2K0JA

Solution structure of cam complexed to drp1p
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
147
structure length
147
Chain Sequence
DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords calmodulin
publication title Accurate solution structures of proteins from X-ray data and a minimal set of NMR data: calmodulin-peptide complexes as examples.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 46
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k0jA00
2LP3A 3M0WA 4OCIA 2LVJA 3WXAA 1B8LA 1QLKA 2BE6A 3ZNIA 1NX0A 2BCBA 1B1GA 2MBXA 3A8RA 2WC8A 2BCAA 2Q91A 1K95A 1SKTA 3I5HB 3BUOB 1MQ1A 3E3RA 3TS5B 4WQ3A 3D0YB 1LXFC 2KYFA 1CLBA 1KFXL 2K0JA 4MBEA 1PSRA 1SYMA 5DKQA 3OHMB 3BUMB 4R1EA 2LCPA 2ZNDA 2CT9A 1S6CA 1J7OA 2WCEA 1IWQA 2K8MB 3D10A 2KYCA 2LUCA 2KGBC 2LVIA 2KFFA 3DVJA 2K7DA 2L51A 4A4CA 2GV5A 1XK4A 3H4SE 1SL7A 2MRDA 1ZFSA 3I5GB 1FW4A 4YGBB 1IH0A 2F33A 1G33A 1GGWA 1TN4A 1TCOB 1SCMC 1J7QA 3SG5A 1XFUO 1QVIY 1R2UA 2LUXA 4GGFC 1AJ4A 5B8IB 1LINA 4YGAA 2BBMA 3JVTC 1CFFA 4XYNA 1S3PA 2LVKA 1SR6C 1BOCA 2OS8C 2KI4C 2O5GA 2PVBA 1NCZA 4I5JA 4BY5A 4DCKA 1MUXA 2OTGC 3KF9A 4ICBA 1ZOTB 1KK8B 3AKAA 4F0ZB 5D7FA 1J1DA 2M1UA 3VGOA 2MLFC 2HF5A 1CM4A 1XFVO 1DJGA 1CM1A 1KSMA 4PALA 3SG7A 1XO5A 3JTDB 2MAZA 4DS7A 1NWDA 2FOTA 2CBLA 2JULA 3MSEB 1K96A 1DJZA 1KQMB 2JXCA 4MRYA 3TUYB 1KCYA 3EK7A 1B9AA 1W7IB 1WDCB 2PASA 4PE0A 1XVJA 1OSAA 2JT3A 1M31A 2WCBA 1YUSA 2PALA 5I2OA 4CLNA 4ORBB 3IQQA 1CDPA 4PHMA 3SIAA 4ETOA 1SPYA 2KAYA 1D1OA 1TNPA 5CSNA 1IQ3A 3O2PA 3LL8B 2ZN8A 3GOFA 2O60A 5ER5A 1JBAA 1F8HA 4N1FA 2PSRA 1A2XA 2KQ6A 1PALA 1GGZA 2MJWB 1BT6A 1U5IA 2NCOA 3EK8A 3OP0A 1V1FA 2L2EA 1EH2A 5D69A 2M7NA 1EG3A 2DOQA 3BUWB 3NSLA 1MR8A 4QJ5B 1IJ6A 1OMDA 3CTNA 1MF8B 4NDBA 2OPOA 3BXKA 1WRKA 1YTZC 4DRWA 2FCEA 3OX6A 3CGAA 1SRAA 3EKJA 3LK0A 3PSRA 1XYDA 3SJSA 1KWOC 1S5GY 1YUUA 3DF0A 3IQOA 1SCMB 2A4JA 4WRIA 1F71A 1MXLC 2F2OA 4OKHA 4XJKA 1IRJA 1NCXA 1S36A 4A4BA 1BODA 1PVAA 2M8UA 1UHJA 2HPSA 1ALWA 4CPVA 3CS1A 2I2RE 4PHKA 4N1GA 1U5IB 1JF2A 2Y4QA 4MZJA 1QV1A 2HQ8A 5ER4X 1XFYO 4U8DA 1K94A 2KFHA 2COLB 2QACA 5CSIA 4YRUA 2SASA 1LKJA 1DT7B 1AP4A 3I5FB 5JOLA 1N2DA 3LCPC 2H2KA 3ICBA 3LK1A 1SMGA 1WLMA 2KAXA 2M29A 4M2PA 3O4YA 4OR9B 1EG4A 2WCFA 4Q04A 2JC2A 4AQJA 4PCWA 1SW8A 3DF0B 2R2IA 1C7VA 1CFDA 1K9PA 1B8RA 1V1GA 2H61A 5AANA 4FQOA 4XJKB 1PRWA 2KOTA 3CR4X 1CNPA 4PE1A 1DJHA 1RK9A 1WLZA 2SCPA 3FWBA 1FPWA 2KI6C 1DJXA 2LLTA 1TIZA 2BBNA 1NPQA 1CMGA 1QX5B 1S6JA 1KFUL 1NCYA 1Y1UA 1G4YR 4L9MA 4GAOA 3EVRA 1AVSA 4CIDA 1A75A 4GBAA 5HLOA 5CSJA 1RJVA 2HETA 1DGUA 3PN7B 4YGCB 2JNFA 1M63B 2NXQA 3C1VA 2Y1NA 2JTTA 4AQIA 2JOJA 1LVCD 1BLQA 3DVMA 5HKZA 3EVUA 3IF7A 1JSAA 1B7TY 2L50A 4WQ2A 2L0PA 1M39A 4ORCB 1XFWO 3PATA 1G8IA 2LM5A 2M97A 3GK4X 5TNCA 3ZWHA 2D8NA 2LMTA 3I5IB 1QS7A 1QXPA 2L4IA 1FF1A 2M1KB 3PALA 1YURA 4USLA 1OQPA 1BG1A 1JFKA 1Y1AA 2LE9B 2LMVA 1NP8A 2JPTA 4GPLB 1FBVA 3VRNA 2Q4UA 1CFPA 1A75B 2CNPA 4MLWA 1UURA 1K9UA 3CLNA 2MHHA 1KQVA 1PULA 1J7PA 1JF0A 1L2OB 1TOPA 4ZCVA 4GGNA 2V53A 2NLNA 1KFXS 1UHNA 3KEVA 2LLUA 1N0YA 1Y1XA 1CKKA 3TUYC 1EL4A 2KGRA 1NYAA 2JZIA 4MZLA 2BECA 4UPGA 4P2YB 3VROA 1M46A 2GGMA 2KI6D 5KU1A 4GGFA 2BL0C 5DKRA 5HYDA 3TDZA 1GQMA 2L4HA 2EGDA 2WNDA 1ZACA 2EC6C 1UP5A 1C7WA 4C0KA 3NSOA 3CR2A 5FYXA 5HLVA 1HQVA 2JWWA 2L98A 1QTXA 4IL1A 3AAKA 1SL8A 1GJYA 2Y1MA 1FI6A 1K8UA 3FWCA 1TTXA 1A4PA 1OMRA 1XFXO 2B1UA 1SBJA 5JJGA 1TNWA 2ZRSA 3BUXB 4E68A 1B4CA 3QRXA 2EHBA 1IKUA 3TS5C 2KHNA 1C07A 4I5KA 1FI5A 4HRGA 4GFTA 2E30A 1AHRA 2P6BB 1F4QA 1YVLA 1ODBA 1DJYA 4I5LB 1BU3A 1M45A 4MEWA 5I2QA 1F54A 1IGVA 1DVIA 1PSBA 2BE4A 3AKBA 2KSPA 1CLMA 1NUBA 3JVTB 3OB2B 4TNCA 3RM1A 2AUCA 1E8AA 3CR5X 4YBHB 3WHUB 1CB1A 1SR6B 2OS8B 1OOJA 2KI4B 2ZN9A 4YGEB 1YVHA 3I5GC 1A29A 1Q80A 2ISDA 2AAOA 3WHTB 5BPJA 1NSHA 4YI8A 1TCFA 1F70A 4ZCUA 1OZSA 1ZMZA 2F3ZA 2OTGB 2M49B 3DD4A 3KO0A 1DGVA 5G08A 1QV0A 3DVEA 1S26D 2K7BA 1R6PA 2ZFDA 3SIBA 2KAVA 1MWNA 1QX2A 1SL9A 1KSOA 1WRLA 2LNKA 4PDZA 2NCPA 2JT0A 2ZRTA 2QPTA 1MHOA 5AXIA 2LHIA 4ORAB 1LA0A 2I7AA 3VRRA 1CMFA 1SNLA 1W7JB 1QVIZ 2K7CA 3FIAA 1BR4B 1SK6D 4M2OA 3TDUA 1KK8C 3CZTX 3VRQA 2RGIA 2NZ0A 2LVVA 1YX7A 2VRGA 3JTDC 3O78A 1RWYA 1QASA 1KQMC 1XK4C 1WRZA 1WDCC 1CDLA 1LA3A 1Y6WA 3PLFB 1ALVA 2K2AA 2G9BA 3BOWA 1DJIA 3NXAA 2PRUA 4AOMA 1J55A 4GNKB 3PM8A 3BQ3A 1SCVA 2AMIA 1BJFA 1UHIA 5KTYA 3PFVA 3RLZA 1S1EA 4YGDB 2CTNA 1JC2A 1KWOB 1BF5A 5DKNA 2JTZA 1JUOA 1S6IA 2LMUA 3A4UB 4YI9A 1NX3A 3OB1B 1BMOA 2KFGA 5HKYA 1MXEA 1WY9A 2LLSA 4C0JA 4C0LA 5KSZA 2KDHA 4JPZB 4FTGA 1F4OA 1KK7Z 1Y0VH 2LHLA 4MSPA 5AERA 1CLLA 1QIVA 3BOWB 2HQWA 2LV7A 1RECA 2F3YA 1K2HA 1TRFA 2FCDA 1ZUZA 2I18A 4JQ0D 3DVKA 3HX4A 3GK1A 3SG6A 3BUNB 1DF0A 2ZNEA 5AEQA 1XA5A 5PALA 1NX1A 2CCMA 4PHNA 2TN4A 1OZOA 3EVVA 3KHEA 1YX8A 1VRKA 1S5GZ 1L7ZA 2G2BA 1KFUS 3AAJA 2JT8A 2L5XB 2M9GA 3GK2A 3OX5A 4HREE 5CPVA 3HCMA 4OVNF 3SG2A 1B8CA 3I5FC 1QIWA 2KQYA 1BR1B 3NSKA 1CDNA 2LAPA 1A03A 1PVBA 1DTLA 1IJ5A 1SY9A 2E6WA 2LANA 4DUQA 1RROA 2M0RA 2KBIA 2JU0A 1NX2A 2M7LA 4MVFA 5K89A 5HKWA 4PE7A 3F45A 4MRXA 1OMVA 4NDDA 2KNEA 2F8PA 2IS9A 4QJ4B 2LP2A 1TNXA 3I5HC 1DF0B 3SG4A 1J7RA 2LC5A 5AFPA 1UHKA 1QATA 1B47A 1RFJA 2JXLA 4MZKA 1HT9A 4QJ3B 3EKHA 1AJ5A 1UWOA 4PHJA 2CXJA 2MA2A 4I5NB 1IG5A 1N65A 1CDMA 5J3XA 3KPXA 1KK7Y 1CFCA 1AUIB 3FS7A 4CFQA 2F2PA 3LLEA 4M2QA 1YRTB 4CFRA 1YUTA 1UHHA 4NQGA 3PN7C 5F6TA 4NDCA 2ZKMX 4HRHA 4JWQA 3NSIA 5GQQC 5I8NA 3K21A 1QX7A 1J1EA 4DIRA 4D1EA 2BCXA 3SG3A 1OE9B 2WORA 4GUKA 2H61C 4N5XA 1K93D 1QJTA 2BKHB 1QLSA 2KBMA 2K2FA 3TDIA 3I5IC 1JFJA 1H4BA 1AK8A 1XFZO 1H8BA 1JWDA 3VRPA 4OV2A 2FJUB 1DJWA 1EJ3A 2JQ6A 2JRFA 2Y5IA 3BYAA 1NIWA 3D0YA 1CTRA 2K7OA 1B7TZ 2GGZA 1UUSA 2BKIB 4P5OE 2WOSA 3WNXB 5IBWA 4BY4A 1TNQA 5I2LA 1EXRA 1K90D 5CSFA 1K9KA 3O6BA 1PK0D 1F55A 1IQ5A 2I94A 3TZ1A 2BL0B 2PMYA 1YRUB 1L2OC 2JNXA 2MLEC 4PE4A 1RTP1 3CWGA 2K61A 2M3WA 1YR5A 2EC6B 3EK4A 1X02A 4MN0A 1DMOA 4HSZA
chains in the Genus database with same CATH superfamily
2LP3A 3M0WA 4OCIA 2LVJA 4KYNA 1B8LA 3WXAA 1QLKA 2BE6A 3SS3A 3ZNIA 1NX0A 2BCBA 1B1GA 2MBXA 3A8RA 2WC8A 2BCAA 4IJ7A 2Q91A 1K95A 1SKTA 3I5HB 3BUOB 1MQ1A 3E3RA 3TS5B 4WQ3A 3D0YB 1LXFC 2KYFA 1CLBA 1KFXL 2K0JA 4MBEA 1PSRA 1SYMA 5DKQA 3OHMB 3BUMB 2WC5A 2LCPA 2ZNDA 2CT9A 4R1EA 1S6CA 1J7OA 1OOGA 3UNWA 2WCEA 1IWQA 2K8MB 3D10A 2KYCA 2LUCA 2KGBC 2LVIA 2KFFA 3DVJA 2K7DA 1OOFA 2L51A 4A4CA 2GV5A 1XK4A 3H4SE 1SL7A 2MRDA 1ZFSA 3I5GB 1FW4A 2WCMA 1TWOA 4YGBB 2F33A 1G33A 1GGWA 1TN4A 1TCOB 1IH0A 1SCMC 1J7QA 3CDNA 3SG5A 1XFUO 1QVIY 1R2UA 2LUXA 3D76A 1AJ4A 4GGFC 5B8IB 3L4LA 1LINA 4YGAA 2BBMA 3JVTC 3IVTA 1CFFA 4XYNA 1S3PA 2LVKA 1SR6C 1BOCA 2OS8C 2QDIA 2KI4C 2O5GA 2PVBA 3B88A 2BAPA 1NCZA 4I5JA 4BY5A 4DCKA 1MUXA 3D77A 2OTGC 3KF9A 4ICBA 1ZOTB 1KK8B 3AKAA 4F0ZB 5D7FA 1J1DA 2M1UA 3VGOA 2MLFC 2HF5A 1CM4A 3R1VA 1XFVO 1DJGA 1CM1A 1KSMA 4PALA 3SG7A 1XO5A 3JTDB 2MAZA 4DS7A 1DC1A 1NWDA 2FOTA 2CBLA 2JULA 3MSEB 1K96A 1DJZA 1KQMB 2JXCA 4MRYA 2JPOA 3TUYB 1KCYA 3EK7A 1B9AA 1W7IB 1WDCB 2PASA 4PE0A 1XVJA 1OSAA 2JT3A 1M31A 2WCBA 1YUSA 2PALA 5I2OA 4CLNA 4ORBB 3IQQA 1CDPA 4PHMA 3SIAA 4ETOA 1SPYA 2KAYA 1D1OA 1TNPA 5CSNA 1IQ3A 3O2PA 3LL8B 2ZN8A 3GOFA 2O60A 5ER5A 1JBAA 1F8HA 3S0FA 4N1FA 2PSRA 1A2XA 2KQ6A 1PALA 1GGZA 2MJWB 1BT6A 1U5IA 2NCOA 3EK8A 3N7HA 1V1FA 2L2EA 3O4XA 3QMEA 5D69A 1EH2A 2M7NA 1EG3A 2DOQA 1W9ZA 3BUWB 3NSLA 1MR8A 4QJ5B 1IJ6A 1OMDA 3CTNA 1MF8B 4NDBA 2OPOA 3B87A 1WRKA 3BXKA 1YTZC 4DRWA 2FCEA 3OX6A 3CGAA 1SRAA 3EKJA 3LK0A 3PSRA 3R1PA 1XYDA 1OOHA 3SJSA 1KWOC 1S5GY 2PYQA 1YUUA 3DF0A 3IQOA 2H8VA 1SCMB 2A4JA 4WRIA 1F71A 1MXLC 2F2OA 4OKHA 4XJKA 1IRJA 1NCXA 1S36A 4A4BA 1BODA 1PVAA 2M8UA 1UHJA 2HPSA 1ALWA 5I94A 4CPVA 3CS1A 2I2RE 4PHKA 4N1GA 1U5IB 1JF2A 2Y4QA 4MZJA 1QV1A 2HQ8A 2QEOA 5ER4X 1XFYO 4U8DA 1K94A 2KFHA 2COLB 2QACA 5CSIA 2BNXA 2SASA 1LKJA 4YRUA 1DT7B 1AP4A 3I5FB 5JOLA 1N2DA 3DZTA 3LCPC 2H2KA 3ICBA 3LK1A 1SMGA 1WLMA 2KAXA 2M29A 4M2PA 3O4YA 4OR9B 1EG4A 2WCFA 2P71A 4Q04A 2JC2A 4AQJA 4PCWA 1SW8A 1XFRA 3DF0B 1C3ZA 2R2IA 1C7VA 1CFDA 1K9PA 1B8RA 1V1GA 2H61A 5AANA 4FQOA 4XJKB 1PRWA 2KOTA 3CR4X 1CNPA 4PE1A 1DELA 1DJHA 1RK9A 1WLZA 2SCPA 3FWBA 1FPWA 3FE8A 2KI6C 1DJXA 2LLTA 2YGUA 4PT1A 1TIZA 3FE9A 2BBNA 1NPQA 3NGVA 1CMGA 1QX5B 1S6JA 1KFUL 1NCYA 1Y1UA 3EG5B 1G4YR 4L9MA 4GAOA 3EVRA 1AVSA 4CIDA 1A75A 3OBVA 4GBAA 5HLOA 5CSJA 3CYZA 1RJVA 2HETA 1DGUA 3PN7B 4YGCB 2JNFA 1M63B 2NXQA 3B86A 2Y1NA 2JTTA 3C1VA 4AQIA 2JOJA 1LVCD 1BLQA 3DVMA 2FJYA 5HKZA 3EVUA 3IF7A 1JSAA 1B7TY 2L50A 4WQ2A 2L0PA 1ORGA 1M39A 4ORCB 1XFWO 3D78A 3BFBA 3PATA 1G8IA 2LM5A 2M97A 3GK4X 5TNCA 3ZWHA 2D8NA 2LMTA 2PQLA 5DICA 3I5IB 1QS7A 1QXPA 2L4IA 3S0DA 1FF1A 4INWA 2M1KB 3PALA 1YURA 4USLA 1OQPA 1SSEB 1BG1A 1JFKA 1Y1AA 2LE9B 2LMVA 1NP8A 4FQTA 2JPTA 4GPLB 3NHTA 1FBVA 3VRNA 2Q4UA 1CFPA 3K1EA 1TUZA 1A75B 2CNPA 2QEVA 4MLWA 5FI2A 1UURA 1K9UA 3CLNA 2MHHA 1KQVA 1PULA 1J7PA 1JF0A 1L2OB 1TOPA 4ZCVA 1C3YA 4OZDA 3OP0A 4GGNA 2V53A 2NLNA 1KFXS 1UHNA 3KEVA 2LLUA 1N0YA 1Y1XA 1CKKA 3TUYC 1EL4A 2KGRA 5FI6A 1NYAA 2JZIA 4MZLA 2BECA 4UPGA 4P2YB 2KLDA 3VROA 1M46A 2GGMA 2KI6D 5KU1A 4GGFA 2BL0C 3UO9A 5DKRA 5HYDA 3TDZA 1GQMA 2L4HA 2EGDA 2WNDA 1ZACA 2EC6C 1UP5A 1C7WA 3D74A 4C0KA 2P70A 2WC6A 5EL2A 3NSOA 3CR2A 5FYXA 5HLVA 1HQVA 2JWWA 2L98A 1QTXA 4IL1A 3AAKA 1SL8A 1GJYA 2Y1MA 1FI6A 1K8UA 3FWCA 1TTXA 4F7FA 1A4PA 1OMRA 1XFXO 2B1UA 3PM2A 1SBJA 5JJGA 1TNWA 2ZRSA 3BUXB 4E68A 1B4CA 3QRXA 2EHBA 1LS8A 3TS5C 1IKUA 2KHNA 1C07A 4I5KA 1FI5A 4HRGA 4GFTA 2E30A 1AHRA 3NHIA 3SS4A 2P6BB 1F4QA 1YVLA 1ODBA 1DJYA 4I5LB 1BU3A 1M45A 4MEWA 5I2QA 1F54A 1IGVA 1DVIA 1PSBA 2BE4A 3AKBA 2KSPA 1CLMA 2QEBA 1NUBA 3B7AA 3JVTB 3OB2B 4TNCA 3RM1A 2AUCA 1E8AA 3CR5X 4YBHB 3WHUB 1CB1A 1SR6B 2OS8B 1OOJA 2KI4B 2ZN9A 4YGEB 1YVHA 4INXA 3I5GC 1A29A 1Q80A 2ISDA 2AAOA 3WHTB 5BPJA 1NSHA 1GM0A 4YI8A 1TCFA 1F70A 4ZCUA 1OZSA 1ZMZA 1DQEA 2F3ZA 2OTGB 2M49B 3DD4A 3KO0A 5HL1A 1DGVA 3CZ0A 5G08A 1QV0A 3DVEA 1S26D 2K7BA 1R6PA 2ZFDA 3SIBA 2KLEA 2KAVA 1MWNA 3R72A 1QX2A 1SL9A 1KSOA 1WRLA 2LNKA 4PDZA 2NCPA 2JT0A 2ZRTA 2QPTA 1MHOA 5AXIA 2LHIA 4ORAB 1LA0A 2I7AA 3VRRA 1CMFA 1SNLA 1W7JB 1QVIZ 2K7CA 3FIAA 1BR4B 1SK6D 4M2OA 3TDUA 1KK8C 3CZTX 3VRQA 2RGIA 2NZ0A 2LVVA 2L2CA 1DEKA 2L5YA 1YX7A 2VRGA 3JTDC 3O78A 1RWYA 1QASA 1KQMC 1XK4C 3RZSA 1WRZA 1WDCC 2WCJA 1CDLA 1LA3A 1T14A 1Y6WA 3PLFB 1ALVA 2K2AA 2G9BA 3BOWA 1DJIA 3NXAA 2PRUA 4AOMA 1J55A 4GNKB 3PM8A 3BQ3A 1SCVA 2AMIA 1BJFA 2WCHA 1UHIA 3DY9A 5KTYA 3PFVA 3PJIA 3RLZA 3D73A 1S1EA 4YGDB 2CTNA 1JC2A 1KWOB 3D75A 5DKNA 2JTZA 1JUOA 1S6IA 1BF5A 2LMUA 3A4UB 4YI9A 3S0BA 1NX3A 3OB1B 1BMOA 2KFGA 3VB1A 5HKYA 1MXEA 1WY9A 2LLSA 4C0JA 4C0LA 5KSZA 1TUJA 2KDHA 4JD9A 4JPZB 4FTGA 1F4OA 1KK7Z 1Y0VH 2LHLA 4MSPA 5AERA 1CLLA 1QIVA 3BOWB 2HQWA 2LV7A 3OGNA 1RECA 2WCKA 3DXLA 2F3YA 1K2HA 1TRFA 2FCDA 1ZUZA 2I18A 4JQ0D 3DVKA 3HX4A 3BJHA 3GK1A 1IIOA 3SG6A 3BUNB 1DF0A 2ZNEA 3CZ1A 5AEQA 5FI7A 1XA5A 5PALA 1NX1A 2CCMA 4PHNA 2TN4A 1OZOA 3EVVA 3KHEA 1YX8A 1VRKA 1S5GZ 1L7ZA 1QWVA 1KFUS 2G2BA 2JT8A 2L5XB 2M9GA 3AAJA 3CZ2A 3GK2A 3OX5A 4HREE 5CPVA 3S0AA 3HCMA 3CABA 4OVNF 3SG2A 2QEHA 3SS5A 1B8CA 3I5FC 3S0EA 1QIWA 2KQYA 1BR1B 3NSKA 1CDNA 1Z2CB 2LAPA 1A03A 1PVBA 1DTLA 1IJ5A 1SY9A 2E6WA 2LANA 4DUQA 1RROA 2M0RA 2KBIA 2JU0A 1NX2A 2M7LA 4MVFA 5K89A 5HKWA 4PE7A 3F45A 4MRXA 1OMVA 4NDDA 2KNEA 2WCLA 4JKTA 2F8PA 2IS9A 4QJ4B 2LP2A 1TNXA 3B6XA 3I5HC 5D3OA 1DF0B 3SG4A 1J7RA 2LC5A 5AFPA 1UHKA 1QATA 1B47A 1RFJA 2JXLA 4MZKA 1HT9A 4QJ3B 3EKHA 1AJ5A 1UWOA 3FE6A 4PHJA 2CXJA 2MA2A 4I5NB 1IG5A 1N65A 1CDMA 5J3XA 3KPXA 1KK7Y 1CFCA 1AUIB 3FS7A 4CFQA 2F2PA 3LLEA 4M2QA 1YRTB 4CFRA 1YUTA 1UHHA 4NQGA 3PN7C 5F6TA 4NDCA 2ZKMX 4HRHA 4JWQA 3NSIA 5GQQC 3Q8IA 3R1OA 5I8NA 3K21A 1QX7A 3S0GA 3V2LA 1Z4HA 1OOIX 1J1EA 3L47A 4DIRA 4D1EA 2BCXA 3SG3A 1OE9B 2WORA 4GUKA 2H61C 4N5XA 2ERBA 1K93D 1QJTA 2BKHB 1QLSA 2KBMA 1P28A 2K2FA 3TDIA 3I5IC 1JFJA 1H4BA 1AK8A 1XFZO 1H8BA 1JWDA 3VRPA 4OV2A 2FJUB 1DJWA 1EJ3A 2JQ6A 2JRFA 2Y5IA 3BYAA 1NIWA 3D0YA 1CTRA 2K7OA 1B7TZ 3L4AA 2GGZA 1UUSA 2BKIB 2K60A 2WOSA 4P5OE 3WNXB 5IBWA 4BY4A 1TNQA 3BFAA 5I2LA 1EXRA 1K90D 5CSFA 1K9KA 3O6BA 1PK0D 1F55A 1IQ5A 2I94A 3TZ1A 2BL0B 2PMYA 1YRUB 1L2OC 2JNXA 2MLEC 2KPHA 4PE4A 3BFHA 1RTP1 3CWGA 1OW4A 2K61A 2M3WA 1YR5A 2EC6B 3DYEA 3EK4A 1X02A 4MN0A 2GTEA 1DMOA 4HSZA
chains in the Genus database with same CATH topology
2LP3A 3M0WA 4OCIA 2LVJA 3WXAA 1B8LA 1QLKA 2BE6A 3ZNIA 1NX0A 2BCBA 1B1GA 2MBXA 3A8RA 2WC8A 2BCAA 2Q91A 1K95A 1SKTA 3I5HB 3BUOB 1MQ1A 3E3RA 3TS5B 4WQ3A 3D0YB 1LXFC 2KYFA 1CLBA 1KFXL 2K0JA 4MBEA 1PSRA 1SYMA 5DKQA 3OHMB 3BUMB 4R1EA 2LCPA 2ZNDA 2CT9A 1S6CA 1J7OA 2WCEA 1IWQA 2K8MB 3D10A 2KYCA 2LUCA 2KGBC 2LVIA 2KFFA 3DVJA 2K7DA 2L51A 4A4CA 2GV5A 1XK4A 3H4SE 1SL7A 2MRDA 1ZFSA 3I5GB 1FW4A 4YGBB 1IH0A 2F33A 1G33A 1GGWA 1TN4A 1TCOB 1SCMC 1J7QA 3SG5A 1XFUO 1QVIY 1R2UA 2LUXA 4GGFC 1AJ4A 5B8IB 1LINA 4YGAA 2BBMA 3JVTC 1CFFA 4XYNA 1S3PA 2LVKA 1SR6C 1BOCA 2OS8C 2KI4C 2O5GA 2PVBA 1NCZA 4I5JA 4BY5A 4DCKA 1MUXA 2OTGC 3KF9A 4ICBA 1ZOTB 1KK8B 3AKAA 4F0ZB 5D7FA 1J1DA 2M1UA 3VGOA 2MLFC 2HF5A 1CM4A 1XFVO 1DJGA 1CM1A 1KSMA 4PALA 3SG7A 1XO5A 3JTDB 2MAZA 4DS7A 1NWDA 2FOTA 2CBLA 2JULA 3MSEB 1K96A 1DJZA 1KQMB 2JXCA 4MRYA 3TUYB 1KCYA 3EK7A 1B9AA 1W7IB 1WDCB 2PASA 4PE0A 1XVJA 1OSAA 2JT3A 1M31A 2WCBA 1YUSA 2PALA 5I2OA 4CLNA 4ORBB 3IQQA 1CDPA 4PHMA 3SIAA 4ETOA 1SPYA 2KAYA 1D1OA 1TNPA 5CSNA 1IQ3A 3O2PA 3LL8B 2ZN8A 3GOFA 2O60A 5ER5A 1JBAA 1F8HA 4N1FA 2PSRA 1A2XA 2KQ6A 1PALA 1GGZA 2MJWB 1BT6A 1U5IA 2NCOA 3EK8A 3OP0A 1V1FA 2L2EA 1EH2A 5D69A 2M7NA 1EG3A 2DOQA 3BUWB 3NSLA 1MR8A 4QJ5B 1IJ6A 1OMDA 3CTNA 1MF8B 4NDBA 2OPOA 3BXKA 1WRKA 1YTZC 4DRWA 2FCEA 3OX6A 3CGAA 1SRAA 3EKJA 3LK0A 3PSRA 1XYDA 3SJSA 1KWOC 1S5GY 1YUUA 3DF0A 3IQOA 1SCMB 2A4JA 4WRIA 1F71A 1MXLC 2F2OA 4OKHA 4XJKA 1IRJA 1NCXA 1S36A 4A4BA 1BODA 1PVAA 2M8UA 1UHJA 2HPSA 1ALWA 4CPVA 3CS1A 2I2RE 4PHKA 4N1GA 1U5IB 1JF2A 2Y4QA 4MZJA 1QV1A 2HQ8A 5ER4X 1XFYO 4U8DA 1K94A 2KFHA 2COLB 2QACA 5CSIA 4YRUA 2SASA 1LKJA 1DT7B 1AP4A 3I5FB 5JOLA 1N2DA 3LCPC 2H2KA 3ICBA 3LK1A 1SMGA 1WLMA 2KAXA 2M29A 4M2PA 3O4YA 4OR9B 1EG4A 2WCFA 4Q04A 2JC2A 4AQJA 4PCWA 1SW8A 3DF0B 2R2IA 1C7VA 1CFDA 1K9PA 1B8RA 1V1GA 2H61A 5AANA 4FQOA 4XJKB 1PRWA 2KOTA 3CR4X 1CNPA 4PE1A 1DJHA 1RK9A 1WLZA 2SCPA 3FWBA 1FPWA 2KI6C 1DJXA 2LLTA 1TIZA 2BBNA 1NPQA 1CMGA 1QX5B 1S6JA 1KFUL 1NCYA 1Y1UA 1G4YR 4L9MA 4GAOA 3EVRA 1AVSA 4CIDA 1A75A 4GBAA 5HLOA 5CSJA 1RJVA 2HETA 1DGUA 3PN7B 4YGCB 2JNFA 1M63B 2NXQA 3C1VA 2Y1NA 2JTTA 4AQIA 2JOJA 1LVCD 1BLQA 3DVMA 5HKZA 3EVUA 3IF7A 1JSAA 1B7TY 2L50A 4WQ2A 2L0PA 1M39A 4ORCB 1XFWO 3PATA 1G8IA 2LM5A 2M97A 3GK4X 5TNCA 3ZWHA 2D8NA 2LMTA 3I5IB 1QS7A 1QXPA 2L4IA 1FF1A 2M1KB 3PALA 1YURA 4USLA 1OQPA 1BG1A 1JFKA 1Y1AA 2LE9B 2LMVA 1NP8A 2JPTA 4GPLB 1FBVA 3VRNA 2Q4UA 1CFPA 1A75B 2CNPA 4MLWA 1UURA 1K9UA 3CLNA 2MHHA 1KQVA 1PULA 1J7PA 1JF0A 1L2OB 1TOPA 4ZCVA 4GGNA 2V53A 2NLNA 1KFXS 1UHNA 3KEVA 2LLUA 1N0YA 1Y1XA 1CKKA 3TUYC 1EL4A 2KGRA 1NYAA 2JZIA 4MZLA 2BECA 4UPGA 4P2YB 3VROA 1M46A 2GGMA 2KI6D 5KU1A 4GGFA 2BL0C 5DKRA 5HYDA 3TDZA 1GQMA 2L4HA 2EGDA 2WNDA 1ZACA 2EC6C 1UP5A 1C7WA 4C0KA 3NSOA 3CR2A 5FYXA 5HLVA 1HQVA 2JWWA 2L98A 1QTXA 4IL1A 3AAKA 1SL8A 1GJYA 2Y1MA 1FI6A 1K8UA 3FWCA 1TTXA 1A4PA 1OMRA 1XFXO 2B1UA 1SBJA 5JJGA 1TNWA 2ZRSA 3BUXB 4E68A 1B4CA 3QRXA 2EHBA 1IKUA 3TS5C 2KHNA 1C07A 4I5KA 1FI5A 4HRGA 4GFTA 2E30A 1AHRA 2P6BB 1F4QA 1YVLA 1ODBA 1DJYA 4I5LB 1BU3A 1M45A 4MEWA 5I2QA 1F54A 1IGVA 1DVIA 1PSBA 2BE4A 3AKBA 2KSPA 1CLMA 1NUBA 3JVTB 3OB2B 4TNCA 3RM1A 2AUCA 1E8AA 3CR5X 4YBHB 3WHUB 1CB1A 1SR6B 2OS8B 1OOJA 2KI4B 2ZN9A 4YGEB 1YVHA 3I5GC 1A29A 1Q80A 2ISDA 2AAOA 3WHTB 5BPJA 1NSHA 4YI8A 1TCFA 1F70A 4ZCUA 1OZSA 1ZMZA 2F3ZA 2OTGB 2M49B 3DD4A 3KO0A 1DGVA 5G08A 1QV0A 3DVEA 1S26D 2K7BA 1R6PA 2ZFDA 3SIBA 2KAVA 1MWNA 1QX2A 1SL9A 1KSOA 1WRLA 2LNKA 4PDZA 2NCPA 2JT0A 2ZRTA 2QPTA 1MHOA 5AXIA 2LHIA 4ORAB 1LA0A 2I7AA 3VRRA 1CMFA 1SNLA 1W7JB 1QVIZ 2K7CA 3FIAA 1BR4B 1SK6D 4M2OA 3TDUA 1KK8C 3CZTX 3VRQA 2RGIA 2NZ0A 2LVVA 1YX7A 2VRGA 3JTDC 3O78A 1RWYA 1QASA 1KQMC 1XK4C 1WRZA 1WDCC 1CDLA 1LA3A 1Y6WA 3PLFB 1ALVA 2K2AA 2G9BA 3BOWA 1DJIA 3NXAA 2PRUA 4AOMA 1J55A 4GNKB 3PM8A 3BQ3A 1SCVA 2AMIA 1BJFA 1UHIA 5KTYA 3PFVA 3RLZA 1S1EA 4YGDB 2CTNA 1JC2A 1KWOB 1BF5A 5DKNA 2JTZA 1JUOA 1S6IA 2LMUA 3A4UB 4YI9A 1NX3A 3OB1B 1BMOA 2KFGA 5HKYA 1MXEA 1WY9A 2LLSA 4C0JA 4C0LA 5KSZA 2KDHA 4JPZB 4FTGA 1F4OA 1KK7Z 1Y0VH 2LHLA 4MSPA 5AERA 1CLLA 1QIVA 3BOWB 2HQWA 2LV7A 1RECA 2F3YA 1K2HA 1TRFA 2FCDA 1ZUZA 2I18A 4JQ0D 3DVKA 3HX4A 3GK1A 3SG6A 3BUNB 1DF0A 2ZNEA 5AEQA 1XA5A 5PALA 1NX1A 2CCMA 4PHNA 2TN4A 1OZOA 3EVVA 3KHEA 1YX8A 1VRKA 1S5GZ 1L7ZA 2G2BA 1KFUS 3AAJA 2JT8A 2L5XB 2M9GA 3GK2A 3OX5A 4HREE 5CPVA 3HCMA 4OVNF 3SG2A 1B8CA 3I5FC 1QIWA 2KQYA 1BR1B 3NSKA 1CDNA 2LAPA 1A03A 1PVBA 1DTLA 1IJ5A 1SY9A 2E6WA 2LANA 4DUQA 1RROA 2M0RA 2KBIA 2JU0A 1NX2A 2M7LA 4MVFA 5K89A 5HKWA 4PE7A 3F45A 4MRXA 1OMVA 4NDDA 2KNEA 2F8PA 2IS9A 4QJ4B 2LP2A 1TNXA 3I5HC 1DF0B 3SG4A 1J7RA 2LC5A 5AFPA 1UHKA 1QATA 1B47A 1RFJA 2JXLA 4MZKA 1HT9A 4QJ3B 3EKHA 1AJ5A 1UWOA 4PHJA 2CXJA 2MA2A 4I5NB 1IG5A 1N65A 1CDMA 5J3XA 3KPXA 1KK7Y 1CFCA 1AUIB 3FS7A 4CFQA 2F2PA 3LLEA 4M2QA 1YRTB 4CFRA 1YUTA 1UHHA 4NQGA 3PN7C 5F6TA 4NDCA 2ZKMX 4HRHA 4JWQA 3NSIA 5GQQC 5I8NA 3K21A 1QX7A 1J1EA 4DIRA 4D1EA 2BCXA 3SG3A 1OE9B 2WORA 4GUKA 2H61C 4N5XA 1K93D 1QJTA 2BKHB 1QLSA 2KBMA 2K2FA 3TDIA 3I5IC 1JFJA 1H4BA 1AK8A 1XFZO 1H8BA 1JWDA 3VRPA 4OV2A 2FJUB 1DJWA 1EJ3A 2JQ6A 2JRFA 2Y5IA 3BYAA 1NIWA 3D0YA 1CTRA 2K7OA 1B7TZ 2GGZA 1UUSA 2BKIB 4P5OE 2WOSA 3WNXB 5IBWA 4BY4A 1TNQA 5I2LA 1EXRA 1K90D 5CSFA 1K9KA 3O6BA 1PK0D 1F55A 1IQ5A 2I94A 3TZ1A 2BL0B 2PMYA 1YRUB 1L2OC 2JNXA 2MLEC 4PE4A 1RTP1 3CWGA 2K61A 2M3WA 1YR5A 2EC6B 3EK4A 1X02A 4MN0A 1DMOA 4HSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LP3 A;  3M0W A;  4OCI A;  2LVJ A;  3WXA A;  1B8L A;  1QLK A;  2BE6 A;  3ZNI A;  1NX0 A;  2BCB A;  1B1G A;  2MBX A;  3A8R A;  2WC8 A;  2BCA A;  2Q91 A;  1K95 A;  1SKT A;  3I5H B;  3BUO B;  1MQ1 A;  3E3R A;  3TS5 B;  4WQ3 A;  3D0Y B;  1LXF C;  2KYF A;  1CLB A;  1KFX L;  2K0J A;  4MBE A;  1PSR A;  1SYM A;  5DKQ A;  3OHM B;  3BUM B;  4R1E A;  2LCP A;  2ZND A;  2CT9 A;  1S6C A;  1J7O A;  2WCE A;  1IWQ A;  2K8M B;  3D10 A;  2KYC A;  2LUC A;  2KGB C;  2LVI A;  2KFF A;  3DVJ A;  2K7D A;  2L51 A;  4A4C A;  2GV5 A;  1XK4 A;  3H4S E;  1SL7 A;  2MRD A;  1ZFS A;  3I5G B;  1FW4 A;  4YGB B;  1IH0 A;  2F33 A;  1G33 A;  1GGW A;  1TN4 A;  1TCO B;  1SCM C;  1J7Q A;  3SG5 A;  1XFU O;  1QVI Y;  1R2U A;  2LUX A;  4GGF C;  1AJ4 A;  5B8I B;  1LIN A;  4YGA A;  2BBM A;  3JVT C;  1CFF A;  4XYN A;  1S3P A;  2LVK A;  1SR6 C;  1BOC A;  2OS8 C;  2KI4 C;  2O5G A;  2PVB A;  1NCZ A;  4I5J A;  4BY5 A;  4DCK A;  1MUX A;  2OTG C;  3KF9 A;  4ICB A;  1ZOT B;  1KK8 B;  3AKA A;  4F0Z B;  5D7F A;  1J1D A;  2M1U A;  3VGO A;  2MLF C;  2HF5 A;  1CM4 A;  1XFV O;  1DJG A;  1CM1 A;  1KSM A;  4PAL A;  3SG7 A;  1XO5 A;  3JTD B;  2MAZ A;  4DS7 A;  1NWD A;  2FOT A;  2CBL A;  2JUL A;  3MSE B;  1K96 A;  1DJZ A;  1KQM B;  2JXC A;  4MRY A;  3TUY B;  1KCY A;  3EK7 A;  1B9A A;  1W7I B;  1WDC B;  2PAS A;  4PE0 A;  1XVJ A;  1OSA A;  2JT3 A;  1M31 A;  2WCB A;  1YUS A;  2PAL A;  5I2O A;  4CLN A;  4ORB B;  3IQQ A;  1CDP A;  4PHM A;  3SIA A;  4ETO A;  1SPY A;  2KAY A;  1D1O A;  1TNP A;  5CSN A;  1IQ3 A;  3O2P A;  3LL8 B;  2ZN8 A;  3GOF A;  2O60 A;  5ER5 A;  1JBA A;  1F8H A;  4N1F A;  2PSR A;  1A2X A;  2KQ6 A;  1PAL A;  1GGZ A;  2MJW B;  1BT6 A;  1U5I A;  2NCO A;  3EK8 A;  3OP0 A;  1V1F A;  2L2E A;  1EH2 A;  5D69 A;  2M7N A;  1EG3 A;  2DOQ A;  3BUW B;  3NSL A;  1MR8 A;  4QJ5 B;  1IJ6 A;  1OMD A;  3CTN A;  1MF8 B;  4NDB A;  2OPO A;  3BXK A;  1WRK A;  1YTZ C;  4DRW A;  2FCE A;  3OX6 A;  3CGA A;  1SRA A;  3EKJ A;  3LK0 A;  3PSR A;  1XYD A;  3SJS A;  1KWO C;  1S5G Y;  1YUU A;  3DF0 A;  3IQO A;  1SCM B;  2A4J A;  4WRI A;  1F71 A;  1MXL C;  2F2O A;  4OKH A;  4XJK A;  1IRJ A;  1NCX A;  1S36 A;  4A4B A;  1BOD A;  1PVA A;  2M8U A;  1UHJ A;  2HPS A;  1ALW A;  4CPV A;  3CS1 A;  2I2R E;  4PHK A;  4N1G A;  1U5I B;  1JF2 A;  2Y4Q A;  4MZJ A;  1QV1 A;  2HQ8 A;  5ER4 X;  1XFY O;  4U8D A;  1K94 A;  2KFH A;  2COL B;  2QAC A;  5CSI A;  4YRU A;  2SAS A;  1LKJ A;  1DT7 B;  1AP4 A;  3I5F B;  5JOL A;  1N2D A;  3LCP C;  2H2K A;  3ICB A;  3LK1 A;  1SMG A;  1WLM A;  2KAX A;  2M29 A;  4M2P A;  3O4Y A;  4OR9 B;  1EG4 A;  2WCF A;  4Q04 A;  2JC2 A;  4AQJ A;  4PCW A;  1SW8 A;  3DF0 B;  2R2I A;  1C7V A;  1CFD A;  1K9P A;  1B8R A;  1V1G A;  2H61 A;  5AAN A;  4FQO A;  4XJK B;  1PRW A;  2KOT A;  3CR4 X;  1CNP A;  4PE1 A;  1DJH A;  1RK9 A;  1WLZ A;  2SCP A;  3FWB A;  1FPW A;  2KI6 C;  1DJX A;  2LLT A;  1TIZ A;  2BBN A;  1NPQ A;  1CMG A;  1QX5 B;  1S6J A;  1KFU L;  1NCY A;  1Y1U A;  1G4Y R;  4L9M A;  4GAO A;  3EVR A;  1AVS A;  4CID A;  1A75 A;  4GBA A;  5HLO A;  5CSJ A;  1RJV A;  2HET A;  1DGU A;  3PN7 B;  4YGC B;  2JNF A;  1M63 B;  2NXQ A;  3C1V A;  2Y1N A;  2JTT A;  4AQI A;  2JOJ A;  1LVC D;  1BLQ A;  3DVM A;  5HKZ A;  3EVU A;  3IF7 A;  1JSA A;  1B7T Y;  2L50 A;  4WQ2 A;  2L0P A;  1M39 A;  4ORC B;  1XFW O;  3PAT A;  1G8I A;  2LM5 A;  2M97 A;  3GK4 X;  5TNC A;  3ZWH A;  2D8N A;  2LMT A;  3I5I B;  1QS7 A;  1QXP A;  2L4I A;  1FF1 A;  2M1K B;  3PAL A;  1YUR A;  4USL A;  1OQP A;  1BG1 A;  1JFK A;  1Y1A A;  2LE9 B;  2LMV A;  1NP8 A;  2JPT A;  4GPL B;  1FBV A;  3VRN A;  2Q4U A;  1CFP A;  1A75 B;  2CNP A;  4MLW A;  1UUR A;  1K9U A;  3CLN A;  2MHH A;  1KQV A;  1PUL A;  1J7P A;  1JF0 A;  1L2O B;  1TOP A;  4ZCV A;  4GGN A;  2V53 A;  2NLN A;  1KFX S;  1UHN A;  3KEV A;  2LLU A;  1N0Y A;  1Y1X A;  1CKK A;  3TUY C;  1EL4 A;  2KGR A;  1NYA A;  2JZI A;  4MZL A;  2BEC A;  4UPG A;  4P2Y B;  3VRO A;  1M46 A;  2GGM A;  2KI6 D;  5KU1 A;  4GGF A;  2BL0 C;  5DKR A;  5HYD A;  3TDZ A;  1GQM A;  2L4H A;  2EGD A;  2WND A;  1ZAC A;  2EC6 C;  1UP5 A;  1C7W A;  4C0K A;  3NSO A;  3CR2 A;  5FYX A;  5HLV A;  1HQV A;  2JWW A;  2L98 A;  1QTX A;  4IL1 A;  3AAK A;  1SL8 A;  1GJY A;  2Y1M A;  1FI6 A;  1K8U A;  3FWC A;  1TTX A;  1A4P A;  1OMR A;  1XFX O;  2B1U A;  1SBJ A;  5JJG A;  1TNW A;  2ZRS A;  3BUX B;  4E68 A;  1B4C A;  3QRX A;  2EHB A;  1IKU A;  3TS5 C;  2KHN A;  1C07 A;  4I5K A;  1FI5 A;  4HRG A;  4GFT A;  2E30 A;  1AHR A;  2P6B B;  1F4Q A;  1YVL A;  1ODB A;  1DJY A;  4I5L B;  1BU3 A;  1M45 A;  4MEW A;  5I2Q A;  1F54 A;  1IGV A;  1DVI A;  1PSB A;  2BE4 A;  3AKB A;  2KSP A;  1CLM A;  1NUB A;  3JVT B;  3OB2 B;  4TNC A;  3RM1 A;  2AUC A;  1E8A A;  3CR5 X;  4YBH B;  3WHU B;  1CB1 A;  1SR6 B;  2OS8 B;  1OOJ A;  2KI4 B;  2ZN9 A;  4YGE B;  1YVH A;  3I5G C;  1A29 A;  1Q80 A;  2ISD A;  2AAO A;  3WHT B;  5BPJ A;  1NSH A;  4YI8 A;  1TCF A;  1F70 A;  4ZCU A;  1OZS A;  1ZMZ A;  2F3Z A;  2OTG B;  2M49 B;  3DD4 A;  3KO0 A;  1DGV A;  5G08 A;  1QV0 A;  3DVE A;  1S26 D;  2K7B A;  1R6P A;  2ZFD A;  3SIB A;  2KAV A;  1MWN A;  1QX2 A;  1SL9 A;  1KSO A;  1WRL A;  2LNK A;  4PDZ A;  2NCP A;  2JT0 A;  2ZRT A;  2QPT A;  1MHO A;  5AXI A;  2LHI A;  4ORA B;  1LA0 A;  2I7A A;  3VRR A;  1CMF A;  1SNL A;  1W7J B;  1QVI Z;  2K7C A;  3FIA A;  1BR4 B;  1SK6 D;  4M2O A;  3TDU A;  1KK8 C;  3CZT X;  3VRQ A;  2RGI A;  2NZ0 A;  2LVV A;  1YX7 A;  2VRG A;  3JTD C;  3O78 A;  1RWY A;  1QAS A;  1KQM C;  1XK4 C;  1WRZ A;  1WDC C;  1CDL A;  1LA3 A;  1Y6W A;  3PLF B;  1ALV A;  2K2A A;  2G9B A;  3BOW A;  1DJI A;  3NXA A;  2PRU A;  4AOM A;  1J55 A;  4GNK B;  3PM8 A;  3BQ3 A;  1SCV A;  2AMI A;  1BJF A;  1UHI A;  5KTY A;  3PFV A;  3RLZ A;  1S1E A;  4YGD B;  2CTN A;  1JC2 A;  1KWO B;  1BF5 A;  5DKN A;  2JTZ A;  1JUO A;  1S6I A;  2LMU A;  3A4U B;  4YI9 A;  1NX3 A;  3OB1 B;  1BMO A;  2KFG A;  5HKY A;  1MXE A;  1WY9 A;  2LLS A;  4C0J A;  4C0L A;  5KSZ A;  2KDH A;  4JPZ B;  4FTG A;  1F4O A;  1KK7 Z;  1Y0V H;  2LHL A;  4MSP A;  5AER A;  1CLL A;  1QIV A;  3BOW B;  2HQW A;  2LV7 A;  1REC A;  2F3Y A;  1K2H A;  1TRF A;  2FCD A;  1ZUZ A;  2I18 A;  4JQ0 D;  3DVK A;  3HX4 A;  3GK1 A;  3SG6 A;  3BUN B;  1DF0 A;  2ZNE A;  5AEQ A;  1XA5 A;  5PAL A;  1NX1 A;  2CCM A;  4PHN A;  2TN4 A;  1OZO A;  3EVV A;  3KHE A;  1YX8 A;  1VRK A;  1S5G Z;  1L7Z A;  2G2B A;  1KFU S;  3AAJ A;  2JT8 A;  2L5X B;  2M9G A;  3GK2 A;  3OX5 A;  4HRE E;  5CPV A;  3HCM A;  4OVN F;  3SG2 A;  1B8C A;  3I5F C;  1QIW A;  2KQY A;  1BR1 B;  3NSK A;  1CDN A;  2LAP A;  1A03 A;  1PVB A;  1DTL A;  1IJ5 A;  1SY9 A;  2E6W A;  2LAN A;  4DUQ A;  1RRO A;  2M0R A;  2KBI A;  2JU0 A;  1NX2 A;  2M7L A;  4MVF A;  5K89 A;  5HKW A;  4PE7 A;  3F45 A;  4MRX A;  1OMV A;  4NDD A;  2KNE A;  2F8P A;  2IS9 A;  4QJ4 B;  2LP2 A;  1TNX A;  3I5H C;  1DF0 B;  3SG4 A;  1J7R A;  2LC5 A;  5AFP A;  1UHK A;  1QAT A;  1B47 A;  1RFJ A;  2JXL A;  4MZK A;  1HT9 A;  4QJ3 B;  3EKH A;  1AJ5 A;  1UWO A;  4PHJ A;  2CXJ A;  2MA2 A;  4I5N B;  1IG5 A;  1N65 A;  1CDM A;  5J3X A;  3KPX A;  1KK7 Y;  1CFC A;  1AUI B;  3FS7 A;  4CFQ A;  2F2P A;  3LLE A;  4M2Q A;  1YRT B;  4CFR A;  1YUT A;  1UHH A;  4NQG A;  3PN7 C;  5F6T A;  4NDC A;  2ZKM X;  4HRH A;  4JWQ A;  3NSI A;  5GQQ C;  5I8N A;  3K21 A;  1QX7 A;  1J1E A;  4DIR A;  4D1E A;  2BCX A;  3SG3 A;  1OE9 B;  2WOR A;  4GUK A;  2H61 C;  4N5X A;  1K93 D;  1QJT A;  2BKH B;  1QLS A;  2KBM A;  2K2F A;  3TDI A;  3I5I C;  1JFJ A;  1H4B A;  1AK8 A;  1XFZ O;  1H8B A;  1JWD A;  3VRP A;  4OV2 A;  2FJU B;  1DJW A;  1EJ3 A;  2JQ6 A;  2JRF A;  2Y5I A;  3BYA A;  1NIW A;  3D0Y A;  1CTR A;  2K7O A;  1B7T Z;  2GGZ A;  1UUS A;  2BKI B;  4P5O E;  2WOS A;  3WNX B;  5IBW A;  4BY4 A;  1TNQ A;  5I2L A;  1EXR A;  1K90 D;  5CSF A;  1K9K A;  3O6B A;  1PK0 D;  1F55 A;  1IQ5 A;  2I94 A;  3TZ1 A;  2BL0 B;  2PMY A;  1YRU B;  1L2O C;  2JNX A;  2MLE C;  4PE4 A;  1RTP 1;  3CWG A;  2K61 A;  2M3W A;  1YR5 A;  2EC6 B;  3EK4 A;  1X02 A;  4MN0 A;  1DMO A;  4HSZ A; 
#chains in the Genus database with same CATH topology
 2LP3 A;  3M0W A;  4OCI A;  2LVJ A;  4KYN A;  1B8L A;  3WXA A;  1QLK A;  2BE6 A;  3SS3 A;  3ZNI A;  1NX0 A;  2BCB A;  1B1G A;  2MBX A;  3A8R A;  2WC8 A;  2BCA A;  4IJ7 A;  2Q91 A;  1K95 A;  1SKT A;  3I5H B;  3BUO B;  1MQ1 A;  3E3R A;  3TS5 B;  4WQ3 A;  3D0Y B;  1LXF C;  2KYF A;  1CLB A;  1KFX L;  2K0J A;  4MBE A;  1PSR A;  1SYM A;  5DKQ A;  3OHM B;  3BUM B;  2WC5 A;  2LCP A;  2ZND A;  2CT9 A;  4R1E A;  1S6C A;  1J7O A;  1OOG A;  3UNW A;  2WCE A;  1IWQ A;  2K8M B;  3D10 A;  2KYC A;  2LUC A;  2KGB C;  2LVI A;  2KFF A;  3DVJ A;  2K7D A;  1OOF A;  2L51 A;  4A4C A;  2GV5 A;  1XK4 A;  3H4S E;  1SL7 A;  2MRD A;  1ZFS A;  3I5G B;  1FW4 A;  2WCM A;  1TWO A;  4YGB B;  2F33 A;  1G33 A;  1GGW A;  1TN4 A;  1TCO B;  1IH0 A;  1SCM C;  1J7Q A;  3CDN A;  3SG5 A;  1XFU O;  1QVI Y;  1R2U A;  2LUX A;  3D76 A;  1AJ4 A;  4GGF C;  5B8I B;  3L4L A;  1LIN A;  4YGA A;  2BBM A;  3JVT C;  3IVT A;  1CFF A;  4XYN A;  1S3P A;  2LVK A;  1SR6 C;  1BOC A;  2OS8 C;  2QDI A;  2KI4 C;  2O5G A;  2PVB A;  3B88 A;  2BAP A;  1NCZ A;  4I5J A;  4BY5 A;  4DCK A;  1MUX A;  3D77 A;  2OTG C;  3KF9 A;  4ICB A;  1ZOT B;  1KK8 B;  3AKA A;  4F0Z B;  5D7F A;  1J1D A;  2M1U A;  3VGO A;  2MLF C;  2HF5 A;  1CM4 A;  3R1V A;  1XFV O;  1DJG A;  1CM1 A;  1KSM A;  4PAL A;  3SG7 A;  1XO5 A;  3JTD B;  2MAZ A;  4DS7 A;  1DC1 A;  1NWD A;  2FOT A;  2CBL A;  2JUL A;  3MSE B;  1K96 A;  1DJZ A;  1KQM B;  2JXC A;  4MRY A;  2JPO A;  3TUY B;  1KCY A;  3EK7 A;  1B9A A;  1W7I B;  1WDC B;  2PAS A;  4PE0 A;  1XVJ A;  1OSA A;  2JT3 A;  1M31 A;  2WCB A;  1YUS A;  2PAL A;  5I2O A;  4CLN A;  4ORB B;  3IQQ A;  1CDP A;  4PHM A;  3SIA A;  4ETO A;  1SPY A;  2KAY A;  1D1O A;  1TNP A;  5CSN A;  1IQ3 A;  3O2P A;  3LL8 B;  2ZN8 A;  3GOF A;  2O60 A;  5ER5 A;  1JBA A;  1F8H A;  3S0F A;  4N1F A;  2PSR A;  1A2X A;  2KQ6 A;  1PAL A;  1GGZ A;  2MJW B;  1BT6 A;  1U5I A;  2NCO A;  3EK8 A;  3N7H A;  1V1F A;  2L2E A;  3O4X A;  3QME A;  5D69 A;  1EH2 A;  2M7N A;  1EG3 A;  2DOQ A;  1W9Z A;  3BUW B;  3NSL A;  1MR8 A;  4QJ5 B;  1IJ6 A;  1OMD A;  3CTN A;  1MF8 B;  4NDB A;  2OPO A;  3B87 A;  1WRK A;  3BXK A;  1YTZ C;  4DRW A;  2FCE A;  3OX6 A;  3CGA A;  1SRA A;  3EKJ A;  3LK0 A;  3PSR A;  3R1P A;  1XYD A;  1OOH A;  3SJS A;  1KWO C;  1S5G Y;  2PYQ A;  1YUU A;  3DF0 A;  3IQO A;  2H8V A;  1SCM B;  2A4J A;  4WRI A;  1F71 A;  1MXL C;  2F2O A;  4OKH A;  4XJK A;  1IRJ A;  1NCX A;  1S36 A;  4A4B A;  1BOD A;  1PVA A;  2M8U A;  1UHJ A;  2HPS A;  1ALW A;  5I94 A;  4CPV A;  3CS1 A;  2I2R E;  4PHK A;  4N1G A;  1U5I B;  1JF2 A;  2Y4Q A;  4MZJ A;  1QV1 A;  2HQ8 A;  2QEO A;  5ER4 X;  1XFY O;  4U8D A;  1K94 A;  2KFH A;  2COL B;  2QAC A;  5CSI A;  2BNX A;  2SAS A;  1LKJ A;  4YRU A;  1DT7 B;  1AP4 A;  3I5F B;  5JOL A;  1N2D A;  3DZT A;  3LCP C;  2H2K A;  3ICB A;  3LK1 A;  1SMG A;  1WLM A;  2KAX A;  2M29 A;  4M2P A;  3O4Y A;  4OR9 B;  1EG4 A;  2WCF A;  2P71 A;  4Q04 A;  2JC2 A;  4AQJ A;  4PCW A;  1SW8 A;  1XFR A;  3DF0 B;  1C3Z A;  2R2I A;  1C7V A;  1CFD A;  1K9P A;  1B8R A;  1V1G A;  2H61 A;  5AAN A;  4FQO A;  4XJK B;  1PRW A;  2KOT A;  3CR4 X;  1CNP A;  4PE1 A;  1DEL A;  1DJH A;  1RK9 A;  1WLZ A;  2SCP A;  3FWB A;  1FPW A;  3FE8 A;  2KI6 C;  1DJX A;  2LLT A;  2YGU A;  4PT1 A;  1TIZ A;  3FE9 A;  2BBN A;  1NPQ A;  3NGV A;  1CMG A;  1QX5 B;  1S6J A;  1KFU L;  1NCY A;  1Y1U A;  3EG5 B;  1G4Y R;  4L9M A;  4GAO A;  3EVR A;  1AVS A;  4CID A;  1A75 A;  3OBV A;  4GBA A;  5HLO A;  5CSJ A;  3CYZ A;  1RJV A;  2HET A;  1DGU A;  3PN7 B;  4YGC B;  2JNF A;  1M63 B;  2NXQ A;  3B86 A;  2Y1N A;  2JTT A;  3C1V A;  4AQI A;  2JOJ A;  1LVC D;  1BLQ A;  3DVM A;  2FJY A;  5HKZ A;  3EVU A;  3IF7 A;  1JSA A;  1B7T Y;  2L50 A;  4WQ2 A;  2L0P A;  1ORG A;  1M39 A;  4ORC B;  1XFW O;  3D78 A;  3BFB A;  3PAT A;  1G8I A;  2LM5 A;  2M97 A;  3GK4 X;  5TNC A;  3ZWH A;  2D8N A;  2LMT A;  2PQL A;  5DIC A;  3I5I B;  1QS7 A;  1QXP A;  2L4I A;  3S0D A;  1FF1 A;  4INW A;  2M1K B;  3PAL A;  1YUR A;  4USL A;  1OQP A;  1SSE B;  1BG1 A;  1JFK A;  1Y1A A;  2LE9 B;  2LMV A;  1NP8 A;  4FQT A;  2JPT A;  4GPL B;  3NHT A;  1FBV A;  3VRN A;  2Q4U A;  1CFP A;  3K1E A;  1TUZ A;  1A75 B;  2CNP A;  2QEV A;  4MLW A;  5FI2 A;  1UUR A;  1K9U A;  3CLN A;  2MHH A;  1KQV A;  1PUL A;  1J7P A;  1JF0 A;  1L2O B;  1TOP A;  4ZCV A;  1C3Y A;  4OZD A;  3OP0 A;  4GGN A;  2V53 A;  2NLN A;  1KFX S;  1UHN A;  3KEV A;  2LLU A;  1N0Y A;  1Y1X A;  1CKK A;  3TUY C;  1EL4 A;  2KGR A;  5FI6 A;  1NYA A;  2JZI A;  4MZL A;  2BEC A;  4UPG A;  4P2Y B;  2KLD A;  3VRO A;  1M46 A;  2GGM A;  2KI6 D;  5KU1 A;  4GGF A;  2BL0 C;  3UO9 A;  5DKR A;  5HYD A;  3TDZ A;  1GQM A;  2L4H A;  2EGD A;  2WND A;  1ZAC A;  2EC6 C;  1UP5 A;  1C7W A;  3D74 A;  4C0K A;  2P70 A;  2WC6 A;  5EL2 A;  3NSO A;  3CR2 A;  5FYX A;  5HLV A;  1HQV A;  2JWW A;  2L98 A;  1QTX A;  4IL1 A;  3AAK A;  1SL8 A;  1GJY A;  2Y1M A;  1FI6 A;  1K8U A;  3FWC A;  1TTX A;  4F7F A;  1A4P A;  1OMR A;  1XFX O;  2B1U A;  3PM2 A;  1SBJ A;  5JJG A;  1TNW A;  2ZRS A;  3BUX B;  4E68 A;  1B4C A;  3QRX A;  2EHB A;  1LS8 A;  3TS5 C;  1IKU A;  2KHN A;  1C07 A;  4I5K A;  1FI5 A;  4HRG A;  4GFT A;  2E30 A;  1AHR A;  3NHI A;  3SS4 A;  2P6B B;  1F4Q A;  1YVL A;  1ODB A;  1DJY A;  4I5L B;  1BU3 A;  1M45 A;  4MEW A;  5I2Q A;  1F54 A;  1IGV A;  1DVI A;  1PSB A;  2BE4 A;  3AKB A;  2KSP A;  1CLM A;  2QEB A;  1NUB A;  3B7A A;  3JVT B;  3OB2 B;  4TNC A;  3RM1 A;  2AUC A;  1E8A A;  3CR5 X;  4YBH B;  3WHU B;  1CB1 A;  1SR6 B;  2OS8 B;  1OOJ A;  2KI4 B;  2ZN9 A;  4YGE B;  1YVH A;  4INX A;  3I5G C;  1A29 A;  1Q80 A;  2ISD A;  2AAO A;  3WHT B;  5BPJ A;  1NSH A;  1GM0 A;  4YI8 A;  1TCF A;  1F70 A;  4ZCU A;  1OZS A;  1ZMZ A;  1DQE A;  2F3Z A;  2OTG B;  2M49 B;  3DD4 A;  3KO0 A;  5HL1 A;  1DGV A;  3CZ0 A;  5G08 A;  1QV0 A;  3DVE A;  1S26 D;  2K7B A;  1R6P A;  2ZFD A;  3SIB A;  2KLE A;  2KAV A;  1MWN A;  3R72 A;  1QX2 A;  1SL9 A;  1KSO A;  1WRL A;  2LNK A;  4PDZ A;  2NCP A;  2JT0 A;  2ZRT A;  2QPT A;  1MHO A;  5AXI A;  2LHI A;  4ORA B;  1LA0 A;  2I7A A;  3VRR A;  1CMF A;  1SNL A;  1W7J B;  1QVI Z;  2K7C A;  3FIA A;  1BR4 B;  1SK6 D;  4M2O A;  3TDU A;  1KK8 C;  3CZT X;  3VRQ A;  2RGI A;  2NZ0 A;  2LVV A;  2L2C A;  1DEK A;  2L5Y A;  1YX7 A;  2VRG A;  3JTD C;  3O78 A;  1RWY A;  1QAS A;  1KQM C;  1XK4 C;  3RZS A;  1WRZ A;  1WDC C;  2WCJ A;  1CDL A;  1LA3 A;  1T14 A;  1Y6W A;  3PLF B;  1ALV A;  2K2A A;  2G9B A;  3BOW A;  1DJI A;  3NXA A;  2PRU A;  4AOM A;  1J55 A;  4GNK B;  3PM8 A;  3BQ3 A;  1SCV A;  2AMI A;  1BJF A;  2WCH A;  1UHI A;  3DY9 A;  5KTY A;  3PFV A;  3PJI A;  3RLZ A;  3D73 A;  1S1E A;  4YGD B;  2CTN A;  1JC2 A;  1KWO B;  3D75 A;  5DKN A;  2JTZ A;  1JUO A;  1S6I A;  1BF5 A;  2LMU A;  3A4U B;  4YI9 A;  3S0B A;  1NX3 A;  3OB1 B;  1BMO A;  2KFG A;  3VB1 A;  5HKY A;  1MXE A;  1WY9 A;  2LLS A;  4C0J A;  4C0L A;  5KSZ A;  1TUJ A;  2KDH A;  4JD9 A;  4JPZ B;  4FTG A;  1F4O A;  1KK7 Z;  1Y0V H;  2LHL A;  4MSP A;  5AER A;  1CLL A;  1QIV A;  3BOW B;  2HQW A;  2LV7 A;  3OGN A;  1REC A;  2WCK A;  3DXL A;  2F3Y A;  1K2H A;  1TRF A;  2FCD A;  1ZUZ A;  2I18 A;  4JQ0 D;  3DVK A;  3HX4 A;  3BJH A;  3GK1 A;  1IIO A;  3SG6 A;  3BUN B;  1DF0 A;  2ZNE A;  3CZ1 A;  5AEQ A;  5FI7 A;  1XA5 A;  5PAL A;  1NX1 A;  2CCM A;  4PHN A;  2TN4 A;  1OZO A;  3EVV A;  3KHE A;  1YX8 A;  1VRK A;  1S5G Z;  1L7Z A;  1QWV A;  1KFU S;  2G2B A;  2JT8 A;  2L5X B;  2M9G A;  3AAJ A;  3CZ2 A;  3GK2 A;  3OX5 A;  4HRE E;  5CPV A;  3S0A A;  3HCM A;  3CAB A;  4OVN F;  3SG2 A;  2QEH A;  3SS5 A;  1B8C A;  3I5F C;  3S0E A;  1QIW A;  2KQY A;  1BR1 B;  3NSK A;  1CDN A;  1Z2C B;  2LAP A;  1A03 A;  1PVB A;  1DTL A;  1IJ5 A;  1SY9 A;  2E6W A;  2LAN A;  4DUQ A;  1RRO A;  2M0R A;  2KBI A;  2JU0 A;  1NX2 A;  2M7L A;  4MVF A;  5K89 A;  5HKW A;  4PE7 A;  3F45 A;  4MRX A;  1OMV A;  4NDD A;  2KNE A;  2WCL A;  4JKT A;  2F8P A;  2IS9 A;  4QJ4 B;  2LP2 A;  1TNX A;  3B6X A;  3I5H C;  5D3O A;  1DF0 B;  3SG4 A;  1J7R A;  2LC5 A;  5AFP A;  1UHK A;  1QAT A;  1B47 A;  1RFJ A;  2JXL A;  4MZK A;  1HT9 A;  4QJ3 B;  3EKH A;  1AJ5 A;  1UWO A;  3FE6 A;  4PHJ A;  2CXJ A;  2MA2 A;  4I5N B;  1IG5 A;  1N65 A;  1CDM A;  5J3X A;  3KPX A;  1KK7 Y;  1CFC A;  1AUI B;  3FS7 A;  4CFQ A;  2F2P A;  3LLE A;  4M2Q A;  1YRT B;  4CFR A;  1YUT A;  1UHH A;  4NQG A;  3PN7 C;  5F6T A;  4NDC A;  2ZKM X;  4HRH A;  4JWQ A;  3NSI A;  5GQQ C;  3Q8I A;  3R1O A;  5I8N A;  3K21 A;  1QX7 A;  3S0G A;  3V2L A;  1Z4H A;  1OOI X;  1J1E A;  3L47 A;  4DIR A;  4D1E A;  2BCX A;  3SG3 A;  1OE9 B;  2WOR A;  4GUK A;  2H61 C;  4N5X A;  2ERB A;  1K93 D;  1QJT A;  2BKH B;  1QLS A;  2KBM A;  1P28 A;  2K2F A;  3TDI A;  3I5I C;  1JFJ A;  1H4B A;  1AK8 A;  1XFZ O;  1H8B A;  1JWD A;  3VRP A;  4OV2 A;  2FJU B;  1DJW A;  1EJ3 A;  2JQ6 A;  2JRF A;  2Y5I A;  3BYA A;  1NIW A;  3D0Y A;  1CTR A;  2K7O A;  1B7T Z;  3L4A A;  2GGZ A;  1UUS A;  2BKI B;  2K60 A;  2WOS A;  4P5O E;  3WNX B;  5IBW A;  4BY4 A;  1TNQ A;  3BFA A;  5I2L A;  1EXR A;  1K90 D;  5CSF A;  1K9K A;  3O6B A;  1PK0 D;  1F55 A;  1IQ5 A;  2I94 A;  3TZ1 A;  2BL0 B;  2PMY A;  1YRU B;  1L2O C;  2JNX A;  2MLE C;  2KPH A;  4PE4 A;  3BFH A;  1RTP 1;  3CWG A;  1OW4 A;  2K61 A;  2M3W A;  1YR5 A;  2EC6 B;  3DYE A;  3EK4 A;  1X02 A;  4MN0 A;  2GTE A;  1DMO A;  4HSZ A; 
#chains in the Genus database with same CATH homology
 2LP3 A;  3M0W A;  4OCI A;  2LVJ A;  3WXA A;  1B8L A;  1QLK A;  2BE6 A;  3ZNI A;  1NX0 A;  2BCB A;  1B1G A;  2MBX A;  3A8R A;  2WC8 A;  2BCA A;  2Q91 A;  1K95 A;  1SKT A;  3I5H B;  3BUO B;  1MQ1 A;  3E3R A;  3TS5 B;  4WQ3 A;  3D0Y B;  1LXF C;  2KYF A;  1CLB A;  1KFX L;  2K0J A;  4MBE A;  1PSR A;  1SYM A;  5DKQ A;  3OHM B;  3BUM B;  4R1E A;  2LCP A;  2ZND A;  2CT9 A;  1S6C A;  1J7O A;  2WCE A;  1IWQ A;  2K8M B;  3D10 A;  2KYC A;  2LUC A;  2KGB C;  2LVI A;  2KFF A;  3DVJ A;  2K7D A;  2L51 A;  4A4C A;  2GV5 A;  1XK4 A;  3H4S E;  1SL7 A;  2MRD A;  1ZFS A;  3I5G B;  1FW4 A;  4YGB B;  1IH0 A;  2F33 A;  1G33 A;  1GGW A;  1TN4 A;  1TCO B;  1SCM C;  1J7Q A;  3SG5 A;  1XFU O;  1QVI Y;  1R2U A;  2LUX A;  4GGF C;  1AJ4 A;  5B8I B;  1LIN A;  4YGA A;  2BBM A;  3JVT C;  1CFF A;  4XYN A;  1S3P A;  2LVK A;  1SR6 C;  1BOC A;  2OS8 C;  2KI4 C;  2O5G A;  2PVB A;  1NCZ A;  4I5J A;  4BY5 A;  4DCK A;  1MUX A;  2OTG C;  3KF9 A;  4ICB A;  1ZOT B;  1KK8 B;  3AKA A;  4F0Z B;  5D7F A;  1J1D A;  2M1U A;  3VGO A;  2MLF C;  2HF5 A;  1CM4 A;  1XFV O;  1DJG A;  1CM1 A;  1KSM A;  4PAL A;  3SG7 A;  1XO5 A;  3JTD B;  2MAZ A;  4DS7 A;  1NWD A;  2FOT A;  2CBL A;  2JUL A;  3MSE B;  1K96 A;  1DJZ A;  1KQM B;  2JXC A;  4MRY A;  3TUY B;  1KCY A;  3EK7 A;  1B9A A;  1W7I B;  1WDC B;  2PAS A;  4PE0 A;  1XVJ A;  1OSA A;  2JT3 A;  1M31 A;  2WCB A;  1YUS A;  2PAL A;  5I2O A;  4CLN A;  4ORB B;  3IQQ A;  1CDP A;  4PHM A;  3SIA A;  4ETO A;  1SPY A;  2KAY A;  1D1O A;  1TNP A;  5CSN A;  1IQ3 A;  3O2P A;  3LL8 B;  2ZN8 A;  3GOF A;  2O60 A;  5ER5 A;  1JBA A;  1F8H A;  4N1F A;  2PSR A;  1A2X A;  2KQ6 A;  1PAL A;  1GGZ A;  2MJW B;  1BT6 A;  1U5I A;  2NCO A;  3EK8 A;  3OP0 A;  1V1F A;  2L2E A;  1EH2 A;  5D69 A;  2M7N A;  1EG3 A;  2DOQ A;  3BUW B;  3NSL A;  1MR8 A;  4QJ5 B;  1IJ6 A;  1OMD A;  3CTN A;  1MF8 B;  4NDB A;  2OPO A;  3BXK A;  1WRK A;  1YTZ C;  4DRW A;  2FCE A;  3OX6 A;  3CGA A;  1SRA A;  3EKJ A;  3LK0 A;  3PSR A;  1XYD A;  3SJS A;  1KWO C;  1S5G Y;  1YUU A;  3DF0 A;  3IQO A;  1SCM B;  2A4J A;  4WRI A;  1F71 A;  1MXL C;  2F2O A;  4OKH A;  4XJK A;  1IRJ A;  1NCX A;  1S36 A;  4A4B A;  1BOD A;  1PVA A;  2M8U A;  1UHJ A;  2HPS A;  1ALW A;  4CPV A;  3CS1 A;  2I2R E;  4PHK A;  4N1G A;  1U5I B;  1JF2 A;  2Y4Q A;  4MZJ A;  1QV1 A;  2HQ8 A;  5ER4 X;  1XFY O;  4U8D A;  1K94 A;  2KFH A;  2COL B;  2QAC A;  5CSI A;  4YRU A;  2SAS A;  1LKJ A;  1DT7 B;  1AP4 A;  3I5F B;  5JOL A;  1N2D A;  3LCP C;  2H2K A;  3ICB A;  3LK1 A;  1SMG A;  1WLM A;  2KAX A;  2M29 A;  4M2P A;  3O4Y A;  4OR9 B;  1EG4 A;  2WCF A;  4Q04 A;  2JC2 A;  4AQJ A;  4PCW A;  1SW8 A;  3DF0 B;  2R2I A;  1C7V A;  1CFD A;  1K9P A;  1B8R A;  1V1G A;  2H61 A;  5AAN A;  4FQO A;  4XJK B;  1PRW A;  2KOT A;  3CR4 X;  1CNP A;  4PE1 A;  1DJH A;  1RK9 A;  1WLZ A;  2SCP A;  3FWB A;  1FPW A;  2KI6 C;  1DJX A;  2LLT A;  1TIZ A;  2BBN A;  1NPQ A;  1CMG A;  1QX5 B;  1S6J A;  1KFU L;  1NCY A;  1Y1U A;  1G4Y R;  4L9M A;  4GAO A;  3EVR A;  1AVS A;  4CID A;  1A75 A;  4GBA A;  5HLO A;  5CSJ A;  1RJV A;  2HET A;  1DGU A;  3PN7 B;  4YGC B;  2JNF A;  1M63 B;  2NXQ A;  3C1V A;  2Y1N A;  2JTT A;  4AQI A;  2JOJ A;  1LVC D;  1BLQ A;  3DVM A;  5HKZ A;  3EVU A;  3IF7 A;  1JSA A;  1B7T Y;  2L50 A;  4WQ2 A;  2L0P A;  1M39 A;  4ORC B;  1XFW O;  3PAT A;  1G8I A;  2LM5 A;  2M97 A;  3GK4 X;  5TNC A;  3ZWH A;  2D8N A;  2LMT A;  3I5I B;  1QS7 A;  1QXP A;  2L4I A;  1FF1 A;  2M1K B;  3PAL A;  1YUR A;  4USL A;  1OQP A;  1BG1 A;  1JFK A;  1Y1A A;  2LE9 B;  2LMV A;  1NP8 A;  2JPT A;  4GPL B;  1FBV A;  3VRN A;  2Q4U A;  1CFP A;  1A75 B;  2CNP A;  4MLW A;  1UUR A;  1K9U A;  3CLN A;  2MHH A;  1KQV A;  1PUL A;  1J7P A;  1JF0 A;  1L2O B;  1TOP A;  4ZCV A;  4GGN A;  2V53 A;  2NLN A;  1KFX S;  1UHN A;  3KEV A;  2LLU A;  1N0Y A;  1Y1X A;  1CKK A;  3TUY C;  1EL4 A;  2KGR A;  1NYA A;  2JZI A;  4MZL A;  2BEC A;  4UPG A;  4P2Y B;  3VRO A;  1M46 A;  2GGM A;  2KI6 D;  5KU1 A;  4GGF A;  2BL0 C;  5DKR A;  5HYD A;  3TDZ A;  1GQM A;  2L4H A;  2EGD A;  2WND A;  1ZAC A;  2EC6 C;  1UP5 A;  1C7W A;  4C0K A;  3NSO A;  3CR2 A;  5FYX A;  5HLV A;  1HQV A;  2JWW A;  2L98 A;  1QTX A;  4IL1 A;  3AAK A;  1SL8 A;  1GJY A;  2Y1M A;  1FI6 A;  1K8U A;  3FWC A;  1TTX A;  1A4P A;  1OMR A;  1XFX O;  2B1U A;  1SBJ A;  5JJG A;  1TNW A;  2ZRS A;  3BUX B;  4E68 A;  1B4C A;  3QRX A;  2EHB A;  1IKU A;  3TS5 C;  2KHN A;  1C07 A;  4I5K A;  1FI5 A;  4HRG A;  4GFT A;  2E30 A;  1AHR A;  2P6B B;  1F4Q A;  1YVL A;  1ODB A;  1DJY A;  4I5L B;  1BU3 A;  1M45 A;  4MEW A;  5I2Q A;  1F54 A;  1IGV A;  1DVI A;  1PSB A;  2BE4 A;  3AKB A;  2KSP A;  1CLM A;  1NUB A;  3JVT B;  3OB2 B;  4TNC A;  3RM1 A;  2AUC A;  1E8A A;  3CR5 X;  4YBH B;  3WHU B;  1CB1 A;  1SR6 B;  2OS8 B;  1OOJ A;  2KI4 B;  2ZN9 A;  4YGE B;  1YVH A;  3I5G C;  1A29 A;  1Q80 A;  2ISD A;  2AAO A;  3WHT B;  5BPJ A;  1NSH A;  4YI8 A;  1TCF A;  1F70 A;  4ZCU A;  1OZS A;  1ZMZ A;  2F3Z A;  2OTG B;  2M49 B;  3DD4 A;  3KO0 A;  1DGV A;  5G08 A;  1QV0 A;  3DVE A;  1S26 D;  2K7B A;  1R6P A;  2ZFD A;  3SIB A;  2KAV A;  1MWN A;  1QX2 A;  1SL9 A;  1KSO A;  1WRL A;  2LNK A;  4PDZ A;  2NCP A;  2JT0 A;  2ZRT A;  2QPT A;  1MHO A;  5AXI A;  2LHI A;  4ORA B;  1LA0 A;  2I7A A;  3VRR A;  1CMF A;  1SNL A;  1W7J B;  1QVI Z;  2K7C A;  3FIA A;  1BR4 B;  1SK6 D;  4M2O A;  3TDU A;  1KK8 C;  3CZT X;  3VRQ A;  2RGI A;  2NZ0 A;  2LVV A;  1YX7 A;  2VRG A;  3JTD C;  3O78 A;  1RWY A;  1QAS A;  1KQM C;  1XK4 C;  1WRZ A;  1WDC C;  1CDL A;  1LA3 A;  1Y6W A;  3PLF B;  1ALV A;  2K2A A;  2G9B A;  3BOW A;  1DJI A;  3NXA A;  2PRU A;  4AOM A;  1J55 A;  4GNK B;  3PM8 A;  3BQ3 A;  1SCV A;  2AMI A;  1BJF A;  1UHI A;  5KTY A;  3PFV A;  3RLZ A;  1S1E A;  4YGD B;  2CTN A;  1JC2 A;  1KWO B;  1BF5 A;  5DKN A;  2JTZ A;  1JUO A;  1S6I A;  2LMU A;  3A4U B;  4YI9 A;  1NX3 A;  3OB1 B;  1BMO A;  2KFG A;  5HKY A;  1MXE A;  1WY9 A;  2LLS A;  4C0J A;  4C0L A;  5KSZ A;  2KDH A;  4JPZ B;  4FTG A;  1F4O A;  1KK7 Z;  1Y0V H;  2LHL A;  4MSP A;  5AER A;  1CLL A;  1QIV A;  3BOW B;  2HQW A;  2LV7 A;  1REC A;  2F3Y A;  1K2H A;  1TRF A;  2FCD A;  1ZUZ A;  2I18 A;  4JQ0 D;  3DVK A;  3HX4 A;  3GK1 A;  3SG6 A;  3BUN B;  1DF0 A;  2ZNE A;  5AEQ A;  1XA5 A;  5PAL A;  1NX1 A;  2CCM A;  4PHN A;  2TN4 A;  1OZO A;  3EVV A;  3KHE A;  1YX8 A;  1VRK A;  1S5G Z;  1L7Z A;  2G2B A;  1KFU S;  3AAJ A;  2JT8 A;  2L5X B;  2M9G A;  3GK2 A;  3OX5 A;  4HRE E;  5CPV A;  3HCM A;  4OVN F;  3SG2 A;  1B8C A;  3I5F C;  1QIW A;  2KQY A;  1BR1 B;  3NSK A;  1CDN A;  2LAP A;  1A03 A;  1PVB A;  1DTL A;  1IJ5 A;  1SY9 A;  2E6W A;  2LAN A;  4DUQ A;  1RRO A;  2M0R A;  2KBI A;  2JU0 A;  1NX2 A;  2M7L A;  4MVF A;  5K89 A;  5HKW A;  4PE7 A;  3F45 A;  4MRX A;  1OMV A;  4NDD A;  2KNE A;  2F8P A;  2IS9 A;  4QJ4 B;  2LP2 A;  1TNX A;  3I5H C;  1DF0 B;  3SG4 A;  1J7R A;  2LC5 A;  5AFP A;  1UHK A;  1QAT A;  1B47 A;  1RFJ A;  2JXL A;  4MZK A;  1HT9 A;  4QJ3 B;  3EKH A;  1AJ5 A;  1UWO A;  4PHJ A;  2CXJ A;  2MA2 A;  4I5N B;  1IG5 A;  1N65 A;  1CDM A;  5J3X A;  3KPX A;  1KK7 Y;  1CFC A;  1AUI B;  3FS7 A;  4CFQ A;  2F2P A;  3LLE A;  4M2Q A;  1YRT B;  4CFR A;  1YUT A;  1UHH A;  4NQG A;  3PN7 C;  5F6T A;  4NDC A;  2ZKM X;  4HRH A;  4JWQ A;  3NSI A;  5GQQ C;  5I8N A;  3K21 A;  1QX7 A;  1J1E A;  4DIR A;  4D1E A;  2BCX A;  3SG3 A;  1OE9 B;  2WOR A;  4GUK A;  2H61 C;  4N5X A;  1K93 D;  1QJT A;  2BKH B;  1QLS A;  2KBM A;  2K2F A;  3TDI A;  3I5I C;  1JFJ A;  1H4B A;  1AK8 A;  1XFZ O;  1H8B A;  1JWD A;  3VRP A;  4OV2 A;  2FJU B;  1DJW A;  1EJ3 A;  2JQ6 A;  2JRF A;  2Y5I A;  3BYA A;  1NIW A;  3D0Y A;  1CTR A;  2K7O A;  1B7T Z;  2GGZ A;  1UUS A;  2BKI B;  4P5O E;  2WOS A;  3WNX B;  5IBW A;  4BY4 A;  1TNQ A;  5I2L A;  1EXR A;  1K90 D;  5CSF A;  1K9K A;  3O6B A;  1PK0 D;  1F55 A;  1IQ5 A;  2I94 A;  3TZ1 A;  2BL0 B;  2PMY A;  1YRU B;  1L2O C;  2JNX A;  2MLE C;  4PE4 A;  1RTP 1;  3CWG A;  2K61 A;  2M3W A;  1YR5 A;  2EC6 B;  3EK4 A;  1X02 A;  4MN0 A;  1DMO A;  4HSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...