2K0JA

Solution structure of cam complexed to drp1p
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
147
structure length
147
Chain Sequence
DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Accurate solution structures of proteins from X-ray data and a minimal set of NMR data: calmodulin-peptide complexes as examples.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords calmodulin
total genus 46
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k0jA00
5F6TA 1OMRA 2WOSA 1YR5A 1MXEA 1A03A 1MQ1A 4GBAA 1BR4B 3D10A 1SR6B 1QLKA 1J7OA 1K2HA 1QIVA 1AHRA 2DOQA 1SCVA 4MVFA 3BOWA 1CDNA 1SNLA 1B8CA 1KWOC 2HQ8A 1RROA 3BOWB 2LLUA 4YGBB 1DJYA 2H61A 1NX1A 1S36A 2LLSA 3NSLA 1CLBA 3TDUA 5J3XA 2JNXA 1CMFA 1RWYA 1BODA 4XJKB 1MR8A 5FYXA 1PVAA 2LLTA 4FTGA 2JZIA 4XJKA 2KAXA 2NLNA 1U5IA 1NYAA 1JC2A 3LCPC 2MAZA 4GAOA 1CM1A 2O5GA 2WC8A 1IH0A 2H2KA 2LVVA 4MZKA 1B7TZ 4PHJA 3LL8B 3CLNA 2PVBA 5D7FA 1TN4A 1K9UA 1QTXA 1UHJA 2PRUA 1YURA 1RFJA 1K93D 2ZKMX 2BBNA 2ISDA 1PK0D 1M31A 5GQQC 2FCEA 3BUMB 1XFWO 1XK4C 4M2PA 1S6IA 4WQ3A 4AOMA 1SMGA 4M2QA 2PMYA 5KU1A 4E68A 3AAJA 4PHNA 3DVMA 2I7AA 4Q04A 1A4PA 2FOTA 2L50A 3A4UB 1TNPA 2KOTA 1LVCD 3CS1A 3PM8A 4NDDA 1S5GZ 1JBAA 1EL4A 3WXAA 1JF0A 3HCMA 2KFGA 4GUKA 3ICBA 2G2BA 5DKQA 1UHIA 2BBMA 1KWOB 3O2PA 3C1VA 2NXQA 4M2OA 1J7QA 1KCYA 2MRDA 2LP2A 1M45A 3PN7C 1PALA 1BJFA 3GK1A 1JSAA 1XFXO 1W7IB 4NDCA 4N5XA 1M39A 1LA0A 4D1EA 1BF5A 4JPZB 4U8DA 1YVLA 2KSPA 1UUSA 1XFYO 1CB1A 3CGAA 1F8HA 2K2FA 1IGVA 1K90D 5CSNA 2ZRSA 2BE4A 1DF0B 1KQMC 2KFHA 2A4JA 1KK7Z 1J55A 2BKIB 1CMGA 1Y1AA 1F55A 1SL8A 2K0JA 4I5NB 4DS7A 1GGWA 4PE4A 2CBLA 1OMDA 2M7LA 3RM1A 1SKTA 2CXJA 2K2AA 1AVSA 1DVIA 2RGIA 3A8RA 3WHTB 2D8NA 2KNEA 3KEVA 2BE6A 2CTNA 2JC2A 2SCPA 3DF0B 2WCEA 3DF0A 3CR4X 1QASA 4YGDB 1MHOA 4OCIA 5G08A 1VRKA 2ZFDA 2K7OA 1TCFA 3LK1A 4P5OE 4N1GA 4ORCB 2JPTA 1KFUL 2HETA 2HQWA 4YI9A 1SW8A 1E8AA 1K8UA 1K94A 5AANA 1CLMA 2LMTA 1RTP1 1GJYA 1B9AA 1PRWA 2JOJA 1Y1UA 1V1GA 4F0ZB 4DIRA 1MUXA 1DJXA 2BKHB 2F33A 4DCKA 3K21A 5BPJA 1TRFA 1X02A 1IJ5A 2CT9A 2H61C 2LHIA 2F2OA 1KK8C 1QIWA 3JVTC 5CSJA 2LE9B 3FS7A 3I5IB 5I8NA 1DJZA 2FJUB 3NSKA 4I5JA 1NX3A 1NPQA 1QX5B 1AJ5A 1S1EA 2EC6B 2KQ6A 3MSEB 4MZLA 1B8LA 1IG5A 1DGUA 2KI6D 1H4BA 3RLZA 1YUSA 4WRIA 1ZACA 4C0JA 3TZ1A 1DMOA 2JT0A 5ER5A 5HKYA 1B4CA 1MWNA 1B8RA 1GGZA 3I5GC 4HRGA 1F70A 2JT3A 2EHBA 1OQPA 2KBMA 1DJHA 2MHHA 1WRLA 2NCOA 1F54A 3JTDC 1G4YR 2JTZA 1OE9B 1XO5A 2FCDA 2JXLA 4MLWA 1F71A 1JUOA 4OKHA 1EG3A 1R6PA 2I18A 2KAYA 3BYAA 5I2LA 3M0WA 3E3RA 1MF8B 5AERA 1J1DA 1XFVO 2JU0A 3NXAA 4XYNA 3GOFA 4MZJA 4FQOA 2BCBA 3H4SE 4JWQA 2M1KB 2M7NA 2LV7A 3OX6A 4QJ4B 1NP8A 3BQ3A 1NUBA 1OSAA 1XA5A 1YX7A 1K95A 1S6JA 3EVRA 3O4YA 1UURA 1LXFC 1CDLA 2WORA 2K7DA 2OTGB 3AKBA 1ZFSA 2L2EA 3EK7A 4C0LA 5K89A 1CDMA 2KFFA 1QVIY 4MEWA 1XK4A 1CKKA 1ALWA 3EVUA 4NDBA 4CFRA 3SG7A 2EC6C 1ODBA 4ORBB 1DT7B 2LP3A 1Y1XA 4L9MA 1CFDA 2LANA 3FWCA 1SBJA 1UWOA 4PHKA 2B1UA 1IWQA 4I5LB 1DJIA 1UHKA 2MJWB 4GGFA 4ORAB 1M46A 1SK6D 4I5KA 3DD4A 1F4OA 1YX8A 3QRXA 1KFUS 1AP4A 1KSOA 2JULA 1FPWA 1K96A 2M3WA 3JTDB 4PDZA 4WQ2A 3LK0A 3NSOA 3ZNIA 3FIAA 3D0YA 1TIZA 4QJ3B 3KF9A 3D0YB 2ZNDA 5KTYA 1QATA 1BOCA 2WCFA 4OR9B 1B1GA 1NIWA 1F4QA 2COLB 1L7ZA 4PALA 2KI6C 2GGZA 3OX5A 1YTZC 1D1OA 1KK7Y 1N65A 2F2PA 4CFQA 1J7RA 1KFXL 3SG4A 2LMVA 3SJSA 1SCMC 1H8BA 1A2XA 1NSHA 2Y5IA 1LA3A 1OMVA 2BECA 4P2YB 1OZOA 1NWDA 2HPSA 2LVJA 4ICBA 2L4IA 2V53A 2KGRA 1EJ3A 1NCYA 4PE7A 1TNQA 2K7BA 1J7PA 5PALA 4MN0A 2JT8A 1SCMB 3BUNB 5AFPA 4MRXA 3EKJA 1YRUB 2JNFA 1U5IB 1DTLA 3DVEA 3PLFB 2MLFC 1DJGA 2KGBC 1TCOB 5DKNA 1YVHA 1QXPA 2L4HA 3KO0A 2SASA 3OP0A 1Q80A 4OV2A 5CSIA 5HKWA 3DVKA 3I5HB 2KBIA 3PFVA 5CSFA 3SG3A 2QACA 1NCXA 1SY9A 1UHHA 3DVJA 4PCWA 3BUXB 4DRWA 4A4CA 1WLZA 3LLEA 2M49B 1ALVA 3TS5C 1BMOA 1G8IA 4HREE 2VRGA 1YUTA 2NZ0A 2L0PA 2PASA 1S3PA 2M9GA 4JQ0D 1QJTA 1TTXA 2KI4C 2JQ6A 4HRHA 5KSZA 3BUOB 5HYDA 4ZCVA 3GK4X 3SG6A 1OZSA 1SYMA 5HLVA 3GK2A 1LKJA 2GGMA 2L5XB 1CNPA 1K9PA 3CZTX 2JRFA 4GGFC 1NX0A 2LUCA 1XYDA 1YRTB 1XFZO 1L2OB 4GNKB 1A75A 3CR2A 5CPVA 1XFUO 2L98A 1PULA 3I5FB 5I2OA 1WDCC 1FI5A 3OB1B 1KQMB 4C0KA 2WNDA 2LC5A 2ZN8A 3OHMB 1GQMA 1R2UA 4YGAA 1JF2A 1W7JB 2R2IA 2BCXA 3BUWB 3VGOA 2ZN9A 2K61A 2Y4QA 3AKAA 1CLLA 3CTNA 2OS8B 1PSRA 1TNXA 1IQ5A 2LMUA 1QLSA 3PALA 3EVVA 2BCAA 3IQQA 1A75B 1PVBA 1Y0VH 3TS5B 1BT6A 2E6WA 5IBWA 2BL0C 1L2OC 4IL1A 5B8IB 2M29A 1SL7A 2K7CA 2Y1NA 1QV1A 1IRJA 3I5GB 1JFJA 1JWDA 1BU3A 3SG5A 4CPVA 1C07A 3WNXB 3HX4A 2HF5A 1CTRA 1WDCB 3I5HC 1QVIZ 1DJWA 2M8UA 1BR1B 4GPLB 3VRNA 1XVJA 4BY4A 1FBVA 2ZNEA 5DKRA 1B7TY 5HLOA 1CFCA 2F8PA 2KYFA 2TN4A 2OS8C 1AJ4A 5AEQA 1A29A 4YRUA 2GV5A 2K8MB 3EK4A 3CWGA 2OPOA 4ZCUA 5HKZA 1AUIB 2AMIA 1LINA 2E30A 1M63B 3FWBA 3VRPA 1C7WA 1YUUA 5I2QA 3JVTB 1K9KA 3I5FC 3IF7A 1WLMA 3WHUB 1ZOTB 2Y1MA 4PE0A 1DGVA 5D69A 3KPXA 4YGCB 1EXRA 1ZMZA 2CNPA 1IQ3A 2KHNA 2I94A 2OTGC 1N2DA 2CCMA 4NQGA 1S5GY 1N0YA 2F3ZA 1QV0A 2Q91A 2EGDA 4CLNA 1J1EA 1QS7A 1V1FA 5TNCA 3VRQA 1EG4A 4OVNF 3SIBA 2MBXA 1AK8A 2JWWA 1RJVA 1NCZA 4BY5A 3TDZA 2JTTA 2O60A 4MRYA 3TUYB 4HSZA 2L51A 4YI8A 1TNWA 1Y6WA 3SG2A 1BG1A 1NX2A 3PSRA 2KAVA 4QJ5B 1S26D 2PALA 5JJGA 1ZUZA 3ZWHA 5AXIA 2AAOA 2I2RE 1C7VA 2MLEC 4PHMA 3SIAA 2LUXA 1TOPA 2M97A 1MXLC 1G33A 1CFFA 2P6BB 2IS9A 1KSMA 3BXKA 1SPYA 1CDPA 3TDIA 1KQVA 4AQIA 2BL0B 1WRKA 1WRZA 4MSPA 4TNCA 4USLA 4YGEB 1UP5A 2LAPA 2KQYA 1IKUA 2LCPA 5JOLA 1QX2A 1RECA 2NCPA 2QPTA 3KHEA 1PSBA 1BLQA 1KFXS 1B47A 1HQVA 1WY9A 1FF1A 2AUCA 2M1UA 3O78A 1IJ6A 3TUYC 2KDHA 2MA2A 2LVKA 3IQOA 3EKHA 1KK8B 2LNKA 3PATA 4N1FA 4PE1A 1RK9A 1CFPA 1FW4A 2PSRA 3I5IC 3VROA 1OOJA 2M0RA 1SR6C 3EK8A 1SL9A 3VRRA 2KYCA 1CM4A 4MBEA 1S6CA 2G9BA 2KI4B 4CIDA 2F3YA 4UPGA 3NSIA 1SRAA 5ER4X 2Q4UA 3O6BA 4AQJA 2WCBA 2JXCA 3CR5X 4ETOA 1HT9A 4A4BA 1EH2A 1QX7A 2ZRTA 1FI6A 1JFKA 4DUQA 1UHNA 4GFTA 2LVIA 2LM5A 2LHLA 3F45A 3OB2B 3PN7B 4R1EA 4YBHB 4GGNA 1DF0A 3AAKA
chains in the Genus database with same CATH superfamily
5F6TA 1OMRA 2WOSA 1YR5A 2YGUA 1MXEA 1A03A 1MQ1A 4GBAA 1BR4B 3D10A 1SR6B 5EL2A 1QLKA 1J7OA 1K2HA 1QIVA 1AHRA 2DOQA 1SCVA 4MVFA 2QEVA 3BOWA 1CDNA 1SNLA 1B8CA 1KWOC 2HQ8A 1RROA 3BOWB 2LLUA 4YGBB 1DJYA 2H61A 1NX1A 1S36A 2LLSA 3NSLA 1CLBA 3TDUA 5J3XA 2JNXA 1CMFA 1RWYA 3R1OA 3D76A 1BODA 4XJKB 1MR8A 5FYXA 1PVAA 2LLTA 4FTGA 2JZIA 3NHIA 4XJKA 2KAXA 2NLNA 1U5IA 1NYAA 1JC2A 2WCLA 2MAZA 3LCPC 1CM1A 2O5GA 2WC8A 4GAOA 2H2KA 1IH0A 2LVVA 4MZKA 1B7TZ 3L4AA 5FI7A 1DC1A 4PHJA 3LL8B 3CLNA 1XFRA 2PVBA 5D7FA 1TN4A 1K9UA 1QTXA 1UHJA 2PRUA 1YURA 1RFJA 1K93D 2ZKMX 3PM2A 2BBNA 2ISDA 1PK0D 1M31A 5GQQC 3D77A 2FCEA 3BUMB 1XFWO 1XK4C 4M2PA 1S6IA 4WQ3A 4AOMA 1SMGA 4M2QA 2PMYA 5KU1A 4E68A 3AAJA 4PHNA 3DVMA 2I7AA 4Q04A 1A4PA 2FOTA 2L50A 3A4UB 1TNPA 2KOTA 1LVCD 3CS1A 3PM8A 4NDDA 1S5GZ 1JBAA 1EL4A 3WXAA 1JF0A 3HCMA 2KFGA 4GUKA 3ICBA 2G2BA 5DKQA 1UHIA 2BBMA 1KWOB 1OW4A 3O2PA 5HL1A 3C1VA 2NXQA 4M2OA 1J7QA 1KCYA 2MRDA 2LP2A 1M45A 2QEBA 4INWA 3PN7C 1DQEA 1PALA 1BJFA 3GK1A 1JSAA 1DEKA 1XFXO 1W7IB 4NDCA 4N5XA 1M39A 1LA0A 4D1EA 1BF5A 4JPZB 4U8DA 1OOHA 1YVLA 2KSPA 3Q8IA 1UUSA 1XFYO 4IJ7A 1CB1A 3CGAA 1F8HA 2K2FA 1IGVA 1K90D 5CSNA 2ZRSA 2QDIA 2BE4A 3B87A 3IVTA 1DF0B 1KQMC 3R72A 2KFHA 2A4JA 1KK7Z 1J55A 2BKIB 2BAPA 4PT1A 1Z2CB 1CMGA 1Y1AA 1F55A 1SL8A 2K0JA 4I5NB 4DS7A 4INXA 3DXLA 4PE4A 2CBLA 1OMDA 4JD9A 1GGWA 2M7LA 3RM1A 1SKTA 2CXJA 2K2AA 1AVSA 3FE9A 1DVIA 2RGIA 3A8RA 3WHTB 2D8NA 2KNEA 2WCKA 3KEVA 2BE6A 2CTNA 2JC2A 2SCPA 3DF0B 2WCEA 3DF0A 3CR4X 1QASA 4YGDB 1MHOA 4OCIA 5G08A 1VRKA 2ZFDA 2K7OA 1TCFA 3LK1A 4P5OE 4N1GA 4ORCB 2JPTA 1KFUL 2HETA 2HQWA 4YI9A 1SW8A 1E8AA 1K8UA 1K94A 5AANA 1CLMA 1Z4HA 2LMTA 1RTP1 2ERBA 3R1PA 1GJYA 1B9AA 4OZDA 1PRWA 3L47A 2KLEA 1OOIX 3BFBA 2WC6A 2JOJA 1Y1UA 1V1GA 4F0ZB 4DIRA 1MUXA 1DJXA 2BKHB 2WCMA 1C3YA 2F33A 4DCKA 3K21A 5BPJA 1TRFA 1X02A 1IJ5A 2CT9A 2KPHA 2H61C 2LHIA 2F2OA 1KK8C 1QIWA 2P71A 3JVTC 2H8VA 3S0FA 5CSJA 2LE9B 3FS7A 3I5IB 5I8NA 3FE6A 1DJZA 2FJUB 3NSKA 4I5JA 1NX3A 1NPQA 1QX5B 1AJ5A 1S1EA 2EC6B 2KQ6A 3MSEB 4MZLA 1B8LA 2WC5A 1IG5A 1DGUA 2KI6D 1H4BA 3RLZA 1YUSA 4WRIA 1ZACA 4C0JA 3TZ1A 1DMOA 2JT0A 5ER5A 5HKYA 1B4CA 1MWNA 3NHTA 1B8RA 1GGZA 3RZSA 3I5GC 4HRGA 1F70A 2JT3A 2EHBA 1OQPA 2KBMA 1DJHA 2MHHA 1WRLA 2NCOA 1F54A 3JTDC 1G4YR 2JTZA 1OE9B 1XO5A 2FCDA 2JXLA 3CZ2A 4MLWA 1F71A 1JUOA 4OKHA 1EG3A 3BFAA 1R6PA 2I18A 2KAYA 3BYAA 5I2LA 3M0WA 3E3RA 1MF8B 5AERA 1J1DA 1XFVO 2JU0A 3B86A 3NXAA 4XYNA 3GOFA 4MZJA 4FQOA 2BCBA 3H4SE 4F7FA 5DICA 4JWQA 2M1KB 1IIOA 2M7NA 2LV7A 3OX6A 4QJ4B 5FI2A 2PQLA 1NP8A 3BQ3A 1NUBA 1OSAA 1XA5A 1YX7A 1K95A 1S6JA 3EVRA 3O4YA 1UURA 1LXFC 1CDLA 2WORA 2K7DA 2OTGB 3AKBA 1ZFSA 2L2EA 3EK7A 4C0LA 5K89A 1CDMA 2KFFA 3D78A 1QVIY 4MEWA 1XK4A 1CKKA 2GTEA 1ALWA 3EVUA 4NDBA 4CFRA 3SG7A 2EC6C 1ODBA 4ORBB 1DT7B 3B6XA 1DELA 1ORGA 2LP3A 1Y1XA 4L9MA 3D74A 1CFDA 2LANA 3FWCA 1SBJA 1UWOA 4PHKA 2B1UA 1IWQA 4I5LB 3EG5B 1DJIA 1UHKA 2MJWB 4GGFA 4ORAB 1M46A 1SK6D 4I5KA 3DD4A 1F4OA 1YX8A 3QRXA 1KFUS 1AP4A 1KSOA 2JULA 3S0BA 1FPWA 1K96A 2M3WA 3JTDB 4PDZA 4WQ2A 3LK0A 3NSOA 3ZNIA 1T14A 3FIAA 3DZTA 3D0YA 1TIZA 4QJ3B 3KF9A 3D0YB 2ZNDA 5KTYA 1QATA 1SSEB 1BOCA 2WCFA 4OR9B 1B1GA 2QEOA 1NIWA 1F4QA 2COLB 1L7ZA 4PALA 2KI6C 2GGZA 3OX5A 1YTZC 1D1OA 1KK7Y 1N65A 2F2PA 3SS5A 3SS3A 4CFQA 1J7RA 1KFXL 3SG4A 2LMVA 3SJSA 1SCMC 1H8BA 1A2XA 1NSHA 1TUZA 2Y5IA 1LA3A 1OMVA 2BECA 4P2YB 1OZOA 1NWDA 2HPSA 2LVJA 4ICBA 2L4IA 2V53A 2KGRA 1EJ3A 1NCYA 4PE7A 1TNQA 2K7BA 1J7PA 5PALA 4MN0A 2JT8A 2P70A 1SCMB 3BUNB 5AFPA 4MRXA 3EKJA 1YRUB 2JNFA 1U5IB 1DTLA 3DVEA 3PLFB 2MLFC 3S0AA 1DJGA 2KGBC 1TCOB 5DKNA 1YVHA 1QXPA 2L4HA 3KO0A 2SASA 3OP0A 1Q80A 4OV2A 5CSIA 5HKWA 3DVKA 3I5HB 2KBIA 3PFVA 5CSFA 3SG3A 2QACA 3D73A 1NCXA 1SY9A 1UHHA 3DVJA 4PCWA 3BUXB 4DRWA 4A4CA 1WLZA 3LLEA 2M49B 1ALVA 3TS5C 1BMOA 1G8IA 3FE8A 4HREE 2VRGA 3K1EA 1YUTA 2NZ0A 2L0PA 2PASA 1S3PA 2M9GA 4JQ0D 1QJTA 1TTXA 2KI4C 2JQ6A 4HRHA 5KSZA 3BUOB 5HYDA 4ZCVA 3GK4X 3SG6A 1OZSA 1SYMA 5HLVA 3GK2A 1LKJA 2GGMA 2L5XB 1CNPA 1K9PA 3CZTX 2FJYA 2JRFA 3BJHA 4GGFC 1NX0A 2LUCA 1XYDA 2PYQA 1QWVA 3VB1A 1YRTB 1XFZO 2K60A 1L2OB 3NGVA 4GNKB 2JPOA 1A75A 3CR2A 5CPVA 1XFUO 2L98A 1PULA 3I5FB 3UNWA 1WDCC 5I2OA 1FI5A 3OB1B 1KQMB 4C0KA 2WNDA 2LC5A 2ZN8A 3OHMB 1GQMA 1R2UA 2KLDA 3CYZA 4YGAA 3SS4A 1JF2A 1W7JB 2R2IA 2BCXA 3BUWB 3VGOA 2QEHA 2K61A 2Y4QA 2ZN9A 1CLLA 3AKAA 1TUJA 3CTNA 2OS8B 1PSRA 1TNXA 1IQ5A 2LMUA 1QLSA 3PALA 3EVVA 2BCAA 1C3ZA 3IQQA 5FI6A 1A75B 3CABA 1PVBA 2WCHA 1Y0VH 3TS5B 1BT6A 2E6WA 5IBWA 2BL0C 1L2OC 4IL1A 3CZ1A 5B8IB 2M29A 1GM0A 1SL7A 2K7CA 2Y1NA 1QV1A 1IRJA 3I5GB 1JFJA 1JWDA 1BU3A 3SG5A 4CPVA 1C07A 3WNXB 1OOFA 2HF5A 3HX4A 1CTRA 1WDCB 3I5HC 1QVIZ 1DJWA 2M8UA 1BR1B 4GPLB 3PJIA 3QMEA 3VRNA 1W9ZA 1XVJA 4BY4A 3L4LA 1FBVA 2ZNEA 5DKRA 1B7TY 5HLOA 1CFCA 2F8PA 2KYFA 2TN4A 2OS8C 1AJ4A 5AEQA 1A29A 5D3OA 2GV5A 4YRUA 2K8MB 3EK4A 3CWGA 2OPOA 4ZCUA 4KYNA 5HKZA 3UO9A 1AUIB 2AMIA 1LINA 2BNXA 2E30A 1M63B 3FWBA 3WHUB 3VRPA 1C7WA 1YUUA 3O4XA 3OGNA 5I2QA 3JVTB 1K9KA 1LS8A 2L2CA 1WLMA 1OOGA 3I5FC 1ZOTB 2Y1MA 3IF7A 1DGVA 4FQTA 4PE0A 5D69A 3KPXA 4YGCB 1EXRA 1ZMZA 2CNPA 1IQ3A 3CDNA 2KHNA 2I94A 2OTGC 1N2DA 2CCMA 4NQGA 1S5GY 1N0YA 2F3ZA 1QV0A 2Q91A 2EGDA 4CLNA 3OBVA 1J1EA 1QS7A 1V1FA 5TNCA 3VRQA 1EG4A 4OVNF 3SIBA 2MBXA 3S0DA 1AK8A 2JWWA 1RJVA 1NCZA 4BY5A 3TDZA 2JTTA 2O60A 3DYEA 3V2LA 4MRYA 3TUYB 3R1VA 4HSZA 2L51A 4YI8A 1TNWA 1Y6WA 3SG2A 1BG1A 1NX2A 3PSRA 2KAVA 4QJ5B 1S26D 3DY9A 2PALA 5JJGA 1ZUZA 3ZWHA 5AXIA 2AAOA 2I2RE 1C7VA 2MLEC 4PHMA 3SIAA 2LUXA 1TOPA 2M97A 1MXLC 1G33A 2WCJA 1CFFA 2P6BB 2IS9A 1KSMA 3BXKA 1SPYA 1CDPA 3TDIA 1KQVA 3S0GA 4AQIA 2BL0B 1WRKA 1WRZA 4MSPA 4TNCA 4USLA 4YGEB 1UP5A 2L5YA 2LAPA 2KQYA 1IKUA 2LCPA 5JOLA 1QX2A 1P28A 1RECA 2NCPA 3B88A 2QPTA 3B7AA 3KHEA 1PSBA 1BLQA 1KFXS 1B47A 1HQVA 1WY9A 1FF1A 2AUCA 2M1UA 3N7HA 3O78A 1IJ6A 3TUYC 2KDHA 2MA2A 2LVKA 3IQOA 3EKHA 1KK8B 1TWOA 2LNKA 3PATA 4N1FA 4PE1A 1RK9A 1CFPA 1FW4A 2PSRA 3I5IC 3VROA 1OOJA 2M0RA 3BFHA 1SR6C 3EK8A 1SL9A 3VRRA 2KYCA 1CM4A 4MBEA 1S6CA 2G9BA 2KI4B 4CIDA 2F3YA 4UPGA 3NSIA 4JKTA 1SRAA 5ER4X 2Q4UA 3O6BA 4AQJA 3D75A 2WCBA 2JXCA 3CR5X 4ETOA 1HT9A 4A4BA 3S0EA 5I94A 1EH2A 1QX7A 2ZRTA 1FI6A 1JFKA 4DUQA 1UHNA 4GFTA 2LVIA 2LM5A 3CZ0A 2LHLA 3F45A 3OB2B 3PN7B 4R1EA 4YBHB 4GGNA 1DF0A 3AAKA
chains in the Genus database with same CATH topology
5F6TA 1OMRA 2WOSA 1YR5A 1MXEA 1A03A 1MQ1A 4GBAA 1BR4B 3D10A 1SR6B 1QLKA 1J7OA 1K2HA 1QIVA 1AHRA 2DOQA 1SCVA 4MVFA 3BOWA 1CDNA 1SNLA 1B8CA 1KWOC 2HQ8A 1RROA 3BOWB 2LLUA 4YGBB 1DJYA 2H61A 1NX1A 1S36A 2LLSA 3NSLA 1CLBA 3TDUA 5J3XA 2JNXA 1CMFA 1RWYA 1BODA 4XJKB 1MR8A 5FYXA 1PVAA 2LLTA 4FTGA 2JZIA 4XJKA 2KAXA 2NLNA 1U5IA 1NYAA 1JC2A 3LCPC 2MAZA 4GAOA 1CM1A 2O5GA 2WC8A 1IH0A 2H2KA 2LVVA 4MZKA 1B7TZ 4PHJA 3LL8B 3CLNA 2PVBA 5D7FA 1TN4A 1K9UA 1QTXA 1UHJA 2PRUA 1YURA 1RFJA 1K93D 2ZKMX 2BBNA 2ISDA 1PK0D 1M31A 5GQQC 2FCEA 3BUMB 1XFWO 1XK4C 4M2PA 1S6IA 4WQ3A 4AOMA 1SMGA 4M2QA 2PMYA 5KU1A 4E68A 3AAJA 4PHNA 3DVMA 2I7AA 4Q04A 1A4PA 2FOTA 2L50A 3A4UB 1TNPA 2KOTA 1LVCD 3CS1A 3PM8A 4NDDA 1S5GZ 1JBAA 1EL4A 3WXAA 1JF0A 3HCMA 2KFGA 4GUKA 3ICBA 2G2BA 5DKQA 1UHIA 2BBMA 1KWOB 3O2PA 3C1VA 2NXQA 4M2OA 1J7QA 1KCYA 2MRDA 2LP2A 1M45A 3PN7C 1PALA 1BJFA 3GK1A 1JSAA 1XFXO 1W7IB 4NDCA 4N5XA 1M39A 1LA0A 4D1EA 1BF5A 4JPZB 4U8DA 1YVLA 2KSPA 1UUSA 1XFYO 1CB1A 3CGAA 1F8HA 2K2FA 1IGVA 1K90D 5CSNA 2ZRSA 2BE4A 1DF0B 1KQMC 2KFHA 2A4JA 1KK7Z 1J55A 2BKIB 1CMGA 1Y1AA 1F55A 1SL8A 2K0JA 4I5NB 4DS7A 1GGWA 4PE4A 2CBLA 1OMDA 2M7LA 3RM1A 1SKTA 2CXJA 2K2AA 1AVSA 1DVIA 2RGIA 3A8RA 3WHTB 2D8NA 2KNEA 3KEVA 2BE6A 2CTNA 2JC2A 2SCPA 3DF0B 2WCEA 3DF0A 3CR4X 1QASA 4YGDB 1MHOA 4OCIA 5G08A 1VRKA 2ZFDA 2K7OA 1TCFA 3LK1A 4P5OE 4N1GA 4ORCB 2JPTA 1KFUL 2HETA 2HQWA 4YI9A 1SW8A 1E8AA 1K8UA 1K94A 5AANA 1CLMA 2LMTA 1RTP1 1GJYA 1B9AA 1PRWA 2JOJA 1Y1UA 1V1GA 4F0ZB 4DIRA 1MUXA 1DJXA 2BKHB 2F33A 4DCKA 3K21A 5BPJA 1TRFA 1X02A 1IJ5A 2CT9A 2H61C 2LHIA 2F2OA 1KK8C 1QIWA 3JVTC 5CSJA 2LE9B 3FS7A 3I5IB 5I8NA 1DJZA 2FJUB 3NSKA 4I5JA 1NX3A 1NPQA 1QX5B 1AJ5A 1S1EA 2EC6B 2KQ6A 3MSEB 4MZLA 1B8LA 1IG5A 1DGUA 2KI6D 1H4BA 3RLZA 1YUSA 4WRIA 1ZACA 4C0JA 3TZ1A 1DMOA 2JT0A 5ER5A 5HKYA 1B4CA 1MWNA 1B8RA 1GGZA 3I5GC 4HRGA 1F70A 2JT3A 2EHBA 1OQPA 2KBMA 1DJHA 2MHHA 1WRLA 2NCOA 1F54A 3JTDC 1G4YR 2JTZA 1OE9B 1XO5A 2FCDA 2JXLA 4MLWA 1F71A 1JUOA 4OKHA 1EG3A 1R6PA 2I18A 2KAYA 3BYAA 5I2LA 3M0WA 3E3RA 1MF8B 5AERA 1J1DA 1XFVO 2JU0A 3NXAA 4XYNA 3GOFA 4MZJA 4FQOA 2BCBA 3H4SE 4JWQA 2M1KB 2M7NA 2LV7A 3OX6A 4QJ4B 1NP8A 3BQ3A 1NUBA 1OSAA 1XA5A 1YX7A 1K95A 1S6JA 3EVRA 3O4YA 1UURA 1LXFC 1CDLA 2WORA 2K7DA 2OTGB 3AKBA 1ZFSA 2L2EA 3EK7A 4C0LA 5K89A 1CDMA 2KFFA 1QVIY 4MEWA 1XK4A 1CKKA 1ALWA 3EVUA 4NDBA 4CFRA 3SG7A 2EC6C 1ODBA 4ORBB 1DT7B 2LP3A 1Y1XA 4L9MA 1CFDA 2LANA 3FWCA 1SBJA 1UWOA 4PHKA 2B1UA 1IWQA 4I5LB 1DJIA 1UHKA 2MJWB 4GGFA 4ORAB 1M46A 1SK6D 4I5KA 3DD4A 1F4OA 1YX8A 3QRXA 1KFUS 1AP4A 1KSOA 2JULA 1FPWA 1K96A 2M3WA 3JTDB 4PDZA 4WQ2A 3LK0A 3NSOA 3ZNIA 3FIAA 3D0YA 1TIZA 4QJ3B 3KF9A 3D0YB 2ZNDA 5KTYA 1QATA 1BOCA 2WCFA 4OR9B 1B1GA 1NIWA 1F4QA 2COLB 1L7ZA 4PALA 2KI6C 2GGZA 3OX5A 1YTZC 1D1OA 1KK7Y 1N65A 2F2PA 4CFQA 1J7RA 1KFXL 3SG4A 2LMVA 3SJSA 1SCMC 1H8BA 1A2XA 1NSHA 2Y5IA 1LA3A 1OMVA 2BECA 4P2YB 1OZOA 1NWDA 2HPSA 2LVJA 4ICBA 2L4IA 2V53A 2KGRA 1EJ3A 1NCYA 4PE7A 1TNQA 2K7BA 1J7PA 5PALA 4MN0A 2JT8A 1SCMB 3BUNB 5AFPA 4MRXA 3EKJA 1YRUB 2JNFA 1U5IB 1DTLA 3DVEA 3PLFB 2MLFC 1DJGA 2KGBC 1TCOB 5DKNA 1YVHA 1QXPA 2L4HA 3KO0A 2SASA 3OP0A 1Q80A 4OV2A 5CSIA 5HKWA 3DVKA 3I5HB 2KBIA 3PFVA 5CSFA 3SG3A 2QACA 1NCXA 1SY9A 1UHHA 3DVJA 4PCWA 3BUXB 4DRWA 4A4CA 1WLZA 3LLEA 2M49B 1ALVA 3TS5C 1BMOA 1G8IA 4HREE 2VRGA 1YUTA 2NZ0A 2L0PA 2PASA 1S3PA 2M9GA 4JQ0D 1QJTA 1TTXA 2KI4C 2JQ6A 4HRHA 5KSZA 3BUOB 5HYDA 4ZCVA 3GK4X 3SG6A 1OZSA 1SYMA 5HLVA 3GK2A 1LKJA 2GGMA 2L5XB 1CNPA 1K9PA 3CZTX 2JRFA 4GGFC 1NX0A 2LUCA 1XYDA 1YRTB 1XFZO 1L2OB 4GNKB 1A75A 3CR2A 5CPVA 1XFUO 2L98A 1PULA 3I5FB 5I2OA 1WDCC 1FI5A 3OB1B 1KQMB 4C0KA 2WNDA 2LC5A 2ZN8A 3OHMB 1GQMA 1R2UA 4YGAA 1JF2A 1W7JB 2R2IA 2BCXA 3BUWB 3VGOA 2ZN9A 2K61A 2Y4QA 3AKAA 1CLLA 3CTNA 2OS8B 1PSRA 1TNXA 1IQ5A 2LMUA 1QLSA 3PALA 3EVVA 2BCAA 3IQQA 1A75B 1PVBA 1Y0VH 3TS5B 1BT6A 2E6WA 5IBWA 2BL0C 1L2OC 4IL1A 5B8IB 2M29A 1SL7A 2K7CA 2Y1NA 1QV1A 1IRJA 3I5GB 1JFJA 1JWDA 1BU3A 3SG5A 4CPVA 1C07A 3WNXB 3HX4A 2HF5A 1CTRA 1WDCB 3I5HC 1QVIZ 1DJWA 2M8UA 1BR1B 4GPLB 3VRNA 1XVJA 4BY4A 1FBVA 2ZNEA 5DKRA 1B7TY 5HLOA 1CFCA 2F8PA 2KYFA 2TN4A 2OS8C 1AJ4A 5AEQA 1A29A 4YRUA 2GV5A 2K8MB 3EK4A 3CWGA 2OPOA 4ZCUA 5HKZA 1AUIB 2AMIA 1LINA 2E30A 1M63B 3FWBA 3VRPA 1C7WA 1YUUA 5I2QA 3JVTB 1K9KA 3I5FC 3IF7A 1WLMA 3WHUB 1ZOTB 2Y1MA 4PE0A 1DGVA 5D69A 3KPXA 4YGCB 1EXRA 1ZMZA 2CNPA 1IQ3A 2KHNA 2I94A 2OTGC 1N2DA 2CCMA 4NQGA 1S5GY 1N0YA 2F3ZA 1QV0A 2Q91A 2EGDA 4CLNA 1J1EA 1QS7A 1V1FA 5TNCA 3VRQA 1EG4A 4OVNF 3SIBA 2MBXA 1AK8A 2JWWA 1RJVA 1NCZA 4BY5A 3TDZA 2JTTA 2O60A 4MRYA 3TUYB 4HSZA 2L51A 4YI8A 1TNWA 1Y6WA 3SG2A 1BG1A 1NX2A 3PSRA 2KAVA 4QJ5B 1S26D 2PALA 5JJGA 1ZUZA 3ZWHA 5AXIA 2AAOA 2I2RE 1C7VA 2MLEC 4PHMA 3SIAA 2LUXA 1TOPA 2M97A 1MXLC 1G33A 1CFFA 2P6BB 2IS9A 1KSMA 3BXKA 1SPYA 1CDPA 3TDIA 1KQVA 4AQIA 2BL0B 1WRKA 1WRZA 4MSPA 4TNCA 4USLA 4YGEB 1UP5A 2LAPA 2KQYA 1IKUA 2LCPA 5JOLA 1QX2A 1RECA 2NCPA 2QPTA 3KHEA 1PSBA 1BLQA 1KFXS 1B47A 1HQVA 1WY9A 1FF1A 2AUCA 2M1UA 3O78A 1IJ6A 3TUYC 2KDHA 2MA2A 2LVKA 3IQOA 3EKHA 1KK8B 2LNKA 3PATA 4N1FA 4PE1A 1RK9A 1CFPA 1FW4A 2PSRA 3I5IC 3VROA 1OOJA 2M0RA 1SR6C 3EK8A 1SL9A 3VRRA 2KYCA 1CM4A 4MBEA 1S6CA 2G9BA 2KI4B 4CIDA 2F3YA 4UPGA 3NSIA 1SRAA 5ER4X 2Q4UA 3O6BA 4AQJA 2WCBA 2JXCA 3CR5X 4ETOA 1HT9A 4A4BA 1EH2A 1QX7A 2ZRTA 1FI6A 1JFKA 4DUQA 1UHNA 4GFTA 2LVIA 2LM5A 2LHLA 3F45A 3OB2B 3PN7B 4R1EA 4YBHB 4GGNA 1DF0A 3AAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F6T A;  1OMR A;  2WOS A;  1YR5 A;  1MXE A;  1A03 A;  1MQ1 A;  4GBA A;  1BR4 B;  3D10 A;  1SR6 B;  1QLK A;  1J7O A;  1K2H A;  1QIV A;  1AHR A;  2DOQ A;  1SCV A;  4MVF A;  3BOW A;  1CDN A;  1SNL A;  1B8C A;  1KWO C;  2HQ8 A;  1RRO A;  3BOW B;  2LLU A;  4YGB B;  1DJY A;  2H61 A;  1NX1 A;  1S36 A;  2LLS A;  3NSL A;  1CLB A;  3TDU A;  5J3X A;  2JNX A;  1CMF A;  1RWY A;  1BOD A;  4XJK B;  1MR8 A;  5FYX A;  1PVA A;  2LLT A;  4FTG A;  2JZI A;  4XJK A;  2KAX A;  2NLN A;  1U5I A;  1NYA A;  1JC2 A;  3LCP C;  2MAZ A;  4GAO A;  1CM1 A;  2O5G A;  2WC8 A;  1IH0 A;  2H2K A;  2LVV A;  4MZK A;  1B7T Z;  4PHJ A;  3LL8 B;  3CLN A;  2PVB A;  5D7F A;  1TN4 A;  1K9U A;  1QTX A;  1UHJ A;  2PRU A;  1YUR A;  1RFJ A;  1K93 D;  2ZKM X;  2BBN A;  2ISD A;  1PK0 D;  1M31 A;  5GQQ C;  2FCE A;  3BUM B;  1XFW O;  1XK4 C;  4M2P A;  1S6I A;  4WQ3 A;  4AOM A;  1SMG A;  4M2Q A;  2PMY A;  5KU1 A;  4E68 A;  3AAJ A;  4PHN A;  3DVM A;  2I7A A;  4Q04 A;  1A4P A;  2FOT A;  2L50 A;  3A4U B;  1TNP A;  2KOT A;  1LVC D;  3CS1 A;  3PM8 A;  4NDD A;  1S5G Z;  1JBA A;  1EL4 A;  3WXA A;  1JF0 A;  3HCM A;  2KFG A;  4GUK A;  3ICB A;  2G2B A;  5DKQ A;  1UHI A;  2BBM A;  1KWO B;  3O2P A;  3C1V A;  2NXQ A;  4M2O A;  1J7Q A;  1KCY A;  2MRD A;  2LP2 A;  1M45 A;  3PN7 C;  1PAL A;  1BJF A;  3GK1 A;  1JSA A;  1XFX O;  1W7I B;  4NDC A;  4N5X A;  1M39 A;  1LA0 A;  4D1E A;  1BF5 A;  4JPZ B;  4U8D A;  1YVL A;  2KSP A;  1UUS A;  1XFY O;  1CB1 A;  3CGA A;  1F8H A;  2K2F A;  1IGV A;  1K90 D;  5CSN A;  2ZRS A;  2BE4 A;  1DF0 B;  1KQM C;  2KFH A;  2A4J A;  1KK7 Z;  1J55 A;  2BKI B;  1CMG A;  1Y1A A;  1F55 A;  1SL8 A;  2K0J A;  4I5N B;  4DS7 A;  1GGW A;  4PE4 A;  2CBL A;  1OMD A;  2M7L A;  3RM1 A;  1SKT A;  2CXJ A;  2K2A A;  1AVS A;  1DVI A;  2RGI A;  3A8R A;  3WHT B;  2D8N A;  2KNE A;  3KEV A;  2BE6 A;  2CTN A;  2JC2 A;  2SCP A;  3DF0 B;  2WCE A;  3DF0 A;  3CR4 X;  1QAS A;  4YGD B;  1MHO A;  4OCI A;  5G08 A;  1VRK A;  2ZFD A;  2K7O A;  1TCF A;  3LK1 A;  4P5O E;  4N1G A;  4ORC B;  2JPT A;  1KFU L;  2HET A;  2HQW A;  4YI9 A;  1SW8 A;  1E8A A;  1K8U A;  1K94 A;  5AAN A;  1CLM A;  2LMT A;  1RTP 1;  1GJY A;  1B9A A;  1PRW A;  2JOJ A;  1Y1U A;  1V1G A;  4F0Z B;  4DIR A;  1MUX A;  1DJX A;  2BKH B;  2F33 A;  4DCK A;  3K21 A;  5BPJ A;  1TRF A;  1X02 A;  1IJ5 A;  2CT9 A;  2H61 C;  2LHI A;  2F2O A;  1KK8 C;  1QIW A;  3JVT C;  5CSJ A;  2LE9 B;  3FS7 A;  3I5I B;  5I8N A;  1DJZ A;  2FJU B;  3NSK A;  4I5J A;  1NX3 A;  1NPQ A;  1QX5 B;  1AJ5 A;  1S1E A;  2EC6 B;  2KQ6 A;  3MSE B;  4MZL A;  1B8L A;  1IG5 A;  1DGU A;  2KI6 D;  1H4B A;  3RLZ A;  1YUS A;  4WRI A;  1ZAC A;  4C0J A;  3TZ1 A;  1DMO A;  2JT0 A;  5ER5 A;  5HKY A;  1B4C A;  1MWN A;  1B8R A;  1GGZ A;  3I5G C;  4HRG A;  1F70 A;  2JT3 A;  2EHB A;  1OQP A;  2KBM A;  1DJH A;  2MHH A;  1WRL A;  2NCO A;  1F54 A;  3JTD C;  1G4Y R;  2JTZ A;  1OE9 B;  1XO5 A;  2FCD A;  2JXL A;  4MLW A;  1F71 A;  1JUO A;  4OKH A;  1EG3 A;  1R6P A;  2I18 A;  2KAY A;  3BYA A;  5I2L A;  3M0W A;  3E3R A;  1MF8 B;  5AER A;  1J1D A;  1XFV O;  2JU0 A;  3NXA A;  4XYN A;  3GOF A;  4MZJ A;  4FQO A;  2BCB A;  3H4S E;  4JWQ A;  2M1K B;  2M7N A;  2LV7 A;  3OX6 A;  4QJ4 B;  1NP8 A;  3BQ3 A;  1NUB A;  1OSA A;  1XA5 A;  1YX7 A;  1K95 A;  1S6J A;  3EVR A;  3O4Y A;  1UUR A;  1LXF C;  1CDL A;  2WOR A;  2K7D A;  2OTG B;  3AKB A;  1ZFS A;  2L2E A;  3EK7 A;  4C0L A;  5K89 A;  1CDM A;  2KFF A;  1QVI Y;  4MEW A;  1XK4 A;  1CKK A;  1ALW A;  3EVU A;  4NDB A;  4CFR A;  3SG7 A;  2EC6 C;  1ODB A;  4ORB B;  1DT7 B;  2LP3 A;  1Y1X A;  4L9M A;  1CFD A;  2LAN A;  3FWC A;  1SBJ A;  1UWO A;  4PHK A;  2B1U A;  1IWQ A;  4I5L B;  1DJI A;  1UHK A;  2MJW B;  4GGF A;  4ORA B;  1M46 A;  1SK6 D;  4I5K A;  3DD4 A;  1F4O A;  1YX8 A;  3QRX A;  1KFU S;  1AP4 A;  1KSO A;  2JUL A;  1FPW A;  1K96 A;  2M3W A;  3JTD B;  4PDZ A;  4WQ2 A;  3LK0 A;  3NSO A;  3ZNI A;  3FIA A;  3D0Y A;  1TIZ A;  4QJ3 B;  3KF9 A;  3D0Y B;  2ZND A;  5KTY A;  1QAT A;  1BOC A;  2WCF A;  4OR9 B;  1B1G A;  1NIW A;  1F4Q A;  2COL B;  1L7Z A;  4PAL A;  2KI6 C;  2GGZ A;  3OX5 A;  1YTZ C;  1D1O A;  1KK7 Y;  1N65 A;  2F2P A;  4CFQ A;  1J7R A;  1KFX L;  3SG4 A;  2LMV A;  3SJS A;  1SCM C;  1H8B A;  1A2X A;  1NSH A;  2Y5I A;  1LA3 A;  1OMV A;  2BEC A;  4P2Y B;  1OZO A;  1NWD A;  2HPS A;  2LVJ A;  4ICB A;  2L4I A;  2V53 A;  2KGR A;  1EJ3 A;  1NCY A;  4PE7 A;  1TNQ A;  2K7B A;  1J7P A;  5PAL A;  4MN0 A;  2JT8 A;  1SCM B;  3BUN B;  5AFP A;  4MRX A;  3EKJ A;  1YRU B;  2JNF A;  1U5I B;  1DTL A;  3DVE A;  3PLF B;  2MLF C;  1DJG A;  2KGB C;  1TCO B;  5DKN A;  1YVH A;  1QXP A;  2L4H A;  3KO0 A;  2SAS A;  3OP0 A;  1Q80 A;  4OV2 A;  5CSI A;  5HKW A;  3DVK A;  3I5H B;  2KBI A;  3PFV A;  5CSF A;  3SG3 A;  2QAC A;  1NCX A;  1SY9 A;  1UHH A;  3DVJ A;  4PCW A;  3BUX B;  4DRW A;  4A4C A;  1WLZ A;  3LLE A;  2M49 B;  1ALV A;  3TS5 C;  1BMO A;  1G8I A;  4HRE E;  2VRG A;  1YUT A;  2NZ0 A;  2L0P A;  2PAS A;  1S3P A;  2M9G A;  4JQ0 D;  1QJT A;  1TTX A;  2KI4 C;  2JQ6 A;  4HRH A;  5KSZ A;  3BUO B;  5HYD A;  4ZCV A;  3GK4 X;  3SG6 A;  1OZS A;  1SYM A;  5HLV A;  3GK2 A;  1LKJ A;  2GGM A;  2L5X B;  1CNP A;  1K9P A;  3CZT X;  2JRF A;  4GGF C;  1NX0 A;  2LUC A;  1XYD A;  1YRT B;  1XFZ O;  1L2O B;  4GNK B;  1A75 A;  3CR2 A;  5CPV A;  1XFU O;  2L98 A;  1PUL A;  3I5F B;  5I2O A;  1WDC C;  1FI5 A;  3OB1 B;  1KQM B;  4C0K A;  2WND A;  2LC5 A;  2ZN8 A;  3OHM B;  1GQM A;  1R2U A;  4YGA A;  1JF2 A;  1W7J B;  2R2I A;  2BCX A;  3BUW B;  3VGO A;  2ZN9 A;  2K61 A;  2Y4Q A;  3AKA A;  1CLL A;  3CTN A;  2OS8 B;  1PSR A;  1TNX A;  1IQ5 A;  2LMU A;  1QLS A;  3PAL A;  3EVV A;  2BCA A;  3IQQ A;  1A75 B;  1PVB A;  1Y0V H;  3TS5 B;  1BT6 A;  2E6W A;  5IBW A;  2BL0 C;  1L2O C;  4IL1 A;  5B8I B;  2M29 A;  1SL7 A;  2K7C A;  2Y1N A;  1QV1 A;  1IRJ A;  3I5G B;  1JFJ A;  1JWD A;  1BU3 A;  3SG5 A;  4CPV A;  1C07 A;  3WNX B;  3HX4 A;  2HF5 A;  1CTR A;  1WDC B;  3I5H C;  1QVI Z;  1DJW A;  2M8U A;  1BR1 B;  4GPL B;  3VRN A;  1XVJ A;  4BY4 A;  1FBV A;  2ZNE A;  5DKR A;  1B7T Y;  5HLO A;  1CFC A;  2F8P A;  2KYF A;  2TN4 A;  2OS8 C;  1AJ4 A;  5AEQ A;  1A29 A;  4YRU A;  2GV5 A;  2K8M B;  3EK4 A;  3CWG A;  2OPO A;  4ZCU A;  5HKZ A;  1AUI B;  2AMI A;  1LIN A;  2E30 A;  1M63 B;  3FWB A;  3VRP A;  1C7W A;  1YUU A;  5I2Q A;  3JVT B;  1K9K A;  3I5F C;  3IF7 A;  1WLM A;  3WHU B;  1ZOT B;  2Y1M A;  4PE0 A;  1DGV A;  5D69 A;  3KPX A;  4YGC B;  1EXR A;  1ZMZ A;  2CNP A;  1IQ3 A;  2KHN A;  2I94 A;  2OTG C;  1N2D A;  2CCM A;  4NQG A;  1S5G Y;  1N0Y A;  2F3Z A;  1QV0 A;  2Q91 A;  2EGD A;  4CLN A;  1J1E A;  1QS7 A;  1V1F A;  5TNC A;  3VRQ A;  1EG4 A;  4OVN F;  3SIB A;  2MBX A;  1AK8 A;  2JWW A;  1RJV A;  1NCZ A;  4BY5 A;  3TDZ A;  2JTT A;  2O60 A;  4MRY A;  3TUY B;  4HSZ A;  2L51 A;  4YI8 A;  1TNW A;  1Y6W A;  3SG2 A;  1BG1 A;  1NX2 A;  3PSR A;  2KAV A;  4QJ5 B;  1S26 D;  2PAL A;  5JJG A;  1ZUZ A;  3ZWH A;  5AXI A;  2AAO A;  2I2R E;  1C7V A;  2MLE C;  4PHM A;  3SIA A;  2LUX A;  1TOP A;  2M97 A;  1MXL C;  1G33 A;  1CFF A;  2P6B B;  2IS9 A;  1KSM A;  3BXK A;  1SPY A;  1CDP A;  3TDI A;  1KQV A;  4AQI A;  2BL0 B;  1WRK A;  1WRZ A;  4MSP A;  4TNC A;  4USL A;  4YGE B;  1UP5 A;  2LAP A;  2KQY A;  1IKU A;  2LCP A;  5JOL A;  1QX2 A;  1REC A;  2NCP A;  2QPT A;  3KHE A;  1PSB A;  1BLQ A;  1KFX S;  1B47 A;  1HQV A;  1WY9 A;  1FF1 A;  2AUC A;  2M1U A;  3O78 A;  1IJ6 A;  3TUY C;  2KDH A;  2MA2 A;  2LVK A;  3IQO A;  3EKH A;  1KK8 B;  2LNK A;  3PAT A;  4N1F A;  4PE1 A;  1RK9 A;  1CFP A;  1FW4 A;  2PSR A;  3I5I C;  3VRO A;  1OOJ A;  2M0R A;  1SR6 C;  3EK8 A;  1SL9 A;  3VRR A;  2KYC A;  1CM4 A;  4MBE A;  1S6C A;  2G9B A;  2KI4 B;  4CID A;  2F3Y A;  4UPG A;  3NSI A;  1SRA A;  5ER4 X;  2Q4U A;  3O6B A;  4AQJ A;  2WCB A;  2JXC A;  3CR5 X;  4ETO A;  1HT9 A;  4A4B A;  1EH2 A;  1QX7 A;  2ZRT A;  1FI6 A;  1JFK A;  4DUQ A;  1UHN A;  4GFT A;  2LVI A;  2LM5 A;  2LHL A;  3F45 A;  3OB2 B;  3PN7 B;  4R1E A;  4YBH B;  4GGN A;  1DF0 A;  3AAK A; 
#chains in the Genus database with same CATH topology
 5F6T A;  1OMR A;  2WOS A;  1YR5 A;  2YGU A;  1MXE A;  1A03 A;  1MQ1 A;  4GBA A;  1BR4 B;  3D10 A;  1SR6 B;  5EL2 A;  1QLK A;  1J7O A;  1K2H A;  1QIV A;  1AHR A;  2DOQ A;  1SCV A;  4MVF A;  2QEV A;  3BOW A;  1CDN A;  1SNL A;  1B8C A;  1KWO C;  2HQ8 A;  1RRO A;  3BOW B;  2LLU A;  4YGB B;  1DJY A;  2H61 A;  1NX1 A;  1S36 A;  2LLS A;  3NSL A;  1CLB A;  3TDU A;  5J3X A;  2JNX A;  1CMF A;  1RWY A;  3R1O A;  3D76 A;  1BOD A;  4XJK B;  1MR8 A;  5FYX A;  1PVA A;  2LLT A;  4FTG A;  2JZI A;  3NHI A;  4XJK A;  2KAX A;  2NLN A;  1U5I A;  1NYA A;  1JC2 A;  2WCL A;  2MAZ A;  3LCP C;  1CM1 A;  2O5G A;  2WC8 A;  4GAO A;  2H2K A;  1IH0 A;  2LVV A;  4MZK A;  1B7T Z;  3L4A A;  5FI7 A;  1DC1 A;  4PHJ A;  3LL8 B;  3CLN A;  1XFR A;  2PVB A;  5D7F A;  1TN4 A;  1K9U A;  1QTX A;  1UHJ A;  2PRU A;  1YUR A;  1RFJ A;  1K93 D;  2ZKM X;  3PM2 A;  2BBN A;  2ISD A;  1PK0 D;  1M31 A;  5GQQ C;  3D77 A;  2FCE A;  3BUM B;  1XFW O;  1XK4 C;  4M2P A;  1S6I A;  4WQ3 A;  4AOM A;  1SMG A;  4M2Q A;  2PMY A;  5KU1 A;  4E68 A;  3AAJ A;  4PHN A;  3DVM A;  2I7A A;  4Q04 A;  1A4P A;  2FOT A;  2L50 A;  3A4U B;  1TNP A;  2KOT A;  1LVC D;  3CS1 A;  3PM8 A;  4NDD A;  1S5G Z;  1JBA A;  1EL4 A;  3WXA A;  1JF0 A;  3HCM A;  2KFG A;  4GUK A;  3ICB A;  2G2B A;  5DKQ A;  1UHI A;  2BBM A;  1KWO B;  1OW4 A;  3O2P A;  5HL1 A;  3C1V A;  2NXQ A;  4M2O A;  1J7Q A;  1KCY A;  2MRD A;  2LP2 A;  1M45 A;  2QEB A;  4INW A;  3PN7 C;  1DQE A;  1PAL A;  1BJF A;  3GK1 A;  1JSA A;  1DEK A;  1XFX O;  1W7I B;  4NDC A;  4N5X A;  1M39 A;  1LA0 A;  4D1E A;  1BF5 A;  4JPZ B;  4U8D A;  1OOH A;  1YVL A;  2KSP A;  3Q8I A;  1UUS A;  1XFY O;  4IJ7 A;  1CB1 A;  3CGA A;  1F8H A;  2K2F A;  1IGV A;  1K90 D;  5CSN A;  2ZRS A;  2QDI A;  2BE4 A;  3B87 A;  3IVT A;  1DF0 B;  1KQM C;  3R72 A;  2KFH A;  2A4J A;  1KK7 Z;  1J55 A;  2BKI B;  2BAP A;  4PT1 A;  1Z2C B;  1CMG A;  1Y1A A;  1F55 A;  1SL8 A;  2K0J A;  4I5N B;  4DS7 A;  4INX A;  3DXL A;  4PE4 A;  2CBL A;  1OMD A;  4JD9 A;  1GGW A;  2M7L A;  3RM1 A;  1SKT A;  2CXJ A;  2K2A A;  1AVS A;  3FE9 A;  1DVI A;  2RGI A;  3A8R A;  3WHT B;  2D8N A;  2KNE A;  2WCK A;  3KEV A;  2BE6 A;  2CTN A;  2JC2 A;  2SCP A;  3DF0 B;  2WCE A;  3DF0 A;  3CR4 X;  1QAS A;  4YGD B;  1MHO A;  4OCI A;  5G08 A;  1VRK A;  2ZFD A;  2K7O A;  1TCF A;  3LK1 A;  4P5O E;  4N1G A;  4ORC B;  2JPT A;  1KFU L;  2HET A;  2HQW A;  4YI9 A;  1SW8 A;  1E8A A;  1K8U A;  1K94 A;  5AAN A;  1CLM A;  1Z4H A;  2LMT A;  1RTP 1;  2ERB A;  3R1P A;  1GJY A;  1B9A A;  4OZD A;  1PRW A;  3L47 A;  2KLE A;  1OOI X;  3BFB A;  2WC6 A;  2JOJ A;  1Y1U A;  1V1G A;  4F0Z B;  4DIR A;  1MUX A;  1DJX A;  2BKH B;  2WCM A;  1C3Y A;  2F33 A;  4DCK A;  3K21 A;  5BPJ A;  1TRF A;  1X02 A;  1IJ5 A;  2CT9 A;  2KPH A;  2H61 C;  2LHI A;  2F2O A;  1KK8 C;  1QIW A;  2P71 A;  3JVT C;  2H8V A;  3S0F A;  5CSJ A;  2LE9 B;  3FS7 A;  3I5I B;  5I8N A;  3FE6 A;  1DJZ A;  2FJU B;  3NSK A;  4I5J A;  1NX3 A;  1NPQ A;  1QX5 B;  1AJ5 A;  1S1E A;  2EC6 B;  2KQ6 A;  3MSE B;  4MZL A;  1B8L A;  2WC5 A;  1IG5 A;  1DGU A;  2KI6 D;  1H4B A;  3RLZ A;  1YUS A;  4WRI A;  1ZAC A;  4C0J A;  3TZ1 A;  1DMO A;  2JT0 A;  5ER5 A;  5HKY A;  1B4C A;  1MWN A;  3NHT A;  1B8R A;  1GGZ A;  3RZS A;  3I5G C;  4HRG A;  1F70 A;  2JT3 A;  2EHB A;  1OQP A;  2KBM A;  1DJH A;  2MHH A;  1WRL A;  2NCO A;  1F54 A;  3JTD C;  1G4Y R;  2JTZ A;  1OE9 B;  1XO5 A;  2FCD A;  2JXL A;  3CZ2 A;  4MLW A;  1F71 A;  1JUO A;  4OKH A;  1EG3 A;  3BFA A;  1R6P A;  2I18 A;  2KAY A;  3BYA A;  5I2L A;  3M0W A;  3E3R A;  1MF8 B;  5AER A;  1J1D A;  1XFV O;  2JU0 A;  3B86 A;  3NXA A;  4XYN A;  3GOF A;  4MZJ A;  4FQO A;  2BCB A;  3H4S E;  4F7F A;  5DIC A;  4JWQ A;  2M1K B;  1IIO A;  2M7N A;  2LV7 A;  3OX6 A;  4QJ4 B;  5FI2 A;  2PQL A;  1NP8 A;  3BQ3 A;  1NUB A;  1OSA A;  1XA5 A;  1YX7 A;  1K95 A;  1S6J A;  3EVR A;  3O4Y A;  1UUR A;  1LXF C;  1CDL A;  2WOR A;  2K7D A;  2OTG B;  3AKB A;  1ZFS A;  2L2E A;  3EK7 A;  4C0L A;  5K89 A;  1CDM A;  2KFF A;  3D78 A;  1QVI Y;  4MEW A;  1XK4 A;  1CKK A;  2GTE A;  1ALW A;  3EVU A;  4NDB A;  4CFR A;  3SG7 A;  2EC6 C;  1ODB A;  4ORB B;  1DT7 B;  3B6X A;  1DEL A;  1ORG A;  2LP3 A;  1Y1X A;  4L9M A;  3D74 A;  1CFD A;  2LAN A;  3FWC A;  1SBJ A;  1UWO A;  4PHK A;  2B1U A;  1IWQ A;  4I5L B;  3EG5 B;  1DJI A;  1UHK A;  2MJW B;  4GGF A;  4ORA B;  1M46 A;  1SK6 D;  4I5K A;  3DD4 A;  1F4O A;  1YX8 A;  3QRX A;  1KFU S;  1AP4 A;  1KSO A;  2JUL A;  3S0B A;  1FPW A;  1K96 A;  2M3W A;  3JTD B;  4PDZ A;  4WQ2 A;  3LK0 A;  3NSO A;  3ZNI A;  1T14 A;  3FIA A;  3DZT A;  3D0Y A;  1TIZ A;  4QJ3 B;  3KF9 A;  3D0Y B;  2ZND A;  5KTY A;  1QAT A;  1SSE B;  1BOC A;  2WCF A;  4OR9 B;  1B1G A;  2QEO A;  1NIW A;  1F4Q A;  2COL B;  1L7Z A;  4PAL A;  2KI6 C;  2GGZ A;  3OX5 A;  1YTZ C;  1D1O A;  1KK7 Y;  1N65 A;  2F2P A;  3SS5 A;  3SS3 A;  4CFQ A;  1J7R A;  1KFX L;  3SG4 A;  2LMV A;  3SJS A;  1SCM C;  1H8B A;  1A2X A;  1NSH A;  1TUZ A;  2Y5I A;  1LA3 A;  1OMV A;  2BEC A;  4P2Y B;  1OZO A;  1NWD A;  2HPS A;  2LVJ A;  4ICB A;  2L4I A;  2V53 A;  2KGR A;  1EJ3 A;  1NCY A;  4PE7 A;  1TNQ A;  2K7B A;  1J7P A;  5PAL A;  4MN0 A;  2JT8 A;  2P70 A;  1SCM B;  3BUN B;  5AFP A;  4MRX A;  3EKJ A;  1YRU B;  2JNF A;  1U5I B;  1DTL A;  3DVE A;  3PLF B;  2MLF C;  3S0A A;  1DJG A;  2KGB C;  1TCO B;  5DKN A;  1YVH A;  1QXP A;  2L4H A;  3KO0 A;  2SAS A;  3OP0 A;  1Q80 A;  4OV2 A;  5CSI A;  5HKW A;  3DVK A;  3I5H B;  2KBI A;  3PFV A;  5CSF A;  3SG3 A;  2QAC A;  3D73 A;  1NCX A;  1SY9 A;  1UHH A;  3DVJ A;  4PCW A;  3BUX B;  4DRW A;  4A4C A;  1WLZ A;  3LLE A;  2M49 B;  1ALV A;  3TS5 C;  1BMO A;  1G8I A;  3FE8 A;  4HRE E;  2VRG A;  3K1E A;  1YUT A;  2NZ0 A;  2L0P A;  2PAS A;  1S3P A;  2M9G A;  4JQ0 D;  1QJT A;  1TTX A;  2KI4 C;  2JQ6 A;  4HRH A;  5KSZ A;  3BUO B;  5HYD A;  4ZCV A;  3GK4 X;  3SG6 A;  1OZS A;  1SYM A;  5HLV A;  3GK2 A;  1LKJ A;  2GGM A;  2L5X B;  1CNP A;  1K9P A;  3CZT X;  2FJY A;  2JRF A;  3BJH A;  4GGF C;  1NX0 A;  2LUC A;  1XYD A;  2PYQ A;  1QWV A;  3VB1 A;  1YRT B;  1XFZ O;  2K60 A;  1L2O B;  3NGV A;  4GNK B;  2JPO A;  1A75 A;  3CR2 A;  5CPV A;  1XFU O;  2L98 A;  1PUL A;  3I5F B;  3UNW A;  1WDC C;  5I2O A;  1FI5 A;  3OB1 B;  1KQM B;  4C0K A;  2WND A;  2LC5 A;  2ZN8 A;  3OHM B;  1GQM A;  1R2U A;  2KLD A;  3CYZ A;  4YGA A;  3SS4 A;  1JF2 A;  1W7J B;  2R2I A;  2BCX A;  3BUW B;  3VGO A;  2QEH A;  2K61 A;  2Y4Q A;  2ZN9 A;  1CLL A;  3AKA A;  1TUJ A;  3CTN A;  2OS8 B;  1PSR A;  1TNX A;  1IQ5 A;  2LMU A;  1QLS A;  3PAL A;  3EVV A;  2BCA A;  1C3Z A;  3IQQ A;  5FI6 A;  1A75 B;  3CAB A;  1PVB A;  2WCH A;  1Y0V H;  3TS5 B;  1BT6 A;  2E6W A;  5IBW A;  2BL0 C;  1L2O C;  4IL1 A;  3CZ1 A;  5B8I B;  2M29 A;  1GM0 A;  1SL7 A;  2K7C A;  2Y1N A;  1QV1 A;  1IRJ A;  3I5G B;  1JFJ A;  1JWD A;  1BU3 A;  3SG5 A;  4CPV A;  1C07 A;  3WNX B;  1OOF A;  2HF5 A;  3HX4 A;  1CTR A;  1WDC B;  3I5H C;  1QVI Z;  1DJW A;  2M8U A;  1BR1 B;  4GPL B;  3PJI A;  3QME A;  3VRN A;  1W9Z A;  1XVJ A;  4BY4 A;  3L4L A;  1FBV A;  2ZNE A;  5DKR A;  1B7T Y;  5HLO A;  1CFC A;  2F8P A;  2KYF A;  2TN4 A;  2OS8 C;  1AJ4 A;  5AEQ A;  1A29 A;  5D3O A;  2GV5 A;  4YRU A;  2K8M B;  3EK4 A;  3CWG A;  2OPO A;  4ZCU A;  4KYN A;  5HKZ A;  3UO9 A;  1AUI B;  2AMI A;  1LIN A;  2BNX A;  2E30 A;  1M63 B;  3FWB A;  3WHU B;  3VRP A;  1C7W A;  1YUU A;  3O4X A;  3OGN A;  5I2Q A;  3JVT B;  1K9K A;  1LS8 A;  2L2C A;  1WLM A;  1OOG A;  3I5F C;  1ZOT B;  2Y1M A;  3IF7 A;  1DGV A;  4FQT A;  4PE0 A;  5D69 A;  3KPX A;  4YGC B;  1EXR A;  1ZMZ A;  2CNP A;  1IQ3 A;  3CDN A;  2KHN A;  2I94 A;  2OTG C;  1N2D A;  2CCM A;  4NQG A;  1S5G Y;  1N0Y A;  2F3Z A;  1QV0 A;  2Q91 A;  2EGD A;  4CLN A;  3OBV A;  1J1E A;  1QS7 A;  1V1F A;  5TNC A;  3VRQ A;  1EG4 A;  4OVN F;  3SIB A;  2MBX A;  3S0D A;  1AK8 A;  2JWW A;  1RJV A;  1NCZ A;  4BY5 A;  3TDZ A;  2JTT A;  2O60 A;  3DYE A;  3V2L A;  4MRY A;  3TUY B;  3R1V A;  4HSZ A;  2L51 A;  4YI8 A;  1TNW A;  1Y6W A;  3SG2 A;  1BG1 A;  1NX2 A;  3PSR A;  2KAV A;  4QJ5 B;  1S26 D;  3DY9 A;  2PAL A;  5JJG A;  1ZUZ A;  3ZWH A;  5AXI A;  2AAO A;  2I2R E;  1C7V A;  2MLE C;  4PHM A;  3SIA A;  2LUX A;  1TOP A;  2M97 A;  1MXL C;  1G33 A;  2WCJ A;  1CFF A;  2P6B B;  2IS9 A;  1KSM A;  3BXK A;  1SPY A;  1CDP A;  3TDI A;  1KQV A;  3S0G A;  4AQI A;  2BL0 B;  1WRK A;  1WRZ A;  4MSP A;  4TNC A;  4USL A;  4YGE B;  1UP5 A;  2L5Y A;  2LAP A;  2KQY A;  1IKU A;  2LCP A;  5JOL A;  1QX2 A;  1P28 A;  1REC A;  2NCP A;  3B88 A;  2QPT A;  3B7A A;  3KHE A;  1PSB A;  1BLQ A;  1KFX S;  1B47 A;  1HQV A;  1WY9 A;  1FF1 A;  2AUC A;  2M1U A;  3N7H A;  3O78 A;  1IJ6 A;  3TUY C;  2KDH A;  2MA2 A;  2LVK A;  3IQO A;  3EKH A;  1KK8 B;  1TWO A;  2LNK A;  3PAT A;  4N1F A;  4PE1 A;  1RK9 A;  1CFP A;  1FW4 A;  2PSR A;  3I5I C;  3VRO A;  1OOJ A;  2M0R A;  3BFH A;  1SR6 C;  3EK8 A;  1SL9 A;  3VRR A;  2KYC A;  1CM4 A;  4MBE A;  1S6C A;  2G9B A;  2KI4 B;  4CID A;  2F3Y A;  4UPG A;  3NSI A;  4JKT A;  1SRA A;  5ER4 X;  2Q4U A;  3O6B A;  4AQJ A;  3D75 A;  2WCB A;  2JXC A;  3CR5 X;  4ETO A;  1HT9 A;  4A4B A;  3S0E A;  5I94 A;  1EH2 A;  1QX7 A;  2ZRT A;  1FI6 A;  1JFK A;  4DUQ A;  1UHN A;  4GFT A;  2LVI A;  2LM5 A;  3CZ0 A;  2LHL A;  3F45 A;  3OB2 B;  3PN7 B;  4R1E A;  4YBH B;  4GGN A;  1DF0 A;  3AAK A; 
#chains in the Genus database with same CATH homology
 5F6T A;  1OMR A;  2WOS A;  1YR5 A;  1MXE A;  1A03 A;  1MQ1 A;  4GBA A;  1BR4 B;  3D10 A;  1SR6 B;  1QLK A;  1J7O A;  1K2H A;  1QIV A;  1AHR A;  2DOQ A;  1SCV A;  4MVF A;  3BOW A;  1CDN A;  1SNL A;  1B8C A;  1KWO C;  2HQ8 A;  1RRO A;  3BOW B;  2LLU A;  4YGB B;  1DJY A;  2H61 A;  1NX1 A;  1S36 A;  2LLS A;  3NSL A;  1CLB A;  3TDU A;  5J3X A;  2JNX A;  1CMF A;  1RWY A;  1BOD A;  4XJK B;  1MR8 A;  5FYX A;  1PVA A;  2LLT A;  4FTG A;  2JZI A;  4XJK A;  2KAX A;  2NLN A;  1U5I A;  1NYA A;  1JC2 A;  3LCP C;  2MAZ A;  4GAO A;  1CM1 A;  2O5G A;  2WC8 A;  1IH0 A;  2H2K A;  2LVV A;  4MZK A;  1B7T Z;  4PHJ A;  3LL8 B;  3CLN A;  2PVB A;  5D7F A;  1TN4 A;  1K9U A;  1QTX A;  1UHJ A;  2PRU A;  1YUR A;  1RFJ A;  1K93 D;  2ZKM X;  2BBN A;  2ISD A;  1PK0 D;  1M31 A;  5GQQ C;  2FCE A;  3BUM B;  1XFW O;  1XK4 C;  4M2P A;  1S6I A;  4WQ3 A;  4AOM A;  1SMG A;  4M2Q A;  2PMY A;  5KU1 A;  4E68 A;  3AAJ A;  4PHN A;  3DVM A;  2I7A A;  4Q04 A;  1A4P A;  2FOT A;  2L50 A;  3A4U B;  1TNP A;  2KOT A;  1LVC D;  3CS1 A;  3PM8 A;  4NDD A;  1S5G Z;  1JBA A;  1EL4 A;  3WXA A;  1JF0 A;  3HCM A;  2KFG A;  4GUK A;  3ICB A;  2G2B A;  5DKQ A;  1UHI A;  2BBM A;  1KWO B;  3O2P A;  3C1V A;  2NXQ A;  4M2O A;  1J7Q A;  1KCY A;  2MRD A;  2LP2 A;  1M45 A;  3PN7 C;  1PAL A;  1BJF A;  3GK1 A;  1JSA A;  1XFX O;  1W7I B;  4NDC A;  4N5X A;  1M39 A;  1LA0 A;  4D1E A;  1BF5 A;  4JPZ B;  4U8D A;  1YVL A;  2KSP A;  1UUS A;  1XFY O;  1CB1 A;  3CGA A;  1F8H A;  2K2F A;  1IGV A;  1K90 D;  5CSN A;  2ZRS A;  2BE4 A;  1DF0 B;  1KQM C;  2KFH A;  2A4J A;  1KK7 Z;  1J55 A;  2BKI B;  1CMG A;  1Y1A A;  1F55 A;  1SL8 A;  2K0J A;  4I5N B;  4DS7 A;  1GGW A;  4PE4 A;  2CBL A;  1OMD A;  2M7L A;  3RM1 A;  1SKT A;  2CXJ A;  2K2A A;  1AVS A;  1DVI A;  2RGI A;  3A8R A;  3WHT B;  2D8N A;  2KNE A;  3KEV A;  2BE6 A;  2CTN A;  2JC2 A;  2SCP A;  3DF0 B;  2WCE A;  3DF0 A;  3CR4 X;  1QAS A;  4YGD B;  1MHO A;  4OCI A;  5G08 A;  1VRK A;  2ZFD A;  2K7O A;  1TCF A;  3LK1 A;  4P5O E;  4N1G A;  4ORC B;  2JPT A;  1KFU L;  2HET A;  2HQW A;  4YI9 A;  1SW8 A;  1E8A A;  1K8U A;  1K94 A;  5AAN A;  1CLM A;  2LMT A;  1RTP 1;  1GJY A;  1B9A A;  1PRW A;  2JOJ A;  1Y1U A;  1V1G A;  4F0Z B;  4DIR A;  1MUX A;  1DJX A;  2BKH B;  2F33 A;  4DCK A;  3K21 A;  5BPJ A;  1TRF A;  1X02 A;  1IJ5 A;  2CT9 A;  2H61 C;  2LHI A;  2F2O A;  1KK8 C;  1QIW A;  3JVT C;  5CSJ A;  2LE9 B;  3FS7 A;  3I5I B;  5I8N A;  1DJZ A;  2FJU B;  3NSK A;  4I5J A;  1NX3 A;  1NPQ A;  1QX5 B;  1AJ5 A;  1S1E A;  2EC6 B;  2KQ6 A;  3MSE B;  4MZL A;  1B8L A;  1IG5 A;  1DGU A;  2KI6 D;  1H4B A;  3RLZ A;  1YUS A;  4WRI A;  1ZAC A;  4C0J A;  3TZ1 A;  1DMO A;  2JT0 A;  5ER5 A;  5HKY A;  1B4C A;  1MWN A;  1B8R A;  1GGZ A;  3I5G C;  4HRG A;  1F70 A;  2JT3 A;  2EHB A;  1OQP A;  2KBM A;  1DJH A;  2MHH A;  1WRL A;  2NCO A;  1F54 A;  3JTD C;  1G4Y R;  2JTZ A;  1OE9 B;  1XO5 A;  2FCD A;  2JXL A;  4MLW A;  1F71 A;  1JUO A;  4OKH A;  1EG3 A;  1R6P A;  2I18 A;  2KAY A;  3BYA A;  5I2L A;  3M0W A;  3E3R A;  1MF8 B;  5AER A;  1J1D A;  1XFV O;  2JU0 A;  3NXA A;  4XYN A;  3GOF A;  4MZJ A;  4FQO A;  2BCB A;  3H4S E;  4JWQ A;  2M1K B;  2M7N A;  2LV7 A;  3OX6 A;  4QJ4 B;  1NP8 A;  3BQ3 A;  1NUB A;  1OSA A;  1XA5 A;  1YX7 A;  1K95 A;  1S6J A;  3EVR A;  3O4Y A;  1UUR A;  1LXF C;  1CDL A;  2WOR A;  2K7D A;  2OTG B;  3AKB A;  1ZFS A;  2L2E A;  3EK7 A;  4C0L A;  5K89 A;  1CDM A;  2KFF A;  1QVI Y;  4MEW A;  1XK4 A;  1CKK A;  1ALW A;  3EVU A;  4NDB A;  4CFR A;  3SG7 A;  2EC6 C;  1ODB A;  4ORB B;  1DT7 B;  2LP3 A;  1Y1X A;  4L9M A;  1CFD A;  2LAN A;  3FWC A;  1SBJ A;  1UWO A;  4PHK A;  2B1U A;  1IWQ A;  4I5L B;  1DJI A;  1UHK A;  2MJW B;  4GGF A;  4ORA B;  1M46 A;  1SK6 D;  4I5K A;  3DD4 A;  1F4O A;  1YX8 A;  3QRX A;  1KFU S;  1AP4 A;  1KSO A;  2JUL A;  1FPW A;  1K96 A;  2M3W A;  3JTD B;  4PDZ A;  4WQ2 A;  3LK0 A;  3NSO A;  3ZNI A;  3FIA A;  3D0Y A;  1TIZ A;  4QJ3 B;  3KF9 A;  3D0Y B;  2ZND A;  5KTY A;  1QAT A;  1BOC A;  2WCF A;  4OR9 B;  1B1G A;  1NIW A;  1F4Q A;  2COL B;  1L7Z A;  4PAL A;  2KI6 C;  2GGZ A;  3OX5 A;  1YTZ C;  1D1O A;  1KK7 Y;  1N65 A;  2F2P A;  4CFQ A;  1J7R A;  1KFX L;  3SG4 A;  2LMV A;  3SJS A;  1SCM C;  1H8B A;  1A2X A;  1NSH A;  2Y5I A;  1LA3 A;  1OMV A;  2BEC A;  4P2Y B;  1OZO A;  1NWD A;  2HPS A;  2LVJ A;  4ICB A;  2L4I A;  2V53 A;  2KGR A;  1EJ3 A;  1NCY A;  4PE7 A;  1TNQ A;  2K7B A;  1J7P A;  5PAL A;  4MN0 A;  2JT8 A;  1SCM B;  3BUN B;  5AFP A;  4MRX A;  3EKJ A;  1YRU B;  2JNF A;  1U5I B;  1DTL A;  3DVE A;  3PLF B;  2MLF C;  1DJG A;  2KGB C;  1TCO B;  5DKN A;  1YVH A;  1QXP A;  2L4H A;  3KO0 A;  2SAS A;  3OP0 A;  1Q80 A;  4OV2 A;  5CSI A;  5HKW A;  3DVK A;  3I5H B;  2KBI A;  3PFV A;  5CSF A;  3SG3 A;  2QAC A;  1NCX A;  1SY9 A;  1UHH A;  3DVJ A;  4PCW A;  3BUX B;  4DRW A;  4A4C A;  1WLZ A;  3LLE A;  2M49 B;  1ALV A;  3TS5 C;  1BMO A;  1G8I A;  4HRE E;  2VRG A;  1YUT A;  2NZ0 A;  2L0P A;  2PAS A;  1S3P A;  2M9G A;  4JQ0 D;  1QJT A;  1TTX A;  2KI4 C;  2JQ6 A;  4HRH A;  5KSZ A;  3BUO B;  5HYD A;  4ZCV A;  3GK4 X;  3SG6 A;  1OZS A;  1SYM A;  5HLV A;  3GK2 A;  1LKJ A;  2GGM A;  2L5X B;  1CNP A;  1K9P A;  3CZT X;  2JRF A;  4GGF C;  1NX0 A;  2LUC A;  1XYD A;  1YRT B;  1XFZ O;  1L2O B;  4GNK B;  1A75 A;  3CR2 A;  5CPV A;  1XFU O;  2L98 A;  1PUL A;  3I5F B;  5I2O A;  1WDC C;  1FI5 A;  3OB1 B;  1KQM B;  4C0K A;  2WND A;  2LC5 A;  2ZN8 A;  3OHM B;  1GQM A;  1R2U A;  4YGA A;  1JF2 A;  1W7J B;  2R2I A;  2BCX A;  3BUW B;  3VGO A;  2ZN9 A;  2K61 A;  2Y4Q A;  3AKA A;  1CLL A;  3CTN A;  2OS8 B;  1PSR A;  1TNX A;  1IQ5 A;  2LMU A;  1QLS A;  3PAL A;  3EVV A;  2BCA A;  3IQQ A;  1A75 B;  1PVB A;  1Y0V H;  3TS5 B;  1BT6 A;  2E6W A;  5IBW A;  2BL0 C;  1L2O C;  4IL1 A;  5B8I B;  2M29 A;  1SL7 A;  2K7C A;  2Y1N A;  1QV1 A;  1IRJ A;  3I5G B;  1JFJ A;  1JWD A;  1BU3 A;  3SG5 A;  4CPV A;  1C07 A;  3WNX B;  3HX4 A;  2HF5 A;  1CTR A;  1WDC B;  3I5H C;  1QVI Z;  1DJW A;  2M8U A;  1BR1 B;  4GPL B;  3VRN A;  1XVJ A;  4BY4 A;  1FBV A;  2ZNE A;  5DKR A;  1B7T Y;  5HLO A;  1CFC A;  2F8P A;  2KYF A;  2TN4 A;  2OS8 C;  1AJ4 A;  5AEQ A;  1A29 A;  4YRU A;  2GV5 A;  2K8M B;  3EK4 A;  3CWG A;  2OPO A;  4ZCU A;  5HKZ A;  1AUI B;  2AMI A;  1LIN A;  2E30 A;  1M63 B;  3FWB A;  3VRP A;  1C7W A;  1YUU A;  5I2Q A;  3JVT B;  1K9K A;  3I5F C;  3IF7 A;  1WLM A;  3WHU B;  1ZOT B;  2Y1M A;  4PE0 A;  1DGV A;  5D69 A;  3KPX A;  4YGC B;  1EXR A;  1ZMZ A;  2CNP A;  1IQ3 A;  2KHN A;  2I94 A;  2OTG C;  1N2D A;  2CCM A;  4NQG A;  1S5G Y;  1N0Y A;  2F3Z A;  1QV0 A;  2Q91 A;  2EGD A;  4CLN A;  1J1E A;  1QS7 A;  1V1F A;  5TNC A;  3VRQ A;  1EG4 A;  4OVN F;  3SIB A;  2MBX A;  1AK8 A;  2JWW A;  1RJV A;  1NCZ A;  4BY5 A;  3TDZ A;  2JTT A;  2O60 A;  4MRY A;  3TUY B;  4HSZ A;  2L51 A;  4YI8 A;  1TNW A;  1Y6W A;  3SG2 A;  1BG1 A;  1NX2 A;  3PSR A;  2KAV A;  4QJ5 B;  1S26 D;  2PAL A;  5JJG A;  1ZUZ A;  3ZWH A;  5AXI A;  2AAO A;  2I2R E;  1C7V A;  2MLE C;  4PHM A;  3SIA A;  2LUX A;  1TOP A;  2M97 A;  1MXL C;  1G33 A;  1CFF A;  2P6B B;  2IS9 A;  1KSM A;  3BXK A;  1SPY A;  1CDP A;  3TDI A;  1KQV A;  4AQI A;  2BL0 B;  1WRK A;  1WRZ A;  4MSP A;  4TNC A;  4USL A;  4YGE B;  1UP5 A;  2LAP A;  2KQY A;  1IKU A;  2LCP A;  5JOL A;  1QX2 A;  1REC A;  2NCP A;  2QPT A;  3KHE A;  1PSB A;  1BLQ A;  1KFX S;  1B47 A;  1HQV A;  1WY9 A;  1FF1 A;  2AUC A;  2M1U A;  3O78 A;  1IJ6 A;  3TUY C;  2KDH A;  2MA2 A;  2LVK A;  3IQO A;  3EKH A;  1KK8 B;  2LNK A;  3PAT A;  4N1F A;  4PE1 A;  1RK9 A;  1CFP A;  1FW4 A;  2PSR A;  3I5I C;  3VRO A;  1OOJ A;  2M0R A;  1SR6 C;  3EK8 A;  1SL9 A;  3VRR A;  2KYC A;  1CM4 A;  4MBE A;  1S6C A;  2G9B A;  2KI4 B;  4CID A;  2F3Y A;  4UPG A;  3NSI A;  1SRA A;  5ER4 X;  2Q4U A;  3O6B A;  4AQJ A;  2WCB A;  2JXC A;  3CR5 X;  4ETO A;  1HT9 A;  4A4B A;  1EH2 A;  1QX7 A;  2ZRT A;  1FI6 A;  1JFK A;  4DUQ A;  1UHN A;  4GFT A;  2LVI A;  2LM5 A;  2LHL A;  3F45 A;  3OB2 B;  3PN7 B;  4R1E A;  4YBH B;  4GGN A;  1DF0 A;  3AAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...