2ERBA

Agamobp1, and odorant binding protein from anopheles gambiae complexed with peg
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
123
structure length
123
Chain Sequence
TPRRDAEYPPPELLEALKPLHDICLGKTGVTEEAIKKFSDEEIHEDEKLKCYMNCLFHEAKVVDDNGDVHLEKLHDSLPSSMHDIAMHMGKRCLYPEGETLCDKAFWLHKCWKQSDPKHYFLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords odorant binding protein
publication title The crystal structure of an odorant binding protein from Anopheles gambiae: Evidence for a common ligand release mechanism.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 43
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2erbA01
3D75A 4FQTA 1QWVA 2PQLA 1OOHA 3N7HA 2P70A 4PT1A 1ORGA 1OOGA 3S0FA 3QMEA 3BJHA 3L47A 2ERBA 2QDIA 3R72A 1TUJA 3CZ1A 3D74A 4JD9A 3R1VA 3B7AA 3CABA 1T14A 2QEVA 3CZ0A 5EL2A 1TWOA 3VB1A 3D76A 3B88A 2WC5A 2L2CA 1OW4A 3PJIA 2WCHA 3DYEA 3S0EA 1C3ZA 3S0GA 2WC6A 1GM0A 3BFHA 2WCMA 3Q8IA 3B87A 3NHTA 3DY9A 3L4LA 3L4AA 3V2LA 2WCLA 2QEOA 3S0AA 3D78A 3K1EA 3OGNA 3B86A 4INWA 3FE8A 3DZTA 3R1PA 2P71A 1OOIX 3D73A 5DICA 3R1OA 2FJYA 3D77A 2GTEA 3S0BA 3CYZA 1LS8A 2WCKA 3S0DA 3DXLA 2JPOA 2QEBA 2WCJA 3NGVA 2QEHA 1XFRA 4OZDA 3FE9A 3RZSA 3NHIA 3BFAA 4INXA 1P28A 3CZ2A 1DQEA 3FE6A 2KPHA 1C3YA 1OOFA 3CDNA 3B6XA 4F7FA 2H8VA 3BFBA
chains in the Genus database with same CATH superfamily
1YRUB 2LNKA 1UUSA 2M8UA 1ALWA 2BE4A 1ODBA 2OTGB 4MZKA 1EXRA 4NDCA 1MUXA 5FI2A 1PRWA 1QWVA 2PQLA 3BOWB 1FW4A 1IQ3A 1IGVA 4ORCB 1KFXL 1ORGA 2LLSA 1B7TZ 3OX5A 2NCPA 3PATA 4N5XA 1LXFC 2M1KB 1B8CA 1OZSA 1RWYA 4C0JA 2NLNA 2G2BA 4MN0A 5TNCA 2JQ6A 1B8RA 1ZMZA 4ORBB 5KTYA 1K94A 1M46A 2MBXA 1CMGA 1QJTA 1NYAA 2QDIA 3DVJA 1B47A 3R72A 1Y6WA 4N1FA 2LCPA 1J7OA 1UHJA 3OBVA 1SRAA 1CDLA 1DT7B 4BY4A 5CSJA 3DF0B 4CIDA 1XFYO 2LVKA 1IIOA 1QIVA 2JNXA 1PK0D 2O60A 1SKTA 4PE7A 1Z2CB 1XA5A 3CR2A 2JWWA 1W9ZA 1Z4HA 4MRYA 1JC2A 2KI6C 1A03A 1BODA 1ALVA 2KQ6A 1BMOA 5HLOA 2I94A 3B88A 5HYDA 2Y5IA 3GK1A 2ZN8A 1NCYA 1XVJA 1YTZC 3CS1A 4HREE 4CPVA 1K9UA 3PN7C 2PRUA 1CTRA 1YVHA 4AOMA 2CBLA 1CB1A 4PHJA 2L4HA 1Y1AA 2K7DA 2LM5A 2WC6A 1GM0A 1DJGA 3BFHA 2JRFA 4P5OE 2F33A 4TNCA 2M0RA 3NSIA 3Q8IA 2LP2A 1OMRA 1EG4A 2E30A 4BY5A 2LVIA 3JVTC 1UHNA 5FI7A 2PSRA 1CFFA 1AUIB 1OSAA 1UHIA 2LHIA 2QEOA 3AAJA 1QLSA 1TCOB 4M2OA 1S5GZ 4ETOA 1PSRA 2HETA 2I7AA 3S0AA 4USLA 2ZKMX 1DVIA 1YUSA 1YUUA 3D0YA 3FE8A 2LMVA 4YBHB 2CT9A 3DZTA 1QV1A 2K0JA 1QS7A 1IJ5A 4A4BA 1M45A 1K8UA 3DD4A 4MRXA 2ZN9A 3WHTB 3AAKA 4C0KA 1SL8A 1ZFSA 1NP8A 3NSLA 4PHNA 4HRGA 3TS5C 1K9KA 2P71A 3D73A 1PSBA 1SCMC 3PN7B 4MZLA 2R2IA 2FJYA 1S1EA 2KBIA 1QXPA 3VROA 1AVSA 1Q80A 2CTNA 2KFHA 2WNDA 3S0BA 1H8BA 3AKAA 3TUYC 1UWOA 5F6TA 3JVTB 2VRGA 1R2UA 2NCOA 3FIAA 3DXLA 2ISDA 2K8MB 1AK8A 2YGUA 2QEBA 3O78A 4C0LA 3D10A 2NZ0A 1J7PA 2EHBA 1BF5A 4DUQA 1DGUA 2QEHA 2TN4A 1V1FA 5K89A 3SS3A 1K96A 3EK8A 3O2PA 1DJXA 2BAPA 3GK4X 3E3RA 1DTLA 5G08A 1RFJA 2WCBA 3ZWHA 2WC8A 2AMIA 3LL8B 1XO5A 1CM1A 3TS5B 4ZCUA 2KPHA 1SCMB 1DELA 1KK7Z 1IH0A 3CLNA 2L5XB 3LLEA 4N1GA 2KI6D 2LMUA 3QRXA 4YI9A 1RK9A 2BL0C 1RROA 4DIRA 4I5NB 4CFQA 3TUYB 2K60A 2KFGA 3JTDC 1KFUS 1U5IA 3BOWA 1PALA 1F4QA 5HKZA 1NX3A 1UURA 4JWQA 1HQVA 3PLFB 3BQ3A 1F4OA 1VRKA 1FI6A 1OOGA 5KSZA 1C07A 1SPYA 1OMDA 4NQGA 1SMGA 1J55A 2FJUB 3BJHA 3HCMA 2PASA 5AXIA 1SY9A 2ZNEA 3L47A 1CLLA 1L2OB 1CMFA 1K95A 3EK4A 1TUJA 2KNEA 2JULA 1DEKA 3DF0A 1SL7A 3B7AA 1TNPA 2K7CA 2BBMA 1B7TY 1T14A 3SG5A 3CZ0A 2ZRSA 1JFKA 1DJWA 2GGMA 2M49B 2LVVA 2KAYA 2BL0B 1IG5A 1WRKA 3VGOA 4YGAA 2JT0A 1JSAA 3IQOA 1MXEA 3EK7A 1YRTB 4GGFC 3TZ1A 1U5IB 3D76A 2KAVA 3BUOB 2WC5A 2LLTA 2L2CA 5DKQA 1C7WA 4QJ3B 2LLUA 2WCEA 3PSRA 4NDDA 1SK6D 2P6BB 3CTNA 5PALA 2JPTA 3VRPA 1ZOTB 2KQYA 5HKWA 2K7OA 2WCMA 1QX7A 1HT9A 1QX2A 3M0WA 3EKJA 1KQVA 1Y1XA 1YX7A 1NSHA 3L4LA 3UO9A 1MQ1A 4MEWA 3EVVA 2ZFDA 4WQ3A 3BXKA 1S3PA 1F55A 2MRDA 2LHLA 3I5IC 1AJ4A 2E6WA 4ORAB 4F0ZB 1YUTA 1N0YA 5KU1A 2JTTA 1TTXA 4L9MA 3VRNA 2NXQA 1SSEB 1FF1A 1K9PA 1JF2A 2L0PA 4IJ7A 2GV5A 4PCWA 4CLNA 4WRIA 4YGCB 1G8IA 2EC6C 2BECA 2PVBA 1WRZA 2SASA 2LAPA 3OB1B 1MF8B 2MHHA 4R1EA 1S5GY 1YURA 2KLEA 5FYXA 4MVFA 2Y1NA 1KK8C 3K21A 1XYDA 1KWOC 2ZNDA 4I5LB 4YRUA 5AANA 2WCKA 2JXCA 1J1DA 4HSZA 1KFXS 1NCXA 1YX8A 3I5HC 4OR9B 2JXLA 3GOFA 2F8PA 2G9BA 1SNLA 2JPOA 2OS8C 3BUXB 4MLWA 5CSNA 3NGVA 2BKIB 1PVAA 1QX5B 4JPZB 3FWCA 4FQOA 4OZDA 3OP0A 5I94A 2L98A 4GUKA 1CFPA 1A29A 1OZOA 1LA3A 3BFAA 3NSOA 1BOCA 1R6PA 4ZCVA 1B1GA 3IVTA 1DQEA 1SR6C 2JT3A 1QV0A 2EC6B 3EG5B 2BKHB 1S36A 2O5GA 2F2OA 3CDNA 3PM2A 3BFBA 1MWNA 1TN4A 2PMYA 4IL1A 3CGAA 3WNXB 1KWOB 5ER5A 4JQ0D 1JWDA 3D75A 2SCPA 1SCVA 3MSEB 1S6IA 1OOHA 1XFWO 3I5HB 3N7HA 4MSPA 1C7VA 1BJFA 2P70A 2OS8B 3PM8A 4PT1A 1CKKA 1XK4C 4FTGA 1OQPA 3S0FA 1IWQA 1KK7Y 1NWDA 2MLEC 5D69A 2KYFA 2LUXA 3TDZA 2BCXA 2AUCA 1K90D 5CSFA 1GJYA 1A75B 1IQ5A 1S6CA 2ERBA 2H61C 1XFZO 3EVUA 3F45A 1QASA 3KHEA 5HLVA 3SIBA 1BLQA 2M9GA 2LC5A 4AQJA 1BG1A 2KYCA 4JD9A 1GGZA 2A4JA 1RTP1 3R1VA 4PDZA 1SR6B 2WCFA 3CABA 2HQWA 1SL9A 4PHKA 3SJSA 1EH2A 2KAXA 1TCFA 3WXAA 2MJWB 3KF9A 2M1UA 4HRHA 4GGNA 5I2LA 1CFCA 4M2QA 1TWOA 2FCDA 2M7LA 1FPWA 2COLB 4XJKB 3VRQA 2K2FA 2L2EA 5DKRA 2Q4UA 1YR5A 1NX1A 3PJIA 2WCHA 2JTZA 2KHNA 1AJ5A 2PALA 2BBNA 1JBAA 1CM4A 3I5FC 2GGZA 2Y4QA 4U8DA 3S0GA 1Y1UA 1WLMA 1PULA 1DJHA 1E8AA 1EL4A 3CR4X 3C1VA 4MBEA 1G33A 1WLZA 3B87A 3FWBA 4QJ4B 3ICBA 4MZJA 2MLFC 2FCEA 2OTGC 2HPSA 3V2LA 4GNKB 1H4BA 2WCLA 1CDMA 1JF0A 2LP3A 2JOJA 4OKHA 4XYNA 2M29A 3DVMA 2FOTA 2I18A 2KGRA 3O6BA 3K1EA 3RM1A 3SG2A 1N2DA 2JZIA 2V53A 3GK2A 4UPGA 1K93D 1FI5A 4PE1A 4GGFA 3SG3A 3JTDB 2KFFA 4CFRA 1WDCC 2KI4C 3KEVA 1ZACA 1AP4A 3NSKA 2QPTA 1N65A 1X02A 2LMTA 1QLKA 4PALA 1OOIX 2L5YA 1TNQA 4PE4A 1F54A 4GPLB 4DS7A 1LKJA 1NIWA 3I5FB 3PFVA 4NDBA 3SG4A 1A4PA 3I5GC 1QVIZ 2KGBC 2JC2A 1J7QA 3CYZA 3UNWA 4ICBA 1LS8A 1KSMA 1LA0A 2BNXA 3S0DA 1CLBA 1S26D 2LUCA 2F3YA 1W7JB 5EL2A 1TOPA 1L7ZA 3LK1A 3LCPC 1B8LA 1SBJA 1S6JA 2JU0A 1XFRA 5HKYA 2L4IA 2K61A 3FE9A 1WDCB 2KI4B 1DC1A 4WQ2A 3NHIA 2RGIA 4INXA 5CPVA 1OMVA 3KO0A 1TRFA 5B8IB 3FE6A 2OPOA 1C3YA 3BUMB 3RLZA 2Y1MA 1OOFA 3B6XA 3I5GB 1JUOA 1QTXA 1DF0B 3H4SE 5DKNA 2M7NA 5JJGA 1G4YR 5J3XA 2F3ZA 5AFPA 2L51A 2EGDA 3A4UB 4FQTA 3SG7A 1KQMC 4P2YB 1TNWA 2I2RE 4I5JA 1OOJA 3I5IB 1FBVA 3WHUB 1IKUA 1F71A 3QMEA 1RJVA 3BUNB 3OB2B 2HF5A 3PALA 1LVCD 1MR8A 1DGVA 3BYAA 4YGEB 5ER4X 1A75A 1GQMA 4GAOA 1JFJA 2DOQA 1TUZA 1J7RA 3EKHA 3SG6A 2LANA 1F70A 3CZ1A 3D74A 5D3OA 1OE9B 1IJ6A 1CDPA 1V1GA 2JT8A 2BCBA 2QEVA 5CSIA 2PYQA 1KK8B 5FI6A 1AHRA 1MHOA 4KYNA 1A2XA 2D8NA 4OCIA 3IQQA 4XJKA 2JNFA 1K2HA 3IF7A 3VB1A 2BE6A 1XFXO 1PVBA 2CNPA 3AKBA 2K7BA 4DCKA 1M31A 1KFUL 1OW4A 1KQMB 1B9AA 1DMOA 1BR1B 1XK4A 3DYEA 1F8HA 2CXJA 1UHKA 5HL1A 3S0EA 1C3ZA 1WY9A 1DJYA 2B1UA 3SIAA 5JOLA 1IRJA 2ZRTA 5BPJA 1B4CA 2H61A 1NX0A 3ZNIA 3LK0A 2QACA 3CR5X 1DJIA 5I2QA 1NPQA 3BUWB 1M39A 1TIZA 3DY9A 3NHTA 1BR4B 2M3WA 3L4AA 4E68A 1CNPA 1SYMA 4AQIA 3FS7A 4A4CA 2BCAA 3OX6A 2F2PA 1DJZA 1SW8A 4D1EA 1LINA 5D7FA 4QJ5B 1NUBA 4OVNF 2KOTA 3D78A 3NXAA 3OGNA 4DRWA 2MAZA 3B86A 1BU3A 2WOSA 4INWA 4OV2A 1NX2A 4PHMA 3D0YB 2KLDA 2WORA 2M97A 1ZUZA 3R1PA 1L2OC 4PE0A 1NCZA 3SS4A 5I8NA 2KDHA 1CFDA 1QATA 4JKTA 1CLMA 1UP5A 3OHMB 4I5KA 5DICA 3TDUA 1GGWA 4M2PA 3R1OA 5AERA 3D77A 3HX4A 1RECA 1EJ3A 2GTEA 2LVJA 2MA2A 3KPXA 1XFVO 1TNXA 4Q04A 1UHHA 1Y0VH 1D1OA 4YI8A 2AAOA 3DVEA 2CCMA 2KSPA 1KSOA 3SS5A 1J1EA 3VRRA 2WCJA 5AEQA 4YGBB 3TDIA 3A8RA 2HQ8A 4YGDB 1EG3A 1QVIY 4GFTA 3CZTX 5IBWA 5I2OA 3RZSA 1W7IB 2IS9A 1CDNA 1YVLA 1P28A 1KCYA 1QIWA 2KBMA 3CWGA 3CZ2A 2L50A 2H2KA 1BT6A 1XFUO 3O4XA 5GQQC 2K2AA 2LE9B 2LV7A 3DVKA 3EVRA 2Q91A 1M63B 3O4YA 4GBAA 1DF0A 1WRLA 4F7FA 2H8VA 1MXLC
chains in the Genus database with same CATH topology
3D75A 4FQTA 1QWVA 2PQLA 1OOHA 3N7HA 2P70A 4PT1A 1ORGA 1OOGA 3S0FA 3QMEA 3BJHA 3L47A 2ERBA 2QDIA 3R72A 1TUJA 3CZ1A 3D74A 4JD9A 3R1VA 3B7AA 3CABA 1T14A 2QEVA 3CZ0A 5EL2A 1TWOA 3VB1A 3D76A 3B88A 2WC5A 2L2CA 1OW4A 3PJIA 2WCHA 3DYEA 3S0EA 1C3ZA 3S0GA 2WC6A 1GM0A 3BFHA 2WCMA 3Q8IA 3B87A 3NHTA 3DY9A 3L4LA 3L4AA 3V2LA 2WCLA 2QEOA 3S0AA 3D78A 3K1EA 3OGNA 3B86A 4INWA 3FE8A 3DZTA 3R1PA 2P71A 1OOIX 3D73A 5DICA 3R1OA 2FJYA 3D77A 2GTEA 3S0BA 3CYZA 1LS8A 2WCKA 3S0DA 3DXLA 2JPOA 2QEBA 2WCJA 3NGVA 2QEHA 1XFRA 4OZDA 3FE9A 3RZSA 3NHIA 3BFAA 4INXA 1P28A 3CZ2A 1DQEA 3FE6A 2KPHA 1C3YA 1OOFA 3CDNA 3B6XA 4F7FA 2H8VA 3BFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D75 A;  4FQT A;  1QWV A;  2PQL A;  1OOH A;  3N7H A;  2P70 A;  4PT1 A;  1ORG A;  1OOG A;  3S0F A;  3QME A;  3BJH A;  3L47 A;  2ERB A;  2QDI A;  3R72 A;  1TUJ A;  3CZ1 A;  3D74 A;  4JD9 A;  3R1V A;  3B7A A;  3CAB A;  1T14 A;  2QEV A;  3CZ0 A;  5EL2 A;  1TWO A;  3VB1 A;  3D76 A;  3B88 A;  2WC5 A;  2L2C A;  1OW4 A;  3PJI A;  2WCH A;  3DYE A;  3S0E A;  1C3Z A;  3S0G A;  2WC6 A;  1GM0 A;  3BFH A;  2WCM A;  3Q8I A;  3B87 A;  3NHT A;  3DY9 A;  3L4L A;  3L4A A;  3V2L A;  2WCL A;  2QEO A;  3S0A A;  3D78 A;  3K1E A;  3OGN A;  3B86 A;  4INW A;  3FE8 A;  3DZT A;  3R1P A;  2P71 A;  1OOI X;  3D73 A;  5DIC A;  3R1O A;  2FJY A;  3D77 A;  2GTE A;  3S0B A;  3CYZ A;  1LS8 A;  2WCK A;  3S0D A;  3DXL A;  2JPO A;  2QEB A;  2WCJ A;  3NGV A;  2QEH A;  1XFR A;  4OZD A;  3FE9 A;  3RZS A;  3NHI A;  3BFA A;  4INX A;  1P28 A;  3CZ2 A;  1DQE A;  3FE6 A;  2KPH A;  1C3Y A;  1OOF A;  3CDN A;  3B6X A;  4F7F A;  2H8V A;  3BFB A; 
#chains in the Genus database with same CATH topology
 1YRU B;  2LNK A;  1UUS A;  2M8U A;  1ALW A;  2BE4 A;  1ODB A;  2OTG B;  4MZK A;  1EXR A;  4NDC A;  1MUX A;  5FI2 A;  1PRW A;  1QWV A;  2PQL A;  3BOW B;  1FW4 A;  1IQ3 A;  1IGV A;  4ORC B;  1KFX L;  1ORG A;  2LLS A;  1B7T Z;  3OX5 A;  2NCP A;  3PAT A;  4N5X A;  1LXF C;  2M1K B;  1B8C A;  1OZS A;  1RWY A;  4C0J A;  2NLN A;  2G2B A;  4MN0 A;  5TNC A;  2JQ6 A;  1B8R A;  1ZMZ A;  4ORB B;  5KTY A;  1K94 A;  1M46 A;  2MBX A;  1CMG A;  1QJT A;  1NYA A;  2QDI A;  3DVJ A;  1B47 A;  3R72 A;  1Y6W A;  4N1F A;  2LCP A;  1J7O A;  1UHJ A;  3OBV A;  1SRA A;  1CDL A;  1DT7 B;  4BY4 A;  5CSJ A;  3DF0 B;  4CID A;  1XFY O;  2LVK A;  1IIO A;  1QIV A;  2JNX A;  1PK0 D;  2O60 A;  1SKT A;  4PE7 A;  1Z2C B;  1XA5 A;  3CR2 A;  2JWW A;  1W9Z A;  1Z4H A;  4MRY A;  1JC2 A;  2KI6 C;  1A03 A;  1BOD A;  1ALV A;  2KQ6 A;  1BMO A;  5HLO A;  2I94 A;  3B88 A;  5HYD A;  2Y5I A;  3GK1 A;  2ZN8 A;  1NCY A;  1XVJ A;  1YTZ C;  3CS1 A;  4HRE E;  4CPV A;  1K9U A;  3PN7 C;  2PRU A;  1CTR A;  1YVH A;  4AOM A;  2CBL A;  1CB1 A;  4PHJ A;  2L4H A;  1Y1A A;  2K7D A;  2LM5 A;  2WC6 A;  1GM0 A;  1DJG A;  3BFH A;  2JRF A;  4P5O E;  2F33 A;  4TNC A;  2M0R A;  3NSI A;  3Q8I A;  2LP2 A;  1OMR A;  1EG4 A;  2E30 A;  4BY5 A;  2LVI A;  3JVT C;  1UHN A;  5FI7 A;  2PSR A;  1CFF A;  1AUI B;  1OSA A;  1UHI A;  2LHI A;  2QEO A;  3AAJ A;  1QLS A;  1TCO B;  4M2O A;  1S5G Z;  4ETO A;  1PSR A;  2HET A;  2I7A A;  3S0A A;  4USL A;  2ZKM X;  1DVI A;  1YUS A;  1YUU A;  3D0Y A;  3FE8 A;  2LMV A;  4YBH B;  2CT9 A;  3DZT A;  1QV1 A;  2K0J A;  1QS7 A;  1IJ5 A;  4A4B A;  1M45 A;  1K8U A;  3DD4 A;  4MRX A;  2ZN9 A;  3WHT B;  3AAK A;  4C0K A;  1SL8 A;  1ZFS A;  1NP8 A;  3NSL A;  4PHN A;  4HRG A;  3TS5 C;  1K9K A;  2P71 A;  3D73 A;  1PSB A;  1SCM C;  3PN7 B;  4MZL A;  2R2I A;  2FJY A;  1S1E A;  2KBI A;  1QXP A;  3VRO A;  1AVS A;  1Q80 A;  2CTN A;  2KFH A;  2WND A;  3S0B A;  1H8B A;  3AKA A;  3TUY C;  1UWO A;  5F6T A;  3JVT B;  2VRG A;  1R2U A;  2NCO A;  3FIA A;  3DXL A;  2ISD A;  2K8M B;  1AK8 A;  2YGU A;  2QEB A;  3O78 A;  4C0L A;  3D10 A;  2NZ0 A;  1J7P A;  2EHB A;  1BF5 A;  4DUQ A;  1DGU A;  2QEH A;  2TN4 A;  1V1F A;  5K89 A;  3SS3 A;  1K96 A;  3EK8 A;  3O2P A;  1DJX A;  2BAP A;  3GK4 X;  3E3R A;  1DTL A;  5G08 A;  1RFJ A;  2WCB A;  3ZWH A;  2WC8 A;  2AMI A;  3LL8 B;  1XO5 A;  1CM1 A;  3TS5 B;  4ZCU A;  2KPH A;  1SCM B;  1DEL A;  1KK7 Z;  1IH0 A;  3CLN A;  2L5X B;  3LLE A;  4N1G A;  2KI6 D;  2LMU A;  3QRX A;  4YI9 A;  1RK9 A;  2BL0 C;  1RRO A;  4DIR A;  4I5N B;  4CFQ A;  3TUY B;  2K60 A;  2KFG A;  3JTD C;  1KFU S;  1U5I A;  3BOW A;  1PAL A;  1F4Q A;  5HKZ A;  1NX3 A;  1UUR A;  4JWQ A;  1HQV A;  3PLF B;  3BQ3 A;  1F4O A;  1VRK A;  1FI6 A;  1OOG A;  5KSZ A;  1C07 A;  1SPY A;  1OMD A;  4NQG A;  1SMG A;  1J55 A;  2FJU B;  3BJH A;  3HCM A;  2PAS A;  5AXI A;  1SY9 A;  2ZNE A;  3L47 A;  1CLL A;  1L2O B;  1CMF A;  1K95 A;  3EK4 A;  1TUJ A;  2KNE A;  2JUL A;  1DEK A;  3DF0 A;  1SL7 A;  3B7A A;  1TNP A;  2K7C A;  2BBM A;  1B7T Y;  1T14 A;  3SG5 A;  3CZ0 A;  2ZRS A;  1JFK A;  1DJW A;  2GGM A;  2M49 B;  2LVV A;  2KAY A;  2BL0 B;  1IG5 A;  1WRK A;  3VGO A;  4YGA A;  2JT0 A;  1JSA A;  3IQO A;  1MXE A;  3EK7 A;  1YRT B;  4GGF C;  3TZ1 A;  1U5I B;  3D76 A;  2KAV A;  3BUO B;  2WC5 A;  2LLT A;  2L2C A;  5DKQ A;  1C7W A;  4QJ3 B;  2LLU A;  2WCE A;  3PSR A;  4NDD A;  1SK6 D;  2P6B B;  3CTN A;  5PAL A;  2JPT A;  3VRP A;  1ZOT B;  2KQY A;  5HKW A;  2K7O A;  2WCM A;  1QX7 A;  1HT9 A;  1QX2 A;  3M0W A;  3EKJ A;  1KQV A;  1Y1X A;  1YX7 A;  1NSH A;  3L4L A;  3UO9 A;  1MQ1 A;  4MEW A;  3EVV A;  2ZFD A;  4WQ3 A;  3BXK A;  1S3P A;  1F55 A;  2MRD A;  2LHL A;  3I5I C;  1AJ4 A;  2E6W A;  4ORA B;  4F0Z B;  1YUT A;  1N0Y A;  5KU1 A;  2JTT A;  1TTX A;  4L9M A;  3VRN A;  2NXQ A;  1SSE B;  1FF1 A;  1K9P A;  1JF2 A;  2L0P A;  4IJ7 A;  2GV5 A;  4PCW A;  4CLN A;  4WRI A;  4YGC B;  1G8I A;  2EC6 C;  2BEC A;  2PVB A;  1WRZ A;  2SAS A;  2LAP A;  3OB1 B;  1MF8 B;  2MHH A;  4R1E A;  1S5G Y;  1YUR A;  2KLE A;  5FYX A;  4MVF A;  2Y1N A;  1KK8 C;  3K21 A;  1XYD A;  1KWO C;  2ZND A;  4I5L B;  4YRU A;  5AAN A;  2WCK A;  2JXC A;  1J1D A;  4HSZ A;  1KFX S;  1NCX A;  1YX8 A;  3I5H C;  4OR9 B;  2JXL A;  3GOF A;  2F8P A;  2G9B A;  1SNL A;  2JPO A;  2OS8 C;  3BUX B;  4MLW A;  5CSN A;  3NGV A;  2BKI B;  1PVA A;  1QX5 B;  4JPZ B;  3FWC A;  4FQO A;  4OZD A;  3OP0 A;  5I94 A;  2L98 A;  4GUK A;  1CFP A;  1A29 A;  1OZO A;  1LA3 A;  3BFA A;  3NSO A;  1BOC A;  1R6P A;  4ZCV A;  1B1G A;  3IVT A;  1DQE A;  1SR6 C;  2JT3 A;  1QV0 A;  2EC6 B;  3EG5 B;  2BKH B;  1S36 A;  2O5G A;  2F2O A;  3CDN A;  3PM2 A;  3BFB A;  1MWN A;  1TN4 A;  2PMY A;  4IL1 A;  3CGA A;  3WNX B;  1KWO B;  5ER5 A;  4JQ0 D;  1JWD A;  3D75 A;  2SCP A;  1SCV A;  3MSE B;  1S6I A;  1OOH A;  1XFW O;  3I5H B;  3N7H A;  4MSP A;  1C7V A;  1BJF A;  2P70 A;  2OS8 B;  3PM8 A;  4PT1 A;  1CKK A;  1XK4 C;  4FTG A;  1OQP A;  3S0F A;  1IWQ A;  1KK7 Y;  1NWD A;  2MLE C;  5D69 A;  2KYF A;  2LUX A;  3TDZ A;  2BCX A;  2AUC A;  1K90 D;  5CSF A;  1GJY A;  1A75 B;  1IQ5 A;  1S6C A;  2ERB A;  2H61 C;  1XFZ O;  3EVU A;  3F45 A;  1QAS A;  3KHE A;  5HLV A;  3SIB A;  1BLQ A;  2M9G A;  2LC5 A;  4AQJ A;  1BG1 A;  2KYC A;  4JD9 A;  1GGZ A;  2A4J A;  1RTP 1;  3R1V A;  4PDZ A;  1SR6 B;  2WCF A;  3CAB A;  2HQW A;  1SL9 A;  4PHK A;  3SJS A;  1EH2 A;  2KAX A;  1TCF A;  3WXA A;  2MJW B;  3KF9 A;  2M1U A;  4HRH A;  4GGN A;  5I2L A;  1CFC A;  4M2Q A;  1TWO A;  2FCD A;  2M7L A;  1FPW A;  2COL B;  4XJK B;  3VRQ A;  2K2F A;  2L2E A;  5DKR A;  2Q4U A;  1YR5 A;  1NX1 A;  3PJI A;  2WCH A;  2JTZ A;  2KHN A;  1AJ5 A;  2PAL A;  2BBN A;  1JBA A;  1CM4 A;  3I5F C;  2GGZ A;  2Y4Q A;  4U8D A;  3S0G A;  1Y1U A;  1WLM A;  1PUL A;  1DJH A;  1E8A A;  1EL4 A;  3CR4 X;  3C1V A;  4MBE A;  1G33 A;  1WLZ A;  3B87 A;  3FWB A;  4QJ4 B;  3ICB A;  4MZJ A;  2MLF C;  2FCE A;  2OTG C;  2HPS A;  3V2L A;  4GNK B;  1H4B A;  2WCL A;  1CDM A;  1JF0 A;  2LP3 A;  2JOJ A;  4OKH A;  4XYN A;  2M29 A;  3DVM A;  2FOT A;  2I18 A;  2KGR A;  3O6B A;  3K1E A;  3RM1 A;  3SG2 A;  1N2D A;  2JZI A;  2V53 A;  3GK2 A;  4UPG A;  1K93 D;  1FI5 A;  4PE1 A;  4GGF A;  3SG3 A;  3JTD B;  2KFF A;  4CFR A;  1WDC C;  2KI4 C;  3KEV A;  1ZAC A;  1AP4 A;  3NSK A;  2QPT A;  1N65 A;  1X02 A;  2LMT A;  1QLK A;  4PAL A;  1OOI X;  2L5Y A;  1TNQ A;  4PE4 A;  1F54 A;  4GPL B;  4DS7 A;  1LKJ A;  1NIW A;  3I5F B;  3PFV A;  4NDB A;  3SG4 A;  1A4P A;  3I5G C;  1QVI Z;  2KGB C;  2JC2 A;  1J7Q A;  3CYZ A;  3UNW A;  4ICB A;  1LS8 A;  1KSM A;  1LA0 A;  2BNX A;  3S0D A;  1CLB A;  1S26 D;  2LUC A;  2F3Y A;  1W7J B;  5EL2 A;  1TOP A;  1L7Z A;  3LK1 A;  3LCP C;  1B8L A;  1SBJ A;  1S6J A;  2JU0 A;  1XFR A;  5HKY A;  2L4I A;  2K61 A;  3FE9 A;  1WDC B;  2KI4 B;  1DC1 A;  4WQ2 A;  3NHI A;  2RGI A;  4INX A;  5CPV A;  1OMV A;  3KO0 A;  1TRF A;  5B8I B;  3FE6 A;  2OPO A;  1C3Y A;  3BUM B;  3RLZ A;  2Y1M A;  1OOF A;  3B6X A;  3I5G B;  1JUO A;  1QTX A;  1DF0 B;  3H4S E;  5DKN A;  2M7N A;  5JJG A;  1G4Y R;  5J3X A;  2F3Z A;  5AFP A;  2L51 A;  2EGD A;  3A4U B;  4FQT A;  3SG7 A;  1KQM C;  4P2Y B;  1TNW A;  2I2R E;  4I5J A;  1OOJ A;  3I5I B;  1FBV A;  3WHU B;  1IKU A;  1F71 A;  3QME A;  1RJV A;  3BUN B;  3OB2 B;  2HF5 A;  3PAL A;  1LVC D;  1MR8 A;  1DGV A;  3BYA A;  4YGE B;  5ER4 X;  1A75 A;  1GQM A;  4GAO A;  1JFJ A;  2DOQ A;  1TUZ A;  1J7R A;  3EKH A;  3SG6 A;  2LAN A;  1F70 A;  3CZ1 A;  3D74 A;  5D3O A;  1OE9 B;  1IJ6 A;  1CDP A;  1V1G A;  2JT8 A;  2BCB A;  2QEV A;  5CSI A;  2PYQ A;  1KK8 B;  5FI6 A;  1AHR A;  1MHO A;  4KYN A;  1A2X A;  2D8N A;  4OCI A;  3IQQ A;  4XJK A;  2JNF A;  1K2H A;  3IF7 A;  3VB1 A;  2BE6 A;  1XFX O;  1PVB A;  2CNP A;  3AKB A;  2K7B A;  4DCK A;  1M31 A;  1KFU L;  1OW4 A;  1KQM B;  1B9A A;  1DMO A;  1BR1 B;  1XK4 A;  3DYE A;  1F8H A;  2CXJ A;  1UHK A;  5HL1 A;  3S0E A;  1C3Z A;  1WY9 A;  1DJY A;  2B1U A;  3SIA A;  5JOL A;  1IRJ A;  2ZRT A;  5BPJ A;  1B4C A;  2H61 A;  1NX0 A;  3ZNI A;  3LK0 A;  2QAC A;  3CR5 X;  1DJI A;  5I2Q A;  1NPQ A;  3BUW B;  1M39 A;  1TIZ A;  3DY9 A;  3NHT A;  1BR4 B;  2M3W A;  3L4A A;  4E68 A;  1CNP A;  1SYM A;  4AQI A;  3FS7 A;  4A4C A;  2BCA A;  3OX6 A;  2F2P A;  1DJZ A;  1SW8 A;  4D1E A;  1LIN A;  5D7F A;  4QJ5 B;  1NUB A;  4OVN F;  2KOT A;  3D78 A;  3NXA A;  3OGN A;  4DRW A;  2MAZ A;  3B86 A;  1BU3 A;  2WOS A;  4INW A;  4OV2 A;  1NX2 A;  4PHM A;  3D0Y B;  2KLD A;  2WOR A;  2M97 A;  1ZUZ A;  3R1P A;  1L2O C;  4PE0 A;  1NCZ A;  3SS4 A;  5I8N A;  2KDH A;  1CFD A;  1QAT A;  4JKT A;  1CLM A;  1UP5 A;  3OHM B;  4I5K A;  5DIC A;  3TDU A;  1GGW A;  4M2P A;  3R1O A;  5AER A;  3D77 A;  3HX4 A;  1REC A;  1EJ3 A;  2GTE A;  2LVJ A;  2MA2 A;  3KPX A;  1XFV O;  1TNX A;  4Q04 A;  1UHH A;  1Y0V H;  1D1O A;  4YI8 A;  2AAO A;  3DVE A;  2CCM A;  2KSP A;  1KSO A;  3SS5 A;  1J1E A;  3VRR A;  2WCJ A;  5AEQ A;  4YGB B;  3TDI A;  3A8R A;  2HQ8 A;  4YGD B;  1EG3 A;  1QVI Y;  4GFT A;  3CZT X;  5IBW A;  5I2O A;  3RZS A;  1W7I B;  2IS9 A;  1CDN A;  1YVL A;  1P28 A;  1KCY A;  1QIW A;  2KBM A;  3CWG A;  3CZ2 A;  2L50 A;  2H2K A;  1BT6 A;  1XFU O;  3O4X A;  5GQQ C;  2K2A A;  2LE9 B;  2LV7 A;  3DVK A;  3EVR A;  2Q91 A;  1M63 B;  3O4Y A;  4GBA A;  1DF0 A;  1WRL A;  4F7F A;  2H8V A;  1MXL C; 
#chains in the Genus database with same CATH homology
 3D75 A;  4FQT A;  1QWV A;  2PQL A;  1OOH A;  3N7H A;  2P70 A;  4PT1 A;  1ORG A;  1OOG A;  3S0F A;  3QME A;  3BJH A;  3L47 A;  2ERB A;  2QDI A;  3R72 A;  1TUJ A;  3CZ1 A;  3D74 A;  4JD9 A;  3R1V A;  3B7A A;  3CAB A;  1T14 A;  2QEV A;  3CZ0 A;  5EL2 A;  1TWO A;  3VB1 A;  3D76 A;  3B88 A;  2WC5 A;  2L2C A;  1OW4 A;  3PJI A;  2WCH A;  3DYE A;  3S0E A;  1C3Z A;  3S0G A;  2WC6 A;  1GM0 A;  3BFH A;  2WCM A;  3Q8I A;  3B87 A;  3NHT A;  3DY9 A;  3L4L A;  3L4A A;  3V2L A;  2WCL A;  2QEO A;  3S0A A;  3D78 A;  3K1E A;  3OGN A;  3B86 A;  4INW A;  3FE8 A;  3DZT A;  3R1P A;  2P71 A;  1OOI X;  3D73 A;  5DIC A;  3R1O A;  2FJY A;  3D77 A;  2GTE A;  3S0B A;  3CYZ A;  1LS8 A;  2WCK A;  3S0D A;  3DXL A;  2JPO A;  2QEB A;  2WCJ A;  3NGV A;  2QEH A;  1XFR A;  4OZD A;  3FE9 A;  3RZS A;  3NHI A;  3BFA A;  4INX A;  1P28 A;  3CZ2 A;  1DQE A;  3FE6 A;  2KPH A;  1C3Y A;  1OOF A;  3CDN A;  3B6X A;  4F7F A;  2H8V A;  3BFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...