2ERBA

Agamobp1, and odorant binding protein from anopheles gambiae complexed with peg
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
123
structure length
123
Chain Sequence
TPRRDAEYPPPELLEALKPLHDICLGKTGVTEEAIKKFSDEEIHEDEKLKCYMNCLFHEAKVVDDNGDVHLEKLHDSLPSSMHDIAMHMGKRCLYPEGETLCDKAFWLHKCWKQSDPKHYFLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of an odorant binding protein from Anopheles gambiae: Evidence for a common ligand release mechanism.
pubmed doi rcsb
molecule keywords odorant binding protein
molecule tags Transport protein
source organism Anopheles gambiae
total genus 43
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2erbA01
3BFHA 2KPHA 3NHTA 2P70A 3RZSA 4F7FA 4INWA 3NGVA 3R1OA 3BFBA 1TWOA 3B7AA 3CZ2A 2WCKA 4JD9A 1C3YA 3S0EA 2WCMA 3D74A 1T14A 1TUJA 1P28A 2QEVA 3DYEA 2P71A 3S0GA 3L4LA 2H8VA 1OOIX 3S0FA 3D78A 2WC5A 1OW4A 3DY9A 1QWVA 3CZ1A 1C3ZA 3FE8A 3B6XA 3CDNA 3CYZA 3S0BA 2WCLA 3B86A 1ORGA 1OOGA 3V2LA 3B88A 1GM0A 3D77A 3R1PA 3PJIA 3L47A 1XFRA 2FJYA 1LS8A 2QEBA 3N7HA 3D75A 3BJHA 2WCJA 3K1EA 3OGNA 4OZDA 3BFAA 3QMEA 1DQEA 2JPOA 3S0DA 3R1VA 3DXLA 3L4AA 1OOFA 3D73A 3CABA 2GTEA 2WCHA 2QEHA 3CZ0A 5DICA 3R72A 3FE6A 5EL2A 4PT1A 2WC6A 2QEOA 2QDIA 3S0AA 2L2CA 2ERBA 3DZTA 4INXA 3B87A 3VB1A 3D76A 3NHIA 2PQLA 3FE9A 3Q8IA 4FQTA 1OOHA
chains in the Genus database with same CATH superfamily
3BFHA 2Q91A 4ORCB 1L2OB 1S36A 4CIDA 1BODA 1K90D 4PE4A 1QV1A 2KPHA 3EVRA 2Y1MA 1IIOA 4P2YB 5FI7A 3RZSA 4HSZA 2H61C 1DJYA 2WCBA 3R1OA 3EKHA 2LANA 1KFXL 1S6CA 4XYNA 2LP2A 5DKRA 2BBMA 3BOWA 1TWOA 1HQVA 1SBJA 4MN0A 4YI8A 1SCVA 1PALA 1SCMB 1QATA 3B7AA 3LK1A 3CZ2A 3CR2A 1KQMC 3TDUA 2KHNA 1J1DA 4GPLB 1IQ3A 1N65A 3S0EA 4YGBB 5K89A 3CR4X 2CTNA 1TUJA 3I5FB 4XJKA 2WOSA 1FI5A 1IWQA 1XFVO 2E6WA 3LLEA 1OZOA 4MBEA 3TUYC 3S0FA 4C0JA 2M9GA 1Y1XA 4U8DA 1LKJA 3D78A 4F0ZB 1H8BA 3O4XA 3SG2A 5FI6A 1OMVA 1SW8A 3AKAA 3DY9A 3ICBA 1OZSA 2MJWB 5HLVA 2LMTA 1TNXA 2Y1NA 2R2IA 4E68A 1Z4HA 1NSHA 1KQVA 1CDNA 3I5IC 5F6TA 1Y6WA 1UHIA 2K7CA 3CDNA 2CBLA 1B4CA 1AJ4A 2SASA 3D0YA 2O5GA 1A75B 2WCLA 1ORGA 3B86A 3BOWB 1ODBA 3BXKA 2GV5A 2K7OA 1E8AA 1DTLA 3O78A 2L50A 1CLBA 1CTRA 1DJHA 3KF9A 1WLZA 2CCMA 4GUKA 4MRYA 2M29A 4DS7A 1TTXA 3EG5B 1ZACA 1DGUA 1NWDA 4YRUA 3B88A 1GQMA 1DJZA 1UHJA 2COLB 1FF1A 1MXEA 1SSEB 2I2RE 2RGIA 1QTXA 4XJKB 2LMUA 3KEVA 3PJIA 1K9UA 2GGMA 3L47A 2QEBA 1F55A 2BE4A 3OP0A 5AXIA 4YGAA 3D75A 1DMOA 2M49B 4USLA 1QV0A 5DKNA 2JXLA 5CSFA 3FWCA 4WQ3A 4NQGA 1V1FA 1CM1A 1AJ5A 4WRIA 3BFAA 1S5GY 1SL8A 2KLDA 4N1GA 1DQEA 1SPYA 3GK1A 2ZN8A 4YI9A 3BYAA 3D73A 5IBWA 1LVCD 3CTNA 3OB1B 4I5LB 2WCHA 3VRQA 1EH2A 1JF0A 2L5XB 1YRTB 3I5IB 3GK2A 4YGCB 1BG1A 1W7JB 1SRAA 3ZNIA 3CLNA 5HKZA 1GJYA 5CSNA 3R72A 5JOLA 1S26D 5EL2A 1DGVA 2WC6A 4KYNA 2KQ6A 4DRWA 1K8UA 2LVIA 3FWBA 2E30A 2JULA 2Q4UA 1BLQA 1BOCA 1K93D 1S6IA 5G08A 2L2CA 1B47A 2PALA 2NCOA 5ER4X 2ERBA 4IJ7A 3DZTA 4INXA 1NCZA 1WY9A 3OB2B 1B7TY 3OX5A 3SJSA 2M3WA 1A29A 1XFZO 2F3YA 1KSOA 3BUOB 4QJ5B 4CFQA 2KBMA 1EJ3A 2KQYA 5HKYA 3JTDC 5AERA 4MZLA 1OOJA 1NX1A 4GGFA 1KK7Z 2P70A 3HX4A 3A4UB 3AAJA 1AUIB 3BQ3A 5HL1A 1Z2CB 1KFUS 1XFYO 2F3ZA 3BFBA 4NDDA 4GGNA 2ISDA 2FCEA 3CWGA 4FQOA 3O4YA 2MLEC 4JD9A 4PE1A 1CNPA 2BECA 1J1EA 1IJ5A 2LVJA 1IH0A 2K7BA 1T14A 2TN4A 3CGAA 1QVIZ 4JQ0D 4M2OA 1NPQA 5AFPA 1X02A 3OX6A 2I94A 1A2XA 1ALWA 1MR8A 1UUSA 3TDIA 1SR6C 3IQOA 2KNEA 2F8PA 1CDLA 4PALA 4C0LA 2LLUA 3UO9A 1DVIA 1JF2A 1OW4A 1CMFA 1A75A 4M2QA 5HKWA 2ZN9A 2KFGA 3SG6A 3VGOA 1AHRA 2MHHA 3IF7A 3CZ1A 3FE8A 3B6XA 2CNPA 4P5OE 3JTDB 2JNXA 2L4HA 1N2DA 2WNDA 3BUNB 3DVJA 2KYFA 2QPTA 5TNCA 1N0YA 2L4IA 1UP5A 2KFFA 1K9PA 2NCPA 2JQ6A 2KSPA 1G4YR 1XFWO 2PMYA 2MLFC 2VRGA 4PHJA 4ORBB 3ZWHA 5I2OA 1J7QA 2GGZA 4DCKA 5KU1A 2MAZA 1DJIA 4HRGA 1DT7B 2ZKMX 4JWQA 1FBVA 1Y0VH 3SS4A 3CZTX 1QLKA 5D7FA 2KFHA 2OTGB 1CFFA 1DELA 1M45A 2DOQA 3E3RA 1GM0A 4GAOA 5JJGA 1MF8B 2BKIB 1LA0A 3D77A 2L51A 1C07A 1ZUZA 5HYDA 1C7WA 3PATA 1EXRA 2BL0C 1RTP1 1IGVA 4M2PA 1NX3A 3K21A 4DUQA 1KFUL 1MQ1A 1SKTA 3N7HA 2WCFA 2ZNDA 1AVSA 2WCJA 2ZRTA 4GNKB 2M1UA 2SCPA 3K1EA 2PRUA 3NXAA 4OZDA 5FYXA 1SR6B 3SG7A 4D1EA 1RFJA 2F2PA 2JT8A 2LVVA 1NP8A 2ZRSA 5D69A 1DJWA 1IJ6A 4CPVA 1OOFA 3BUXB 4MVFA 1JFJA 1B8LA 5ER5A 3CABA 3SG5A 2I18A 2K0JA 3CZ0A 2K2AA 4PE7A 1QLSA 2Y4QA 1YTZC 2ZFDA 4C0KA 2CXJA 4MZKA 1PULA 3VRRA 2QEOA 1FPWA 1S1EA 4N5XA 1OMDA 3DD4A 4Q04A 1D1OA 3EK4A 2ZNEA 1QX7A 3RLZA 5DKQA 4BY4A 3PN7C 1BU3A 3FS7A 2PASA 3B87A 1G8IA 2YGUA 3BUMB 4IL1A 3PSRA 1UWOA 1GGZA 2LVKA 3VRNA 3Q8IA 4FQTA 1W9ZA 2BL0B 1UHKA 2EHBA 4OVNF 1XYDA 1IG5A 1NYAA 2WCEA 1BMOA 2LHIA 3NHTA 2JTTA 1LXFC 4F7FA 4NDBA 3C1VA 3NGVA 3LCPC 3WXAA 3WHTB 1SY9A 4QJ4B 1XK4C 1JUOA 1PSBA 2LC5A 1XO5A 1XK4A 2K8MB 2LCPA 2LP3A 4I5JA 2BBNA 1K94A 2WCKA 1Q80A 1WDCC 1RECA 3D10A 3PFVA 4FTGA 1KK8C 1TIZA 2JNFA 2JOJA 2WCMA 1KWOB 1AP4A 1GGWA 1P28A 3I5GC 4PHKA 3AAKA 4AQJA 2BCXA 1IRJA 3JVTC 2HQWA 5CPVA 2BCBA 3PLFB 1F70A 1KFXS 1JBAA 1UHNA 3L4LA 4N1FA 2FJUB 2H8VA 5D3OA 2BE6A 4GGFC 1XA5A 2AMIA 1CDPA 1J7RA 2HQ8A 1TUZA 3PN7B 2WC5A 1WRLA 3F45A 1DJGA 2M7LA 1V1GA 1QXPA 4AOMA 3H4SE 1PK0D 3TZ1A 4AQIA 1TCFA 1H4BA 5KTYA 2JT0A 2OS8C 1M31A 1RROA 1KK7Y 1VRKA 3AKBA 4YBHB 2KAYA 2K61A 1C3ZA 3PM8A 5J3XA 2CT9A 2OTGC 1IKUA 3VROA 3CYZA 2V53A 1U5IA 2HPSA 1OOGA 1RJVA 3I5HC 3V2LA 1A4PA 2D8NA 1SYMA 2JRFA 1K95A 2B1UA 3TDZA 1UHHA 1QJTA 4ICBA 1WDCB 2L98A 1QVIY 2KI6D 3EKJA 2JC2A 1KK8B 1Y1UA 2F2OA 3R1PA 1OQPA 3DVMA 1S6JA 4HREE 4ZCVA 2G2BA 4CLNA 3I5GB 1QS7A 3WNXB 1XFRA 2FJYA 1JSAA 2WORA 3JVTB 1KSMA 2LLSA 3VRPA 2KDHA 3BJHA 5PALA 3SIAA 1SL7A 5I2QA 3MSEB 1LA3A 1EG4A 1RK9A 3FIAA 1HT9A 1EG3A 2BNXA 3EVUA 4PHMA 1CFDA 2M0RA 3IQQA 1WRZA 4ORAB 1Y1AA 3QRXA 2KOTA 4YGDB 2JPOA 3PALA 3NSIA 3L4AA 1BR1B 2OS8B 2JWWA 1PVBA 2H2KA 2LLTA 5I2LA 4GFTA 2MA2A 1CLLA 2MRDA 4L9MA 5DICA 1NCXA 2H61A 1U5IB 1YVLA 1QX2A 1CLMA 1IQ5A 1B9AA 1BT6A 1SK6D 3FE6A 1B8RA 1W7IB 3OBVA 4NDCA 5HLOA 3I5HB 4PCWA 2KAVA 1OE9B 2PYQA 3EK7A 2QDIA 3SG4A 3S0AA 1QIVA 1R6PA 1F4OA 2FOTA 2LV7A 4I5NB 4BY5A 3SG3A 1L7ZA 4OKHA 2NLNA 3O6BA 2I7AA 1YUTA 4GBAA 3CS1A 2BAPA 3DF0A 3NHIA 1K96A 4QJ3B 3GK4X 2JXCA 3FE9A 4YGEB 1YURA 1OOHA 1JFKA 1F54A 1SL9A 1MXLC 2KYCA 2K60A 4OCIA 1MUXA 1ZOTB 2LAPA 2BCAA 1TN4A 1A03A 4INWA 1KWOC 2IS9A 3NSKA 4TNCA 2KLEA 3LK0A 1TNQA 1XFXO 2MBXA 1TRFA 1YUSA 2L2EA 2OPOA 3NSLA 1YUUA 3PM2A 1ZFSA 4PE0A 2LNKA 1BR4B 1ALVA 1R2UA 1OSAA 2HF5A 1B8CA 1FW4A 1C3YA 1NIWA 3D74A 1CFCA 2L0PA 1TNWA 1QIWA 1WRKA 1YVHA 2K2FA 2KI4C 2P71A 2QEVA 1DF0A 1LINA 3DYEA 1M39A 2K7DA 2QACA 4HRHA 4MLWA 1BF5A 3S0GA 1NX2A 4CFRA 1AK8A 1KQMB 2KAXA 5AANA 1OOIX 2L5YA 5FI2A 5I8NA 1CFPA 3SS5A 3O2PA 1JC2A 5BPJA 2P6BB 3NSOA 2G9BA 2M8UA 3DF0B 3DVEA 1UURA 5I94A 2HETA 4JKTA 1PRWA 1SMGA 2KBIA 2LMVA 2WC8A 1S5GZ 4OR9B 4DIRA 1QWVA 4JPZB 1CB1A 3TS5C 1QX5B 2M1KB 3TUYB 1CDMA 2O60A 1J7OA 3UNWA 1CM4A 1K9KA 2JT3A 3S0BA 4OV2A 2JPTA 4MRXA 4MSPA 1EL4A 2M97A 1OMRA 1DEKA 4UPGA 3WHUB 1F4QA 1M46A 1MWNA 2A4JA 3DVKA 5AEQA 1K2HA 1YX8A 3EVVA 1NCYA 3GOFA 1NUBA 1BJFA 1WLMA 1RWYA 3D0YB 1B1GA 4WQ2A 1S3PA 2NXQA 2JU0A 2PVBA 5CSIA 2KGBC 2NZ0A 2EC6C 1FI6A 2KI6C 3CR5X 1YRUB 3A8RA 4ETOA 1DF0B 2M7NA 1LS8A 1L2OC 2KI4B 1B7TZ 2AUCA 2LUXA 3BUWB 3KPXA 5CSJA 4R1EA 3SIBA 3SS3A 3M0WA 2KGRA 2LE9B 3IVTA 5KSZA 4MEWA 1KCYA 3OGNA 1YX7A 3LL8B 3QMEA 2BKHB 1TOPA 1TNPA 1QASA 2EGDA 1SCMC 3KHEA 3S0DA 3R1VA 2Y5IA 3DXLA 1DJXA 2JZIA 4A4CA 1PVAA 3RM1A 1NX0A 2FCDA 2GTEA 3TS5B 2QEHA 4I5KA 1J7PA 1JWDA 1XVJA 3I5FC 4A4BA 1CMGA 1M63B 4PHNA 1F71A 3OHMB 3KO0A 4PT1A 1F8HA 2LM5A 4PDZA 2JTZA 1SNLA 1PSRA 1CKKA 2PSRA 1YR5A 4ZCUA 1ZMZA 1C7VA 3EK8A 2AAOA 1MHOA 5B8IB 1J55A 4MZJA 1G33A 3VB1A 3D76A 3HCMA 1TCOB 1DC1A 2PQLA 2EC6B 2LHLA 5GQQC 1XFUO 2LUCA 2F33A
chains in the Genus database with same CATH topology
3BFHA 2KPHA 3NHTA 2P70A 3RZSA 4F7FA 4INWA 3NGVA 3R1OA 3BFBA 1TWOA 3B7AA 3CZ2A 2WCKA 4JD9A 1C3YA 3S0EA 2WCMA 3D74A 1T14A 1TUJA 1P28A 2QEVA 3DYEA 2P71A 3S0GA 3L4LA 2H8VA 1OOIX 3S0FA 3D78A 2WC5A 1OW4A 3DY9A 1QWVA 3CZ1A 1C3ZA 3FE8A 3B6XA 3CDNA 3CYZA 3S0BA 2WCLA 3B86A 1ORGA 1OOGA 3V2LA 3B88A 1GM0A 3D77A 3R1PA 3PJIA 3L47A 1XFRA 2FJYA 1LS8A 2QEBA 3N7HA 3D75A 3BJHA 2WCJA 3K1EA 3OGNA 4OZDA 3BFAA 3QMEA 1DQEA 2JPOA 3S0DA 3R1VA 3DXLA 3L4AA 1OOFA 3D73A 3CABA 2GTEA 2WCHA 2QEHA 3CZ0A 5DICA 3R72A 3FE6A 5EL2A 4PT1A 2WC6A 2QEOA 2QDIA 3S0AA 2L2CA 2ERBA 3DZTA 4INXA 3B87A 3VB1A 3D76A 3NHIA 2PQLA 3FE9A 3Q8IA 4FQTA 1OOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BFH A;  2KPH A;  3NHT A;  2P70 A;  3RZS A;  4F7F A;  4INW A;  3NGV A;  3R1O A;  3BFB A;  1TWO A;  3B7A A;  3CZ2 A;  2WCK A;  4JD9 A;  1C3Y A;  3S0E A;  2WCM A;  3D74 A;  1T14 A;  1TUJ A;  1P28 A;  2QEV A;  3DYE A;  2P71 A;  3S0G A;  3L4L A;  2H8V A;  1OOI X;  3S0F A;  3D78 A;  2WC5 A;  1OW4 A;  3DY9 A;  1QWV A;  3CZ1 A;  1C3Z A;  3FE8 A;  3B6X A;  3CDN A;  3CYZ A;  3S0B A;  2WCL A;  3B86 A;  1ORG A;  1OOG A;  3V2L A;  3B88 A;  1GM0 A;  3D77 A;  3R1P A;  3PJI A;  3L47 A;  1XFR A;  2FJY A;  1LS8 A;  2QEB A;  3N7H A;  3D75 A;  3BJH A;  2WCJ A;  3K1E A;  3OGN A;  4OZD A;  3BFA A;  3QME A;  1DQE A;  2JPO A;  3S0D A;  3R1V A;  3DXL A;  3L4A A;  1OOF A;  3D73 A;  3CAB A;  2GTE A;  2WCH A;  2QEH A;  3CZ0 A;  5DIC A;  3R72 A;  3FE6 A;  5EL2 A;  4PT1 A;  2WC6 A;  2QEO A;  2QDI A;  3S0A A;  2L2C A;  2ERB A;  3DZT A;  4INX A;  3B87 A;  3VB1 A;  3D76 A;  3NHI A;  2PQL A;  3FE9 A;  3Q8I A;  4FQT A;  1OOH A; 
#chains in the Genus database with same CATH topology
 3BFH A;  2Q91 A;  4ORC B;  1L2O B;  1S36 A;  4CID A;  1BOD A;  1K90 D;  4PE4 A;  1QV1 A;  2KPH A;  3EVR A;  2Y1M A;  1IIO A;  4P2Y B;  5FI7 A;  3RZS A;  4HSZ A;  2H61 C;  1DJY A;  2WCB A;  3R1O A;  3EKH A;  2LAN A;  1KFX L;  1S6C A;  4XYN A;  2LP2 A;  5DKR A;  2BBM A;  3BOW A;  1TWO A;  1HQV A;  1SBJ A;  4MN0 A;  4YI8 A;  1SCV A;  1PAL A;  1SCM B;  1QAT A;  3B7A A;  3LK1 A;  3CZ2 A;  3CR2 A;  1KQM C;  3TDU A;  2KHN A;  1J1D A;  4GPL B;  1IQ3 A;  1N65 A;  3S0E A;  4YGB B;  5K89 A;  3CR4 X;  2CTN A;  1TUJ A;  3I5F B;  4XJK A;  2WOS A;  1FI5 A;  1IWQ A;  1XFV O;  2E6W A;  3LLE A;  1OZO A;  4MBE A;  3TUY C;  3S0F A;  4C0J A;  2M9G A;  1Y1X A;  4U8D A;  1LKJ A;  3D78 A;  4F0Z B;  1H8B A;  3O4X A;  3SG2 A;  5FI6 A;  1OMV A;  1SW8 A;  3AKA A;  3DY9 A;  3ICB A;  1OZS A;  2MJW B;  5HLV A;  2LMT A;  1TNX A;  2Y1N A;  2R2I A;  4E68 A;  1Z4H A;  1NSH A;  1KQV A;  1CDN A;  3I5I C;  5F6T A;  1Y6W A;  1UHI A;  2K7C A;  3CDN A;  2CBL A;  1B4C A;  1AJ4 A;  2SAS A;  3D0Y A;  2O5G A;  1A75 B;  2WCL A;  1ORG A;  3B86 A;  3BOW B;  1ODB A;  3BXK A;  2GV5 A;  2K7O A;  1E8A A;  1DTL A;  3O78 A;  2L50 A;  1CLB A;  1CTR A;  1DJH A;  3KF9 A;  1WLZ A;  2CCM A;  4GUK A;  4MRY A;  2M29 A;  4DS7 A;  1TTX A;  3EG5 B;  1ZAC A;  1DGU A;  1NWD A;  4YRU A;  3B88 A;  1GQM A;  1DJZ A;  1UHJ A;  2COL B;  1FF1 A;  1MXE A;  1SSE B;  2I2R E;  2RGI A;  1QTX A;  4XJK B;  2LMU A;  3KEV A;  3PJI A;  1K9U A;  2GGM A;  3L47 A;  2QEB A;  1F55 A;  2BE4 A;  3OP0 A;  5AXI A;  4YGA A;  3D75 A;  1DMO A;  2M49 B;  4USL A;  1QV0 A;  5DKN A;  2JXL A;  5CSF A;  3FWC A;  4WQ3 A;  4NQG A;  1V1F A;  1CM1 A;  1AJ5 A;  4WRI A;  3BFA A;  1S5G Y;  1SL8 A;  2KLD A;  4N1G A;  1DQE A;  1SPY A;  3GK1 A;  2ZN8 A;  4YI9 A;  3BYA A;  3D73 A;  5IBW A;  1LVC D;  3CTN A;  3OB1 B;  4I5L B;  2WCH A;  3VRQ A;  1EH2 A;  1JF0 A;  2L5X B;  1YRT B;  3I5I B;  3GK2 A;  4YGC B;  1BG1 A;  1W7J B;  1SRA A;  3ZNI A;  3CLN A;  5HKZ A;  1GJY A;  5CSN A;  3R72 A;  5JOL A;  1S26 D;  5EL2 A;  1DGV A;  2WC6 A;  4KYN A;  2KQ6 A;  4DRW A;  1K8U A;  2LVI A;  3FWB A;  2E30 A;  2JUL A;  2Q4U A;  1BLQ A;  1BOC A;  1K93 D;  1S6I A;  5G08 A;  2L2C A;  1B47 A;  2PAL A;  2NCO A;  5ER4 X;  2ERB A;  4IJ7 A;  3DZT A;  4INX A;  1NCZ A;  1WY9 A;  3OB2 B;  1B7T Y;  3OX5 A;  3SJS A;  2M3W A;  1A29 A;  1XFZ O;  2F3Y A;  1KSO A;  3BUO B;  4QJ5 B;  4CFQ A;  2KBM A;  1EJ3 A;  2KQY A;  5HKY A;  3JTD C;  5AER A;  4MZL A;  1OOJ A;  1NX1 A;  4GGF A;  1KK7 Z;  2P70 A;  3HX4 A;  3A4U B;  3AAJ A;  1AUI B;  3BQ3 A;  5HL1 A;  1Z2C B;  1KFU S;  1XFY O;  2F3Z A;  3BFB A;  4NDD A;  4GGN A;  2ISD A;  2FCE A;  3CWG A;  4FQO A;  3O4Y A;  2MLE C;  4JD9 A;  4PE1 A;  1CNP A;  2BEC A;  1J1E A;  1IJ5 A;  2LVJ A;  1IH0 A;  2K7B A;  1T14 A;  2TN4 A;  3CGA A;  1QVI Z;  4JQ0 D;  4M2O A;  1NPQ A;  5AFP A;  1X02 A;  3OX6 A;  2I94 A;  1A2X A;  1ALW A;  1MR8 A;  1UUS A;  3TDI A;  1SR6 C;  3IQO A;  2KNE A;  2F8P A;  1CDL A;  4PAL A;  4C0L A;  2LLU A;  3UO9 A;  1DVI A;  1JF2 A;  1OW4 A;  1CMF A;  1A75 A;  4M2Q A;  5HKW A;  2ZN9 A;  2KFG A;  3SG6 A;  3VGO A;  1AHR A;  2MHH A;  3IF7 A;  3CZ1 A;  3FE8 A;  3B6X A;  2CNP A;  4P5O E;  3JTD B;  2JNX A;  2L4H A;  1N2D A;  2WND A;  3BUN B;  3DVJ A;  2KYF A;  2QPT A;  5TNC A;  1N0Y A;  2L4I A;  1UP5 A;  2KFF A;  1K9P A;  2NCP A;  2JQ6 A;  2KSP A;  1G4Y R;  1XFW O;  2PMY A;  2MLF C;  2VRG A;  4PHJ A;  4ORB B;  3ZWH A;  5I2O A;  1J7Q A;  2GGZ A;  4DCK A;  5KU1 A;  2MAZ A;  1DJI A;  4HRG A;  1DT7 B;  2ZKM X;  4JWQ A;  1FBV A;  1Y0V H;  3SS4 A;  3CZT X;  1QLK A;  5D7F A;  2KFH A;  2OTG B;  1CFF A;  1DEL A;  1M45 A;  2DOQ A;  3E3R A;  1GM0 A;  4GAO A;  5JJG A;  1MF8 B;  2BKI B;  1LA0 A;  3D77 A;  2L51 A;  1C07 A;  1ZUZ A;  5HYD A;  1C7W A;  3PAT A;  1EXR A;  2BL0 C;  1RTP 1;  1IGV A;  4M2P A;  1NX3 A;  3K21 A;  4DUQ A;  1KFU L;  1MQ1 A;  1SKT A;  3N7H A;  2WCF A;  2ZND A;  1AVS A;  2WCJ A;  2ZRT A;  4GNK B;  2M1U A;  2SCP A;  3K1E A;  2PRU A;  3NXA A;  4OZD A;  5FYX A;  1SR6 B;  3SG7 A;  4D1E A;  1RFJ A;  2F2P A;  2JT8 A;  2LVV A;  1NP8 A;  2ZRS A;  5D69 A;  1DJW A;  1IJ6 A;  4CPV A;  1OOF A;  3BUX B;  4MVF A;  1JFJ A;  1B8L A;  5ER5 A;  3CAB A;  3SG5 A;  2I18 A;  2K0J A;  3CZ0 A;  2K2A A;  4PE7 A;  1QLS A;  2Y4Q A;  1YTZ C;  2ZFD A;  4C0K A;  2CXJ A;  4MZK A;  1PUL A;  3VRR A;  2QEO A;  1FPW A;  1S1E A;  4N5X A;  1OMD A;  3DD4 A;  4Q04 A;  1D1O A;  3EK4 A;  2ZNE A;  1QX7 A;  3RLZ A;  5DKQ A;  4BY4 A;  3PN7 C;  1BU3 A;  3FS7 A;  2PAS A;  3B87 A;  1G8I A;  2YGU A;  3BUM B;  4IL1 A;  3PSR A;  1UWO A;  1GGZ A;  2LVK A;  3VRN A;  3Q8I A;  4FQT A;  1W9Z A;  2BL0 B;  1UHK A;  2EHB A;  4OVN F;  1XYD A;  1IG5 A;  1NYA A;  2WCE A;  1BMO A;  2LHI A;  3NHT A;  2JTT A;  1LXF C;  4F7F A;  4NDB A;  3C1V A;  3NGV A;  3LCP C;  3WXA A;  3WHT B;  1SY9 A;  4QJ4 B;  1XK4 C;  1JUO A;  1PSB A;  2LC5 A;  1XO5 A;  1XK4 A;  2K8M B;  2LCP A;  2LP3 A;  4I5J A;  2BBN A;  1K94 A;  2WCK A;  1Q80 A;  1WDC C;  1REC A;  3D10 A;  3PFV A;  4FTG A;  1KK8 C;  1TIZ A;  2JNF A;  2JOJ A;  2WCM A;  1KWO B;  1AP4 A;  1GGW A;  1P28 A;  3I5G C;  4PHK A;  3AAK A;  4AQJ A;  2BCX A;  1IRJ A;  3JVT C;  2HQW A;  5CPV A;  2BCB A;  3PLF B;  1F70 A;  1KFX S;  1JBA A;  1UHN A;  3L4L A;  4N1F A;  2FJU B;  2H8V A;  5D3O A;  2BE6 A;  4GGF C;  1XA5 A;  2AMI A;  1CDP A;  1J7R A;  2HQ8 A;  1TUZ A;  3PN7 B;  2WC5 A;  1WRL A;  3F45 A;  1DJG A;  2M7L A;  1V1G A;  1QXP A;  4AOM A;  3H4S E;  1PK0 D;  3TZ1 A;  4AQI A;  1TCF A;  1H4B A;  5KTY A;  2JT0 A;  2OS8 C;  1M31 A;  1RRO A;  1KK7 Y;  1VRK A;  3AKB A;  4YBH B;  2KAY A;  2K61 A;  1C3Z A;  3PM8 A;  5J3X A;  2CT9 A;  2OTG C;  1IKU A;  3VRO A;  3CYZ A;  2V53 A;  1U5I A;  2HPS A;  1OOG A;  1RJV A;  3I5H C;  3V2L A;  1A4P A;  2D8N A;  1SYM A;  2JRF A;  1K95 A;  2B1U A;  3TDZ A;  1UHH A;  1QJT A;  4ICB A;  1WDC B;  2L98 A;  1QVI Y;  2KI6 D;  3EKJ A;  2JC2 A;  1KK8 B;  1Y1U A;  2F2O A;  3R1P A;  1OQP A;  3DVM A;  1S6J A;  4HRE E;  4ZCV A;  2G2B A;  4CLN A;  3I5G B;  1QS7 A;  3WNX B;  1XFR A;  2FJY A;  1JSA A;  2WOR A;  3JVT B;  1KSM A;  2LLS A;  3VRP A;  2KDH A;  3BJH A;  5PAL A;  3SIA A;  1SL7 A;  5I2Q A;  3MSE B;  1LA3 A;  1EG4 A;  1RK9 A;  3FIA A;  1HT9 A;  1EG3 A;  2BNX A;  3EVU A;  4PHM A;  1CFD A;  2M0R A;  3IQQ A;  1WRZ A;  4ORA B;  1Y1A A;  3QRX A;  2KOT A;  4YGD B;  2JPO A;  3PAL A;  3NSI A;  3L4A A;  1BR1 B;  2OS8 B;  2JWW A;  1PVB A;  2H2K A;  2LLT A;  5I2L A;  4GFT A;  2MA2 A;  1CLL A;  2MRD A;  4L9M A;  5DIC A;  1NCX A;  2H61 A;  1U5I B;  1YVL A;  1QX2 A;  1CLM A;  1IQ5 A;  1B9A A;  1BT6 A;  1SK6 D;  3FE6 A;  1B8R A;  1W7I B;  3OBV A;  4NDC A;  5HLO A;  3I5H B;  4PCW A;  2KAV A;  1OE9 B;  2PYQ A;  3EK7 A;  2QDI A;  3SG4 A;  3S0A A;  1QIV A;  1R6P A;  1F4O A;  2FOT A;  2LV7 A;  4I5N B;  4BY5 A;  3SG3 A;  1L7Z A;  4OKH A;  2NLN A;  3O6B A;  2I7A A;  1YUT A;  4GBA A;  3CS1 A;  2BAP A;  3DF0 A;  3NHI A;  1K96 A;  4QJ3 B;  3GK4 X;  2JXC A;  3FE9 A;  4YGE B;  1YUR A;  1OOH A;  1JFK A;  1F54 A;  1SL9 A;  1MXL C;  2KYC A;  2K60 A;  4OCI A;  1MUX A;  1ZOT B;  2LAP A;  2BCA A;  1TN4 A;  1A03 A;  4INW A;  1KWO C;  2IS9 A;  3NSK A;  4TNC A;  2KLE A;  3LK0 A;  1TNQ A;  1XFX O;  2MBX A;  1TRF A;  1YUS A;  2L2E A;  2OPO A;  3NSL A;  1YUU A;  3PM2 A;  1ZFS A;  4PE0 A;  2LNK A;  1BR4 B;  1ALV A;  1R2U A;  1OSA A;  2HF5 A;  1B8C A;  1FW4 A;  1C3Y A;  1NIW A;  3D74 A;  1CFC A;  2L0P A;  1TNW A;  1QIW A;  1WRK A;  1YVH A;  2K2F A;  2KI4 C;  2P71 A;  2QEV A;  1DF0 A;  1LIN A;  3DYE A;  1M39 A;  2K7D A;  2QAC A;  4HRH A;  4MLW A;  1BF5 A;  3S0G A;  1NX2 A;  4CFR A;  1AK8 A;  1KQM B;  2KAX A;  5AAN A;  1OOI X;  2L5Y A;  5FI2 A;  5I8N A;  1CFP A;  3SS5 A;  3O2P A;  1JC2 A;  5BPJ A;  2P6B B;  3NSO A;  2G9B A;  2M8U A;  3DF0 B;  3DVE A;  1UUR A;  5I94 A;  2HET A;  4JKT A;  1PRW A;  1SMG A;  2KBI A;  2LMV A;  2WC8 A;  1S5G Z;  4OR9 B;  4DIR A;  1QWV A;  4JPZ B;  1CB1 A;  3TS5 C;  1QX5 B;  2M1K B;  3TUY B;  1CDM A;  2O60 A;  1J7O A;  3UNW A;  1CM4 A;  1K9K A;  2JT3 A;  3S0B A;  4OV2 A;  2JPT A;  4MRX A;  4MSP A;  1EL4 A;  2M97 A;  1OMR A;  1DEK A;  4UPG A;  3WHU B;  1F4Q A;  1M46 A;  1MWN A;  2A4J A;  3DVK A;  5AEQ A;  1K2H A;  1YX8 A;  3EVV A;  1NCY A;  3GOF A;  1NUB A;  1BJF A;  1WLM A;  1RWY A;  3D0Y B;  1B1G A;  4WQ2 A;  1S3P A;  2NXQ A;  2JU0 A;  2PVB A;  5CSI A;  2KGB C;  2NZ0 A;  2EC6 C;  1FI6 A;  2KI6 C;  3CR5 X;  1YRU B;  3A8R A;  4ETO A;  1DF0 B;  2M7N A;  1LS8 A;  1L2O C;  2KI4 B;  1B7T Z;  2AUC A;  2LUX A;  3BUW B;  3KPX A;  5CSJ A;  4R1E A;  3SIB A;  3SS3 A;  3M0W A;  2KGR A;  2LE9 B;  3IVT A;  5KSZ A;  4MEW A;  1KCY A;  3OGN A;  1YX7 A;  3LL8 B;  3QME A;  2BKH B;  1TOP A;  1TNP A;  1QAS A;  2EGD A;  1SCM C;  3KHE A;  3S0D A;  3R1V A;  2Y5I A;  3DXL A;  1DJX A;  2JZI A;  4A4C A;  1PVA A;  3RM1 A;  1NX0 A;  2FCD A;  2GTE A;  3TS5 B;  2QEH A;  4I5K A;  1J7P A;  1JWD A;  1XVJ A;  3I5F C;  4A4B A;  1CMG A;  1M63 B;  4PHN A;  1F71 A;  3OHM B;  3KO0 A;  4PT1 A;  1F8H A;  2LM5 A;  4PDZ A;  2JTZ A;  1SNL A;  1PSR A;  1CKK A;  2PSR A;  1YR5 A;  4ZCU A;  1ZMZ A;  1C7V A;  3EK8 A;  2AAO A;  1MHO A;  5B8I B;  1J55 A;  4MZJ A;  1G33 A;  3VB1 A;  3D76 A;  3HCM A;  1TCO B;  1DC1 A;  2PQL A;  2EC6 B;  2LHL A;  5GQQ C;  1XFU O;  2LUC A;  2F33 A; 
#chains in the Genus database with same CATH homology
 3BFH A;  2KPH A;  3NHT A;  2P70 A;  3RZS A;  4F7F A;  4INW A;  3NGV A;  3R1O A;  3BFB A;  1TWO A;  3B7A A;  3CZ2 A;  2WCK A;  4JD9 A;  1C3Y A;  3S0E A;  2WCM A;  3D74 A;  1T14 A;  1TUJ A;  1P28 A;  2QEV A;  3DYE A;  2P71 A;  3S0G A;  3L4L A;  2H8V A;  1OOI X;  3S0F A;  3D78 A;  2WC5 A;  1OW4 A;  3DY9 A;  1QWV A;  3CZ1 A;  1C3Z A;  3FE8 A;  3B6X A;  3CDN A;  3CYZ A;  3S0B A;  2WCL A;  3B86 A;  1ORG A;  1OOG A;  3V2L A;  3B88 A;  1GM0 A;  3D77 A;  3R1P A;  3PJI A;  3L47 A;  1XFR A;  2FJY A;  1LS8 A;  2QEB A;  3N7H A;  3D75 A;  3BJH A;  2WCJ A;  3K1E A;  3OGN A;  4OZD A;  3BFA A;  3QME A;  1DQE A;  2JPO A;  3S0D A;  3R1V A;  3DXL A;  3L4A A;  1OOF A;  3D73 A;  3CAB A;  2GTE A;  2WCH A;  2QEH A;  3CZ0 A;  5DIC A;  3R72 A;  3FE6 A;  5EL2 A;  4PT1 A;  2WC6 A;  2QEO A;  2QDI A;  3S0A A;  2L2C A;  2ERB A;  3DZT A;  4INX A;  3B87 A;  3VB1 A;  3D76 A;  3NHI A;  2PQL A;  3FE9 A;  3Q8I A;  4FQT A;  1OOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...