2K0JA

Solution structure of cam complexed to drp1p
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
147
structure length
147
Chain Sequence
DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Accurate solution structures of proteins from X-ray data and a minimal set of NMR data: calmodulin-peptide complexes as examples.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords calmodulin
total genus 46
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k0jA00
1NWDA 3I5FB 3WHUB 5I2QA 4UPGA 4L9MA 4JWQA 2E30A 3TDIA 1BLQA 1J7OA 1KQMB 3BOWA 1UWOA 3TDUA 3RM1A 1JF2A 3AAKA 1XFVO 1M46A 1V1GA 1S36A 2LAPA 1CDMA 2KBMA 1OMDA 1UHNA 3K21A 2LLUA 2M49B 3GK2A 2WCBA 1LKJA 1JFJA 2LMUA 1TCFA 1DJXA 1A03A 2M1UA 4GBAA 2IS9A 3AKBA 2JC2A 4PHNA 3D10A 1OQPA 3CS1A 1SCMC 1NX0A 2ZNEA 1J7RA 3HCMA 3BUXB 1L7ZA 2RGIA 2PASA 4C0LA 4MSPA 3VRPA 4CFQA 1PSRA 4FQOA 2K61A 4GGNA 3I5IB 4WRIA 1U5IB 5BPJA 2F3ZA 4IL1A 1BR1B 2FJUB 4FTGA 2KI4C 3I5HB 1K93D 1SL7A 2O5GA 1TNXA 1CFDA 1B8RA 2M1KB 1B7TY 4PHJA 4ORBB 3BUMB 1HT9A 2AUCA 1M45A 3M0WA 2V53A 2WOSA 4OV2A 5IBWA 4GPLB 1SCMB 3SG3A 2JOJA 1KK8C 1DJZA 1KFUS 2M8UA 1B9AA 5GQQC 1ZACA 3KEVA 1VRKA 2WNDA 4XJKB 1JF0A 1NX3A 2KFFA 3SG4A 4TNCA 4PDZA 4DIRA 3O4YA 3SG6A 2KI4B 5DKRA 2OTGC 2BL0C 4E68A 2I18A 1NP8A 3EKHA 5DKQA 1MF8B 4A4CA 1DF0B 1BG1A 4Q04A 1DT7B 2L4IA 1LVCD 1IKUA 2MA2A 2BBNA 4PHMA 1K9PA 1Y1UA 5TNCA 1B8LA 1KFXS 2PALA 2QPTA 3DF0B 4MZJA 4PE7A 1JFKA 1ZMZA 1B47A 1GQMA 3AAJA 3DVJA 4MVFA 3TZ1A 2K8MB 1RK9A 1QIVA 1KQMC 1BODA 1R2UA 3D0YA 1YR5A 2NLNA 1W7JB 3O78A 1CMGA 2ISDA 2LVKA 2MJWB 4MZKA 2BL0B 4ORCB 1D1OA 2PRUA 3BUNB 3BUWB 1M31A 3OX6A 3BQ3A 3OX5A 1B1GA 1NUBA 5ER5A 5HLOA 3QRXA 2MRDA 4JQ0D 1AUIB 2K7CA 4USLA 3NSIA 1MXEA 2K7DA 4D1EA 1TTXA 1DGVA 2KQ6A 3EVVA 1YX7A 1UHIA 1UURA 1YTZC 4P5OE 4GFTA 2BCBA 2JWWA 1F55A 2JTZA 2JT0A 3CR2A 1EG3A 2HF5A 4GUKA 4MBEA 2NZ0A 5G08A 1KQVA 2LANA 2Q91A 2LVJA 4M2OA 2ZRSA 1OMRA 2A4JA 3I5GC 1IQ5A 1K94A 2LE9B 3FIAA 2WC8A 2QACA 1CFPA 1XFXO 2O60A 3FWBA 3I5IC 5AFPA 1TNQA 5FYXA 4GGFA 2TN4A 3EVUA 4CLNA 2KQYA 1WRZA 1YURA 4YGDB 1LINA 3PATA 4N1GA 1M63B 1G33A 2Y1MA 2AMIA 4MLWA 3A8RA 3PALA 5CSNA 3AKAA 1J7QA 1PSBA 1E8AA 1XFWO 2Y1NA 1JC2A 1R6PA 2R2IA 2EGDA 2P6BB 4YGBB 4PE1A 1XO5A 3CR4X 1FF1A 3CTNA 2CBLA 1XFZO 3SG2A 3SG7A 2WCEA 4CPVA 2EC6C 1CMFA 1LA3A 1QX2A 1QIWA 3IQOA 4YGAA 2OTGB 1A2XA 5DKNA 5JJGA 2BE4A 4MZLA 1SR6C 2HQWA 1UP5A 3EK4A 1BR4B 2GGMA 3ICBA 4DRWA 2CTNA 1UUSA 1DVIA 2ZNDA 1NCZA 1DJWA 3EKJA 4NDBA 1TNWA 1WRLA 1Y1AA 2H61C 2LVVA 4WQ3A 1J1EA 2JTTA 2G9BA 1PVAA 3TUYB 3VRRA 4DCKA 1K8UA 5D7FA 4DS7A 3BOWB 1K9KA 4F0ZB 1S6CA 2LUXA 3LCPC 2KAXA 2F2OA 4CIDA 4N1FA 2EHBA 2LMVA 1UHHA 2M97A 3TDZA 1Y6WA 2JQ6A 1YRTB 4NDCA 2M29A 2LP2A 5AANA 3OB1B 2LVIA 1JSAA 1N0YA 2L51A 5HKYA 1RFJA 2LC5A 3TUYC 1F8HA 1MQ1A 1ODBA 2HETA 1IH0A 1QLSA 2LV7A 4U8DA 5HKWA 4YI9A 4OVNF 1NIWA 1OMVA 4QJ4B 3O6BA 5HYDA 4YGEB 1H8BA 1SW8A 2KOTA 3EVRA 1ALWA 4HRHA 1WDCB 2MLEC 2NCOA 3OHMB 3GK4X 2F33A 4YGCB 4A4BA 1TNPA 1F4QA 1W7IB 3JTDB 2LM5A 1KWOC 2KFHA 2OS8B 3CR5X 2GV5A 1PALA 3KHEA 1MWNA 1N2DA 1FI5A 3KPXA 1V1FA 2Y5IA 3PN7B 1HQVA 3WNXB 1FBVA 2COLB 3LK0A 3FWCA 1F71A 2KSPA 1RTP1 1YUSA 1BU3A 3A4UB 1A29A 2K2FA 1WDCC 1AVSA 4BY4A 2NCPA 1NYAA 1LXFC 4N5XA 1FW4A 1QLKA 2JNXA 5ER4X 1TRFA 3VRQA 1IJ6A 1K95A 1IJ5A 3IF7A 4YI8A 2K2AA 1SKTA 1SL9A 2MHHA 1MUXA 3TS5C 5KU1A 1CM4A 1F4OA 3DF0A 2BBMA 1K96A 1KSOA 1YVHA 2F2PA 2G2BA 1S1EA 2KBIA 2HPSA 1WY9A 3WXAA 1EG4A 2L50A 5HLVA 1NCXA 1CB1A 2KAYA 1QX5B 2I7AA 3I5HC 1Y1XA 1SY9A 1QV1A 3EK7A 4MRXA 4PE0A 1UHJA 2LHIA 3VRNA 1LA0A 2H2KA 1XVJA 2JT8A 5CSJA 1G4YR 2PVBA 2CXJA 1A75B 1XYDA 1MR8A 3O2PA 4I5NB 3RLZA 1IQ3A 2M9GA 1MHOA 3DVKA 4C0KA 1SPYA 1ZFSA 3I5GB 1DF0A 2H61A 1BMOA 2ZRTA 1CLLA 2PSRA 5JOLA 1J1DA 3D0YB 1WLMA 4I5LB 2PMYA 2BKHB 4M2QA 3GK1A 2BCAA 1NX2A 2K7BA 4WQ2A 3H4SE 4AQIA 1CDNA 1S3PA 2MLFC 3ZWHA 3OB2B 3PLFB 5B8IB 1ALVA 2KHNA 1WRKA 2KYCA 2LMTA 3BYAA 2OS8C 1IRJA 2JU0A 2AAOA 3PN7C 5AERA 1N65A 1B4CA 5F6TA 1QVIZ 2ZN9A 4OKHA 1NSHA 3DD4A 1QASA 4P2YB 1JBAA 4HSZA 1SR6B 4ZCUA 1H4BA 5CPVA 2KNEA 1NPQA 3PSRA 1SNLA 1NX1A 1U5IA 2FCEA 1KK8B 5PALA 3I5FC 1CDPA 1FPWA 1PVBA 2VRGA 5J3XA 2JXLA 4QJ3B 1YUUA 4MRYA 1SMGA 4OCIA 1NCYA 2FCDA 1QV0A 1DTLA 1KK7Y 5CSIA 1JUOA 1IGVA 1Q80A 3KO0A 2LLSA 3NSKA 1GJYA 2LP3A 3LL8B 2MAZA 4HRGA 1YX8A 1YRUB 1BF5A 3SIBA 1OE9B 1SYMA 2NXQA 4M2PA 1EH2A 2D8NA 1A75A 2LLTA 5I2LA 2ZFDA 1QX7A 1XK4C 4I5KA 4GGFC 1QVIY 1IG5A 1ZUZA 2KGRA 1CDLA 1DJYA 2BKIB 1SK6D 3DVEA 1KFUL 3JVTB 1F70A 3LLEA 1XFYO 3PM8A 2JT3A 4ETOA 4GNKB 2EC6B 2DOQA 4MEWA 3JTDC 3WHTB 1KWOB 1Y0VH 1A4PA 2L0PA 4DUQA 4AQJA 1KFXL 4PE4A 5D69A 1K2HA 1QXPA 4BY5A 1EXRA 3OP0A 1B7TZ 1DMOA 1DGUA 2BE6A 3HX4A 1RWYA 3NSLA 1F54A 2F8PA 1PRWA 1QJTA 2WCFA 2E6WA 2JULA 1AP4A 3VGOA 1S6IA 4PHKA 4C0JA 2B1UA 1K90D 1IWQA 1L2OB 5KTYA 1YUTA 1XA5A 4YBHB 3CGAA 1XK4A 1S5GY 2KGBC 4AOMA 4PALA 2I2RE 3KF9A 5CSFA 1CFCA 2Y4QA 1OZSA 3BXKA 3DVMA 1M39A 1S26D 1PK0D 1KK7Z 3F45A 1CM1A 2JPTA 2L98A 2LUCA 2GGZA 1DJHA 2M7NA 2HQ8A 5AEQA 3SG5A 4NDDA 1BT6A 2BECA 1EL4A 3NXAA 3SJSA 2KYFA 1AHRA 1GGZA 3MSEB 1L2OC 5I2OA 3LK1A 2OPOA 2L5XB 4GAOA 1C07A 1J7PA 4ZCVA 1CFFA 5HKZA 1G8IA 2KAVA 1XFUO 4I5JA 3GOFA 1X02A 2L2EA 1GGWA 3BUOB 3EK8A 5K89A 3C1VA 2M7LA 1AK8A 1DJGA 1CKKA 2MBXA 1SRAA 2JRFA 1RROA 2KFGA 2KI6C 3CZTX 4QJ5B 1RECA 1YVLA 2BCXA 1CLBA 5I8NA 1JWDA 1TOPA 4ORAB 4NQGA 1AJ5A 5KSZA 4R1EA 1DJIA 5AXIA 1SCVA 1QATA 2JZIA 3E3RA 1KSMA 3VROA 3SIAA 1EJ3A 4YRUA 2LHLA 1ZOTB 3FS7A 2ZKMX 1TN4A 1CTRA 1UHKA 2M0RA 3NSOA 3IQQA 3JVTC 4CFRA 1C7WA 2SCPA 2LNKA 1FI6A 1BJFA 1OZOA 1K9UA 1SL8A 1B8CA 4JPZB 2F3YA 2Q4UA 1OSAA 2LCPA 2KDHA 1C7VA 2M3WA 1J55A 1PULA 1S5GZ 3CWGA 2ZN8A 4XJKA 3CLNA 1CLMA 2JNFA 1TCOB 2I94A 1SBJA 3TS5B 1QS7A 3ZNIA 4HREE 1S6JA 2CNPA 1RJVA 1CNPA 2KI6D 4ICBA 1MXLC 2K7OA 2L4HA 4MN0A 1TIZA 1OOJA 2CT9A 4PCWA 4XYNA 1WLZA 1QTXA 1AJ4A 1KCYA 4OR9B 1BOCA 2SASA 2FOTA 2K0JA 2CCMA 2WORA 2JXCA 3PFVA
chains in the Genus database with same CATH superfamily
1NWDA 3I5FB 3WHUB 5I2QA 4UPGA 1OW4A 4L9MA 4JWQA 2E30A 3TDIA 1BLQA 1J7OA 1KQMB 3BOWA 1UWOA 3TDUA 3RM1A 1JF2A 3AAKA 2WCKA 1XFVO 3VB1A 1M46A 1V1GA 1S36A 2LAPA 1CDMA 2KBMA 3SS5A 1OMDA 3L4LA 1UHNA 1C3ZA 1DQEA 3K21A 2FJYA 2LLUA 2M49B 3GK2A 1DEKA 2WCBA 1LKJA 1JFJA 2LMUA 1TCFA 1DJXA 1A03A 2M1UA 4GBAA 2IS9A 3AKBA 2JC2A 4PHNA 3D10A 2K60A 1OQPA 3CS1A 1SCMC 1NX0A 2ZNEA 1J7RA 3HCMA 3BUXB 1L7ZA 2RGIA 2PASA 4C0LA 4MSPA 3VRPA 2QEBA 4CFQA 1PSRA 4FQOA 1W9ZA 2K61A 4GGNA 3I5IB 4WRIA 1U5IB 5BPJA 2F3ZA 4IL1A 1BR1B 2FJUB 4FTGA 2KI4C 3I5HB 1K93D 1SL7A 2O5GA 1TNXA 1CFDA 1B8RA 2M1KB 1B7TY 3B87A 4ORBB 4PHJA 3BUMB 1HT9A 2AUCA 1M45A 3M0WA 2V53A 2WOSA 2PQLA 3NHIA 4OV2A 5IBWA 4GPLB 1SCMB 3SG3A 2JOJA 1KK8C 1DJZA 1KFUS 2M8UA 1B9AA 5GQQC 1ZACA 3KEVA 1VRKA 2WNDA 1TWOA 4XJKB 1JF0A 1NX3A 2KFFA 3SG4A 4TNCA 4PDZA 4DIRA 3O4YA 3SG6A 3DY9A 2KI4B 5DKRA 2OTGC 2BL0C 4E68A 2I18A 1NP8A 3EKHA 5DKQA 1MF8B 4A4CA 1DF0B 1BG1A 4Q04A 1DT7B 2L4IA 1LVCD 1IKUA 2MA2A 2BBNA 4PHMA 2P70A 1K9PA 3S0AA 4JKTA 1Y1UA 5TNCA 1B8LA 1KFXS 2PALA 2QPTA 3DF0B 4MZJA 4PE7A 1JFKA 1ZMZA 1B47A 1GQMA 1T14A 3AAJA 3DVJA 4MVFA 2K8MB 3SS3A 3D73A 1RK9A 3TZ1A 1QIVA 1KQMC 1BODA 1R2UA 3D0YA 1YR5A 2NLNA 1W7JB 3O78A 1CMGA 2ISDA 2LVKA 2MJWB 4MZKA 1GM0A 2BL0B 4ORCB 1D1OA 2PRUA 3BUNB 3BUWB 1M31A 3OX6A 3BQ3A 3OX5A 1B1GA 1LS8A 1NUBA 5ER5A 5HLOA 3QRXA 2MRDA 4JQ0D 1AUIB 2K7CA 4USLA 3NSIA 1MXEA 2K7DA 4D1EA 1TTXA 1DGVA 2KQ6A 3EVVA 1CLBA 1YX7A 1UHIA 1UURA 1YTZC 4P5OE 4GFTA 2BCBA 2JWWA 1F55A 2JTZA 2JT0A 3CR2A 1EG3A 2HF5A 4GUKA 4MBEA 2NZ0A 5G08A 1KQVA 2LANA 2Q91A 2LVJA 4M2OA 2ZRSA 1OMRA 2A4JA 3I5GC 1IQ5A 1K94A 2LE9B 3FIAA 2WC8A 2QACA 1DC1A 1CFPA 1XFXO 2O60A 3FWBA 3I5IC 3S0BA 5AFPA 1TNQA 5FYXA 4GGFA 2TN4A 3EVUA 4CLNA 2KQYA 1WRZA 1YURA 4IJ7A 4YGDB 1LINA 3PATA 4N1GA 5FI7A 1M63B 1G33A 2Y1MA 2BAPA 2AMIA 4MLWA 3A8RA 3PALA 5CSNA 3AKAA 1J7QA 1PSBA 1E8AA 1XFWO 2Y1NA 1JC2A 1R6PA 2R2IA 2EGDA 2P6BB 3DZTA 4YGBB 4PE1A 1XO5A 3CR4X 3DXLA 1FF1A 3CTNA 2CBLA 1XFZO 3SG2A 3QMEA 3SG7A 2WCEA 4CPVA 2P71A 2EC6C 1CMFA 1LA3A 1QX2A 1QIWA 3IQOA 4YGAA 2OTGB 1A2XA 1P28A 3FE6A 5DKNA 5JJGA 2BE4A 4MZLA 1SR6C 2HQWA 1UP5A 3EK4A 2WCHA 1BR4B 2GGMA 3ICBA 4DRWA 2CTNA 3D76A 1UUSA 1DVIA 2ERBA 2ZNDA 5EL2A 1NCZA 1DJWA 3EKJA 4NDBA 1TNWA 1WRLA 1Y1AA 2H61C 3PJIA 2LVVA 4WQ3A 1J1EA 2JTTA 2G9BA 1PVAA 3TUYB 3VRRA 4DCKA 1K8UA 5D7FA 4PT1A 4DS7A 3BOWB 1K9KA 3S0EA 3CDNA 4F0ZB 1S6CA 2L5YA 2LUXA 3LCPC 3R1OA 2KAXA 3D75A 2F2OA 4CIDA 4N1FA 2EHBA 2LMVA 1UHHA 2M97A 3TDZA 1Y6WA 2JQ6A 1YRTB 4NDCA 2M29A 2LP2A 5AANA 3OB1B 2LVIA 1JSAA 1N0YA 2L51A 5HKYA 1RFJA 2LC5A 3TUYC 1F8HA 1MQ1A 1ODBA 2HETA 1IH0A 3BFHA 1QLSA 2LV7A 4U8DA 5HKWA 4YI9A 4OVNF 1NIWA 1OMVA 4QJ4B 3O6BA 5HYDA 4YGEB 1H8BA 1SW8A 2KOTA 3EVRA 1ALWA 4HRHA 1WDCB 2MLEC 2NCOA 3OHMB 3GK4X 2F33A 4YRUA 3L4AA 4YGCB 4A4BA 1TNPA 2QDIA 1F4QA 1W7IB 3JTDB 2LM5A 1KWOC 2KFHA 2OS8B 3CR5X 1OOIX 2GV5A 1PALA 3FE8A 3KHEA 3R1VA 1MWNA 1N2DA 1FI5A 3KPXA 1V1FA 2Y5IA 3PN7B 1HQVA 3WNXB 1FBVA 2COLB 3LK0A 3FWCA 1F71A 2KSPA 1RTP1 1YUSA 1BU3A 3A4UB 1A29A 2K2FA 1WDCC 1AVSA 3D74A 4BY4A 2NCPA 2WCMA 1NYAA 1LXFC 4N5XA 1FW4A 1OOFA 1QLKA 2JNXA 3NGVA 5ER4X 1TRFA 3VRQA 1IJ6A 1K95A 1IJ5A 3IF7A 4YI8A 2K2AA 1SKTA 1SL9A 1C3YA 2MHHA 1MUXA 3TS5C 3S0GA 5KU1A 1CM4A 1ORGA 1F4OA 1OOHA 1XFRA 2BBMA 1K96A 1KSOA 1YVHA 2F2PA 2G2BA 1S1EA 2KBIA 3DF0A 2HPSA 1WY9A 3WXAA 1EG4A 2L50A 5HLVA 1NCXA 1CB1A 2KAYA 1QX5B 2I7AA 3I5HC 1Y1XA 1SY9A 1QV1A 3EK7A 4MRXA 4PE0A 1UHJA 2LHIA 3VRNA 1LA0A 2H2KA 1XVJA 2KPHA 2JT8A 5CSJA 1G4YR 2PVBA 4INWA 2CXJA 1A75B 1XYDA 1MR8A 3O2PA 4I5NB 3RLZA 1IQ3A 2M9GA 1MHOA 3DVKA 4C0KA 1SPYA 1ZFSA 3I5GB 1DF0A 2H61A 1BMOA 2ZRTA 1CLLA 2PSRA 5JOLA 1J1DA 3D0YB 1WLMA 1Z2CB 3K1EA 3CZ0A 4I5LB 2PMYA 3RZSA 3UO9A 2BKHB 3EG5B 4M2QA 3GK1A 3BJHA 2BCAA 1NX2A 2K7BA 4WQ2A 4OZDA 3H4SE 4AQIA 1CDNA 2JPOA 1S3PA 2QEHA 1JWDA 2MLFC 3ZWHA 3OB2B 2QEVA 3PLFB 5B8IB 1ALVA 2WCJA 3O4XA 3N7HA 2KHNA 1WRKA 2KYCA 2LMTA 3BYAA 2OS8C 1IRJA 2JU0A 2AAOA 3NHTA 3PN7C 5AERA 1N65A 1Z4HA 5F6TA 1B4CA 1QVIZ 2ZN9A 4OKHA 3L47A 1NSHA 3DD4A 1QASA 4P2YB 3R72A 1JBAA 4HSZA 1SR6B 4ZCUA 1H4BA 4INXA 5CPVA 2KNEA 1NPQA 3PSRA 1SNLA 1NX1A 1U5IA 2FCEA 1KK8B 1DELA 4FQTA 3I5FC 1CDPA 5PALA 1PVBA 2VRGA 1FPWA 5J3XA 2JXLA 3R1PA 4QJ3B 1YUUA 4MRYA 1SMGA 4OCIA 1NCYA 3BFBA 2FCDA 1QV0A 2PYQA 1DTLA 1KK7Y 5CSIA 3FE9A 1JUOA 1IGVA 3B86A 1Q80A 3KO0A 2LLSA 3NSKA 1GJYA 2LP3A 3LL8B 2MAZA 4HRGA 1YX8A 1YRUB 1BF5A 3SIBA 1OE9B 1SYMA 2NXQA 4M2PA 3IVTA 3UNWA 4F7FA 2D8NA 1EH2A 2BNXA 2WC5A 1A75A 2LLTA 5I2LA 2ZFDA 1QX7A 1XK4C 4I5KA 4GGFC 1QVIY 3CZ2A 1IG5A 1ZUZA 2KGRA 1CDLA 1DJYA 3S0FA 2BKIB 1SK6D 3DVEA 1KFUL 3JVTB 1F70A 3LLEA 1XFYO 3PM8A 3CZ1A 4JD9A 2JT3A 4ETOA 3D77A 4GNKB 2EC6B 2H8VA 2DOQA 4MEWA 5FI2A 3V2LA 2QEOA 3JTDC 3WHTB 1KWOB 1Y0VH 1A4PA 2L0PA 4DUQA 4AQJA 2WCLA 1KFXL 4PE4A 5D69A 1K2HA 1QXPA 2KLEA 1EXRA 4BY5A 3OP0A 1B7TZ 3D78A 1DMOA 1DGUA 2BE6A 3HX4A 1RWYA 3NSLA 1F54A 2F8PA 1PRWA 1QJTA 2WCFA 2E6WA 2JULA 1AP4A 3VGOA 1S6IA 3OBVA 4PHKA 4C0JA 2B1UA 1K90D 1IWQA 1L2OB 5KTYA 1YUTA 1XA5A 2FOTA 4YBHB 5DICA 3CGAA 3B88A 1XK4A 1S5GY 2KGBC 4AOMA 4PALA 2I2RE 3KF9A 3PM2A 5CSFA 1CFCA 2Y4QA 1OZSA 3BXKA 3DVMA 5FI6A 1M39A 1S26D 1PK0D 1KK7Z 3F45A 1CM1A 2JPTA 2L98A 2LUCA 2GGZA 1DJHA 2M7NA 2HQ8A 5AEQA 3SG5A 4NDDA 1BT6A 2BECA 3SS4A 1EL4A 3NXAA 3SJSA 2KYFA 1AHRA 1GGZA 3MSEB 1L2OC 5I2OA 3LK1A 2OPOA 2L5XB 4GAOA 1C07A 1J7PA 4ZCVA 3CYZA 5HKZA 1G8IA 2KAVA 1XFUO 4I5JA 3B7AA 3GOFA 1CFFA 1X02A 2L2EA 1IIOA 1GGWA 3BUOB 3EK8A 5K89A 5D3OA 3C1VA 2M7LA 1AK8A 1DJGA 1CKKA 2MBXA 1SRAA 1QWVA 1RROA 2JRFA 2KFGA 2KI6C 3CZTX 1RECA 1YVLA 2BCXA 3DYEA 3OGNA 4QJ5B 1TOPA 4ORAB 1OOGA 1AJ5A 3Q8IA 4NQGA 4R1EA 5I8NA 5KSZA 1DJIA 3BFAA 1SCVA 1QATA 2JZIA 3E3RA 1KSMA 2GTEA 5AXIA 1EJ3A 3SIAA 3B6XA 3VROA 2LHLA 1ZOTB 3FS7A 2WC6A 2ZKMX 1TN4A 1CTRA 1UHKA 2M0RA 2L2CA 3NSOA 3IQQA 3JVTC 4CFRA 4KYNA 1C7WA 2SCPA 5HL1A 2KLDA 2LNKA 3S0DA 1FI6A 1BJFA 1OZOA 1K9UA 1SL8A 1B8CA 4JPZB 2F3YA 2Q4UA 1TUJA 1OSAA 2YGUA 3CABA 2LCPA 2KDHA 5I94A 1C7VA 2M3WA 1J55A 1PULA 1S5GZ 3CWGA 1SSEB 2ZN8A 4XJKA 3CLNA 1CLMA 2JNFA 1TCOB 2I94A 1SBJA 3TS5B 1QS7A 3ZNIA 4HREE 1S6JA 2CNPA 1RJVA 1CNPA 2KI6D 4ICBA 1MXLC 2K7OA 2L4HA 4MN0A 1TIZA 1OOJA 2CT9A 4PCWA 4XYNA 1WLZA 1QTXA 1AJ4A 1KCYA 4OR9B 1BOCA 2SASA 1TUZA 2K0JA 2CCMA 2WORA 2JXCA 3PFVA
chains in the Genus database with same CATH topology
1NWDA 3I5FB 3WHUB 5I2QA 4UPGA 4L9MA 4JWQA 2E30A 3TDIA 1BLQA 1J7OA 1KQMB 3BOWA 1UWOA 3TDUA 3RM1A 1JF2A 3AAKA 1XFVO 1M46A 1V1GA 1S36A 2LAPA 1CDMA 2KBMA 1OMDA 1UHNA 3K21A 2LLUA 2M49B 3GK2A 2WCBA 1LKJA 1JFJA 2LMUA 1TCFA 1DJXA 1A03A 2M1UA 4GBAA 2IS9A 3AKBA 2JC2A 4PHNA 3D10A 1OQPA 3CS1A 1SCMC 1NX0A 2ZNEA 1J7RA 3HCMA 3BUXB 1L7ZA 2RGIA 2PASA 4C0LA 4MSPA 3VRPA 4CFQA 1PSRA 4FQOA 2K61A 4GGNA 3I5IB 4WRIA 1U5IB 5BPJA 2F3ZA 4IL1A 1BR1B 2FJUB 4FTGA 2KI4C 3I5HB 1K93D 1SL7A 2O5GA 1TNXA 1CFDA 1B8RA 2M1KB 1B7TY 4PHJA 4ORBB 3BUMB 1HT9A 2AUCA 1M45A 3M0WA 2V53A 2WOSA 4OV2A 5IBWA 4GPLB 1SCMB 3SG3A 2JOJA 1KK8C 1DJZA 1KFUS 2M8UA 1B9AA 5GQQC 1ZACA 3KEVA 1VRKA 2WNDA 4XJKB 1JF0A 1NX3A 2KFFA 3SG4A 4TNCA 4PDZA 4DIRA 3O4YA 3SG6A 2KI4B 5DKRA 2OTGC 2BL0C 4E68A 2I18A 1NP8A 3EKHA 5DKQA 1MF8B 4A4CA 1DF0B 1BG1A 4Q04A 1DT7B 2L4IA 1LVCD 1IKUA 2MA2A 2BBNA 4PHMA 1K9PA 1Y1UA 5TNCA 1B8LA 1KFXS 2PALA 2QPTA 3DF0B 4MZJA 4PE7A 1JFKA 1ZMZA 1B47A 1GQMA 3AAJA 3DVJA 4MVFA 3TZ1A 2K8MB 1RK9A 1QIVA 1KQMC 1BODA 1R2UA 3D0YA 1YR5A 2NLNA 1W7JB 3O78A 1CMGA 2ISDA 2LVKA 2MJWB 4MZKA 2BL0B 4ORCB 1D1OA 2PRUA 3BUNB 3BUWB 1M31A 3OX6A 3BQ3A 3OX5A 1B1GA 1NUBA 5ER5A 5HLOA 3QRXA 2MRDA 4JQ0D 1AUIB 2K7CA 4USLA 3NSIA 1MXEA 2K7DA 4D1EA 1TTXA 1DGVA 2KQ6A 3EVVA 1YX7A 1UHIA 1UURA 1YTZC 4P5OE 4GFTA 2BCBA 2JWWA 1F55A 2JTZA 2JT0A 3CR2A 1EG3A 2HF5A 4GUKA 4MBEA 2NZ0A 5G08A 1KQVA 2LANA 2Q91A 2LVJA 4M2OA 2ZRSA 1OMRA 2A4JA 3I5GC 1IQ5A 1K94A 2LE9B 3FIAA 2WC8A 2QACA 1CFPA 1XFXO 2O60A 3FWBA 3I5IC 5AFPA 1TNQA 5FYXA 4GGFA 2TN4A 3EVUA 4CLNA 2KQYA 1WRZA 1YURA 4YGDB 1LINA 3PATA 4N1GA 1M63B 1G33A 2Y1MA 2AMIA 4MLWA 3A8RA 3PALA 5CSNA 3AKAA 1J7QA 1PSBA 1E8AA 1XFWO 2Y1NA 1JC2A 1R6PA 2R2IA 2EGDA 2P6BB 4YGBB 4PE1A 1XO5A 3CR4X 1FF1A 3CTNA 2CBLA 1XFZO 3SG2A 3SG7A 2WCEA 4CPVA 2EC6C 1CMFA 1LA3A 1QX2A 1QIWA 3IQOA 4YGAA 2OTGB 1A2XA 5DKNA 5JJGA 2BE4A 4MZLA 1SR6C 2HQWA 1UP5A 3EK4A 1BR4B 2GGMA 3ICBA 4DRWA 2CTNA 1UUSA 1DVIA 2ZNDA 1NCZA 1DJWA 3EKJA 4NDBA 1TNWA 1WRLA 1Y1AA 2H61C 2LVVA 4WQ3A 1J1EA 2JTTA 2G9BA 1PVAA 3TUYB 3VRRA 4DCKA 1K8UA 5D7FA 4DS7A 3BOWB 1K9KA 4F0ZB 1S6CA 2LUXA 3LCPC 2KAXA 2F2OA 4CIDA 4N1FA 2EHBA 2LMVA 1UHHA 2M97A 3TDZA 1Y6WA 2JQ6A 1YRTB 4NDCA 2M29A 2LP2A 5AANA 3OB1B 2LVIA 1JSAA 1N0YA 2L51A 5HKYA 1RFJA 2LC5A 3TUYC 1F8HA 1MQ1A 1ODBA 2HETA 1IH0A 1QLSA 2LV7A 4U8DA 5HKWA 4YI9A 4OVNF 1NIWA 1OMVA 4QJ4B 3O6BA 5HYDA 4YGEB 1H8BA 1SW8A 2KOTA 3EVRA 1ALWA 4HRHA 1WDCB 2MLEC 2NCOA 3OHMB 3GK4X 2F33A 4YGCB 4A4BA 1TNPA 1F4QA 1W7IB 3JTDB 2LM5A 1KWOC 2KFHA 2OS8B 3CR5X 2GV5A 1PALA 3KHEA 1MWNA 1N2DA 1FI5A 3KPXA 1V1FA 2Y5IA 3PN7B 1HQVA 3WNXB 1FBVA 2COLB 3LK0A 3FWCA 1F71A 2KSPA 1RTP1 1YUSA 1BU3A 3A4UB 1A29A 2K2FA 1WDCC 1AVSA 4BY4A 2NCPA 1NYAA 1LXFC 4N5XA 1FW4A 1QLKA 2JNXA 5ER4X 1TRFA 3VRQA 1IJ6A 1K95A 1IJ5A 3IF7A 4YI8A 2K2AA 1SKTA 1SL9A 2MHHA 1MUXA 3TS5C 5KU1A 1CM4A 1F4OA 3DF0A 2BBMA 1K96A 1KSOA 1YVHA 2F2PA 2G2BA 1S1EA 2KBIA 2HPSA 1WY9A 3WXAA 1EG4A 2L50A 5HLVA 1NCXA 1CB1A 2KAYA 1QX5B 2I7AA 3I5HC 1Y1XA 1SY9A 1QV1A 3EK7A 4MRXA 4PE0A 1UHJA 2LHIA 3VRNA 1LA0A 2H2KA 1XVJA 2JT8A 5CSJA 1G4YR 2PVBA 2CXJA 1A75B 1XYDA 1MR8A 3O2PA 4I5NB 3RLZA 1IQ3A 2M9GA 1MHOA 3DVKA 4C0KA 1SPYA 1ZFSA 3I5GB 1DF0A 2H61A 1BMOA 2ZRTA 1CLLA 2PSRA 5JOLA 1J1DA 3D0YB 1WLMA 4I5LB 2PMYA 2BKHB 4M2QA 3GK1A 2BCAA 1NX2A 2K7BA 4WQ2A 3H4SE 4AQIA 1CDNA 1S3PA 2MLFC 3ZWHA 3OB2B 3PLFB 5B8IB 1ALVA 2KHNA 1WRKA 2KYCA 2LMTA 3BYAA 2OS8C 1IRJA 2JU0A 2AAOA 3PN7C 5AERA 1N65A 1B4CA 5F6TA 1QVIZ 2ZN9A 4OKHA 1NSHA 3DD4A 1QASA 4P2YB 1JBAA 4HSZA 1SR6B 4ZCUA 1H4BA 5CPVA 2KNEA 1NPQA 3PSRA 1SNLA 1NX1A 1U5IA 2FCEA 1KK8B 5PALA 3I5FC 1CDPA 1FPWA 1PVBA 2VRGA 5J3XA 2JXLA 4QJ3B 1YUUA 4MRYA 1SMGA 4OCIA 1NCYA 2FCDA 1QV0A 1DTLA 1KK7Y 5CSIA 1JUOA 1IGVA 1Q80A 3KO0A 2LLSA 3NSKA 1GJYA 2LP3A 3LL8B 2MAZA 4HRGA 1YX8A 1YRUB 1BF5A 3SIBA 1OE9B 1SYMA 2NXQA 4M2PA 1EH2A 2D8NA 1A75A 2LLTA 5I2LA 2ZFDA 1QX7A 1XK4C 4I5KA 4GGFC 1QVIY 1IG5A 1ZUZA 2KGRA 1CDLA 1DJYA 2BKIB 1SK6D 3DVEA 1KFUL 3JVTB 1F70A 3LLEA 1XFYO 3PM8A 2JT3A 4ETOA 4GNKB 2EC6B 2DOQA 4MEWA 3JTDC 3WHTB 1KWOB 1Y0VH 1A4PA 2L0PA 4DUQA 4AQJA 1KFXL 4PE4A 5D69A 1K2HA 1QXPA 4BY5A 1EXRA 3OP0A 1B7TZ 1DMOA 1DGUA 2BE6A 3HX4A 1RWYA 3NSLA 1F54A 2F8PA 1PRWA 1QJTA 2WCFA 2E6WA 2JULA 1AP4A 3VGOA 1S6IA 4PHKA 4C0JA 2B1UA 1K90D 1IWQA 1L2OB 5KTYA 1YUTA 1XA5A 4YBHB 3CGAA 1XK4A 1S5GY 2KGBC 4AOMA 4PALA 2I2RE 3KF9A 5CSFA 1CFCA 2Y4QA 1OZSA 3BXKA 3DVMA 1M39A 1S26D 1PK0D 1KK7Z 3F45A 1CM1A 2JPTA 2L98A 2LUCA 2GGZA 1DJHA 2M7NA 2HQ8A 5AEQA 3SG5A 4NDDA 1BT6A 2BECA 1EL4A 3NXAA 3SJSA 2KYFA 1AHRA 1GGZA 3MSEB 1L2OC 5I2OA 3LK1A 2OPOA 2L5XB 4GAOA 1C07A 1J7PA 4ZCVA 1CFFA 5HKZA 1G8IA 2KAVA 1XFUO 4I5JA 3GOFA 1X02A 2L2EA 1GGWA 3BUOB 3EK8A 5K89A 3C1VA 2M7LA 1AK8A 1DJGA 1CKKA 2MBXA 1SRAA 2JRFA 1RROA 2KFGA 2KI6C 3CZTX 4QJ5B 1RECA 1YVLA 2BCXA 1CLBA 5I8NA 1JWDA 1TOPA 4ORAB 4NQGA 1AJ5A 5KSZA 4R1EA 1DJIA 5AXIA 1SCVA 1QATA 2JZIA 3E3RA 1KSMA 3VROA 3SIAA 1EJ3A 4YRUA 2LHLA 1ZOTB 3FS7A 2ZKMX 1TN4A 1CTRA 1UHKA 2M0RA 3NSOA 3IQQA 3JVTC 4CFRA 1C7WA 2SCPA 2LNKA 1FI6A 1BJFA 1OZOA 1K9UA 1SL8A 1B8CA 4JPZB 2F3YA 2Q4UA 1OSAA 2LCPA 2KDHA 1C7VA 2M3WA 1J55A 1PULA 1S5GZ 3CWGA 2ZN8A 4XJKA 3CLNA 1CLMA 2JNFA 1TCOB 2I94A 1SBJA 3TS5B 1QS7A 3ZNIA 4HREE 1S6JA 2CNPA 1RJVA 1CNPA 2KI6D 4ICBA 1MXLC 2K7OA 2L4HA 4MN0A 1TIZA 1OOJA 2CT9A 4PCWA 4XYNA 1WLZA 1QTXA 1AJ4A 1KCYA 4OR9B 1BOCA 2SASA 2FOTA 2K0JA 2CCMA 2WORA 2JXCA 3PFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NWD A;  3I5F B;  3WHU B;  5I2Q A;  4UPG A;  4L9M A;  4JWQ A;  2E30 A;  3TDI A;  1BLQ A;  1J7O A;  1KQM B;  3BOW A;  1UWO A;  3TDU A;  3RM1 A;  1JF2 A;  3AAK A;  1XFV O;  1M46 A;  1V1G A;  1S36 A;  2LAP A;  1CDM A;  2KBM A;  1OMD A;  1UHN A;  3K21 A;  2LLU A;  2M49 B;  3GK2 A;  2WCB A;  1LKJ A;  1JFJ A;  2LMU A;  1TCF A;  1DJX A;  1A03 A;  2M1U A;  4GBA A;  2IS9 A;  3AKB A;  2JC2 A;  4PHN A;  3D10 A;  1OQP A;  3CS1 A;  1SCM C;  1NX0 A;  2ZNE A;  1J7R A;  3HCM A;  3BUX B;  1L7Z A;  2RGI A;  2PAS A;  4C0L A;  4MSP A;  3VRP A;  4CFQ A;  1PSR A;  4FQO A;  2K61 A;  4GGN A;  3I5I B;  4WRI A;  1U5I B;  5BPJ A;  2F3Z A;  4IL1 A;  1BR1 B;  2FJU B;  4FTG A;  2KI4 C;  3I5H B;  1K93 D;  1SL7 A;  2O5G A;  1TNX A;  1CFD A;  1B8R A;  2M1K B;  1B7T Y;  4PHJ A;  4ORB B;  3BUM B;  1HT9 A;  2AUC A;  1M45 A;  3M0W A;  2V53 A;  2WOS A;  4OV2 A;  5IBW A;  4GPL B;  1SCM B;  3SG3 A;  2JOJ A;  1KK8 C;  1DJZ A;  1KFU S;  2M8U A;  1B9A A;  5GQQ C;  1ZAC A;  3KEV A;  1VRK A;  2WND A;  4XJK B;  1JF0 A;  1NX3 A;  2KFF A;  3SG4 A;  4TNC A;  4PDZ A;  4DIR A;  3O4Y A;  3SG6 A;  2KI4 B;  5DKR A;  2OTG C;  2BL0 C;  4E68 A;  2I18 A;  1NP8 A;  3EKH A;  5DKQ A;  1MF8 B;  4A4C A;  1DF0 B;  1BG1 A;  4Q04 A;  1DT7 B;  2L4I A;  1LVC D;  1IKU A;  2MA2 A;  2BBN A;  4PHM A;  1K9P A;  1Y1U A;  5TNC A;  1B8L A;  1KFX S;  2PAL A;  2QPT A;  3DF0 B;  4MZJ A;  4PE7 A;  1JFK A;  1ZMZ A;  1B47 A;  1GQM A;  3AAJ A;  3DVJ A;  4MVF A;  3TZ1 A;  2K8M B;  1RK9 A;  1QIV A;  1KQM C;  1BOD A;  1R2U A;  3D0Y A;  1YR5 A;  2NLN A;  1W7J B;  3O78 A;  1CMG A;  2ISD A;  2LVK A;  2MJW B;  4MZK A;  2BL0 B;  4ORC B;  1D1O A;  2PRU A;  3BUN B;  3BUW B;  1M31 A;  3OX6 A;  3BQ3 A;  3OX5 A;  1B1G A;  1NUB A;  5ER5 A;  5HLO A;  3QRX A;  2MRD A;  4JQ0 D;  1AUI B;  2K7C A;  4USL A;  3NSI A;  1MXE A;  2K7D A;  4D1E A;  1TTX A;  1DGV A;  2KQ6 A;  3EVV A;  1YX7 A;  1UHI A;  1UUR A;  1YTZ C;  4P5O E;  4GFT A;  2BCB A;  2JWW A;  1F55 A;  2JTZ A;  2JT0 A;  3CR2 A;  1EG3 A;  2HF5 A;  4GUK A;  4MBE A;  2NZ0 A;  5G08 A;  1KQV A;  2LAN A;  2Q91 A;  2LVJ A;  4M2O A;  2ZRS A;  1OMR A;  2A4J A;  3I5G C;  1IQ5 A;  1K94 A;  2LE9 B;  3FIA A;  2WC8 A;  2QAC A;  1CFP A;  1XFX O;  2O60 A;  3FWB A;  3I5I C;  5AFP A;  1TNQ A;  5FYX A;  4GGF A;  2TN4 A;  3EVU A;  4CLN A;  2KQY A;  1WRZ A;  1YUR A;  4YGD B;  1LIN A;  3PAT A;  4N1G A;  1M63 B;  1G33 A;  2Y1M A;  2AMI A;  4MLW A;  3A8R A;  3PAL A;  5CSN A;  3AKA A;  1J7Q A;  1PSB A;  1E8A A;  1XFW O;  2Y1N A;  1JC2 A;  1R6P A;  2R2I A;  2EGD A;  2P6B B;  4YGB B;  4PE1 A;  1XO5 A;  3CR4 X;  1FF1 A;  3CTN A;  2CBL A;  1XFZ O;  3SG2 A;  3SG7 A;  2WCE A;  4CPV A;  2EC6 C;  1CMF A;  1LA3 A;  1QX2 A;  1QIW A;  3IQO A;  4YGA A;  2OTG B;  1A2X A;  5DKN A;  5JJG A;  2BE4 A;  4MZL A;  1SR6 C;  2HQW A;  1UP5 A;  3EK4 A;  1BR4 B;  2GGM A;  3ICB A;  4DRW A;  2CTN A;  1UUS A;  1DVI A;  2ZND A;  1NCZ A;  1DJW A;  3EKJ A;  4NDB A;  1TNW A;  1WRL A;  1Y1A A;  2H61 C;  2LVV A;  4WQ3 A;  1J1E A;  2JTT A;  2G9B A;  1PVA A;  3TUY B;  3VRR A;  4DCK A;  1K8U A;  5D7F A;  4DS7 A;  3BOW B;  1K9K A;  4F0Z B;  1S6C A;  2LUX A;  3LCP C;  2KAX A;  2F2O A;  4CID A;  4N1F A;  2EHB A;  2LMV A;  1UHH A;  2M97 A;  3TDZ A;  1Y6W A;  2JQ6 A;  1YRT B;  4NDC A;  2M29 A;  2LP2 A;  5AAN A;  3OB1 B;  2LVI A;  1JSA A;  1N0Y A;  2L51 A;  5HKY A;  1RFJ A;  2LC5 A;  3TUY C;  1F8H A;  1MQ1 A;  1ODB A;  2HET A;  1IH0 A;  1QLS A;  2LV7 A;  4U8D A;  5HKW A;  4YI9 A;  4OVN F;  1NIW A;  1OMV A;  4QJ4 B;  3O6B A;  5HYD A;  4YGE B;  1H8B A;  1SW8 A;  2KOT A;  3EVR A;  1ALW A;  4HRH A;  1WDC B;  2MLE C;  2NCO A;  3OHM B;  3GK4 X;  2F33 A;  4YGC B;  4A4B A;  1TNP A;  1F4Q A;  1W7I B;  3JTD B;  2LM5 A;  1KWO C;  2KFH A;  2OS8 B;  3CR5 X;  2GV5 A;  1PAL A;  3KHE A;  1MWN A;  1N2D A;  1FI5 A;  3KPX A;  1V1F A;  2Y5I A;  3PN7 B;  1HQV A;  3WNX B;  1FBV A;  2COL B;  3LK0 A;  3FWC A;  1F71 A;  2KSP A;  1RTP 1;  1YUS A;  1BU3 A;  3A4U B;  1A29 A;  2K2F A;  1WDC C;  1AVS A;  4BY4 A;  2NCP A;  1NYA A;  1LXF C;  4N5X A;  1FW4 A;  1QLK A;  2JNX A;  5ER4 X;  1TRF A;  3VRQ A;  1IJ6 A;  1K95 A;  1IJ5 A;  3IF7 A;  4YI8 A;  2K2A A;  1SKT A;  1SL9 A;  2MHH A;  1MUX A;  3TS5 C;  5KU1 A;  1CM4 A;  1F4O A;  3DF0 A;  2BBM A;  1K96 A;  1KSO A;  1YVH A;  2F2P A;  2G2B A;  1S1E A;  2KBI A;  2HPS A;  1WY9 A;  3WXA A;  1EG4 A;  2L50 A;  5HLV A;  1NCX A;  1CB1 A;  2KAY A;  1QX5 B;  2I7A A;  3I5H C;  1Y1X A;  1SY9 A;  1QV1 A;  3EK7 A;  4MRX A;  4PE0 A;  1UHJ A;  2LHI A;  3VRN A;  1LA0 A;  2H2K A;  1XVJ A;  2JT8 A;  5CSJ A;  1G4Y R;  2PVB A;  2CXJ A;  1A75 B;  1XYD A;  1MR8 A;  3O2P A;  4I5N B;  3RLZ A;  1IQ3 A;  2M9G A;  1MHO A;  3DVK A;  4C0K A;  1SPY A;  1ZFS A;  3I5G B;  1DF0 A;  2H61 A;  1BMO A;  2ZRT A;  1CLL A;  2PSR A;  5JOL A;  1J1D A;  3D0Y B;  1WLM A;  4I5L B;  2PMY A;  2BKH B;  4M2Q A;  3GK1 A;  2BCA A;  1NX2 A;  2K7B A;  4WQ2 A;  3H4S E;  4AQI A;  1CDN A;  1S3P A;  2MLF C;  3ZWH A;  3OB2 B;  3PLF B;  5B8I B;  1ALV A;  2KHN A;  1WRK A;  2KYC A;  2LMT A;  3BYA A;  2OS8 C;  1IRJ A;  2JU0 A;  2AAO A;  3PN7 C;  5AER A;  1N65 A;  1B4C A;  5F6T A;  1QVI Z;  2ZN9 A;  4OKH A;  1NSH A;  3DD4 A;  1QAS A;  4P2Y B;  1JBA A;  4HSZ A;  1SR6 B;  4ZCU A;  1H4B A;  5CPV A;  2KNE A;  1NPQ A;  3PSR A;  1SNL A;  1NX1 A;  1U5I A;  2FCE A;  1KK8 B;  5PAL A;  3I5F C;  1CDP A;  1FPW A;  1PVB A;  2VRG A;  5J3X A;  2JXL A;  4QJ3 B;  1YUU A;  4MRY A;  1SMG A;  4OCI A;  1NCY A;  2FCD A;  1QV0 A;  1DTL A;  1KK7 Y;  5CSI A;  1JUO A;  1IGV A;  1Q80 A;  3KO0 A;  2LLS A;  3NSK A;  1GJY A;  2LP3 A;  3LL8 B;  2MAZ A;  4HRG A;  1YX8 A;  1YRU B;  1BF5 A;  3SIB A;  1OE9 B;  1SYM A;  2NXQ A;  4M2P A;  1EH2 A;  2D8N A;  1A75 A;  2LLT A;  5I2L A;  2ZFD A;  1QX7 A;  1XK4 C;  4I5K A;  4GGF C;  1QVI Y;  1IG5 A;  1ZUZ A;  2KGR A;  1CDL A;  1DJY A;  2BKI B;  1SK6 D;  3DVE A;  1KFU L;  3JVT B;  1F70 A;  3LLE A;  1XFY O;  3PM8 A;  2JT3 A;  4ETO A;  4GNK B;  2EC6 B;  2DOQ A;  4MEW A;  3JTD C;  3WHT B;  1KWO B;  1Y0V H;  1A4P A;  2L0P A;  4DUQ A;  4AQJ A;  1KFX L;  4PE4 A;  5D69 A;  1K2H A;  1QXP A;  4BY5 A;  1EXR A;  3OP0 A;  1B7T Z;  1DMO A;  1DGU A;  2BE6 A;  3HX4 A;  1RWY A;  3NSL A;  1F54 A;  2F8P A;  1PRW A;  1QJT A;  2WCF A;  2E6W A;  2JUL A;  1AP4 A;  3VGO A;  1S6I A;  4PHK A;  4C0J A;  2B1U A;  1K90 D;  1IWQ A;  1L2O B;  5KTY A;  1YUT A;  1XA5 A;  4YBH B;  3CGA A;  1XK4 A;  1S5G Y;  2KGB C;  4AOM A;  4PAL A;  2I2R E;  3KF9 A;  5CSF A;  1CFC A;  2Y4Q A;  1OZS A;  3BXK A;  3DVM A;  1M39 A;  1S26 D;  1PK0 D;  1KK7 Z;  3F45 A;  1CM1 A;  2JPT A;  2L98 A;  2LUC A;  2GGZ A;  1DJH A;  2M7N A;  2HQ8 A;  5AEQ A;  3SG5 A;  4NDD A;  1BT6 A;  2BEC A;  1EL4 A;  3NXA A;  3SJS A;  2KYF A;  1AHR A;  1GGZ A;  3MSE B;  1L2O C;  5I2O A;  3LK1 A;  2OPO A;  2L5X B;  4GAO A;  1C07 A;  1J7P A;  4ZCV A;  1CFF A;  5HKZ A;  1G8I A;  2KAV A;  1XFU O;  4I5J A;  3GOF A;  1X02 A;  2L2E A;  1GGW A;  3BUO B;  3EK8 A;  5K89 A;  3C1V A;  2M7L A;  1AK8 A;  1DJG A;  1CKK A;  2MBX A;  1SRA A;  2JRF A;  1RRO A;  2KFG A;  2KI6 C;  3CZT X;  4QJ5 B;  1REC A;  1YVL A;  2BCX A;  1CLB A;  5I8N A;  1JWD A;  1TOP A;  4ORA B;  4NQG A;  1AJ5 A;  5KSZ A;  4R1E A;  1DJI A;  5AXI A;  1SCV A;  1QAT A;  2JZI A;  3E3R A;  1KSM A;  3VRO A;  3SIA A;  1EJ3 A;  4YRU A;  2LHL A;  1ZOT B;  3FS7 A;  2ZKM X;  1TN4 A;  1CTR A;  1UHK A;  2M0R A;  3NSO A;  3IQQ A;  3JVT C;  4CFR A;  1C7W A;  2SCP A;  2LNK A;  1FI6 A;  1BJF A;  1OZO A;  1K9U A;  1SL8 A;  1B8C A;  4JPZ B;  2F3Y A;  2Q4U A;  1OSA A;  2LCP A;  2KDH A;  1C7V A;  2M3W A;  1J55 A;  1PUL A;  1S5G Z;  3CWG A;  2ZN8 A;  4XJK A;  3CLN A;  1CLM A;  2JNF A;  1TCO B;  2I94 A;  1SBJ A;  3TS5 B;  1QS7 A;  3ZNI A;  4HRE E;  1S6J A;  2CNP A;  1RJV A;  1CNP A;  2KI6 D;  4ICB A;  1MXL C;  2K7O A;  2L4H A;  4MN0 A;  1TIZ A;  1OOJ A;  2CT9 A;  4PCW A;  4XYN A;  1WLZ A;  1QTX A;  1AJ4 A;  1KCY A;  4OR9 B;  1BOC A;  2SAS A;  2FOT A;  2K0J A;  2CCM A;  2WOR A;  2JXC A;  3PFV A; 
#chains in the Genus database with same CATH topology
 1NWD A;  3I5F B;  3WHU B;  5I2Q A;  4UPG A;  1OW4 A;  4L9M A;  4JWQ A;  2E30 A;  3TDI A;  1BLQ A;  1J7O A;  1KQM B;  3BOW A;  1UWO A;  3TDU A;  3RM1 A;  1JF2 A;  3AAK A;  2WCK A;  1XFV O;  3VB1 A;  1M46 A;  1V1G A;  1S36 A;  2LAP A;  1CDM A;  2KBM A;  3SS5 A;  1OMD A;  3L4L A;  1UHN A;  1C3Z A;  1DQE A;  3K21 A;  2FJY A;  2LLU A;  2M49 B;  3GK2 A;  1DEK A;  2WCB A;  1LKJ A;  1JFJ A;  2LMU A;  1TCF A;  1DJX A;  1A03 A;  2M1U A;  4GBA A;  2IS9 A;  3AKB A;  2JC2 A;  4PHN A;  3D10 A;  2K60 A;  1OQP A;  3CS1 A;  1SCM C;  1NX0 A;  2ZNE A;  1J7R A;  3HCM A;  3BUX B;  1L7Z A;  2RGI A;  2PAS A;  4C0L A;  4MSP A;  3VRP A;  2QEB A;  4CFQ A;  1PSR A;  4FQO A;  1W9Z A;  2K61 A;  4GGN A;  3I5I B;  4WRI A;  1U5I B;  5BPJ A;  2F3Z A;  4IL1 A;  1BR1 B;  2FJU B;  4FTG A;  2KI4 C;  3I5H B;  1K93 D;  1SL7 A;  2O5G A;  1TNX A;  1CFD A;  1B8R A;  2M1K B;  1B7T Y;  3B87 A;  4ORB B;  4PHJ A;  3BUM B;  1HT9 A;  2AUC A;  1M45 A;  3M0W A;  2V53 A;  2WOS A;  2PQL A;  3NHI A;  4OV2 A;  5IBW A;  4GPL B;  1SCM B;  3SG3 A;  2JOJ A;  1KK8 C;  1DJZ A;  1KFU S;  2M8U A;  1B9A A;  5GQQ C;  1ZAC A;  3KEV A;  1VRK A;  2WND A;  1TWO A;  4XJK B;  1JF0 A;  1NX3 A;  2KFF A;  3SG4 A;  4TNC A;  4PDZ A;  4DIR A;  3O4Y A;  3SG6 A;  3DY9 A;  2KI4 B;  5DKR A;  2OTG C;  2BL0 C;  4E68 A;  2I18 A;  1NP8 A;  3EKH A;  5DKQ A;  1MF8 B;  4A4C A;  1DF0 B;  1BG1 A;  4Q04 A;  1DT7 B;  2L4I A;  1LVC D;  1IKU A;  2MA2 A;  2BBN A;  4PHM A;  2P70 A;  1K9P A;  3S0A A;  4JKT A;  1Y1U A;  5TNC A;  1B8L A;  1KFX S;  2PAL A;  2QPT A;  3DF0 B;  4MZJ A;  4PE7 A;  1JFK A;  1ZMZ A;  1B47 A;  1GQM A;  1T14 A;  3AAJ A;  3DVJ A;  4MVF A;  2K8M B;  3SS3 A;  3D73 A;  1RK9 A;  3TZ1 A;  1QIV A;  1KQM C;  1BOD A;  1R2U A;  3D0Y A;  1YR5 A;  2NLN A;  1W7J B;  3O78 A;  1CMG A;  2ISD A;  2LVK A;  2MJW B;  4MZK A;  1GM0 A;  2BL0 B;  4ORC B;  1D1O A;  2PRU A;  3BUN B;  3BUW B;  1M31 A;  3OX6 A;  3BQ3 A;  3OX5 A;  1B1G A;  1LS8 A;  1NUB A;  5ER5 A;  5HLO A;  3QRX A;  2MRD A;  4JQ0 D;  1AUI B;  2K7C A;  4USL A;  3NSI A;  1MXE A;  2K7D A;  4D1E A;  1TTX A;  1DGV A;  2KQ6 A;  3EVV A;  1CLB A;  1YX7 A;  1UHI A;  1UUR A;  1YTZ C;  4P5O E;  4GFT A;  2BCB A;  2JWW A;  1F55 A;  2JTZ A;  2JT0 A;  3CR2 A;  1EG3 A;  2HF5 A;  4GUK A;  4MBE A;  2NZ0 A;  5G08 A;  1KQV A;  2LAN A;  2Q91 A;  2LVJ A;  4M2O A;  2ZRS A;  1OMR A;  2A4J A;  3I5G C;  1IQ5 A;  1K94 A;  2LE9 B;  3FIA A;  2WC8 A;  2QAC A;  1DC1 A;  1CFP A;  1XFX O;  2O60 A;  3FWB A;  3I5I C;  3S0B A;  5AFP A;  1TNQ A;  5FYX A;  4GGF A;  2TN4 A;  3EVU A;  4CLN A;  2KQY A;  1WRZ A;  1YUR A;  4IJ7 A;  4YGD B;  1LIN A;  3PAT A;  4N1G A;  5FI7 A;  1M63 B;  1G33 A;  2Y1M A;  2BAP A;  2AMI A;  4MLW A;  3A8R A;  3PAL A;  5CSN A;  3AKA A;  1J7Q A;  1PSB A;  1E8A A;  1XFW O;  2Y1N A;  1JC2 A;  1R6P A;  2R2I A;  2EGD A;  2P6B B;  3DZT A;  4YGB B;  4PE1 A;  1XO5 A;  3CR4 X;  3DXL A;  1FF1 A;  3CTN A;  2CBL A;  1XFZ O;  3SG2 A;  3QME A;  3SG7 A;  2WCE A;  4CPV A;  2P71 A;  2EC6 C;  1CMF A;  1LA3 A;  1QX2 A;  1QIW A;  3IQO A;  4YGA A;  2OTG B;  1A2X A;  1P28 A;  3FE6 A;  5DKN A;  5JJG A;  2BE4 A;  4MZL A;  1SR6 C;  2HQW A;  1UP5 A;  3EK4 A;  2WCH A;  1BR4 B;  2GGM A;  3ICB A;  4DRW A;  2CTN A;  3D76 A;  1UUS A;  1DVI A;  2ERB A;  2ZND A;  5EL2 A;  1NCZ A;  1DJW A;  3EKJ A;  4NDB A;  1TNW A;  1WRL A;  1Y1A A;  2H61 C;  3PJI A;  2LVV A;  4WQ3 A;  1J1E A;  2JTT A;  2G9B A;  1PVA A;  3TUY B;  3VRR A;  4DCK A;  1K8U A;  5D7F A;  4PT1 A;  4DS7 A;  3BOW B;  1K9K A;  3S0E A;  3CDN A;  4F0Z B;  1S6C A;  2L5Y A;  2LUX A;  3LCP C;  3R1O A;  2KAX A;  3D75 A;  2F2O A;  4CID A;  4N1F A;  2EHB A;  2LMV A;  1UHH A;  2M97 A;  3TDZ A;  1Y6W A;  2JQ6 A;  1YRT B;  4NDC A;  2M29 A;  2LP2 A;  5AAN A;  3OB1 B;  2LVI A;  1JSA A;  1N0Y A;  2L51 A;  5HKY A;  1RFJ A;  2LC5 A;  3TUY C;  1F8H A;  1MQ1 A;  1ODB A;  2HET A;  1IH0 A;  3BFH A;  1QLS A;  2LV7 A;  4U8D A;  5HKW A;  4YI9 A;  4OVN F;  1NIW A;  1OMV A;  4QJ4 B;  3O6B A;  5HYD A;  4YGE B;  1H8B A;  1SW8 A;  2KOT A;  3EVR A;  1ALW A;  4HRH A;  1WDC B;  2MLE C;  2NCO A;  3OHM B;  3GK4 X;  2F33 A;  4YRU A;  3L4A A;  4YGC B;  4A4B A;  1TNP A;  2QDI A;  1F4Q A;  1W7I B;  3JTD B;  2LM5 A;  1KWO C;  2KFH A;  2OS8 B;  3CR5 X;  1OOI X;  2GV5 A;  1PAL A;  3FE8 A;  3KHE A;  3R1V A;  1MWN A;  1N2D A;  1FI5 A;  3KPX A;  1V1F A;  2Y5I A;  3PN7 B;  1HQV A;  3WNX B;  1FBV A;  2COL B;  3LK0 A;  3FWC A;  1F71 A;  2KSP A;  1RTP 1;  1YUS A;  1BU3 A;  3A4U B;  1A29 A;  2K2F A;  1WDC C;  1AVS A;  3D74 A;  4BY4 A;  2NCP A;  2WCM A;  1NYA A;  1LXF C;  4N5X A;  1FW4 A;  1OOF A;  1QLK A;  2JNX A;  3NGV A;  5ER4 X;  1TRF A;  3VRQ A;  1IJ6 A;  1K95 A;  1IJ5 A;  3IF7 A;  4YI8 A;  2K2A A;  1SKT A;  1SL9 A;  1C3Y A;  2MHH A;  1MUX A;  3TS5 C;  3S0G A;  5KU1 A;  1CM4 A;  1ORG A;  1F4O A;  1OOH A;  1XFR A;  2BBM A;  1K96 A;  1KSO A;  1YVH A;  2F2P A;  2G2B A;  1S1E A;  2KBI A;  3DF0 A;  2HPS A;  1WY9 A;  3WXA A;  1EG4 A;  2L50 A;  5HLV A;  1NCX A;  1CB1 A;  2KAY A;  1QX5 B;  2I7A A;  3I5H C;  1Y1X A;  1SY9 A;  1QV1 A;  3EK7 A;  4MRX A;  4PE0 A;  1UHJ A;  2LHI A;  3VRN A;  1LA0 A;  2H2K A;  1XVJ A;  2KPH A;  2JT8 A;  5CSJ A;  1G4Y R;  2PVB A;  4INW A;  2CXJ A;  1A75 B;  1XYD A;  1MR8 A;  3O2P A;  4I5N B;  3RLZ A;  1IQ3 A;  2M9G A;  1MHO A;  3DVK A;  4C0K A;  1SPY A;  1ZFS A;  3I5G B;  1DF0 A;  2H61 A;  1BMO A;  2ZRT A;  1CLL A;  2PSR A;  5JOL A;  1J1D A;  3D0Y B;  1WLM A;  1Z2C B;  3K1E A;  3CZ0 A;  4I5L B;  2PMY A;  3RZS A;  3UO9 A;  2BKH B;  3EG5 B;  4M2Q A;  3GK1 A;  3BJH A;  2BCA A;  1NX2 A;  2K7B A;  4WQ2 A;  4OZD A;  3H4S E;  4AQI A;  1CDN A;  2JPO A;  1S3P A;  2QEH A;  1JWD A;  2MLF C;  3ZWH A;  3OB2 B;  2QEV A;  3PLF B;  5B8I B;  1ALV A;  2WCJ A;  3O4X A;  3N7H A;  2KHN A;  1WRK A;  2KYC A;  2LMT A;  3BYA A;  2OS8 C;  1IRJ A;  2JU0 A;  2AAO A;  3NHT A;  3PN7 C;  5AER A;  1N65 A;  1Z4H A;  5F6T A;  1B4C A;  1QVI Z;  2ZN9 A;  4OKH A;  3L47 A;  1NSH A;  3DD4 A;  1QAS A;  4P2Y B;  3R72 A;  1JBA A;  4HSZ A;  1SR6 B;  4ZCU A;  1H4B A;  4INX A;  5CPV A;  2KNE A;  1NPQ A;  3PSR A;  1SNL A;  1NX1 A;  1U5I A;  2FCE A;  1KK8 B;  1DEL A;  4FQT A;  3I5F C;  1CDP A;  5PAL A;  1PVB A;  2VRG A;  1FPW A;  5J3X A;  2JXL A;  3R1P A;  4QJ3 B;  1YUU A;  4MRY A;  1SMG A;  4OCI A;  1NCY A;  3BFB A;  2FCD A;  1QV0 A;  2PYQ A;  1DTL A;  1KK7 Y;  5CSI A;  3FE9 A;  1JUO A;  1IGV A;  3B86 A;  1Q80 A;  3KO0 A;  2LLS A;  3NSK A;  1GJY A;  2LP3 A;  3LL8 B;  2MAZ A;  4HRG A;  1YX8 A;  1YRU B;  1BF5 A;  3SIB A;  1OE9 B;  1SYM A;  2NXQ A;  4M2P A;  3IVT A;  3UNW A;  4F7F A;  2D8N A;  1EH2 A;  2BNX A;  2WC5 A;  1A75 A;  2LLT A;  5I2L A;  2ZFD A;  1QX7 A;  1XK4 C;  4I5K A;  4GGF C;  1QVI Y;  3CZ2 A;  1IG5 A;  1ZUZ A;  2KGR A;  1CDL A;  1DJY A;  3S0F A;  2BKI B;  1SK6 D;  3DVE A;  1KFU L;  3JVT B;  1F70 A;  3LLE A;  1XFY O;  3PM8 A;  3CZ1 A;  4JD9 A;  2JT3 A;  4ETO A;  3D77 A;  4GNK B;  2EC6 B;  2H8V A;  2DOQ A;  4MEW A;  5FI2 A;  3V2L A;  2QEO A;  3JTD C;  3WHT B;  1KWO B;  1Y0V H;  1A4P A;  2L0P A;  4DUQ A;  4AQJ A;  2WCL A;  1KFX L;  4PE4 A;  5D69 A;  1K2H A;  1QXP A;  2KLE A;  1EXR A;  4BY5 A;  3OP0 A;  1B7T Z;  3D78 A;  1DMO A;  1DGU A;  2BE6 A;  3HX4 A;  1RWY A;  3NSL A;  1F54 A;  2F8P A;  1PRW A;  1QJT A;  2WCF A;  2E6W A;  2JUL A;  1AP4 A;  3VGO A;  1S6I A;  3OBV A;  4PHK A;  4C0J A;  2B1U A;  1K90 D;  1IWQ A;  1L2O B;  5KTY A;  1YUT A;  1XA5 A;  2FOT A;  4YBH B;  5DIC A;  3CGA A;  3B88 A;  1XK4 A;  1S5G Y;  2KGB C;  4AOM A;  4PAL A;  2I2R E;  3KF9 A;  3PM2 A;  5CSF A;  1CFC A;  2Y4Q A;  1OZS A;  3BXK A;  3DVM A;  5FI6 A;  1M39 A;  1S26 D;  1PK0 D;  1KK7 Z;  3F45 A;  1CM1 A;  2JPT A;  2L98 A;  2LUC A;  2GGZ A;  1DJH A;  2M7N A;  2HQ8 A;  5AEQ A;  3SG5 A;  4NDD A;  1BT6 A;  2BEC A;  3SS4 A;  1EL4 A;  3NXA A;  3SJS A;  2KYF A;  1AHR A;  1GGZ A;  3MSE B;  1L2O C;  5I2O A;  3LK1 A;  2OPO A;  2L5X B;  4GAO A;  1C07 A;  1J7P A;  4ZCV A;  3CYZ A;  5HKZ A;  1G8I A;  2KAV A;  1XFU O;  4I5J A;  3B7A A;  3GOF A;  1CFF A;  1X02 A;  2L2E A;  1IIO A;  1GGW A;  3BUO B;  3EK8 A;  5K89 A;  5D3O A;  3C1V A;  2M7L A;  1AK8 A;  1DJG A;  1CKK A;  2MBX A;  1SRA A;  1QWV A;  1RRO A;  2JRF A;  2KFG A;  2KI6 C;  3CZT X;  1REC A;  1YVL A;  2BCX A;  3DYE A;  3OGN A;  4QJ5 B;  1TOP A;  4ORA B;  1OOG A;  1AJ5 A;  3Q8I A;  4NQG A;  4R1E A;  5I8N A;  5KSZ A;  1DJI A;  3BFA A;  1SCV A;  1QAT A;  2JZI A;  3E3R A;  1KSM A;  2GTE A;  5AXI A;  1EJ3 A;  3SIA A;  3B6X A;  3VRO A;  2LHL A;  1ZOT B;  3FS7 A;  2WC6 A;  2ZKM X;  1TN4 A;  1CTR A;  1UHK A;  2M0R A;  2L2C A;  3NSO A;  3IQQ A;  3JVT C;  4CFR A;  4KYN A;  1C7W A;  2SCP A;  5HL1 A;  2KLD A;  2LNK A;  3S0D A;  1FI6 A;  1BJF A;  1OZO A;  1K9U A;  1SL8 A;  1B8C A;  4JPZ B;  2F3Y A;  2Q4U A;  1TUJ A;  1OSA A;  2YGU A;  3CAB A;  2LCP A;  2KDH A;  5I94 A;  1C7V A;  2M3W A;  1J55 A;  1PUL A;  1S5G Z;  3CWG A;  1SSE B;  2ZN8 A;  4XJK A;  3CLN A;  1CLM A;  2JNF A;  1TCO B;  2I94 A;  1SBJ A;  3TS5 B;  1QS7 A;  3ZNI A;  4HRE E;  1S6J A;  2CNP A;  1RJV A;  1CNP A;  2KI6 D;  4ICB A;  1MXL C;  2K7O A;  2L4H A;  4MN0 A;  1TIZ A;  1OOJ A;  2CT9 A;  4PCW A;  4XYN A;  1WLZ A;  1QTX A;  1AJ4 A;  1KCY A;  4OR9 B;  1BOC A;  2SAS A;  1TUZ A;  2K0J A;  2CCM A;  2WOR A;  2JXC A;  3PFV A; 
#chains in the Genus database with same CATH homology
 1NWD A;  3I5F B;  3WHU B;  5I2Q A;  4UPG A;  4L9M A;  4JWQ A;  2E30 A;  3TDI A;  1BLQ A;  1J7O A;  1KQM B;  3BOW A;  1UWO A;  3TDU A;  3RM1 A;  1JF2 A;  3AAK A;  1XFV O;  1M46 A;  1V1G A;  1S36 A;  2LAP A;  1CDM A;  2KBM A;  1OMD A;  1UHN A;  3K21 A;  2LLU A;  2M49 B;  3GK2 A;  2WCB A;  1LKJ A;  1JFJ A;  2LMU A;  1TCF A;  1DJX A;  1A03 A;  2M1U A;  4GBA A;  2IS9 A;  3AKB A;  2JC2 A;  4PHN A;  3D10 A;  1OQP A;  3CS1 A;  1SCM C;  1NX0 A;  2ZNE A;  1J7R A;  3HCM A;  3BUX B;  1L7Z A;  2RGI A;  2PAS A;  4C0L A;  4MSP A;  3VRP A;  4CFQ A;  1PSR A;  4FQO A;  2K61 A;  4GGN A;  3I5I B;  4WRI A;  1U5I B;  5BPJ A;  2F3Z A;  4IL1 A;  1BR1 B;  2FJU B;  4FTG A;  2KI4 C;  3I5H B;  1K93 D;  1SL7 A;  2O5G A;  1TNX A;  1CFD A;  1B8R A;  2M1K B;  1B7T Y;  4PHJ A;  4ORB B;  3BUM B;  1HT9 A;  2AUC A;  1M45 A;  3M0W A;  2V53 A;  2WOS A;  4OV2 A;  5IBW A;  4GPL B;  1SCM B;  3SG3 A;  2JOJ A;  1KK8 C;  1DJZ A;  1KFU S;  2M8U A;  1B9A A;  5GQQ C;  1ZAC A;  3KEV A;  1VRK A;  2WND A;  4XJK B;  1JF0 A;  1NX3 A;  2KFF A;  3SG4 A;  4TNC A;  4PDZ A;  4DIR A;  3O4Y A;  3SG6 A;  2KI4 B;  5DKR A;  2OTG C;  2BL0 C;  4E68 A;  2I18 A;  1NP8 A;  3EKH A;  5DKQ A;  1MF8 B;  4A4C A;  1DF0 B;  1BG1 A;  4Q04 A;  1DT7 B;  2L4I A;  1LVC D;  1IKU A;  2MA2 A;  2BBN A;  4PHM A;  1K9P A;  1Y1U A;  5TNC A;  1B8L A;  1KFX S;  2PAL A;  2QPT A;  3DF0 B;  4MZJ A;  4PE7 A;  1JFK A;  1ZMZ A;  1B47 A;  1GQM A;  3AAJ A;  3DVJ A;  4MVF A;  3TZ1 A;  2K8M B;  1RK9 A;  1QIV A;  1KQM C;  1BOD A;  1R2U A;  3D0Y A;  1YR5 A;  2NLN A;  1W7J B;  3O78 A;  1CMG A;  2ISD A;  2LVK A;  2MJW B;  4MZK A;  2BL0 B;  4ORC B;  1D1O A;  2PRU A;  3BUN B;  3BUW B;  1M31 A;  3OX6 A;  3BQ3 A;  3OX5 A;  1B1G A;  1NUB A;  5ER5 A;  5HLO A;  3QRX A;  2MRD A;  4JQ0 D;  1AUI B;  2K7C A;  4USL A;  3NSI A;  1MXE A;  2K7D A;  4D1E A;  1TTX A;  1DGV A;  2KQ6 A;  3EVV A;  1YX7 A;  1UHI A;  1UUR A;  1YTZ C;  4P5O E;  4GFT A;  2BCB A;  2JWW A;  1F55 A;  2JTZ A;  2JT0 A;  3CR2 A;  1EG3 A;  2HF5 A;  4GUK A;  4MBE A;  2NZ0 A;  5G08 A;  1KQV A;  2LAN A;  2Q91 A;  2LVJ A;  4M2O A;  2ZRS A;  1OMR A;  2A4J A;  3I5G C;  1IQ5 A;  1K94 A;  2LE9 B;  3FIA A;  2WC8 A;  2QAC A;  1CFP A;  1XFX O;  2O60 A;  3FWB A;  3I5I C;  5AFP A;  1TNQ A;  5FYX A;  4GGF A;  2TN4 A;  3EVU A;  4CLN A;  2KQY A;  1WRZ A;  1YUR A;  4YGD B;  1LIN A;  3PAT A;  4N1G A;  1M63 B;  1G33 A;  2Y1M A;  2AMI A;  4MLW A;  3A8R A;  3PAL A;  5CSN A;  3AKA A;  1J7Q A;  1PSB A;  1E8A A;  1XFW O;  2Y1N A;  1JC2 A;  1R6P A;  2R2I A;  2EGD A;  2P6B B;  4YGB B;  4PE1 A;  1XO5 A;  3CR4 X;  1FF1 A;  3CTN A;  2CBL A;  1XFZ O;  3SG2 A;  3SG7 A;  2WCE A;  4CPV A;  2EC6 C;  1CMF A;  1LA3 A;  1QX2 A;  1QIW A;  3IQO A;  4YGA A;  2OTG B;  1A2X A;  5DKN A;  5JJG A;  2BE4 A;  4MZL A;  1SR6 C;  2HQW A;  1UP5 A;  3EK4 A;  1BR4 B;  2GGM A;  3ICB A;  4DRW A;  2CTN A;  1UUS A;  1DVI A;  2ZND A;  1NCZ A;  1DJW A;  3EKJ A;  4NDB A;  1TNW A;  1WRL A;  1Y1A A;  2H61 C;  2LVV A;  4WQ3 A;  1J1E A;  2JTT A;  2G9B A;  1PVA A;  3TUY B;  3VRR A;  4DCK A;  1K8U A;  5D7F A;  4DS7 A;  3BOW B;  1K9K A;  4F0Z B;  1S6C A;  2LUX A;  3LCP C;  2KAX A;  2F2O A;  4CID A;  4N1F A;  2EHB A;  2LMV A;  1UHH A;  2M97 A;  3TDZ A;  1Y6W A;  2JQ6 A;  1YRT B;  4NDC A;  2M29 A;  2LP2 A;  5AAN A;  3OB1 B;  2LVI A;  1JSA A;  1N0Y A;  2L51 A;  5HKY A;  1RFJ A;  2LC5 A;  3TUY C;  1F8H A;  1MQ1 A;  1ODB A;  2HET A;  1IH0 A;  1QLS A;  2LV7 A;  4U8D A;  5HKW A;  4YI9 A;  4OVN F;  1NIW A;  1OMV A;  4QJ4 B;  3O6B A;  5HYD A;  4YGE B;  1H8B A;  1SW8 A;  2KOT A;  3EVR A;  1ALW A;  4HRH A;  1WDC B;  2MLE C;  2NCO A;  3OHM B;  3GK4 X;  2F33 A;  4YGC B;  4A4B A;  1TNP A;  1F4Q A;  1W7I B;  3JTD B;  2LM5 A;  1KWO C;  2KFH A;  2OS8 B;  3CR5 X;  2GV5 A;  1PAL A;  3KHE A;  1MWN A;  1N2D A;  1FI5 A;  3KPX A;  1V1F A;  2Y5I A;  3PN7 B;  1HQV A;  3WNX B;  1FBV A;  2COL B;  3LK0 A;  3FWC A;  1F71 A;  2KSP A;  1RTP 1;  1YUS A;  1BU3 A;  3A4U B;  1A29 A;  2K2F A;  1WDC C;  1AVS A;  4BY4 A;  2NCP A;  1NYA A;  1LXF C;  4N5X A;  1FW4 A;  1QLK A;  2JNX A;  5ER4 X;  1TRF A;  3VRQ A;  1IJ6 A;  1K95 A;  1IJ5 A;  3IF7 A;  4YI8 A;  2K2A A;  1SKT A;  1SL9 A;  2MHH A;  1MUX A;  3TS5 C;  5KU1 A;  1CM4 A;  1F4O A;  3DF0 A;  2BBM A;  1K96 A;  1KSO A;  1YVH A;  2F2P A;  2G2B A;  1S1E A;  2KBI A;  2HPS A;  1WY9 A;  3WXA A;  1EG4 A;  2L50 A;  5HLV A;  1NCX A;  1CB1 A;  2KAY A;  1QX5 B;  2I7A A;  3I5H C;  1Y1X A;  1SY9 A;  1QV1 A;  3EK7 A;  4MRX A;  4PE0 A;  1UHJ A;  2LHI A;  3VRN A;  1LA0 A;  2H2K A;  1XVJ A;  2JT8 A;  5CSJ A;  1G4Y R;  2PVB A;  2CXJ A;  1A75 B;  1XYD A;  1MR8 A;  3O2P A;  4I5N B;  3RLZ A;  1IQ3 A;  2M9G A;  1MHO A;  3DVK A;  4C0K A;  1SPY A;  1ZFS A;  3I5G B;  1DF0 A;  2H61 A;  1BMO A;  2ZRT A;  1CLL A;  2PSR A;  5JOL A;  1J1D A;  3D0Y B;  1WLM A;  4I5L B;  2PMY A;  2BKH B;  4M2Q A;  3GK1 A;  2BCA A;  1NX2 A;  2K7B A;  4WQ2 A;  3H4S E;  4AQI A;  1CDN A;  1S3P A;  2MLF C;  3ZWH A;  3OB2 B;  3PLF B;  5B8I B;  1ALV A;  2KHN A;  1WRK A;  2KYC A;  2LMT A;  3BYA A;  2OS8 C;  1IRJ A;  2JU0 A;  2AAO A;  3PN7 C;  5AER A;  1N65 A;  1B4C A;  5F6T A;  1QVI Z;  2ZN9 A;  4OKH A;  1NSH A;  3DD4 A;  1QAS A;  4P2Y B;  1JBA A;  4HSZ A;  1SR6 B;  4ZCU A;  1H4B A;  5CPV A;  2KNE A;  1NPQ A;  3PSR A;  1SNL A;  1NX1 A;  1U5I A;  2FCE A;  1KK8 B;  5PAL A;  3I5F C;  1CDP A;  1FPW A;  1PVB A;  2VRG A;  5J3X A;  2JXL A;  4QJ3 B;  1YUU A;  4MRY A;  1SMG A;  4OCI A;  1NCY A;  2FCD A;  1QV0 A;  1DTL A;  1KK7 Y;  5CSI A;  1JUO A;  1IGV A;  1Q80 A;  3KO0 A;  2LLS A;  3NSK A;  1GJY A;  2LP3 A;  3LL8 B;  2MAZ A;  4HRG A;  1YX8 A;  1YRU B;  1BF5 A;  3SIB A;  1OE9 B;  1SYM A;  2NXQ A;  4M2P A;  1EH2 A;  2D8N A;  1A75 A;  2LLT A;  5I2L A;  2ZFD A;  1QX7 A;  1XK4 C;  4I5K A;  4GGF C;  1QVI Y;  1IG5 A;  1ZUZ A;  2KGR A;  1CDL A;  1DJY A;  2BKI B;  1SK6 D;  3DVE A;  1KFU L;  3JVT B;  1F70 A;  3LLE A;  1XFY O;  3PM8 A;  2JT3 A;  4ETO A;  4GNK B;  2EC6 B;  2DOQ A;  4MEW A;  3JTD C;  3WHT B;  1KWO B;  1Y0V H;  1A4P A;  2L0P A;  4DUQ A;  4AQJ A;  1KFX L;  4PE4 A;  5D69 A;  1K2H A;  1QXP A;  4BY5 A;  1EXR A;  3OP0 A;  1B7T Z;  1DMO A;  1DGU A;  2BE6 A;  3HX4 A;  1RWY A;  3NSL A;  1F54 A;  2F8P A;  1PRW A;  1QJT A;  2WCF A;  2E6W A;  2JUL A;  1AP4 A;  3VGO A;  1S6I A;  4PHK A;  4C0J A;  2B1U A;  1K90 D;  1IWQ A;  1L2O B;  5KTY A;  1YUT A;  1XA5 A;  4YBH B;  3CGA A;  1XK4 A;  1S5G Y;  2KGB C;  4AOM A;  4PAL A;  2I2R E;  3KF9 A;  5CSF A;  1CFC A;  2Y4Q A;  1OZS A;  3BXK A;  3DVM A;  1M39 A;  1S26 D;  1PK0 D;  1KK7 Z;  3F45 A;  1CM1 A;  2JPT A;  2L98 A;  2LUC A;  2GGZ A;  1DJH A;  2M7N A;  2HQ8 A;  5AEQ A;  3SG5 A;  4NDD A;  1BT6 A;  2BEC A;  1EL4 A;  3NXA A;  3SJS A;  2KYF A;  1AHR A;  1GGZ A;  3MSE B;  1L2O C;  5I2O A;  3LK1 A;  2OPO A;  2L5X B;  4GAO A;  1C07 A;  1J7P A;  4ZCV A;  1CFF A;  5HKZ A;  1G8I A;  2KAV A;  1XFU O;  4I5J A;  3GOF A;  1X02 A;  2L2E A;  1GGW A;  3BUO B;  3EK8 A;  5K89 A;  3C1V A;  2M7L A;  1AK8 A;  1DJG A;  1CKK A;  2MBX A;  1SRA A;  2JRF A;  1RRO A;  2KFG A;  2KI6 C;  3CZT X;  4QJ5 B;  1REC A;  1YVL A;  2BCX A;  1CLB A;  5I8N A;  1JWD A;  1TOP A;  4ORA B;  4NQG A;  1AJ5 A;  5KSZ A;  4R1E A;  1DJI A;  5AXI A;  1SCV A;  1QAT A;  2JZI A;  3E3R A;  1KSM A;  3VRO A;  3SIA A;  1EJ3 A;  4YRU A;  2LHL A;  1ZOT B;  3FS7 A;  2ZKM X;  1TN4 A;  1CTR A;  1UHK A;  2M0R A;  3NSO A;  3IQQ A;  3JVT C;  4CFR A;  1C7W A;  2SCP A;  2LNK A;  1FI6 A;  1BJF A;  1OZO A;  1K9U A;  1SL8 A;  1B8C A;  4JPZ B;  2F3Y A;  2Q4U A;  1OSA A;  2LCP A;  2KDH A;  1C7V A;  2M3W A;  1J55 A;  1PUL A;  1S5G Z;  3CWG A;  2ZN8 A;  4XJK A;  3CLN A;  1CLM A;  2JNF A;  1TCO B;  2I94 A;  1SBJ A;  3TS5 B;  1QS7 A;  3ZNI A;  4HRE E;  1S6J A;  2CNP A;  1RJV A;  1CNP A;  2KI6 D;  4ICB A;  1MXL C;  2K7O A;  2L4H A;  4MN0 A;  1TIZ A;  1OOJ A;  2CT9 A;  4PCW A;  4XYN A;  1WLZ A;  1QTX A;  1AJ4 A;  1KCY A;  4OR9 B;  1BOC A;  2SAS A;  2FOT A;  2K0J A;  2CCM A;  2WOR A;  2JXC A;  3PFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...