 1KQMB 1L7ZA 2LHIA 3EKJA 2G2BA 1B7TZ 1DELA 1BU3A 1G33A 2BAPA 2LUCA 2MAZA 3D0YB 3PALA 1M46A 4MRYA 3RLZA 1QIVA 2RGIA 3UNWA 1N2DA 1PRWA 1PSRA 3D77A 2O5GA 1S6CA 2NLNA 1DJXA 2K7OA 3FWBA 3TS5C 3PM8A 1AHRA 5D69A 2WC5A 2QACA 3BUWB 1T14A 2M7LA 1M39A 1MXLC 2NCOA 1DQEA 1IG5A 1N0YA 3B87A 3EVVA 3K1EA 1OOFA 1XFVO 2CXJA 3GOFA 3PLFB 2LNKA 3TDUA 1OW4A 1U5IA 2PRUA 3PFVA 5K89A 1XFRA 3EVRA 4TNCA 4DRWA 3N7HA 1KFXL 3PSRA 1HT9A 3IQOA 2LP2A 2LVKA 2SASA 4MZKA 1P28A 2K7BA 2L51A 4PHNA 5HL1A 2L50A 1CDPA 2PMYA 3I5IC 1C7WA 3CR5X 1DT7B 1NX2A 4C0JA 4CFRA 2M7NA 2PVBA 5JJGA 1FI5A 2ZNEA 4M2PA 3BOWA 2BECA 2NCPA 4N1FA 3D75A 3NSIA 2KAXA 4ORCB 5PALA 1FI6A 2F2PA 4GUKA 4CLNA 1S6JA 1QTXA 3SG6A 1NX1A 3EG5B 4A4CA 3CDNA 5EL2A 4MZJA 2WORA 2JPTA 2H61C 2K2AA 2CTNA 4P5OE 2FOTA 1TOPA 4QJ3B 1BR4B 1CM4A 3QMEA 2LANA 1BJFA 2KHNA 1EH2A 1SMGA 2F2OA 4F0ZB 3BYAA 1HQVA 5TNCA 3R72A 3JVTB 4PHMA 5DKQA 1GQMA 1JWDA 1OOJA 4JPZB 1F55A 1SR6C 4FQOA 2R2IA 2I18A 3SS4A 2LVJA 2L2EA 1ZUZA 3FE9A 1XK4C 2I7AA 4PCWA 1YUUA 4NDCA 1YR5A 3AAJA 2WCFA 3D74A 1BT6A 4CIDA 1CMFA 4ORBB 1IQ5A 1RWYA 1UHJA 1YVHA 4NDBA 1J1DA 3UO9A 1QXPA 1JFKA 1CLLA 1B47A 3I5FC 4PE4A 1IH0A 4ETOA 2LM5A 2OS8C 2DOQA 4GGNA 2KDHA 4IJ7A 1S36A 2KBMA 4NQGA 3NGVA 1K94A 3DXLA 1CNPA 4GFTA 3D10A 4FTGA 2FCDA 1NX3A 1TUZA 2MJWB 4PE0A 2ZRSA 1WLMA 3BFHA 2M97A 1IWQA 1IJ6A 4HREE 5KU1A 1BODA 4DIRA 2M1KB 1W9ZA 4YI8A 1K93D 2WOSA 3NHIA 5CSNA 5AXIA 2VRGA 1UWOA 2KI4C 4YGCB 1IRJA 1OOIX 1TUJA 1TCFA 1LA3A 1KFUL 2ERBA 2JNFA 3OB1B 2JT8A 4GAOA 1U5IB 3S0GA 4PALA 3NHTA 2BCBA 2BL0B 1QLKA 1C07A 1PSBA 2H2KA 1RK9A 1NCXA 1KSOA 1MUXA 1DMOA 1XFYO 3SIAA 4XYNA 2M8UA 1TN4A 4YGEB 4INXA 3VGOA 2JC2A 2TN4A 1IIOA 2I2RE 1CM1A 2A4JA 2BBNA 1TNXA 2FJUB 4PE7A 2LVIA 1QX5B 1WDCC 2AUCA 2MA2A 1G4YR 5CSJA 3VRNA 2GGMA 2LV7A 3FE8A 1SSEB 3AAKA 2WCHA 4OKHA 3OHMB 3VRQA 1CDMA 1SL8A 5I8NA 1SBJA 2HETA 2MLFC 4MEWA 4OVNF 3DVMA 3I5IB 4MRXA 1S5GZ 2HPSA 3H4SE 2JXCA 2LE9B 4E68A 2ZN9A 2V53A 1X02A 4AQJA 3F45A 3VB1A 1KCYA 4GPLB 3BXKA 2AMIA 1J7OA 2KFFA 1VRKA 2KPHA 4I5KA 1YRTB 1QV1A 2JQ6A 2ZRTA 1KFXS 5D7FA 4AOMA 1A2XA 3OX6A 1DJZA 2L2CA 2NXQA 3DD4A 3EVUA 3PN7B 2QEOA 1H8BA 2KSPA 2FCEA 3LK0A 2M29A 2BKHB 5HLVA 2L4HA 3NSLA 1SY9A 3SS3A 1CLBA 4NDDA 1ORGA 2ZN8A 2M49B 2K0JA 1FW4A 1FPWA 2EC6B 3OGNA 1K2HA 4YI9A 1CFDA 1OZOA 1Q80A 1K96A 1UHNA 5KSZA 1DVIA 1PALA 2QEBA 5HYDA 1B8RA 1Y1XA 3BOWB 1TIZA 2WCJA 2ZNDA 4YGAA 3O4XA 1CLMA 2LLUA 1JF0A 1OMDA 1QX7A 3WHTB 3IVTA 1JUOA 1A4PA 1DTLA 1A75A 1J1EA 1TWOA 1UHIA 1W7JB 2BNXA 2KOTA 3L4AA 4R1EA 1AP4A 5J3XA 3LK1A 1LINA 4XJKA 1NCZA 2LLTA 4WRIA 1TNWA 2JTTA 2OS8B 1EJ3A 3GK2A 4OZDA 4JD9A 5ER4X 3S0AA 2QEHA 1RECA 2CCMA 4MN0A 2M3WA 5I94A 2BCXA 1XVJA 1N65A 1TTXA 2MHHA 4INWA 1CB1A 2B1UA 4M2QA 1OMRA 4MBEA 3BJHA 4C0KA 4OV2A 4I5NB 4GNKB 1CFCA 2KI6C 4BY5A 2KQYA 1YVLA 4MSPA 1UUSA 1CTRA 1QASA 2JT0A 3KEVA 1NPQA 3O4YA 1Y1AA 2EHBA 1LA0A 1YTZC 2E6WA 3CS1A 3VRRA 2LCPA 2FJYA 1WRZA 3JVTC 2L5XB 2QEVA 2K60A 4U8DA 1R6PA 4PE1A 4CPVA 1SW8A 1SR6B 1DEKA 1EG4A 1A75B 2K8MB 2EC6C 2QPTA 1M45A 2BKIB 1NP8A 1K95A 4ICBA 1LXFC 1DJWA 1OOHA 4ORAB 2MLEC 1F71A 2E30A 2WC6A 2Y1NA 3OX5A 1MXEA 1DGUA 1KSMA 2JNXA 5HKZA 3TUYC 2I94A 3BQ3A 2JULA 1F4OA
chains in the Genus database with same CATH topology
5I2QA 4QJ5B 2KGRA 5G08A 2WNDA 1BG1A 3DVJA 3PATA 3TUYB 3CR4X 3HCMA 1V1GA 1UURA 2OPOA 2ZKMX 3KO0A 1KK7Y 3EKHA 1DJHA 4I5LB 1F70A 2COLB 3GK1A 1RTP1 1PVAA 4PHKA 1BF5A 1Y6WA 2KAYA 2H61A 3A8RA 1OZSA 1IKUA 2KNEA 2LC5A 1EG3A 2K7CA 3ZWHA 4N5XA 1R2UA 2KI4B 2L98A 4DUQA 1JC2A 3LLEA 3EK8A 1MWNA 3SG7A 2ZFDA 1E8AA 3BUOB 3TS5B 1EXRA 1NX0A 1WY9A 2JWWA 1YX8A 4M2OA 1ALVA 1MHOA 1SCVA 1F54A 1K9KA 5B8IB 3QRXA 3TDIA 1CFFA 1TNPA 3DVKA 5JOLA 1Y0VH 1KQMC 2BL0C 1MR8A 1WRLA 3OB2B 1MQ1A 1QIWA 5AFPA 1QVIZ 1ZACA 2BE4A 1MF8B 2LP3A 1JSAA 3JTDB 1NUBA 2LAPA 3E3RA 3FS7A 1K8UA 1YRUB 1IGVA 5DKRA 3I5FB 2WCBA 1SNLA 3K21A 1TCOB 3ZNIA 3WHUB 1NYAA 1BMOA 1AUIB 1CFPA 3KHEA 1UHKA 3SJSA 1B9AA 1QS7A 3CZTX 4OR9B 1SRAA 3IQQA 1B7TY 4MLWA 4QJ4B 1KWOB 1S1EA 1SL9A 2Y1MA 1DJYA 1SCMB 1QVIY 1ZMZA 5FYXA 2KGBC 1CKKA 1XA5A 2P6BB 1RROA 2KAVA 2LLSA 3KPXA 4DS7A 2LMVA 1SYMA 3HX4A 1KK7Z 2L4IA 4XJKB 1A03A 1KQVA 5CSFA 1OMVA 4ZCUA 2K2FA 3CLNA 3WXAA 3CGAA 3D0YA 4L9MA 2Y5IA 3PN7C 2BE6A 1B1GA 2AAOA 2HF5A 2JZIA 5AEQA 1AVSA 1TRFA 1LVCD 1NWDA 1RJVA 1IQ3A 1AJ5A 3SG3A 2PSRA 3A4UB 1YUSA 3CR2A 4HRHA 3SG4A 2F33A 1JFJA 3CTNA 1DJGA 5I2OA 4USLA 3O6BA 4C0LA 4I5JA 3M0WA 4JWQA 2EGDA 4P2YB 1FF1A 2LHLA 4JQ0D 5I2LA 1SKTA 2Q4UA 1UP5A 1LKJA 1AK8A 1J7RA 4YGDB 3SG2A 2KI6D 2KYFA 1NCYA 1YX7A 2K7DA 4YRUA 1G8IA 2IS9A 3C1VA 1PK0D 3IF7A 3I5GB 1WDCB 1KK8B 2F8PA 4MVFA 5CPVA 2KFHA 1BOCA 3FIAA 1QJTA 5HKYA 4AQIA 1XYDA 2BCAA 2JXLA 4ZCVA 2Q91A 3LL8B 3WNXB 4IL1A 2KYCA 3DVEA 2OTGC 3MSEB 1K9PA 1IJ5A 1NIWA 3CWGA 1L2OB 2LVVA 3VROA 3DF0B 3SIBA 1QLSA 1K90D 3AKBA 1GJYA 1FBVA 4A4BA 3VRPA 1TNQA 2HQWA 2OTGB 4HRGA 4BY4A 5IBWA 2KBIA 2M0RA 1S26D 1S3PA 1BR1B 2WC8A 3GK4X 1DGVA 5AERA 4PHJA 1YUTA 1XO5A 1OE9B 2GV5A 2JU0A 1D1OA 2GGZA 5CSIA 1QV0A 3KF9A 5HLOA 1KK8C 3SG5A 1ODBA 1NSHA 1OSAA 1YURA 1XFWO 2D8NA 3AKAA 4WQ3A 1S5GY 1UHHA 2CT9A 2M1UA 3BUMB 2CNPA 1W7IB 3BUXB 3EK4A 2K61A 3I5GC 2M9GA 3NXAA 1GGZA 4MZLA 3I5HC 5GQQC 2ISDA 1S6IA 2LMTA 3NSOA 1KFUS 1CMGA 1XFXO 1M31A 4YGBB 2L0PA 3DF0A 1DF0A 2MRDA 3FWCA 4GBAA 1B4CA 1DJIA 1DF0B 1B8LA 1ALWA 2O60A 1F4QA 5F6TA 1PULA 1J55A 1C7VA 1CDNA 4PDZA 2JTZA 5DKNA 1JBAA 3BUNB 5BPJA 2G9BA 5KTYA 1J7PA 2LMUA 4HSZA 3TZ1A 4GGFC 1BLQA 1CDLA 1K9UA 1WRKA 2JT3A 3OP0A 1A29A 5HKWA 2SCPA 2MBXA 3TDZA 1M63B 1OQPA 1QX2A 4UPGA 1AJ4A 3LCPC 1SCMC 2NZ0A 2JOJA 3EK7A 1XFZO 1ZFSA 3O78A 4D1EA 1KWOC 1JF2A 4DCKA 1RFJA 4Q04A 2HQ8A 4YBHB 1ZOTB 2KFGA 1B8CA 1SPYA 3O2PA 1PVBA 3ICBA 1Y1UA 4CFQA 1GGWA 1EL4A 1SK6D 1XK4A 1WLZA 2CBLA 2JRFA 1H4BA 2Y4QA 4WQ2A 1QATA 1SL7A 1XFUO 4N1GA 5ER5A 3I5HB 1F8HA 2F3ZA 2F3YA 1V1FA 2KQ6A 2PALA 2LUXA 2WCEA 3JTDC 3NSKA 3RM1A 2PASA 1J7QA 4GGFA 4OCIA 5AANA 2BBMA 1L2OC 1KQMB 1L7ZA 2LHIA 3EKJA 2G2BA 1B7TZ 3D0YB 1BU3A 1G33A 2LUCA 3PALA 2MAZA 4MRYA 3RLZA 1M46A 1FPWA 1QIVA 2RGIA 1N2DA 1PRWA 1PSRA 2O5GA 1S6CA 2NLNA 1DJXA 2K7OA 3FWBA 3TS5C 3PM8A 1AHRA 5D69A 2QACA 3BUWB 2M7LA 1M39A 1MXLC 2NCOA 1IG5A 1N0YA 3EVVA 2CXJA 1XFVO 3GOFA 3PLFB 2LNKA 3TDUA 3PFVA 1U5IA 2PRUA 5K89A 3EVRA 4TNCA 4DRWA 1KFXL 3PSRA 1HT9A 3IQOA 2LP2A 2LVKA 2SASA 4MZKA 2K7BA 4PHNA 2L51A 2L50A 1CDPA 2PMYA 3I5IC 1C7WA 3CR5X 1DT7B 1NX2A 4C0JA 4CFRA 2M7NA 2PVBA 5JJGA 1FI5A 2ZNEA 4M2PA 3BOWA 2BECA 2NCPA 4N1FA 3NSIA 2KAXA 4ORCB 5PALA 1FI6A 2F2PA 4GUKA 4CLNA 1S6JA 1QTXA 3SG6A 1NX1A 4A4CA 4MZJA 2WORA 2JPTA 2H61C 2K2AA 2CTNA 4P5OE 2FOTA 1TOPA 4QJ3B 1BR4B 1CM4A 1EH2A 2LANA 1BJFA 2KHNA 1SMGA 2F2OA 4F0ZB 3BYAA 1HQVA 5TNCA 3JVTB 4PHMA 5DKQA 1GQMA 1JWDA 1OOJA 4JPZB 1F55A 1SR6C 4FQOA 2R2IA 2I18A 2LVJA 2L2EA 1ZUZA 1XK4C 2I7AA 4PCWA 1YUUA 4NDCA 1YR5A 3AAJA 2WCFA 1BT6A 4CIDA 1CMFA 4ORBB 1IQ5A 1RWYA 1UHJA 1YVHA 4NDBA 1J1DA 1QXPA 1JFKA 1CLLA 1B47A 3I5FC 4PE4A 1IH0A 4ETOA 2LM5A 2OS8C 2DOQA 4GGNA 2KDHA 1S36A 2KBMA 4NQGA 1K94A 1CNPA 4GFTA 3D10A 4FTGA 2FCDA 1NX3A 2MJWB 4PE0A 2ZRSA 1WLMA 2M97A 1IWQA 1IJ6A 4HREE 5KU1A 1BODA 4DIRA 2M1KB 4YI8A 1K93D 2WOSA 5CSNA 5AXIA 2VRGA 1UWOA 2KI4C 4YGCB 1IRJA 1TCFA 1LA3A 1KFUL 2JNFA 3OB1B 4GAOA 2JT8A 1U5IB 4PALA 2BCBA 2BL0B 1QLKA 1C07A 1PSBA 2H2KA 1RK9A 1NCXA 1KSOA 1MUXA 1DMOA 1XFYO 3SIAA 4XYNA 2M8UA 1TN4A 4YGEB 3VGOA 2JC2A 2TN4A 2I2RE 1CM1A 2A4JA 2BBNA 1TNXA 2FJUB 4PE7A 2LVIA 1QX5B 1WDCC 2AUCA 2MA2A 1G4YR 5CSJA 3VRNA 2GGMA 2LV7A 3AAKA 3VRQA 4OKHA 3OHMB 1CDMA 1SL8A 5I8NA 1SBJA 2HETA 2MLFC 4MEWA 4OVNF 3DVMA 3I5IB 4MRXA 1S5GZ 2HPSA 3H4SE 2JXCA 2LE9B 4E68A 2ZN9A 2V53A 1X02A 4AQJA 3F45A 1KCYA 4GPLB 3BXKA 2AMIA 1J7OA 2KFFA 1VRKA 4I5KA 1YRTB 1QV1A 2JQ6A 2ZRTA 1KFXS 5D7FA 4AOMA 1A2XA 3OX6A 1DJZA 2NXQA 3DD4A 3EVUA 3PN7B 1H8BA 2KSPA 2FCEA 3LK0A 2M29A 2BKHB 5HLVA 2L4HA 3NSLA 1SY9A 1CLBA 4NDDA 2ZN8A 2M49B 2K0JA 1FW4A 2EC6B 1K2HA 4YI9A 1CFDA 1OZOA 1Q80A 1K96A 1UHNA 5KSZA 1DVIA 1PALA 5HYDA 1B8RA 1Y1XA 3BOWB 1TIZA 2ZNDA 4YGAA 1CLMA 2LLUA 1JF0A 1OMDA 1QX7A 3WHTB 1JUOA 1A4PA 1DTLA 1A75A 1J1EA 1W7JB 1UHIA 2KOTA 4R1EA 1AP4A 5J3XA 3LK1A 1LINA 4XJKA 1NCZA 2LLTA 4WRIA 1TNWA 2JTTA 2OS8B 1EJ3A 3GK2A 5ER4X 1RECA 2CCMA 4MN0A 2M3WA 2BCXA 1XVJA 1N65A 1TTXA 2MHHA 1CB1A 2B1UA 4M2QA 1OMRA 4MBEA 4C0KA 4OV2A 4I5NB 4GNKB 1CFCA 2KI6C 4BY5A 2KQYA 1YVLA 4MSPA 1UUSA 1CTRA 1QASA 2JT0A 3KEVA 1NPQA 3O4YA 1Y1AA 2EHBA 1LA0A 1YTZC 2E6WA 3CS1A 3VRRA 2LCPA 1WRZA 3JVTC 2L5XB 4U8DA 1R6PA 4PE1A 4CPVA 1SW8A 1SR6B 1EG4A 2K8MB 1A75B 2QPTA 2EC6C 1M45A 2BKIB 1NP8A 1K95A 4ICBA 1LXFC 1DJWA 4ORAB 2MLEC 1F71A 2E30A 2Y1NA 3OX5A 1MXEA 1DGUA 1KSMA 2JNXA 5HKZA 3TUYC 2I94A 3BQ3A 2JULA 1F4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I2Q A;  4QJ5 B;  2KGR A;  5G08 A;  2WND A;  1BG1 A;  3DVJ A;  3PAT A;  3TUY B;  3CR4 X;  3HCM A;  1V1G A;  1UUR A;  2OPO A;  2ZKM X;  3KO0 A;  1KK7 Y;  3EKH A;  1DJH A;  4I5L B;  1F70 A;  2COL B;  3GK1 A;  1RTP 1;  1PVA A;  4PHK A;  1BF5 A;  1Y6W A;  2KAY A;  2H61 A;  3A8R A;  1OZS A;  1IKU A;  2KNE A;  2LC5 A;  1EG3 A;  2K7C A;  3ZWH A;  4N5X A;  1R2U A;  2KI4 B;  2L98 A;  4DUQ A;  1JC2 A;  3LLE A;  3EK8 A;  1MWN A;  3SG7 A;  2ZFD A;  1E8A A;  3BUO B;  3TS5 B;  1EXR A;  1NX0 A;  1WY9 A;  2JWW A;  1YX8 A;  4M2O A;  1ALV A;  1MHO A;  1SCV A;  1F54 A;  1K9K A;  5B8I B;  3QRX A;  3TDI A;  1CFF A;  1TNP A;  3DVK A;  5JOL A;  1Y0V H;  1KQM C;  2BL0 C;  1MR8 A;  1WRL A;  3OB2 B;  1MQ1 A;  1QIW A;  5AFP A;  1QVI Z;  1ZAC A;  2BE4 A;  1MF8 B;  2LP3 A;  1JSA A;  3JTD B;  1NUB A;  2LAP A;  3E3R A;  3FS7 A;  1K8U A;  1YRU B;  1IGV A;  5DKR A;  3I5F B;  2WCB A;  1SNL A;  3K21 A;  1TCO B;  3ZNI A;  3WHU B;  1NYA A;  1BMO A;  1AUI B;  1CFP A;  3KHE A;  1UHK A;  3SJS A;  1B9A A;  1QS7 A;  3CZT X;  4OR9 B;  1SRA A;  3IQQ A;  1B7T Y;  4MLW A;  4QJ4 B;  1KWO B;  1S1E A;  1SL9 A;  2Y1M A;  1DJY A;  1SCM B;  1QVI Y;  1ZMZ A;  5FYX A;  2KGB C;  1CKK A;  1XA5 A;  2P6B B;  1RRO A;  2KAV A;  2LLS A;  3KPX A;  4DS7 A;  2LMV A;  1SYM A;  3HX4 A;  1KK7 Z;  2L4I A;  4XJK B;  1A03 A;  1KQV A;  5CSF A;  1OMV A;  4ZCU A;  2K2F A;  3CLN A;  3WXA A;  3CGA A;  3D0Y A;  4L9M A;  2Y5I A;  3PN7 C;  2BE6 A;  1B1G A;  2AAO A;  2HF5 A;  2JZI A;  5AEQ A;  1AVS A;  1TRF A;  1LVC D;  1NWD A;  1RJV A;  1IQ3 A;  1AJ5 A;  3SG3 A;  2PSR A;  3A4U B;  1YUS A;  3CR2 A;  4HRH A;  3SG4 A;  2F33 A;  1JFJ A;  3CTN A;  1DJG A;  5I2O A;  4USL A;  3O6B A;  4C0L A;  4I5J A;  3M0W A;  4JWQ A;  2EGD A;  4P2Y B;  1FF1 A;  2LHL A;  4JQ0 D;  5I2L A;  1SKT A;  2Q4U A;  1UP5 A;  1LKJ A;  1AK8 A;  1J7R A;  4YGD B;  3SG2 A;  2KI6 D;  2KYF A;  1NCY A;  1YX7 A;  2K7D A;  4YRU A;  1G8I A;  2IS9 A;  3C1V A;  1PK0 D;  3IF7 A;  3I5G B;  1WDC B;  1KK8 B;  2F8P A;  4MVF A;  5CPV A;  2KFH A;  1BOC A;  3FIA A;  1QJT A;  5HKY A;  4AQI A;  1XYD A;  2BCA A;  2JXL A;  4ZCV A;  2Q91 A;  3LL8 B;  3WNX B;  4IL1 A;  2KYC A;  3DVE A;  2OTG C;  3MSE B;  1K9P A;  1IJ5 A;  1NIW A;  3CWG A;  1L2O B;  2LVV A;  3VRO A;  3DF0 B;  3SIB A;  1QLS A;  1K90 D;  3AKB A;  1GJY A;  1FBV A;  4A4B A;  3VRP A;  1TNQ A;  2HQW A;  2OTG B;  4HRG A;  4BY4 A;  5IBW A;  2KBI A;  2M0R A;  1S26 D;  1S3P A;  1BR1 B;  2WC8 A;  3GK4 X;  1DGV A;  5AER A;  4PHJ A;  1YUT A;  1XO5 A;  1OE9 B;  2GV5 A;  2JU0 A;  1D1O A;  2GGZ A;  5CSI A;  1QV0 A;  3KF9 A;  5HLO A;  1KK8 C;  3SG5 A;  1ODB A;  1NSH A;  1OSA A;  1YUR A;  1XFW O;  2D8N A;  3AKA A;  4WQ3 A;  1S5G Y;  1UHH A;  2CT9 A;  2M1U A;  3BUM B;  2CNP A;  1W7I B;  3BUX B;  3EK4 A;  2K61 A;  3I5G C;  2M9G A;  3NXA A;  1GGZ A;  4MZL A;  3I5H C;  5GQQ C;  2ISD A;  1S6I A;  2LMT A;  3NSO A;  1KFU S;  1CMG A;  1XFX O;  1M31 A;  4YGB B;  2L0P A;  3DF0 A;  1DF0 A;  2MRD A;  3FWC A;  4GBA A;  1B4C A;  1DJI A;  1DF0 B;  1B8L A;  1ALW A;  2O60 A;  1F4Q A;  5F6T A;  1PUL A;  1J55 A;  1C7V A;  1CDN A;  4PDZ A;  2JTZ A;  5DKN A;  1JBA A;  3BUN B;  5BPJ A;  2G9B A;  5KTY A;  1J7P A;  2LMU A;  4HSZ A;  3TZ1 A;  4GGF C;  1BLQ A;  1CDL A;  1K9U A;  1WRK A;  2JT3 A;  3OP0 A;  1A29 A;  5HKW A;  2SCP A;  2MBX A;  3TDZ A;  1M63 B;  1OQP A;  1QX2 A;  4UPG A;  1AJ4 A;  3LCP C;  1SCM C;  2NZ0 A;  2JOJ A;  3EK7 A;  1XFZ O;  1ZFS A;  3O78 A;  4D1E A;  1KWO C;  1JF2 A;  4DCK A;  1RFJ A;  4Q04 A;  2HQ8 A;  4YBH B;  1ZOT B;  2KFG A;  1B8C A;  1SPY A;  3O2P A;  1PVB A;  3ICB A;  1Y1U A;  4CFQ A;  1GGW A;  1EL4 A;  1SK6 D;  1XK4 A;  1WLZ A;  2CBL A;  2JRF A;  1H4B A;  2Y4Q A;  4WQ2 A;  1QAT A;  1SL7 A;  1XFU O;  4N1G A;  5ER5 A;  3I5H B;  1F8H A;  2F3Z A;  2F3Y A;  1V1F A;  2KQ6 A;  2PAL A;  2LUX A;  2WCE A;  3JTD C;  3NSK A;  3RM1 A;  2PAS A;  1J7Q A;  4GGF A;  4OCI A;  5AAN A;  2BBM A;  1L2O C;  1KQM B;  1L7Z A;  2LHI A;  3EKJ A;  2G2B A;  1B7T Z;  3D0Y B;  1BU3 A;  1G33 A;  2LUC A;  3PAL A;  2MAZ A;  4MRY A;  3RLZ A;  1M46 A;  1FPW A;  1QIV A;  2RGI A;  1N2D A;  1PRW A;  1PSR A;  2O5G A;  1S6C A;  2NLN A;  1DJX A;  2K7O A;  3FWB A;  3TS5 C;  3PM8 A;  1AHR A;  5D69 A;  2QAC A;  3BUW B;  2M7L A;  1M39 A;  1MXL C;  2NCO A;  1IG5 A;  1N0Y A;  3EVV A;  2CXJ A;  1XFV O;  3GOF A;  3PLF B;  2LNK A;  3TDU A;  3PFV A;  1U5I A;  2PRU A;  5K89 A;  3EVR A;  4TNC A;  4DRW A;  1KFX L;  3PSR A;  1HT9 A;  3IQO A;  2LP2 A;  2LVK A;  2SAS A;  4MZK A;  2K7B A;  4PHN A;  2L51 A;  2L50 A;  1CDP A;  2PMY A;  3I5I C;  1C7W A;  3CR5 X;  1DT7 B;  1NX2 A;  4C0J A;  4CFR A;  2M7N A;  2PVB A;  5JJG A;  1FI5 A;  2ZNE A;  4M2P A;  3BOW A;  2BEC A;  2NCP A;  4N1F A;  3NSI A;  2KAX A;  4ORC B;  5PAL A;  1FI6 A;  2F2P A;  4GUK A;  4CLN A;  1S6J A;  1QTX A;  3SG6 A;  1NX1 A;  4A4C A;  4MZJ A;  2WOR A;  2JPT A;  2H61 C;  2K2A A;  2CTN A;  4P5O E;  2FOT A;  1TOP A;  4QJ3 B;  1BR4 B;  1CM4 A;  1EH2 A;  2LAN A;  1BJF A;  2KHN A;  1SMG A;  2F2O A;  4F0Z B;  3BYA A;  1HQV A;  5TNC A;  3JVT B;  4PHM A;  5DKQ A;  1GQM A;  1JWD A;  1OOJ A;  4JPZ B;  1F55 A;  1SR6 C;  4FQO A;  2R2I A;  2I18 A;  2LVJ A;  2L2E A;  1ZUZ A;  1XK4 C;  2I7A A;  4PCW A;  1YUU A;  4NDC A;  1YR5 A;  3AAJ A;  2WCF A;  1BT6 A;  4CID A;  1CMF A;  4ORB B;  1IQ5 A;  1RWY A;  1UHJ A;  1YVH A;  4NDB A;  1J1D A;  1QXP A;  1JFK A;  1CLL A;  1B47 A;  3I5F C;  4PE4 A;  1IH0 A;  4ETO A;  2LM5 A;  2OS8 C;  2DOQ A;  4GGN A;  2KDH A;  1S36 A;  2KBM A;  4NQG A;  1K94 A;  1CNP A;  4GFT A;  3D10 A;  4FTG A;  2FCD A;  1NX3 A;  2MJW B;  4PE0 A;  2ZRS A;  1WLM A;  2M97 A;  1IWQ A;  1IJ6 A;  4HRE E;  5KU1 A;  1BOD A;  4DIR A;  2M1K B;  4YI8 A;  1K93 D;  2WOS A;  5CSN A;  5AXI A;  2VRG A;  1UWO A;  2KI4 C;  4YGC B;  1IRJ A;  1TCF A;  1LA3 A;  1KFU L;  2JNF A;  3OB1 B;  4GAO A;  2JT8 A;  1U5I B;  4PAL A;  2BCB A;  2BL0 B;  1QLK A;  1C07 A;  1PSB A;  2H2K A;  1RK9 A;  1NCX A;  1KSO A;  1MUX A;  1DMO A;  1XFY O;  3SIA A;  4XYN A;  2M8U A;  1TN4 A;  4YGE B;  3VGO A;  2JC2 A;  2TN4 A;  2I2R E;  1CM1 A;  2A4J A;  2BBN A;  1TNX A;  2FJU B;  4PE7 A;  2LVI A;  1QX5 B;  1WDC C;  2AUC A;  2MA2 A;  1G4Y R;  5CSJ A;  3VRN A;  2GGM A;  2LV7 A;  3AAK A;  3VRQ A;  4OKH A;  3OHM B;  1CDM A;  1SL8 A;  5I8N A;  1SBJ A;  2HET A;  2MLF C;  4MEW A;  4OVN F;  3DVM A;  3I5I B;  4MRX A;  1S5G Z;  2HPS A;  3H4S E;  2JXC A;  2LE9 B;  4E68 A;  2ZN9 A;  2V53 A;  1X02 A;  4AQJ A;  3F45 A;  1KCY A;  4GPL B;  3BXK A;  2AMI A;  1J7O A;  2KFF A;  1VRK A;  4I5K A;  1YRT B;  1QV1 A;  2JQ6 A;  2ZRT A;  1KFX S;  5D7F A;  4AOM A;  1A2X A;  3OX6 A;  1DJZ A;  2NXQ A;  3DD4 A;  3EVU A;  3PN7 B;  1H8B A;  2KSP A;  2FCE A;  3LK0 A;  2M29 A;  2BKH B;  5HLV A;  2L4H A;  3NSL A;  1SY9 A;  1CLB A;  4NDD A;  2ZN8 A;  2M49 B;  2K0J A;  1FW4 A;  2EC6 B;  1K2H A;  4YI9 A;  1CFD A;  1OZO A;  1Q80 A;  1K96 A;  1UHN A;  5KSZ A;  1DVI A;  1PAL A;  5HYD A;  1B8R A;  1Y1X A;  3BOW B;  1TIZ A;  2ZND A;  4YGA A;  1CLM A;  2LLU A;  1JF0 A;  1OMD A;  1QX7 A;  3WHT B;  1JUO A;  1A4P A;  1DTL A;  1A75 A;  1J1E A;  1W7J B;  1UHI A;  2KOT A;  4R1E A;  1AP4 A;  5J3X A;  3LK1 A;  1LIN A;  4XJK A;  1NCZ A;  2LLT A;  4WRI A;  1TNW A;  2JTT A;  2OS8 B;  1EJ3 A;  3GK2 A;  5ER4 X;  1REC A;  2CCM A;  4MN0 A;  2M3W A;  2BCX A;  1XVJ A;  1N65 A;  1TTX A;  2MHH A;  1CB1 A;  2B1U A;  4M2Q A;  1OMR A;  4MBE A;  4C0K A;  4OV2 A;  4I5N B;  4GNK B;  1CFC A;  2KI6 C;  4BY5 A;  2KQY A;  1YVL A;  4MSP A;  1UUS A;  1CTR A;  1QAS A;  2JT0 A;  3KEV A;  1NPQ A;  3O4Y A;  1Y1A A;  2EHB A;  1LA0 A;  1YTZ C;  2E6W A;  3CS1 A;  3VRR A;  2LCP A;  1WRZ A;  3JVT C;  2L5X B;  4U8D A;  1R6P A;  4PE1 A;  4CPV A;  1SW8 A;  1SR6 B;  1EG4 A;  2K8M B;  1A75 B;  2QPT A;  2EC6 C;  1M45 A;  2BKI B;  1NP8 A;  1K95 A;  4ICB A;  1LXF C;  1DJW A;  4ORA B;  2MLE C;  1F71 A;  2E30 A;  2Y1N A;  3OX5 A;  1MXE A;  1DGU A;  1KSM A;  2JNX A;  5HKZ A;  3TUY C;  2I94 A;  3BQ3 A;  2JUL A;  1F4O A; 
#chains in the Genus database with same CATH topology
 5I2Q A;  4QJ5 B;  2KGR A;  5G08 A;  2WND A;  1BG1 A;  3DVJ A;  3PAT A;  3TUY B;  3CR4 X;  3HCM A;  1V1G A;  1UUR A;  2OPO A;  2ZKM X;  3KO0 A;  1KK7 Y;  3EKH A;  1DJH A;  4I5L B;  1F70 A;  2COL B;  3GK1 A;  1RTP 1;  1PVA A;  4PHK A;  1BF5 A;  1Y6W A;  2KAY A;  2H61 A;  3A8R A;  1OZS A;  1IKU A;  2KNE A;  2LC5 A;  3D78 A;  1EG3 A;  2K7C A;  2YGU A;  3ZWH A;  4N5X A;  1R2U A;  2KI4 B;  2L98 A;  4DUQ A;  1JC2 A;  3LLE A;  3EK8 A;  1MWN A;  3SG7 A;  2ZFD A;  1E8A A;  5DIC A;  3DY9 A;  3BUO B;  3TS5 B;  1OOG A;  1EXR A;  1NX0 A;  1WY9 A;  2JWW A;  1YX8 A;  4M2O A;  1ALV A;  1MHO A;  1SCV A;  1F54 A;  1K9K A;  5B8I B;  3QRX A;  3D76 A;  3TDI A;  1CFF A;  5FI6 A;  1TNP A;  3DVK A;  5JOL A;  1Y0V H;  3D73 A;  1KQM C;  2BL0 C;  1MR8 A;  1WRL A;  3OB2 B;  1MQ1 A;  1QIW A;  5AFP A;  1QVI Z;  1ZAC A;  2BE4 A;  1MF8 B;  2LP3 A;  1JSA A;  3B88 A;  3L47 A;  3JTD B;  1NUB A;  2LAP A;  3E3R A;  3FS7 A;  1K8U A;  2H8V A;  1YRU B;  1IGV A;  1GM0 A;  3S0B A;  5DKR A;  3I5F B;  2WCB A;  1SNL A;  3K21 A;  1TCO B;  3ZNI A;  3WHU B;  1NYA A;  1BMO A;  1AUI B;  1CFP A;  3KHE A;  1UHK A;  3SJS A;  1B9A A;  1QS7 A;  3R1O A;  1C3Y A;  3CZT X;  4OR9 B;  1SRA A;  3S0F A;  3IQQ A;  1B7T Y;  2WCK A;  3PM2 A;  3B86 A;  4MLW A;  4QJ4 B;  1KWO B;  1S1E A;  1SL9 A;  2Y1M A;  1DJY A;  1SCM B;  1QVI Y;  1ZMZ A;  5FYX A;  2KGB C;  1CKK A;  1DC1 A;  1XA5 A;  4JKT A;  2P6B B;  1RRO A;  2KAV A;  2LLS A;  3KPX A;  4DS7 A;  2LMV A;  1SYM A;  3HX4 A;  1KK7 Z;  2L4I A;  4XJK B;  1A03 A;  1KQV A;  5CSF A;  2P71 A;  1OMV A;  4ZCU A;  2K2F A;  3CLN A;  3WXA A;  3CGA A;  3Q8I A;  3D0Y A;  4L9M A;  2Y5I A;  3PN7 C;  2BE6 A;  1B1G A;  2AAO A;  2HF5 A;  2JZI A;  5AEQ A;  1AVS A;  1TRF A;  1LVC D;  1NWD A;  1RJV A;  2JPO A;  1IQ3 A;  1AJ5 A;  3SS5 A;  3SG3 A;  2PSR A;  3A4U B;  2KLD A;  1YUS A;  3CR2 A;  4HRH A;  3SG4 A;  2F33 A;  1JFJ A;  3CTN A;  1DJG A;  5I2O A;  4USL A;  3O6B A;  1Z2C B;  4C0L A;  4I5J A;  3M0W A;  4JWQ A;  2EGD A;  4P2Y B;  1FF1 A;  2LHL A;  3DZT A;  2QDI A;  4JQ0 D;  5I2L A;  1SKT A;  2Q4U A;  1UP5 A;  1LKJ A;  1AK8 A;  1J7R A;  4YGD B;  3SG2 A;  2KI6 D;  4PT1 A;  5FI2 A;  5FI7 A;  2KYF A;  1NCY A;  1YX7 A;  2K7D A;  4YRU A;  1G8I A;  2IS9 A;  2WCM A;  3C1V A;  1PK0 D;  3CAB A;  3IF7 A;  3I5G B;  1WDC B;  1KK8 B;  2F8P A;  2PYQ A;  4MVF A;  5CPV A;  2KFH A;  3S0D A;  1BOC A;  3FIA A;  1QJT A;  5HKY A;  4AQI A;  1XYD A;  2BCA A;  2JXL A;  4ZCV A;  2Q91 A;  3B6X A;  3LL8 B;  3WNX B;  4IL1 A;  2KYC A;  3DVE A;  2OTG C;  2GTE A;  3MSE B;  1K9P A;  1IJ5 A;  3BFB A;  1NIW A;  3CWG A;  1L2O B;  2LVV A;  3CZ1 A;  3L4L A;  3VRO A;  1QWV A;  3DF0 B;  3SIB A;  3V2L A;  1QLS A;  1K90 D;  3AKB A;  1GJY A;  1FBV A;  4A4B A;  3VRP A;  1TNQ A;  2HQW A;  2OTG B;  4HRG A;  3BFA A;  4BY4 A;  3R1V A;  5IBW A;  2KBI A;  1LS8 A;  2M0R A;  1S26 D;  1S3P A;  1BR1 B;  2WC8 A;  3GK4 X;  1DGV A;  5AER A;  4PHJ A;  1YUT A;  1XO5 A;  1OE9 B;  2GV5 A;  2JU0 A;  1D1O A;  2GGZ A;  5CSI A;  1QV0 A;  3KF9 A;  1C3Z A;  3DYE A;  5HLO A;  1KK8 C;  3SG5 A;  1ODB A;  1NSH A;  1OSA A;  1YUR A;  1XFW O;  2D8N A;  3AKA A;  4WQ3 A;  1S5G Y;  1UHH A;  2CT9 A;  2M1U A;  5D3O A;  3BUM B;  2CNP A;  2L5Y A;  3RZS A;  1W7I B;  3BUX B;  3EK4 A;  2K61 A;  3I5G C;  2M9G A;  3NXA A;  1GGZ A;  4MZL A;  3I5H C;  5GQQ C;  2ISD A;  1S6I A;  3CZ0 A;  2LMT A;  3NSO A;  1KFU S;  3S0E A;  1CMG A;  3B7A A;  1XFX O;  1M31 A;  4YGB B;  2L0P A;  3DF0 A;  1DF0 A;  2MRD A;  3FE6 A;  3FWC A;  4GBA A;  1B4C A;  1DJI A;  1DF0 B;  1B8L A;  1ALW A;  2O60 A;  1F4Q A;  5F6T A;  1PUL A;  1J55 A;  1C7V A;  1CDN A;  4PDZ A;  2JTZ A;  2WCL A;  5DKN A;  1JBA A;  3BUN B;  5BPJ A;  2G9B A;  5KTY A;  1J7P A;  2LMU A;  4HSZ A;  3TZ1 A;  4GGF C;  4KYN A;  1BLQ A;  1CDL A;  1K9U A;  1WRK A;  2JT3 A;  3OP0 A;  1A29 A;  5HKW A;  2SCP A;  2MBX A;  3TDZ A;  1M63 B;  1OQP A;  1QX2 A;  4UPG A;  1AJ4 A;  2P70 A;  3LCP C;  3CZ2 A;  1SCM C;  2NZ0 A;  2JOJ A;  3EK7 A;  1XFZ O;  1ZFS A;  3O78 A;  4D1E A;  1KWO C;  2PQL A;  1JF2 A;  3R1P A;  4DCK A;  4FQT A;  1RFJ A;  4Q04 A;  3PJI A;  1Z4H A;  2HQ8 A;  4YBH B;  2KLE A;  1ZOT B;  2KFG A;  1B8C A;  1SPY A;  3O2P A;  1PVB A;  3ICB A;  1Y1U A;  4CFQ A;  1GGW A;  1EL4 A;  1SK6 D;  1XK4 A;  1WLZ A;  2CBL A;  2JRF A;  1H4B A;  2Y4Q A;  4WQ2 A;  1QAT A;  1SL7 A;  1XFU O;  4N1G A;  5ER5 A;  3I5H B;  1F8H A;  2F3Z A;  4F7F A;  2F3Y A;  1V1F A;  2KQ6 A;  2PAL A;  2LUX A;  2WCE A;  3CYZ A;  3JTD C;  3NSK A;  3OBV A;  2PAS A;  3RM1 A;  4GGF A;  1J7Q A;  4OCI A;  5AAN A;  2BBM A;  1L2O C;  1KQM B;  1L7Z A;  2LHI A;  3EKJ A;  2G2B A;  1B7T Z;  1DEL A;  1BU3 A;  1G33 A;  2BAP A;  2LUC A;  2MAZ A;  3D0Y B;  3PAL A;  1M46 A;  4MRY A;  3RLZ A;  1QIV A;  2RGI A;  3UNW A;  1N2D A;  1PRW A;  1PSR A;  3D77 A;  2O5G A;  1S6C A;  2NLN A;  1DJX A;  2K7O A;  3FWB A;  3TS5 C;  3PM8 A;  1AHR A;  5D69 A;  2WC5 A;  2QAC A;  3BUW B;  1T14 A;  2M7L A;  1M39 A;  1MXL C;  2NCO A;  1DQE A;  1IG5 A;  1N0Y A;  3B87 A;  3EVV A;  3K1E A;  1OOF A;  1XFV O;  2CXJ A;  3GOF A;  3PLF B;  2LNK A;  3TDU A;  1OW4 A;  1U5I A;  2PRU A;  3PFV A;  5K89 A;  1XFR A;  3EVR A;  4TNC A;  4DRW A;  3N7H A;  1KFX L;  3PSR A;  1HT9 A;  3IQO A;  2LP2 A;  2LVK A;  2SAS A;  4MZK A;  1P28 A;  2K7B A;  2L51 A;  4PHN A;  5HL1 A;  2L50 A;  1CDP A;  2PMY A;  3I5I C;  1C7W A;  3CR5 X;  1DT7 B;  1NX2 A;  4C0J A;  4CFR A;  2M7N A;  2PVB A;  5JJG A;  1FI5 A;  2ZNE A;  4M2P A;  3BOW A;  2BEC A;  2NCP A;  4N1F A;  3D75 A;  3NSI A;  2KAX A;  4ORC B;  5PAL A;  1FI6 A;  2F2P A;  4GUK A;  4CLN A;  1S6J A;  1QTX A;  3SG6 A;  1NX1 A;  3EG5 B;  4A4C A;  3CDN A;  5EL2 A;  4MZJ A;  2WOR A;  2JPT A;  2H61 C;  2K2A A;  2CTN A;  4P5O E;  2FOT A;  1TOP A;  4QJ3 B;  1BR4 B;  1CM4 A;  3QME A;  2LAN A;  1BJF A;  2KHN A;  1EH2 A;  1SMG A;  2F2O A;  4F0Z B;  3BYA A;  1HQV A;  5TNC A;  3R72 A;  3JVT B;  4PHM A;  5DKQ A;  1GQM A;  1JWD A;  1OOJ A;  4JPZ B;  1F55 A;  1SR6 C;  4FQO A;  2R2I A;  2I18 A;  3SS4 A;  2LVJ A;  2L2E A;  1ZUZ A;  3FE9 A;  1XK4 C;  2I7A A;  4PCW A;  1YUU A;  4NDC A;  1YR5 A;  3AAJ A;  2WCF A;  3D74 A;  1BT6 A;  4CID A;  1CMF A;  4ORB B;  1IQ5 A;  1RWY A;  1UHJ A;  1YVH A;  4NDB A;  1J1D A;  3UO9 A;  1QXP A;  1JFK A;  1CLL A;  1B47 A;  3I5F C;  4PE4 A;  1IH0 A;  4ETO A;  2LM5 A;  2OS8 C;  2DOQ A;  4GGN A;  2KDH A;  4IJ7 A;  1S36 A;  2KBM A;  4NQG A;  3NGV A;  1K94 A;  3DXL A;  1CNP A;  4GFT A;  3D10 A;  4FTG A;  2FCD A;  1NX3 A;  1TUZ A;  2MJW B;  4PE0 A;  2ZRS A;  1WLM A;  3BFH A;  2M97 A;  1IWQ A;  1IJ6 A;  4HRE E;  5KU1 A;  1BOD A;  4DIR A;  2M1K B;  1W9Z A;  4YI8 A;  1K93 D;  2WOS A;  3NHI A;  5CSN A;  5AXI A;  2VRG A;  1UWO A;  2KI4 C;  4YGC B;  1IRJ A;  1OOI X;  1TUJ A;  1TCF A;  1LA3 A;  1KFU L;  2ERB A;  2JNF A;  3OB1 B;  2JT8 A;  4GAO A;  1U5I B;  3S0G A;  4PAL A;  3NHT A;  2BCB A;  2BL0 B;  1QLK A;  1C07 A;  1PSB A;  2H2K A;  1RK9 A;  1NCX A;  1KSO A;  1MUX A;  1DMO A;  1XFY O;  3SIA A;  4XYN A;  2M8U A;  1TN4 A;  4YGE B;  4INX A;  3VGO A;  2JC2 A;  2TN4 A;  1IIO A;  2I2R E;  1CM1 A;  2A4J A;  2BBN A;  1TNX A;  2FJU B;  4PE7 A;  2LVI A;  1QX5 B;  1WDC C;  2AUC A;  2MA2 A;  1G4Y R;  5CSJ A;  3VRN A;  2GGM A;  2LV7 A;  3FE8 A;  1SSE B;  3AAK A;  2WCH A;  4OKH A;  3OHM B;  3VRQ A;  1CDM A;  1SL8 A;  5I8N A;  1SBJ A;  2HET A;  2MLF C;  4MEW A;  4OVN F;  3DVM A;  3I5I B;  4MRX A;  1S5G Z;  2HPS A;  3H4S E;  2JXC A;  2LE9 B;  4E68 A;  2ZN9 A;  2V53 A;  1X02 A;  4AQJ A;  3F45 A;  3VB1 A;  1KCY A;  4GPL B;  3BXK A;  2AMI A;  1J7O A;  2KFF A;  1VRK A;  2KPH A;  4I5K A;  1YRT B;  1QV1 A;  2JQ6 A;  2ZRT A;  1KFX S;  5D7F A;  4AOM A;  1A2X A;  3OX6 A;  1DJZ A;  2L2C A;  2NXQ A;  3DD4 A;  3EVU A;  3PN7 B;  2QEO A;  1H8B A;  2KSP A;  2FCE A;  3LK0 A;  2M29 A;  2BKH B;  5HLV A;  2L4H A;  3NSL A;  1SY9 A;  3SS3 A;  1CLB A;  4NDD A;  1ORG A;  2ZN8 A;  2M49 B;  2K0J A;  1FW4 A;  1FPW A;  2EC6 B;  3OGN A;  1K2H A;  4YI9 A;  1CFD A;  1OZO A;  1Q80 A;  1K96 A;  1UHN A;  5KSZ A;  1DVI A;  1PAL A;  2QEB A;  5HYD A;  1B8R A;  1Y1X A;  3BOW B;  1TIZ A;  2WCJ A;  2ZND A;  4YGA A;  3O4X A;  1CLM A;  2LLU A;  1JF0 A;  1OMD A;  1QX7 A;  3WHT B;  3IVT A;  1JUO A;  1A4P A;  1DTL A;  1A75 A;  1J1E A;  1TWO A;  1UHI A;  1W7J B;  2BNX A;  2KOT A;  3L4A A;  4R1E A;  1AP4 A;  5J3X A;  3LK1 A;  1LIN A;  4XJK A;  1NCZ A;  2LLT A;  4WRI A;  1TNW A;  2JTT A;  2OS8 B;  1EJ3 A;  3GK2 A;  4OZD A;  4JD9 A;  5ER4 X;  3S0A A;  2QEH A;  1REC A;  2CCM A;  4MN0 A;  2M3W A;  5I94 A;  2BCX A;  1XVJ A;  1N65 A;  1TTX A;  2MHH A;  4INW A;  1CB1 A;  2B1U A;  4M2Q A;  1OMR A;  4MBE A;  3BJH A;  4C0K A;  4OV2 A;  4I5N B;  4GNK B;  1CFC A;  2KI6 C;  4BY5 A;  2KQY A;  1YVL A;  4MSP A;  1UUS A;  1CTR A;  1QAS A;  2JT0 A;  3KEV A;  1NPQ A;  3O4Y A;  1Y1A A;  2EHB A;  1LA0 A;  1YTZ C;  2E6W A;  3CS1 A;  3VRR A;  2LCP A;  2FJY A;  1WRZ A;  3JVT C;  2L5X B;  2QEV A;  2K60 A;  4U8D A;  1R6P A;  4PE1 A;  4CPV A;  1SW8 A;  1SR6 B;  1DEK A;  1EG4 A;  1A75 B;  2K8M B;  2EC6 C;  2QPT A;  1M45 A;  2BKI B;  1NP8 A;  1K95 A;  4ICB A;  1LXF C;  1DJW A;  1OOH A;  4ORA B;  2MLE C;  1F71 A;  2E30 A;  2WC6 A;  2Y1N A;  3OX5 A;  1MXE A;  1DGU A;  1KSM A;  2JNX A;  5HKZ A;  3TUY C;  2I94 A;  3BQ3 A;  2JUL A;  1F4O A; 
#chains in the Genus database with same CATH homology
 5I2Q A;  4QJ5 B;  2KGR A;  5G08 A;  2WND A;  1BG1 A;  3DVJ A;  3PAT A;  3TUY B;  3CR4 X;  3HCM A;  1V1G A;  1UUR A;  2OPO A;  2ZKM X;  3KO0 A;  1KK7 Y;  3EKH A;  1DJH A;  4I5L B;  1F70 A;  2COL B;  3GK1 A;  1RTP 1;  1PVA A;  4PHK A;  1BF5 A;  1Y6W A;  2KAY A;  2H61 A;  3A8R A;  1OZS A;  1IKU A;  2KNE A;  2LC5 A;  1EG3 A;  2K7C A;  3ZWH A;  4N5X A;  1R2U A;  2KI4 B;  2L98 A;  4DUQ A;  1JC2 A;  3LLE A;  3EK8 A;  1MWN A;  3SG7 A;  2ZFD A;  1E8A A;  3BUO B;  3TS5 B;  1EXR A;  1NX0 A;  1WY9 A;  2JWW A;  1YX8 A;  4M2O A;  1ALV A;  1MHO A;  1SCV A;  1F54 A;  1K9K A;  5B8I B;  3QRX A;  3TDI A;  1CFF A;  1TNP A;  3DVK A;  5JOL A;  1Y0V H;  1KQM C;  2BL0 C;  1MR8 A;  1WRL A;  3OB2 B;  1MQ1 A;  1QIW A;  5AFP A;  1QVI Z;  1ZAC A;  2BE4 A;  1MF8 B;  2LP3 A;  1JSA A;  3JTD B;  1NUB A;  2LAP A;  3E3R A;  3FS7 A;  1K8U A;  1YRU B;  1IGV A;  5DKR A;  3I5F B;  2WCB A;  1SNL A;  3K21 A;  1TCO B;  3ZNI A;  3WHU B;  1NYA A;  1BMO A;  1AUI B;  1CFP A;  3KHE A;  1UHK A;  3SJS A;  1B9A A;  1QS7 A;  3CZT X;  4OR9 B;  1SRA A;  3IQQ A;  1B7T Y;  4MLW A;  4QJ4 B;  1KWO B;  1S1E A;  1SL9 A;  2Y1M A;  1DJY A;  1SCM B;  1QVI Y;  1ZMZ A;  5FYX A;  2KGB C;  1CKK A;  1XA5 A;  2P6B B;  1RRO A;  2KAV A;  2LLS A;  3KPX A;  4DS7 A;  2LMV A;  1SYM A;  3HX4 A;  1KK7 Z;  2L4I A;  4XJK B;  1A03 A;  1KQV A;  5CSF A;  1OMV A;  4ZCU A;  2K2F A;  3CLN A;  3WXA A;  3CGA A;  3D0Y A;  4L9M A;  2Y5I A;  3PN7 C;  2BE6 A;  1B1G A;  2AAO A;  2HF5 A;  2JZI A;  5AEQ A;  1AVS A;  1TRF A;  1LVC D;  1NWD A;  1RJV A;  1IQ3 A;  1AJ5 A;  3SG3 A;  2PSR A;  3A4U B;  1YUS A;  3CR2 A;  4HRH A;  3SG4 A;  2F33 A;  1JFJ A;  3CTN A;  1DJG A;  5I2O A;  4USL A;  3O6B A;  4C0L A;  4I5J A;  3M0W A;  4JWQ A;  2EGD A;  4P2Y B;  1FF1 A;  2LHL A;  4JQ0 D;  5I2L A;  1SKT A;  2Q4U A;  1UP5 A;  1LKJ A;  1AK8 A;  1J7R A;  4YGD B;  3SG2 A;  2KI6 D;  2KYF A;  1NCY A;  1YX7 A;  2K7D A;  4YRU A;  1G8I A;  2IS9 A;  3C1V A;  1PK0 D;  3IF7 A;  3I5G B;  1WDC B;  1KK8 B;  2F8P A;  4MVF A;  5CPV A;  2KFH A;  1BOC A;  3FIA A;  1QJT A;  5HKY A;  4AQI A;  1XYD A;  2BCA A;  2JXL A;  4ZCV A;  2Q91 A;  3LL8 B;  3WNX B;  4IL1 A;  2KYC A;  3DVE A;  2OTG C;  3MSE B;  1K9P A;  1IJ5 A;  1NIW A;  3CWG A;  1L2O B;  2LVV A;  3VRO A;  3DF0 B;  3SIB A;  1QLS A;  1K90 D;  3AKB A;  1GJY A;  1FBV A;  4A4B A;  3VRP A;  1TNQ A;  2HQW A;  2OTG B;  4HRG A;  4BY4 A;  5IBW A;  2KBI A;  2M0R A;  1S26 D;  1S3P A;  1BR1 B;  2WC8 A;  3GK4 X;  1DGV A;  5AER A;  4PHJ A;  1YUT A;  1XO5 A;  1OE9 B;  2GV5 A;  2JU0 A;  1D1O A;  2GGZ A;  5CSI A;  1QV0 A;  3KF9 A;  5HLO A;  1KK8 C;  3SG5 A;  1ODB A;  1NSH A;  1OSA A;  1YUR A;  1XFW O;  2D8N A;  3AKA A;  4WQ3 A;  1S5G Y;  1UHH A;  2CT9 A;  2M1U A;  3BUM B;  2CNP A;  1W7I B;  3BUX B;  3EK4 A;  2K61 A;  3I5G C;  2M9G A;  3NXA A;  1GGZ A;  4MZL A;  3I5H C;  5GQQ C;  2ISD A;  1S6I A;  2LMT A;  3NSO A;  1KFU S;  1CMG A;  1XFX O;  1M31 A;  4YGB B;  2L0P A;  3DF0 A;  1DF0 A;  2MRD A;  3FWC A;  4GBA A;  1B4C A;  1DJI A;  1DF0 B;  1B8L A;  1ALW A;  2O60 A;  1F4Q A;  5F6T A;  1PUL A;  1J55 A;  1C7V A;  1CDN A;  4PDZ A;  2JTZ A;  5DKN A;  1JBA A;  3BUN B;  5BPJ A;  2G9B A;  5KTY A;  1J7P A;  2LMU A;  4HSZ A;  3TZ1 A;  4GGF C;  1BLQ A;  1CDL A;  1K9U A;  1WRK A;  2JT3 A;  3OP0 A;  1A29 A;  5HKW A;  2SCP A;  2MBX A;  3TDZ A;  1M63 B;  1OQP A;  1QX2 A;  4UPG A;  1AJ4 A;  3LCP C;  1SCM C;  2NZ0 A;  2JOJ A;  3EK7 A;  1XFZ O;  1ZFS A;  3O78 A;  4D1E A;  1KWO C;  1JF2 A;  4DCK A;  1RFJ A;  4Q04 A;  2HQ8 A;  4YBH B;  1ZOT B;  2KFG A;  1B8C A;  1SPY A;  3O2P A;  1PVB A;  3ICB A;  1Y1U A;  4CFQ A;  1GGW A;  1EL4 A;  1SK6 D;  1XK4 A;  1WLZ A;  2CBL A;  2JRF A;  1H4B A;  2Y4Q A;  4WQ2 A;  1QAT A;  1SL7 A;  1XFU O;  4N1G A;  5ER5 A;  3I5H B;  1F8H A;  2F3Z A;  2F3Y A;  1V1F A;  2KQ6 A;  2PAL A;  2LUX A;  2WCE A;  3JTD C;  3NSK A;  3RM1 A;  2PAS A;  1J7Q A;  4GGF A;  4OCI A;  5AAN A;  2BBM A;  1L2O C;  1KQM B;  1L7Z A;  2LHI A;  3EKJ A;  2G2B A;  1B7T Z;  3D0Y B;  1BU3 A;  1G33 A;  2LUC A;  3PAL A;  2MAZ A;  4MRY A;  3RLZ A;  1M46 A;  1FPW A;  1QIV A;  2RGI A;  1N2D A;  1PRW A;  1PSR A;  2O5G A;  1S6C A;  2NLN A;  1DJX A;  2K7O A;  3FWB A;  3TS5 C;  3PM8 A;  1AHR A;  5D69 A;  2QAC A;  3BUW B;  2M7L A;  1M39 A;  1MXL C;  2NCO A;  1IG5 A;  1N0Y A;  3EVV A;  2CXJ A;  1XFV O;  3GOF A;  3PLF B;  2LNK A;  3TDU A;  3PFV A;  1U5I A;  2PRU A;  5K89 A;  3EVR A;  4TNC A;  4DRW A;  1KFX L;  3PSR A;  1HT9 A;  3IQO A;  2LP2 A;  2LVK A;  2SAS A;  4MZK A;  2K7B A;  4PHN A;  2L51 A;  2L50 A;  1CDP A;  2PMY A;  3I5I C;  1C7W A;  3CR5 X;  1DT7 B;  1NX2 A;  4C0J A;  4CFR A;  2M7N A;  2PVB A;  5JJG A;  1FI5 A;  2ZNE A;  4M2P A;  3BOW A;  2BEC A;  2NCP A;  4N1F A;  3NSI A;  2KAX A;  4ORC B;  5PAL A;  1FI6 A;  2F2P A;  4GUK A;  4CLN A;  1S6J A;  1QTX A;  3SG6 A;  1NX1 A;  4A4C A;  4MZJ A;  2WOR A;  2JPT A;  2H61 C;  2K2A A;  2CTN A;  4P5O E;  2FOT A;  1TOP A;  4QJ3 B;  1BR4 B;  1CM4 A;  1EH2 A;  2LAN A;  1BJF A;  2KHN A;  1SMG A;  2F2O A;  4F0Z B;  3BYA A;  1HQV A;  5TNC A;  3JVT B;  4PHM A;  5DKQ A;  1GQM A;  1JWD A;  1OOJ A;  4JPZ B;  1F55 A;  1SR6 C;  4FQO A;  2R2I A;  2I18 A;  2LVJ A;  2L2E A;  1ZUZ A;  1XK4 C;  2I7A A;  4PCW A;  1YUU A;  4NDC A;  1YR5 A;  3AAJ A;  2WCF A;  1BT6 A;  4CID A;  1CMF A;  4ORB B;  1IQ5 A;  1RWY A;  1UHJ A;  1YVH A;  4NDB A;  1J1D A;  1QXP A;  1JFK A;  1CLL A;  1B47 A;  3I5F C;  4PE4 A;  1IH0 A;  4ETO A;  2LM5 A;  2OS8 C;  2DOQ A;  4GGN A;  2KDH A;  1S36 A;  2KBM A;  4NQG A;  1K94 A;  1CNP A;  4GFT A;  3D10 A;  4FTG A;  2FCD A;  1NX3 A;  2MJW B;  4PE0 A;  2ZRS A;  1WLM A;  2M97 A;  1IWQ A;  1IJ6 A;  4HRE E;  5KU1 A;  1BOD A;  4DIR A;  2M1K B;  4YI8 A;  1K93 D;  2WOS A;  5CSN A;  5AXI A;  2VRG A;  1UWO A;  2KI4 C;  4YGC B;  1IRJ A;  1TCF A;  1LA3 A;  1KFU L;  2JNF A;  3OB1 B;  4GAO A;  2JT8 A;  1U5I B;  4PAL A;  2BCB A;  2BL0 B;  1QLK A;  1C07 A;  1PSB A;  2H2K A;  1RK9 A;  1NCX A;  1KSO A;  1MUX A;  1DMO A;  1XFY O;  3SIA A;  4XYN A;  2M8U A;  1TN4 A;  4YGE B;  3VGO A;  2JC2 A;  2TN4 A;  2I2R E;  1CM1 A;  2A4J A;  2BBN A;  1TNX A;  2FJU B;  4PE7 A;  2LVI A;  1QX5 B;  1WDC C;  2AUC A;  2MA2 A;  1G4Y R;  5CSJ A;  3VRN A;  2GGM A;  2LV7 A;  3AAK A;  3VRQ A;  4OKH A;  3OHM B;  1CDM A;  1SL8 A;  5I8N A;  1SBJ A;  2HET A;  2MLF C;  4MEW A;  4OVN F;  3DVM A;  3I5I B;  4MRX A;  1S5G Z;  2HPS A;  3H4S E;  2JXC A;  2LE9 B;  4E68 A;  2ZN9 A;  2V53 A;  1X02 A;  4AQJ A;  3F45 A;  1KCY A;  4GPL B;  3BXK A;  2AMI A;  1J7O A;  2KFF A;  1VRK A;  4I5K A;  1YRT B;  1QV1 A;  2JQ6 A;  2ZRT A;  1KFX S;  5D7F A;  4AOM A;  1A2X A;  3OX6 A;  1DJZ A;  2NXQ A;  3DD4 A;  3EVU A;  3PN7 B;  1H8B A;  2KSP A;  2FCE A;  3LK0 A;  2M29 A;  2BKH B;  5HLV A;  2L4H A;  3NSL A;  1SY9 A;  1CLB A;  4NDD A;  2ZN8 A;  2M49 B;  2K0J A;  1FW4 A;  2EC6 B;  1K2H A;  4YI9 A;  1CFD A;  1OZO A;  1Q80 A;  1K96 A;  1UHN A;  5KSZ A;  1DVI A;  1PAL A;  5HYD A;  1B8R A;  1Y1X A;  3BOW B;  1TIZ A;  2ZND A;  4YGA A;  1CLM A;  2LLU A;  1JF0 A;  1OMD A;  1QX7 A;  3WHT B;  1JUO A;  1A4P A;  1DTL A;  1A75 A;  1J1E A;  1W7J B;  1UHI A;  2KOT A;  4R1E A;  1AP4 A;  5J3X A;  3LK1 A;  1LIN A;  4XJK A;  1NCZ A;  2LLT A;  4WRI A;  1TNW A;  2JTT A;  2OS8 B;  1EJ3 A;  3GK2 A;  5ER4 X;  1REC A;  2CCM A;  4MN0 A;  2M3W A;  2BCX A;  1XVJ A;  1N65 A;  1TTX A;  2MHH A;  1CB1 A;  2B1U A;  4M2Q A;  1OMR A;  4MBE A;  4C0K A;  4OV2 A;  4I5N B;  4GNK B;  1CFC A;  2KI6 C;  4BY5 A;  2KQY A;  1YVL A;  4MSP A;  1UUS A;  1CTR A;  1QAS A;  2JT0 A;  3KEV A;  1NPQ A;  3O4Y A;  1Y1A A;  2EHB A;  1LA0 A;  1YTZ C;  2E6W A;  3CS1 A;  3VRR A;  2LCP A;  1WRZ A;  3JVT C;  2L5X B;  4U8D A;  1R6P A;  4PE1 A;  4CPV A;  1SW8 A;  1SR6 B;  1EG4 A;  2K8M B;  1A75 B;  2QPT A;  2EC6 C;  1M45 A;  2BKI B;  1NP8 A;  1K95 A;  4ICB A;  1LXF C;  1DJW A;  4ORA B;  2MLE C;  1F71 A;  2E30 A;  2Y1N A;  3OX5 A;  1MXE A;  1DGU A;  1KSM A;  2JNX A;  5HKZ A;  3TUY C;  2I94 A;  3BQ3 A;  2JUL A;  1F4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...