2K0JA

Solution structure of cam complexed to drp1p
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
147
structure length
147
Chain Sequence
DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords calmodulin
publication title Accurate solution structures of proteins from X-ray data and a minimal set of NMR data: calmodulin-peptide complexes as examples.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 46
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k0jA00
1G4YR 4PALA 2TN4A 1KK8C 2BCXA 3I5IC 3SG5A 3ZWHA 1N2DA 1F55A 3LK1A 2WNDA 2LMTA 1M31A 3I5HB 1ZOTB 2ZN8A 1BU3A 1ZUZA 2CBLA 2JWWA 1R2UA 2MHHA 2FOTA 2SCPA 5HLOA 1PVAA 1DF0A 4ETOA 2LCPA 1SPYA 4PE7A 1F70A 1YX7A 2KGRA 2WC8A 1CDNA 2HPSA 3EKJA 1DMOA 4OR9B 2KOTA 2ZNDA 3HCMA 2CXJA 4JWQA 4PE4A 1RFJA 2PRUA 1F4OA 2JQ6A 1LINA 1F54A 1SL7A 4NDDA 1S3PA 1TRFA 3ZNIA 1XO5A 4A4CA 1DT7B 1NSHA 2A4JA 3BYAA 1ZMZA 3BUMB 2L98A 4CIDA 5AEQA 3M0WA 1DJZA 3TS5B 5G08A 1TNXA 1EG4A 5DKQA 2K2AA 1FI5A 3IQQA 3JTDC 3SIBA 2LMUA 2JULA 1IQ5A 4PE1A 5AANA 1IJ5A 4R1EA 3VRPA 3PFVA 2KI4C 1K90D 2BECA 1SCMB 1KCYA 2KBMA 1K96A 1PSRA 3I5FB 5HKWA 4XJKA 5DKRA 2OS8B 1SRAA 4PCWA 1S36A 2PMYA 1QXPA 1AHRA 3C1VA 1BMOA 1WRZA 1BOCA 3CR2A 1DJWA 2LVVA 1LKJA 2BE4A 4GGNA 3EK7A 2CT9A 2NXQA 5HKZA 1JSAA 4I5JA 1YX8A 4ZCVA 2JU0A 4HSZA 1S5GZ 4OV2A 1WY9A 2B1UA 1OMDA 2O5GA 2LVJA 1TNQA 2BBMA 4MLWA 2LLUA 1Y1AA 3TDUA 1S26D 4PE0A 1J55A 1KQMB 4IL1A 1PSBA 1CMGA 3JVTC 1QLSA 3KO0A 2L51A 4YGEB 1XA5A 1DTLA 3GK1A 1GGZA 1BR4B 1EL4A 1PALA 4DIRA 4YGAA 3EVUA 1OQPA 1S6CA 2LHIA 3OX5A 1K95A 3O6BA 2LP3A 3PN7C 4YGCB 1QVIY 1Y1UA 3RM1A 4AOMA 3RLZA 3OHMB 4XYNA 1SR6B 3AAJA 2BL0C 1XFXO 1SKTA 2LLSA 1SBJA 2L5XB 1NPQA 3A4UB 1TNPA 2M8UA 1V1GA 3MSEB 5J3XA 2WOSA 1XFUO 5D69A 4ORAB 2FCDA 1UHNA 4QJ5B 2L4HA 3NSKA 4C0LA 1F71A 2M97A 1WDCB 2MLEC 4L9MA 1U5IB 2CNPA 1E8AA 5JJGA 1B1GA 2I7AA 1C7VA 4Q04A 1WLMA 2WCEA 3EK8A 2KQ6A 2Y5IA 3OB2B 4JPZB 3SG4A 3OP0A 2BKHB 2KAYA 1J7RA 1XK4C 1CLLA 2M7NA 3NXAA 1UUSA 2L4IA 3CWGA 1SL8A 2F3YA 1SK6D 2LM5A 1A4PA 2NCOA 3TDZA 2KI6D 1DF0B 2OTGB 2RGIA 5HKYA 4C0KA 1F4QA 2Y4QA 2F2OA 5AXIA 3H4SE 1RTP1 1KSMA 1CFCA 1B47A 2JXLA 1MHOA 1HT9A 4WQ2A 3DVJA 1KK8B 3I5IB 1JUOA 4MEWA 1OE9B 5JOLA 4CFQA 1BR1B 5KTYA 1BG1A 2EC6C 1XK4A 3NSIA 4ORCB 2QPTA 3BUOB 2MLFC 1S6IA 1CFDA 3PATA 2E30A 1NX3A 2K0JA 1OMVA 4YGDB 1PK0D 5I2QA 2K7BA 2LNKA 2HETA 1K9PA 1UHHA 3VROA 3OB1B 2E6WA 4DCKA 4M2OA 1DJYA 1YURA 3EK4A 2PVBA 1VRKA 4MSPA 3K21A 4YI9A 3BOWA 3KPXA 2KSPA 4XJKB 2M7LA 1AK8A 4A4BA 1Y0VH 2F8PA 3FS7A 1DGUA 1PULA 5I2LA 1CDLA 2JXCA 1RROA 2KFGA 1LA3A 2WCBA 2KNEA 2M9GA 1A03A 1WLZA 1QIWA 3JTDB 1MUXA 4GUKA 1B8CA 1NCZA 1YVLA 2JC2A 2L0PA 2PALA 3DVEA 4HRHA 4CLNA 2KI4B 1X02A 5K89A 3ICBA 2KAXA 1KK7Y 3VGOA 1D1OA 1DJIA 2LVIA 5HLVA 4GNKB 2AMIA 1FF1A 1QVIZ 1UHJA 3BUXB 2JOJA 1OZSA 1JC2A 1CM4A 1DJHA 1PRWA 3DVKA 1QX7A 4GFTA 2BKIB 1IWQA 2ZN9A 3LLEA 2M49B 2JNFA 1KFXL 1MQ1A 2Y1NA 1NCXA 4N1GA 1IH0A 3KHEA 1CDMA 2JPTA 4YI8A 1EH2A 2LHLA 2JTZA 2JT8A 3FWCA 3SJSA 1GQMA 1MWNA 1CM1A 1QJTA 4MRXA 2LANA 2O60A 2M29A 2COLB 3JVTB 1JFJA 2K7CA 4MRYA 3TZ1A 5CSIA 1BLQA 1MXLC 2HQWA 2SASA 1XVJA 4MZLA 3A8RA 3PN7B 1QASA 4NQGA 2HQ8A 2K8MB 4I5LB 5AERA 1IJ6A 4MVFA 2LUCA 2ZNEA 2P6BB 1FW4A 1V1FA 2BL0B 3WNXB 2MA2A 1IKUA 1TTXA 4GGFC 1S1EA 3AKBA 1QTXA 2I94A 2CTNA 3AKAA 1L7ZA 4AQJA 1J7QA 2LVKA 2KYFA 2KAVA 1L2OC 2F2PA 5B8IB 2WCFA 1AJ5A 3TDIA 1CMFA 2AAOA 5CSNA 1KQVA 1N0YA 1B8LA 3I5GC 5KU1A 3DF0B 2M3WA 4U8DA 4GGFA 1QLKA 4WQ3A 4E68A 2F3ZA 3KF9A 1UURA 3D0YB 2ZRTA 2JNXA 2Q4UA 1SY9A 1UHKA 1OSAA 2ZRSA 1K9UA 3SG6A 3D10A 1QX5B 2BCBA 5ER5A 1OOJA 4M2PA 1TCFA 3F45A 3WXAA 4ICBA 4GBAA 3TUYC 1YTZC 2ISDA 4F0ZB 2EC6B 4FTGA 3BOWB 2LUXA 1UP5A 4BY4A 2L2EA 4MBEA 5IBWA 3FWBA 1EXRA 1KK7Z 4YBHB 1CDPA 4PHNA 5KSZA 1FBVA 1JBAA 2MAZA 2LP2A 1QIVA 2K7DA 1JWDA 1F8HA 1B4CA 2KDHA 1S6JA 1ZFSA 3LCPC 1KWOC 1M39A 4OVNF 2DOQA 1DGVA 2EGDA 2JZIA 2LLTA 2KGBC 1YUSA 1W7IB 4I5KA 3DVMA 3CS1A 4GPLB 3LK0A 1TOPA 3BQ3A 1MXEA 4N1FA 1KFXS 3SG3A 2KBIA 1SYMA 4N5XA 2KQYA 2BCAA 1KFUL 2NLNA 1ALWA 2LMVA 5TNCA 4BY5A 4NDBA 5I2OA 1FPWA 4DS7A 1J1EA 1JF0A 2JT3A 2KI6C 2H2KA 2JTTA 4TNCA 1U5IA 3DD4A 1YR5A 1HQVA 2IS9A 1QS7A 1OZOA 1M45A 2M0RA 3AAKA 1J7OA 1DVIA 2FCEA 5D7FA 2ZFDA 1A75A 1B7TY 2G2BA 5PALA 3VRNA 2NCPA 4DUQA 3WHTB 1K93D 1GJYA 1LXFC 1K9KA 1YUUA 3O4YA 4M2QA 1UHIA 1CLMA 1SL9A 1GGWA 2GGZA 3EKHA 2LAPA 3BUNB 3CZTX 1BF5A 2K61A 1AUIB 1NIWA 1SW8A 1XFVO 1XFZO 3SIAA 1M46A 3I5HC 1QX2A 4DRWA 3CTNA 3GK2A 1LA0A 2NZ0A 1MR8A 4P2YB 2FJUB 2M1UA 4P5OE 2LV7A 1C7WA 4MZKA 1NP8A 2JT0A 1JF2A 5F6TA 3PALA 1BT6A 2BBNA 4HRGA 5CSFA 1R6PA 4HREE 1B9AA 3CGAA 1A2XA 1EG3A 4PHKA 1B8RA 1TIZA 4QJ3B 1YVHA 2KHNA 1CKKA 3QRXA 2Q91A 1XFYO 1XYDA 1Y6WA 2R2IA 1MF8B 1BJFA 3PLFB 1LVCD 4PHMA 3IQOA 3TS5C 4ZCUA 5ER4X 5FYXA 1IGVA 1M63B 2H61C 1AVSA 1JFKA 2EHBA 5BPJA 1QV0A 3VRRA 1K8UA 4GAOA 1L2OB 2I18A 1SCMC 1SNLA 3PSRA 1CLBA 3I5FC 2OS8C 1J1DA 4OKHA 1PVBA 3GOFA 3EVRA 3HX4A 1Q80A 2HF5A 3I5GB 4QJ4B 2CCMA 1YRUB 4CFRA 1NYAA 1TNWA 4YRUA 5HYDA 2QACA 3NSLA 2H61A 2L50A 1C07A 1CB1A 5AFPA 1TCOB 2WORA 1J7PA 1NX1A 1RECA 2Y1MA 1G33A 2I2RE 4I5NB 3EVVA 5GQQC 2LE9B 1H8BA 1K94A 1ZACA 1AP4A 3TUYB 3GK4X 1KFUS 5DKNA 4MZJA 1CFFA 1KQMC 1YRTB 1TN4A 1DJGA 2V53A 3NSOA 1Y1XA 2GV5A 4JQ0D 4UPGA 1SCVA 1XFWO 2KFFA 3O2PA 2BE6A 2MBXA 2LC5A 5CSJA 3E3RA 1NX2A 1OMRA 1B7TZ 3CR4X 2M1KB 1W7JB 1NWDA 3KEVA 3O78A 1CFPA 1QATA 2GGMA 1SR6C 3BXKA 3CR5X 4NDCA 4MN0A 1NCYA 1KWOB 1AJ4A 2MRDA 4PDZA 1IG5A 2VRGA 3FIAA 1KSOA 3LL8B 3WHUB 1G8IA 1K2HA 4FQOA 1YUTA 1RWYA 1IRJA 2KYCA 4ORBB 1WRLA 2KFHA 1S5GY 1A75B 1WDCC 4OCIA 4WRIA 5CPVA 1H4BA 1CNPA 2K2FA 1N65A 2D8NA 4C0JA 2F33A 2OPOA 3VRQA 1EJ3A 4AQIA 1NUBA 1ALVA 1NX0A 3SG7A 1WRKA 2MJWB 3SG2A 4YGBB 1DJXA 1SMGA 2K7OA 3OX6A 4PHJA 4CPVA 1CTRA 1BODA 1RJVA 3BUWB 1A29A 1RK9A 3IF7A 4D1EA 1QV1A 2G9BA 2PASA 2OTGC 2PSRA 3PM8A 1IQ3A 1ODBA 1UWOA 3CLNA 1FI6A 3DF0A 2AUCA 2ZKMX 2JRFA 4USLA 5I8NA 3D0YA
chains in the Genus database with same CATH superfamily
1GM0A 2GTEA 1G4YR 4PALA 2TN4A 1KK8C 2BCXA 3I5IC 3SG5A 3ZWHA 1N2DA 5EL2A 1F55A 3LK1A 3B6XA 2WNDA 2LMTA 1M31A 3I5HB 1ZOTB 1TUJA 2ZN8A 1BU3A 1ZUZA 3UO9A 2CBLA 2JWWA 1R2UA 2MHHA 2FOTA 2SCPA 5HLOA 1PVAA 1DF0A 2P71A 2LCPA 4ETOA 1SPYA 4PE7A 1F70A 3R72A 1YX7A 2KGRA 2WC8A 4PT1A 1CDNA 2HPSA 3EKJA 1DMOA 4OR9B 2KOTA 2ZNDA 3HCMA 2ERBA 2CXJA 4JWQA 4PE4A 1RFJA 2PRUA 2H8VA 1F4OA 2JQ6A 1LINA 3R1PA 1F54A 1SL7A 4NDDA 1DEKA 3S0FA 1S3PA 1TRFA 3ZNIA 1XO5A 4A4CA 1DT7B 1NSHA 2A4JA 3BYAA 1ZMZA 3BUMB 2L98A 4CIDA 5AEQA 3M0WA 1DJZA 3TS5B 5G08A 1TNXA 1EG4A 2P70A 5DKQA 2K2AA 1FI5A 3IQQA 3JTDC 3SIBA 2LMUA 2JULA 1IQ5A 4PE1A 5AANA 1IJ5A 3BJHA 4R1EA 3VRPA 3PFVA 2KI4C 1K90D 2BECA 1SCMB 1KCYA 2KBMA 1K96A 2QDIA 4INXA 1IIOA 1PSRA 3I5FB 5HKWA 4XJKA 5DKRA 2OS8B 1SRAA 4PCWA 1S36A 2PMYA 1QXPA 1AHRA 3C1VA 1BMOA 1WRZA 3B86A 1BOCA 3CR2A 1DJWA 2LVVA 1LKJA 2BE4A 1W9ZA 4GGNA 3EK7A 3NHIA 2CT9A 2NXQA 5HKZA 3QMEA 1JSAA 4I5JA 1YX8A 2PYQA 1CFFA 4ZCVA 2JU0A 1Z4HA 2QEHA 1S5GZ 4HSZA 4OV2A 1WY9A 2B1UA 1OMDA 2O5GA 2LVJA 1TNQA 2BBMA 4MLWA 2LLUA 2K60A 1Y1AA 3TDUA 1S26D 4PE0A 1J55A 1KQMB 4IL1A 3NGVA 1PSBA 1CMGA 3JVTC 1QLSA 3KO0A 2L51A 4YGEB 1XA5A 1DTLA 3GK1A 1GGZA 1BR4B 1EL4A 1PALA 4DIRA 4YGAA 3EVUA 1OQPA 1S6CA 2LHIA 3OX5A 1K95A 3O6BA 2LP3A 3PN7C 4YGCB 1QVIY 1Y1UA 3RM1A 4AOMA 3RLZA 3OHMB 3B87A 4XYNA 1SR6B 3AAJA 2WCLA 2BL0C 1XFXO 1SKTA 2LLSA 1SBJA 2L5XB 1NPQA 2QEBA 1TNPA 2M8UA 1V1GA 3A4UB 3MSEB 2WOSA 5J3XA 1XFUO 3BFAA 5D69A 1ORGA 4ORAB 2FCDA 1UHNA 4QJ5B 2L4HA 3NSKA 4C0LA 1F71A 2M97A 1WDCB 2MLEC 4L9MA 1U5IB 2CNPA 1E8AA 5JJGA 1B1GA 2I7AA 3BFBA 3L47A 4Q04A 3VB1A 1C7VA 1WLMA 2WCEA 3EK8A 2KQ6A 3FE9A 2Y5IA 3OB2B 1OW4A 4JPZB 3SG4A 3SS4A 3OP0A 2BKHB 2KAYA 1J7RA 1XK4C 1CLLA 2M7NA 3NXAA 1UUSA 2L4IA 3CWGA 1SL8A 2F3YA 1SK6D 2LM5A 1A4PA 2NCOA 3TDZA 2KI6D 1DF0B 2OTGB 2RGIA 5HKYA 4C0KA 1F4QA 2Y4QA 2F2OA 5AXIA 3H4SE 1RTP1 1KSMA 1CFCA 1B47A 2JXLA 1MHOA 1HT9A 4WQ2A 3CZ2A 1KK8B 3DVJA 1JUOA 3I5IB 1OE9B 4MEWA 5JOLA 4CFQA 1BR1B 5KTYA 1BG1A 2EC6C 1XK4A 3NSIA 4JD9A 4ORCB 2QPTA 3DYEA 3BUOB 2MLFC 3EG5B 1S6IA 1CFDA 3PATA 3FE6A 2E30A 1NX3A 2BNXA 2K0JA 1OMVA 4YGDB 1PK0D 5I2QA 2K7BA 2LNKA 2HETA 1K9PA 2WCMA 1UHHA 3VROA 3OB1B 3S0BA 2E6WA 4DCKA 4M2OA 1DJYA 1YURA 3EK4A 2PVBA 1VRKA 4MSPA 3RZSA 3K21A 4YI9A 3BOWA 1TUZA 3KPXA 2PQLA 3BFHA 2KSPA 4XJKB 2M7LA 1AK8A 4A4BA 1Y0VH 2F8PA 3D73A 3FS7A 1DGUA 1PULA 5I2LA 1CDLA 2JXCA 1RROA 2KFGA 3D76A 1LA3A 2WCBA 2KNEA 2M9GA 3CABA 1A03A 1WLZA 1QIWA 2KLDA 3JTDB 1MUXA 4GUKA 3CDNA 1B8CA 1NCZA 1YVLA 2JC2A 2L0PA 2PALA 3DVEA 4HRHA 4CLNA 2KI4B 1X02A 5K89A 3ICBA 2KAXA 1KK7Y 3VGOA 1D1OA 1DJIA 5I94A 2LVIA 5HLVA 1OOIX 4GNKB 2AMIA 1FF1A 1QVIZ 1UHJA 3BUXB 2JOJA 1OZSA 1JC2A 1CM4A 1DJHA 1PRWA 3DVKA 1QX7A 4GFTA 2BKIB 1IWQA 1OOHA 2ZN9A 3LLEA 1DELA 3SS5A 2M49B 2JNFA 1KFXL 1MQ1A 2Y1NA 1C3ZA 1NCXA 4N1GA 2WCJA 1IH0A 3KHEA 1CDMA 2JPTA 4YI8A 1EH2A 2LHLA 2JPOA 2JTZA 2JT8A 3DZTA 3FWCA 3SJSA 5FI6A 1GQMA 1MWNA 1CM1A 1QJTA 4MRXA 2LANA 2O60A 2M29A 2COLB 3R1OA 3JVTB 1JFJA 2K7CA 2WC6A 4MRYA 3O4XA 3TZ1A 5CSIA 1BLQA 1MXLC 2HQWA 2SASA 3S0AA 1XVJA 4MZLA 3A8RA 3L4LA 3PN7B 1QASA 4NQGA 2HQ8A 2L2CA 3S0DA 2K8MB 4I5LB 3K1EA 1IJ6A 4MVFA 2LUCA 2ZNEA 5AERA 2P6BB 1FW4A 1V1FA 2BL0B 3WNXB 2WCKA 2MA2A 1IKUA 1TTXA 4GGFC 1S1EA 3AKBA 1QTXA 2I94A 2CTNA 3AKAA 3S0GA 1L7ZA 4AQJA 1J7QA 2LVKA 2KYFA 2KAVA 1L2OC 2F2PA 1LS8A 5B8IB 2WCFA 1AJ5A 3D77A 3TDIA 1CMFA 2AAOA 5CSNA 1KQVA 1DQEA 1N0YA 1B8LA 3I5GC 5KU1A 3DF0B 2M3WA 4U8DA 4GGFA 1QLKA 3FE8A 4WQ3A 4F7FA 4E68A 2F3ZA 3KF9A 1UURA 3D0YB 1DC1A 2ZRTA 3D74A 2KLEA 2JNXA 3UNWA 2Q4UA 1SY9A 1UHKA 1OSAA 2ZRSA 1K9UA 3SG6A 3D10A 1QX5B 5I8NA 2BCBA 5ER5A 1OOJA 4M2PA 1TCFA 3F45A 3WXAA 4ICBA 1TWOA 4GBAA 3TUYC 1YTZC 2ISDA 4F0ZB 5HL1A 2EC6B 4FTGA 3BOWB 2LUXA 1UP5A 4BY4A 2L2EA 4MBEA 5IBWA 4JKTA 4KYNA 3FWBA 3PJIA 1EXRA 1KK7Z 2KPHA 4YBHB 1CDPA 3D78A 4PHNA 1XFRA 5KSZA 1FBVA 1OOGA 1JBAA 2MAZA 2LP2A 1QIVA 2K7DA 1JWDA 1F8HA 1B4CA 3N7HA 2KDHA 1S6JA 1ZFSA 3LCPC 4FQTA 1KWOC 1M39A 4OVNF 2DOQA 1DGVA 2EGDA 2JZIA 2L5YA 2LLTA 2KGBC 1YUSA 1W7IB 4I5KA 3DVMA 3CS1A 4GPLB 3LK0A 1TOPA 3BQ3A 1MXEA 4N1FA 1KFXS 3SG3A 2KBIA 1SYMA 4N5XA 2KQYA 2BCAA 1KFUL 2YGUA 3B88A 2NLNA 3PM2A 3SS3A 1ALWA 2LMVA 5TNCA 4BY5A 3OBVA 4NDBA 5I2OA 1FPWA 4DS7A 1J1EA 1JF0A 2JT3A 4INWA 2KI6C 2H2KA 2JTTA 1OOFA 1U5IA 1T14A 4TNCA 3DD4A 3CZ1A 1YR5A 1HQVA 2IS9A 1QS7A 1OZOA 1M45A 2M0RA 3AAKA 1J7OA 1DVIA 2FCEA 2FJYA 5D7FA 2ZFDA 1A75A 1B7TY 2G2BA 5PALA 3VRNA 2NCPA 4DUQA 3WHTB 1K93D 1GJYA 1LXFC 1K9KA 1YUUA 3O4YA 3R1VA 1UHIA 1CLMA 1SL9A 4M2QA 1GGWA 2GGZA 3EKHA 2LAPA 3BUNB 3CZTX 1BF5A 2K61A 1AUIB 1NIWA 1SW8A 1XFVO 1XFZO 1Z2CB 3SIAA 1M46A 3I5HC 1QX2A 4DRWA 3CTNA 3GK2A 1LA0A 2NZ0A 1MR8A 4P2YB 2FJUB 2M1UA 3Q8IA 2LV7A 2WC5A 4P5OE 1C7WA 4MZKA 1NP8A 2JT0A 1JF2A 5F6TA 3PALA 1BT6A 2BBNA 4HRGA 5CSFA 1R6PA 4HREE 1B9AA 3OGNA 3CGAA 1A2XA 1EG3A 4PHKA 1B8RA 1TIZA 4QJ3B 1YVHA 2KHNA 5FI7A 1CKKA 3QRXA 2Q91A 1XFYO 1XYDA 1Y6WA 2R2IA 1MF8B 1BJFA 3PLFB 1LVCD 1P28A 3IVTA 4PHMA 3IQOA 3TS5C 4ZCUA 5ER4X 5FYXA 2WCHA 1IGVA 1M63B 2H61C 1AVSA 1JFKA 2EHBA 5BPJA 1QV0A 3VRRA 1K8UA 4GAOA 1L2OB 2I18A 1SCMC 1SNLA 3B7AA 3PSRA 1CLBA 3I5FC 2OS8C 1J1DA 4OKHA 1PVBA 3GOFA 3EVRA 3HX4A 1Q80A 3D75A 3NHTA 2HF5A 3I5GB 3CZ0A 4QJ4B 2CCMA 3CYZA 1YRUB 4CFRA 1NYAA 1TNWA 4YRUA 5HYDA 2QACA 3NSLA 2H61A 2L50A 1C07A 1CB1A 5AFPA 1TCOB 2WORA 1J7PA 1NX1A 1RECA 2Y1MA 1G33A 2I2RE 4I5NB 3EVVA 5GQQC 2LE9B 1H8BA 1K94A 1ZACA 1AP4A 4IJ7A 3GK4X 1KFUS 5DKNA 4MZJA 3TUYB 1KQMC 1YRTB 1TN4A 3DY9A 1DJGA 2V53A 3NSOA 1Y1XA 2GV5A 4JQ0D 4UPGA 1SCVA 1XFWO 2KFFA 2QEVA 3O2PA 2BE6A 4OZDA 2MBXA 2LC5A 5CSJA 3E3RA 1NX2A 1OMRA 1B7TZ 3CR4X 2M1KB 1W7JB 1NWDA 2QEOA 3KEVA 3O78A 3V2LA 1QATA 1CFPA 2GGMA 1SR6C 3BXKA 3CR5X 4NDCA 4MN0A 3S0EA 1NCYA 1KWOB 1AJ4A 2MRDA 4PDZA 1IG5A 2VRGA 3FIAA 1KSOA 3LL8B 3WHUB 1G8IA 1K2HA 4FQOA 1YUTA 1RWYA 1IRJA 2KYCA 5D3OA 4ORBB 1WRLA 2KFHA 1S5GY 1A75B 1WDCC 4OCIA 4WRIA 5CPVA 1H4BA 1CNPA 2K2FA 1N65A 2D8NA 5DICA 2F33A 4C0JA 2OPOA 3VRQA 1C3YA 1EJ3A 4AQIA 1NUBA 1ALVA 1NX0A 3SG7A 1SSEB 1WRKA 2MJWB 3SG2A 4YGBB 1DJXA 1SMGA 2K7OA 3OX6A 4PHJA 4CPVA 1CTRA 1BODA 1RJVA 3BUWB 2BAPA 1QWVA 1A29A 1RK9A 3IF7A 4D1EA 1QV1A 3DXLA 2G9BA 2PASA 2OTGC 2PSRA 3PM8A 1IQ3A 1ODBA 1UWOA 3CLNA 1FI6A 3DF0A 2AUCA 2ZKMX 2JRFA 5FI2A 4USLA 3L4AA 3D0YA
chains in the Genus database with same CATH topology
1G4YR 4PALA 2TN4A 1KK8C 2BCXA 3I5IC 3SG5A 3ZWHA 1N2DA 1F55A 3LK1A 2WNDA 2LMTA 1M31A 3I5HB 1ZOTB 2ZN8A 1BU3A 1ZUZA 2CBLA 2JWWA 1R2UA 2MHHA 2FOTA 2SCPA 5HLOA 1PVAA 1DF0A 4ETOA 2LCPA 1SPYA 4PE7A 1F70A 1YX7A 2KGRA 2WC8A 1CDNA 2HPSA 3EKJA 1DMOA 4OR9B 2KOTA 2ZNDA 3HCMA 2CXJA 4JWQA 4PE4A 1RFJA 2PRUA 1F4OA 2JQ6A 1LINA 1F54A 1SL7A 4NDDA 1S3PA 1TRFA 3ZNIA 1XO5A 4A4CA 1DT7B 1NSHA 2A4JA 3BYAA 1ZMZA 3BUMB 2L98A 4CIDA 5AEQA 3M0WA 1DJZA 3TS5B 5G08A 1TNXA 1EG4A 5DKQA 2K2AA 1FI5A 3IQQA 3JTDC 3SIBA 2LMUA 2JULA 1IQ5A 4PE1A 5AANA 1IJ5A 4R1EA 3VRPA 3PFVA 2KI4C 1K90D 2BECA 1SCMB 1KCYA 2KBMA 1K96A 1PSRA 3I5FB 5HKWA 4XJKA 5DKRA 2OS8B 1SRAA 4PCWA 1S36A 2PMYA 1QXPA 1AHRA 3C1VA 1BMOA 1WRZA 1BOCA 3CR2A 1DJWA 2LVVA 1LKJA 2BE4A 4GGNA 3EK7A 2CT9A 2NXQA 5HKZA 1JSAA 4I5JA 1YX8A 4ZCVA 2JU0A 4HSZA 1S5GZ 4OV2A 1WY9A 2B1UA 1OMDA 2O5GA 2LVJA 1TNQA 2BBMA 4MLWA 2LLUA 1Y1AA 3TDUA 1S26D 4PE0A 1J55A 1KQMB 4IL1A 1PSBA 1CMGA 3JVTC 1QLSA 3KO0A 2L51A 4YGEB 1XA5A 1DTLA 3GK1A 1GGZA 1BR4B 1EL4A 1PALA 4DIRA 4YGAA 3EVUA 1OQPA 1S6CA 2LHIA 3OX5A 1K95A 3O6BA 2LP3A 3PN7C 4YGCB 1QVIY 1Y1UA 3RM1A 4AOMA 3RLZA 3OHMB 4XYNA 1SR6B 3AAJA 2BL0C 1XFXO 1SKTA 2LLSA 1SBJA 2L5XB 1NPQA 3A4UB 1TNPA 2M8UA 1V1GA 3MSEB 5J3XA 2WOSA 1XFUO 5D69A 4ORAB 2FCDA 1UHNA 4QJ5B 2L4HA 3NSKA 4C0LA 1F71A 2M97A 1WDCB 2MLEC 4L9MA 1U5IB 2CNPA 1E8AA 5JJGA 1B1GA 2I7AA 1C7VA 4Q04A 1WLMA 2WCEA 3EK8A 2KQ6A 2Y5IA 3OB2B 4JPZB 3SG4A 3OP0A 2BKHB 2KAYA 1J7RA 1XK4C 1CLLA 2M7NA 3NXAA 1UUSA 2L4IA 3CWGA 1SL8A 2F3YA 1SK6D 2LM5A 1A4PA 2NCOA 3TDZA 2KI6D 1DF0B 2OTGB 2RGIA 5HKYA 4C0KA 1F4QA 2Y4QA 2F2OA 5AXIA 3H4SE 1RTP1 1KSMA 1CFCA 1B47A 2JXLA 1MHOA 1HT9A 4WQ2A 3DVJA 1KK8B 3I5IB 1JUOA 4MEWA 1OE9B 5JOLA 4CFQA 1BR1B 5KTYA 1BG1A 2EC6C 1XK4A 3NSIA 4ORCB 2QPTA 3BUOB 2MLFC 1S6IA 1CFDA 3PATA 2E30A 1NX3A 2K0JA 1OMVA 4YGDB 1PK0D 5I2QA 2K7BA 2LNKA 2HETA 1K9PA 1UHHA 3VROA 3OB1B 2E6WA 4DCKA 4M2OA 1DJYA 1YURA 3EK4A 2PVBA 1VRKA 4MSPA 3K21A 4YI9A 3BOWA 3KPXA 2KSPA 4XJKB 2M7LA 1AK8A 4A4BA 1Y0VH 2F8PA 3FS7A 1DGUA 1PULA 5I2LA 1CDLA 2JXCA 1RROA 2KFGA 1LA3A 2WCBA 2KNEA 2M9GA 1A03A 1WLZA 1QIWA 3JTDB 1MUXA 4GUKA 1B8CA 1NCZA 1YVLA 2JC2A 2L0PA 2PALA 3DVEA 4HRHA 4CLNA 2KI4B 1X02A 5K89A 3ICBA 2KAXA 1KK7Y 3VGOA 1D1OA 1DJIA 2LVIA 5HLVA 4GNKB 2AMIA 1FF1A 1QVIZ 1UHJA 3BUXB 2JOJA 1OZSA 1JC2A 1CM4A 1DJHA 1PRWA 3DVKA 1QX7A 4GFTA 2BKIB 1IWQA 2ZN9A 3LLEA 2M49B 2JNFA 1KFXL 1MQ1A 2Y1NA 1NCXA 4N1GA 1IH0A 3KHEA 1CDMA 2JPTA 4YI8A 1EH2A 2LHLA 2JTZA 2JT8A 3FWCA 3SJSA 1GQMA 1MWNA 1CM1A 1QJTA 4MRXA 2LANA 2O60A 2M29A 2COLB 3JVTB 1JFJA 2K7CA 4MRYA 3TZ1A 5CSIA 1BLQA 1MXLC 2HQWA 2SASA 1XVJA 4MZLA 3A8RA 3PN7B 1QASA 4NQGA 2HQ8A 2K8MB 4I5LB 5AERA 1IJ6A 4MVFA 2LUCA 2ZNEA 2P6BB 1FW4A 1V1FA 2BL0B 3WNXB 2MA2A 1IKUA 1TTXA 4GGFC 1S1EA 3AKBA 1QTXA 2I94A 2CTNA 3AKAA 1L7ZA 4AQJA 1J7QA 2LVKA 2KYFA 2KAVA 1L2OC 2F2PA 5B8IB 2WCFA 1AJ5A 3TDIA 1CMFA 2AAOA 5CSNA 1KQVA 1N0YA 1B8LA 3I5GC 5KU1A 3DF0B 2M3WA 4U8DA 4GGFA 1QLKA 4WQ3A 4E68A 2F3ZA 3KF9A 1UURA 3D0YB 2ZRTA 2JNXA 2Q4UA 1SY9A 1UHKA 1OSAA 2ZRSA 1K9UA 3SG6A 3D10A 1QX5B 2BCBA 5ER5A 1OOJA 4M2PA 1TCFA 3F45A 3WXAA 4ICBA 4GBAA 3TUYC 1YTZC 2ISDA 4F0ZB 2EC6B 4FTGA 3BOWB 2LUXA 1UP5A 4BY4A 2L2EA 4MBEA 5IBWA 3FWBA 1EXRA 1KK7Z 4YBHB 1CDPA 4PHNA 5KSZA 1FBVA 1JBAA 2MAZA 2LP2A 1QIVA 2K7DA 1JWDA 1F8HA 1B4CA 2KDHA 1S6JA 1ZFSA 3LCPC 1KWOC 1M39A 4OVNF 2DOQA 1DGVA 2EGDA 2JZIA 2LLTA 2KGBC 1YUSA 1W7IB 4I5KA 3DVMA 3CS1A 4GPLB 3LK0A 1TOPA 3BQ3A 1MXEA 4N1FA 1KFXS 3SG3A 2KBIA 1SYMA 4N5XA 2KQYA 2BCAA 1KFUL 2NLNA 1ALWA 2LMVA 5TNCA 4BY5A 4NDBA 5I2OA 1FPWA 4DS7A 1J1EA 1JF0A 2JT3A 2KI6C 2H2KA 2JTTA 4TNCA 1U5IA 3DD4A 1YR5A 1HQVA 2IS9A 1QS7A 1OZOA 1M45A 2M0RA 3AAKA 1J7OA 1DVIA 2FCEA 5D7FA 2ZFDA 1A75A 1B7TY 2G2BA 5PALA 3VRNA 2NCPA 4DUQA 3WHTB 1K93D 1GJYA 1LXFC 1K9KA 1YUUA 3O4YA 4M2QA 1UHIA 1CLMA 1SL9A 1GGWA 2GGZA 3EKHA 2LAPA 3BUNB 3CZTX 1BF5A 2K61A 1AUIB 1NIWA 1SW8A 1XFVO 1XFZO 3SIAA 1M46A 3I5HC 1QX2A 4DRWA 3CTNA 3GK2A 1LA0A 2NZ0A 1MR8A 4P2YB 2FJUB 2M1UA 4P5OE 2LV7A 1C7WA 4MZKA 1NP8A 2JT0A 1JF2A 5F6TA 3PALA 1BT6A 2BBNA 4HRGA 5CSFA 1R6PA 4HREE 1B9AA 3CGAA 1A2XA 1EG3A 4PHKA 1B8RA 1TIZA 4QJ3B 1YVHA 2KHNA 1CKKA 3QRXA 2Q91A 1XFYO 1XYDA 1Y6WA 2R2IA 1MF8B 1BJFA 3PLFB 1LVCD 4PHMA 3IQOA 3TS5C 4ZCUA 5ER4X 5FYXA 1IGVA 1M63B 2H61C 1AVSA 1JFKA 2EHBA 5BPJA 1QV0A 3VRRA 1K8UA 4GAOA 1L2OB 2I18A 1SCMC 1SNLA 3PSRA 1CLBA 3I5FC 2OS8C 1J1DA 4OKHA 1PVBA 3GOFA 3EVRA 3HX4A 1Q80A 2HF5A 3I5GB 4QJ4B 2CCMA 1YRUB 4CFRA 1NYAA 1TNWA 4YRUA 5HYDA 2QACA 3NSLA 2H61A 2L50A 1C07A 1CB1A 5AFPA 1TCOB 2WORA 1J7PA 1NX1A 1RECA 2Y1MA 1G33A 2I2RE 4I5NB 3EVVA 5GQQC 2LE9B 1H8BA 1K94A 1ZACA 1AP4A 3TUYB 3GK4X 1KFUS 5DKNA 4MZJA 1CFFA 1KQMC 1YRTB 1TN4A 1DJGA 2V53A 3NSOA 1Y1XA 2GV5A 4JQ0D 4UPGA 1SCVA 1XFWO 2KFFA 3O2PA 2BE6A 2MBXA 2LC5A 5CSJA 3E3RA 1NX2A 1OMRA 1B7TZ 3CR4X 2M1KB 1W7JB 1NWDA 3KEVA 3O78A 1CFPA 1QATA 2GGMA 1SR6C 3BXKA 3CR5X 4NDCA 4MN0A 1NCYA 1KWOB 1AJ4A 2MRDA 4PDZA 1IG5A 2VRGA 3FIAA 1KSOA 3LL8B 3WHUB 1G8IA 1K2HA 4FQOA 1YUTA 1RWYA 1IRJA 2KYCA 4ORBB 1WRLA 2KFHA 1S5GY 1A75B 1WDCC 4OCIA 4WRIA 5CPVA 1H4BA 1CNPA 2K2FA 1N65A 2D8NA 4C0JA 2F33A 2OPOA 3VRQA 1EJ3A 4AQIA 1NUBA 1ALVA 1NX0A 3SG7A 1WRKA 2MJWB 3SG2A 4YGBB 1DJXA 1SMGA 2K7OA 3OX6A 4PHJA 4CPVA 1CTRA 1BODA 1RJVA 3BUWB 1A29A 1RK9A 3IF7A 4D1EA 1QV1A 2G9BA 2PASA 2OTGC 2PSRA 3PM8A 1IQ3A 1ODBA 1UWOA 3CLNA 1FI6A 3DF0A 2AUCA 2ZKMX 2JRFA 4USLA 5I8NA 3D0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G4Y R;  4PAL A;  2TN4 A;  1KK8 C;  2BCX A;  3I5I C;  3SG5 A;  3ZWH A;  1N2D A;  1F55 A;  3LK1 A;  2WND A;  2LMT A;  1M31 A;  3I5H B;  1ZOT B;  2ZN8 A;  1BU3 A;  1ZUZ A;  2CBL A;  2JWW A;  1R2U A;  2MHH A;  2FOT A;  2SCP A;  5HLO A;  1PVA A;  1DF0 A;  4ETO A;  2LCP A;  1SPY A;  4PE7 A;  1F70 A;  1YX7 A;  2KGR A;  2WC8 A;  1CDN A;  2HPS A;  3EKJ A;  1DMO A;  4OR9 B;  2KOT A;  2ZND A;  3HCM A;  2CXJ A;  4JWQ A;  4PE4 A;  1RFJ A;  2PRU A;  1F4O A;  2JQ6 A;  1LIN A;  1F54 A;  1SL7 A;  4NDD A;  1S3P A;  1TRF A;  3ZNI A;  1XO5 A;  4A4C A;  1DT7 B;  1NSH A;  2A4J A;  3BYA A;  1ZMZ A;  3BUM B;  2L98 A;  4CID A;  5AEQ A;  3M0W A;  1DJZ A;  3TS5 B;  5G08 A;  1TNX A;  1EG4 A;  5DKQ A;  2K2A A;  1FI5 A;  3IQQ A;  3JTD C;  3SIB A;  2LMU A;  2JUL A;  1IQ5 A;  4PE1 A;  5AAN A;  1IJ5 A;  4R1E A;  3VRP A;  3PFV A;  2KI4 C;  1K90 D;  2BEC A;  1SCM B;  1KCY A;  2KBM A;  1K96 A;  1PSR A;  3I5F B;  5HKW A;  4XJK A;  5DKR A;  2OS8 B;  1SRA A;  4PCW A;  1S36 A;  2PMY A;  1QXP A;  1AHR A;  3C1V A;  1BMO A;  1WRZ A;  1BOC A;  3CR2 A;  1DJW A;  2LVV A;  1LKJ A;  2BE4 A;  4GGN A;  3EK7 A;  2CT9 A;  2NXQ A;  5HKZ A;  1JSA A;  4I5J A;  1YX8 A;  4ZCV A;  2JU0 A;  4HSZ A;  1S5G Z;  4OV2 A;  1WY9 A;  2B1U A;  1OMD A;  2O5G A;  2LVJ A;  1TNQ A;  2BBM A;  4MLW A;  2LLU A;  1Y1A A;  3TDU A;  1S26 D;  4PE0 A;  1J55 A;  1KQM B;  4IL1 A;  1PSB A;  1CMG A;  3JVT C;  1QLS A;  3KO0 A;  2L51 A;  4YGE B;  1XA5 A;  1DTL A;  3GK1 A;  1GGZ A;  1BR4 B;  1EL4 A;  1PAL A;  4DIR A;  4YGA A;  3EVU A;  1OQP A;  1S6C A;  2LHI A;  3OX5 A;  1K95 A;  3O6B A;  2LP3 A;  3PN7 C;  4YGC B;  1QVI Y;  1Y1U A;  3RM1 A;  4AOM A;  3RLZ A;  3OHM B;  4XYN A;  1SR6 B;  3AAJ A;  2BL0 C;  1XFX O;  1SKT A;  2LLS A;  1SBJ A;  2L5X B;  1NPQ A;  3A4U B;  1TNP A;  2M8U A;  1V1G A;  3MSE B;  5J3X A;  2WOS A;  1XFU O;  5D69 A;  4ORA B;  2FCD A;  1UHN A;  4QJ5 B;  2L4H A;  3NSK A;  4C0L A;  1F71 A;  2M97 A;  1WDC B;  2MLE C;  4L9M A;  1U5I B;  2CNP A;  1E8A A;  5JJG A;  1B1G A;  2I7A A;  1C7V A;  4Q04 A;  1WLM A;  2WCE A;  3EK8 A;  2KQ6 A;  2Y5I A;  3OB2 B;  4JPZ B;  3SG4 A;  3OP0 A;  2BKH B;  2KAY A;  1J7R A;  1XK4 C;  1CLL A;  2M7N A;  3NXA A;  1UUS A;  2L4I A;  3CWG A;  1SL8 A;  2F3Y A;  1SK6 D;  2LM5 A;  1A4P A;  2NCO A;  3TDZ A;  2KI6 D;  1DF0 B;  2OTG B;  2RGI A;  5HKY A;  4C0K A;  1F4Q A;  2Y4Q A;  2F2O A;  5AXI A;  3H4S E;  1RTP 1;  1KSM A;  1CFC A;  1B47 A;  2JXL A;  1MHO A;  1HT9 A;  4WQ2 A;  3DVJ A;  1KK8 B;  3I5I B;  1JUO A;  4MEW A;  1OE9 B;  5JOL A;  4CFQ A;  1BR1 B;  5KTY A;  1BG1 A;  2EC6 C;  1XK4 A;  3NSI A;  4ORC B;  2QPT A;  3BUO B;  2MLF C;  1S6I A;  1CFD A;  3PAT A;  2E30 A;  1NX3 A;  2K0J A;  1OMV A;  4YGD B;  1PK0 D;  5I2Q A;  2K7B A;  2LNK A;  2HET A;  1K9P A;  1UHH A;  3VRO A;  3OB1 B;  2E6W A;  4DCK A;  4M2O A;  1DJY A;  1YUR A;  3EK4 A;  2PVB A;  1VRK A;  4MSP A;  3K21 A;  4YI9 A;  3BOW A;  3KPX A;  2KSP A;  4XJK B;  2M7L A;  1AK8 A;  4A4B A;  1Y0V H;  2F8P A;  3FS7 A;  1DGU A;  1PUL A;  5I2L A;  1CDL A;  2JXC A;  1RRO A;  2KFG A;  1LA3 A;  2WCB A;  2KNE A;  2M9G A;  1A03 A;  1WLZ A;  1QIW A;  3JTD B;  1MUX A;  4GUK A;  1B8C A;  1NCZ A;  1YVL A;  2JC2 A;  2L0P A;  2PAL A;  3DVE A;  4HRH A;  4CLN A;  2KI4 B;  1X02 A;  5K89 A;  3ICB A;  2KAX A;  1KK7 Y;  3VGO A;  1D1O A;  1DJI A;  2LVI A;  5HLV A;  4GNK B;  2AMI A;  1FF1 A;  1QVI Z;  1UHJ A;  3BUX B;  2JOJ A;  1OZS A;  1JC2 A;  1CM4 A;  1DJH A;  1PRW A;  3DVK A;  1QX7 A;  4GFT A;  2BKI B;  1IWQ A;  2ZN9 A;  3LLE A;  2M49 B;  2JNF A;  1KFX L;  1MQ1 A;  2Y1N A;  1NCX A;  4N1G A;  1IH0 A;  3KHE A;  1CDM A;  2JPT A;  4YI8 A;  1EH2 A;  2LHL A;  2JTZ A;  2JT8 A;  3FWC A;  3SJS A;  1GQM A;  1MWN A;  1CM1 A;  1QJT A;  4MRX A;  2LAN A;  2O60 A;  2M29 A;  2COL B;  3JVT B;  1JFJ A;  2K7C A;  4MRY A;  3TZ1 A;  5CSI A;  1BLQ A;  1MXL C;  2HQW A;  2SAS A;  1XVJ A;  4MZL A;  3A8R A;  3PN7 B;  1QAS A;  4NQG A;  2HQ8 A;  2K8M B;  4I5L B;  5AER A;  1IJ6 A;  4MVF A;  2LUC A;  2ZNE A;  2P6B B;  1FW4 A;  1V1F A;  2BL0 B;  3WNX B;  2MA2 A;  1IKU A;  1TTX A;  4GGF C;  1S1E A;  3AKB A;  1QTX A;  2I94 A;  2CTN A;  3AKA A;  1L7Z A;  4AQJ A;  1J7Q A;  2LVK A;  2KYF A;  2KAV A;  1L2O C;  2F2P A;  5B8I B;  2WCF A;  1AJ5 A;  3TDI A;  1CMF A;  2AAO A;  5CSN A;  1KQV A;  1N0Y A;  1B8L A;  3I5G C;  5KU1 A;  3DF0 B;  2M3W A;  4U8D A;  4GGF A;  1QLK A;  4WQ3 A;  4E68 A;  2F3Z A;  3KF9 A;  1UUR A;  3D0Y B;  2ZRT A;  2JNX A;  2Q4U A;  1SY9 A;  1UHK A;  1OSA A;  2ZRS A;  1K9U A;  3SG6 A;  3D10 A;  1QX5 B;  2BCB A;  5ER5 A;  1OOJ A;  4M2P A;  1TCF A;  3F45 A;  3WXA A;  4ICB A;  4GBA A;  3TUY C;  1YTZ C;  2ISD A;  4F0Z B;  2EC6 B;  4FTG A;  3BOW B;  2LUX A;  1UP5 A;  4BY4 A;  2L2E A;  4MBE A;  5IBW A;  3FWB A;  1EXR A;  1KK7 Z;  4YBH B;  1CDP A;  4PHN A;  5KSZ A;  1FBV A;  1JBA A;  2MAZ A;  2LP2 A;  1QIV A;  2K7D A;  1JWD A;  1F8H A;  1B4C A;  2KDH A;  1S6J A;  1ZFS A;  3LCP C;  1KWO C;  1M39 A;  4OVN F;  2DOQ A;  1DGV A;  2EGD A;  2JZI A;  2LLT A;  2KGB C;  1YUS A;  1W7I B;  4I5K A;  3DVM A;  3CS1 A;  4GPL B;  3LK0 A;  1TOP A;  3BQ3 A;  1MXE A;  4N1F A;  1KFX S;  3SG3 A;  2KBI A;  1SYM A;  4N5X A;  2KQY A;  2BCA A;  1KFU L;  2NLN A;  1ALW A;  2LMV A;  5TNC A;  4BY5 A;  4NDB A;  5I2O A;  1FPW A;  4DS7 A;  1J1E A;  1JF0 A;  2JT3 A;  2KI6 C;  2H2K A;  2JTT A;  4TNC A;  1U5I A;  3DD4 A;  1YR5 A;  1HQV A;  2IS9 A;  1QS7 A;  1OZO A;  1M45 A;  2M0R A;  3AAK A;  1J7O A;  1DVI A;  2FCE A;  5D7F A;  2ZFD A;  1A75 A;  1B7T Y;  2G2B A;  5PAL A;  3VRN A;  2NCP A;  4DUQ A;  3WHT B;  1K93 D;  1GJY A;  1LXF C;  1K9K A;  1YUU A;  3O4Y A;  4M2Q A;  1UHI A;  1CLM A;  1SL9 A;  1GGW A;  2GGZ A;  3EKH A;  2LAP A;  3BUN B;  3CZT X;  1BF5 A;  2K61 A;  1AUI B;  1NIW A;  1SW8 A;  1XFV O;  1XFZ O;  3SIA A;  1M46 A;  3I5H C;  1QX2 A;  4DRW A;  3CTN A;  3GK2 A;  1LA0 A;  2NZ0 A;  1MR8 A;  4P2Y B;  2FJU B;  2M1U A;  4P5O E;  2LV7 A;  1C7W A;  4MZK A;  1NP8 A;  2JT0 A;  1JF2 A;  5F6T A;  3PAL A;  1BT6 A;  2BBN A;  4HRG A;  5CSF A;  1R6P A;  4HRE E;  1B9A A;  3CGA A;  1A2X A;  1EG3 A;  4PHK A;  1B8R A;  1TIZ A;  4QJ3 B;  1YVH A;  2KHN A;  1CKK A;  3QRX A;  2Q91 A;  1XFY O;  1XYD A;  1Y6W A;  2R2I A;  1MF8 B;  1BJF A;  3PLF B;  1LVC D;  4PHM A;  3IQO A;  3TS5 C;  4ZCU A;  5ER4 X;  5FYX A;  1IGV A;  1M63 B;  2H61 C;  1AVS A;  1JFK A;  2EHB A;  5BPJ A;  1QV0 A;  3VRR A;  1K8U A;  4GAO A;  1L2O B;  2I18 A;  1SCM C;  1SNL A;  3PSR A;  1CLB A;  3I5F C;  2OS8 C;  1J1D A;  4OKH A;  1PVB A;  3GOF A;  3EVR A;  3HX4 A;  1Q80 A;  2HF5 A;  3I5G B;  4QJ4 B;  2CCM A;  1YRU B;  4CFR A;  1NYA A;  1TNW A;  4YRU A;  5HYD A;  2QAC A;  3NSL A;  2H61 A;  2L50 A;  1C07 A;  1CB1 A;  5AFP A;  1TCO B;  2WOR A;  1J7P A;  1NX1 A;  1REC A;  2Y1M A;  1G33 A;  2I2R E;  4I5N B;  3EVV A;  5GQQ C;  2LE9 B;  1H8B A;  1K94 A;  1ZAC A;  1AP4 A;  3TUY B;  3GK4 X;  1KFU S;  5DKN A;  4MZJ A;  1CFF A;  1KQM C;  1YRT B;  1TN4 A;  1DJG A;  2V53 A;  3NSO A;  1Y1X A;  2GV5 A;  4JQ0 D;  4UPG A;  1SCV A;  1XFW O;  2KFF A;  3O2P A;  2BE6 A;  2MBX A;  2LC5 A;  5CSJ A;  3E3R A;  1NX2 A;  1OMR A;  1B7T Z;  3CR4 X;  2M1K B;  1W7J B;  1NWD A;  3KEV A;  3O78 A;  1CFP A;  1QAT A;  2GGM A;  1SR6 C;  3BXK A;  3CR5 X;  4NDC A;  4MN0 A;  1NCY A;  1KWO B;  1AJ4 A;  2MRD A;  4PDZ A;  1IG5 A;  2VRG A;  3FIA A;  1KSO A;  3LL8 B;  3WHU B;  1G8I A;  1K2H A;  4FQO A;  1YUT A;  1RWY A;  1IRJ A;  2KYC A;  4ORB B;  1WRL A;  2KFH A;  1S5G Y;  1A75 B;  1WDC C;  4OCI A;  4WRI A;  5CPV A;  1H4B A;  1CNP A;  2K2F A;  1N65 A;  2D8N A;  4C0J A;  2F33 A;  2OPO A;  3VRQ A;  1EJ3 A;  4AQI A;  1NUB A;  1ALV A;  1NX0 A;  3SG7 A;  1WRK A;  2MJW B;  3SG2 A;  4YGB B;  1DJX A;  1SMG A;  2K7O A;  3OX6 A;  4PHJ A;  4CPV A;  1CTR A;  1BOD A;  1RJV A;  3BUW B;  1A29 A;  1RK9 A;  3IF7 A;  4D1E A;  1QV1 A;  2G9B A;  2PAS A;  2OTG C;  2PSR A;  3PM8 A;  1IQ3 A;  1ODB A;  1UWO A;  3CLN A;  1FI6 A;  3DF0 A;  2AUC A;  2ZKM X;  2JRF A;  4USL A;  5I8N A;  3D0Y A; 
#chains in the Genus database with same CATH topology
 1GM0 A;  2GTE A;  1G4Y R;  4PAL A;  2TN4 A;  1KK8 C;  2BCX A;  3I5I C;  3SG5 A;  3ZWH A;  1N2D A;  5EL2 A;  1F55 A;  3LK1 A;  3B6X A;  2WND A;  2LMT A;  1M31 A;  3I5H B;  1ZOT B;  1TUJ A;  2ZN8 A;  1BU3 A;  1ZUZ A;  3UO9 A;  2CBL A;  2JWW A;  1R2U A;  2MHH A;  2FOT A;  2SCP A;  5HLO A;  1PVA A;  1DF0 A;  2P71 A;  2LCP A;  4ETO A;  1SPY A;  4PE7 A;  1F70 A;  3R72 A;  1YX7 A;  2KGR A;  2WC8 A;  4PT1 A;  1CDN A;  2HPS A;  3EKJ A;  1DMO A;  4OR9 B;  2KOT A;  2ZND A;  3HCM A;  2ERB A;  2CXJ A;  4JWQ A;  4PE4 A;  1RFJ A;  2PRU A;  2H8V A;  1F4O A;  2JQ6 A;  1LIN A;  3R1P A;  1F54 A;  1SL7 A;  4NDD A;  1DEK A;  3S0F A;  1S3P A;  1TRF A;  3ZNI A;  1XO5 A;  4A4C A;  1DT7 B;  1NSH A;  2A4J A;  3BYA A;  1ZMZ A;  3BUM B;  2L98 A;  4CID A;  5AEQ A;  3M0W A;  1DJZ A;  3TS5 B;  5G08 A;  1TNX A;  1EG4 A;  2P70 A;  5DKQ A;  2K2A A;  1FI5 A;  3IQQ A;  3JTD C;  3SIB A;  2LMU A;  2JUL A;  1IQ5 A;  4PE1 A;  5AAN A;  1IJ5 A;  3BJH A;  4R1E A;  3VRP A;  3PFV A;  2KI4 C;  1K90 D;  2BEC A;  1SCM B;  1KCY A;  2KBM A;  1K96 A;  2QDI A;  4INX A;  1IIO A;  1PSR A;  3I5F B;  5HKW A;  4XJK A;  5DKR A;  2OS8 B;  1SRA A;  4PCW A;  1S36 A;  2PMY A;  1QXP A;  1AHR A;  3C1V A;  1BMO A;  1WRZ A;  3B86 A;  1BOC A;  3CR2 A;  1DJW A;  2LVV A;  1LKJ A;  2BE4 A;  1W9Z A;  4GGN A;  3EK7 A;  3NHI A;  2CT9 A;  2NXQ A;  5HKZ A;  3QME A;  1JSA A;  4I5J A;  1YX8 A;  2PYQ A;  1CFF A;  4ZCV A;  2JU0 A;  1Z4H A;  2QEH A;  1S5G Z;  4HSZ A;  4OV2 A;  1WY9 A;  2B1U A;  1OMD A;  2O5G A;  2LVJ A;  1TNQ A;  2BBM A;  4MLW A;  2LLU A;  2K60 A;  1Y1A A;  3TDU A;  1S26 D;  4PE0 A;  1J55 A;  1KQM B;  4IL1 A;  3NGV A;  1PSB A;  1CMG A;  3JVT C;  1QLS A;  3KO0 A;  2L51 A;  4YGE B;  1XA5 A;  1DTL A;  3GK1 A;  1GGZ A;  1BR4 B;  1EL4 A;  1PAL A;  4DIR A;  4YGA A;  3EVU A;  1OQP A;  1S6C A;  2LHI A;  3OX5 A;  1K95 A;  3O6B A;  2LP3 A;  3PN7 C;  4YGC B;  1QVI Y;  1Y1U A;  3RM1 A;  4AOM A;  3RLZ A;  3OHM B;  3B87 A;  4XYN A;  1SR6 B;  3AAJ A;  2WCL A;  2BL0 C;  1XFX O;  1SKT A;  2LLS A;  1SBJ A;  2L5X B;  1NPQ A;  2QEB A;  1TNP A;  2M8U A;  1V1G A;  3A4U B;  3MSE B;  2WOS A;  5J3X A;  1XFU O;  3BFA A;  5D69 A;  1ORG A;  4ORA B;  2FCD A;  1UHN A;  4QJ5 B;  2L4H A;  3NSK A;  4C0L A;  1F71 A;  2M97 A;  1WDC B;  2MLE C;  4L9M A;  1U5I B;  2CNP A;  1E8A A;  5JJG A;  1B1G A;  2I7A A;  3BFB A;  3L47 A;  4Q04 A;  3VB1 A;  1C7V A;  1WLM A;  2WCE A;  3EK8 A;  2KQ6 A;  3FE9 A;  2Y5I A;  3OB2 B;  1OW4 A;  4JPZ B;  3SG4 A;  3SS4 A;  3OP0 A;  2BKH B;  2KAY A;  1J7R A;  1XK4 C;  1CLL A;  2M7N A;  3NXA A;  1UUS A;  2L4I A;  3CWG A;  1SL8 A;  2F3Y A;  1SK6 D;  2LM5 A;  1A4P A;  2NCO A;  3TDZ A;  2KI6 D;  1DF0 B;  2OTG B;  2RGI A;  5HKY A;  4C0K A;  1F4Q A;  2Y4Q A;  2F2O A;  5AXI A;  3H4S E;  1RTP 1;  1KSM A;  1CFC A;  1B47 A;  2JXL A;  1MHO A;  1HT9 A;  4WQ2 A;  3CZ2 A;  1KK8 B;  3DVJ A;  1JUO A;  3I5I B;  1OE9 B;  4MEW A;  5JOL A;  4CFQ A;  1BR1 B;  5KTY A;  1BG1 A;  2EC6 C;  1XK4 A;  3NSI A;  4JD9 A;  4ORC B;  2QPT A;  3DYE A;  3BUO B;  2MLF C;  3EG5 B;  1S6I A;  1CFD A;  3PAT A;  3FE6 A;  2E30 A;  1NX3 A;  2BNX A;  2K0J A;  1OMV A;  4YGD B;  1PK0 D;  5I2Q A;  2K7B A;  2LNK A;  2HET A;  1K9P A;  2WCM A;  1UHH A;  3VRO A;  3OB1 B;  3S0B A;  2E6W A;  4DCK A;  4M2O A;  1DJY A;  1YUR A;  3EK4 A;  2PVB A;  1VRK A;  4MSP A;  3RZS A;  3K21 A;  4YI9 A;  3BOW A;  1TUZ A;  3KPX A;  2PQL A;  3BFH A;  2KSP A;  4XJK B;  2M7L A;  1AK8 A;  4A4B A;  1Y0V H;  2F8P A;  3D73 A;  3FS7 A;  1DGU A;  1PUL A;  5I2L A;  1CDL A;  2JXC A;  1RRO A;  2KFG A;  3D76 A;  1LA3 A;  2WCB A;  2KNE A;  2M9G A;  3CAB A;  1A03 A;  1WLZ A;  1QIW A;  2KLD A;  3JTD B;  1MUX A;  4GUK A;  3CDN A;  1B8C A;  1NCZ A;  1YVL A;  2JC2 A;  2L0P A;  2PAL A;  3DVE A;  4HRH A;  4CLN A;  2KI4 B;  1X02 A;  5K89 A;  3ICB A;  2KAX A;  1KK7 Y;  3VGO A;  1D1O A;  1DJI A;  5I94 A;  2LVI A;  5HLV A;  1OOI X;  4GNK B;  2AMI A;  1FF1 A;  1QVI Z;  1UHJ A;  3BUX B;  2JOJ A;  1OZS A;  1JC2 A;  1CM4 A;  1DJH A;  1PRW A;  3DVK A;  1QX7 A;  4GFT A;  2BKI B;  1IWQ A;  1OOH A;  2ZN9 A;  3LLE A;  1DEL A;  3SS5 A;  2M49 B;  2JNF A;  1KFX L;  1MQ1 A;  2Y1N A;  1C3Z A;  1NCX A;  4N1G A;  2WCJ A;  1IH0 A;  3KHE A;  1CDM A;  2JPT A;  4YI8 A;  1EH2 A;  2LHL A;  2JPO A;  2JTZ A;  2JT8 A;  3DZT A;  3FWC A;  3SJS A;  5FI6 A;  1GQM A;  1MWN A;  1CM1 A;  1QJT A;  4MRX A;  2LAN A;  2O60 A;  2M29 A;  2COL B;  3R1O A;  3JVT B;  1JFJ A;  2K7C A;  2WC6 A;  4MRY A;  3O4X A;  3TZ1 A;  5CSI A;  1BLQ A;  1MXL C;  2HQW A;  2SAS A;  3S0A A;  1XVJ A;  4MZL A;  3A8R A;  3L4L A;  3PN7 B;  1QAS A;  4NQG A;  2HQ8 A;  2L2C A;  3S0D A;  2K8M B;  4I5L B;  3K1E A;  1IJ6 A;  4MVF A;  2LUC A;  2ZNE A;  5AER A;  2P6B B;  1FW4 A;  1V1F A;  2BL0 B;  3WNX B;  2WCK A;  2MA2 A;  1IKU A;  1TTX A;  4GGF C;  1S1E A;  3AKB A;  1QTX A;  2I94 A;  2CTN A;  3AKA A;  3S0G A;  1L7Z A;  4AQJ A;  1J7Q A;  2LVK A;  2KYF A;  2KAV A;  1L2O C;  2F2P A;  1LS8 A;  5B8I B;  2WCF A;  1AJ5 A;  3D77 A;  3TDI A;  1CMF A;  2AAO A;  5CSN A;  1KQV A;  1DQE A;  1N0Y A;  1B8L A;  3I5G C;  5KU1 A;  3DF0 B;  2M3W A;  4U8D A;  4GGF A;  1QLK A;  3FE8 A;  4WQ3 A;  4F7F A;  4E68 A;  2F3Z A;  3KF9 A;  1UUR A;  3D0Y B;  1DC1 A;  2ZRT A;  3D74 A;  2KLE A;  2JNX A;  3UNW A;  2Q4U A;  1SY9 A;  1UHK A;  1OSA A;  2ZRS A;  1K9U A;  3SG6 A;  3D10 A;  1QX5 B;  5I8N A;  2BCB A;  5ER5 A;  1OOJ A;  4M2P A;  1TCF A;  3F45 A;  3WXA A;  4ICB A;  1TWO A;  4GBA A;  3TUY C;  1YTZ C;  2ISD A;  4F0Z B;  5HL1 A;  2EC6 B;  4FTG A;  3BOW B;  2LUX A;  1UP5 A;  4BY4 A;  2L2E A;  4MBE A;  5IBW A;  4JKT A;  4KYN A;  3FWB A;  3PJI A;  1EXR A;  1KK7 Z;  2KPH A;  4YBH B;  1CDP A;  3D78 A;  4PHN A;  1XFR A;  5KSZ A;  1FBV A;  1OOG A;  1JBA A;  2MAZ A;  2LP2 A;  1QIV A;  2K7D A;  1JWD A;  1F8H A;  1B4C A;  3N7H A;  2KDH A;  1S6J A;  1ZFS A;  3LCP C;  4FQT A;  1KWO C;  1M39 A;  4OVN F;  2DOQ A;  1DGV A;  2EGD A;  2JZI A;  2L5Y A;  2LLT A;  2KGB C;  1YUS A;  1W7I B;  4I5K A;  3DVM A;  3CS1 A;  4GPL B;  3LK0 A;  1TOP A;  3BQ3 A;  1MXE A;  4N1F A;  1KFX S;  3SG3 A;  2KBI A;  1SYM A;  4N5X A;  2KQY A;  2BCA A;  1KFU L;  2YGU A;  3B88 A;  2NLN A;  3PM2 A;  3SS3 A;  1ALW A;  2LMV A;  5TNC A;  4BY5 A;  3OBV A;  4NDB A;  5I2O A;  1FPW A;  4DS7 A;  1J1E A;  1JF0 A;  2JT3 A;  4INW A;  2KI6 C;  2H2K A;  2JTT A;  1OOF A;  1U5I A;  1T14 A;  4TNC A;  3DD4 A;  3CZ1 A;  1YR5 A;  1HQV A;  2IS9 A;  1QS7 A;  1OZO A;  1M45 A;  2M0R A;  3AAK A;  1J7O A;  1DVI A;  2FCE A;  2FJY A;  5D7F A;  2ZFD A;  1A75 A;  1B7T Y;  2G2B A;  5PAL A;  3VRN A;  2NCP A;  4DUQ A;  3WHT B;  1K93 D;  1GJY A;  1LXF C;  1K9K A;  1YUU A;  3O4Y A;  3R1V A;  1UHI A;  1CLM A;  1SL9 A;  4M2Q A;  1GGW A;  2GGZ A;  3EKH A;  2LAP A;  3BUN B;  3CZT X;  1BF5 A;  2K61 A;  1AUI B;  1NIW A;  1SW8 A;  1XFV O;  1XFZ O;  1Z2C B;  3SIA A;  1M46 A;  3I5H C;  1QX2 A;  4DRW A;  3CTN A;  3GK2 A;  1LA0 A;  2NZ0 A;  1MR8 A;  4P2Y B;  2FJU B;  2M1U A;  3Q8I A;  2LV7 A;  2WC5 A;  4P5O E;  1C7W A;  4MZK A;  1NP8 A;  2JT0 A;  1JF2 A;  5F6T A;  3PAL A;  1BT6 A;  2BBN A;  4HRG A;  5CSF A;  1R6P A;  4HRE E;  1B9A A;  3OGN A;  3CGA A;  1A2X A;  1EG3 A;  4PHK A;  1B8R A;  1TIZ A;  4QJ3 B;  1YVH A;  2KHN A;  5FI7 A;  1CKK A;  3QRX A;  2Q91 A;  1XFY O;  1XYD A;  1Y6W A;  2R2I A;  1MF8 B;  1BJF A;  3PLF B;  1LVC D;  1P28 A;  3IVT A;  4PHM A;  3IQO A;  3TS5 C;  4ZCU A;  5ER4 X;  5FYX A;  2WCH A;  1IGV A;  1M63 B;  2H61 C;  1AVS A;  1JFK A;  2EHB A;  5BPJ A;  1QV0 A;  3VRR A;  1K8U A;  4GAO A;  1L2O B;  2I18 A;  1SCM C;  1SNL A;  3B7A A;  3PSR A;  1CLB A;  3I5F C;  2OS8 C;  1J1D A;  4OKH A;  1PVB A;  3GOF A;  3EVR A;  3HX4 A;  1Q80 A;  3D75 A;  3NHT A;  2HF5 A;  3I5G B;  3CZ0 A;  4QJ4 B;  2CCM A;  3CYZ A;  1YRU B;  4CFR A;  1NYA A;  1TNW A;  4YRU A;  5HYD A;  2QAC A;  3NSL A;  2H61 A;  2L50 A;  1C07 A;  1CB1 A;  5AFP A;  1TCO B;  2WOR A;  1J7P A;  1NX1 A;  1REC A;  2Y1M A;  1G33 A;  2I2R E;  4I5N B;  3EVV A;  5GQQ C;  2LE9 B;  1H8B A;  1K94 A;  1ZAC A;  1AP4 A;  4IJ7 A;  3GK4 X;  1KFU S;  5DKN A;  4MZJ A;  3TUY B;  1KQM C;  1YRT B;  1TN4 A;  3DY9 A;  1DJG A;  2V53 A;  3NSO A;  1Y1X A;  2GV5 A;  4JQ0 D;  4UPG A;  1SCV A;  1XFW O;  2KFF A;  2QEV A;  3O2P A;  2BE6 A;  4OZD A;  2MBX A;  2LC5 A;  5CSJ A;  3E3R A;  1NX2 A;  1OMR A;  1B7T Z;  3CR4 X;  2M1K B;  1W7J B;  1NWD A;  2QEO A;  3KEV A;  3O78 A;  3V2L A;  1QAT A;  1CFP A;  2GGM A;  1SR6 C;  3BXK A;  3CR5 X;  4NDC A;  4MN0 A;  3S0E A;  1NCY A;  1KWO B;  1AJ4 A;  2MRD A;  4PDZ A;  1IG5 A;  2VRG A;  3FIA A;  1KSO A;  3LL8 B;  3WHU B;  1G8I A;  1K2H A;  4FQO A;  1YUT A;  1RWY A;  1IRJ A;  2KYC A;  5D3O A;  4ORB B;  1WRL A;  2KFH A;  1S5G Y;  1A75 B;  1WDC C;  4OCI A;  4WRI A;  5CPV A;  1H4B A;  1CNP A;  2K2F A;  1N65 A;  2D8N A;  5DIC A;  2F33 A;  4C0J A;  2OPO A;  3VRQ A;  1C3Y A;  1EJ3 A;  4AQI A;  1NUB A;  1ALV A;  1NX0 A;  3SG7 A;  1SSE B;  1WRK A;  2MJW B;  3SG2 A;  4YGB B;  1DJX A;  1SMG A;  2K7O A;  3OX6 A;  4PHJ A;  4CPV A;  1CTR A;  1BOD A;  1RJV A;  3BUW B;  2BAP A;  1QWV A;  1A29 A;  1RK9 A;  3IF7 A;  4D1E A;  1QV1 A;  3DXL A;  2G9B A;  2PAS A;  2OTG C;  2PSR A;  3PM8 A;  1IQ3 A;  1ODB A;  1UWO A;  3CLN A;  1FI6 A;  3DF0 A;  2AUC A;  2ZKM X;  2JRF A;  5FI2 A;  4USL A;  3L4A A;  3D0Y A; 
#chains in the Genus database with same CATH homology
 1G4Y R;  4PAL A;  2TN4 A;  1KK8 C;  2BCX A;  3I5I C;  3SG5 A;  3ZWH A;  1N2D A;  1F55 A;  3LK1 A;  2WND A;  2LMT A;  1M31 A;  3I5H B;  1ZOT B;  2ZN8 A;  1BU3 A;  1ZUZ A;  2CBL A;  2JWW A;  1R2U A;  2MHH A;  2FOT A;  2SCP A;  5HLO A;  1PVA A;  1DF0 A;  4ETO A;  2LCP A;  1SPY A;  4PE7 A;  1F70 A;  1YX7 A;  2KGR A;  2WC8 A;  1CDN A;  2HPS A;  3EKJ A;  1DMO A;  4OR9 B;  2KOT A;  2ZND A;  3HCM A;  2CXJ A;  4JWQ A;  4PE4 A;  1RFJ A;  2PRU A;  1F4O A;  2JQ6 A;  1LIN A;  1F54 A;  1SL7 A;  4NDD A;  1S3P A;  1TRF A;  3ZNI A;  1XO5 A;  4A4C A;  1DT7 B;  1NSH A;  2A4J A;  3BYA A;  1ZMZ A;  3BUM B;  2L98 A;  4CID A;  5AEQ A;  3M0W A;  1DJZ A;  3TS5 B;  5G08 A;  1TNX A;  1EG4 A;  5DKQ A;  2K2A A;  1FI5 A;  3IQQ A;  3JTD C;  3SIB A;  2LMU A;  2JUL A;  1IQ5 A;  4PE1 A;  5AAN A;  1IJ5 A;  4R1E A;  3VRP A;  3PFV A;  2KI4 C;  1K90 D;  2BEC A;  1SCM B;  1KCY A;  2KBM A;  1K96 A;  1PSR A;  3I5F B;  5HKW A;  4XJK A;  5DKR A;  2OS8 B;  1SRA A;  4PCW A;  1S36 A;  2PMY A;  1QXP A;  1AHR A;  3C1V A;  1BMO A;  1WRZ A;  1BOC A;  3CR2 A;  1DJW A;  2LVV A;  1LKJ A;  2BE4 A;  4GGN A;  3EK7 A;  2CT9 A;  2NXQ A;  5HKZ A;  1JSA A;  4I5J A;  1YX8 A;  4ZCV A;  2JU0 A;  4HSZ A;  1S5G Z;  4OV2 A;  1WY9 A;  2B1U A;  1OMD A;  2O5G A;  2LVJ A;  1TNQ A;  2BBM A;  4MLW A;  2LLU A;  1Y1A A;  3TDU A;  1S26 D;  4PE0 A;  1J55 A;  1KQM B;  4IL1 A;  1PSB A;  1CMG A;  3JVT C;  1QLS A;  3KO0 A;  2L51 A;  4YGE B;  1XA5 A;  1DTL A;  3GK1 A;  1GGZ A;  1BR4 B;  1EL4 A;  1PAL A;  4DIR A;  4YGA A;  3EVU A;  1OQP A;  1S6C A;  2LHI A;  3OX5 A;  1K95 A;  3O6B A;  2LP3 A;  3PN7 C;  4YGC B;  1QVI Y;  1Y1U A;  3RM1 A;  4AOM A;  3RLZ A;  3OHM B;  4XYN A;  1SR6 B;  3AAJ A;  2BL0 C;  1XFX O;  1SKT A;  2LLS A;  1SBJ A;  2L5X B;  1NPQ A;  3A4U B;  1TNP A;  2M8U A;  1V1G A;  3MSE B;  5J3X A;  2WOS A;  1XFU O;  5D69 A;  4ORA B;  2FCD A;  1UHN A;  4QJ5 B;  2L4H A;  3NSK A;  4C0L A;  1F71 A;  2M97 A;  1WDC B;  2MLE C;  4L9M A;  1U5I B;  2CNP A;  1E8A A;  5JJG A;  1B1G A;  2I7A A;  1C7V A;  4Q04 A;  1WLM A;  2WCE A;  3EK8 A;  2KQ6 A;  2Y5I A;  3OB2 B;  4JPZ B;  3SG4 A;  3OP0 A;  2BKH B;  2KAY A;  1J7R A;  1XK4 C;  1CLL A;  2M7N A;  3NXA A;  1UUS A;  2L4I A;  3CWG A;  1SL8 A;  2F3Y A;  1SK6 D;  2LM5 A;  1A4P A;  2NCO A;  3TDZ A;  2KI6 D;  1DF0 B;  2OTG B;  2RGI A;  5HKY A;  4C0K A;  1F4Q A;  2Y4Q A;  2F2O A;  5AXI A;  3H4S E;  1RTP 1;  1KSM A;  1CFC A;  1B47 A;  2JXL A;  1MHO A;  1HT9 A;  4WQ2 A;  3DVJ A;  1KK8 B;  3I5I B;  1JUO A;  4MEW A;  1OE9 B;  5JOL A;  4CFQ A;  1BR1 B;  5KTY A;  1BG1 A;  2EC6 C;  1XK4 A;  3NSI A;  4ORC B;  2QPT A;  3BUO B;  2MLF C;  1S6I A;  1CFD A;  3PAT A;  2E30 A;  1NX3 A;  2K0J A;  1OMV A;  4YGD B;  1PK0 D;  5I2Q A;  2K7B A;  2LNK A;  2HET A;  1K9P A;  1UHH A;  3VRO A;  3OB1 B;  2E6W A;  4DCK A;  4M2O A;  1DJY A;  1YUR A;  3EK4 A;  2PVB A;  1VRK A;  4MSP A;  3K21 A;  4YI9 A;  3BOW A;  3KPX A;  2KSP A;  4XJK B;  2M7L A;  1AK8 A;  4A4B A;  1Y0V H;  2F8P A;  3FS7 A;  1DGU A;  1PUL A;  5I2L A;  1CDL A;  2JXC A;  1RRO A;  2KFG A;  1LA3 A;  2WCB A;  2KNE A;  2M9G A;  1A03 A;  1WLZ A;  1QIW A;  3JTD B;  1MUX A;  4GUK A;  1B8C A;  1NCZ A;  1YVL A;  2JC2 A;  2L0P A;  2PAL A;  3DVE A;  4HRH A;  4CLN A;  2KI4 B;  1X02 A;  5K89 A;  3ICB A;  2KAX A;  1KK7 Y;  3VGO A;  1D1O A;  1DJI A;  2LVI A;  5HLV A;  4GNK B;  2AMI A;  1FF1 A;  1QVI Z;  1UHJ A;  3BUX B;  2JOJ A;  1OZS A;  1JC2 A;  1CM4 A;  1DJH A;  1PRW A;  3DVK A;  1QX7 A;  4GFT A;  2BKI B;  1IWQ A;  2ZN9 A;  3LLE A;  2M49 B;  2JNF A;  1KFX L;  1MQ1 A;  2Y1N A;  1NCX A;  4N1G A;  1IH0 A;  3KHE A;  1CDM A;  2JPT A;  4YI8 A;  1EH2 A;  2LHL A;  2JTZ A;  2JT8 A;  3FWC A;  3SJS A;  1GQM A;  1MWN A;  1CM1 A;  1QJT A;  4MRX A;  2LAN A;  2O60 A;  2M29 A;  2COL B;  3JVT B;  1JFJ A;  2K7C A;  4MRY A;  3TZ1 A;  5CSI A;  1BLQ A;  1MXL C;  2HQW A;  2SAS A;  1XVJ A;  4MZL A;  3A8R A;  3PN7 B;  1QAS A;  4NQG A;  2HQ8 A;  2K8M B;  4I5L B;  5AER A;  1IJ6 A;  4MVF A;  2LUC A;  2ZNE A;  2P6B B;  1FW4 A;  1V1F A;  2BL0 B;  3WNX B;  2MA2 A;  1IKU A;  1TTX A;  4GGF C;  1S1E A;  3AKB A;  1QTX A;  2I94 A;  2CTN A;  3AKA A;  1L7Z A;  4AQJ A;  1J7Q A;  2LVK A;  2KYF A;  2KAV A;  1L2O C;  2F2P A;  5B8I B;  2WCF A;  1AJ5 A;  3TDI A;  1CMF A;  2AAO A;  5CSN A;  1KQV A;  1N0Y A;  1B8L A;  3I5G C;  5KU1 A;  3DF0 B;  2M3W A;  4U8D A;  4GGF A;  1QLK A;  4WQ3 A;  4E68 A;  2F3Z A;  3KF9 A;  1UUR A;  3D0Y B;  2ZRT A;  2JNX A;  2Q4U A;  1SY9 A;  1UHK A;  1OSA A;  2ZRS A;  1K9U A;  3SG6 A;  3D10 A;  1QX5 B;  2BCB A;  5ER5 A;  1OOJ A;  4M2P A;  1TCF A;  3F45 A;  3WXA A;  4ICB A;  4GBA A;  3TUY C;  1YTZ C;  2ISD A;  4F0Z B;  2EC6 B;  4FTG A;  3BOW B;  2LUX A;  1UP5 A;  4BY4 A;  2L2E A;  4MBE A;  5IBW A;  3FWB A;  1EXR A;  1KK7 Z;  4YBH B;  1CDP A;  4PHN A;  5KSZ A;  1FBV A;  1JBA A;  2MAZ A;  2LP2 A;  1QIV A;  2K7D A;  1JWD A;  1F8H A;  1B4C A;  2KDH A;  1S6J A;  1ZFS A;  3LCP C;  1KWO C;  1M39 A;  4OVN F;  2DOQ A;  1DGV A;  2EGD A;  2JZI A;  2LLT A;  2KGB C;  1YUS A;  1W7I B;  4I5K A;  3DVM A;  3CS1 A;  4GPL B;  3LK0 A;  1TOP A;  3BQ3 A;  1MXE A;  4N1F A;  1KFX S;  3SG3 A;  2KBI A;  1SYM A;  4N5X A;  2KQY A;  2BCA A;  1KFU L;  2NLN A;  1ALW A;  2LMV A;  5TNC A;  4BY5 A;  4NDB A;  5I2O A;  1FPW A;  4DS7 A;  1J1E A;  1JF0 A;  2JT3 A;  2KI6 C;  2H2K A;  2JTT A;  4TNC A;  1U5I A;  3DD4 A;  1YR5 A;  1HQV A;  2IS9 A;  1QS7 A;  1OZO A;  1M45 A;  2M0R A;  3AAK A;  1J7O A;  1DVI A;  2FCE A;  5D7F A;  2ZFD A;  1A75 A;  1B7T Y;  2G2B A;  5PAL A;  3VRN A;  2NCP A;  4DUQ A;  3WHT B;  1K93 D;  1GJY A;  1LXF C;  1K9K A;  1YUU A;  3O4Y A;  4M2Q A;  1UHI A;  1CLM A;  1SL9 A;  1GGW A;  2GGZ A;  3EKH A;  2LAP A;  3BUN B;  3CZT X;  1BF5 A;  2K61 A;  1AUI B;  1NIW A;  1SW8 A;  1XFV O;  1XFZ O;  3SIA A;  1M46 A;  3I5H C;  1QX2 A;  4DRW A;  3CTN A;  3GK2 A;  1LA0 A;  2NZ0 A;  1MR8 A;  4P2Y B;  2FJU B;  2M1U A;  4P5O E;  2LV7 A;  1C7W A;  4MZK A;  1NP8 A;  2JT0 A;  1JF2 A;  5F6T A;  3PAL A;  1BT6 A;  2BBN A;  4HRG A;  5CSF A;  1R6P A;  4HRE E;  1B9A A;  3CGA A;  1A2X A;  1EG3 A;  4PHK A;  1B8R A;  1TIZ A;  4QJ3 B;  1YVH A;  2KHN A;  1CKK A;  3QRX A;  2Q91 A;  1XFY O;  1XYD A;  1Y6W A;  2R2I A;  1MF8 B;  1BJF A;  3PLF B;  1LVC D;  4PHM A;  3IQO A;  3TS5 C;  4ZCU A;  5ER4 X;  5FYX A;  1IGV A;  1M63 B;  2H61 C;  1AVS A;  1JFK A;  2EHB A;  5BPJ A;  1QV0 A;  3VRR A;  1K8U A;  4GAO A;  1L2O B;  2I18 A;  1SCM C;  1SNL A;  3PSR A;  1CLB A;  3I5F C;  2OS8 C;  1J1D A;  4OKH A;  1PVB A;  3GOF A;  3EVR A;  3HX4 A;  1Q80 A;  2HF5 A;  3I5G B;  4QJ4 B;  2CCM A;  1YRU B;  4CFR A;  1NYA A;  1TNW A;  4YRU A;  5HYD A;  2QAC A;  3NSL A;  2H61 A;  2L50 A;  1C07 A;  1CB1 A;  5AFP A;  1TCO B;  2WOR A;  1J7P A;  1NX1 A;  1REC A;  2Y1M A;  1G33 A;  2I2R E;  4I5N B;  3EVV A;  5GQQ C;  2LE9 B;  1H8B A;  1K94 A;  1ZAC A;  1AP4 A;  3TUY B;  3GK4 X;  1KFU S;  5DKN A;  4MZJ A;  1CFF A;  1KQM C;  1YRT B;  1TN4 A;  1DJG A;  2V53 A;  3NSO A;  1Y1X A;  2GV5 A;  4JQ0 D;  4UPG A;  1SCV A;  1XFW O;  2KFF A;  3O2P A;  2BE6 A;  2MBX A;  2LC5 A;  5CSJ A;  3E3R A;  1NX2 A;  1OMR A;  1B7T Z;  3CR4 X;  2M1K B;  1W7J B;  1NWD A;  3KEV A;  3O78 A;  1CFP A;  1QAT A;  2GGM A;  1SR6 C;  3BXK A;  3CR5 X;  4NDC A;  4MN0 A;  1NCY A;  1KWO B;  1AJ4 A;  2MRD A;  4PDZ A;  1IG5 A;  2VRG A;  3FIA A;  1KSO A;  3LL8 B;  3WHU B;  1G8I A;  1K2H A;  4FQO A;  1YUT A;  1RWY A;  1IRJ A;  2KYC A;  4ORB B;  1WRL A;  2KFH A;  1S5G Y;  1A75 B;  1WDC C;  4OCI A;  4WRI A;  5CPV A;  1H4B A;  1CNP A;  2K2F A;  1N65 A;  2D8N A;  4C0J A;  2F33 A;  2OPO A;  3VRQ A;  1EJ3 A;  4AQI A;  1NUB A;  1ALV A;  1NX0 A;  3SG7 A;  1WRK A;  2MJW B;  3SG2 A;  4YGB B;  1DJX A;  1SMG A;  2K7O A;  3OX6 A;  4PHJ A;  4CPV A;  1CTR A;  1BOD A;  1RJV A;  3BUW B;  1A29 A;  1RK9 A;  3IF7 A;  4D1E A;  1QV1 A;  2G9B A;  2PAS A;  2OTG C;  2PSR A;  3PM8 A;  1IQ3 A;  1ODB A;  1UWO A;  3CLN A;  1FI6 A;  3DF0 A;  2AUC A;  2ZKM X;  2JRF A;  4USL A;  5I8N A;  3D0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...