3CR2A

X-ray structure of bovine zn(2+),ca(2+)-s100b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
90
structure length
90
Chain Sequence
b'MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
molecule tags Metal binding protein
source organism Bos taurus
publication title Divalent metal ion complexes of S100B in the absence and presence of pentamidine.
pubmed doi rcsb
total genus 29
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cr2A00
2JTTA 1KK8B 1W7JB 1NPQA 3DVEA 4BY5A 1H4BA 2F33A 4NDDA 2Y5IA 1NYAA 2V53A 1FI5A 1C7WA 2M7LA 1WRLA 2KDHA 1PALA 3CTNA 3DF0A 2ZFDA 1EXRA 2JXLA 2M8UA 2KNEA 3BUNB 1LA0A 2E30A 4I5NB 2F8PA 2KI4B 3WHTB 4XJKB 2IS9A 1KFUL 1PVAA 1LVCD 4MSPA 1K96A 2LANA 2JULA 1KWOB 1N0YA 3CS1A 4PE4A 4GGNA 2Q91A 3AAJA 1IWQA 1DVIA 1PRWA 1U5IA 1U5IB 1AK8A 1WLZA 1CDNA 2O5GA 1TNXA 4XYNA 2M9GA 1N65A 3QRXA 4I5LB 2BBNA 1C07A 1YTZC 2LHIA 2MA2A 2OS8B 3PLFB 2LMVA 5AERA 2ZN9A 1S6IA 5CSNA 1BLQA 1NX2A 4PE1A 4OCIA 3NSIA 3KF9A 1BMOA 1XVJA 2PMYA 5HKWA 1QX2A 2MLEC 5J3XA 5I2QA 1QIWA 1SKTA 1ZUZA 1S1EA 2BKHB 1UUSA 2WC8A 3BUOB 3CLNA 2K61A 2LAPA 3SIBA 2MLFC 1IGVA 2RGIA 4OR9B 3JVTC 4MZJA 1HT9A 1RFJA 1MQ1A 5DKRA 2R2IA 3VRNA 1K2HA 2LUXA 2COLB 1SBJA 3JTDC 5JJGA 4N1GA 3AKAA 1TN4A 4P5OE 1XFXO 3PATA 1C7VA 2K7OA 1CMGA 5CSIA 4PALA 5HKZA 2L4HA 1TTXA 4DRWA 3M0WA 4ICBA 1AJ5A 3A4UB 1V1FA 3DVMA 4HRGA 4QJ4B 4ZCVA 4AQJA 1XFZO 2LP3A 1CLMA 5AXIA 1PULA 1UHIA 1SR6C 2NXQA 1RWYA 1GGZA 1M39A 2L0PA 3TUYC 2KBMA 1UHKA 3ICBA 1F54A 4JWQA 1SL8A 1B7TY 3FWCA 2F2OA 2WOSA 2JC2A 1J7RA 2KAXA 1SRAA 1R2UA 2KGRA 3OX6A 3CWGA 1F55A 1KK7Y 1K94A 4I5JA 3LCPC 4MVFA 3TDIA 5ER4X 1DF0A 1XO5A 2OPOA 1XFWO 2A4JA 1TCFA 4WQ2A 1UHJA 4DCKA 1YUTA 3CGAA 5HKYA 1SL7A 2ZNEA 3PSRA 5I8NA 2OTGC 1CM4A 3O6BA 3BXKA 1E8AA 4PHNA 1DTLA 1F71A 3D0YB 1L7ZA 3AAKA 3A8RA 3KPXA 4WQ3A 4PHJA 4HSZA 1CB1A 4OKHA 1BF5A 3CR2A 4NDBA 2I2RE 3SG5A 1BOCA 1PSBA 3DVJA 5I2LA 5DKQA 3E3RA 2JXCA 1KQMB 4CLNA 1A75A 1F4QA 1MHOA 1DJGA 1F8HA 2KBIA 2LVJA 3JVTB 3LK0A 1BODA 1EJ3A 2F3YA 3C1VA 4F0ZB 2KFFA 1JFKA 1J1DA 2PALA 3GK4X 1MUXA 1KK8C 1G4YR 2BL0C 1MXEA 4A4BA 1GQMA 4TNCA 3GK1A 3CR5X 3BOWA 1QX5B 3PALA 1YRTB 1K9UA 1TIZA 3LLEA 1JWDA 2K7BA 2PVBA 2Y4QA 2E6WA 3NSLA 2LLTA 3FS7A 1YRUB 4AOMA 4N5XA 4L9MA 4NDCA 4A4CA 1IJ5A 1OQPA 2ZN8A 2G2BA 2CCMA 3I5HC 1KSMA 3K21A 3KHEA 3PFVA 4Q04A 1KQMC 4XJKA 5AANA 1J55A 5K89A 4DUQA 1IKUA 2D8NA 2VRGA 3WHUB 3TUYB 1FW4A 2MJWB 2K2FA 1NWDA 2K0JA 1KWOC 1R6PA 1M45A 1S5GY 1OMDA 4U8DA 3FIAA 3VRRA 1KFUS 1TNWA 1B9AA 2LVKA 4FQOA 2BL0B 1XK4A 3I5GB 3HX4A 1AP4A 3RLZA 2KYCA 4MLWA 1L2OC 2KAYA 2WCEA 1NP8A 1CFCA 1D1OA 1K9PA 4MEWA 1YX8A 1MWNA 2KI6C 4QJ3B 2LMUA 4E68A 4WRIA 4PCWA 1S3PA 1UHNA 2WCBA 4CPVA 2BECA 3SG3A 1LXFC 3EKHA 4ZCUA 1CFPA 2NZ0A 3BOWB 5GQQC 2CT9A 3EK4A 3TDUA 3EK7A 2CXJA 1RROA 1IRJA 1NSHA 2O60A 4YGEB 1ODBA 1QVIZ 3BQ3A 1B8RA 3TS5C 1A03A 3IQOA 2Y1MA 3NSKA 2WORA 4MZKA 1YX7A 3OB1B 1IQ5A 1NX3A 2BKIB 3GK2A 1SW8A 3RM1A 1MR8A 3EVVA 3LL8B 4IL1A 2LC5A 4PE0A 2LVIA 1DMOA 1J1EA 1LKJA 3D0YA 3DD4A 4OVNF 1K95A 1XFUO 2BCBA 3OX5A 3WNXB 5I2OA 1J7QA 1JF2A 1PK0D 1XFVO 5HLVA 1AUIB 1G8IA 2L5XB 2LVVA 1Q80A 5G08A 2JWWA 1NX1A 1M63B 3BUMB 2AMIA 4DIRA 4JPZB 4YGDB 1Y6WA 4M2QA 1TRFA 4D1EA 1B8CA 1ALVA 1F4OA 1BJFA 1EG3A 1RJVA 4GBAA 1KQVA 2M7NA 4GPLB 2HPSA 2PRUA 2BE4A 4MRYA 3I5IC 2MHHA 3CR4X 1AVSA 1S6JA 4JQ0D 1Y1AA 1B7TZ 3SG6A 1QJTA 1V1GA 2K2AA 4ORAB 1UURA 1SR6B 1EG4A 2H2KA 3EKJA 2JNFA 1DT7B 1UWOA 3I5HB 1EL4A 2LHLA 2LV7A 2KQYA 1A4PA 2KHNA 4GGFA 1DJXA 5TNCA 1DGUA 1TOPA 1KFXS 5JOLA 3TZ1A 2I7AA 3AKBA 3FWBA 1WDCB 2Q4UA 3VROA 4CIDA 1JBAA 1PSRA 1XK4C 4ETOA 1NCZA 2BCAA 2P6BB 2MRDA 1W7IB 2I18A 3EVRA 2EHBA 1CFFA 1SYMA 5D69A 1Y1UA 2JPTA 3IF7A 2M1KB 3PN7B 2OTGB 1WRKA 3MSEB 1WLMA 1YURA 1LA3A 1CLBA 1CKKA 1DGVA 2BCXA 2EC6C 5CSJA 5B8IB 1S26D 1JC2A 1BR1B 2M3WA 1LINA 2ZRSA 4GFTA 4HREE 2JT3A 2FCDA 5KTYA 1BG1A 4QJ5B 2AUCA 1BT6A 1ZOTB 4M2OA 2PASA 2M0RA 1FBVA 3I5GC 1NUBA 1QIVA 2L2EA 1ALWA 1SY9A 2KAVA 3VRPA 3O2PA 1YVLA 2LUCA 3D10A 1CDPA 3OHMB 5BPJA 1CNPA 1ZMZA 2QPTA 2I94A 1CDLA 2M97A 3BUWB 2GGZA 1OSAA 1QASA 2HQWA 4MRXA 4OV2A 1OE9B 4UPGA 1GGWA 1SCVA 3SG2A 3H4SE 1SMGA 3TS5B 1TNQA 1AHRA 2MBXA 4AQIA 1K93D 2M1UA 2LCPA 3SJSA 4GAOA 1B8LA 1S36A 2LLSA 2F2PA 2DOQA 1A75B 3PM8A 5AEQA 2KOTA 1A2XA 1OMVA 2H61C 3KEVA 1K90D 1QV0A 4N1FA 1TNPA 2JU0A 1QS7A 1FF1A 2LP2A 1OZSA 2TN4A 1QLSA 4YGAA 1L2OB 1K8UA 1J7OA 1RTP1 1K9KA 5AFPA 2CTNA 1QX7A 1SK6D 1YVHA 4ORCB 3WXAA 1ZACA 2L51A 2WNDA 4PDZA 2LNKA 3PN7C 2KGBC 1M46A 2EC6B 4YBHB 1YUSA 4FTGA 3SG4A 2G9BA 2K8MB 1KSOA 2K7CA 3CZTX 3KO0A 1XYDA 5FYXA 2GGMA 1YR5A 2MAZA 1IG5A 1IJ6A 1AJ4A 3ZWHA 2LM5A 3BYAA 3DF0B 2CBLA 1TCOB 2NCPA 1QXPA 1JF0A 3HCMA 1JFJA 2GV5A 1NCYA 1CFDA 4P2YB 5KSZA 4NQGA 1ZFSA 2KFHA 2JT0A 1GJYA 3F45A 1WRZA 3SIAA 1VRKA 5PALA 2NCOA 4YGCB 1S6CA 2JZIA 1N2DA 1J7PA 3NSOA 3I5IB 2HQ8A 1CLLA 5DKNA 5HYDA 3VGOA 1X02A 4PHMA 1DJYA 1S5GZ 4YI9A 5HLOA 1F70A 4HRHA 1IQ3A 2FOTA 2L4IA 3I5FB 1NCXA 2PSRA 2LMTA 2CNPA 2KFGA 2NLNA 2WCFA 1PVBA 2KYFA 3O78A 1H8BA 4YI8A 3JTDB 4PE7A 1G33A 2KSPA 4BY4A 1IH0A 2K7DA 2M29A 2F3ZA 2HETA 1WY9A 1JUOA 2OS8C 1WDCC 3LK1A 2JNXA 1B47A 1NIWA 1MF8B 2KI6D 1KFXL 1OMRA 1RK9A 4GGFC 1FPWA 1KCYA 1M31A 1YUUA 1CMFA 1Y0VH 1HQVA 1MXLC 1SCMB 2ZNDA 3TDZA 1CM1A 3EVUA 4C0LA 3OP0A 4PHKA 2ZRTA 3IQQA 3ZNIA 1RECA 5F6TA 5KU1A 1DJHA 1QLKA 2M49B 4CFQA 1DF0B 3I5FC 1DJIA 2SCPA 5D7FA 3VRQA 3BUXB 3EK8A 3OB2B 2L98A 1DJZA 2EGDA 3SG7A 1Y1XA 3NXAA 2AAOA 4DS7A 1B1GA 2JOJA 4CFRA 2QACA 1EH2A 1SPYA 4R1EA 4MN0A 2Y1NA 2ISDA 3O4YA 2JQ6A 1JSAA 1QATA 1OZOA 1QTXA 1QV1A 4M2PA 4USLA 1OOJA 2B1UA 1KK7Z 5ER5A 5IBWA 1UHHA 1SCMC 4YGBB 4I5KA 1DJWA 4YRUA 1BU3A 2ZKMX 4MZLA 1B4CA 2BBMA 2L50A 3GOFA 1XA5A 1XFYO 1NX0A 4GNKB 3DVKA 2FCEA 1SL9A 2LLUA 4C0KA 1CTRA 2H61A 2KI4C 2LE9B 1A29A 1BR4B 1CDMA 2BE6A 2JRFA 2JT8A 2SASA 4MBEA 4C0JA 1FI6A 1SNLA 4ORBB 5CPVA 2FJUB 5CSFA 4GUKA 1UP5A 2HF5A 2KQ6A 2JTZA 1QVIY
chains in the Genus database with same CATH superfamily
2JTTA 4JD9A 1KK8B 1W7JB 1NPQA 3DVEA 4BY5A 1H4BA 5I94A 2F33A 4NDDA 2WC6A 2Y5IA 1NYAA 1Z2CB 2V53A 1FI5A 1C7WA 2BAPA 2M7LA 1WRLA 2KDHA 1PALA 3CTNA 3DF0A 1TUJA 2ZFDA 3R1OA 1EXRA 2JXLA 2M8UA 2KNEA 3BUNB 3V2LA 1LA0A 2E30A 4I5NB 2F8PA 2KI4B 3WHTB 3EG5B 4XJKB 2IS9A 1KFUL 1PVAA 3S0EA 1LVCD 4MSPA 1K96A 2LANA 2JULA 1KWOB 1N0YA 3CS1A 4PE4A 4GGNA 2Q91A 3AAJA 1IWQA 1DVIA 1PRWA 1U5IA 1U5IB 1AK8A 1WLZA 1CDNA 2O5GA 1TNXA 4XYNA 2M9GA 3S0GA 1N65A 3QRXA 3DXLA 4I5LB 2BBNA 2QEBA 1C07A 1YTZC 2LHIA 2MA2A 2OS8B 3PLFB 2LMVA 5AERA 2ZN9A 1S6IA 2KPHA 5CSNA 1BLQA 1NX2A 4PE1A 4OCIA 3NSIA 3KF9A 1BMOA 1XVJA 3BJHA 2PMYA 5HKWA 1QX2A 2MLEC 3B88A 5J3XA 5I2QA 1QIWA 1SKTA 1ZUZA 1S1EA 1TUZA 1UUSA 2BKHB 2WC8A 3BUOB 3CLNA 3UO9A 2K61A 2LAPA 3SIBA 2MLFC 1IGVA 2RGIA 4OR9B 3JVTC 4MZJA 3R1VA 1HT9A 3FE6A 1RFJA 1MQ1A 5DKRA 2H8VA 2R2IA 3BFHA 3BFAA 4INXA 3VRNA 1K2HA 3L47A 4INWA 2LUXA 2COLB 1SBJA 3JTDC 5JJGA 3Q8IA 4N1GA 3AKAA 1TN4A 4P5OE 1XFXO 3PATA 1C7VA 2K7OA 1CMGA 2WCMA 5CSIA 1DELA 4PALA 5HKZA 2L4HA 1TTXA 4DRWA 3M0WA 4ICBA 1AJ5A 3A4UB 1V1FA 5HL1A 3DVMA 4HRGA 4QJ4B 4ZCVA 4AQJA 1XFZO 2LP3A 1CLMA 5AXIA 1PULA 1UHIA 1SR6C 2NXQA 1RWYA 1GGZA 1M39A 1OOHA 2L0PA 3D75A 3TUYC 2KBMA 5FI6A 2WCLA 1UHKA 2WCKA 3ICBA 1F54A 4JWQA 1SL8A 1B7TY 1OOIX 3DYEA 3FWCA 4PT1A 2F2OA 2WOSA 2JC2A 1J7RA 2KAXA 1SRAA 1R2UA 2KGRA 2JPOA 3OX6A 3CWGA 1F55A 1KK7Y 1K94A 1OOGA 4I5JA 3LCPC 4MVFA 3TDIA 5ER4X 1DF0A 1XO5A 2OPOA 1XFWO 2WCHA 1LS8A 2A4JA 1TCFA 4WQ2A 1UHJA 4DCKA 1YUTA 3CGAA 5EL2A 1SL7A 2ZNEA 3PSRA 5HKYA 5I8NA 2OTGC 1CM4A 3O6BA 3BXKA 1E8AA 4PHNA 5FI7A 1DTLA 1F71A 3D0YB 1L7ZA 3AAKA 3A8RA 3KPXA 4WQ3A 4PHJA 4HSZA 1CB1A 4OKHA 1BF5A 3CR2A 1QWVA 4NDBA 2I2RE 2QEHA 3OBVA 3SG5A 1BOCA 1PSBA 3DVJA 5I2LA 5DKQA 3E3RA 2JXCA 1KQMB 4CLNA 1A75A 1F4QA 3RZSA 1MHOA 1DJGA 1F8HA 2KBIA 1W9ZA 2LVJA 3JVTB 3LK0A 1BODA 1EJ3A 2F3YA 3C1VA 4F0ZB 2KFFA 1JFKA 1J1DA 2PALA 3GK4X 1MUXA 1KK8C 1G4YR 2BL0C 1MXEA 3BFBA 4A4BA 1GQMA 4TNCA 3GK1A 3CR5X 1XFRA 3BOWA 1QX5B 3PALA 1YRTB 1K9UA 1TIZA 3LLEA 1JWDA 2K7BA 2PVBA 2Y4QA 5FI2A 2E6WA 3NHTA 3NSLA 2LLTA 3FS7A 1YRUB 4AOMA 4N5XA 4L9MA 4NDCA 4A4CA 1IJ5A 1OQPA 2ZN8A 2G2BA 2CCMA 3FE8A 1KSMA 3I5HC 3K21A 3KHEA 3PFVA 1KQMC 4Q04A 4XJKA 5AANA 1J55A 5K89A 4DUQA 1IKUA 2D8NA 2VRGA 3WHUB 3TUYB 1FW4A 1DEKA 2MJWB 2ERBA 2K2FA 1NWDA 2K0JA 1KWOC 1R6PA 1M45A 1S5GY 1OMDA 4U8DA 3FIAA 3VRRA 1KFUS 1TNWA 1B9AA 2LVKA 3CZ1A 3D78A 2BL0B 1XK4A 4FQOA 3I5GB 3HX4A 1AP4A 3RLZA 2KYCA 4MLWA 1L2OC 2KAYA 2WCEA 1NP8A 1CFCA 2KLDA 1D1OA 1K9PA 4MEWA 3N7HA 1YX8A 1MWNA 2KI6C 4QJ3B 3S0BA 2LMUA 4E68A 4WRIA 4PCWA 1S3PA 1UHNA 2WCBA 4CPVA 2BECA 3SG3A 3VB1A 1LXFC 3EKHA 4ZCUA 1CFPA 2NZ0A 3BOWB 5GQQC 2CT9A 3EK4A 3TDUA 3EK7A 2CXJA 1RROA 1T14A 1IRJA 1NSHA 2O60A 1ODBA 2QDIA 4YGEB 3R72A 1QVIZ 3BQ3A 1B8RA 3TS5C 1A03A 3IQOA 2Y1MA 3NSKA 2WORA 4MZKA 1YX7A 3OB1B 1IQ5A 1NX3A 2BKIB 4IJ7A 3GK2A 1SW8A 3RM1A 1MR8A 3EVVA 3LL8B 2PYQA 4IL1A 2LC5A 4PE0A 2LVIA 1DMOA 1J1EA 1LKJA 3D0YA 3DD4A 4OVNF 1K95A 1XFUO 2BCBA 3B86A 3OX5A 3WNXB 5I2OA 1J7QA 1JF2A 1PK0D 1XFVO 4F7FA 5HLVA 1AUIB 1G8IA 2L5XB 2LVVA 1Q80A 5G08A 2JWWA 1NX1A 1M63B 3BUMB 2AMIA 4DIRA 4JPZB 4YGDB 1Y6WA 4M2QA 1TRFA 4D1EA 1B8CA 1ALVA 1F4OA 1BJFA 3S0DA 1EG3A 1RJVA 1Z4HA 2P70A 4GBAA 1KQVA 2M7NA 3FE9A 4GPLB 2HPSA 2PRUA 2BE4A 4MRYA 3I5IC 2MHHA 3CR4X 1AVSA 1S6JA 4JQ0D 1Y1AA 1B7TZ 3SG6A 1QJTA 1V1GA 2K2AA 4ORAB 1UURA 1SR6B 1EG4A 2H2KA 3EKJA 2JNFA 2K60A 1DT7B 1UWOA 3I5HB 1EL4A 2LHLA 2LV7A 2KQYA 1A4PA 2KHNA 3D77A 3K1EA 4GGFA 1DJXA 5TNCA 1DGUA 1TOPA 1ORGA 1KFXS 3OGNA 5JOLA 3TZ1A 2I7AA 3AKBA 3FWBA 1WDCB 2Q4UA 3VROA 4CIDA 1JBAA 1PSRA 1XK4C 2PQLA 4ETOA 2YGUA 1NCZA 2BCAA 2P6BB 2MRDA 2KLEA 1W7IB 2I18A 3EVRA 2EHBA 1CFFA 1SYMA 1IIOA 5D69A 1Y1UA 2JPTA 3IF7A 2M1KB 3CYZA 3PN7B 2OTGB 1WRKA 3MSEB 1WLMA 1YURA 1LA3A 1C3ZA 1CLBA 1CKKA 1DGVA 2BCXA 2EC6C 3B6XA 5CSJA 5B8IB 1S26D 1JC2A 1BR1B 2M3WA 3CZ0A 1LINA 2ZRSA 4GFTA 4HREE 2JT3A 2FCDA 5KTYA 1BG1A 4QJ5B 2AUCA 1BT6A 1ZOTB 4M2OA 2PASA 2M0RA 1FBVA 3I5GC 1NUBA 1QIVA 2L2EA 1ALWA 1SY9A 2KAVA 3VRPA 3O2PA 1YVLA 2LUCA 3D10A 1CDPA 3OHMB 5BPJA 1CNPA 1ZMZA 2QPTA 3DY9A 2I94A 1CDLA 2M97A 3SS5A 3BUWB 2GGZA 1OSAA 1QASA 2HQWA 4MRXA 4OV2A 1OE9B 4UPGA 1GGWA 1SCVA 3NHIA 5D3OA 3SG2A 1SSEB 3H4SE 1SMGA 3TS5B 1TNQA 2BNXA 1AHRA 2MBXA 4AQIA 1K93D 2M1UA 2LCPA 3D74A 2QEVA 3PJIA 4JKTA 3SJSA 3S0FA 4GAOA 4FQTA 1B8LA 1S36A 2LLSA 2F2PA 2P71A 3R1PA 2DOQA 1A75B 3O4XA 3PM8A 5AEQA 2KOTA 1A2XA 1OMVA 1OW4A 2H61C 1K90D 1QV0A 3B7AA 3KEVA 3DZTA 1TNPA 2JU0A 4N1FA 1QS7A 3S0AA 1FF1A 2LP2A 1OZSA 2TN4A 1QLSA 4YGAA 1L2OB 1K8UA 1J7OA 1RTP1 1K9KA 5AFPA 2CTNA 1QX7A 1SK6D 1YVHA 4ORCB 3WXAA 3UNWA 1ZACA 2L51A 2WNDA 2WCJA 4PDZA 2LNKA 3PN7C 3B87A 2KGBC 1M46A 2EC6B 4YBHB 1YUSA 4FTGA 3SG4A 2G9BA 2K8MB 1KSOA 2K7CA 3CZTX 1P28A 3KO0A 1XYDA 5FYXA 2GGMA 1YR5A 2MAZA 1IG5A 1IJ6A 1AJ4A 3ZWHA 2LM5A 3BYAA 3DF0B 2CBLA 3L4LA 1TCOB 2NCPA 1QXPA 1JF0A 3HCMA 1JFJA 2GV5A 1NCYA 1CFDA 4P2YB 5KSZA 4NQGA 1ZFSA 2KFHA 2JT0A 1GJYA 3F45A 1WRZA 3SIAA 1VRKA 5PALA 2NCOA 4YGCB 1S6CA 5DICA 2JZIA 1N2DA 1J7PA 3NGVA 3NSOA 3SS3A 2WC5A 1OOFA 3I5IB 2HQ8A 1CLLA 5DKNA 5HYDA 3VGOA 1C3YA 1X02A 4PHMA 1TWOA 1DJYA 1S5GZ 4YI9A 5HLOA 1F70A 4HRHA 1IQ3A 2FOTA 2L4IA 3I5FB 1NCXA 2PSRA 2LMTA 2CNPA 2KFGA 2NLNA 2WCFA 1PVBA 2KYFA 3IVTA 3O78A 1H8BA 4YI8A 3JTDB 4PE7A 1G33A 2GTEA 2KSPA 4BY4A 1IH0A 2K7DA 2M29A 2F3ZA 2HETA 1WY9A 1JUOA 1DC1A 2OS8C 1WDCC 3LK1A 2JNXA 1B47A 1NIWA 1MF8B 2KI6D 3CABA 1KFXL 1OMRA 1RK9A 3QMEA 4GGFC 1FPWA 1KCYA 1M31A 1YUUA 1CMFA 1Y0VH 1HQVA 1MXLC 1SCMB 2ZNDA 1GM0A 3TDZA 1CM1A 3D73A 3EVUA 4C0LA 3OP0A 4PHKA 2ZRTA 3IQQA 3ZNIA 1RECA 5F6TA 5KU1A 1DJHA 1QLKA 2L5YA 2M49B 4CFQA 1DF0B 3CDNA 2QEOA 3I5FC 1DJIA 2SCPA 5D7FA 3VRQA 3BUXB 3EK8A 3OB2B 2L98A 1DJZA 2EGDA 3SG7A 1Y1XA 3NXAA 2AAOA 4DS7A 1B1GA 2JOJA 4CFRA 2QACA 1EH2A 1SPYA 4R1EA 4MN0A 2Y1NA 3L4AA 3SS4A 2FJYA 2ISDA 3O4YA 2JQ6A 1JSAA 1QATA 1OZOA 1QTXA 1QV1A 4M2PA 4USLA 2L2CA 1OOJA 2B1UA 1KK7Z 3D76A 5ER5A 3CZ2A 5IBWA 1UHHA 1SCMC 4YGBB 4I5KA 1DJWA 4YRUA 1BU3A 2ZKMX 4MZLA 1B4CA 2BBMA 2L50A 3GOFA 4KYNA 4OZDA 1XA5A 1XFYO 1NX0A 4GNKB 3DVKA 2FCEA 1SL9A 2LLUA 4C0KA 1CTRA 2H61A 2KI4C 1DQEA 2LE9B 1A29A 1BR4B 1CDMA 2BE6A 2JRFA 2JT8A 2SASA 4MBEA 4C0JA 1FI6A 1SNLA 4ORBB 5CPVA 2FJUB 5CSFA 4GUKA 1UP5A 2HF5A 2KQ6A 3PM2A 2JTZA 1QVIY
chains in the Genus database with same CATH topology
2JTTA 1KK8B 1W7JB 1NPQA 3DVEA 4BY5A 1H4BA 2F33A 4NDDA 2Y5IA 1NYAA 2V53A 1FI5A 1C7WA 2M7LA 1WRLA 2KDHA 1PALA 3CTNA 3DF0A 2ZFDA 1EXRA 2JXLA 2M8UA 2KNEA 3BUNB 1LA0A 2E30A 4I5NB 2F8PA 2KI4B 3WHTB 4XJKB 2IS9A 1KFUL 1PVAA 1LVCD 4MSPA 1K96A 2LANA 2JULA 1KWOB 1N0YA 3CS1A 4PE4A 4GGNA 2Q91A 3AAJA 1IWQA 1DVIA 1PRWA 1U5IA 1U5IB 1AK8A 1WLZA 1CDNA 2O5GA 1TNXA 4XYNA 2M9GA 1N65A 3QRXA 4I5LB 2BBNA 1C07A 1YTZC 2LHIA 2MA2A 2OS8B 3PLFB 2LMVA 5AERA 2ZN9A 1S6IA 5CSNA 1BLQA 1NX2A 4PE1A 4OCIA 3NSIA 3KF9A 1BMOA 1XVJA 2PMYA 5HKWA 1QX2A 2MLEC 5J3XA 5I2QA 1QIWA 1SKTA 1ZUZA 1S1EA 2BKHB 1UUSA 2WC8A 3BUOB 3CLNA 2K61A 2LAPA 3SIBA 2MLFC 1IGVA 2RGIA 4OR9B 3JVTC 4MZJA 1HT9A 1RFJA 1MQ1A 5DKRA 2R2IA 3VRNA 1K2HA 2LUXA 2COLB 1SBJA 3JTDC 5JJGA 4N1GA 3AKAA 1TN4A 4P5OE 1XFXO 3PATA 1C7VA 2K7OA 1CMGA 5CSIA 4PALA 5HKZA 2L4HA 1TTXA 4DRWA 3M0WA 4ICBA 1AJ5A 3A4UB 1V1FA 3DVMA 4HRGA 4QJ4B 4ZCVA 4AQJA 1XFZO 2LP3A 1CLMA 5AXIA 1PULA 1UHIA 1SR6C 2NXQA 1RWYA 1GGZA 1M39A 2L0PA 3TUYC 2KBMA 1UHKA 3ICBA 1F54A 4JWQA 1SL8A 1B7TY 3FWCA 2F2OA 2WOSA 2JC2A 1J7RA 2KAXA 1SRAA 1R2UA 2KGRA 3OX6A 3CWGA 1F55A 1KK7Y 1K94A 4I5JA 3LCPC 4MVFA 3TDIA 5ER4X 1DF0A 1XO5A 2OPOA 1XFWO 2A4JA 1TCFA 4WQ2A 1UHJA 4DCKA 1YUTA 3CGAA 5HKYA 1SL7A 2ZNEA 3PSRA 5I8NA 2OTGC 1CM4A 3O6BA 3BXKA 1E8AA 4PHNA 1DTLA 1F71A 3D0YB 1L7ZA 3AAKA 3A8RA 3KPXA 4WQ3A 4PHJA 4HSZA 1CB1A 4OKHA 1BF5A 3CR2A 4NDBA 2I2RE 3SG5A 1BOCA 1PSBA 3DVJA 5I2LA 5DKQA 3E3RA 2JXCA 1KQMB 4CLNA 1A75A 1F4QA 1MHOA 1DJGA 1F8HA 2KBIA 2LVJA 3JVTB 3LK0A 1BODA 1EJ3A 2F3YA 3C1VA 4F0ZB 2KFFA 1JFKA 1J1DA 2PALA 3GK4X 1MUXA 1KK8C 1G4YR 2BL0C 1MXEA 4A4BA 1GQMA 4TNCA 3GK1A 3CR5X 3BOWA 1QX5B 3PALA 1YRTB 1K9UA 1TIZA 3LLEA 1JWDA 2K7BA 2PVBA 2Y4QA 2E6WA 3NSLA 2LLTA 3FS7A 1YRUB 4AOMA 4N5XA 4L9MA 4NDCA 4A4CA 1IJ5A 1OQPA 2ZN8A 2G2BA 2CCMA 3I5HC 1KSMA 3K21A 3KHEA 3PFVA 4Q04A 1KQMC 4XJKA 5AANA 1J55A 5K89A 4DUQA 1IKUA 2D8NA 2VRGA 3WHUB 3TUYB 1FW4A 2MJWB 2K2FA 1NWDA 2K0JA 1KWOC 1R6PA 1M45A 1S5GY 1OMDA 4U8DA 3FIAA 3VRRA 1KFUS 1TNWA 1B9AA 2LVKA 4FQOA 2BL0B 1XK4A 3I5GB 3HX4A 1AP4A 3RLZA 2KYCA 4MLWA 1L2OC 2KAYA 2WCEA 1NP8A 1CFCA 1D1OA 1K9PA 4MEWA 1YX8A 1MWNA 2KI6C 4QJ3B 2LMUA 4E68A 4WRIA 4PCWA 1S3PA 1UHNA 2WCBA 4CPVA 2BECA 3SG3A 1LXFC 3EKHA 4ZCUA 1CFPA 2NZ0A 3BOWB 5GQQC 2CT9A 3EK4A 3TDUA 3EK7A 2CXJA 1RROA 1IRJA 1NSHA 2O60A 4YGEB 1ODBA 1QVIZ 3BQ3A 1B8RA 3TS5C 1A03A 3IQOA 2Y1MA 3NSKA 2WORA 4MZKA 1YX7A 3OB1B 1IQ5A 1NX3A 2BKIB 3GK2A 1SW8A 3RM1A 1MR8A 3EVVA 3LL8B 4IL1A 2LC5A 4PE0A 2LVIA 1DMOA 1J1EA 1LKJA 3D0YA 3DD4A 4OVNF 1K95A 1XFUO 2BCBA 3OX5A 3WNXB 5I2OA 1J7QA 1JF2A 1PK0D 1XFVO 5HLVA 1AUIB 1G8IA 2L5XB 2LVVA 1Q80A 5G08A 2JWWA 1NX1A 1M63B 3BUMB 2AMIA 4DIRA 4JPZB 4YGDB 1Y6WA 4M2QA 1TRFA 4D1EA 1B8CA 1ALVA 1F4OA 1BJFA 1EG3A 1RJVA 4GBAA 1KQVA 2M7NA 4GPLB 2HPSA 2PRUA 2BE4A 4MRYA 3I5IC 2MHHA 3CR4X 1AVSA 1S6JA 4JQ0D 1Y1AA 1B7TZ 3SG6A 1QJTA 1V1GA 2K2AA 4ORAB 1UURA 1SR6B 1EG4A 2H2KA 3EKJA 2JNFA 1DT7B 1UWOA 3I5HB 1EL4A 2LHLA 2LV7A 2KQYA 1A4PA 2KHNA 4GGFA 1DJXA 5TNCA 1DGUA 1TOPA 1KFXS 5JOLA 3TZ1A 2I7AA 3AKBA 3FWBA 1WDCB 2Q4UA 3VROA 4CIDA 1JBAA 1PSRA 1XK4C 4ETOA 1NCZA 2BCAA 2P6BB 2MRDA 1W7IB 2I18A 3EVRA 2EHBA 1CFFA 1SYMA 5D69A 1Y1UA 2JPTA 3IF7A 2M1KB 3PN7B 2OTGB 1WRKA 3MSEB 1WLMA 1YURA 1LA3A 1CLBA 1CKKA 1DGVA 2BCXA 2EC6C 5CSJA 5B8IB 1S26D 1JC2A 1BR1B 2M3WA 1LINA 2ZRSA 4GFTA 4HREE 2JT3A 2FCDA 5KTYA 1BG1A 4QJ5B 2AUCA 1BT6A 1ZOTB 4M2OA 2PASA 2M0RA 1FBVA 3I5GC 1NUBA 1QIVA 2L2EA 1ALWA 1SY9A 2KAVA 3VRPA 3O2PA 1YVLA 2LUCA 3D10A 1CDPA 3OHMB 5BPJA 1CNPA 1ZMZA 2QPTA 2I94A 1CDLA 2M97A 3BUWB 2GGZA 1OSAA 1QASA 2HQWA 4MRXA 4OV2A 1OE9B 4UPGA 1GGWA 1SCVA 3SG2A 3H4SE 1SMGA 3TS5B 1TNQA 1AHRA 2MBXA 4AQIA 1K93D 2M1UA 2LCPA 3SJSA 4GAOA 1B8LA 1S36A 2LLSA 2F2PA 2DOQA 1A75B 3PM8A 5AEQA 2KOTA 1A2XA 1OMVA 2H61C 3KEVA 1K90D 1QV0A 4N1FA 1TNPA 2JU0A 1QS7A 1FF1A 2LP2A 1OZSA 2TN4A 1QLSA 4YGAA 1L2OB 1K8UA 1J7OA 1RTP1 1K9KA 5AFPA 2CTNA 1QX7A 1SK6D 1YVHA 4ORCB 3WXAA 1ZACA 2L51A 2WNDA 4PDZA 2LNKA 3PN7C 2KGBC 1M46A 2EC6B 4YBHB 1YUSA 4FTGA 3SG4A 2G9BA 2K8MB 1KSOA 2K7CA 3CZTX 3KO0A 1XYDA 5FYXA 2GGMA 1YR5A 2MAZA 1IG5A 1IJ6A 1AJ4A 3ZWHA 2LM5A 3BYAA 3DF0B 2CBLA 1TCOB 2NCPA 1QXPA 1JF0A 3HCMA 1JFJA 2GV5A 1NCYA 1CFDA 4P2YB 5KSZA 4NQGA 1ZFSA 2KFHA 2JT0A 1GJYA 3F45A 1WRZA 3SIAA 1VRKA 5PALA 2NCOA 4YGCB 1S6CA 2JZIA 1N2DA 1J7PA 3NSOA 3I5IB 2HQ8A 1CLLA 5DKNA 5HYDA 3VGOA 1X02A 4PHMA 1DJYA 1S5GZ 4YI9A 5HLOA 1F70A 4HRHA 1IQ3A 2FOTA 2L4IA 3I5FB 1NCXA 2PSRA 2LMTA 2CNPA 2KFGA 2NLNA 2WCFA 1PVBA 2KYFA 3O78A 1H8BA 4YI8A 3JTDB 4PE7A 1G33A 2KSPA 4BY4A 1IH0A 2K7DA 2M29A 2F3ZA 2HETA 1WY9A 1JUOA 2OS8C 1WDCC 3LK1A 2JNXA 1B47A 1NIWA 1MF8B 2KI6D 1KFXL 1OMRA 1RK9A 4GGFC 1FPWA 1KCYA 1M31A 1YUUA 1CMFA 1Y0VH 1HQVA 1MXLC 1SCMB 2ZNDA 3TDZA 1CM1A 3EVUA 4C0LA 3OP0A 4PHKA 2ZRTA 3IQQA 3ZNIA 1RECA 5F6TA 5KU1A 1DJHA 1QLKA 2M49B 4CFQA 1DF0B 3I5FC 1DJIA 2SCPA 5D7FA 3VRQA 3BUXB 3EK8A 3OB2B 2L98A 1DJZA 2EGDA 3SG7A 1Y1XA 3NXAA 2AAOA 4DS7A 1B1GA 2JOJA 4CFRA 2QACA 1EH2A 1SPYA 4R1EA 4MN0A 2Y1NA 2ISDA 3O4YA 2JQ6A 1JSAA 1QATA 1OZOA 1QTXA 1QV1A 4M2PA 4USLA 1OOJA 2B1UA 1KK7Z 5ER5A 5IBWA 1UHHA 1SCMC 4YGBB 4I5KA 1DJWA 4YRUA 1BU3A 2ZKMX 4MZLA 1B4CA 2BBMA 2L50A 3GOFA 1XA5A 1XFYO 1NX0A 4GNKB 3DVKA 2FCEA 1SL9A 2LLUA 4C0KA 1CTRA 2H61A 2KI4C 2LE9B 1A29A 1BR4B 1CDMA 2BE6A 2JRFA 2JT8A 2SASA 4MBEA 4C0JA 1FI6A 1SNLA 4ORBB 5CPVA 2FJUB 5CSFA 4GUKA 1UP5A 2HF5A 2KQ6A 2JTZA 1QVIY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JTT A;  1KK8 B;  1W7J B;  1NPQ A;  3DVE A;  4BY5 A;  1H4B A;  2F33 A;  4NDD A;  2Y5I A;  1NYA A;  2V53 A;  1FI5 A;  1C7W A;  2M7L A;  1WRL A;  2KDH A;  1PAL A;  3CTN A;  3DF0 A;  2ZFD A;  1EXR A;  2JXL A;  2M8U A;  2KNE A;  3BUN B;  1LA0 A;  2E30 A;  4I5N B;  2F8P A;  2KI4 B;  3WHT B;  4XJK B;  2IS9 A;  1KFU L;  1PVA A;  1LVC D;  4MSP A;  1K96 A;  2LAN A;  2JUL A;  1KWO B;  1N0Y A;  3CS1 A;  4PE4 A;  4GGN A;  2Q91 A;  3AAJ A;  1IWQ A;  1DVI A;  1PRW A;  1U5I A;  1U5I B;  1AK8 A;  1WLZ A;  1CDN A;  2O5G A;  1TNX A;  4XYN A;  2M9G A;  1N65 A;  3QRX A;  4I5L B;  2BBN A;  1C07 A;  1YTZ C;  2LHI A;  2MA2 A;  2OS8 B;  3PLF B;  2LMV A;  5AER A;  2ZN9 A;  1S6I A;  5CSN A;  1BLQ A;  1NX2 A;  4PE1 A;  4OCI A;  3NSI A;  3KF9 A;  1BMO A;  1XVJ A;  2PMY A;  5HKW A;  1QX2 A;  2MLE C;  5J3X A;  5I2Q A;  1QIW A;  1SKT A;  1ZUZ A;  1S1E A;  2BKH B;  1UUS A;  2WC8 A;  3BUO B;  3CLN A;  2K61 A;  2LAP A;  3SIB A;  2MLF C;  1IGV A;  2RGI A;  4OR9 B;  3JVT C;  4MZJ A;  1HT9 A;  1RFJ A;  1MQ1 A;  5DKR A;  2R2I A;  3VRN A;  1K2H A;  2LUX A;  2COL B;  1SBJ A;  3JTD C;  5JJG A;  4N1G A;  3AKA A;  1TN4 A;  4P5O E;  1XFX O;  3PAT A;  1C7V A;  2K7O A;  1CMG A;  5CSI A;  4PAL A;  5HKZ A;  2L4H A;  1TTX A;  4DRW A;  3M0W A;  4ICB A;  1AJ5 A;  3A4U B;  1V1F A;  3DVM A;  4HRG A;  4QJ4 B;  4ZCV A;  4AQJ A;  1XFZ O;  2LP3 A;  1CLM A;  5AXI A;  1PUL A;  1UHI A;  1SR6 C;  2NXQ A;  1RWY A;  1GGZ A;  1M39 A;  2L0P A;  3TUY C;  2KBM A;  1UHK A;  3ICB A;  1F54 A;  4JWQ A;  1SL8 A;  1B7T Y;  3FWC A;  2F2O A;  2WOS A;  2JC2 A;  1J7R A;  2KAX A;  1SRA A;  1R2U A;  2KGR A;  3OX6 A;  3CWG A;  1F55 A;  1KK7 Y;  1K94 A;  4I5J A;  3LCP C;  4MVF A;  3TDI A;  5ER4 X;  1DF0 A;  1XO5 A;  2OPO A;  1XFW O;  2A4J A;  1TCF A;  4WQ2 A;  1UHJ A;  4DCK A;  1YUT A;  3CGA A;  5HKY A;  1SL7 A;  2ZNE A;  3PSR A;  5I8N A;  2OTG C;  1CM4 A;  3O6B A;  3BXK A;  1E8A A;  4PHN A;  1DTL A;  1F71 A;  3D0Y B;  1L7Z A;  3AAK A;  3A8R A;  3KPX A;  4WQ3 A;  4PHJ A;  4HSZ A;  1CB1 A;  4OKH A;  1BF5 A;  3CR2 A;  4NDB A;  2I2R E;  3SG5 A;  1BOC A;  1PSB A;  3DVJ A;  5I2L A;  5DKQ A;  3E3R A;  2JXC A;  1KQM B;  4CLN A;  1A75 A;  1F4Q A;  1MHO A;  1DJG A;  1F8H A;  2KBI A;  2LVJ A;  3JVT B;  3LK0 A;  1BOD A;  1EJ3 A;  2F3Y A;  3C1V A;  4F0Z B;  2KFF A;  1JFK A;  1J1D A;  2PAL A;  3GK4 X;  1MUX A;  1KK8 C;  1G4Y R;  2BL0 C;  1MXE A;  4A4B A;  1GQM A;  4TNC A;  3GK1 A;  3CR5 X;  3BOW A;  1QX5 B;  3PAL A;  1YRT B;  1K9U A;  1TIZ A;  3LLE A;  1JWD A;  2K7B A;  2PVB A;  2Y4Q A;  2E6W A;  3NSL A;  2LLT A;  3FS7 A;  1YRU B;  4AOM A;  4N5X A;  4L9M A;  4NDC A;  4A4C A;  1IJ5 A;  1OQP A;  2ZN8 A;  2G2B A;  2CCM A;  3I5H C;  1KSM A;  3K21 A;  3KHE A;  3PFV A;  4Q04 A;  1KQM C;  4XJK A;  5AAN A;  1J55 A;  5K89 A;  4DUQ A;  1IKU A;  2D8N A;  2VRG A;  3WHU B;  3TUY B;  1FW4 A;  2MJW B;  2K2F A;  1NWD A;  2K0J A;  1KWO C;  1R6P A;  1M45 A;  1S5G Y;  1OMD A;  4U8D A;  3FIA A;  3VRR A;  1KFU S;  1TNW A;  1B9A A;  2LVK A;  4FQO A;  2BL0 B;  1XK4 A;  3I5G B;  3HX4 A;  1AP4 A;  3RLZ A;  2KYC A;  4MLW A;  1L2O C;  2KAY A;  2WCE A;  1NP8 A;  1CFC A;  1D1O A;  1K9P A;  4MEW A;  1YX8 A;  1MWN A;  2KI6 C;  4QJ3 B;  2LMU A;  4E68 A;  4WRI A;  4PCW A;  1S3P A;  1UHN A;  2WCB A;  4CPV A;  2BEC A;  3SG3 A;  1LXF C;  3EKH A;  4ZCU A;  1CFP A;  2NZ0 A;  3BOW B;  5GQQ C;  2CT9 A;  3EK4 A;  3TDU A;  3EK7 A;  2CXJ A;  1RRO A;  1IRJ A;  1NSH A;  2O60 A;  4YGE B;  1ODB A;  1QVI Z;  3BQ3 A;  1B8R A;  3TS5 C;  1A03 A;  3IQO A;  2Y1M A;  3NSK A;  2WOR A;  4MZK A;  1YX7 A;  3OB1 B;  1IQ5 A;  1NX3 A;  2BKI B;  3GK2 A;  1SW8 A;  3RM1 A;  1MR8 A;  3EVV A;  3LL8 B;  4IL1 A;  2LC5 A;  4PE0 A;  2LVI A;  1DMO A;  1J1E A;  1LKJ A;  3D0Y A;  3DD4 A;  4OVN F;  1K95 A;  1XFU O;  2BCB A;  3OX5 A;  3WNX B;  5I2O A;  1J7Q A;  1JF2 A;  1PK0 D;  1XFV O;  5HLV A;  1AUI B;  1G8I A;  2L5X B;  2LVV A;  1Q80 A;  5G08 A;  2JWW A;  1NX1 A;  1M63 B;  3BUM B;  2AMI A;  4DIR A;  4JPZ B;  4YGD B;  1Y6W A;  4M2Q A;  1TRF A;  4D1E A;  1B8C A;  1ALV A;  1F4O A;  1BJF A;  1EG3 A;  1RJV A;  4GBA A;  1KQV A;  2M7N A;  4GPL B;  2HPS A;  2PRU A;  2BE4 A;  4MRY A;  3I5I C;  2MHH A;  3CR4 X;  1AVS A;  1S6J A;  4JQ0 D;  1Y1A A;  1B7T Z;  3SG6 A;  1QJT A;  1V1G A;  2K2A A;  4ORA B;  1UUR A;  1SR6 B;  1EG4 A;  2H2K A;  3EKJ A;  2JNF A;  1DT7 B;  1UWO A;  3I5H B;  1EL4 A;  2LHL A;  2LV7 A;  2KQY A;  1A4P A;  2KHN A;  4GGF A;  1DJX A;  5TNC A;  1DGU A;  1TOP A;  1KFX S;  5JOL A;  3TZ1 A;  2I7A A;  3AKB A;  3FWB A;  1WDC B;  2Q4U A;  3VRO A;  4CID A;  1JBA A;  1PSR A;  1XK4 C;  4ETO A;  1NCZ A;  2BCA A;  2P6B B;  2MRD A;  1W7I B;  2I18 A;  3EVR A;  2EHB A;  1CFF A;  1SYM A;  5D69 A;  1Y1U A;  2JPT A;  3IF7 A;  2M1K B;  3PN7 B;  2OTG B;  1WRK A;  3MSE B;  1WLM A;  1YUR A;  1LA3 A;  1CLB A;  1CKK A;  1DGV A;  2BCX A;  2EC6 C;  5CSJ A;  5B8I B;  1S26 D;  1JC2 A;  1BR1 B;  2M3W A;  1LIN A;  2ZRS A;  4GFT A;  4HRE E;  2JT3 A;  2FCD A;  5KTY A;  1BG1 A;  4QJ5 B;  2AUC A;  1BT6 A;  1ZOT B;  4M2O A;  2PAS A;  2M0R A;  1FBV A;  3I5G C;  1NUB A;  1QIV A;  2L2E A;  1ALW A;  1SY9 A;  2KAV A;  3VRP A;  3O2P A;  1YVL A;  2LUC A;  3D10 A;  1CDP A;  3OHM B;  5BPJ A;  1CNP A;  1ZMZ A;  2QPT A;  2I94 A;  1CDL A;  2M97 A;  3BUW B;  2GGZ A;  1OSA A;  1QAS A;  2HQW A;  4MRX A;  4OV2 A;  1OE9 B;  4UPG A;  1GGW A;  1SCV A;  3SG2 A;  3H4S E;  1SMG A;  3TS5 B;  1TNQ A;  1AHR A;  2MBX A;  4AQI A;  1K93 D;  2M1U A;  2LCP A;  3SJS A;  4GAO A;  1B8L A;  1S36 A;  2LLS A;  2F2P A;  2DOQ A;  1A75 B;  3PM8 A;  5AEQ A;  2KOT A;  1A2X A;  1OMV A;  2H61 C;  3KEV A;  1K90 D;  1QV0 A;  4N1F A;  1TNP A;  2JU0 A;  1QS7 A;  1FF1 A;  2LP2 A;  1OZS A;  2TN4 A;  1QLS A;  4YGA A;  1L2O B;  1K8U A;  1J7O A;  1RTP 1;  1K9K A;  5AFP A;  2CTN A;  1QX7 A;  1SK6 D;  1YVH A;  4ORC B;  3WXA A;  1ZAC A;  2L51 A;  2WND A;  4PDZ A;  2LNK A;  3PN7 C;  2KGB C;  1M46 A;  2EC6 B;  4YBH B;  1YUS A;  4FTG A;  3SG4 A;  2G9B A;  2K8M B;  1KSO A;  2K7C A;  3CZT X;  3KO0 A;  1XYD A;  5FYX A;  2GGM A;  1YR5 A;  2MAZ A;  1IG5 A;  1IJ6 A;  1AJ4 A;  3ZWH A;  2LM5 A;  3BYA A;  3DF0 B;  2CBL A;  1TCO B;  2NCP A;  1QXP A;  1JF0 A;  3HCM A;  1JFJ A;  2GV5 A;  1NCY A;  1CFD A;  4P2Y B;  5KSZ A;  4NQG A;  1ZFS A;  2KFH A;  2JT0 A;  1GJY A;  3F45 A;  1WRZ A;  3SIA A;  1VRK A;  5PAL A;  2NCO A;  4YGC B;  1S6C A;  2JZI A;  1N2D A;  1J7P A;  3NSO A;  3I5I B;  2HQ8 A;  1CLL A;  5DKN A;  5HYD A;  3VGO A;  1X02 A;  4PHM A;  1DJY A;  1S5G Z;  4YI9 A;  5HLO A;  1F70 A;  4HRH A;  1IQ3 A;  2FOT A;  2L4I A;  3I5F B;  1NCX A;  2PSR A;  2LMT A;  2CNP A;  2KFG A;  2NLN A;  2WCF A;  1PVB A;  2KYF A;  3O78 A;  1H8B A;  4YI8 A;  3JTD B;  4PE7 A;  1G33 A;  2KSP A;  4BY4 A;  1IH0 A;  2K7D A;  2M29 A;  2F3Z A;  2HET A;  1WY9 A;  1JUO A;  2OS8 C;  1WDC C;  3LK1 A;  2JNX A;  1B47 A;  1NIW A;  1MF8 B;  2KI6 D;  1KFX L;  1OMR A;  1RK9 A;  4GGF C;  1FPW A;  1KCY A;  1M31 A;  1YUU A;  1CMF A;  1Y0V H;  1HQV A;  1MXL C;  1SCM B;  2ZND A;  3TDZ A;  1CM1 A;  3EVU A;  4C0L A;  3OP0 A;  4PHK A;  2ZRT A;  3IQQ A;  3ZNI A;  1REC A;  5F6T A;  5KU1 A;  1DJH A;  1QLK A;  2M49 B;  4CFQ A;  1DF0 B;  3I5F C;  1DJI A;  2SCP A;  5D7F A;  3VRQ A;  3BUX B;  3EK8 A;  3OB2 B;  2L98 A;  1DJZ A;  2EGD A;  3SG7 A;  1Y1X A;  3NXA A;  2AAO A;  4DS7 A;  1B1G A;  2JOJ A;  4CFR A;  2QAC A;  1EH2 A;  1SPY A;  4R1E A;  4MN0 A;  2Y1N A;  2ISD A;  3O4Y A;  2JQ6 A;  1JSA A;  1QAT A;  1OZO A;  1QTX A;  1QV1 A;  4M2P A;  4USL A;  1OOJ A;  2B1U A;  1KK7 Z;  5ER5 A;  5IBW A;  1UHH A;  1SCM C;  4YGB B;  4I5K A;  1DJW A;  4YRU A;  1BU3 A;  2ZKM X;  4MZL A;  1B4C A;  2BBM A;  2L50 A;  3GOF A;  1XA5 A;  1XFY O;  1NX0 A;  4GNK B;  3DVK A;  2FCE A;  1SL9 A;  2LLU A;  4C0K A;  1CTR A;  2H61 A;  2KI4 C;  2LE9 B;  1A29 A;  1BR4 B;  1CDM A;  2BE6 A;  2JRF A;  2JT8 A;  2SAS A;  4MBE A;  4C0J A;  1FI6 A;  1SNL A;  4ORB B;  5CPV A;  2FJU B;  5CSF A;  4GUK A;  1UP5 A;  2HF5 A;  2KQ6 A;  2JTZ A;  1QVI Y; 
#chains in the Genus database with same CATH topology
 2JTT A;  4JD9 A;  1KK8 B;  1W7J B;  1NPQ A;  3DVE A;  4BY5 A;  1H4B A;  5I94 A;  2F33 A;  4NDD A;  2WC6 A;  2Y5I A;  1NYA A;  1Z2C B;  2V53 A;  1FI5 A;  1C7W A;  2BAP A;  2M7L A;  1WRL A;  2KDH A;  1PAL A;  3CTN A;  3DF0 A;  1TUJ A;  2ZFD A;  3R1O A;  1EXR A;  2JXL A;  2M8U A;  2KNE A;  3BUN B;  3V2L A;  1LA0 A;  2E30 A;  4I5N B;  2F8P A;  2KI4 B;  3WHT B;  3EG5 B;  4XJK B;  2IS9 A;  1KFU L;  1PVA A;  3S0E A;  1LVC D;  4MSP A;  1K96 A;  2LAN A;  2JUL A;  1KWO B;  1N0Y A;  3CS1 A;  4PE4 A;  4GGN A;  2Q91 A;  3AAJ A;  1IWQ A;  1DVI A;  1PRW A;  1U5I A;  1U5I B;  1AK8 A;  1WLZ A;  1CDN A;  2O5G A;  1TNX A;  4XYN A;  2M9G A;  3S0G A;  1N65 A;  3QRX A;  3DXL A;  4I5L B;  2BBN A;  2QEB A;  1C07 A;  1YTZ C;  2LHI A;  2MA2 A;  2OS8 B;  3PLF B;  2LMV A;  5AER A;  2ZN9 A;  1S6I A;  2KPH A;  5CSN A;  1BLQ A;  1NX2 A;  4PE1 A;  4OCI A;  3NSI A;  3KF9 A;  1BMO A;  1XVJ A;  3BJH A;  2PMY A;  5HKW A;  1QX2 A;  2MLE C;  3B88 A;  5J3X A;  5I2Q A;  1QIW A;  1SKT A;  1ZUZ A;  1S1E A;  1TUZ A;  1UUS A;  2BKH B;  2WC8 A;  3BUO B;  3CLN A;  3UO9 A;  2K61 A;  2LAP A;  3SIB A;  2MLF C;  1IGV A;  2RGI A;  4OR9 B;  3JVT C;  4MZJ A;  3R1V A;  1HT9 A;  3FE6 A;  1RFJ A;  1MQ1 A;  5DKR A;  2H8V A;  2R2I A;  3BFH A;  3BFA A;  4INX A;  3VRN A;  1K2H A;  3L47 A;  4INW A;  2LUX A;  2COL B;  1SBJ A;  3JTD C;  5JJG A;  3Q8I A;  4N1G A;  3AKA A;  1TN4 A;  4P5O E;  1XFX O;  3PAT A;  1C7V A;  2K7O A;  1CMG A;  2WCM A;  5CSI A;  1DEL A;  4PAL A;  5HKZ A;  2L4H A;  1TTX A;  4DRW A;  3M0W A;  4ICB A;  1AJ5 A;  3A4U B;  1V1F A;  5HL1 A;  3DVM A;  4HRG A;  4QJ4 B;  4ZCV A;  4AQJ A;  1XFZ O;  2LP3 A;  1CLM A;  5AXI A;  1PUL A;  1UHI A;  1SR6 C;  2NXQ A;  1RWY A;  1GGZ A;  1M39 A;  1OOH A;  2L0P A;  3D75 A;  3TUY C;  2KBM A;  5FI6 A;  2WCL A;  1UHK A;  2WCK A;  3ICB A;  1F54 A;  4JWQ A;  1SL8 A;  1B7T Y;  1OOI X;  3DYE A;  3FWC A;  4PT1 A;  2F2O A;  2WOS A;  2JC2 A;  1J7R A;  2KAX A;  1SRA A;  1R2U A;  2KGR A;  2JPO A;  3OX6 A;  3CWG A;  1F55 A;  1KK7 Y;  1K94 A;  1OOG A;  4I5J A;  3LCP C;  4MVF A;  3TDI A;  5ER4 X;  1DF0 A;  1XO5 A;  2OPO A;  1XFW O;  2WCH A;  1LS8 A;  2A4J A;  1TCF A;  4WQ2 A;  1UHJ A;  4DCK A;  1YUT A;  3CGA A;  5EL2 A;  1SL7 A;  2ZNE A;  3PSR A;  5HKY A;  5I8N A;  2OTG C;  1CM4 A;  3O6B A;  3BXK A;  1E8A A;  4PHN A;  5FI7 A;  1DTL A;  1F71 A;  3D0Y B;  1L7Z A;  3AAK A;  3A8R A;  3KPX A;  4WQ3 A;  4PHJ A;  4HSZ A;  1CB1 A;  4OKH A;  1BF5 A;  3CR2 A;  1QWV A;  4NDB A;  2I2R E;  2QEH A;  3OBV A;  3SG5 A;  1BOC A;  1PSB A;  3DVJ A;  5I2L A;  5DKQ A;  3E3R A;  2JXC A;  1KQM B;  4CLN A;  1A75 A;  1F4Q A;  3RZS A;  1MHO A;  1DJG A;  1F8H A;  2KBI A;  1W9Z A;  2LVJ A;  3JVT B;  3LK0 A;  1BOD A;  1EJ3 A;  2F3Y A;  3C1V A;  4F0Z B;  2KFF A;  1JFK A;  1J1D A;  2PAL A;  3GK4 X;  1MUX A;  1KK8 C;  1G4Y R;  2BL0 C;  1MXE A;  3BFB A;  4A4B A;  1GQM A;  4TNC A;  3GK1 A;  3CR5 X;  1XFR A;  3BOW A;  1QX5 B;  3PAL A;  1YRT B;  1K9U A;  1TIZ A;  3LLE A;  1JWD A;  2K7B A;  2PVB A;  2Y4Q A;  5FI2 A;  2E6W A;  3NHT A;  3NSL A;  2LLT A;  3FS7 A;  1YRU B;  4AOM A;  4N5X A;  4L9M A;  4NDC A;  4A4C A;  1IJ5 A;  1OQP A;  2ZN8 A;  2G2B A;  2CCM A;  3FE8 A;  1KSM A;  3I5H C;  3K21 A;  3KHE A;  3PFV A;  1KQM C;  4Q04 A;  4XJK A;  5AAN A;  1J55 A;  5K89 A;  4DUQ A;  1IKU A;  2D8N A;  2VRG A;  3WHU B;  3TUY B;  1FW4 A;  1DEK A;  2MJW B;  2ERB A;  2K2F A;  1NWD A;  2K0J A;  1KWO C;  1R6P A;  1M45 A;  1S5G Y;  1OMD A;  4U8D A;  3FIA A;  3VRR A;  1KFU S;  1TNW A;  1B9A A;  2LVK A;  3CZ1 A;  3D78 A;  2BL0 B;  1XK4 A;  4FQO A;  3I5G B;  3HX4 A;  1AP4 A;  3RLZ A;  2KYC A;  4MLW A;  1L2O C;  2KAY A;  2WCE A;  1NP8 A;  1CFC A;  2KLD A;  1D1O A;  1K9P A;  4MEW A;  3N7H A;  1YX8 A;  1MWN A;  2KI6 C;  4QJ3 B;  3S0B A;  2LMU A;  4E68 A;  4WRI A;  4PCW A;  1S3P A;  1UHN A;  2WCB A;  4CPV A;  2BEC A;  3SG3 A;  3VB1 A;  1LXF C;  3EKH A;  4ZCU A;  1CFP A;  2NZ0 A;  3BOW B;  5GQQ C;  2CT9 A;  3EK4 A;  3TDU A;  3EK7 A;  2CXJ A;  1RRO A;  1T14 A;  1IRJ A;  1NSH A;  2O60 A;  1ODB A;  2QDI A;  4YGE B;  3R72 A;  1QVI Z;  3BQ3 A;  1B8R A;  3TS5 C;  1A03 A;  3IQO A;  2Y1M A;  3NSK A;  2WOR A;  4MZK A;  1YX7 A;  3OB1 B;  1IQ5 A;  1NX3 A;  2BKI B;  4IJ7 A;  3GK2 A;  1SW8 A;  3RM1 A;  1MR8 A;  3EVV A;  3LL8 B;  2PYQ A;  4IL1 A;  2LC5 A;  4PE0 A;  2LVI A;  1DMO A;  1J1E A;  1LKJ A;  3D0Y A;  3DD4 A;  4OVN F;  1K95 A;  1XFU O;  2BCB A;  3B86 A;  3OX5 A;  3WNX B;  5I2O A;  1J7Q A;  1JF2 A;  1PK0 D;  1XFV O;  4F7F A;  5HLV A;  1AUI B;  1G8I A;  2L5X B;  2LVV A;  1Q80 A;  5G08 A;  2JWW A;  1NX1 A;  1M63 B;  3BUM B;  2AMI A;  4DIR A;  4JPZ B;  4YGD B;  1Y6W A;  4M2Q A;  1TRF A;  4D1E A;  1B8C A;  1ALV A;  1F4O A;  1BJF A;  3S0D A;  1EG3 A;  1RJV A;  1Z4H A;  2P70 A;  4GBA A;  1KQV A;  2M7N A;  3FE9 A;  4GPL B;  2HPS A;  2PRU A;  2BE4 A;  4MRY A;  3I5I C;  2MHH A;  3CR4 X;  1AVS A;  1S6J A;  4JQ0 D;  1Y1A A;  1B7T Z;  3SG6 A;  1QJT A;  1V1G A;  2K2A A;  4ORA B;  1UUR A;  1SR6 B;  1EG4 A;  2H2K A;  3EKJ A;  2JNF A;  2K60 A;  1DT7 B;  1UWO A;  3I5H B;  1EL4 A;  2LHL A;  2LV7 A;  2KQY A;  1A4P A;  2KHN A;  3D77 A;  3K1E A;  4GGF A;  1DJX A;  5TNC A;  1DGU A;  1TOP A;  1ORG A;  1KFX S;  3OGN A;  5JOL A;  3TZ1 A;  2I7A A;  3AKB A;  3FWB A;  1WDC B;  2Q4U A;  3VRO A;  4CID A;  1JBA A;  1PSR A;  1XK4 C;  2PQL A;  4ETO A;  2YGU A;  1NCZ A;  2BCA A;  2P6B B;  2MRD A;  2KLE A;  1W7I B;  2I18 A;  3EVR A;  2EHB A;  1CFF A;  1SYM A;  1IIO A;  5D69 A;  1Y1U A;  2JPT A;  3IF7 A;  2M1K B;  3CYZ A;  3PN7 B;  2OTG B;  1WRK A;  3MSE B;  1WLM A;  1YUR A;  1LA3 A;  1C3Z A;  1CLB A;  1CKK A;  1DGV A;  2BCX A;  2EC6 C;  3B6X A;  5CSJ A;  5B8I B;  1S26 D;  1JC2 A;  1BR1 B;  2M3W A;  3CZ0 A;  1LIN A;  2ZRS A;  4GFT A;  4HRE E;  2JT3 A;  2FCD A;  5KTY A;  1BG1 A;  4QJ5 B;  2AUC A;  1BT6 A;  1ZOT B;  4M2O A;  2PAS A;  2M0R A;  1FBV A;  3I5G C;  1NUB A;  1QIV A;  2L2E A;  1ALW A;  1SY9 A;  2KAV A;  3VRP A;  3O2P A;  1YVL A;  2LUC A;  3D10 A;  1CDP A;  3OHM B;  5BPJ A;  1CNP A;  1ZMZ A;  2QPT A;  3DY9 A;  2I94 A;  1CDL A;  2M97 A;  3SS5 A;  3BUW B;  2GGZ A;  1OSA A;  1QAS A;  2HQW A;  4MRX A;  4OV2 A;  1OE9 B;  4UPG A;  1GGW A;  1SCV A;  3NHI A;  5D3O A;  3SG2 A;  1SSE B;  3H4S E;  1SMG A;  3TS5 B;  1TNQ A;  2BNX A;  1AHR A;  2MBX A;  4AQI A;  1K93 D;  2M1U A;  2LCP A;  3D74 A;  2QEV A;  3PJI A;  4JKT A;  3SJS A;  3S0F A;  4GAO A;  4FQT A;  1B8L A;  1S36 A;  2LLS A;  2F2P A;  2P71 A;  3R1P A;  2DOQ A;  1A75 B;  3O4X A;  3PM8 A;  5AEQ A;  2KOT A;  1A2X A;  1OMV A;  1OW4 A;  2H61 C;  1K90 D;  1QV0 A;  3B7A A;  3KEV A;  3DZT A;  1TNP A;  2JU0 A;  4N1F A;  1QS7 A;  3S0A A;  1FF1 A;  2LP2 A;  1OZS A;  2TN4 A;  1QLS A;  4YGA A;  1L2O B;  1K8U A;  1J7O A;  1RTP 1;  1K9K A;  5AFP A;  2CTN A;  1QX7 A;  1SK6 D;  1YVH A;  4ORC B;  3WXA A;  3UNW A;  1ZAC A;  2L51 A;  2WND A;  2WCJ A;  4PDZ A;  2LNK A;  3PN7 C;  3B87 A;  2KGB C;  1M46 A;  2EC6 B;  4YBH B;  1YUS A;  4FTG A;  3SG4 A;  2G9B A;  2K8M B;  1KSO A;  2K7C A;  3CZT X;  1P28 A;  3KO0 A;  1XYD A;  5FYX A;  2GGM A;  1YR5 A;  2MAZ A;  1IG5 A;  1IJ6 A;  1AJ4 A;  3ZWH A;  2LM5 A;  3BYA A;  3DF0 B;  2CBL A;  3L4L A;  1TCO B;  2NCP A;  1QXP A;  1JF0 A;  3HCM A;  1JFJ A;  2GV5 A;  1NCY A;  1CFD A;  4P2Y B;  5KSZ A;  4NQG A;  1ZFS A;  2KFH A;  2JT0 A;  1GJY A;  3F45 A;  1WRZ A;  3SIA A;  1VRK A;  5PAL A;  2NCO A;  4YGC B;  1S6C A;  5DIC A;  2JZI A;  1N2D A;  1J7P A;  3NGV A;  3NSO A;  3SS3 A;  2WC5 A;  1OOF A;  3I5I B;  2HQ8 A;  1CLL A;  5DKN A;  5HYD A;  3VGO A;  1C3Y A;  1X02 A;  4PHM A;  1TWO A;  1DJY A;  1S5G Z;  4YI9 A;  5HLO A;  1F70 A;  4HRH A;  1IQ3 A;  2FOT A;  2L4I A;  3I5F B;  1NCX A;  2PSR A;  2LMT A;  2CNP A;  2KFG A;  2NLN A;  2WCF A;  1PVB A;  2KYF A;  3IVT A;  3O78 A;  1H8B A;  4YI8 A;  3JTD B;  4PE7 A;  1G33 A;  2GTE A;  2KSP A;  4BY4 A;  1IH0 A;  2K7D A;  2M29 A;  2F3Z A;  2HET A;  1WY9 A;  1JUO A;  1DC1 A;  2OS8 C;  1WDC C;  3LK1 A;  2JNX A;  1B47 A;  1NIW A;  1MF8 B;  2KI6 D;  3CAB A;  1KFX L;  1OMR A;  1RK9 A;  3QME A;  4GGF C;  1FPW A;  1KCY A;  1M31 A;  1YUU A;  1CMF A;  1Y0V H;  1HQV A;  1MXL C;  1SCM B;  2ZND A;  1GM0 A;  3TDZ A;  1CM1 A;  3D73 A;  3EVU A;  4C0L A;  3OP0 A;  4PHK A;  2ZRT A;  3IQQ A;  3ZNI A;  1REC A;  5F6T A;  5KU1 A;  1DJH A;  1QLK A;  2L5Y A;  2M49 B;  4CFQ A;  1DF0 B;  3CDN A;  2QEO A;  3I5F C;  1DJI A;  2SCP A;  5D7F A;  3VRQ A;  3BUX B;  3EK8 A;  3OB2 B;  2L98 A;  1DJZ A;  2EGD A;  3SG7 A;  1Y1X A;  3NXA A;  2AAO A;  4DS7 A;  1B1G A;  2JOJ A;  4CFR A;  2QAC A;  1EH2 A;  1SPY A;  4R1E A;  4MN0 A;  2Y1N A;  3L4A A;  3SS4 A;  2FJY A;  2ISD A;  3O4Y A;  2JQ6 A;  1JSA A;  1QAT A;  1OZO A;  1QTX A;  1QV1 A;  4M2P A;  4USL A;  2L2C A;  1OOJ A;  2B1U A;  1KK7 Z;  3D76 A;  5ER5 A;  3CZ2 A;  5IBW A;  1UHH A;  1SCM C;  4YGB B;  4I5K A;  1DJW A;  4YRU A;  1BU3 A;  2ZKM X;  4MZL A;  1B4C A;  2BBM A;  2L50 A;  3GOF A;  4KYN A;  4OZD A;  1XA5 A;  1XFY O;  1NX0 A;  4GNK B;  3DVK A;  2FCE A;  1SL9 A;  2LLU A;  4C0K A;  1CTR A;  2H61 A;  2KI4 C;  1DQE A;  2LE9 B;  1A29 A;  1BR4 B;  1CDM A;  2BE6 A;  2JRF A;  2JT8 A;  2SAS A;  4MBE A;  4C0J A;  1FI6 A;  1SNL A;  4ORB B;  5CPV A;  2FJU B;  5CSF A;  4GUK A;  1UP5 A;  2HF5 A;  2KQ6 A;  3PM2 A;  2JTZ A;  1QVI Y; 
#chains in the Genus database with same CATH homology
 2JTT A;  1KK8 B;  1W7J B;  1NPQ A;  3DVE A;  4BY5 A;  1H4B A;  2F33 A;  4NDD A;  2Y5I A;  1NYA A;  2V53 A;  1FI5 A;  1C7W A;  2M7L A;  1WRL A;  2KDH A;  1PAL A;  3CTN A;  3DF0 A;  2ZFD A;  1EXR A;  2JXL A;  2M8U A;  2KNE A;  3BUN B;  1LA0 A;  2E30 A;  4I5N B;  2F8P A;  2KI4 B;  3WHT B;  4XJK B;  2IS9 A;  1KFU L;  1PVA A;  1LVC D;  4MSP A;  1K96 A;  2LAN A;  2JUL A;  1KWO B;  1N0Y A;  3CS1 A;  4PE4 A;  4GGN A;  2Q91 A;  3AAJ A;  1IWQ A;  1DVI A;  1PRW A;  1U5I A;  1U5I B;  1AK8 A;  1WLZ A;  1CDN A;  2O5G A;  1TNX A;  4XYN A;  2M9G A;  1N65 A;  3QRX A;  4I5L B;  2BBN A;  1C07 A;  1YTZ C;  2LHI A;  2MA2 A;  2OS8 B;  3PLF B;  2LMV A;  5AER A;  2ZN9 A;  1S6I A;  5CSN A;  1BLQ A;  1NX2 A;  4PE1 A;  4OCI A;  3NSI A;  3KF9 A;  1BMO A;  1XVJ A;  2PMY A;  5HKW A;  1QX2 A;  2MLE C;  5J3X A;  5I2Q A;  1QIW A;  1SKT A;  1ZUZ A;  1S1E A;  2BKH B;  1UUS A;  2WC8 A;  3BUO B;  3CLN A;  2K61 A;  2LAP A;  3SIB A;  2MLF C;  1IGV A;  2RGI A;  4OR9 B;  3JVT C;  4MZJ A;  1HT9 A;  1RFJ A;  1MQ1 A;  5DKR A;  2R2I A;  3VRN A;  1K2H A;  2LUX A;  2COL B;  1SBJ A;  3JTD C;  5JJG A;  4N1G A;  3AKA A;  1TN4 A;  4P5O E;  1XFX O;  3PAT A;  1C7V A;  2K7O A;  1CMG A;  5CSI A;  4PAL A;  5HKZ A;  2L4H A;  1TTX A;  4DRW A;  3M0W A;  4ICB A;  1AJ5 A;  3A4U B;  1V1F A;  3DVM A;  4HRG A;  4QJ4 B;  4ZCV A;  4AQJ A;  1XFZ O;  2LP3 A;  1CLM A;  5AXI A;  1PUL A;  1UHI A;  1SR6 C;  2NXQ A;  1RWY A;  1GGZ A;  1M39 A;  2L0P A;  3TUY C;  2KBM A;  1UHK A;  3ICB A;  1F54 A;  4JWQ A;  1SL8 A;  1B7T Y;  3FWC A;  2F2O A;  2WOS A;  2JC2 A;  1J7R A;  2KAX A;  1SRA A;  1R2U A;  2KGR A;  3OX6 A;  3CWG A;  1F55 A;  1KK7 Y;  1K94 A;  4I5J A;  3LCP C;  4MVF A;  3TDI A;  5ER4 X;  1DF0 A;  1XO5 A;  2OPO A;  1XFW O;  2A4J A;  1TCF A;  4WQ2 A;  1UHJ A;  4DCK A;  1YUT A;  3CGA A;  5HKY A;  1SL7 A;  2ZNE A;  3PSR A;  5I8N A;  2OTG C;  1CM4 A;  3O6B A;  3BXK A;  1E8A A;  4PHN A;  1DTL A;  1F71 A;  3D0Y B;  1L7Z A;  3AAK A;  3A8R A;  3KPX A;  4WQ3 A;  4PHJ A;  4HSZ A;  1CB1 A;  4OKH A;  1BF5 A;  3CR2 A;  4NDB A;  2I2R E;  3SG5 A;  1BOC A;  1PSB A;  3DVJ A;  5I2L A;  5DKQ A;  3E3R A;  2JXC A;  1KQM B;  4CLN A;  1A75 A;  1F4Q A;  1MHO A;  1DJG A;  1F8H A;  2KBI A;  2LVJ A;  3JVT B;  3LK0 A;  1BOD A;  1EJ3 A;  2F3Y A;  3C1V A;  4F0Z B;  2KFF A;  1JFK A;  1J1D A;  2PAL A;  3GK4 X;  1MUX A;  1KK8 C;  1G4Y R;  2BL0 C;  1MXE A;  4A4B A;  1GQM A;  4TNC A;  3GK1 A;  3CR5 X;  3BOW A;  1QX5 B;  3PAL A;  1YRT B;  1K9U A;  1TIZ A;  3LLE A;  1JWD A;  2K7B A;  2PVB A;  2Y4Q A;  2E6W A;  3NSL A;  2LLT A;  3FS7 A;  1YRU B;  4AOM A;  4N5X A;  4L9M A;  4NDC A;  4A4C A;  1IJ5 A;  1OQP A;  2ZN8 A;  2G2B A;  2CCM A;  3I5H C;  1KSM A;  3K21 A;  3KHE A;  3PFV A;  4Q04 A;  1KQM C;  4XJK A;  5AAN A;  1J55 A;  5K89 A;  4DUQ A;  1IKU A;  2D8N A;  2VRG A;  3WHU B;  3TUY B;  1FW4 A;  2MJW B;  2K2F A;  1NWD A;  2K0J A;  1KWO C;  1R6P A;  1M45 A;  1S5G Y;  1OMD A;  4U8D A;  3FIA A;  3VRR A;  1KFU S;  1TNW A;  1B9A A;  2LVK A;  4FQO A;  2BL0 B;  1XK4 A;  3I5G B;  3HX4 A;  1AP4 A;  3RLZ A;  2KYC A;  4MLW A;  1L2O C;  2KAY A;  2WCE A;  1NP8 A;  1CFC A;  1D1O A;  1K9P A;  4MEW A;  1YX8 A;  1MWN A;  2KI6 C;  4QJ3 B;  2LMU A;  4E68 A;  4WRI A;  4PCW A;  1S3P A;  1UHN A;  2WCB A;  4CPV A;  2BEC A;  3SG3 A;  1LXF C;  3EKH A;  4ZCU A;  1CFP A;  2NZ0 A;  3BOW B;  5GQQ C;  2CT9 A;  3EK4 A;  3TDU A;  3EK7 A;  2CXJ A;  1RRO A;  1IRJ A;  1NSH A;  2O60 A;  4YGE B;  1ODB A;  1QVI Z;  3BQ3 A;  1B8R A;  3TS5 C;  1A03 A;  3IQO A;  2Y1M A;  3NSK A;  2WOR A;  4MZK A;  1YX7 A;  3OB1 B;  1IQ5 A;  1NX3 A;  2BKI B;  3GK2 A;  1SW8 A;  3RM1 A;  1MR8 A;  3EVV A;  3LL8 B;  4IL1 A;  2LC5 A;  4PE0 A;  2LVI A;  1DMO A;  1J1E A;  1LKJ A;  3D0Y A;  3DD4 A;  4OVN F;  1K95 A;  1XFU O;  2BCB A;  3OX5 A;  3WNX B;  5I2O A;  1J7Q A;  1JF2 A;  1PK0 D;  1XFV O;  5HLV A;  1AUI B;  1G8I A;  2L5X B;  2LVV A;  1Q80 A;  5G08 A;  2JWW A;  1NX1 A;  1M63 B;  3BUM B;  2AMI A;  4DIR A;  4JPZ B;  4YGD B;  1Y6W A;  4M2Q A;  1TRF A;  4D1E A;  1B8C A;  1ALV A;  1F4O A;  1BJF A;  1EG3 A;  1RJV A;  4GBA A;  1KQV A;  2M7N A;  4GPL B;  2HPS A;  2PRU A;  2BE4 A;  4MRY A;  3I5I C;  2MHH A;  3CR4 X;  1AVS A;  1S6J A;  4JQ0 D;  1Y1A A;  1B7T Z;  3SG6 A;  1QJT A;  1V1G A;  2K2A A;  4ORA B;  1UUR A;  1SR6 B;  1EG4 A;  2H2K A;  3EKJ A;  2JNF A;  1DT7 B;  1UWO A;  3I5H B;  1EL4 A;  2LHL A;  2LV7 A;  2KQY A;  1A4P A;  2KHN A;  4GGF A;  1DJX A;  5TNC A;  1DGU A;  1TOP A;  1KFX S;  5JOL A;  3TZ1 A;  2I7A A;  3AKB A;  3FWB A;  1WDC B;  2Q4U A;  3VRO A;  4CID A;  1JBA A;  1PSR A;  1XK4 C;  4ETO A;  1NCZ A;  2BCA A;  2P6B B;  2MRD A;  1W7I B;  2I18 A;  3EVR A;  2EHB A;  1CFF A;  1SYM A;  5D69 A;  1Y1U A;  2JPT A;  3IF7 A;  2M1K B;  3PN7 B;  2OTG B;  1WRK A;  3MSE B;  1WLM A;  1YUR A;  1LA3 A;  1CLB A;  1CKK A;  1DGV A;  2BCX A;  2EC6 C;  5CSJ A;  5B8I B;  1S26 D;  1JC2 A;  1BR1 B;  2M3W A;  1LIN A;  2ZRS A;  4GFT A;  4HRE E;  2JT3 A;  2FCD A;  5KTY A;  1BG1 A;  4QJ5 B;  2AUC A;  1BT6 A;  1ZOT B;  4M2O A;  2PAS A;  2M0R A;  1FBV A;  3I5G C;  1NUB A;  1QIV A;  2L2E A;  1ALW A;  1SY9 A;  2KAV A;  3VRP A;  3O2P A;  1YVL A;  2LUC A;  3D10 A;  1CDP A;  3OHM B;  5BPJ A;  1CNP A;  1ZMZ A;  2QPT A;  2I94 A;  1CDL A;  2M97 A;  3BUW B;  2GGZ A;  1OSA A;  1QAS A;  2HQW A;  4MRX A;  4OV2 A;  1OE9 B;  4UPG A;  1GGW A;  1SCV A;  3SG2 A;  3H4S E;  1SMG A;  3TS5 B;  1TNQ A;  1AHR A;  2MBX A;  4AQI A;  1K93 D;  2M1U A;  2LCP A;  3SJS A;  4GAO A;  1B8L A;  1S36 A;  2LLS A;  2F2P A;  2DOQ A;  1A75 B;  3PM8 A;  5AEQ A;  2KOT A;  1A2X A;  1OMV A;  2H61 C;  3KEV A;  1K90 D;  1QV0 A;  4N1F A;  1TNP A;  2JU0 A;  1QS7 A;  1FF1 A;  2LP2 A;  1OZS A;  2TN4 A;  1QLS A;  4YGA A;  1L2O B;  1K8U A;  1J7O A;  1RTP 1;  1K9K A;  5AFP A;  2CTN A;  1QX7 A;  1SK6 D;  1YVH A;  4ORC B;  3WXA A;  1ZAC A;  2L51 A;  2WND A;  4PDZ A;  2LNK A;  3PN7 C;  2KGB C;  1M46 A;  2EC6 B;  4YBH B;  1YUS A;  4FTG A;  3SG4 A;  2G9B A;  2K8M B;  1KSO A;  2K7C A;  3CZT X;  3KO0 A;  1XYD A;  5FYX A;  2GGM A;  1YR5 A;  2MAZ A;  1IG5 A;  1IJ6 A;  1AJ4 A;  3ZWH A;  2LM5 A;  3BYA A;  3DF0 B;  2CBL A;  1TCO B;  2NCP A;  1QXP A;  1JF0 A;  3HCM A;  1JFJ A;  2GV5 A;  1NCY A;  1CFD A;  4P2Y B;  5KSZ A;  4NQG A;  1ZFS A;  2KFH A;  2JT0 A;  1GJY A;  3F45 A;  1WRZ A;  3SIA A;  1VRK A;  5PAL A;  2NCO A;  4YGC B;  1S6C A;  2JZI A;  1N2D A;  1J7P A;  3NSO A;  3I5I B;  2HQ8 A;  1CLL A;  5DKN A;  5HYD A;  3VGO A;  1X02 A;  4PHM A;  1DJY A;  1S5G Z;  4YI9 A;  5HLO A;  1F70 A;  4HRH A;  1IQ3 A;  2FOT A;  2L4I A;  3I5F B;  1NCX A;  2PSR A;  2LMT A;  2CNP A;  2KFG A;  2NLN A;  2WCF A;  1PVB A;  2KYF A;  3O78 A;  1H8B A;  4YI8 A;  3JTD B;  4PE7 A;  1G33 A;  2KSP A;  4BY4 A;  1IH0 A;  2K7D A;  2M29 A;  2F3Z A;  2HET A;  1WY9 A;  1JUO A;  2OS8 C;  1WDC C;  3LK1 A;  2JNX A;  1B47 A;  1NIW A;  1MF8 B;  2KI6 D;  1KFX L;  1OMR A;  1RK9 A;  4GGF C;  1FPW A;  1KCY A;  1M31 A;  1YUU A;  1CMF A;  1Y0V H;  1HQV A;  1MXL C;  1SCM B;  2ZND A;  3TDZ A;  1CM1 A;  3EVU A;  4C0L A;  3OP0 A;  4PHK A;  2ZRT A;  3IQQ A;  3ZNI A;  1REC A;  5F6T A;  5KU1 A;  1DJH A;  1QLK A;  2M49 B;  4CFQ A;  1DF0 B;  3I5F C;  1DJI A;  2SCP A;  5D7F A;  3VRQ A;  3BUX B;  3EK8 A;  3OB2 B;  2L98 A;  1DJZ A;  2EGD A;  3SG7 A;  1Y1X A;  3NXA A;  2AAO A;  4DS7 A;  1B1G A;  2JOJ A;  4CFR A;  2QAC A;  1EH2 A;  1SPY A;  4R1E A;  4MN0 A;  2Y1N A;  2ISD A;  3O4Y A;  2JQ6 A;  1JSA A;  1QAT A;  1OZO A;  1QTX A;  1QV1 A;  4M2P A;  4USL A;  1OOJ A;  2B1U A;  1KK7 Z;  5ER5 A;  5IBW A;  1UHH A;  1SCM C;  4YGB B;  4I5K A;  1DJW A;  4YRU A;  1BU3 A;  2ZKM X;  4MZL A;  1B4C A;  2BBM A;  2L50 A;  3GOF A;  1XA5 A;  1XFY O;  1NX0 A;  4GNK B;  3DVK A;  2FCE A;  1SL9 A;  2LLU A;  4C0K A;  1CTR A;  2H61 A;  2KI4 C;  2LE9 B;  1A29 A;  1BR4 B;  1CDM A;  2BE6 A;  2JRF A;  2JT8 A;  2SAS A;  4MBE A;  4C0J A;  1FI6 A;  1SNL A;  4ORB B;  5CPV A;  2FJU B;  5CSF A;  4GUK A;  1UP5 A;  2HF5 A;  2KQ6 A;  2JTZ A;  1QVI Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...