4YI9A

Crystal structure of non-myristoylated e153a recoverin at 1.35 a resolution with a sodium ion bound to ef-hand 2 and calcium ion bound to ef-hand 3
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
192
structure length
192
Chain Sequence
ALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAAKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recoverin
publication title Crystal Structure of Recoverin with Calcium Ions Bound to Both Functional EF Hands.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium binding protein
total genus 75
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2015-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4yi9A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4yi9A01
1SBJA 2LMUA 5IBWA 1H4BA 1TTXA 1OMDA 5ER4X 4QJ3B 4MBEA 5AEQA 3I5IC 1AK8A 2MBXA 2E30A 4YI9A 3IQQA 4OKHA 2QPTA 2WCEA 3OB1B 1CMGA 2JZIA 1SW8A 2I94A 5F6TA 2HQWA 3D0YA 1K8UA 1Y1XA 1M46A 3RM1A 1K95A 3M0WA 1OMVA 1B9AA 4MRYA 3O2PA 2WOSA 2LV7A 1ODBA 1TRFA 1SL8A 4R1EA 5BPJA 1SY9A 5AFPA 2IS9A 2LVVA 4C0KA 2BE4A 2K7OA 1B8LA 3PLFB 1XYDA 4MRXA 4CLNA 4M2PA 3E3RA 2KNEA 2JQ6A 3I5HC 1NCZA 4P2YB 2VRGA 3D10A 1QATA 1BF5A 4JWQA 1QIVA 5CSIA 3AKAA 1B7TZ 1MHOA 1OOJA 1D1OA 4TNCA 2E6WA 3SG4A 1J7OA 2JRFA 1HT9A 2PALA 2FJUB 4PALA 1CM4A 1QX7A 1LA0A 1KWOB 3DVJA 4I5LB 4P5OE 5K89A 1S5GZ 2B1UA 2KGBC 1BG1A 1UUSA 5B8IB 2CCMA 2Y5IA 4WRIA 4YGDB 4ETOA 1A4PA 2F8PA 1JWDA 3OX5A 4MLWA 3IF7A 1DTLA 2HETA 1W7JB 2JNXA 1MQ1A 2NCPA 1KWOC 4CFQA 4I5NB 1BR4B 2SASA 2PMYA 1E8AA 1DF0B 1K9PA 1DJXA 1AVSA 4ORAB 1NCYA 2JXCA 1FI5A 1DGUA 3CR4X 1NSHA 4BY5A 5JOLA 2TN4A 1S6JA 1UHJA 2BECA 1ZACA 1BLQA 4N5XA 3GK4X 1F55A 3DD4A 3EVUA 1F54A 1SMGA 5HLOA 1R6PA 1JF2A 4I5JA 2BE6A 1LXFC 2LUXA 2WCBA 4YGEB 1J7RA 3KEVA 1BJFA 4L9MA 2L98A 3O4YA 4CPVA 4U8DA 2LAPA 2P6BB 1TN4A 1SCMB 4NDBA 1LINA 4GGNA 1KK7Y 2JT0A 4PDZA 1Y0VH 1MWNA 3LK0A 2GV5A 1KFXS 4MZLA 3VRRA 3DVEA 1FF1A 4NDCA 3TDUA 1SCMC 2KFFA 3CZTX 4AQJA 4MN0A 4YI8A 2M9GA 3A8RA 1KSMA 1Y6WA 4Q04A 2WORA 4YGBB 2KBIA 3PN7B 5J3XA 3SG7A 3MSEB 1RROA 2ZNEA 2COLB 2H61C 2HPSA 2H2KA 4GFTA 3NSKA 1EH2A 5DKRA 1S1EA 2CXJA 3FS7A 1YUTA 2KI6C 1NWDA 3PSRA 1UHHA 1ZFSA 3AAKA 2G2BA 1DJIA 2AUCA 3PN7C 2ZN9A 3BUOB 4D1EA 1DGVA 1YX7A 4CIDA 1PVBA 2EHBA 2L2EA 3BUXB 1PK0D 3FIAA 3HX4A 3I5FB 3VRPA 3FWCA 2OS8B 1BU3A 2A4JA 2F33A 2DOQA 3SG3A 2KSPA 1CFCA 1FBVA 3TDZA 2I2RE 1UURA 1IGVA 1BODA 1HQVA 1KSOA 2JTTA 3ZWHA 5CSNA 1YURA 2NLNA 2LLSA 1CDLA 2OS8C 5I2QA 2ZNDA 4CFRA 1GQMA 1A2XA 1XFXO 1EG3A 3PATA 4MVFA 1CKKA 1CFDA 4HSZA 1EL4A 2F2OA 2WCFA 1RFJA 1SYMA 2MLEC 1YUUA 4PHMA 2ZFDA 2PVBA 4GBAA 1C7WA 3OB2B 3PM8A 1IJ6A 1XVJA 1EJ3A 1B1GA 1A03A 2KI6D 3OX6A 1DJHA 1L2OB 3FWBA 2NZ0A 4OCIA 3CLNA 1JFJA 1KK8C 3NSOA 3TS5C 2LLTA 2M3WA 3C1VA 3I5HB 3A4UB 3DF0A 1CLBA 1QIWA 2KQ6A 2JT8A 2M0RA 2K2FA 2L5XB 2K0JA 3SG5A 2HF5A 3HCMA 1L2OC 2JXLA 1JUOA 1NX2A 3LCPC 3AKBA 4MZJA 1IG5A 5AXIA 4ZCVA 1M31A 2CT9A 1SK6D 1F4OA 2KQYA 2LNKA 1PSRA 1S6CA 2JTZA 2KBMA 3VROA 1TNXA 1YRTB 2ISDA 2O60A 2NCOA 2AMIA 1SR6C 1CNPA 1ALWA 1XFYO 4C0LA 3LL8B 3SG6A 4A4BA 2LE9B 1QXPA 5DKQA 1NPQA 4OVNF 3PFVA 1CM1A 1K9UA 3WHTB 1DT7B 1QASA 1PRWA 2WC8A 1C7VA 2CTNA 2JU0A 5HKZA 5I8NA 1GJYA 2EC6C 1SNLA 2L4IA 4PHNA 3CR5X 2L51A 2ZN8A 2ZKMX 3TZ1A 1IWQA 2BCAA 1WDCC 4MEWA 2KDHA 2PSRA 2M8UA 1QLKA 1JFKA 3OHMB 1N0YA 2BBNA 1DVIA 1CTRA 1TNPA 2L0PA 1A75B 2JC2A 1XFZO 2WNDA 1J55A 1KQMC 1KFUS 1N65A 1WLMA 2LP2A 4OR9B 3BYAA 4WQ2A 5D7FA 4XYNA 1J7PA 1SL7A 3SIBA 4F0ZB 1TOPA 1K9KA 1L7ZA 3K21A 4XJKA 1MXEA 1S3PA 2KFGA 2KI4C 3OP0A 2BBMA 1XK4C 4YBHB 3TUYC 2LHLA 1UHIA 4QJ5B 1K94A 1K93D 2M7NA 4PE4A 2Q91A 1LVCD 3CR2A 1TCFA 5HLVA 3NSIA 2MLFC 2GGZA 1KFXL 3QRXA 4MSPA 4PE7A 3H4SE 1TNWA 4FTGA 1SCVA 1QV0A 1B8CA 1ZOTB 2M97A 2QACA 5I2OA 4I5KA 5TNCA 5KSZA 1QVIY 4DRWA 1XK4A 3IQOA 3EVRA 1DMOA 1YTZC 1A29A 2M1KB 4GAOA 2V53A 5ER5A 1WRKA 3DVMA 1U5IA 4NDDA 2BKIB 4USLA 1IRJA 2M1UA 4AOMA 4AQIA 4MZKA 2LANA 1RECA 1TIZA 2BKHB 5DKNA 5HKWA 1G33A 1B7TY 3D0YB 1NIWA 4FQOA 5CSFA 4YGCB 2LP3A 1SL9A 2D8NA 2NXQA 3O78A 4C0JA 2LCPA 3DF0B 3BUWB 2JPTA 1MXLC 4HRHA 1UHNA 3BOWA 1JC2A 1BMOA 1XFUO 1JBAA 4GNKB 3O6BA 3SIAA 1QTXA 1IQ5A 1XFVO 3NXAA 1J1DA 1JF0A 1SPYA 3JVTC 1UP5A 1KK8B 4YGAA 1MUXA 3TS5B 4UPGA 1OE9B 1FW4A 1YVHA 1IH0A 1BR1B 1DJWA 3EK4A 3NSLA 1OZOA 4DCKA 3JTDB 3EKJA 4JQ0D 1F8HA 1NX0A 1ZUZA 1CDMA 1C07A 1S26D 4HRGA 2HQ8A 2M49B 2F2PA 4GGFA 1KK7Z 4IL1A 1QV1A 2MJWB 3KF9A 2K2AA 5AANA 5GQQC 3JTDC 3EK8A 2CNPA 1B47A 1F4QA 1K2HA 2MRDA 1SR6B 3GK1A 1WLZA 1BT6A 1VRKA 3I5GB 1LKJA 1WY9A 2LVKA 2Q4UA 4QJ4B 2I7AA 3VRNA 2FOTA 3CTNA 1OSAA 4ZCUA 1AJ5A 1OQPA 2LLUA 5I2LA 2LM5A 2KYFA 3PALA 1CLMA 3I5GC 2MAZA 4DS7A 1QS7A 1QVIZ 2EC6B 2JOJA 5AERA 1CFPA 1LA3A 2JNFA 1RJVA 1PULA 1B8RA 1SKTA 2R2IA 1IJ5A 1CDPA 3CWGA 4M2QA 1OZSA 1XA5A 1UWOA 3KPXA 1WDCB 3RLZA 2MA2A 1TNQA 2BCXA 1PVAA 2PRUA 2Y4QA 4ORBB 3SJSA 5HKYA 1CMFA 1WRLA 4GPLB 4XJKB 2LUCA 1KCYA 3F45A 2GGMA 4DIRA 3KHEA 3EKHA 3WHUB 1QX5B 3SG2A 1GGWA 1G4YR 1KQMB 2F3YA 1QJTA 1FI6A 1MR8A 4N1GA 1KQVA 1R2UA 1FPWA 1XO5A 1DJYA 1Y1AA 2LVJA 1SRAA 1M39A 2AAOA 2EGDA 2KAVA 1F71A 3EVVA 2KI4B 5G08A 5HYDA 2BL0B 1M45A 1AUIB 1ZMZA 2G9BA 1WRZA 4PHJA 1F70A 1RTP1 3TUYB 3LK1A 2KFHA 2SCPA 4PE1A 1NCXA 2KHNA 1MF8B 1XFWO 1V1FA 4PHKA 1PALA 5CPVA 4A4CA 1U5IB 2OPOA 4HREE 1M63B 5PALA 2KGRA 3BQ3A 2BL0C 1KFUL 2RGIA 2L50A 2FCEA 1S36A 3EK7A 1YUSA 3GK2A 2LC5A 2BCBA 2M7LA 1YX8A 3ICBA 1IKUA 1H8BA 3AAJA 5D69A 1UHKA 2KAXA 3DVKA 1B4CA 1QLSA 1CLLA 2LMVA 3BOWB 3BUNB 3LLEA 3TDIA 1TCOB 1X02A 2M29A 1DJZA 1ALVA 1NUBA 1DF0A 1W7IB 2CBLA 2K8MB 4NQGA 4E68A 1NP8A 1PSBA 1NX1A 1DJGA 2K7CA 2KAYA 2KOTA 1K96A 2L4HA 4ICBA 1CFFA 1CB1A 2K7BA 2OTGB 4BY4A 1JSAA 1Y1UA 3VRQA 1NX3A 2I18A 1RWYA 2JULA 2MHHA 3GOFA 1J7QA 1IQ3A 1GGZA 4ORCB 1A75A 1QX2A 1AHRA 2O5GA 1AJ4A 2F3ZA 2PASA 3KO0A 4WQ3A 4YRUA 1NYAA 1BOCA 2OTGC 3JVTB 4M2OA 3CS1A 4N1FA 3BUMB 1K90D 4PE0A 5KTYA 1S5GY 2KYCA 4DUQA 1V1GA 1OMRA 1AP4A 4OV2A 5FYXA 1Q80A 1S6IA 3ZNIA 1EG4A 3BXKA 2JT3A 5KU1A 2K61A 4GGFC 1YRUB 5JJGA 5CSJA 1EXRA 3CGAA 2K7DA 3VGOA 1CDNA 2LHIA 2H61A 2JWWA 4PCWA 2ZRSA 4JPZB 1YR5A 2LMTA 2FCDA 2ZRTA 1YVLA 3WXAA 1G8IA 4GUKA 1J1EA 2Y1NA 3I5IB 2Y1MA 2LVIA 1N2DA 3WNXB 1RK9A 3I5FC
chains in the Genus database with same CATH superfamily
1SBJA 3V2LA 2LMUA 5IBWA 1H4BA 1TTXA 1OMDA 5ER4X 3B87A 4QJ3B 4MBEA 5AEQA 3DYEA 3I5IC 1AK8A 2MBXA 3L47A 3OBVA 2E30A 4YI9A 3IQQA 4OKHA 2QPTA 2WCEA 3OB1B 1CMGA 4FQTA 2JZIA 2KPHA 1SW8A 2I94A 5F6TA 2HQWA 3D0YA 1K8UA 3IVTA 3K1EA 3S0AA 1Y1XA 1M46A 3RM1A 1K95A 1W9ZA 3M0WA 1OMVA 1B9AA 4MRYA 3L4LA 3O2PA 2WOSA 2LV7A 1ODBA 3B86A 1TRFA 1SL8A 4R1EA 5BPJA 1SY9A 3B88A 5AFPA 2IS9A 2LVVA 4C0KA 2BE4A 2K7OA 3UNWA 1B8LA 3PLFB 1XYDA 3Q8IA 4MRXA 4CLNA 4M2PA 3E3RA 1DELA 2KNEA 2JQ6A 3I5HC 1NCZA 4P2YB 2VRGA 3D10A 1QATA 1BF5A 4JWQA 1QIVA 5CSIA 3AKAA 1B7TZ 1MHOA 1OOJA 1D1OA 4TNCA 2E6WA 3SG4A 1J7OA 2JRFA 1HT9A 2PALA 2FJUB 4PALA 1CM4A 1QX7A 1LA0A 1KWOB 3DVJA 4I5LB 4P5OE 2BNXA 5K89A 1S5GZ 4PT1A 2B1UA 2KGBC 1BG1A 1UUSA 2WCMA 5B8IB 2CCMA 2Y5IA 4WRIA 4YGDB 4ETOA 1A4PA 2F8PA 1JWDA 3OX5A 4MLWA 3IF7A 1DTLA 2HETA 1W7JB 2JNXA 1MQ1A 2NCPA 1KWOC 4CFQA 4I5NB 1BR4B 2SASA 2PMYA 1E8AA 1DF0B 1K9PA 1DJXA 1AVSA 4ORAB 1NCYA 2JXCA 1FI5A 1DGUA 3CR4X 1NSHA 4BY5A 2QEBA 5JOLA 2TN4A 1S6JA 1UHJA 2BECA 1ZACA 1BLQA 4N5XA 3GK4X 1F55A 3DD4A 3EVUA 1F54A 3D75A 1SMGA 2WCLA 1R6PA 5HLOA 1JF2A 4I5JA 2BE6A 1LXFC 2LUXA 2FJYA 2WCBA 4YGEB 1J7RA 3KEVA 3PM2A 1BJFA 4L9MA 2L98A 3O4YA 4CPVA 4U8DA 2LAPA 1XFRA 2P6BB 1TN4A 1SCMB 4NDBA 1LINA 4GGNA 1KK7Y 1LS8A 2JT0A 5AERA 4PDZA 1Y0VH 1MWNA 1DC1A 3LK0A 2GV5A 1KFXS 4OZDA 4MZLA 3VRRA 3DVEA 1FF1A 4NDCA 2P71A 3TDUA 1SCMC 2KFFA 3CZTX 4JKTA 4AQJA 1IIOA 4MN0A 4YI8A 2M9GA 3A8RA 1KSMA 1Y6WA 4Q04A 2WORA 4YGBB 2KBIA 3PN7B 5J3XA 3SG7A 3MSEB 3D76A 1RROA 2ZNEA 2COLB 2H61C 2HPSA 2H2KA 4GFTA 2K60A 3NSKA 1EH2A 5DKRA 1S1EA 2CXJA 3FS7A 1YUTA 2KI6C 1NWDA 3PSRA 1UHHA 1ZFSA 3AAKA 2GTEA 3SS5A 3UO9A 2G2BA 1DJIA 2AUCA 3PN7C 2ZN9A 3BUOB 4D1EA 1DEKA 1DGVA 1YX7A 4CIDA 1PVBA 2EHBA 2L2EA 3BUXB 1PK0D 3FIAA 3HX4A 3I5FB 3VRPA 3FWCA 2OS8B 1BU3A 2A4JA 2F33A 2DOQA 3SG3A 2KSPA 1CFCA 1FBVA 3TDZA 2I2RE 1UURA 1IGVA 1BODA 1HQVA 1KSOA 2JTTA 3ZWHA 5CSNA 1YURA 2NLNA 2LLSA 2YGUA 1Z4HA 1CDLA 2OS8C 5I2QA 2ZNDA 3B6XA 4CFRA 1GQMA 1A2XA 1XFXO 1EG3A 3PATA 4MVFA 1CKKA 1CFDA 4HSZA 1EL4A 2F2OA 2WCFA 1C3YA 1RFJA 1TUZA 1SYMA 2MLEC 1YUUA 4PHMA 2ZFDA 2PVBA 4GBAA 1C7WA 3OB2B 2KLDA 3PM8A 1IJ6A 1XVJA 1EJ3A 1B1GA 3SS4A 1A03A 2WCJA 3D78A 2KI6D 3OX6A 1DJHA 1L2OB 3FWBA 2NZ0A 4OCIA 3CLNA 1JFJA 1KK8C 3NSOA 3TS5C 2LLTA 2M3WA 3C1VA 3I5HB 3A4UB 3DF0A 1CLBA 1QIWA 2KQ6A 2JT8A 2M0RA 2JPOA 2K2FA 2L5XB 2K0JA 3SG5A 2HF5A 3HCMA 1L2OC 2JXLA 1JUOA 1NX2A 3LCPC 3AKBA 3D73A 1DQEA 4MZJA 1IG5A 5AXIA 4ZCVA 1M31A 2CT9A 1SK6D 1F4OA 2KQYA 3D74A 2LNKA 5D3OA 1PSRA 1S6CA 2JTZA 2KBMA 3VROA 1TNXA 2WC6A 1YRTB 3S0DA 4IJ7A 3BFBA 2ISDA 2O60A 2NCOA 2AMIA 1SR6C 3R1PA 1ALWA 1XFYO 5FI7A 1CNPA 4C0LA 3N7HA 3LL8B 1Z2CB 3SG6A 4A4BA 2LE9B 1QXPA 3S0BA 5DKQA 1NPQA 4OVNF 3PFVA 1CM1A 1K9UA 1QWVA 3S0FA 3WHTB 1DT7B 1QASA 3D77A 1PRWA 2H8VA 2WC8A 1C7VA 1GM0A 2CTNA 2JU0A 5HKZA 5I8NA 1GJYA 2EC6C 1SNLA 2L4IA 4PHNA 3CR5X 2L51A 2ZN8A 2ZKMX 3TZ1A 1IWQA 4JD9A 2BCAA 1WDCC 4MEWA 2KDHA 2PSRA 2M8UA 1QLKA 1JFKA 3OHMB 1N0YA 2BBNA 1DVIA 1CTRA 1TNPA 2L0PA 1A75B 2JC2A 1XFZO 2WNDA 1J55A 1TUJA 1KQMC 1KFUS 1N65A 1WLMA 2LP2A 4OR9B 3BYAA 4WQ2A 5D7FA 4XYNA 1J7PA 1SL7A 5FI6A 4KYNA 1OOHA 4F7FA 1C3ZA 3SIBA 4F0ZB 1TOPA 1K9KA 1L7ZA 3K21A 4XJKA 1MXEA 1S3PA 2KFGA 2KI4C 3B7AA 2QEVA 3OP0A 2BBMA 1XK4C 4YBHB 3TUYC 2LHLA 1UHIA 4QJ5B 1K94A 1K93D 2M7NA 4PE4A 2Q91A 1LVCD 3CR2A 1TCFA 5DICA 5HLVA 3NSIA 2MLFC 2GGZA 1KFXL 3QRXA 4MSPA 4PE7A 3H4SE 1TNWA 4FTGA 1SCVA 1QV0A 1B8CA 1ZOTB 2M97A 2QACA 5I2OA 4I5KA 3QMEA 5TNCA 1QVIY 4DRWA 1XK4A 3IQOA 5KSZA 3EVRA 1DMOA 1YTZC 1A29A 2M1KB 4GAOA 2V53A 5ER5A 3EG5B 3FE6A 1WRKA 3DVMA 1U5IA 3FE9A 2BKIB 4NDDA 4USLA 1IRJA 2M1UA 4AOMA 4AQIA 3SS3A 4MZKA 2LANA 1RECA 1TIZA 2BKHB 5DKNA 5HKWA 1G33A 3CYZA 1B7TY 3S0EA 3D0YB 1NIWA 4FQOA 5CSFA 4YGCB 2LP3A 1SL9A 2D8NA 2NXQA 3O78A 4C0JA 2LCPA 3DF0B 3BUWB 3BFHA 3I5FC 2JPTA 1MXLC 4HRHA 1UHNA 3BOWA 1JC2A 3DZTA 1BMOA 1XFUO 1JBAA 4GNKB 3O6BA 3SIAA 1XFVO 1IQ5A 1QTXA 3NXAA 1J1DA 3VB1A 1JF0A 3RZSA 1SPYA 3JVTC 1UP5A 3R72A 1KK8B 4YGAA 1MUXA 3TS5B 4UPGA 1OE9B 1FW4A 1YVHA 1IH0A 1BR1B 1DJWA 3EK4A 3NSLA 1OZOA 4DCKA 3JTDB 3EKJA 4JQ0D 1OOIX 1F8HA 1NX0A 3DXLA 3PJIA 1ZUZA 1CDMA 1C07A 1S26D 2QDIA 4HRGA 2HQ8A 2M49B 2F2PA 4GGFA 1KK7Z 4IL1A 1QV1A 2MJWB 3KF9A 2K2AA 5AANA 5GQQC 3JTDC 3EK8A 2CNPA 2L2CA 1B47A 1F4QA 1K2HA 2WCHA 4INWA 2MRDA 1SR6B 3CDNA 3GK1A 1WLZA 2WCKA 1BT6A 3CABA 1SSEB 1VRKA 1LKJA 3I5GB 1WY9A 2LVKA 2Q4UA 4QJ4B 2I7AA 3VRNA 2FOTA 2PQLA 1OSAA 3CTNA 4ZCUA 1AJ5A 1OQPA 2LLUA 5I2LA 1P28A 2LM5A 2KYFA 3PALA 1CLMA 3CZ0A 3I5GC 2MAZA 2PYQA 1QS7A 1QVIZ 2EC6B 2JOJA 2ERBA 2QEOA 1LA3A 4DS7A 2JNFA 3NHTA 1CFPA 1RJVA 3CZ2A 1PULA 1B8RA 1SKTA 2R2IA 1IJ5A 1CDPA 3CWGA 4M2QA 3BJHA 1OZSA 1XA5A 1UWOA 3KPXA 1WDCB 3RLZA 2MA2A 2P70A 1TNQA 2BCXA 1PVAA 2PRUA 2Y4QA 4ORBB 3SJSA 5HKYA 1CMFA 1WRLA 4GPLB 4XJKB 2LUCA 1KCYA 3F45A 2GGMA 2QEHA 4DIRA 3NHIA 3KHEA 3EKHA 3WHUB 1QX5B 3SG2A 5HL1A 1G4YR 1GGWA 1KQMB 2F3YA 1QJTA 5EL2A 1MR8A 1FI6A 4N1GA 1KQVA 1R2UA 1FPWA 1XO5A 1DJYA 1Y1AA 2LVJA 1SRAA 1M39A 2AAOA 2EGDA 2KAVA 1F71A 3EVVA 2KI4B 5G08A 5HYDA 2BL0B 1M45A 1AUIB 1ZMZA 2G9BA 1OW4A 1WRZA 2WC5A 1RTP1 4PHJA 3TUYB 1F70A 3LK1A 2KFHA 2SCPA 4PE1A 1NCXA 2KHNA 1MF8B 2BAPA 1XFWO 1V1FA 4PHKA 1PALA 3CZ1A 5CPVA 5I94A 4A4CA 1U5IB 2OPOA 4INXA 4HREE 1M63B 5PALA 2KGRA 3BQ3A 2BL0C 1KFUL 2RGIA 2L50A 2FCEA 3R1VA 1S36A 3EK7A 1YUSA 3GK2A 2LC5A 2BCBA 2M7LA 1YX8A 3ICBA 3OGNA 1IKUA 1H8BA 3AAJA 5D69A 1UHKA 2KAXA 3DVKA 1B4CA 1QLSA 1CLLA 2LMVA 1T14A 3BOWB 3BUNB 1TWOA 3LLEA 3TDIA 1TCOB 1X02A 1ORGA 1DJZA 1ALVA 1NUBA 2M29A 1DF0A 1W7IB 3FE8A 2CBLA 2L5YA 2K8MB 4NQGA 4E68A 1NP8A 1PSBA 1NX1A 1DJGA 2K7CA 2KAYA 2KOTA 1K96A 2L4HA 3BFAA 4ICBA 1CFFA 1CB1A 2K7BA 2OTGB 4BY4A 1JSAA 1Y1UA 3VRQA 1NX3A 2I18A 1RWYA 2JULA 3L4AA 2MHHA 3GOFA 1J7QA 1IQ3A 1GGZA 4ORCB 1A75A 1QX2A 3R1OA 1AHRA 2O5GA 1AJ4A 2F3ZA 1OOFA 2PASA 3KO0A 4WQ3A 4YRUA 1NYAA 1BOCA 2OTGC 3O4XA 3JVTB 4M2OA 3CS1A 4N1FA 3BUMB 1K90D 4PE0A 5KTYA 1S5GY 2KYCA 3DY9A 4DUQA 1V1GA 1OMRA 1AP4A 4OV2A 5FYXA 1Q80A 1S6IA 3ZNIA 1EG4A 3BXKA 2JT3A 5KU1A 3NGVA 2K61A 4GGFC 1YRUB 5JJGA 5CSJA 1EXRA 3CGAA 2K7DA 3VGOA 1CDNA 2LHIA 3S0GA 2H61A 2JWWA 4PCWA 2ZRSA 4JPZB 1YR5A 5FI2A 2LMTA 2FCDA 2ZRTA 1YVLA 3WXAA 1G8IA 4GUKA 1J1EA 2Y1NA 3I5IB 2Y1MA 2KLEA 2LVIA 1N2DA 3WNXB 1RK9A 1OOGA
chains in the Genus database with same CATH topology
1SBJA 2LMUA 5IBWA 1H4BA 1TTXA 1OMDA 5ER4X 4QJ3B 4MBEA 5AEQA 3I5IC 1AK8A 2MBXA 2E30A 4YI9A 3IQQA 4OKHA 2QPTA 2WCEA 3OB1B 1CMGA 2JZIA 1SW8A 2I94A 5F6TA 2HQWA 3D0YA 1K8UA 1Y1XA 1M46A 3RM1A 1K95A 3M0WA 1OMVA 1B9AA 4MRYA 3O2PA 2WOSA 2LV7A 1ODBA 1TRFA 1SL8A 4R1EA 5BPJA 1SY9A 5AFPA 2IS9A 2LVVA 4C0KA 2BE4A 2K7OA 1B8LA 3PLFB 1XYDA 4MRXA 4CLNA 4M2PA 3E3RA 2KNEA 2JQ6A 3I5HC 1NCZA 4P2YB 2VRGA 3D10A 1QATA 1BF5A 4JWQA 1QIVA 5CSIA 3AKAA 1B7TZ 1MHOA 1OOJA 1D1OA 4TNCA 2E6WA 3SG4A 1J7OA 2JRFA 1HT9A 2PALA 2FJUB 4PALA 1CM4A 1QX7A 1LA0A 1KWOB 3DVJA 4I5LB 4P5OE 5K89A 1S5GZ 2B1UA 2KGBC 1BG1A 1UUSA 5B8IB 2CCMA 2Y5IA 4WRIA 4YGDB 4ETOA 1A4PA 2F8PA 1JWDA 3OX5A 4MLWA 3IF7A 1DTLA 2HETA 1W7JB 2JNXA 1MQ1A 2NCPA 1KWOC 4CFQA 4I5NB 1BR4B 2SASA 2PMYA 1E8AA 1DF0B 1K9PA 1DJXA 1AVSA 4ORAB 1NCYA 2JXCA 1FI5A 1DGUA 3CR4X 1NSHA 4BY5A 5JOLA 2TN4A 1S6JA 1UHJA 2BECA 1ZACA 1BLQA 4N5XA 3GK4X 1F55A 3DD4A 3EVUA 1F54A 1SMGA 5HLOA 1R6PA 1JF2A 4I5JA 2BE6A 1LXFC 2LUXA 2WCBA 4YGEB 1J7RA 3KEVA 1BJFA 4L9MA 2L98A 3O4YA 4CPVA 4U8DA 2LAPA 2P6BB 1TN4A 1SCMB 4NDBA 1LINA 4GGNA 1KK7Y 2JT0A 4PDZA 1Y0VH 1MWNA 3LK0A 2GV5A 1KFXS 4MZLA 3VRRA 3DVEA 1FF1A 4NDCA 3TDUA 1SCMC 2KFFA 3CZTX 4AQJA 4MN0A 4YI8A 2M9GA 3A8RA 1KSMA 1Y6WA 4Q04A 2WORA 4YGBB 2KBIA 3PN7B 5J3XA 3SG7A 3MSEB 1RROA 2ZNEA 2COLB 2H61C 2HPSA 2H2KA 4GFTA 3NSKA 1EH2A 5DKRA 1S1EA 2CXJA 3FS7A 1YUTA 2KI6C 1NWDA 3PSRA 1UHHA 1ZFSA 3AAKA 2G2BA 1DJIA 2AUCA 3PN7C 2ZN9A 3BUOB 4D1EA 1DGVA 1YX7A 4CIDA 1PVBA 2EHBA 2L2EA 3BUXB 1PK0D 3FIAA 3HX4A 3I5FB 3VRPA 3FWCA 2OS8B 1BU3A 2A4JA 2F33A 2DOQA 3SG3A 2KSPA 1CFCA 1FBVA 3TDZA 2I2RE 1UURA 1IGVA 1BODA 1HQVA 1KSOA 2JTTA 3ZWHA 5CSNA 1YURA 2NLNA 2LLSA 1CDLA 2OS8C 5I2QA 2ZNDA 4CFRA 1GQMA 1A2XA 1XFXO 1EG3A 3PATA 4MVFA 1CKKA 1CFDA 4HSZA 1EL4A 2F2OA 2WCFA 1RFJA 1SYMA 2MLEC 1YUUA 4PHMA 2ZFDA 2PVBA 4GBAA 1C7WA 3OB2B 3PM8A 1IJ6A 1XVJA 1EJ3A 1B1GA 1A03A 2KI6D 3OX6A 1DJHA 1L2OB 3FWBA 2NZ0A 4OCIA 3CLNA 1JFJA 1KK8C 3NSOA 3TS5C 2LLTA 2M3WA 3C1VA 3I5HB 3A4UB 3DF0A 1CLBA 1QIWA 2KQ6A 2JT8A 2M0RA 2K2FA 2L5XB 2K0JA 3SG5A 2HF5A 3HCMA 1L2OC 2JXLA 1JUOA 1NX2A 3LCPC 3AKBA 4MZJA 1IG5A 5AXIA 4ZCVA 1M31A 2CT9A 1SK6D 1F4OA 2KQYA 2LNKA 1PSRA 1S6CA 2JTZA 2KBMA 3VROA 1TNXA 1YRTB 2ISDA 2O60A 2NCOA 2AMIA 1SR6C 1CNPA 1ALWA 1XFYO 4C0LA 3LL8B 3SG6A 4A4BA 2LE9B 1QXPA 5DKQA 1NPQA 4OVNF 3PFVA 1CM1A 1K9UA 3WHTB 1DT7B 1QASA 1PRWA 2WC8A 1C7VA 2CTNA 2JU0A 5HKZA 5I8NA 1GJYA 2EC6C 1SNLA 2L4IA 4PHNA 3CR5X 2L51A 2ZN8A 2ZKMX 3TZ1A 1IWQA 2BCAA 1WDCC 4MEWA 2KDHA 2PSRA 2M8UA 1QLKA 1JFKA 3OHMB 1N0YA 2BBNA 1DVIA 1CTRA 1TNPA 2L0PA 1A75B 2JC2A 1XFZO 2WNDA 1J55A 1KQMC 1KFUS 1N65A 1WLMA 2LP2A 4OR9B 3BYAA 4WQ2A 5D7FA 4XYNA 1J7PA 1SL7A 3SIBA 4F0ZB 1TOPA 1K9KA 1L7ZA 3K21A 4XJKA 1MXEA 1S3PA 2KFGA 2KI4C 3OP0A 2BBMA 1XK4C 4YBHB 3TUYC 2LHLA 1UHIA 4QJ5B 1K94A 1K93D 2M7NA 4PE4A 2Q91A 1LVCD 3CR2A 1TCFA 5HLVA 3NSIA 2MLFC 2GGZA 1KFXL 3QRXA 4MSPA 4PE7A 3H4SE 1TNWA 4FTGA 1SCVA 1QV0A 1B8CA 1ZOTB 2M97A 2QACA 5I2OA 4I5KA 5TNCA 5KSZA 1QVIY 4DRWA 1XK4A 3IQOA 3EVRA 1DMOA 1YTZC 1A29A 2M1KB 4GAOA 2V53A 5ER5A 1WRKA 3DVMA 1U5IA 4NDDA 2BKIB 4USLA 1IRJA 2M1UA 4AOMA 4AQIA 4MZKA 2LANA 1RECA 1TIZA 2BKHB 5DKNA 5HKWA 1G33A 1B7TY 3D0YB 1NIWA 4FQOA 5CSFA 4YGCB 2LP3A 1SL9A 2D8NA 2NXQA 3O78A 4C0JA 2LCPA 3DF0B 3BUWB 2JPTA 1MXLC 4HRHA 1UHNA 3BOWA 1JC2A 1BMOA 1XFUO 1JBAA 4GNKB 3O6BA 3SIAA 1QTXA 1IQ5A 1XFVO 3NXAA 1J1DA 1JF0A 1SPYA 3JVTC 1UP5A 1KK8B 4YGAA 1MUXA 3TS5B 4UPGA 1OE9B 1FW4A 1YVHA 1IH0A 1BR1B 1DJWA 3EK4A 3NSLA 1OZOA 4DCKA 3JTDB 3EKJA 4JQ0D 1F8HA 1NX0A 1ZUZA 1CDMA 1C07A 1S26D 4HRGA 2HQ8A 2M49B 2F2PA 4GGFA 1KK7Z 4IL1A 1QV1A 2MJWB 3KF9A 2K2AA 5AANA 5GQQC 3JTDC 3EK8A 2CNPA 1B47A 1F4QA 1K2HA 2MRDA 1SR6B 3GK1A 1WLZA 1BT6A 1VRKA 3I5GB 1LKJA 1WY9A 2LVKA 2Q4UA 4QJ4B 2I7AA 3VRNA 2FOTA 3CTNA 1OSAA 4ZCUA 1AJ5A 1OQPA 2LLUA 5I2LA 2LM5A 2KYFA 3PALA 1CLMA 3I5GC 2MAZA 4DS7A 1QS7A 1QVIZ 2EC6B 2JOJA 5AERA 1CFPA 1LA3A 2JNFA 1RJVA 1PULA 1B8RA 1SKTA 2R2IA 1IJ5A 1CDPA 3CWGA 4M2QA 1OZSA 1XA5A 1UWOA 3KPXA 1WDCB 3RLZA 2MA2A 1TNQA 2BCXA 1PVAA 2PRUA 2Y4QA 4ORBB 3SJSA 5HKYA 1CMFA 1WRLA 4GPLB 4XJKB 2LUCA 1KCYA 3F45A 2GGMA 4DIRA 3KHEA 3EKHA 3WHUB 1QX5B 3SG2A 1GGWA 1G4YR 1KQMB 2F3YA 1QJTA 1FI6A 1MR8A 4N1GA 1KQVA 1R2UA 1FPWA 1XO5A 1DJYA 1Y1AA 2LVJA 1SRAA 1M39A 2AAOA 2EGDA 2KAVA 1F71A 3EVVA 2KI4B 5G08A 5HYDA 2BL0B 1M45A 1AUIB 1ZMZA 2G9BA 1WRZA 4PHJA 1F70A 1RTP1 3TUYB 3LK1A 2KFHA 2SCPA 4PE1A 1NCXA 2KHNA 1MF8B 1XFWO 1V1FA 4PHKA 1PALA 5CPVA 4A4CA 1U5IB 2OPOA 4HREE 1M63B 5PALA 2KGRA 3BQ3A 2BL0C 1KFUL 2RGIA 2L50A 2FCEA 1S36A 3EK7A 1YUSA 3GK2A 2LC5A 2BCBA 2M7LA 1YX8A 3ICBA 1IKUA 1H8BA 3AAJA 5D69A 1UHKA 2KAXA 3DVKA 1B4CA 1QLSA 1CLLA 2LMVA 3BOWB 3BUNB 3LLEA 3TDIA 1TCOB 1X02A 2M29A 1DJZA 1ALVA 1NUBA 1DF0A 1W7IB 2CBLA 2K8MB 4NQGA 4E68A 1NP8A 1PSBA 1NX1A 1DJGA 2K7CA 2KAYA 2KOTA 1K96A 2L4HA 4ICBA 1CFFA 1CB1A 2K7BA 2OTGB 4BY4A 1JSAA 1Y1UA 3VRQA 1NX3A 2I18A 1RWYA 2JULA 2MHHA 3GOFA 1J7QA 1IQ3A 1GGZA 4ORCB 1A75A 1QX2A 1AHRA 2O5GA 1AJ4A 2F3ZA 2PASA 3KO0A 4WQ3A 4YRUA 1NYAA 1BOCA 2OTGC 3JVTB 4M2OA 3CS1A 4N1FA 3BUMB 1K90D 4PE0A 5KTYA 1S5GY 2KYCA 4DUQA 1V1GA 1OMRA 1AP4A 4OV2A 5FYXA 1Q80A 1S6IA 3ZNIA 1EG4A 3BXKA 2JT3A 5KU1A 2K61A 4GGFC 1YRUB 5JJGA 5CSJA 1EXRA 3CGAA 2K7DA 3VGOA 1CDNA 2LHIA 2H61A 2JWWA 4PCWA 2ZRSA 4JPZB 1YR5A 2LMTA 2FCDA 2ZRTA 1YVLA 3WXAA 1G8IA 4GUKA 1J1EA 2Y1NA 3I5IB 2Y1MA 2LVIA 1N2DA 3WNXB 1RK9A 3I5FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SBJ A;  2LMU A;  5IBW A;  1H4B A;  1TTX A;  1OMD A;  5ER4 X;  4QJ3 B;  4MBE A;  5AEQ A;  3I5I C;  1AK8 A;  2MBX A;  2E30 A;  4YI9 A;  3IQQ A;  4OKH A;  2QPT A;  2WCE A;  3OB1 B;  1CMG A;  2JZI A;  1SW8 A;  2I94 A;  5F6T A;  2HQW A;  3D0Y A;  1K8U A;  1Y1X A;  1M46 A;  3RM1 A;  1K95 A;  3M0W A;  1OMV A;  1B9A A;  4MRY A;  3O2P A;  2WOS A;  2LV7 A;  1ODB A;  1TRF A;  1SL8 A;  4R1E A;  5BPJ A;  1SY9 A;  5AFP A;  2IS9 A;  2LVV A;  4C0K A;  2BE4 A;  2K7O A;  1B8L A;  3PLF B;  1XYD A;  4MRX A;  4CLN A;  4M2P A;  3E3R A;  2KNE A;  2JQ6 A;  3I5H C;  1NCZ A;  4P2Y B;  2VRG A;  3D10 A;  1QAT A;  1BF5 A;  4JWQ A;  1QIV A;  5CSI A;  3AKA A;  1B7T Z;  1MHO A;  1OOJ A;  1D1O A;  4TNC A;  2E6W A;  3SG4 A;  1J7O A;  2JRF A;  1HT9 A;  2PAL A;  2FJU B;  4PAL A;  1CM4 A;  1QX7 A;  1LA0 A;  1KWO B;  3DVJ A;  4I5L B;  4P5O E;  5K89 A;  1S5G Z;  2B1U A;  2KGB C;  1BG1 A;  1UUS A;  5B8I B;  2CCM A;  2Y5I A;  4WRI A;  4YGD B;  4ETO A;  1A4P A;  2F8P A;  1JWD A;  3OX5 A;  4MLW A;  3IF7 A;  1DTL A;  2HET A;  1W7J B;  2JNX A;  1MQ1 A;  2NCP A;  1KWO C;  4CFQ A;  4I5N B;  1BR4 B;  2SAS A;  2PMY A;  1E8A A;  1DF0 B;  1K9P A;  1DJX A;  1AVS A;  4ORA B;  1NCY A;  2JXC A;  1FI5 A;  1DGU A;  3CR4 X;  1NSH A;  4BY5 A;  5JOL A;  2TN4 A;  1S6J A;  1UHJ A;  2BEC A;  1ZAC A;  1BLQ A;  4N5X A;  3GK4 X;  1F55 A;  3DD4 A;  3EVU A;  1F54 A;  1SMG A;  5HLO A;  1R6P A;  1JF2 A;  4I5J A;  2BE6 A;  1LXF C;  2LUX A;  2WCB A;  4YGE B;  1J7R A;  3KEV A;  1BJF A;  4L9M A;  2L98 A;  3O4Y A;  4CPV A;  4U8D A;  2LAP A;  2P6B B;  1TN4 A;  1SCM B;  4NDB A;  1LIN A;  4GGN A;  1KK7 Y;  2JT0 A;  4PDZ A;  1Y0V H;  1MWN A;  3LK0 A;  2GV5 A;  1KFX S;  4MZL A;  3VRR A;  3DVE A;  1FF1 A;  4NDC A;  3TDU A;  1SCM C;  2KFF A;  3CZT X;  4AQJ A;  4MN0 A;  4YI8 A;  2M9G A;  3A8R A;  1KSM A;  1Y6W A;  4Q04 A;  2WOR A;  4YGB B;  2KBI A;  3PN7 B;  5J3X A;  3SG7 A;  3MSE B;  1RRO A;  2ZNE A;  2COL B;  2H61 C;  2HPS A;  2H2K A;  4GFT A;  3NSK A;  1EH2 A;  5DKR A;  1S1E A;  2CXJ A;  3FS7 A;  1YUT A;  2KI6 C;  1NWD A;  3PSR A;  1UHH A;  1ZFS A;  3AAK A;  2G2B A;  1DJI A;  2AUC A;  3PN7 C;  2ZN9 A;  3BUO B;  4D1E A;  1DGV A;  1YX7 A;  4CID A;  1PVB A;  2EHB A;  2L2E A;  3BUX B;  1PK0 D;  3FIA A;  3HX4 A;  3I5F B;  3VRP A;  3FWC A;  2OS8 B;  1BU3 A;  2A4J A;  2F33 A;  2DOQ A;  3SG3 A;  2KSP A;  1CFC A;  1FBV A;  3TDZ A;  2I2R E;  1UUR A;  1IGV A;  1BOD A;  1HQV A;  1KSO A;  2JTT A;  3ZWH A;  5CSN A;  1YUR A;  2NLN A;  2LLS A;  1CDL A;  2OS8 C;  5I2Q A;  2ZND A;  4CFR A;  1GQM A;  1A2X A;  1XFX O;  1EG3 A;  3PAT A;  4MVF A;  1CKK A;  1CFD A;  4HSZ A;  1EL4 A;  2F2O A;  2WCF A;  1RFJ A;  1SYM A;  2MLE C;  1YUU A;  4PHM A;  2ZFD A;  2PVB A;  4GBA A;  1C7W A;  3OB2 B;  3PM8 A;  1IJ6 A;  1XVJ A;  1EJ3 A;  1B1G A;  1A03 A;  2KI6 D;  3OX6 A;  1DJH A;  1L2O B;  3FWB A;  2NZ0 A;  4OCI A;  3CLN A;  1JFJ A;  1KK8 C;  3NSO A;  3TS5 C;  2LLT A;  2M3W A;  3C1V A;  3I5H B;  3A4U B;  3DF0 A;  1CLB A;  1QIW A;  2KQ6 A;  2JT8 A;  2M0R A;  2K2F A;  2L5X B;  2K0J A;  3SG5 A;  2HF5 A;  3HCM A;  1L2O C;  2JXL A;  1JUO A;  1NX2 A;  3LCP C;  3AKB A;  4MZJ A;  1IG5 A;  5AXI A;  4ZCV A;  1M31 A;  2CT9 A;  1SK6 D;  1F4O A;  2KQY A;  2LNK A;  1PSR A;  1S6C A;  2JTZ A;  2KBM A;  3VRO A;  1TNX A;  1YRT B;  2ISD A;  2O60 A;  2NCO A;  2AMI A;  1SR6 C;  1CNP A;  1ALW A;  1XFY O;  4C0L A;  3LL8 B;  3SG6 A;  4A4B A;  2LE9 B;  1QXP A;  5DKQ A;  1NPQ A;  4OVN F;  3PFV A;  1CM1 A;  1K9U A;  3WHT B;  1DT7 B;  1QAS A;  1PRW A;  2WC8 A;  1C7V A;  2CTN A;  2JU0 A;  5HKZ A;  5I8N A;  1GJY A;  2EC6 C;  1SNL A;  2L4I A;  4PHN A;  3CR5 X;  2L51 A;  2ZN8 A;  2ZKM X;  3TZ1 A;  1IWQ A;  2BCA A;  1WDC C;  4MEW A;  2KDH A;  2PSR A;  2M8U A;  1QLK A;  1JFK A;  3OHM B;  1N0Y A;  2BBN A;  1DVI A;  1CTR A;  1TNP A;  2L0P A;  1A75 B;  2JC2 A;  1XFZ O;  2WND A;  1J55 A;  1KQM C;  1KFU S;  1N65 A;  1WLM A;  2LP2 A;  4OR9 B;  3BYA A;  4WQ2 A;  5D7F A;  4XYN A;  1J7P A;  1SL7 A;  3SIB A;  4F0Z B;  1TOP A;  1K9K A;  1L7Z A;  3K21 A;  4XJK A;  1MXE A;  1S3P A;  2KFG A;  2KI4 C;  3OP0 A;  2BBM A;  1XK4 C;  4YBH B;  3TUY C;  2LHL A;  1UHI A;  4QJ5 B;  1K94 A;  1K93 D;  2M7N A;  4PE4 A;  2Q91 A;  1LVC D;  3CR2 A;  1TCF A;  5HLV A;  3NSI A;  2MLF C;  2GGZ A;  1KFX L;  3QRX A;  4MSP A;  4PE7 A;  3H4S E;  1TNW A;  4FTG A;  1SCV A;  1QV0 A;  1B8C A;  1ZOT B;  2M97 A;  2QAC A;  5I2O A;  4I5K A;  5TNC A;  5KSZ A;  1QVI Y;  4DRW A;  1XK4 A;  3IQO A;  3EVR A;  1DMO A;  1YTZ C;  1A29 A;  2M1K B;  4GAO A;  2V53 A;  5ER5 A;  1WRK A;  3DVM A;  1U5I A;  4NDD A;  2BKI B;  4USL A;  1IRJ A;  2M1U A;  4AOM A;  4AQI A;  4MZK A;  2LAN A;  1REC A;  1TIZ A;  2BKH B;  5DKN A;  5HKW A;  1G33 A;  1B7T Y;  3D0Y B;  1NIW A;  4FQO A;  5CSF A;  4YGC B;  2LP3 A;  1SL9 A;  2D8N A;  2NXQ A;  3O78 A;  4C0J A;  2LCP A;  3DF0 B;  3BUW B;  2JPT A;  1MXL C;  4HRH A;  1UHN A;  3BOW A;  1JC2 A;  1BMO A;  1XFU O;  1JBA A;  4GNK B;  3O6B A;  3SIA A;  1QTX A;  1IQ5 A;  1XFV O;  3NXA A;  1J1D A;  1JF0 A;  1SPY A;  3JVT C;  1UP5 A;  1KK8 B;  4YGA A;  1MUX A;  3TS5 B;  4UPG A;  1OE9 B;  1FW4 A;  1YVH A;  1IH0 A;  1BR1 B;  1DJW A;  3EK4 A;  3NSL A;  1OZO A;  4DCK A;  3JTD B;  3EKJ A;  4JQ0 D;  1F8H A;  1NX0 A;  1ZUZ A;  1CDM A;  1C07 A;  1S26 D;  4HRG A;  2HQ8 A;  2M49 B;  2F2P A;  4GGF A;  1KK7 Z;  4IL1 A;  1QV1 A;  2MJW B;  3KF9 A;  2K2A A;  5AAN A;  5GQQ C;  3JTD C;  3EK8 A;  2CNP A;  1B47 A;  1F4Q A;  1K2H A;  2MRD A;  1SR6 B;  3GK1 A;  1WLZ A;  1BT6 A;  1VRK A;  3I5G B;  1LKJ A;  1WY9 A;  2LVK A;  2Q4U A;  4QJ4 B;  2I7A A;  3VRN A;  2FOT A;  3CTN A;  1OSA A;  4ZCU A;  1AJ5 A;  1OQP A;  2LLU A;  5I2L A;  2LM5 A;  2KYF A;  3PAL A;  1CLM A;  3I5G C;  2MAZ A;  4DS7 A;  1QS7 A;  1QVI Z;  2EC6 B;  2JOJ A;  5AER A;  1CFP A;  1LA3 A;  2JNF A;  1RJV A;  1PUL A;  1B8R A;  1SKT A;  2R2I A;  1IJ5 A;  1CDP A;  3CWG A;  4M2Q A;  1OZS A;  1XA5 A;  1UWO A;  3KPX A;  1WDC B;  3RLZ A;  2MA2 A;  1TNQ A;  2BCX A;  1PVA A;  2PRU A;  2Y4Q A;  4ORB B;  3SJS A;  5HKY A;  1CMF A;  1WRL A;  4GPL B;  4XJK B;  2LUC A;  1KCY A;  3F45 A;  2GGM A;  4DIR A;  3KHE A;  3EKH A;  3WHU B;  1QX5 B;  3SG2 A;  1GGW A;  1G4Y R;  1KQM B;  2F3Y A;  1QJT A;  1FI6 A;  1MR8 A;  4N1G A;  1KQV A;  1R2U A;  1FPW A;  1XO5 A;  1DJY A;  1Y1A A;  2LVJ A;  1SRA A;  1M39 A;  2AAO A;  2EGD A;  2KAV A;  1F71 A;  3EVV A;  2KI4 B;  5G08 A;  5HYD A;  2BL0 B;  1M45 A;  1AUI B;  1ZMZ A;  2G9B A;  1WRZ A;  4PHJ A;  1F70 A;  1RTP 1;  3TUY B;  3LK1 A;  2KFH A;  2SCP A;  4PE1 A;  1NCX A;  2KHN A;  1MF8 B;  1XFW O;  1V1F A;  4PHK A;  1PAL A;  5CPV A;  4A4C A;  1U5I B;  2OPO A;  4HRE E;  1M63 B;  5PAL A;  2KGR A;  3BQ3 A;  2BL0 C;  1KFU L;  2RGI A;  2L50 A;  2FCE A;  1S36 A;  3EK7 A;  1YUS A;  3GK2 A;  2LC5 A;  2BCB A;  2M7L A;  1YX8 A;  3ICB A;  1IKU A;  1H8B A;  3AAJ A;  5D69 A;  1UHK A;  2KAX A;  3DVK A;  1B4C A;  1QLS A;  1CLL A;  2LMV A;  3BOW B;  3BUN B;  3LLE A;  3TDI A;  1TCO B;  1X02 A;  2M29 A;  1DJZ A;  1ALV A;  1NUB A;  1DF0 A;  1W7I B;  2CBL A;  2K8M B;  4NQG A;  4E68 A;  1NP8 A;  1PSB A;  1NX1 A;  1DJG A;  2K7C A;  2KAY A;  2KOT A;  1K96 A;  2L4H A;  4ICB A;  1CFF A;  1CB1 A;  2K7B A;  2OTG B;  4BY4 A;  1JSA A;  1Y1U A;  3VRQ A;  1NX3 A;  2I18 A;  1RWY A;  2JUL A;  2MHH A;  3GOF A;  1J7Q A;  1IQ3 A;  1GGZ A;  4ORC B;  1A75 A;  1QX2 A;  1AHR A;  2O5G A;  1AJ4 A;  2F3Z A;  2PAS A;  3KO0 A;  4WQ3 A;  4YRU A;  1NYA A;  1BOC A;  2OTG C;  3JVT B;  4M2O A;  3CS1 A;  4N1F A;  3BUM B;  1K90 D;  4PE0 A;  5KTY A;  1S5G Y;  2KYC A;  4DUQ A;  1V1G A;  1OMR A;  1AP4 A;  4OV2 A;  5FYX A;  1Q80 A;  1S6I A;  3ZNI A;  1EG4 A;  3BXK A;  2JT3 A;  5KU1 A;  2K61 A;  4GGF C;  1YRU B;  5JJG A;  5CSJ A;  1EXR A;  3CGA A;  2K7D A;  3VGO A;  1CDN A;  2LHI A;  2H61 A;  2JWW A;  4PCW A;  2ZRS A;  4JPZ B;  1YR5 A;  2LMT A;  2FCD A;  2ZRT A;  1YVL A;  3WXA A;  1G8I A;  4GUK A;  1J1E A;  2Y1N A;  3I5I B;  2Y1M A;  2LVI A;  1N2D A;  3WNX B;  1RK9 A;  3I5F C; 
#chains in the Genus database with same CATH topology
 1SBJ A;  3V2L A;  2LMU A;  5IBW A;  1H4B A;  1TTX A;  1OMD A;  5ER4 X;  3B87 A;  4QJ3 B;  4MBE A;  5AEQ A;  3DYE A;  3I5I C;  1AK8 A;  2MBX A;  3L47 A;  3OBV A;  2E30 A;  4YI9 A;  3IQQ A;  4OKH A;  2QPT A;  2WCE A;  3OB1 B;  1CMG A;  4FQT A;  2JZI A;  2KPH A;  1SW8 A;  2I94 A;  5F6T A;  2HQW A;  3D0Y A;  1K8U A;  3IVT A;  3K1E A;  3S0A A;  1Y1X A;  1M46 A;  3RM1 A;  1K95 A;  1W9Z A;  3M0W A;  1OMV A;  1B9A A;  4MRY A;  3L4L A;  3O2P A;  2WOS A;  2LV7 A;  1ODB A;  3B86 A;  1TRF A;  1SL8 A;  4R1E A;  5BPJ A;  1SY9 A;  3B88 A;  5AFP A;  2IS9 A;  2LVV A;  4C0K A;  2BE4 A;  2K7O A;  3UNW A;  1B8L A;  3PLF B;  1XYD A;  3Q8I A;  4MRX A;  4CLN A;  4M2P A;  3E3R A;  1DEL A;  2KNE A;  2JQ6 A;  3I5H C;  1NCZ A;  4P2Y B;  2VRG A;  3D10 A;  1QAT A;  1BF5 A;  4JWQ A;  1QIV A;  5CSI A;  3AKA A;  1B7T Z;  1MHO A;  1OOJ A;  1D1O A;  4TNC A;  2E6W A;  3SG4 A;  1J7O A;  2JRF A;  1HT9 A;  2PAL A;  2FJU B;  4PAL A;  1CM4 A;  1QX7 A;  1LA0 A;  1KWO B;  3DVJ A;  4I5L B;  4P5O E;  2BNX A;  5K89 A;  1S5G Z;  4PT1 A;  2B1U A;  2KGB C;  1BG1 A;  1UUS A;  2WCM A;  5B8I B;  2CCM A;  2Y5I A;  4WRI A;  4YGD B;  4ETO A;  1A4P A;  2F8P A;  1JWD A;  3OX5 A;  4MLW A;  3IF7 A;  1DTL A;  2HET A;  1W7J B;  2JNX A;  1MQ1 A;  2NCP A;  1KWO C;  4CFQ A;  4I5N B;  1BR4 B;  2SAS A;  2PMY A;  1E8A A;  1DF0 B;  1K9P A;  1DJX A;  1AVS A;  4ORA B;  1NCY A;  2JXC A;  1FI5 A;  1DGU A;  3CR4 X;  1NSH A;  4BY5 A;  2QEB A;  5JOL A;  2TN4 A;  1S6J A;  1UHJ A;  2BEC A;  1ZAC A;  1BLQ A;  4N5X A;  3GK4 X;  1F55 A;  3DD4 A;  3EVU A;  1F54 A;  3D75 A;  1SMG A;  2WCL A;  1R6P A;  5HLO A;  1JF2 A;  4I5J A;  2BE6 A;  1LXF C;  2LUX A;  2FJY A;  2WCB A;  4YGE B;  1J7R A;  3KEV A;  3PM2 A;  1BJF A;  4L9M A;  2L98 A;  3O4Y A;  4CPV A;  4U8D A;  2LAP A;  1XFR A;  2P6B B;  1TN4 A;  1SCM B;  4NDB A;  1LIN A;  4GGN A;  1KK7 Y;  1LS8 A;  2JT0 A;  5AER A;  4PDZ A;  1Y0V H;  1MWN A;  1DC1 A;  3LK0 A;  2GV5 A;  1KFX S;  4OZD A;  4MZL A;  3VRR A;  3DVE A;  1FF1 A;  4NDC A;  2P71 A;  3TDU A;  1SCM C;  2KFF A;  3CZT X;  4JKT A;  4AQJ A;  1IIO A;  4MN0 A;  4YI8 A;  2M9G A;  3A8R A;  1KSM A;  1Y6W A;  4Q04 A;  2WOR A;  4YGB B;  2KBI A;  3PN7 B;  5J3X A;  3SG7 A;  3MSE B;  3D76 A;  1RRO A;  2ZNE A;  2COL B;  2H61 C;  2HPS A;  2H2K A;  4GFT A;  2K60 A;  3NSK A;  1EH2 A;  5DKR A;  1S1E A;  2CXJ A;  3FS7 A;  1YUT A;  2KI6 C;  1NWD A;  3PSR A;  1UHH A;  1ZFS A;  3AAK A;  2GTE A;  3SS5 A;  3UO9 A;  2G2B A;  1DJI A;  2AUC A;  3PN7 C;  2ZN9 A;  3BUO B;  4D1E A;  1DEK A;  1DGV A;  1YX7 A;  4CID A;  1PVB A;  2EHB A;  2L2E A;  3BUX B;  1PK0 D;  3FIA A;  3HX4 A;  3I5F B;  3VRP A;  3FWC A;  2OS8 B;  1BU3 A;  2A4J A;  2F33 A;  2DOQ A;  3SG3 A;  2KSP A;  1CFC A;  1FBV A;  3TDZ A;  2I2R E;  1UUR A;  1IGV A;  1BOD A;  1HQV A;  1KSO A;  2JTT A;  3ZWH A;  5CSN A;  1YUR A;  2NLN A;  2LLS A;  2YGU A;  1Z4H A;  1CDL A;  2OS8 C;  5I2Q A;  2ZND A;  3B6X A;  4CFR A;  1GQM A;  1A2X A;  1XFX O;  1EG3 A;  3PAT A;  4MVF A;  1CKK A;  1CFD A;  4HSZ A;  1EL4 A;  2F2O A;  2WCF A;  1C3Y A;  1RFJ A;  1TUZ A;  1SYM A;  2MLE C;  1YUU A;  4PHM A;  2ZFD A;  2PVB A;  4GBA A;  1C7W A;  3OB2 B;  2KLD A;  3PM8 A;  1IJ6 A;  1XVJ A;  1EJ3 A;  1B1G A;  3SS4 A;  1A03 A;  2WCJ A;  3D78 A;  2KI6 D;  3OX6 A;  1DJH A;  1L2O B;  3FWB A;  2NZ0 A;  4OCI A;  3CLN A;  1JFJ A;  1KK8 C;  3NSO A;  3TS5 C;  2LLT A;  2M3W A;  3C1V A;  3I5H B;  3A4U B;  3DF0 A;  1CLB A;  1QIW A;  2KQ6 A;  2JT8 A;  2M0R A;  2JPO A;  2K2F A;  2L5X B;  2K0J A;  3SG5 A;  2HF5 A;  3HCM A;  1L2O C;  2JXL A;  1JUO A;  1NX2 A;  3LCP C;  3AKB A;  3D73 A;  1DQE A;  4MZJ A;  1IG5 A;  5AXI A;  4ZCV A;  1M31 A;  2CT9 A;  1SK6 D;  1F4O A;  2KQY A;  3D74 A;  2LNK A;  5D3O A;  1PSR A;  1S6C A;  2JTZ A;  2KBM A;  3VRO A;  1TNX A;  2WC6 A;  1YRT B;  3S0D A;  4IJ7 A;  3BFB A;  2ISD A;  2O60 A;  2NCO A;  2AMI A;  1SR6 C;  3R1P A;  1ALW A;  1XFY O;  5FI7 A;  1CNP A;  4C0L A;  3N7H A;  3LL8 B;  1Z2C B;  3SG6 A;  4A4B A;  2LE9 B;  1QXP A;  3S0B A;  5DKQ A;  1NPQ A;  4OVN F;  3PFV A;  1CM1 A;  1K9U A;  1QWV A;  3S0F A;  3WHT B;  1DT7 B;  1QAS A;  3D77 A;  1PRW A;  2H8V A;  2WC8 A;  1C7V A;  1GM0 A;  2CTN A;  2JU0 A;  5HKZ A;  5I8N A;  1GJY A;  2EC6 C;  1SNL A;  2L4I A;  4PHN A;  3CR5 X;  2L51 A;  2ZN8 A;  2ZKM X;  3TZ1 A;  1IWQ A;  4JD9 A;  2BCA A;  1WDC C;  4MEW A;  2KDH A;  2PSR A;  2M8U A;  1QLK A;  1JFK A;  3OHM B;  1N0Y A;  2BBN A;  1DVI A;  1CTR A;  1TNP A;  2L0P A;  1A75 B;  2JC2 A;  1XFZ O;  2WND A;  1J55 A;  1TUJ A;  1KQM C;  1KFU S;  1N65 A;  1WLM A;  2LP2 A;  4OR9 B;  3BYA A;  4WQ2 A;  5D7F A;  4XYN A;  1J7P A;  1SL7 A;  5FI6 A;  4KYN A;  1OOH A;  4F7F A;  1C3Z A;  3SIB A;  4F0Z B;  1TOP A;  1K9K A;  1L7Z A;  3K21 A;  4XJK A;  1MXE A;  1S3P A;  2KFG A;  2KI4 C;  3B7A A;  2QEV A;  3OP0 A;  2BBM A;  1XK4 C;  4YBH B;  3TUY C;  2LHL A;  1UHI A;  4QJ5 B;  1K94 A;  1K93 D;  2M7N A;  4PE4 A;  2Q91 A;  1LVC D;  3CR2 A;  1TCF A;  5DIC A;  5HLV A;  3NSI A;  2MLF C;  2GGZ A;  1KFX L;  3QRX A;  4MSP A;  4PE7 A;  3H4S E;  1TNW A;  4FTG A;  1SCV A;  1QV0 A;  1B8C A;  1ZOT B;  2M97 A;  2QAC A;  5I2O A;  4I5K A;  3QME A;  5TNC A;  1QVI Y;  4DRW A;  1XK4 A;  3IQO A;  5KSZ A;  3EVR A;  1DMO A;  1YTZ C;  1A29 A;  2M1K B;  4GAO A;  2V53 A;  5ER5 A;  3EG5 B;  3FE6 A;  1WRK A;  3DVM A;  1U5I A;  3FE9 A;  2BKI B;  4NDD A;  4USL A;  1IRJ A;  2M1U A;  4AOM A;  4AQI A;  3SS3 A;  4MZK A;  2LAN A;  1REC A;  1TIZ A;  2BKH B;  5DKN A;  5HKW A;  1G33 A;  3CYZ A;  1B7T Y;  3S0E A;  3D0Y B;  1NIW A;  4FQO A;  5CSF A;  4YGC B;  2LP3 A;  1SL9 A;  2D8N A;  2NXQ A;  3O78 A;  4C0J A;  2LCP A;  3DF0 B;  3BUW B;  3BFH A;  3I5F C;  2JPT A;  1MXL C;  4HRH A;  1UHN A;  3BOW A;  1JC2 A;  3DZT A;  1BMO A;  1XFU O;  1JBA A;  4GNK B;  3O6B A;  3SIA A;  1XFV O;  1IQ5 A;  1QTX A;  3NXA A;  1J1D A;  3VB1 A;  1JF0 A;  3RZS A;  1SPY A;  3JVT C;  1UP5 A;  3R72 A;  1KK8 B;  4YGA A;  1MUX A;  3TS5 B;  4UPG A;  1OE9 B;  1FW4 A;  1YVH A;  1IH0 A;  1BR1 B;  1DJW A;  3EK4 A;  3NSL A;  1OZO A;  4DCK A;  3JTD B;  3EKJ A;  4JQ0 D;  1OOI X;  1F8H A;  1NX0 A;  3DXL A;  3PJI A;  1ZUZ A;  1CDM A;  1C07 A;  1S26 D;  2QDI A;  4HRG A;  2HQ8 A;  2M49 B;  2F2P A;  4GGF A;  1KK7 Z;  4IL1 A;  1QV1 A;  2MJW B;  3KF9 A;  2K2A A;  5AAN A;  5GQQ C;  3JTD C;  3EK8 A;  2CNP A;  2L2C A;  1B47 A;  1F4Q A;  1K2H A;  2WCH A;  4INW A;  2MRD A;  1SR6 B;  3CDN A;  3GK1 A;  1WLZ A;  2WCK A;  1BT6 A;  3CAB A;  1SSE B;  1VRK A;  1LKJ A;  3I5G B;  1WY9 A;  2LVK A;  2Q4U A;  4QJ4 B;  2I7A A;  3VRN A;  2FOT A;  2PQL A;  1OSA A;  3CTN A;  4ZCU A;  1AJ5 A;  1OQP A;  2LLU A;  5I2L A;  1P28 A;  2LM5 A;  2KYF A;  3PAL A;  1CLM A;  3CZ0 A;  3I5G C;  2MAZ A;  2PYQ A;  1QS7 A;  1QVI Z;  2EC6 B;  2JOJ A;  2ERB A;  2QEO A;  1LA3 A;  4DS7 A;  2JNF A;  3NHT A;  1CFP A;  1RJV A;  3CZ2 A;  1PUL A;  1B8R A;  1SKT A;  2R2I A;  1IJ5 A;  1CDP A;  3CWG A;  4M2Q A;  3BJH A;  1OZS A;  1XA5 A;  1UWO A;  3KPX A;  1WDC B;  3RLZ A;  2MA2 A;  2P70 A;  1TNQ A;  2BCX A;  1PVA A;  2PRU A;  2Y4Q A;  4ORB B;  3SJS A;  5HKY A;  1CMF A;  1WRL A;  4GPL B;  4XJK B;  2LUC A;  1KCY A;  3F45 A;  2GGM A;  2QEH A;  4DIR A;  3NHI A;  3KHE A;  3EKH A;  3WHU B;  1QX5 B;  3SG2 A;  5HL1 A;  1G4Y R;  1GGW A;  1KQM B;  2F3Y A;  1QJT A;  5EL2 A;  1MR8 A;  1FI6 A;  4N1G A;  1KQV A;  1R2U A;  1FPW A;  1XO5 A;  1DJY A;  1Y1A A;  2LVJ A;  1SRA A;  1M39 A;  2AAO A;  2EGD A;  2KAV A;  1F71 A;  3EVV A;  2KI4 B;  5G08 A;  5HYD A;  2BL0 B;  1M45 A;  1AUI B;  1ZMZ A;  2G9B A;  1OW4 A;  1WRZ A;  2WC5 A;  1RTP 1;  4PHJ A;  3TUY B;  1F70 A;  3LK1 A;  2KFH A;  2SCP A;  4PE1 A;  1NCX A;  2KHN A;  1MF8 B;  2BAP A;  1XFW O;  1V1F A;  4PHK A;  1PAL A;  3CZ1 A;  5CPV A;  5I94 A;  4A4C A;  1U5I B;  2OPO A;  4INX A;  4HRE E;  1M63 B;  5PAL A;  2KGR A;  3BQ3 A;  2BL0 C;  1KFU L;  2RGI A;  2L50 A;  2FCE A;  3R1V A;  1S36 A;  3EK7 A;  1YUS A;  3GK2 A;  2LC5 A;  2BCB A;  2M7L A;  1YX8 A;  3ICB A;  3OGN A;  1IKU A;  1H8B A;  3AAJ A;  5D69 A;  1UHK A;  2KAX A;  3DVK A;  1B4C A;  1QLS A;  1CLL A;  2LMV A;  1T14 A;  3BOW B;  3BUN B;  1TWO A;  3LLE A;  3TDI A;  1TCO B;  1X02 A;  1ORG A;  1DJZ A;  1ALV A;  1NUB A;  2M29 A;  1DF0 A;  1W7I B;  3FE8 A;  2CBL A;  2L5Y A;  2K8M B;  4NQG A;  4E68 A;  1NP8 A;  1PSB A;  1NX1 A;  1DJG A;  2K7C A;  2KAY A;  2KOT A;  1K96 A;  2L4H A;  3BFA A;  4ICB A;  1CFF A;  1CB1 A;  2K7B A;  2OTG B;  4BY4 A;  1JSA A;  1Y1U A;  3VRQ A;  1NX3 A;  2I18 A;  1RWY A;  2JUL A;  3L4A A;  2MHH A;  3GOF A;  1J7Q A;  1IQ3 A;  1GGZ A;  4ORC B;  1A75 A;  1QX2 A;  3R1O A;  1AHR A;  2O5G A;  1AJ4 A;  2F3Z A;  1OOF A;  2PAS A;  3KO0 A;  4WQ3 A;  4YRU A;  1NYA A;  1BOC A;  2OTG C;  3O4X A;  3JVT B;  4M2O A;  3CS1 A;  4N1F A;  3BUM B;  1K90 D;  4PE0 A;  5KTY A;  1S5G Y;  2KYC A;  3DY9 A;  4DUQ A;  1V1G A;  1OMR A;  1AP4 A;  4OV2 A;  5FYX A;  1Q80 A;  1S6I A;  3ZNI A;  1EG4 A;  3BXK A;  2JT3 A;  5KU1 A;  3NGV A;  2K61 A;  4GGF C;  1YRU B;  5JJG A;  5CSJ A;  1EXR A;  3CGA A;  2K7D A;  3VGO A;  1CDN A;  2LHI A;  3S0G A;  2H61 A;  2JWW A;  4PCW A;  2ZRS A;  4JPZ B;  1YR5 A;  5FI2 A;  2LMT A;  2FCD A;  2ZRT A;  1YVL A;  3WXA A;  1G8I A;  4GUK A;  1J1E A;  2Y1N A;  3I5I B;  2Y1M A;  2KLE A;  2LVI A;  1N2D A;  3WNX B;  1RK9 A;  1OOG A; 
#chains in the Genus database with same CATH homology
 1SBJ A;  2LMU A;  5IBW A;  1H4B A;  1TTX A;  1OMD A;  5ER4 X;  4QJ3 B;  4MBE A;  5AEQ A;  3I5I C;  1AK8 A;  2MBX A;  2E30 A;  4YI9 A;  3IQQ A;  4OKH A;  2QPT A;  2WCE A;  3OB1 B;  1CMG A;  2JZI A;  1SW8 A;  2I94 A;  5F6T A;  2HQW A;  3D0Y A;  1K8U A;  1Y1X A;  1M46 A;  3RM1 A;  1K95 A;  3M0W A;  1OMV A;  1B9A A;  4MRY A;  3O2P A;  2WOS A;  2LV7 A;  1ODB A;  1TRF A;  1SL8 A;  4R1E A;  5BPJ A;  1SY9 A;  5AFP A;  2IS9 A;  2LVV A;  4C0K A;  2BE4 A;  2K7O A;  1B8L A;  3PLF B;  1XYD A;  4MRX A;  4CLN A;  4M2P A;  3E3R A;  2KNE A;  2JQ6 A;  3I5H C;  1NCZ A;  4P2Y B;  2VRG A;  3D10 A;  1QAT A;  1BF5 A;  4JWQ A;  1QIV A;  5CSI A;  3AKA A;  1B7T Z;  1MHO A;  1OOJ A;  1D1O A;  4TNC A;  2E6W A;  3SG4 A;  1J7O A;  2JRF A;  1HT9 A;  2PAL A;  2FJU B;  4PAL A;  1CM4 A;  1QX7 A;  1LA0 A;  1KWO B;  3DVJ A;  4I5L B;  4P5O E;  5K89 A;  1S5G Z;  2B1U A;  2KGB C;  1BG1 A;  1UUS A;  5B8I B;  2CCM A;  2Y5I A;  4WRI A;  4YGD B;  4ETO A;  1A4P A;  2F8P A;  1JWD A;  3OX5 A;  4MLW A;  3IF7 A;  1DTL A;  2HET A;  1W7J B;  2JNX A;  1MQ1 A;  2NCP A;  1KWO C;  4CFQ A;  4I5N B;  1BR4 B;  2SAS A;  2PMY A;  1E8A A;  1DF0 B;  1K9P A;  1DJX A;  1AVS A;  4ORA B;  1NCY A;  2JXC A;  1FI5 A;  1DGU A;  3CR4 X;  1NSH A;  4BY5 A;  5JOL A;  2TN4 A;  1S6J A;  1UHJ A;  2BEC A;  1ZAC A;  1BLQ A;  4N5X A;  3GK4 X;  1F55 A;  3DD4 A;  3EVU A;  1F54 A;  1SMG A;  5HLO A;  1R6P A;  1JF2 A;  4I5J A;  2BE6 A;  1LXF C;  2LUX A;  2WCB A;  4YGE B;  1J7R A;  3KEV A;  1BJF A;  4L9M A;  2L98 A;  3O4Y A;  4CPV A;  4U8D A;  2LAP A;  2P6B B;  1TN4 A;  1SCM B;  4NDB A;  1LIN A;  4GGN A;  1KK7 Y;  2JT0 A;  4PDZ A;  1Y0V H;  1MWN A;  3LK0 A;  2GV5 A;  1KFX S;  4MZL A;  3VRR A;  3DVE A;  1FF1 A;  4NDC A;  3TDU A;  1SCM C;  2KFF A;  3CZT X;  4AQJ A;  4MN0 A;  4YI8 A;  2M9G A;  3A8R A;  1KSM A;  1Y6W A;  4Q04 A;  2WOR A;  4YGB B;  2KBI A;  3PN7 B;  5J3X A;  3SG7 A;  3MSE B;  1RRO A;  2ZNE A;  2COL B;  2H61 C;  2HPS A;  2H2K A;  4GFT A;  3NSK A;  1EH2 A;  5DKR A;  1S1E A;  2CXJ A;  3FS7 A;  1YUT A;  2KI6 C;  1NWD A;  3PSR A;  1UHH A;  1ZFS A;  3AAK A;  2G2B A;  1DJI A;  2AUC A;  3PN7 C;  2ZN9 A;  3BUO B;  4D1E A;  1DGV A;  1YX7 A;  4CID A;  1PVB A;  2EHB A;  2L2E A;  3BUX B;  1PK0 D;  3FIA A;  3HX4 A;  3I5F B;  3VRP A;  3FWC A;  2OS8 B;  1BU3 A;  2A4J A;  2F33 A;  2DOQ A;  3SG3 A;  2KSP A;  1CFC A;  1FBV A;  3TDZ A;  2I2R E;  1UUR A;  1IGV A;  1BOD A;  1HQV A;  1KSO A;  2JTT A;  3ZWH A;  5CSN A;  1YUR A;  2NLN A;  2LLS A;  1CDL A;  2OS8 C;  5I2Q A;  2ZND A;  4CFR A;  1GQM A;  1A2X A;  1XFX O;  1EG3 A;  3PAT A;  4MVF A;  1CKK A;  1CFD A;  4HSZ A;  1EL4 A;  2F2O A;  2WCF A;  1RFJ A;  1SYM A;  2MLE C;  1YUU A;  4PHM A;  2ZFD A;  2PVB A;  4GBA A;  1C7W A;  3OB2 B;  3PM8 A;  1IJ6 A;  1XVJ A;  1EJ3 A;  1B1G A;  1A03 A;  2KI6 D;  3OX6 A;  1DJH A;  1L2O B;  3FWB A;  2NZ0 A;  4OCI A;  3CLN A;  1JFJ A;  1KK8 C;  3NSO A;  3TS5 C;  2LLT A;  2M3W A;  3C1V A;  3I5H B;  3A4U B;  3DF0 A;  1CLB A;  1QIW A;  2KQ6 A;  2JT8 A;  2M0R A;  2K2F A;  2L5X B;  2K0J A;  3SG5 A;  2HF5 A;  3HCM A;  1L2O C;  2JXL A;  1JUO A;  1NX2 A;  3LCP C;  3AKB A;  4MZJ A;  1IG5 A;  5AXI A;  4ZCV A;  1M31 A;  2CT9 A;  1SK6 D;  1F4O A;  2KQY A;  2LNK A;  1PSR A;  1S6C A;  2JTZ A;  2KBM A;  3VRO A;  1TNX A;  1YRT B;  2ISD A;  2O60 A;  2NCO A;  2AMI A;  1SR6 C;  1CNP A;  1ALW A;  1XFY O;  4C0L A;  3LL8 B;  3SG6 A;  4A4B A;  2LE9 B;  1QXP A;  5DKQ A;  1NPQ A;  4OVN F;  3PFV A;  1CM1 A;  1K9U A;  3WHT B;  1DT7 B;  1QAS A;  1PRW A;  2WC8 A;  1C7V A;  2CTN A;  2JU0 A;  5HKZ A;  5I8N A;  1GJY A;  2EC6 C;  1SNL A;  2L4I A;  4PHN A;  3CR5 X;  2L51 A;  2ZN8 A;  2ZKM X;  3TZ1 A;  1IWQ A;  2BCA A;  1WDC C;  4MEW A;  2KDH A;  2PSR A;  2M8U A;  1QLK A;  1JFK A;  3OHM B;  1N0Y A;  2BBN A;  1DVI A;  1CTR A;  1TNP A;  2L0P A;  1A75 B;  2JC2 A;  1XFZ O;  2WND A;  1J55 A;  1KQM C;  1KFU S;  1N65 A;  1WLM A;  2LP2 A;  4OR9 B;  3BYA A;  4WQ2 A;  5D7F A;  4XYN A;  1J7P A;  1SL7 A;  3SIB A;  4F0Z B;  1TOP A;  1K9K A;  1L7Z A;  3K21 A;  4XJK A;  1MXE A;  1S3P A;  2KFG A;  2KI4 C;  3OP0 A;  2BBM A;  1XK4 C;  4YBH B;  3TUY C;  2LHL A;  1UHI A;  4QJ5 B;  1K94 A;  1K93 D;  2M7N A;  4PE4 A;  2Q91 A;  1LVC D;  3CR2 A;  1TCF A;  5HLV A;  3NSI A;  2MLF C;  2GGZ A;  1KFX L;  3QRX A;  4MSP A;  4PE7 A;  3H4S E;  1TNW A;  4FTG A;  1SCV A;  1QV0 A;  1B8C A;  1ZOT B;  2M97 A;  2QAC A;  5I2O A;  4I5K A;  5TNC A;  5KSZ A;  1QVI Y;  4DRW A;  1XK4 A;  3IQO A;  3EVR A;  1DMO A;  1YTZ C;  1A29 A;  2M1K B;  4GAO A;  2V53 A;  5ER5 A;  1WRK A;  3DVM A;  1U5I A;  4NDD A;  2BKI B;  4USL A;  1IRJ A;  2M1U A;  4AOM A;  4AQI A;  4MZK A;  2LAN A;  1REC A;  1TIZ A;  2BKH B;  5DKN A;  5HKW A;  1G33 A;  1B7T Y;  3D0Y B;  1NIW A;  4FQO A;  5CSF A;  4YGC B;  2LP3 A;  1SL9 A;  2D8N A;  2NXQ A;  3O78 A;  4C0J A;  2LCP A;  3DF0 B;  3BUW B;  2JPT A;  1MXL C;  4HRH A;  1UHN A;  3BOW A;  1JC2 A;  1BMO A;  1XFU O;  1JBA A;  4GNK B;  3O6B A;  3SIA A;  1QTX A;  1IQ5 A;  1XFV O;  3NXA A;  1J1D A;  1JF0 A;  1SPY A;  3JVT C;  1UP5 A;  1KK8 B;  4YGA A;  1MUX A;  3TS5 B;  4UPG A;  1OE9 B;  1FW4 A;  1YVH A;  1IH0 A;  1BR1 B;  1DJW A;  3EK4 A;  3NSL A;  1OZO A;  4DCK A;  3JTD B;  3EKJ A;  4JQ0 D;  1F8H A;  1NX0 A;  1ZUZ A;  1CDM A;  1C07 A;  1S26 D;  4HRG A;  2HQ8 A;  2M49 B;  2F2P A;  4GGF A;  1KK7 Z;  4IL1 A;  1QV1 A;  2MJW B;  3KF9 A;  2K2A A;  5AAN A;  5GQQ C;  3JTD C;  3EK8 A;  2CNP A;  1B47 A;  1F4Q A;  1K2H A;  2MRD A;  1SR6 B;  3GK1 A;  1WLZ A;  1BT6 A;  1VRK A;  3I5G B;  1LKJ A;  1WY9 A;  2LVK A;  2Q4U A;  4QJ4 B;  2I7A A;  3VRN A;  2FOT A;  3CTN A;  1OSA A;  4ZCU A;  1AJ5 A;  1OQP A;  2LLU A;  5I2L A;  2LM5 A;  2KYF A;  3PAL A;  1CLM A;  3I5G C;  2MAZ A;  4DS7 A;  1QS7 A;  1QVI Z;  2EC6 B;  2JOJ A;  5AER A;  1CFP A;  1LA3 A;  2JNF A;  1RJV A;  1PUL A;  1B8R A;  1SKT A;  2R2I A;  1IJ5 A;  1CDP A;  3CWG A;  4M2Q A;  1OZS A;  1XA5 A;  1UWO A;  3KPX A;  1WDC B;  3RLZ A;  2MA2 A;  1TNQ A;  2BCX A;  1PVA A;  2PRU A;  2Y4Q A;  4ORB B;  3SJS A;  5HKY A;  1CMF A;  1WRL A;  4GPL B;  4XJK B;  2LUC A;  1KCY A;  3F45 A;  2GGM A;  4DIR A;  3KHE A;  3EKH A;  3WHU B;  1QX5 B;  3SG2 A;  1GGW A;  1G4Y R;  1KQM B;  2F3Y A;  1QJT A;  1FI6 A;  1MR8 A;  4N1G A;  1KQV A;  1R2U A;  1FPW A;  1XO5 A;  1DJY A;  1Y1A A;  2LVJ A;  1SRA A;  1M39 A;  2AAO A;  2EGD A;  2KAV A;  1F71 A;  3EVV A;  2KI4 B;  5G08 A;  5HYD A;  2BL0 B;  1M45 A;  1AUI B;  1ZMZ A;  2G9B A;  1WRZ A;  4PHJ A;  1F70 A;  1RTP 1;  3TUY B;  3LK1 A;  2KFH A;  2SCP A;  4PE1 A;  1NCX A;  2KHN A;  1MF8 B;  1XFW O;  1V1F A;  4PHK A;  1PAL A;  5CPV A;  4A4C A;  1U5I B;  2OPO A;  4HRE E;  1M63 B;  5PAL A;  2KGR A;  3BQ3 A;  2BL0 C;  1KFU L;  2RGI A;  2L50 A;  2FCE A;  1S36 A;  3EK7 A;  1YUS A;  3GK2 A;  2LC5 A;  2BCB A;  2M7L A;  1YX8 A;  3ICB A;  1IKU A;  1H8B A;  3AAJ A;  5D69 A;  1UHK A;  2KAX A;  3DVK A;  1B4C A;  1QLS A;  1CLL A;  2LMV A;  3BOW B;  3BUN B;  3LLE A;  3TDI A;  1TCO B;  1X02 A;  2M29 A;  1DJZ A;  1ALV A;  1NUB A;  1DF0 A;  1W7I B;  2CBL A;  2K8M B;  4NQG A;  4E68 A;  1NP8 A;  1PSB A;  1NX1 A;  1DJG A;  2K7C A;  2KAY A;  2KOT A;  1K96 A;  2L4H A;  4ICB A;  1CFF A;  1CB1 A;  2K7B A;  2OTG B;  4BY4 A;  1JSA A;  1Y1U A;  3VRQ A;  1NX3 A;  2I18 A;  1RWY A;  2JUL A;  2MHH A;  3GOF A;  1J7Q A;  1IQ3 A;  1GGZ A;  4ORC B;  1A75 A;  1QX2 A;  1AHR A;  2O5G A;  1AJ4 A;  2F3Z A;  2PAS A;  3KO0 A;  4WQ3 A;  4YRU A;  1NYA A;  1BOC A;  2OTG C;  3JVT B;  4M2O A;  3CS1 A;  4N1F A;  3BUM B;  1K90 D;  4PE0 A;  5KTY A;  1S5G Y;  2KYC A;  4DUQ A;  1V1G A;  1OMR A;  1AP4 A;  4OV2 A;  5FYX A;  1Q80 A;  1S6I A;  3ZNI A;  1EG4 A;  3BXK A;  2JT3 A;  5KU1 A;  2K61 A;  4GGF C;  1YRU B;  5JJG A;  5CSJ A;  1EXR A;  3CGA A;  2K7D A;  3VGO A;  1CDN A;  2LHI A;  2H61 A;  2JWW A;  4PCW A;  2ZRS A;  4JPZ B;  1YR5 A;  2LMT A;  2FCD A;  2ZRT A;  1YVL A;  3WXA A;  1G8I A;  4GUK A;  1J1E A;  2Y1N A;  3I5I B;  2Y1M A;  2LVI A;  1N2D A;  3WNX B;  1RK9 A;  3I5F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...