2K0JA

Solution structure of cam complexed to drp1p
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
147
structure length
147
Chain Sequence
b'DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords calmodulin
publication title Accurate solution structures of proteins from X-ray data and a minimal set of NMR data: calmodulin-peptide complexes as examples.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 46
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k0jA00
2M8UA 2IS9A 3E3RA 1ALWA 1M63B 1OMDA 1V1GA 4PHKA 1FI6A 2LMTA 4NDDA 4PHNA 2E6WA 1ZFSA 1PSBA 1S5GY 2WOSA 3OX5A 1F71A 1CKKA 2EGDA 2G2BA 2WNDA 4GUKA 4U8DA 5DKQA 3GK4X 2MJWB 3NXAA 2Y5IA 1XA5A 2L4IA 1KWOB 2LMVA 2KQ6A 1UUSA 2JNXA 4BY4A 1PALA 1SCMC 2LLSA 1GGZA 1UWOA 4MZKA 4YRUA 3AAKA 4OVNF 1F4QA 1MXEA 1R6PA 2KSPA 1YRUB 4A4CA 1K9KA 3CLNA 3EKHA 4AQIA 1B7TZ 2QPTA 4PALA 1K8UA 2M97A 1J7PA 2PSRA 1AUIB 2GV5A 3I5IB 5ER5A 1FF1A 2M7LA 1CLBA 3PN7C 1AVSA 5B8IB 1C7VA 2CNPA 3VROA 3CR2A 5J3XA 1SNLA 1QIVA 2BE4A 3SG5A 3PM8A 1TTXA 2L0PA 2BBNA 1DGVA 1L2OC 3PSRA 1BODA 1J7RA 2AMIA 3DF0B 1S26D 4MEWA 3BOWA 5KTYA 2I18A 4YBHB 1DGUA 1MXLC 2HPSA 1YUTA 3D0YA 4ETOA 1RROA 1DMOA 1J1DA 2NCPA 1YTZC 1YRTB 2MLEC 2M0RA 2NCOA 2ZFDA 1OZOA 2JPTA 4QJ3B 3IF7A 1YVLA 2LVJA 4OR9B 1OMVA 1UP5A 1XFZO 1ZOTB 5I2LA 4YGCB 1C07A 3TS5B 1QLSA 5CSNA 1FBVA 4I5LB 1DJYA 1BOCA 1BR4B 1XFXO 2CCMA 1ZUZA 1TNXA 4GNKB 4PHMA 1DT7B 1K90D 3CR4X 3SIBA 1F8HA 1KK7Y 4CPVA 2LANA 3EKJA 1NX1A 2JU0A 2K2AA 3CWGA 5CPVA 1CFDA 2F3ZA 4M2QA 1XFUO 2HF5A 1GQMA 2JT3A 2GGMA 4USLA 1SL7A 5F6TA 1N0YA 1Y1AA 3JTDB 1M31A 4BY5A 1ZMZA 1IQ3A 2F2OA 1OSAA 1J7QA 3EVRA 3FS7A 3TDUA 1N65A 5PALA 2CBLA 3NSIA 5CSFA 1B4CA 3LK0A 1JC2A 1SR6B 2KQYA 2NXQA 2ZRSA 3SG6A 4YGEB 1BJFA 2EHBA 5AANA 4IL1A 2CTNA 2OTGC 4NDBA 3KPXA 2KBMA 4ZCVA 1QVIZ 1QATA 1TRFA 1N2DA 1K9UA 2O5GA 2LLUA 3ICBA 1SK6D 3I5HB 3ZNIA 1QLKA 3NSOA 1CMGA 1QJTA 1RWYA 3KEVA 1W7IB 4L9MA 1ZACA 4A4BA 1XFYO 2LVIA 1K96A 3HCMA 2L50A 1K2HA 2A4JA 1CLLA 4HRGA 1B1GA 1UURA 2TN4A 2Y1MA 1A4PA 1UHNA 1SRAA 2D8NA 3BQ3A 1DJGA 1YVHA 2ZNEA 4HRHA 1JSAA 1C7WA 2JWWA 1B47A 3BXKA 4MRXA 1Y0VH 1HT9A 3DF0A 1BLQA 1FI5A 1QV0A 1LINA 2KAVA 2LV7A 1HQVA 1CLMA 1TCFA 2MHHA 4FTGA 1WLMA 4PDZA 5AEQA 1SCVA 2KYCA 1X02A 5AERA 3O4YA 4MZJA 1TNWA 2LP3A 1CMFA 4GAOA 2M1KB 2LHIA 4GFTA 1K93D 5HKWA 2MRDA 1B8LA 1RK9A 1JF0A 1NYAA 3CR5X 4AOMA 2K8MB 2LLTA 1J55A 2WCFA 1LA3A 1IG5A 5HYDA 2JXCA 2L5XB 4MLWA 4MVFA 2JNFA 1F55A 1MUXA 4DRWA 5DKRA 4JPZB 5JJGA 2KAYA 3HX4A 3TDIA 4CLNA 1V1FA 4GPLB 1NCZA 3F45A 3I5IC 3TDZA 4MSPA 3H4SE 4HREE 4YGBB 1GJYA 1ODBA 4QJ4B 4WRIA 2BE6A 2B1UA 2BL0B 3RM1A 1MF8B 1WRZA 1CDLA 2L4HA 2Q4UA 4ORCB 4OV2A 2FJUB 3AAJA 3RLZA 2ZNDA 2MBXA 1NPQA 4PE4A 1IQ5A 1KSMA 1TN4A 3CZTX 2WCEA 1CM1A 1U5IB 3SG3A 5GQQC 2M49B 1LA0A 1QIWA 2JZIA 1WRKA 1JF2A 4MN0A 1DF0B 2LM5A 1OMRA 3BUXB 2LVVA 3WXAA 1WY9A 4DCKA 2MAZA 1E8AA 5FYXA 1XVJA 3KHEA 3O2PA 1WDCB 3M0WA 5BPJA 1D1OA 3DVJA 2RGIA 1EL4A 3BUNB 1F70A 2KI6D 5KU1A 3TS5C 1Y6WA 2L2EA 1TCOB 1YR5A 2EC6C 5CSIA 1JWDA 1B7TY 1TNQA 2LUXA 4PE7A 1CFFA 1DJHA 4XJKB 1IJ6A 1S6IA 3VRPA 3WHTB 1RECA 1EH2A 2MA2A 1F54A 2PASA 1BU3A 2HQWA 1BR1B 1YUSA 2JTZA 1NWDA 5G08A 3DD4A 3JTDC 1IH0A 2V53A 3VRQA 1M46A 4GGFA 1DJZA 3KF9A 1CFPA 2M1UA 1KFUS 2OS8B 1B8RA 4MRYA 1A75B 2FCDA 4M2PA 4C0JA 4CFQA 1QX2A 2KI4B 4E68A 2PRUA 2LHLA 1G4YR 1SL9A 2O60A 2QACA 4N5XA 5ER4X 2WC8A 2BBMA 4MZLA 1NSHA 2JC2A 1SR6C 4PE0A 1IKUA 1JFJA 4GGNA 2PALA 1NX3A 1B8CA 3EK7A 1EG3A 3MSEB 1KFXS 2LAPA 1KK8B 1SBJA 2ZN8A 1JFKA 1SW8A 2VRGA 1LVCD 5I2QA 1CDMA 1YX7A 2K0JA 1YURA 2JT8A 1DJIA 2I2RE 2Y1NA 2LCPA 3FWCA 4C0LA 3I5HC 1LKJA 3PFVA 1XO5A 3EK8A 4PHJA 2ZRTA 5AFPA 4AQJA 3CS1A 2ISDA 3O6BA 2KYFA 1KSOA 4ICBA 1JBAA 3SG2A 2BKHB 1H4BA 1ALVA 3I5GB 4JQ0D 2P6BB 1SKTA 1SMGA 4TNCA 1A29A 3TUYC 4I5NB 1K95A 3I5FB 1J7OA 1L7ZA 2NZ0A 1A03A 2Q91A 1BG1A 4ORBB 2BECA 1U5IA 2KDHA 1KQVA 1S3PA 1FW4A 2R2IA 4GGFC 2HQ8A 1SYMA 4UPGA 1S5GZ 2AAOA 4WQ2A 4YGAA 5HLVA 2M9GA 1DF0A 2KNEA 2M7NA 1AJ4A 4YI8A 2L98A 5JOLA 5DKNA 3LK1A 4MBEA 1PVBA 4YI9A 1JUOA 3GOFA 3OX6A 1SPYA 1NIWA 2PVBA 2ZKMX 3DVKA 1QXPA 3LL8B 5I8NA 1SL8A 2K7DA 5D7FA 1QVIY 1XK4A 1H8BA 1IGVA 1Y1XA 1AK8A 1EG4A 1OE9B 2K7OA 4I5KA 2LNKA 3BYAA 2BCBA 1KWOC 4HSZA 4ORAB 2K61A 1KQMB 1DJXA 1YX8A 2SCPA 4XJKA 2BCXA 1G8IA 1PSRA 2K2FA 3GK1A 1OOJA 3A4UB 3PATA 5I2OA 3JVTB 1QX7A 2M3WA 1BF5A 3BUOB 3EVVA 2KBIA 2FOTA 5TNCA 3PLFB 1CB1A 1IWQA 1M39A 2M29A 3DVMA 1R2UA 3KO0A 2BL0C 4FQOA 1VRKA 4ZCUA 1PULA 2KFFA 1A75A 4I5JA 1YUUA 2KFHA 3SJSA 1UHKA 1GGWA 3CTNA 2COLB 1RJVA 2FCEA 3NSKA 5HLOA 1KFUL 3WNXB 3OB2B 3LLEA 1S6JA 3LCPC 4M2OA 4N1FA 3SG7A 3D10A 4OKHA 2F3YA 2KFGA 2LMUA 2KGRA 1XFVO 1SCMB 2ZN9A 2HETA 4YGDB 2G9BA 1WDCC 2JQ6A 2KGBC 3IQOA 2F2PA 1KFXL 1CFCA 4P5OE 1XK4C 2KOTA 2Y4QA 1OQPA 1W7JB 1QASA 1SY9A 1UHIA 1CNPA 1BT6A 1NX0A 3NSLA 1KCYA 3EVUA 1DJWA 3GK2A 4WQ3A 3SG4A 1KK7Z 1CTRA 3IQQA 3PN7B 1TIZA 4R1EA 2K7CA 1FPWA 1XFWO 1PRWA 2LP2A 2H61A 2OPOA 4QJ5B 1L2OB 2H2KA 3AKAA 1UHJA 3CGAA 1CDPA 4Q04A 2SASA 2JTTA 3BUMB 1NUBA 2OS8C 3OHMB 1S1EA 2WCBA 2KHNA 2KI4C 3WHUB 1IRJA 2AUCA 3PALA 2KAXA 3DVEA 1NCXA 1AHRA 1MWNA 2F8PA 1EJ3A 1NX2A 2EC6B 4OCIA 5D69A 2LUCA 1TOPA 1KK8C 3VRNA 3VGOA 1PVAA 1DVIA 1G33A 1QTXA 1S6CA 4DIRA 1XYDA 1OZSA 3SIAA 3OB1B 4NQGA 2JT0A 5HKYA 2K7BA 3O78A 3FWBA 2L51A 1WRLA 3FIAA 2JOJA 1S36A 2WORA 3BUWB 3QRXA 1TNPA 2CT9A 1M45A 1F4OA 1Q80A 2F33A 3EK4A 3I5GC 1K94A 4N1GA 5CSJA 4DUQA 1CM4A 4NDCA 3C1VA 1DTLA 2I94A 4PE1A 4C0KA 1BMOA 2PMYA 3I5FC 4CFRA 1QX5B 2KI6C 1RFJA 1IJ5A 2H61C 2I7AA 2NLNA 4P2YB 1LXFC 3VRRA 3BOWB 5HKZA 2MLFC 3A8RA 3AKBA 3D0YB 1B9AA 5KSZA 2LVKA 1Y1UA 1J1EA 1RTP1 4F0ZB 4CIDA 4D1EA 4GBAA 1PK0D 4XYNA 2OTGB 2JRFA 2BKIB 4JWQA 5AXIA 4DS7A 1AJ5A 1A2XA 1QV1A 2LE9B 1NP8A 4PCWA 1UHHA 1MHOA 3TZ1A 1AP4A 2DOQA 2BCAA 1EXRA 1NCYA 2JXLA 1K9PA 1KQMC 3TUYB 3K21A 1MQ1A 2LC5A 3ZWHA 5IBWA 1WLZA 2JULA 2E30A 2GGZA 3JVTC 1QS7A 1CDNA 3OP0A 5K89A 2CXJA 1MR8A
chains in the Genus database with same CATH superfamily
2M8UA 2IS9A 3E3RA 3NHIA 1ALWA 1M63B 1OMDA 1V1GA 2PYQA 4PHKA 1FI6A 2LMTA 4NDDA 4PHNA 2E6WA 3FE9A 1ZFSA 1PSBA 1S5GY 2WOSA 3OX5A 3S0EA 1F71A 1CKKA 2EGDA 2G2BA 2WNDA 4GUKA 4U8DA 5DKQA 1TUJA 1ORGA 3GK4X 2MJWB 5HL1A 3NXAA 3R72A 2Y5IA 1XA5A 2L4IA 2P70A 1KWOB 2LMVA 2KQ6A 1UUSA 2JNXA 4BY4A 1PALA 1SCMC 2LLSA 1GGZA 1UWOA 4MZKA 4YRUA 3AAKA 4OVNF 1F4QA 1MXEA 1R6PA 2KSPA 1YRUB 4FQTA 4A4CA 1K9KA 2JPOA 3CLNA 3EKHA 4AQIA 1OOHA 1B7TZ 2KLDA 3QMEA 2QPTA 4PALA 1OOGA 1K8UA 2M97A 1J7PA 2PSRA 1AUIB 2GV5A 3I5IB 5ER5A 1FF1A 2M7LA 1CLBA 3PN7C 1AVSA 5B8IB 1C7VA 2CNPA 3VROA 3CR2A 5J3XA 1SNLA 1SSEB 1QIVA 2BE4A 4JKTA 3SG5A 3PM8A 4JD9A 1TTXA 2L0PA 2BBNA 1DGVA 1L2OC 3PSRA 1BODA 1J7RA 2AMIA 3DF0B 1S26D 4MEWA 3BFBA 3BOWA 5KTYA 2I18A 4YBHB 3EG5B 1DGUA 1MXLC 3B6XA 2HPSA 1YUTA 3D0YA 4ETOA 1RROA 1DMOA 1J1DA 2NCPA 1YTZC 1YRTB 2MLEC 2M0RA 2NCOA 2ZFDA 1OZOA 2JPTA 3B7AA 4QJ3B 3IF7A 1YVLA 2LVJA 4OR9B 1OMVA 1UP5A 1XFZO 1ZOTB 5I2LA 4YGCB 1C07A 3TS5B 1QLSA 5CSNA 1FBVA 4I5LB 1DJYA 1BOCA 1BR4B 1XFXO 3CZ0A 2CCMA 1ZUZA 5I94A 1TNXA 4GNKB 4PHMA 1DT7B 1K90D 3CR4X 1OOFA 3D73A 3SIBA 1F8HA 1KK7Y 4CPVA 2LANA 3EKJA 1NX1A 2JU0A 2K2AA 3CWGA 5CPVA 1Z4HA 1CFDA 3S0DA 2F3ZA 4M2QA 1XFUO 2HF5A 1GQMA 2JT3A 3CYZA 2GGMA 4USLA 1SL7A 5F6TA 1N0YA 1Y1AA 3JTDB 3V2LA 1M31A 2QEVA 2WCJA 1ZMZA 2L5YA 4BY5A 1IQ3A 2F2OA 1OSAA 1J7QA 3EVRA 3FS7A 3L47A 3TDUA 1N65A 2BAPA 5FI6A 5PALA 2CBLA 3NSIA 5CSFA 5FI2A 1B4CA 3LK0A 1JC2A 3DY9A 1SR6B 2KQYA 2NXQA 2ZRSA 3SG6A 4YGEB 1BJFA 5D3OA 2EHBA 5AANA 3L4LA 3Q8IA 4IL1A 2CTNA 2OTGC 4NDBA 3KPXA 1OW4A 2KBMA 4ZCVA 1QVIZ 1QATA 1TRFA 1N2DA 1K9UA 2O5GA 2LLUA 3ICBA 1SK6D 3I5HB 3CZ2A 3ZNIA 2BNXA 1QLKA 3NSOA 3BJHA 1CMGA 1QJTA 1RWYA 3KEVA 1W7IB 4L9MA 1ZACA 4A4BA 1XFYO 2LVIA 1K96A 2WCHA 3HCMA 2L50A 3SS4A 1K2HA 2A4JA 1CLLA 4HRGA 1B1GA 1UURA 2TN4A 2Y1MA 1A4PA 1UHNA 1SRAA 3DYEA 2D8NA 3BQ3A 1OOIX 1DJGA 1YVHA 2ZNEA 4HRHA 1JSAA 1C7WA 3DXLA 2JWWA 1B47A 3BXKA 4MRXA 1Y0VH 1HT9A 3DF0A 1BLQA 1FI5A 1QV0A 3R1VA 1LINA 2KAVA 2LV7A 3D78A 1HQVA 3SS3A 1CLMA 1TCFA 2MHHA 1C3ZA 1WLMA 4FTGA 3OBVA 4PDZA 3L4AA 5AEQA 1SCVA 2KYCA 1X02A 5AERA 3O4YA 4MZJA 1TNWA 2LP3A 1CMFA 4GAOA 2M1KB 2LHIA 4GFTA 1K93D 5HKWA 2MRDA 1B8LA 1RK9A 1JF0A 1NYAA 3CR5X 3O4XA 4AOMA 2QEBA 2K8MB 2LLTA 1J55A 2WCFA 1LA3A 1IG5A 5HYDA 2JXCA 2L5XB 4MLWA 4MVFA 2JNFA 1F55A 1MUXA 4DRWA 5DKRA 4JPZB 5JJGA 2KAYA 3HX4A 3TDIA 4CLNA 1V1FA 4GPLB 1NCZA 3F45A 3I5IC 3TDZA 4MSPA 3H4SE 5EL2A 4HREE 4YGBB 1GJYA 3IVTA 1ODBA 3FE8A 4WRIA 2BE6A 2B1UA 2BL0B 3RM1A 4QJ4B 2K60A 1MF8B 1WRZA 1CDLA 2L4HA 2Q4UA 4ORCB 4OV2A 2FJUB 3AAJA 3RLZA 2ZNDA 2MBXA 1NPQA 4PE4A 2H8VA 1IQ5A 1KSMA 1TN4A 3CZTX 2WCEA 1CM1A 3D74A 1U5IB 3SG3A 5GQQC 2M49B 1LS8A 5DICA 1LA0A 3PM2A 1QIWA 2JZIA 1WRKA 1JF2A 4MN0A 2KLEA 1DF0B 2LM5A 1OMRA 3BUXB 3BFAA 1QWVA 2LVVA 3WXAA 1WY9A 4DCKA 2MAZA 3RZSA 1E8AA 5FYXA 1XVJA 3KHEA 3O2PA 1WDCB 3M0WA 5BPJA 1D1OA 3DVJA 2RGIA 1EL4A 3BUNB 1F70A 2KI6D 3VB1A 5KU1A 3TS5C 1Y6WA 2L2EA 1TCOB 1XFRA 1YR5A 2EC6C 5CSIA 1JWDA 1B7TY 1TNQA 2LUXA 4PE7A 1CFFA 2WCKA 1DJHA 4XJKB 1IJ6A 1S6IA 3VRPA 3WHTB 3FE6A 1RECA 1EH2A 2MA2A 2WCMA 1F54A 2PASA 1BU3A 2HQWA 1BR1B 1YUSA 2JTZA 1NWDA 5G08A 3DD4A 3JTDC 1IH0A 2QDIA 2V53A 3VRQA 1M46A 4GGFA 1DJZA 3R1PA 3KF9A 1CFPA 2M1UA 1KFUS 2OS8B 1B8RA 4MRYA 1A75B 2FCDA 4M2PA 4C0JA 4CFQA 1QX2A 2KI4B 3UO9A 2PRUA 4E68A 2LHLA 1G4YR 1SL9A 2O60A 2QACA 2WC5A 4N5XA 1DQEA 2WC8A 5ER4X 2BBMA 4MZLA 1NSHA 2JC2A 1SR6C 4PE0A 1IKUA 1JFJA 2ERBA 4GGNA 2PALA 1NX3A 1B8CA 3EK7A 1EG3A 3MSEB 1KFXS 2LAPA 1KK8B 1SBJA 2ZN8A 1JFKA 3D75A 1SW8A 2VRGA 1LVCD 5I2QA 1CDMA 1YX7A 2K0JA 1YURA 2JT8A 1DJIA 2I2RE 2Y1NA 2LCPA 3FWCA 4C0LA 3I5HC 1LKJA 3PFVA 1XO5A 3EK8A 4PHJA 2ZRTA 5AFPA 4AQJA 3D76A 3CS1A 2ISDA 3O6BA 2KYFA 1KSOA 4ICBA 1JBAA 3SG2A 2BKHB 2QEHA 1H4BA 1ALVA 3I5GB 4JQ0D 2P6BB 1SKTA 1SMGA 4TNCA 1GM0A 1A29A 3TUYC 4I5NB 1K95A 3I5FB 1J7OA 1L7ZA 3R1OA 2NZ0A 1A03A 2Q91A 1BG1A 3K1EA 4ORBB 1U5IA 2BECA 2KDHA 1KQVA 1S3PA 1FW4A 2R2IA 4GGFC 4OZDA 2HQ8A 1SYMA 2L2CA 4UPGA 1S5GZ 2AAOA 4WQ2A 4YGAA 5HLVA 2M9GA 1DF0A 3N7HA 2KNEA 2M7NA 1AJ4A 3B88A 4YI8A 2L98A 5JOLA 5DKNA 3LK1A 4MBEA 1PVBA 4YI9A 1JUOA 3GOFA 3OX6A 1SPYA 1NIWA 2PVBA 2ZKMX 3CDNA 1QXPA 3DVKA 3LL8B 3UNWA 1SL8A 2K7DA 2WC6A 5D7FA 5I8NA 1QVIY 1XK4A 1H8BA 1IGVA 1Y1XA 1AK8A 1EG4A 1OE9B 2K7OA 4I5KA 2LNKA 3BYAA 2BCBA 1KWOC 4HSZA 4ORAB 2K61A 1KQMB 1DJXA 1YX8A 2SCPA 4XJKA 2BCXA 3S0FA 1G8IA 1PSRA 2K2FA 3GK1A 1OOJA 3A4UB 1TUZA 3PATA 5FI7A 5I2OA 4INWA 3JVTB 1QX7A 2M3WA 1BF5A 3BUOB 3EVVA 2KBIA 2FOTA 5TNCA 3PLFB 1CB1A 1IWQA 1M39A 2M29A 3DVMA 1R2UA 3KO0A 2BL0C 4FQOA 1VRKA 4ZCUA 1PULA 3NGVA 2KFFA 1A75A 4I5JA 1YUUA 2KFHA 3SJSA 1UHKA 1GGWA 3CTNA 2COLB 1RJVA 2QEOA 2FCEA 3NSKA 5HLOA 1KFUL 2GTEA 2WCLA 3WNXB 3OB2B 3LLEA 3PJIA 1S6JA 3LCPC 4M2OA 4N1FA 3SG7A 3D10A 4OKHA 2F3YA 2KFGA 3NHTA 2LMUA 2FJYA 2KGRA 1XFVO 1SCMB 2ZN9A 2HETA 4YGDB 3S0BA 2G9BA 1WDCC 2JQ6A 3B87A 2KGBC 3IQOA 2F2PA 1KFXL 1CFCA 1DC1A 2YGUA 4P5OE 1XK4C 3S0AA 3SS5A 2KOTA 2Y4QA 1OQPA 1W7JB 4KYNA 1QASA 1SY9A 1UHIA 1CNPA 1BT6A 1NX0A 3NSLA 1KCYA 3EVUA 1DJWA 3GK2A 4WQ3A 3SG4A 1KK7Z 1CTRA 3IQQA 3PN7B 1TIZA 4R1EA 2K7CA 3CZ1A 2P71A 1FPWA 1XFWO 4IJ7A 1W9ZA 1PRWA 2LP2A 2H61A 2OPOA 4QJ5B 1L2OB 2H2KA 3AKAA 1UHJA 3CABA 1CDPA 3CGAA 4Q04A 2SASA 2JTTA 3BUMB 1NUBA 2OS8C 3OHMB 1S1EA 1T14A 2WCBA 2KHNA 2KI4C 3WHUB 1IRJA 2AUCA 3PALA 2KAXA 3DVEA 1NCXA 2KPHA 1AHRA 1MWNA 2F8PA 1EJ3A 1NX2A 2EC6B 3OGNA 4OCIA 5D69A 2LUCA 1TOPA 1KK8C 3VRNA 4F7FA 3VGOA 1PVAA 1DVIA 1G33A 1QTXA 1S6CA 4DIRA 1XYDA 1OZSA 3DZTA 3SIAA 3OB1B 4NQGA 1IIOA 2JT0A 1TWOA 2K7BA 5HKYA 3O78A 3FWBA 2L51A 1WRLA 3FIAA 2JOJA 1S36A 2WORA 3BUWB 3QRXA 3S0GA 1TNPA 2CT9A 1M45A 1F4OA 1Q80A 2F33A 3EK4A 3I5GC 1K94A 4N1GA 5CSJA 4DUQA 1CM4A 4NDCA 3C1VA 1DTLA 2I94A 4PE1A 4C0KA 1BMOA 2PMYA 3I5FC 4CFRA 1QX5B 2KI6C 1RFJA 1Z2CB 1IJ5A 2H61C 2I7AA 2NLNA 2PQLA 4P2YB 1LXFC 3VRRA 3BOWB 5HKZA 2MLFC 3A8RA 3D77A 3AKBA 3D0YB 1B9AA 5KSZA 2LVKA 1Y1UA 1J1EA 1RTP1 4F0ZB 4INXA 4CIDA 4D1EA 1C3YA 1DELA 4GBAA 1PK0D 4PT1A 2OTGB 4XYNA 1P28A 2JRFA 2BKIB 4JWQA 5AXIA 4DS7A 1AJ5A 1A2XA 1QV1A 2LE9B 1NP8A 4PCWA 1UHHA 1MHOA 3TZ1A 1AP4A 2DOQA 3BFHA 2BCAA 1EXRA 1NCYA 2JXLA 1K9PA 1KQMC 3TUYB 3K21A 1MQ1A 2LC5A 1DEKA 3ZWHA 5IBWA 1WLZA 2JULA 2E30A 2GGZA 3JVTC 1QS7A 1CDNA 3OP0A 5K89A 2CXJA 1MR8A 3B86A
chains in the Genus database with same CATH topology
2M8UA 2IS9A 3E3RA 1ALWA 1M63B 1OMDA 1V1GA 4PHKA 1FI6A 2LMTA 4NDDA 4PHNA 2E6WA 1ZFSA 1PSBA 1S5GY 2WOSA 3OX5A 1F71A 1CKKA 2EGDA 2G2BA 2WNDA 4GUKA 4U8DA 5DKQA 3GK4X 2MJWB 3NXAA 2Y5IA 1XA5A 2L4IA 1KWOB 2LMVA 2KQ6A 1UUSA 2JNXA 4BY4A 1PALA 1SCMC 2LLSA 1GGZA 1UWOA 4MZKA 4YRUA 3AAKA 4OVNF 1F4QA 1MXEA 1R6PA 2KSPA 1YRUB 4A4CA 1K9KA 3CLNA 3EKHA 4AQIA 1B7TZ 2QPTA 4PALA 1K8UA 2M97A 1J7PA 2PSRA 1AUIB 2GV5A 3I5IB 5ER5A 1FF1A 2M7LA 1CLBA 3PN7C 1AVSA 5B8IB 1C7VA 2CNPA 3VROA 3CR2A 5J3XA 1SNLA 1QIVA 2BE4A 3SG5A 3PM8A 1TTXA 2L0PA 2BBNA 1DGVA 1L2OC 3PSRA 1BODA 1J7RA 2AMIA 3DF0B 1S26D 4MEWA 3BOWA 5KTYA 2I18A 4YBHB 1DGUA 1MXLC 2HPSA 1YUTA 3D0YA 4ETOA 1RROA 1DMOA 1J1DA 2NCPA 1YTZC 1YRTB 2MLEC 2M0RA 2NCOA 2ZFDA 1OZOA 2JPTA 4QJ3B 3IF7A 1YVLA 2LVJA 4OR9B 1OMVA 1UP5A 1XFZO 1ZOTB 5I2LA 4YGCB 1C07A 3TS5B 1QLSA 5CSNA 1FBVA 4I5LB 1DJYA 1BOCA 1BR4B 1XFXO 2CCMA 1ZUZA 1TNXA 4GNKB 4PHMA 1DT7B 1K90D 3CR4X 3SIBA 1F8HA 1KK7Y 4CPVA 2LANA 3EKJA 1NX1A 2JU0A 2K2AA 3CWGA 5CPVA 1CFDA 2F3ZA 4M2QA 1XFUO 2HF5A 1GQMA 2JT3A 2GGMA 4USLA 1SL7A 5F6TA 1N0YA 1Y1AA 3JTDB 1M31A 4BY5A 1ZMZA 1IQ3A 2F2OA 1OSAA 1J7QA 3EVRA 3FS7A 3TDUA 1N65A 5PALA 2CBLA 3NSIA 5CSFA 1B4CA 3LK0A 1JC2A 1SR6B 2KQYA 2NXQA 2ZRSA 3SG6A 4YGEB 1BJFA 2EHBA 5AANA 4IL1A 2CTNA 2OTGC 4NDBA 3KPXA 2KBMA 4ZCVA 1QVIZ 1QATA 1TRFA 1N2DA 1K9UA 2O5GA 2LLUA 3ICBA 1SK6D 3I5HB 3ZNIA 1QLKA 3NSOA 1CMGA 1QJTA 1RWYA 3KEVA 1W7IB 4L9MA 1ZACA 4A4BA 1XFYO 2LVIA 1K96A 3HCMA 2L50A 1K2HA 2A4JA 1CLLA 4HRGA 1B1GA 1UURA 2TN4A 2Y1MA 1A4PA 1UHNA 1SRAA 2D8NA 3BQ3A 1DJGA 1YVHA 2ZNEA 4HRHA 1JSAA 1C7WA 2JWWA 1B47A 3BXKA 4MRXA 1Y0VH 1HT9A 3DF0A 1BLQA 1FI5A 1QV0A 1LINA 2KAVA 2LV7A 1HQVA 1CLMA 1TCFA 2MHHA 4FTGA 1WLMA 4PDZA 5AEQA 1SCVA 2KYCA 1X02A 5AERA 3O4YA 4MZJA 1TNWA 2LP3A 1CMFA 4GAOA 2M1KB 2LHIA 4GFTA 1K93D 5HKWA 2MRDA 1B8LA 1RK9A 1JF0A 1NYAA 3CR5X 4AOMA 2K8MB 2LLTA 1J55A 2WCFA 1LA3A 1IG5A 5HYDA 2JXCA 2L5XB 4MLWA 4MVFA 2JNFA 1F55A 1MUXA 4DRWA 5DKRA 4JPZB 5JJGA 2KAYA 3HX4A 3TDIA 4CLNA 1V1FA 4GPLB 1NCZA 3F45A 3I5IC 3TDZA 4MSPA 3H4SE 4HREE 4YGBB 1GJYA 1ODBA 4QJ4B 4WRIA 2BE6A 2B1UA 2BL0B 3RM1A 1MF8B 1WRZA 1CDLA 2L4HA 2Q4UA 4ORCB 4OV2A 2FJUB 3AAJA 3RLZA 2ZNDA 2MBXA 1NPQA 4PE4A 1IQ5A 1KSMA 1TN4A 3CZTX 2WCEA 1CM1A 1U5IB 3SG3A 5GQQC 2M49B 1LA0A 1QIWA 2JZIA 1WRKA 1JF2A 4MN0A 1DF0B 2LM5A 1OMRA 3BUXB 2LVVA 3WXAA 1WY9A 4DCKA 2MAZA 1E8AA 5FYXA 1XVJA 3KHEA 3O2PA 1WDCB 3M0WA 5BPJA 1D1OA 3DVJA 2RGIA 1EL4A 3BUNB 1F70A 2KI6D 5KU1A 3TS5C 1Y6WA 2L2EA 1TCOB 1YR5A 2EC6C 5CSIA 1JWDA 1B7TY 1TNQA 2LUXA 4PE7A 1CFFA 1DJHA 4XJKB 1IJ6A 1S6IA 3VRPA 3WHTB 1RECA 1EH2A 2MA2A 1F54A 2PASA 1BU3A 2HQWA 1BR1B 1YUSA 2JTZA 1NWDA 5G08A 3DD4A 3JTDC 1IH0A 2V53A 3VRQA 1M46A 4GGFA 1DJZA 3KF9A 1CFPA 2M1UA 1KFUS 2OS8B 1B8RA 4MRYA 1A75B 2FCDA 4M2PA 4C0JA 4CFQA 1QX2A 2KI4B 4E68A 2PRUA 2LHLA 1G4YR 1SL9A 2O60A 2QACA 4N5XA 5ER4X 2WC8A 2BBMA 4MZLA 1NSHA 2JC2A 1SR6C 4PE0A 1IKUA 1JFJA 4GGNA 2PALA 1NX3A 1B8CA 3EK7A 1EG3A 3MSEB 1KFXS 2LAPA 1KK8B 1SBJA 2ZN8A 1JFKA 1SW8A 2VRGA 1LVCD 5I2QA 1CDMA 1YX7A 2K0JA 1YURA 2JT8A 1DJIA 2I2RE 2Y1NA 2LCPA 3FWCA 4C0LA 3I5HC 1LKJA 3PFVA 1XO5A 3EK8A 4PHJA 2ZRTA 5AFPA 4AQJA 3CS1A 2ISDA 3O6BA 2KYFA 1KSOA 4ICBA 1JBAA 3SG2A 2BKHB 1H4BA 1ALVA 3I5GB 4JQ0D 2P6BB 1SKTA 1SMGA 4TNCA 1A29A 3TUYC 4I5NB 1K95A 3I5FB 1J7OA 1L7ZA 2NZ0A 1A03A 2Q91A 1BG1A 4ORBB 2BECA 1U5IA 2KDHA 1KQVA 1S3PA 1FW4A 2R2IA 4GGFC 2HQ8A 1SYMA 4UPGA 1S5GZ 2AAOA 4WQ2A 4YGAA 5HLVA 2M9GA 1DF0A 2KNEA 2M7NA 1AJ4A 4YI8A 2L98A 5JOLA 5DKNA 3LK1A 4MBEA 1PVBA 4YI9A 1JUOA 3GOFA 3OX6A 1SPYA 1NIWA 2PVBA 2ZKMX 3DVKA 1QXPA 3LL8B 5I8NA 1SL8A 2K7DA 5D7FA 1QVIY 1XK4A 1H8BA 1IGVA 1Y1XA 1AK8A 1EG4A 1OE9B 2K7OA 4I5KA 2LNKA 3BYAA 2BCBA 1KWOC 4HSZA 4ORAB 2K61A 1KQMB 1DJXA 1YX8A 2SCPA 4XJKA 2BCXA 1G8IA 1PSRA 2K2FA 3GK1A 1OOJA 3A4UB 3PATA 5I2OA 3JVTB 1QX7A 2M3WA 1BF5A 3BUOB 3EVVA 2KBIA 2FOTA 5TNCA 3PLFB 1CB1A 1IWQA 1M39A 2M29A 3DVMA 1R2UA 3KO0A 2BL0C 4FQOA 1VRKA 4ZCUA 1PULA 2KFFA 1A75A 4I5JA 1YUUA 2KFHA 3SJSA 1UHKA 1GGWA 3CTNA 2COLB 1RJVA 2FCEA 3NSKA 5HLOA 1KFUL 3WNXB 3OB2B 3LLEA 1S6JA 3LCPC 4M2OA 4N1FA 3SG7A 3D10A 4OKHA 2F3YA 2KFGA 2LMUA 2KGRA 1XFVO 1SCMB 2ZN9A 2HETA 4YGDB 2G9BA 1WDCC 2JQ6A 2KGBC 3IQOA 2F2PA 1KFXL 1CFCA 4P5OE 1XK4C 2KOTA 2Y4QA 1OQPA 1W7JB 1QASA 1SY9A 1UHIA 1CNPA 1BT6A 1NX0A 3NSLA 1KCYA 3EVUA 1DJWA 3GK2A 4WQ3A 3SG4A 1KK7Z 1CTRA 3IQQA 3PN7B 1TIZA 4R1EA 2K7CA 1FPWA 1XFWO 1PRWA 2LP2A 2H61A 2OPOA 4QJ5B 1L2OB 2H2KA 3AKAA 1UHJA 3CGAA 1CDPA 4Q04A 2SASA 2JTTA 3BUMB 1NUBA 2OS8C 3OHMB 1S1EA 2WCBA 2KHNA 2KI4C 3WHUB 1IRJA 2AUCA 3PALA 2KAXA 3DVEA 1NCXA 1AHRA 1MWNA 2F8PA 1EJ3A 1NX2A 2EC6B 4OCIA 5D69A 2LUCA 1TOPA 1KK8C 3VRNA 3VGOA 1PVAA 1DVIA 1G33A 1QTXA 1S6CA 4DIRA 1XYDA 1OZSA 3SIAA 3OB1B 4NQGA 2JT0A 5HKYA 2K7BA 3O78A 3FWBA 2L51A 1WRLA 3FIAA 2JOJA 1S36A 2WORA 3BUWB 3QRXA 1TNPA 2CT9A 1M45A 1F4OA 1Q80A 2F33A 3EK4A 3I5GC 1K94A 4N1GA 5CSJA 4DUQA 1CM4A 4NDCA 3C1VA 1DTLA 2I94A 4PE1A 4C0KA 1BMOA 2PMYA 3I5FC 4CFRA 1QX5B 2KI6C 1RFJA 1IJ5A 2H61C 2I7AA 2NLNA 4P2YB 1LXFC 3VRRA 3BOWB 5HKZA 2MLFC 3A8RA 3AKBA 3D0YB 1B9AA 5KSZA 2LVKA 1Y1UA 1J1EA 1RTP1 4F0ZB 4CIDA 4D1EA 4GBAA 1PK0D 4XYNA 2OTGB 2JRFA 2BKIB 4JWQA 5AXIA 4DS7A 1AJ5A 1A2XA 1QV1A 2LE9B 1NP8A 4PCWA 1UHHA 1MHOA 3TZ1A 1AP4A 2DOQA 2BCAA 1EXRA 1NCYA 2JXLA 1K9PA 1KQMC 3TUYB 3K21A 1MQ1A 2LC5A 3ZWHA 5IBWA 1WLZA 2JULA 2E30A 2GGZA 3JVTC 1QS7A 1CDNA 3OP0A 5K89A 2CXJA 1MR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8U A;  2IS9 A;  3E3R A;  1ALW A;  1M63 B;  1OMD A;  1V1G A;  4PHK A;  1FI6 A;  2LMT A;  4NDD A;  4PHN A;  2E6W A;  1ZFS A;  1PSB A;  1S5G Y;  2WOS A;  3OX5 A;  1F71 A;  1CKK A;  2EGD A;  2G2B A;  2WND A;  4GUK A;  4U8D A;  5DKQ A;  3GK4 X;  2MJW B;  3NXA A;  2Y5I A;  1XA5 A;  2L4I A;  1KWO B;  2LMV A;  2KQ6 A;  1UUS A;  2JNX A;  4BY4 A;  1PAL A;  1SCM C;  2LLS A;  1GGZ A;  1UWO A;  4MZK A;  4YRU A;  3AAK A;  4OVN F;  1F4Q A;  1MXE A;  1R6P A;  2KSP A;  1YRU B;  4A4C A;  1K9K A;  3CLN A;  3EKH A;  4AQI A;  1B7T Z;  2QPT A;  4PAL A;  1K8U A;  2M97 A;  1J7P A;  2PSR A;  1AUI B;  2GV5 A;  3I5I B;  5ER5 A;  1FF1 A;  2M7L A;  1CLB A;  3PN7 C;  1AVS A;  5B8I B;  1C7V A;  2CNP A;  3VRO A;  3CR2 A;  5J3X A;  1SNL A;  1QIV A;  2BE4 A;  3SG5 A;  3PM8 A;  1TTX A;  2L0P A;  2BBN A;  1DGV A;  1L2O C;  3PSR A;  1BOD A;  1J7R A;  2AMI A;  3DF0 B;  1S26 D;  4MEW A;  3BOW A;  5KTY A;  2I18 A;  4YBH B;  1DGU A;  1MXL C;  2HPS A;  1YUT A;  3D0Y A;  4ETO A;  1RRO A;  1DMO A;  1J1D A;  2NCP A;  1YTZ C;  1YRT B;  2MLE C;  2M0R A;  2NCO A;  2ZFD A;  1OZO A;  2JPT A;  4QJ3 B;  3IF7 A;  1YVL A;  2LVJ A;  4OR9 B;  1OMV A;  1UP5 A;  1XFZ O;  1ZOT B;  5I2L A;  4YGC B;  1C07 A;  3TS5 B;  1QLS A;  5CSN A;  1FBV A;  4I5L B;  1DJY A;  1BOC A;  1BR4 B;  1XFX O;  2CCM A;  1ZUZ A;  1TNX A;  4GNK B;  4PHM A;  1DT7 B;  1K90 D;  3CR4 X;  3SIB A;  1F8H A;  1KK7 Y;  4CPV A;  2LAN A;  3EKJ A;  1NX1 A;  2JU0 A;  2K2A A;  3CWG A;  5CPV A;  1CFD A;  2F3Z A;  4M2Q A;  1XFU O;  2HF5 A;  1GQM A;  2JT3 A;  2GGM A;  4USL A;  1SL7 A;  5F6T A;  1N0Y A;  1Y1A A;  3JTD B;  1M31 A;  4BY5 A;  1ZMZ A;  1IQ3 A;  2F2O A;  1OSA A;  1J7Q A;  3EVR A;  3FS7 A;  3TDU A;  1N65 A;  5PAL A;  2CBL A;  3NSI A;  5CSF A;  1B4C A;  3LK0 A;  1JC2 A;  1SR6 B;  2KQY A;  2NXQ A;  2ZRS A;  3SG6 A;  4YGE B;  1BJF A;  2EHB A;  5AAN A;  4IL1 A;  2CTN A;  2OTG C;  4NDB A;  3KPX A;  2KBM A;  4ZCV A;  1QVI Z;  1QAT A;  1TRF A;  1N2D A;  1K9U A;  2O5G A;  2LLU A;  3ICB A;  1SK6 D;  3I5H B;  3ZNI A;  1QLK A;  3NSO A;  1CMG A;  1QJT A;  1RWY A;  3KEV A;  1W7I B;  4L9M A;  1ZAC A;  4A4B A;  1XFY O;  2LVI A;  1K96 A;  3HCM A;  2L50 A;  1K2H A;  2A4J A;  1CLL A;  4HRG A;  1B1G A;  1UUR A;  2TN4 A;  2Y1M A;  1A4P A;  1UHN A;  1SRA A;  2D8N A;  3BQ3 A;  1DJG A;  1YVH A;  2ZNE A;  4HRH A;  1JSA A;  1C7W A;  2JWW A;  1B47 A;  3BXK A;  4MRX A;  1Y0V H;  1HT9 A;  3DF0 A;  1BLQ A;  1FI5 A;  1QV0 A;  1LIN A;  2KAV A;  2LV7 A;  1HQV A;  1CLM A;  1TCF A;  2MHH A;  4FTG A;  1WLM A;  4PDZ A;  5AEQ A;  1SCV A;  2KYC A;  1X02 A;  5AER A;  3O4Y A;  4MZJ A;  1TNW A;  2LP3 A;  1CMF A;  4GAO A;  2M1K B;  2LHI A;  4GFT A;  1K93 D;  5HKW A;  2MRD A;  1B8L A;  1RK9 A;  1JF0 A;  1NYA A;  3CR5 X;  4AOM A;  2K8M B;  2LLT A;  1J55 A;  2WCF A;  1LA3 A;  1IG5 A;  5HYD A;  2JXC A;  2L5X B;  4MLW A;  4MVF A;  2JNF A;  1F55 A;  1MUX A;  4DRW A;  5DKR A;  4JPZ B;  5JJG A;  2KAY A;  3HX4 A;  3TDI A;  4CLN A;  1V1F A;  4GPL B;  1NCZ A;  3F45 A;  3I5I C;  3TDZ A;  4MSP A;  3H4S E;  4HRE E;  4YGB B;  1GJY A;  1ODB A;  4QJ4 B;  4WRI A;  2BE6 A;  2B1U A;  2BL0 B;  3RM1 A;  1MF8 B;  1WRZ A;  1CDL A;  2L4H A;  2Q4U A;  4ORC B;  4OV2 A;  2FJU B;  3AAJ A;  3RLZ A;  2ZND A;  2MBX A;  1NPQ A;  4PE4 A;  1IQ5 A;  1KSM A;  1TN4 A;  3CZT X;  2WCE A;  1CM1 A;  1U5I B;  3SG3 A;  5GQQ C;  2M49 B;  1LA0 A;  1QIW A;  2JZI A;  1WRK A;  1JF2 A;  4MN0 A;  1DF0 B;  2LM5 A;  1OMR A;  3BUX B;  2LVV A;  3WXA A;  1WY9 A;  4DCK A;  2MAZ A;  1E8A A;  5FYX A;  1XVJ A;  3KHE A;  3O2P A;  1WDC B;  3M0W A;  5BPJ A;  1D1O A;  3DVJ A;  2RGI A;  1EL4 A;  3BUN B;  1F70 A;  2KI6 D;  5KU1 A;  3TS5 C;  1Y6W A;  2L2E A;  1TCO B;  1YR5 A;  2EC6 C;  5CSI A;  1JWD A;  1B7T Y;  1TNQ A;  2LUX A;  4PE7 A;  1CFF A;  1DJH A;  4XJK B;  1IJ6 A;  1S6I A;  3VRP A;  3WHT B;  1REC A;  1EH2 A;  2MA2 A;  1F54 A;  2PAS A;  1BU3 A;  2HQW A;  1BR1 B;  1YUS A;  2JTZ A;  1NWD A;  5G08 A;  3DD4 A;  3JTD C;  1IH0 A;  2V53 A;  3VRQ A;  1M46 A;  4GGF A;  1DJZ A;  3KF9 A;  1CFP A;  2M1U A;  1KFU S;  2OS8 B;  1B8R A;  4MRY A;  1A75 B;  2FCD A;  4M2P A;  4C0J A;  4CFQ A;  1QX2 A;  2KI4 B;  4E68 A;  2PRU A;  2LHL A;  1G4Y R;  1SL9 A;  2O60 A;  2QAC A;  4N5X A;  5ER4 X;  2WC8 A;  2BBM A;  4MZL A;  1NSH A;  2JC2 A;  1SR6 C;  4PE0 A;  1IKU A;  1JFJ A;  4GGN A;  2PAL A;  1NX3 A;  1B8C A;  3EK7 A;  1EG3 A;  3MSE B;  1KFX S;  2LAP A;  1KK8 B;  1SBJ A;  2ZN8 A;  1JFK A;  1SW8 A;  2VRG A;  1LVC D;  5I2Q A;  1CDM A;  1YX7 A;  2K0J A;  1YUR A;  2JT8 A;  1DJI A;  2I2R E;  2Y1N A;  2LCP A;  3FWC A;  4C0L A;  3I5H C;  1LKJ A;  3PFV A;  1XO5 A;  3EK8 A;  4PHJ A;  2ZRT A;  5AFP A;  4AQJ A;  3CS1 A;  2ISD A;  3O6B A;  2KYF A;  1KSO A;  4ICB A;  1JBA A;  3SG2 A;  2BKH B;  1H4B A;  1ALV A;  3I5G B;  4JQ0 D;  2P6B B;  1SKT A;  1SMG A;  4TNC A;  1A29 A;  3TUY C;  4I5N B;  1K95 A;  3I5F B;  1J7O A;  1L7Z A;  2NZ0 A;  1A03 A;  2Q91 A;  1BG1 A;  4ORB B;  2BEC A;  1U5I A;  2KDH A;  1KQV A;  1S3P A;  1FW4 A;  2R2I A;  4GGF C;  2HQ8 A;  1SYM A;  4UPG A;  1S5G Z;  2AAO A;  4WQ2 A;  4YGA A;  5HLV A;  2M9G A;  1DF0 A;  2KNE A;  2M7N A;  1AJ4 A;  4YI8 A;  2L98 A;  5JOL A;  5DKN A;  3LK1 A;  4MBE A;  1PVB A;  4YI9 A;  1JUO A;  3GOF A;  3OX6 A;  1SPY A;  1NIW A;  2PVB A;  2ZKM X;  3DVK A;  1QXP A;  3LL8 B;  5I8N A;  1SL8 A;  2K7D A;  5D7F A;  1QVI Y;  1XK4 A;  1H8B A;  1IGV A;  1Y1X A;  1AK8 A;  1EG4 A;  1OE9 B;  2K7O A;  4I5K A;  2LNK A;  3BYA A;  2BCB A;  1KWO C;  4HSZ A;  4ORA B;  2K61 A;  1KQM B;  1DJX A;  1YX8 A;  2SCP A;  4XJK A;  2BCX A;  1G8I A;  1PSR A;  2K2F A;  3GK1 A;  1OOJ A;  3A4U B;  3PAT A;  5I2O A;  3JVT B;  1QX7 A;  2M3W A;  1BF5 A;  3BUO B;  3EVV A;  2KBI A;  2FOT A;  5TNC A;  3PLF B;  1CB1 A;  1IWQ A;  1M39 A;  2M29 A;  3DVM A;  1R2U A;  3KO0 A;  2BL0 C;  4FQO A;  1VRK A;  4ZCU A;  1PUL A;  2KFF A;  1A75 A;  4I5J A;  1YUU A;  2KFH A;  3SJS A;  1UHK A;  1GGW A;  3CTN A;  2COL B;  1RJV A;  2FCE A;  3NSK A;  5HLO A;  1KFU L;  3WNX B;  3OB2 B;  3LLE A;  1S6J A;  3LCP C;  4M2O A;  4N1F A;  3SG7 A;  3D10 A;  4OKH A;  2F3Y A;  2KFG A;  2LMU A;  2KGR A;  1XFV O;  1SCM B;  2ZN9 A;  2HET A;  4YGD B;  2G9B A;  1WDC C;  2JQ6 A;  2KGB C;  3IQO A;  2F2P A;  1KFX L;  1CFC A;  4P5O E;  1XK4 C;  2KOT A;  2Y4Q A;  1OQP A;  1W7J B;  1QAS A;  1SY9 A;  1UHI A;  1CNP A;  1BT6 A;  1NX0 A;  3NSL A;  1KCY A;  3EVU A;  1DJW A;  3GK2 A;  4WQ3 A;  3SG4 A;  1KK7 Z;  1CTR A;  3IQQ A;  3PN7 B;  1TIZ A;  4R1E A;  2K7C A;  1FPW A;  1XFW O;  1PRW A;  2LP2 A;  2H61 A;  2OPO A;  4QJ5 B;  1L2O B;  2H2K A;  3AKA A;  1UHJ A;  3CGA A;  1CDP A;  4Q04 A;  2SAS A;  2JTT A;  3BUM B;  1NUB A;  2OS8 C;  3OHM B;  1S1E A;  2WCB A;  2KHN A;  2KI4 C;  3WHU B;  1IRJ A;  2AUC A;  3PAL A;  2KAX A;  3DVE A;  1NCX A;  1AHR A;  1MWN A;  2F8P A;  1EJ3 A;  1NX2 A;  2EC6 B;  4OCI A;  5D69 A;  2LUC A;  1TOP A;  1KK8 C;  3VRN A;  3VGO A;  1PVA A;  1DVI A;  1G33 A;  1QTX A;  1S6C A;  4DIR A;  1XYD A;  1OZS A;  3SIA A;  3OB1 B;  4NQG A;  2JT0 A;  5HKY A;  2K7B A;  3O78 A;  3FWB A;  2L51 A;  1WRL A;  3FIA A;  2JOJ A;  1S36 A;  2WOR A;  3BUW B;  3QRX A;  1TNP A;  2CT9 A;  1M45 A;  1F4O A;  1Q80 A;  2F33 A;  3EK4 A;  3I5G C;  1K94 A;  4N1G A;  5CSJ A;  4DUQ A;  1CM4 A;  4NDC A;  3C1V A;  1DTL A;  2I94 A;  4PE1 A;  4C0K A;  1BMO A;  2PMY A;  3I5F C;  4CFR A;  1QX5 B;  2KI6 C;  1RFJ A;  1IJ5 A;  2H61 C;  2I7A A;  2NLN A;  4P2Y B;  1LXF C;  3VRR A;  3BOW B;  5HKZ A;  2MLF C;  3A8R A;  3AKB A;  3D0Y B;  1B9A A;  5KSZ A;  2LVK A;  1Y1U A;  1J1E A;  1RTP 1;  4F0Z B;  4CID A;  4D1E A;  4GBA A;  1PK0 D;  4XYN A;  2OTG B;  2JRF A;  2BKI B;  4JWQ A;  5AXI A;  4DS7 A;  1AJ5 A;  1A2X A;  1QV1 A;  2LE9 B;  1NP8 A;  4PCW A;  1UHH A;  1MHO A;  3TZ1 A;  1AP4 A;  2DOQ A;  2BCA A;  1EXR A;  1NCY A;  2JXL A;  1K9P A;  1KQM C;  3TUY B;  3K21 A;  1MQ1 A;  2LC5 A;  3ZWH A;  5IBW A;  1WLZ A;  2JUL A;  2E30 A;  2GGZ A;  3JVT C;  1QS7 A;  1CDN A;  3OP0 A;  5K89 A;  2CXJ A;  1MR8 A; 
#chains in the Genus database with same CATH topology
 2M8U A;  2IS9 A;  3E3R A;  3NHI A;  1ALW A;  1M63 B;  1OMD A;  1V1G A;  2PYQ A;  4PHK A;  1FI6 A;  2LMT A;  4NDD A;  4PHN A;  2E6W A;  3FE9 A;  1ZFS A;  1PSB A;  1S5G Y;  2WOS A;  3OX5 A;  3S0E A;  1F71 A;  1CKK A;  2EGD A;  2G2B A;  2WND A;  4GUK A;  4U8D A;  5DKQ A;  1TUJ A;  1ORG A;  3GK4 X;  2MJW B;  5HL1 A;  3NXA A;  3R72 A;  2Y5I A;  1XA5 A;  2L4I A;  2P70 A;  1KWO B;  2LMV A;  2KQ6 A;  1UUS A;  2JNX A;  4BY4 A;  1PAL A;  1SCM C;  2LLS A;  1GGZ A;  1UWO A;  4MZK A;  4YRU A;  3AAK A;  4OVN F;  1F4Q A;  1MXE A;  1R6P A;  2KSP A;  1YRU B;  4FQT A;  4A4C A;  1K9K A;  2JPO A;  3CLN A;  3EKH A;  4AQI A;  1OOH A;  1B7T Z;  2KLD A;  3QME A;  2QPT A;  4PAL A;  1OOG A;  1K8U A;  2M97 A;  1J7P A;  2PSR A;  1AUI B;  2GV5 A;  3I5I B;  5ER5 A;  1FF1 A;  2M7L A;  1CLB A;  3PN7 C;  1AVS A;  5B8I B;  1C7V A;  2CNP A;  3VRO A;  3CR2 A;  5J3X A;  1SNL A;  1SSE B;  1QIV A;  2BE4 A;  4JKT A;  3SG5 A;  3PM8 A;  4JD9 A;  1TTX A;  2L0P A;  2BBN A;  1DGV A;  1L2O C;  3PSR A;  1BOD A;  1J7R A;  2AMI A;  3DF0 B;  1S26 D;  4MEW A;  3BFB A;  3BOW A;  5KTY A;  2I18 A;  4YBH B;  3EG5 B;  1DGU A;  1MXL C;  3B6X A;  2HPS A;  1YUT A;  3D0Y A;  4ETO A;  1RRO A;  1DMO A;  1J1D A;  2NCP A;  1YTZ C;  1YRT B;  2MLE C;  2M0R A;  2NCO A;  2ZFD A;  1OZO A;  2JPT A;  3B7A A;  4QJ3 B;  3IF7 A;  1YVL A;  2LVJ A;  4OR9 B;  1OMV A;  1UP5 A;  1XFZ O;  1ZOT B;  5I2L A;  4YGC B;  1C07 A;  3TS5 B;  1QLS A;  5CSN A;  1FBV A;  4I5L B;  1DJY A;  1BOC A;  1BR4 B;  1XFX O;  3CZ0 A;  2CCM A;  1ZUZ A;  5I94 A;  1TNX A;  4GNK B;  4PHM A;  1DT7 B;  1K90 D;  3CR4 X;  1OOF A;  3D73 A;  3SIB A;  1F8H A;  1KK7 Y;  4CPV A;  2LAN A;  3EKJ A;  1NX1 A;  2JU0 A;  2K2A A;  3CWG A;  5CPV A;  1Z4H A;  1CFD A;  3S0D A;  2F3Z A;  4M2Q A;  1XFU O;  2HF5 A;  1GQM A;  2JT3 A;  3CYZ A;  2GGM A;  4USL A;  1SL7 A;  5F6T A;  1N0Y A;  1Y1A A;  3JTD B;  3V2L A;  1M31 A;  2QEV A;  2WCJ A;  1ZMZ A;  2L5Y A;  4BY5 A;  1IQ3 A;  2F2O A;  1OSA A;  1J7Q A;  3EVR A;  3FS7 A;  3L47 A;  3TDU A;  1N65 A;  2BAP A;  5FI6 A;  5PAL A;  2CBL A;  3NSI A;  5CSF A;  5FI2 A;  1B4C A;  3LK0 A;  1JC2 A;  3DY9 A;  1SR6 B;  2KQY A;  2NXQ A;  2ZRS A;  3SG6 A;  4YGE B;  1BJF A;  5D3O A;  2EHB A;  5AAN A;  3L4L A;  3Q8I A;  4IL1 A;  2CTN A;  2OTG C;  4NDB A;  3KPX A;  1OW4 A;  2KBM A;  4ZCV A;  1QVI Z;  1QAT A;  1TRF A;  1N2D A;  1K9U A;  2O5G A;  2LLU A;  3ICB A;  1SK6 D;  3I5H B;  3CZ2 A;  3ZNI A;  2BNX A;  1QLK A;  3NSO A;  3BJH A;  1CMG A;  1QJT A;  1RWY A;  3KEV A;  1W7I B;  4L9M A;  1ZAC A;  4A4B A;  1XFY O;  2LVI A;  1K96 A;  2WCH A;  3HCM A;  2L50 A;  3SS4 A;  1K2H A;  2A4J A;  1CLL A;  4HRG A;  1B1G A;  1UUR A;  2TN4 A;  2Y1M A;  1A4P A;  1UHN A;  1SRA A;  3DYE A;  2D8N A;  3BQ3 A;  1OOI X;  1DJG A;  1YVH A;  2ZNE A;  4HRH A;  1JSA A;  1C7W A;  3DXL A;  2JWW A;  1B47 A;  3BXK A;  4MRX A;  1Y0V H;  1HT9 A;  3DF0 A;  1BLQ A;  1FI5 A;  1QV0 A;  3R1V A;  1LIN A;  2KAV A;  2LV7 A;  3D78 A;  1HQV A;  3SS3 A;  1CLM A;  1TCF A;  2MHH A;  1C3Z A;  1WLM A;  4FTG A;  3OBV A;  4PDZ A;  3L4A A;  5AEQ A;  1SCV A;  2KYC A;  1X02 A;  5AER A;  3O4Y A;  4MZJ A;  1TNW A;  2LP3 A;  1CMF A;  4GAO A;  2M1K B;  2LHI A;  4GFT A;  1K93 D;  5HKW A;  2MRD A;  1B8L A;  1RK9 A;  1JF0 A;  1NYA A;  3CR5 X;  3O4X A;  4AOM A;  2QEB A;  2K8M B;  2LLT A;  1J55 A;  2WCF A;  1LA3 A;  1IG5 A;  5HYD A;  2JXC A;  2L5X B;  4MLW A;  4MVF A;  2JNF A;  1F55 A;  1MUX A;  4DRW A;  5DKR A;  4JPZ B;  5JJG A;  2KAY A;  3HX4 A;  3TDI A;  4CLN A;  1V1F A;  4GPL B;  1NCZ A;  3F45 A;  3I5I C;  3TDZ A;  4MSP A;  3H4S E;  5EL2 A;  4HRE E;  4YGB B;  1GJY A;  3IVT A;  1ODB A;  3FE8 A;  4WRI A;  2BE6 A;  2B1U A;  2BL0 B;  3RM1 A;  4QJ4 B;  2K60 A;  1MF8 B;  1WRZ A;  1CDL A;  2L4H A;  2Q4U A;  4ORC B;  4OV2 A;  2FJU B;  3AAJ A;  3RLZ A;  2ZND A;  2MBX A;  1NPQ A;  4PE4 A;  2H8V A;  1IQ5 A;  1KSM A;  1TN4 A;  3CZT X;  2WCE A;  1CM1 A;  3D74 A;  1U5I B;  3SG3 A;  5GQQ C;  2M49 B;  1LS8 A;  5DIC A;  1LA0 A;  3PM2 A;  1QIW A;  2JZI A;  1WRK A;  1JF2 A;  4MN0 A;  2KLE A;  1DF0 B;  2LM5 A;  1OMR A;  3BUX B;  3BFA A;  1QWV A;  2LVV A;  3WXA A;  1WY9 A;  4DCK A;  2MAZ A;  3RZS A;  1E8A A;  5FYX A;  1XVJ A;  3KHE A;  3O2P A;  1WDC B;  3M0W A;  5BPJ A;  1D1O A;  3DVJ A;  2RGI A;  1EL4 A;  3BUN B;  1F70 A;  2KI6 D;  3VB1 A;  5KU1 A;  3TS5 C;  1Y6W A;  2L2E A;  1TCO B;  1XFR A;  1YR5 A;  2EC6 C;  5CSI A;  1JWD A;  1B7T Y;  1TNQ A;  2LUX A;  4PE7 A;  1CFF A;  2WCK A;  1DJH A;  4XJK B;  1IJ6 A;  1S6I A;  3VRP A;  3WHT B;  3FE6 A;  1REC A;  1EH2 A;  2MA2 A;  2WCM A;  1F54 A;  2PAS A;  1BU3 A;  2HQW A;  1BR1 B;  1YUS A;  2JTZ A;  1NWD A;  5G08 A;  3DD4 A;  3JTD C;  1IH0 A;  2QDI A;  2V53 A;  3VRQ A;  1M46 A;  4GGF A;  1DJZ A;  3R1P A;  3KF9 A;  1CFP A;  2M1U A;  1KFU S;  2OS8 B;  1B8R A;  4MRY A;  1A75 B;  2FCD A;  4M2P A;  4C0J A;  4CFQ A;  1QX2 A;  2KI4 B;  3UO9 A;  2PRU A;  4E68 A;  2LHL A;  1G4Y R;  1SL9 A;  2O60 A;  2QAC A;  2WC5 A;  4N5X A;  1DQE A;  2WC8 A;  5ER4 X;  2BBM A;  4MZL A;  1NSH A;  2JC2 A;  1SR6 C;  4PE0 A;  1IKU A;  1JFJ A;  2ERB A;  4GGN A;  2PAL A;  1NX3 A;  1B8C A;  3EK7 A;  1EG3 A;  3MSE B;  1KFX S;  2LAP A;  1KK8 B;  1SBJ A;  2ZN8 A;  1JFK A;  3D75 A;  1SW8 A;  2VRG A;  1LVC D;  5I2Q A;  1CDM A;  1YX7 A;  2K0J A;  1YUR A;  2JT8 A;  1DJI A;  2I2R E;  2Y1N A;  2LCP A;  3FWC A;  4C0L A;  3I5H C;  1LKJ A;  3PFV A;  1XO5 A;  3EK8 A;  4PHJ A;  2ZRT A;  5AFP A;  4AQJ A;  3D76 A;  3CS1 A;  2ISD A;  3O6B A;  2KYF A;  1KSO A;  4ICB A;  1JBA A;  3SG2 A;  2BKH B;  2QEH A;  1H4B A;  1ALV A;  3I5G B;  4JQ0 D;  2P6B B;  1SKT A;  1SMG A;  4TNC A;  1GM0 A;  1A29 A;  3TUY C;  4I5N B;  1K95 A;  3I5F B;  1J7O A;  1L7Z A;  3R1O A;  2NZ0 A;  1A03 A;  2Q91 A;  1BG1 A;  3K1E A;  4ORB B;  1U5I A;  2BEC A;  2KDH A;  1KQV A;  1S3P A;  1FW4 A;  2R2I A;  4GGF C;  4OZD A;  2HQ8 A;  1SYM A;  2L2C A;  4UPG A;  1S5G Z;  2AAO A;  4WQ2 A;  4YGA A;  5HLV A;  2M9G A;  1DF0 A;  3N7H A;  2KNE A;  2M7N A;  1AJ4 A;  3B88 A;  4YI8 A;  2L98 A;  5JOL A;  5DKN A;  3LK1 A;  4MBE A;  1PVB A;  4YI9 A;  1JUO A;  3GOF A;  3OX6 A;  1SPY A;  1NIW A;  2PVB A;  2ZKM X;  3CDN A;  1QXP A;  3DVK A;  3LL8 B;  3UNW A;  1SL8 A;  2K7D A;  2WC6 A;  5D7F A;  5I8N A;  1QVI Y;  1XK4 A;  1H8B A;  1IGV A;  1Y1X A;  1AK8 A;  1EG4 A;  1OE9 B;  2K7O A;  4I5K A;  2LNK A;  3BYA A;  2BCB A;  1KWO C;  4HSZ A;  4ORA B;  2K61 A;  1KQM B;  1DJX A;  1YX8 A;  2SCP A;  4XJK A;  2BCX A;  3S0F A;  1G8I A;  1PSR A;  2K2F A;  3GK1 A;  1OOJ A;  3A4U B;  1TUZ A;  3PAT A;  5FI7 A;  5I2O A;  4INW A;  3JVT B;  1QX7 A;  2M3W A;  1BF5 A;  3BUO B;  3EVV A;  2KBI A;  2FOT A;  5TNC A;  3PLF B;  1CB1 A;  1IWQ A;  1M39 A;  2M29 A;  3DVM A;  1R2U A;  3KO0 A;  2BL0 C;  4FQO A;  1VRK A;  4ZCU A;  1PUL A;  3NGV A;  2KFF A;  1A75 A;  4I5J A;  1YUU A;  2KFH A;  3SJS A;  1UHK A;  1GGW A;  3CTN A;  2COL B;  1RJV A;  2QEO A;  2FCE A;  3NSK A;  5HLO A;  1KFU L;  2GTE A;  2WCL A;  3WNX B;  3OB2 B;  3LLE A;  3PJI A;  1S6J A;  3LCP C;  4M2O A;  4N1F A;  3SG7 A;  3D10 A;  4OKH A;  2F3Y A;  2KFG A;  3NHT A;  2LMU A;  2FJY A;  2KGR A;  1XFV O;  1SCM B;  2ZN9 A;  2HET A;  4YGD B;  3S0B A;  2G9B A;  1WDC C;  2JQ6 A;  3B87 A;  2KGB C;  3IQO A;  2F2P A;  1KFX L;  1CFC A;  1DC1 A;  2YGU A;  4P5O E;  1XK4 C;  3S0A A;  3SS5 A;  2KOT A;  2Y4Q A;  1OQP A;  1W7J B;  4KYN A;  1QAS A;  1SY9 A;  1UHI A;  1CNP A;  1BT6 A;  1NX0 A;  3NSL A;  1KCY A;  3EVU A;  1DJW A;  3GK2 A;  4WQ3 A;  3SG4 A;  1KK7 Z;  1CTR A;  3IQQ A;  3PN7 B;  1TIZ A;  4R1E A;  2K7C A;  3CZ1 A;  2P71 A;  1FPW A;  1XFW O;  4IJ7 A;  1W9Z A;  1PRW A;  2LP2 A;  2H61 A;  2OPO A;  4QJ5 B;  1L2O B;  2H2K A;  3AKA A;  1UHJ A;  3CAB A;  1CDP A;  3CGA A;  4Q04 A;  2SAS A;  2JTT A;  3BUM B;  1NUB A;  2OS8 C;  3OHM B;  1S1E A;  1T14 A;  2WCB A;  2KHN A;  2KI4 C;  3WHU B;  1IRJ A;  2AUC A;  3PAL A;  2KAX A;  3DVE A;  1NCX A;  2KPH A;  1AHR A;  1MWN A;  2F8P A;  1EJ3 A;  1NX2 A;  2EC6 B;  3OGN A;  4OCI A;  5D69 A;  2LUC A;  1TOP A;  1KK8 C;  3VRN A;  4F7F A;  3VGO A;  1PVA A;  1DVI A;  1G33 A;  1QTX A;  1S6C A;  4DIR A;  1XYD A;  1OZS A;  3DZT A;  3SIA A;  3OB1 B;  4NQG A;  1IIO A;  2JT0 A;  1TWO A;  2K7B A;  5HKY A;  3O78 A;  3FWB A;  2L51 A;  1WRL A;  3FIA A;  2JOJ A;  1S36 A;  2WOR A;  3BUW B;  3QRX A;  3S0G A;  1TNP A;  2CT9 A;  1M45 A;  1F4O A;  1Q80 A;  2F33 A;  3EK4 A;  3I5G C;  1K94 A;  4N1G A;  5CSJ A;  4DUQ A;  1CM4 A;  4NDC A;  3C1V A;  1DTL A;  2I94 A;  4PE1 A;  4C0K A;  1BMO A;  2PMY A;  3I5F C;  4CFR A;  1QX5 B;  2KI6 C;  1RFJ A;  1Z2C B;  1IJ5 A;  2H61 C;  2I7A A;  2NLN A;  2PQL A;  4P2Y B;  1LXF C;  3VRR A;  3BOW B;  5HKZ A;  2MLF C;  3A8R A;  3D77 A;  3AKB A;  3D0Y B;  1B9A A;  5KSZ A;  2LVK A;  1Y1U A;  1J1E A;  1RTP 1;  4F0Z B;  4INX A;  4CID A;  4D1E A;  1C3Y A;  1DEL A;  4GBA A;  1PK0 D;  4PT1 A;  2OTG B;  4XYN A;  1P28 A;  2JRF A;  2BKI B;  4JWQ A;  5AXI A;  4DS7 A;  1AJ5 A;  1A2X A;  1QV1 A;  2LE9 B;  1NP8 A;  4PCW A;  1UHH A;  1MHO A;  3TZ1 A;  1AP4 A;  2DOQ A;  3BFH A;  2BCA A;  1EXR A;  1NCY A;  2JXL A;  1K9P A;  1KQM C;  3TUY B;  3K21 A;  1MQ1 A;  2LC5 A;  1DEK A;  3ZWH A;  5IBW A;  1WLZ A;  2JUL A;  2E30 A;  2GGZ A;  3JVT C;  1QS7 A;  1CDN A;  3OP0 A;  5K89 A;  2CXJ A;  1MR8 A;  3B86 A; 
#chains in the Genus database with same CATH homology
 2M8U A;  2IS9 A;  3E3R A;  1ALW A;  1M63 B;  1OMD A;  1V1G A;  4PHK A;  1FI6 A;  2LMT A;  4NDD A;  4PHN A;  2E6W A;  1ZFS A;  1PSB A;  1S5G Y;  2WOS A;  3OX5 A;  1F71 A;  1CKK A;  2EGD A;  2G2B A;  2WND A;  4GUK A;  4U8D A;  5DKQ A;  3GK4 X;  2MJW B;  3NXA A;  2Y5I A;  1XA5 A;  2L4I A;  1KWO B;  2LMV A;  2KQ6 A;  1UUS A;  2JNX A;  4BY4 A;  1PAL A;  1SCM C;  2LLS A;  1GGZ A;  1UWO A;  4MZK A;  4YRU A;  3AAK A;  4OVN F;  1F4Q A;  1MXE A;  1R6P A;  2KSP A;  1YRU B;  4A4C A;  1K9K A;  3CLN A;  3EKH A;  4AQI A;  1B7T Z;  2QPT A;  4PAL A;  1K8U A;  2M97 A;  1J7P A;  2PSR A;  1AUI B;  2GV5 A;  3I5I B;  5ER5 A;  1FF1 A;  2M7L A;  1CLB A;  3PN7 C;  1AVS A;  5B8I B;  1C7V A;  2CNP A;  3VRO A;  3CR2 A;  5J3X A;  1SNL A;  1QIV A;  2BE4 A;  3SG5 A;  3PM8 A;  1TTX A;  2L0P A;  2BBN A;  1DGV A;  1L2O C;  3PSR A;  1BOD A;  1J7R A;  2AMI A;  3DF0 B;  1S26 D;  4MEW A;  3BOW A;  5KTY A;  2I18 A;  4YBH B;  1DGU A;  1MXL C;  2HPS A;  1YUT A;  3D0Y A;  4ETO A;  1RRO A;  1DMO A;  1J1D A;  2NCP A;  1YTZ C;  1YRT B;  2MLE C;  2M0R A;  2NCO A;  2ZFD A;  1OZO A;  2JPT A;  4QJ3 B;  3IF7 A;  1YVL A;  2LVJ A;  4OR9 B;  1OMV A;  1UP5 A;  1XFZ O;  1ZOT B;  5I2L A;  4YGC B;  1C07 A;  3TS5 B;  1QLS A;  5CSN A;  1FBV A;  4I5L B;  1DJY A;  1BOC A;  1BR4 B;  1XFX O;  2CCM A;  1ZUZ A;  1TNX A;  4GNK B;  4PHM A;  1DT7 B;  1K90 D;  3CR4 X;  3SIB A;  1F8H A;  1KK7 Y;  4CPV A;  2LAN A;  3EKJ A;  1NX1 A;  2JU0 A;  2K2A A;  3CWG A;  5CPV A;  1CFD A;  2F3Z A;  4M2Q A;  1XFU O;  2HF5 A;  1GQM A;  2JT3 A;  2GGM A;  4USL A;  1SL7 A;  5F6T A;  1N0Y A;  1Y1A A;  3JTD B;  1M31 A;  4BY5 A;  1ZMZ A;  1IQ3 A;  2F2O A;  1OSA A;  1J7Q A;  3EVR A;  3FS7 A;  3TDU A;  1N65 A;  5PAL A;  2CBL A;  3NSI A;  5CSF A;  1B4C A;  3LK0 A;  1JC2 A;  1SR6 B;  2KQY A;  2NXQ A;  2ZRS A;  3SG6 A;  4YGE B;  1BJF A;  2EHB A;  5AAN A;  4IL1 A;  2CTN A;  2OTG C;  4NDB A;  3KPX A;  2KBM A;  4ZCV A;  1QVI Z;  1QAT A;  1TRF A;  1N2D A;  1K9U A;  2O5G A;  2LLU A;  3ICB A;  1SK6 D;  3I5H B;  3ZNI A;  1QLK A;  3NSO A;  1CMG A;  1QJT A;  1RWY A;  3KEV A;  1W7I B;  4L9M A;  1ZAC A;  4A4B A;  1XFY O;  2LVI A;  1K96 A;  3HCM A;  2L50 A;  1K2H A;  2A4J A;  1CLL A;  4HRG A;  1B1G A;  1UUR A;  2TN4 A;  2Y1M A;  1A4P A;  1UHN A;  1SRA A;  2D8N A;  3BQ3 A;  1DJG A;  1YVH A;  2ZNE A;  4HRH A;  1JSA A;  1C7W A;  2JWW A;  1B47 A;  3BXK A;  4MRX A;  1Y0V H;  1HT9 A;  3DF0 A;  1BLQ A;  1FI5 A;  1QV0 A;  1LIN A;  2KAV A;  2LV7 A;  1HQV A;  1CLM A;  1TCF A;  2MHH A;  4FTG A;  1WLM A;  4PDZ A;  5AEQ A;  1SCV A;  2KYC A;  1X02 A;  5AER A;  3O4Y A;  4MZJ A;  1TNW A;  2LP3 A;  1CMF A;  4GAO A;  2M1K B;  2LHI A;  4GFT A;  1K93 D;  5HKW A;  2MRD A;  1B8L A;  1RK9 A;  1JF0 A;  1NYA A;  3CR5 X;  4AOM A;  2K8M B;  2LLT A;  1J55 A;  2WCF A;  1LA3 A;  1IG5 A;  5HYD A;  2JXC A;  2L5X B;  4MLW A;  4MVF A;  2JNF A;  1F55 A;  1MUX A;  4DRW A;  5DKR A;  4JPZ B;  5JJG A;  2KAY A;  3HX4 A;  3TDI A;  4CLN A;  1V1F A;  4GPL B;  1NCZ A;  3F45 A;  3I5I C;  3TDZ A;  4MSP A;  3H4S E;  4HRE E;  4YGB B;  1GJY A;  1ODB A;  4QJ4 B;  4WRI A;  2BE6 A;  2B1U A;  2BL0 B;  3RM1 A;  1MF8 B;  1WRZ A;  1CDL A;  2L4H A;  2Q4U A;  4ORC B;  4OV2 A;  2FJU B;  3AAJ A;  3RLZ A;  2ZND A;  2MBX A;  1NPQ A;  4PE4 A;  1IQ5 A;  1KSM A;  1TN4 A;  3CZT X;  2WCE A;  1CM1 A;  1U5I B;  3SG3 A;  5GQQ C;  2M49 B;  1LA0 A;  1QIW A;  2JZI A;  1WRK A;  1JF2 A;  4MN0 A;  1DF0 B;  2LM5 A;  1OMR A;  3BUX B;  2LVV A;  3WXA A;  1WY9 A;  4DCK A;  2MAZ A;  1E8A A;  5FYX A;  1XVJ A;  3KHE A;  3O2P A;  1WDC B;  3M0W A;  5BPJ A;  1D1O A;  3DVJ A;  2RGI A;  1EL4 A;  3BUN B;  1F70 A;  2KI6 D;  5KU1 A;  3TS5 C;  1Y6W A;  2L2E A;  1TCO B;  1YR5 A;  2EC6 C;  5CSI A;  1JWD A;  1B7T Y;  1TNQ A;  2LUX A;  4PE7 A;  1CFF A;  1DJH A;  4XJK B;  1IJ6 A;  1S6I A;  3VRP A;  3WHT B;  1REC A;  1EH2 A;  2MA2 A;  1F54 A;  2PAS A;  1BU3 A;  2HQW A;  1BR1 B;  1YUS A;  2JTZ A;  1NWD A;  5G08 A;  3DD4 A;  3JTD C;  1IH0 A;  2V53 A;  3VRQ A;  1M46 A;  4GGF A;  1DJZ A;  3KF9 A;  1CFP A;  2M1U A;  1KFU S;  2OS8 B;  1B8R A;  4MRY A;  1A75 B;  2FCD A;  4M2P A;  4C0J A;  4CFQ A;  1QX2 A;  2KI4 B;  4E68 A;  2PRU A;  2LHL A;  1G4Y R;  1SL9 A;  2O60 A;  2QAC A;  4N5X A;  5ER4 X;  2WC8 A;  2BBM A;  4MZL A;  1NSH A;  2JC2 A;  1SR6 C;  4PE0 A;  1IKU A;  1JFJ A;  4GGN A;  2PAL A;  1NX3 A;  1B8C A;  3EK7 A;  1EG3 A;  3MSE B;  1KFX S;  2LAP A;  1KK8 B;  1SBJ A;  2ZN8 A;  1JFK A;  1SW8 A;  2VRG A;  1LVC D;  5I2Q A;  1CDM A;  1YX7 A;  2K0J A;  1YUR A;  2JT8 A;  1DJI A;  2I2R E;  2Y1N A;  2LCP A;  3FWC A;  4C0L A;  3I5H C;  1LKJ A;  3PFV A;  1XO5 A;  3EK8 A;  4PHJ A;  2ZRT A;  5AFP A;  4AQJ A;  3CS1 A;  2ISD A;  3O6B A;  2KYF A;  1KSO A;  4ICB A;  1JBA A;  3SG2 A;  2BKH B;  1H4B A;  1ALV A;  3I5G B;  4JQ0 D;  2P6B B;  1SKT A;  1SMG A;  4TNC A;  1A29 A;  3TUY C;  4I5N B;  1K95 A;  3I5F B;  1J7O A;  1L7Z A;  2NZ0 A;  1A03 A;  2Q91 A;  1BG1 A;  4ORB B;  2BEC A;  1U5I A;  2KDH A;  1KQV A;  1S3P A;  1FW4 A;  2R2I A;  4GGF C;  2HQ8 A;  1SYM A;  4UPG A;  1S5G Z;  2AAO A;  4WQ2 A;  4YGA A;  5HLV A;  2M9G A;  1DF0 A;  2KNE A;  2M7N A;  1AJ4 A;  4YI8 A;  2L98 A;  5JOL A;  5DKN A;  3LK1 A;  4MBE A;  1PVB A;  4YI9 A;  1JUO A;  3GOF A;  3OX6 A;  1SPY A;  1NIW A;  2PVB A;  2ZKM X;  3DVK A;  1QXP A;  3LL8 B;  5I8N A;  1SL8 A;  2K7D A;  5D7F A;  1QVI Y;  1XK4 A;  1H8B A;  1IGV A;  1Y1X A;  1AK8 A;  1EG4 A;  1OE9 B;  2K7O A;  4I5K A;  2LNK A;  3BYA A;  2BCB A;  1KWO C;  4HSZ A;  4ORA B;  2K61 A;  1KQM B;  1DJX A;  1YX8 A;  2SCP A;  4XJK A;  2BCX A;  1G8I A;  1PSR A;  2K2F A;  3GK1 A;  1OOJ A;  3A4U B;  3PAT A;  5I2O A;  3JVT B;  1QX7 A;  2M3W A;  1BF5 A;  3BUO B;  3EVV A;  2KBI A;  2FOT A;  5TNC A;  3PLF B;  1CB1 A;  1IWQ A;  1M39 A;  2M29 A;  3DVM A;  1R2U A;  3KO0 A;  2BL0 C;  4FQO A;  1VRK A;  4ZCU A;  1PUL A;  2KFF A;  1A75 A;  4I5J A;  1YUU A;  2KFH A;  3SJS A;  1UHK A;  1GGW A;  3CTN A;  2COL B;  1RJV A;  2FCE A;  3NSK A;  5HLO A;  1KFU L;  3WNX B;  3OB2 B;  3LLE A;  1S6J A;  3LCP C;  4M2O A;  4N1F A;  3SG7 A;  3D10 A;  4OKH A;  2F3Y A;  2KFG A;  2LMU A;  2KGR A;  1XFV O;  1SCM B;  2ZN9 A;  2HET A;  4YGD B;  2G9B A;  1WDC C;  2JQ6 A;  2KGB C;  3IQO A;  2F2P A;  1KFX L;  1CFC A;  4P5O E;  1XK4 C;  2KOT A;  2Y4Q A;  1OQP A;  1W7J B;  1QAS A;  1SY9 A;  1UHI A;  1CNP A;  1BT6 A;  1NX0 A;  3NSL A;  1KCY A;  3EVU A;  1DJW A;  3GK2 A;  4WQ3 A;  3SG4 A;  1KK7 Z;  1CTR A;  3IQQ A;  3PN7 B;  1TIZ A;  4R1E A;  2K7C A;  1FPW A;  1XFW O;  1PRW A;  2LP2 A;  2H61 A;  2OPO A;  4QJ5 B;  1L2O B;  2H2K A;  3AKA A;  1UHJ A;  3CGA A;  1CDP A;  4Q04 A;  2SAS A;  2JTT A;  3BUM B;  1NUB A;  2OS8 C;  3OHM B;  1S1E A;  2WCB A;  2KHN A;  2KI4 C;  3WHU B;  1IRJ A;  2AUC A;  3PAL A;  2KAX A;  3DVE A;  1NCX A;  1AHR A;  1MWN A;  2F8P A;  1EJ3 A;  1NX2 A;  2EC6 B;  4OCI A;  5D69 A;  2LUC A;  1TOP A;  1KK8 C;  3VRN A;  3VGO A;  1PVA A;  1DVI A;  1G33 A;  1QTX A;  1S6C A;  4DIR A;  1XYD A;  1OZS A;  3SIA A;  3OB1 B;  4NQG A;  2JT0 A;  5HKY A;  2K7B A;  3O78 A;  3FWB A;  2L51 A;  1WRL A;  3FIA A;  2JOJ A;  1S36 A;  2WOR A;  3BUW B;  3QRX A;  1TNP A;  2CT9 A;  1M45 A;  1F4O A;  1Q80 A;  2F33 A;  3EK4 A;  3I5G C;  1K94 A;  4N1G A;  5CSJ A;  4DUQ A;  1CM4 A;  4NDC A;  3C1V A;  1DTL A;  2I94 A;  4PE1 A;  4C0K A;  1BMO A;  2PMY A;  3I5F C;  4CFR A;  1QX5 B;  2KI6 C;  1RFJ A;  1IJ5 A;  2H61 C;  2I7A A;  2NLN A;  4P2Y B;  1LXF C;  3VRR A;  3BOW B;  5HKZ A;  2MLF C;  3A8R A;  3AKB A;  3D0Y B;  1B9A A;  5KSZ A;  2LVK A;  1Y1U A;  1J1E A;  1RTP 1;  4F0Z B;  4CID A;  4D1E A;  4GBA A;  1PK0 D;  4XYN A;  2OTG B;  2JRF A;  2BKI B;  4JWQ A;  5AXI A;  4DS7 A;  1AJ5 A;  1A2X A;  1QV1 A;  2LE9 B;  1NP8 A;  4PCW A;  1UHH A;  1MHO A;  3TZ1 A;  1AP4 A;  2DOQ A;  2BCA A;  1EXR A;  1NCY A;  2JXL A;  1K9P A;  1KQM C;  3TUY B;  3K21 A;  1MQ1 A;  2LC5 A;  3ZWH A;  5IBW A;  1WLZ A;  2JUL A;  2E30 A;  2GGZ A;  3JVT C;  1QS7 A;  1CDN A;  3OP0 A;  5K89 A;  2CXJ A;  1MR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...