2KI6C

The fgf1-s100a13-c2a hetero-hexameric complex structure: a component in the non-classical pathway for fgf1 secretion
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synaptotagmin-1
publication title The heterohexameric complex structure, a component in the non-classical pathway for fibroblast growth factor 1 (FGF1) secretion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 35
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ki6C00
2F33A 3EK8A 5DKRA 1IG5A 1CFCA 1WRZA 2K61A 1N2DA 2LLTA 1F71A 1F55A 1SCMC 1YR5A 2FJUB 1ALVA 1NSHA 2GGZA 5DKQA 1U5IA 1NWDA 3CTNA 2ZNDA 3LK0A 3M0WA 2BCBA 2LV7A 2V53A 4AQIA 3HX4A 2CT9A 3JVTB 1DJXA 1MQ1A 1KQMC 1S6JA 1CLMA 1LKJA 1S5GY 1YUSA 3BUXB 3PSRA 4U8DA 1RWYA 2G2BA 4C0KA 2R2IA 1QS7A 2LUXA 2JRFA 3KO0A 1GQMA 2COLB 4ORCB 4PALA 5GQQC 2OTGB 3LCPC 1EL4A 1CLLA 1UHKA 1WRKA 4GPLB 2M8UA 1ZMZA 1TOPA 4Q04A 4I5NB 5G08A 3TS5C 2FCEA 1KK7Y 1BMOA 2L50A 3RM1A 4ORBB 4F0ZB 1A75A 5CSIA 1M63B 3EKJA 4OVNF 2QACA 5AFPA 1J7QA 2KI6D 4PE4A 2CTNA 4NDBA 3WNXB 2KQYA 3SG5A 3MSEB 3O78A 2JT0A 1B8CA 1XFYO 2FOTA 4R1EA 5HKWA 1SK6D 5AEQA 2Q91A 2L0PA 1NUBA 1NX1A 3BUWB 4QJ5B 1YRTB 3I5HC 5B8IB 2KFHA 2MA2A 1AJ5A 1X02A 4GFTA 1H4BA 1JFKA 1J7PA 1RK9A 1PRWA 2P6BB 2PSRA 1C7VA 1FW4A 1YX7A 1FI5A 1MXLC 2LCPA 1PALA 3EVUA 1XFWO 4GBAA 1XK4C 2BE6A 2SCPA 3BUMB 4ORAB 3KPXA 2ISDA 1IQ3A 4BY4A 1PVAA 1RTP1 3PALA 3GK2A 5KU1A 1IGVA 2LM5A 4MVFA 3VRNA 3K21A 3KEVA 4HSZA 1TNXA 4WRIA 5TNCA 2Y5IA 3LK1A 4GGFA 5CSJA 3OP0A 1BG1A 2ZN8A 1JFJA 2LMTA 1QV1A 2JULA 2OTGC 3DVKA 2EC6C 1SCMB 3SG6A 4ZCUA 1K96A 1XYDA 2MLFC 1B8LA 3OB1B 1SRAA 2K0JA 2EGDA 3I5IB 2K7BA 1WLMA 2WCEA 3O6BA 4MRYA 1A2XA 3KF9A 5CSFA 4UPGA 1YVHA 4DRWA 3TDIA 4OKHA 4CFQA 3WHTB 1PK0D 1CFPA 2L98A 1OMVA 1DJGA 3CZTX 5FYXA 5IBWA 4C0JA 2ZRTA 1QVIZ 2QPTA 1OSAA 1SW8A 2H61A 2LLUA 1L2OC 1FF1A 1WY9A 2RGIA 4JQ0D 1SBJA 1B7TZ 4WQ2A 1DF0A 3PN7C 3DVJA 1CFDA 2BL0C 1N65A 1OMRA 2MHHA 2JPTA 2LC5A 4HRGA 2JTTA 3QRXA 2L4IA 1Y1AA 2LE9B 1DJWA 1K9PA 2H2KA 1B1GA 1RJVA 2KOTA 2MAZA 2CNPA 1BF5A 3LL8B 1BU3A 1TCOB 2MBXA 1G4YR 1ALWA 2JNXA 3D0YA 3I5HB 1UUSA 3KHEA 1B4CA 3EVRA 5JJGA 1XVJA 3CGAA 1QX7A 2Y1MA 1TNPA 1Y1XA 2GV5A 3CLNA 2BKHB 1UWOA 3VROA 4PCWA 5F6TA 2LHIA 4MEWA 1BJFA 4MZKA 1JUOA 2FCDA 2ZRSA 1AHRA 1EG3A 1L7ZA 2OPOA 1GJYA 5KTYA 1CB1A 3I5IC 1FI6A 2JOJA 1RFJA 3ICBA 2A4JA 1QATA 1SY9A 3E3RA 1RECA 3NSOA 1SPYA 1UURA 3DF0B 1DMOA 1NX2A 1DJZA 1EH2A 3AAKA 1KWOC 5I2OA 1C7WA 1K90D 2HQWA 2EC6B 3C1VA 4DUQA 4YI9A 5J3XA 1Y1UA 1QLSA 1YVLA 1NIWA 5PALA 3RLZA 1OMDA 1QIWA 3TDUA 4GGNA 1R6PA 3DVMA 5AERA 2KFFA 3VRRA 4PHNA 2PRUA 3GK4X 1K93D 3TUYC 3OHMB 1UHIA 1J1DA 1XFXO 1PVBA 1YURA 1JF0A 5CPVA 4AQJA 1TCFA 3WXAA 2I2RE 1MR8A 2K8MB 2KAYA 4QJ3B 1HT9A 1QLKA 1QVIY 2LP3A 1LA3A 1PSBA 2LUCA 2KHNA 1KQVA 1B7TY 1CM4A 1QJTA 4P2YB 2GGMA 3D10A 1NCYA 1L2OB 1IRJA 1J7RA 1K9UA 1MF8B 1XK4A 2KFGA 2NCPA 4DIRA 1YUUA 5HYDA 1MXEA 3PN7B 2BL0B 1BODA 1G8IA 1PULA 1SL7A 2HETA 2L51A 1S1EA 2LLSA 2BCXA 1CDMA 2KAXA 3DF0A 1MWNA 3AAJA 1TRFA 2AAOA 2JZIA 4JPZB 1K9KA 2BCAA 2ZFDA 2BECA 2KDHA 2L5XB 4PHJA 3O4YA 2Q4UA 1OE9B 3NSIA 1CMFA 1SNLA 2K2AA 4YGEB 4CIDA 2M0RA 2AMIA 3A4UB 4MLWA 4MZJA 4PE7A 1AVSA 1Q80A 1JSAA 4HREE 3VGOA 2PMYA 1KK8B 1S36A 4QJ4B 3CR2A 3HCMA 4CFRA 1Y6WA 2K7OA 1D1OA 3JTDC 1XFZO 1DJYA 1AUIB 4M2QA 3OX6A 3SIAA 1NPQA 1NCXA 3DD4A 2AUCA 1G33A 1YUTA 2VRGA 1F4QA 2KYFA 2JNFA 1A03A 3BOWB 1XFUO 3O2PA 1SL8A 2L4HA 2M7LA 2HF5A 5I8NA 5HLOA 3CWGA 4TNCA 4A4BA 4M2PA 3OB2B 1NYAA 5D7FA 1KWOB 1S3PA 1FBVA 3H4SE 3I5FB 4N1FA 3SG3A 3PATA 3BXKA 1UHJA 1AP4A 2F3YA 1NCZA 4DCKA 1KSMA 1IJ6A 2O60A 3GOFA 4WQ3A 2LAPA 2F8PA 3AKAA 1V1GA 4XJKB 1UHNA 2BE4A 3TUYB 3VRQA 1JWDA 5K89A 3SG4A 4C0LA 3DVEA 2HQ8A 1QIVA 4NDDA 1BOCA 2M1UA 4OV2A 5BPJA 2LMVA 4ETOA 2JU0A 1YRUB 2M49B 4YGDB 1KSOA 3IQQA 1QASA 2KQ6A 4MSPA 4PHMA 4YGCB 4GAOA 3CR5X 1C07A 2PASA 1GGWA 4OR9B 5AANA 5CSNA 4P5OE 1A29A 1BR1B 1J55A 1LVCD 2NXQA 1KK8C 2WNDA 1CDPA 1S6IA 1LINA 4I5JA 4MRXA 4I5KA 3BYAA 4ZCVA 1YTZC 3BOWA 1CM1A 5JOLA 1UP5A 2JXLA 3BUNB 1MUXA 2DOQA 1UHHA 1AK8A 5D69A 2WOSA 1J1EA 1E8AA 1DTLA 1TTXA 2OS8C 1CLBA 5HKZA 2D8NA 1CDNA 3IQOA 1IKUA 4CPVA 1KCYA 2BKIB 1F4OA 2LANA 4A4CA 3I5FC 1SKTA 3FWCA 4GNKB 2KAVA 1DGUA 2KGBC 2M97A 3JTDB 3ZWHA 1NX3A 2TN4A 4D1EA 1KFUS 1M45A 2M1KB 1H8BA 2LVVA 4YGAA 1KFXL 1DJIA 1CTRA 1EG4A 2PALA 3AKBA 2KI4C 2EHBA 2M7NA 2JWWA 2IS9A 1CFFA 1JF2A 2JT3A 2WCBA 2LVJA 1SYMA 1K94A 1IWQA 4YI8A 5HKYA 2LP2A 3IF7A 3WHUB 1PSRA 4CLNA 1JC2A 2JT8A 1J7OA 4PDZA 3BUOB 1Y0VH 1RROA 4PE1A 4BY5A 2MLEC 1DVIA 2PVBA 2F2OA 5HLVA 4FQOA 3BQ3A 1TNQA 1W7IB 1ZACA 1M46A 2NLNA 4MZLA 5ER4X 1B8RA 4YBHB 2I94A 1WDCB 1QTXA 1CDLA 2JC2A 1TNWA 2L2EA 2LVIA 2M9GA 1TIZA 2F2PA 2ZKMX 3OX5A 1SMGA 3PM8A 3I5GB 1K2HA 2KGRA 1OQPA 3FWBA 1OOJA 4M2OA 4NDCA 1BR4B 1K8UA 3CS1A 4IL1A 1NX0A 1WLZA 4YRUA 4ICBA 1YX8A 2WC8A 1W7JB 1SL9A 3PFVA 2M29A 2M3WA 3TZ1A 3LLEA 1QX2A 4JWQA 4HRHA 4E68A 1SR6B 2LNKA 1BT6A 4L9MA 1QV0A 1B9AA 1IQ5A 3NSKA 1DF0B 2KI6C 1KFUL 2CXJA 2I7AA 1OZSA 3NSLA 2JXCA 3EVVA 2CBLA 3GK1A 3JVTC 2BBNA 2OS8B 1EXRA 4MN0A 2JTZA 3NXAA 3FS7A 5AXIA 3A8RA 3EKHA 1VRKA 1TN4A 1XA5A 1ZUZA 1S26D 1IJ5A 1S5GZ 1OZOA 1GGZA 5KSZA 1CNPA 2LHLA 1DJHA 1FPWA 3FIAA 2I18A 3SIBA 1F54A 3D0YB 2JQ6A 2NZ0A 1F8HA 3SJSA 4GUKA 2K7DA 4YGBB 1KFXS 1MHOA 4GGFC 1LA0A 4PE0A 5DKNA 3SG2A 1ZOTB 2K7CA 1B47A 2KI4B 3CR4X 2Y4QA 3EK4A 5ER5A 1JBAA 1KK7Z 4OCIA 1IH0A 1KQMB 2KSPA 1WDCC 2NCOA 2E30A 1U5IB 4DS7A 4N5XA 2HPSA 2G9BA 4XYNA 3SG7A 2E6WA 1CMGA 3I5GC 3TDZA 3EK7A 4PHKA 2K2FA 2MRDA 1DGVA 1M31A 1NP8A 1ODBA 1K95A 1N0YA 2BBMA 2LMUA 1WRLA 1M39A 2KBIA 2KYCA 4AOMA 1XO5A 3TS5B 1V1FA 1DT7B 4N1GA 1SCVA 1ZFSA 1CKKA 4NQGA 3ZNIA 1R2UA 1QXPA 2ZNEA 1F70A 1XFVO 1EJ3A 2F3ZA 2ZN9A 1SR6C 1S6CA 2H61C 2WCFA 3F45A 5I2QA 2SASA 2CCMA 1HQVA 1A75B 2MJWB 4FTGA 3PLFB 4USLA 2LVKA 1AJ4A 2B1UA 4MBEA 2WORA 1A4PA 2KNEA 1LXFC 1BLQA 5I2LA 4I5LB 1QX5B 2KBMA 3VRPA 2O5GA 2Y1NA 4XJKA
chains in the Genus database with same CATH superfamily
2F33A 3D78A 3EK8A 5DKRA 1IG5A 1CFCA 1WRZA 2K61A 1N2DA 2LLTA 1F71A 1F55A 1SCMC 1YR5A 2FJUB 1ALVA 1NSHA 2GGZA 3FE8A 1U5IA 1NWDA 5DKQA 3CTNA 3RZSA 2ZNDA 3LK0A 3M0WA 2BCBA 2LV7A 2V53A 4AQIA 3HX4A 2CT9A 3JVTB 1DJXA 1MQ1A 1KQMC 1S6JA 1CLMA 1LKJA 1S5GY 1YUSA 3BUXB 3PSRA 4U8DA 1RWYA 2G2BA 4OZDA 4C0KA 2R2IA 4PT1A 3FE9A 1QS7A 2LUXA 2JRFA 3KO0A 1GQMA 2COLB 4ORCB 3CYZA 4PALA 5GQQC 2OTGB 3LCPC 1EL4A 1CLLA 1UHKA 1WRKA 4GPLB 2M8UA 1ZMZA 1TOPA 4Q04A 4I5NB 5G08A 3TS5C 2FCEA 1KK7Y 1BMOA 2L50A 2WCKA 3RM1A 3UO9A 4ORBB 4F0ZB 1A75A 3D74A 5CSIA 1QWVA 1M63B 3EKJA 4OVNF 2QACA 5AFPA 1J7QA 3N7HA 2KI6D 4PE4A 2CTNA 1P28A 4NDBA 3WNXB 2KQYA 3SG5A 3MSEB 3O78A 2JT0A 1B8CA 1XFYO 2FOTA 4R1EA 5HKWA 1DQEA 1SK6D 5AEQA 2Q91A 2L0PA 3K1EA 2YGUA 1NUBA 1NX1A 3BUWB 4QJ5B 1YRTB 3I5HC 5B8IB 2KFHA 2MA2A 1AJ5A 1X02A 3S0EA 4GFTA 1H4BA 1JFKA 1J7PA 1RK9A 1PRWA 2P6BB 2PSRA 1C7VA 1FW4A 1YX7A 1FI5A 1MXLC 1DC1A 2LCPA 1PALA 3EVUA 1XFWO 4GBAA 1XK4C 1T14A 1XFRA 2BE6A 2SCPA 3BUMB 4ORAB 3KPXA 2ISDA 1IQ3A 4BY4A 3B86A 3D76A 1PVAA 1RTP1 3PALA 3GK2A 5KU1A 1IGVA 2LM5A 4MVFA 3VRNA 2KPHA 2QEHA 3K21A 3KEVA 4HSZA 1TNXA 4WRIA 5TNCA 2Y5IA 3LK1A 4GGFA 2GTEA 3OP0A 5CSJA 2ZN8A 2BAPA 1BG1A 1JFJA 2LMTA 4INXA 1QV1A 2JULA 2OTGC 3DVKA 2EC6C 1SCMB 3SG6A 4ZCUA 1K96A 1XYDA 2MLFC 1B8LA 1Z4HA 3L4LA 3OB1B 1SRAA 1DEKA 2K0JA 2EGDA 3I5IB 2K7BA 3NHIA 1WLMA 2WCEA 3O6BA 4MRYA 1A2XA 3KF9A 5CSFA 4UPGA 1YVHA 4DRWA 3BFAA 3TDIA 4OKHA 4CFQA 3WHTB 2FJYA 1PK0D 1CFPA 2L98A 2WCLA 1OMVA 3IVTA 1DJGA 3CZTX 5FYXA 5IBWA 4C0JA 2ZRTA 1QVIZ 2QPTA 1OSAA 1SW8A 2H61A 2LLUA 1L2OC 1FF1A 1WY9A 2RGIA 2L2CA 4JQ0D 1SBJA 1B7TZ 4WQ2A 1DF0A 3PN7C 3DVJA 1CFDA 5EL2A 2BL0C 1N65A 1OMRA 2MHHA 3L4AA 4JD9A 2JPTA 2LC5A 4HRGA 2JTTA 3QRXA 2L4IA 1Y1AA 2LE9B 1DJWA 1K9PA 2H2KA 1B1GA 1RJVA 2KOTA 2MAZA 2CNPA 3CDNA 3NGVA 3R72A 3LL8B 1BU3A 1TCOB 2MBXA 4F7FA 1BF5A 1G4YR 1ALWA 2JNXA 3D0YA 3I5HB 1UUSA 3VB1A 3KHEA 1B4CA 3EVRA 5JJGA 1XVJA 3CGAA 1QX7A 2Y1MA 1TNPA 1Y1XA 2GV5A 3CLNA 2BKHB 1UWOA 3VROA 4PCWA 5F6TA 3O4XA 2LHIA 4MEWA 1BJFA 5D3OA 4MZKA 1JUOA 2FCDA 2ZRSA 1AHRA 1EG3A 1L7ZA 2OPOA 1GJYA 5KTYA 3B7AA 1CB1A 3I5IC 1FI6A 2ERBA 2JOJA 1RFJA 1C3ZA 3ICBA 2A4JA 1QATA 1SY9A 3E3RA 1RECA 2P71A 3NSOA 1SPYA 1UURA 3DF0B 2K60A 1DMOA 1NX2A 1DJZA 1EH2A 3AAKA 1KWOC 5I2OA 1C7WA 1K90D 2HQWA 2EC6B 3C1VA 4DUQA 4YI9A 3D75A 1Y1UA 1QLSA 1YVLA 1LS8A 1NIWA 5J3XA 1OMDA 5PALA 3RLZA 1QIWA 3TDUA 4GGNA 1R6PA 3DVMA 5AERA 2KFFA 3VRRA 4PHNA 1TUZA 2PRUA 3GK4X 1K93D 2WCHA 3OHMB 1UHIA 3TUYC 1J1DA 1XFXO 1PVBA 1YURA 3S0BA 1JF0A 4INWA 5CPVA 1TCFA 2L5YA 2I2RE 1MR8A 2K8MB 2KAYA 4QJ3B 3WXAA 2QEOA 2WC6A 1HT9A 1QLKA 1QVIY 2H8VA 1LA3A 2LP3A 1PSBA 2LUCA 2KHNA 1KQVA 1B7TY 1CM4A 1QJTA 4P2YB 2GGMA 3BFHA 3D10A 1NCYA 1L2OB 1IRJA 1J7RA 1K9UA 1MF8B 1XK4A 2JPOA 2KFGA 2NCPA 4IJ7A 4DIRA 1YUUA 5HYDA 1MXEA 3OBVA 3PN7B 2BL0B 1BODA 1G8IA 1PULA 1SL7A 2HETA 1DELA 2L51A 4AQJA 1S1EA 2LLSA 2BCXA 1CDMA 2KAXA 3DF0A 1MWNA 3AAJA 1TRFA 2AAOA 2JZIA 4JPZB 1K9KA 2BCAA 2ZFDA 2BECA 2KDHA 2L5XB 3CZ2A 3DXLA 4PHJA 3O4YA 2Q4UA 1OE9B 3UNWA 3NSIA 1CMFA 1SNLA 2K2AA 5I94A 4YGEB 4CIDA 2M0RA 2AMIA 3A4UB 4MLWA 4MZJA 4PE7A 1AVSA 2QEBA 1Q80A 1JSAA 4HREE 3VGOA 2PMYA 4KYNA 1KK8B 1S36A 2PQLA 4QJ4B 5HL1A 3CR2A 3HCMA 4CFRA 1Y6WA 2K7OA 1D1OA 3JTDC 1XFZO 1DJYA 1AUIB 4M2QA 3Q8IA 3OX6A 3SIAA 1NPQA 1NCXA 3DD4A 2AUCA 1G33A 1YUTA 2VRGA 1F4QA 2KYFA 2JNFA 3D73A 1A03A 3BOWB 1XFUO 2KLDA 3O2PA 1SL8A 5FI2A 2L4HA 2M7LA 2HF5A 5I8NA 5HLOA 3CWGA 4TNCA 3EG5B 4A4BA 4M2PA 3OB2B 1NYAA 5D7FA 1KWOB 1S3PA 1FBVA 2P70A 3H4SE 3I5FB 4N1FA 3PATA 3BXKA 1UHJA 1AP4A 2F3YA 3PM2A 1NCZA 4DCKA 1KSMA 1IJ6A 2O60A 3DY9A 3GOFA 2LAPA 4WQ3A 5FI7A 2F8PA 3S0FA 3AKAA 1V1GA 4XJKB 1UHNA 2BE4A 3TUYB 3VRQA 1JWDA 5K89A 3SG4A 4C0LA 3DVEA 2HQ8A 1QIVA 4NDDA 3OGNA 2M1UA 1BOCA 4OV2A 5BPJA 2LMVA 4ETOA 2JU0A 3FE6A 1YRUB 2M49B 4YGDB 1KSOA 3IQQA 1QASA 2KQ6A 4MSPA 4PHMA 4YGCB 4GAOA 3CR5X 1C07A 2PASA 1GGWA 4OR9B 5AANA 5CSNA 4P5OE 1A29A 1OOFA 1BR1B 1J55A 1LVCD 2NXQA 1KK8C 2WNDA 1CDPA 1S6IA 1LINA 1SSEB 1W9ZA 3D77A 4I5KA 3BYAA 4I5JA 4MRXA 1C3YA 4ZCVA 1YTZC 1Z2CB 3BOWA 1CM1A 5JOLA 1UP5A 2JXLA 3BUNB 3R1VA 1GM0A 1MUXA 3SS3A 2DOQA 1UHHA 3PJIA 3B6XA 3R1PA 1AK8A 5D69A 2WOSA 1J1EA 1E8AA 1DTLA 1TTXA 2WCJA 2OS8C 1CLBA 5DICA 5HKZA 2D8NA 1CDNA 3IQOA 1IKUA 4CPVA 1KCYA 2BKIB 1F4OA 2LANA 4A4CA 2WC5A 3I5FC 2WCMA 1SKTA 3FWCA 4GNKB 2KAVA 1DGUA 4JKTA 3SG3A 2KGBC 2M97A 3JTDB 3ZWHA 1NX3A 2TN4A 4D1EA 1KFUS 1M45A 2M1KB 1H8BA 2LVVA 3DYEA 3BJHA 1KFXL 1DJIA 1CTRA 1EG4A 2BNXA 2PALA 3AKBA 2KI4C 2EHBA 1IIOA 2M7NA 3CABA 2JWWA 4FQTA 2IS9A 1CFFA 1JF2A 2JT3A 2WCBA 2LVJA 1SYMA 1K94A 1IWQA 4YI8A 5HKYA 2LP2A 3IF7A 3WHUB 1OOHA 1PSRA 4CLNA 1JC2A 2JT8A 1J7OA 4PDZA 2QEVA 4YGAA 3BUOB 1Y0VH 1RROA 3DZTA 2KLEA 4PE1A 1OOIX 2MLEC 4BY5A 1DVIA 2PVBA 2F2OA 5HLVA 4FQOA 3NHTA 3BQ3A 1TNQA 1W7IB 1ZACA 1M46A 2NLNA 4MZLA 5ER4X 1B8RA 3V2LA 4YBHB 2I94A 1WDCB 1QTXA 1CDLA 2JC2A 1TNWA 2L2EA 2LVIA 2M9GA 1TIZA 2F2PA 2PYQA 2ZKMX 1SMGA 3OX5A 3PM8A 3I5GB 1K2HA 2KGRA 1OQPA 3FWBA 1OOJA 3S0GA 4M2OA 1OW4A 1BR4B 4NDCA 1K8UA 3CS1A 3B87A 4IL1A 1NX0A 1WLZA 4YRUA 4ICBA 1YX8A 2WC8A 1W7JB 1SL9A 3PFVA 2M29A 2M3WA 3TZ1A 3LLEA 1QX2A 4JWQA 4HRHA 4E68A 1SR6B 2LNKA 1BT6A 4L9MA 1QV0A 1B9AA 1IQ5A 3NSKA 1DF0B 2KI6C 1KFUL 2CXJA 3S0DA 2I7AA 1OZSA 3NSLA 2JXCA 3EVVA 2CBLA 2QDIA 3GK1A 3JVTC 2BBNA 2OS8B 1EXRA 4MN0A 2JTZA 3NXAA 3FS7A 5AXIA 3A8RA 3EKHA 1VRKA 3CZ0A 1TN4A 1XA5A 3SS4A 1ZUZA 1S26D 1IJ5A 1S5GZ 1OZOA 1GGZA 5KSZA 1CNPA 3B88A 2LHLA 1DJHA 1FPWA 3FIAA 2I18A 3SIBA 1F54A 3D0YB 2JQ6A 2NZ0A 1F8HA 3SJSA 4GUKA 2K7DA 4YGBB 1KFXS 1MHOA 4GGFC 1LA0A 4PE0A 5DKNA 3SG2A 1ZOTB 2K7CA 1B47A 1TUJA 2KI4B 2Y4QA 3CR4X 3EK4A 3QMEA 5ER5A 3S0AA 1JBAA 1KK7Z 4OCIA 1IH0A 1KQMB 2KSPA 1WDCC 2NCOA 2E30A 1U5IB 4DS7A 1TWOA 3L47A 4N5XA 2HPSA 2G9BA 4XYNA 3SG7A 2E6WA 1CMGA 3I5GC 3TDZA 3EK7A 4PHKA 1ORGA 2K2FA 2MRDA 1DGVA 1M31A 1NP8A 1ODBA 1K95A 1N0YA 2BBMA 2LMUA 1WRLA 1M39A 2KBIA 2KYCA 4AOMA 1OOGA 1XO5A 1V1FA 3TS5B 1DT7B 4N1GA 1SCVA 1ZFSA 1CKKA 4NQGA 3ZNIA 1R2UA 1QXPA 2ZNEA 3SS5A 1F70A 1XFVO 1EJ3A 2F3ZA 2ZN9A 1SR6C 1S6CA 2H61C 2WCFA 3F45A 5I2QA 2SASA 2CCMA 3BFBA 1HQVA 1A75B 2MJWB 4FTGA 3PLFB 3CZ1A 4USLA 2LVKA 1AJ4A 2B1UA 4MBEA 2WORA 1A4PA 2KNEA 1LXFC 1BLQA 5I2LA 5FI6A 4I5LB 1QX5B 2KBMA 3R1OA 3VRPA 2O5GA 2Y1NA 4XJKA
chains in the Genus database with same CATH topology
2F33A 3EK8A 5DKRA 1IG5A 1CFCA 1WRZA 2K61A 1N2DA 2LLTA 1F71A 1F55A 1SCMC 1YR5A 2FJUB 1ALVA 1NSHA 2GGZA 5DKQA 1U5IA 1NWDA 3CTNA 2ZNDA 3LK0A 3M0WA 2BCBA 2LV7A 2V53A 4AQIA 3HX4A 2CT9A 3JVTB 1DJXA 1MQ1A 1KQMC 1S6JA 1CLMA 1LKJA 1S5GY 1YUSA 3BUXB 3PSRA 4U8DA 1RWYA 2G2BA 4C0KA 2R2IA 1QS7A 2LUXA 2JRFA 3KO0A 1GQMA 2COLB 4ORCB 4PALA 5GQQC 2OTGB 3LCPC 1EL4A 1CLLA 1UHKA 1WRKA 4GPLB 2M8UA 1ZMZA 1TOPA 4Q04A 4I5NB 5G08A 3TS5C 2FCEA 1KK7Y 1BMOA 2L50A 3RM1A 4ORBB 4F0ZB 1A75A 5CSIA 1M63B 3EKJA 4OVNF 2QACA 5AFPA 1J7QA 2KI6D 4PE4A 2CTNA 4NDBA 3WNXB 2KQYA 3SG5A 3MSEB 3O78A 2JT0A 1B8CA 1XFYO 2FOTA 4R1EA 5HKWA 1SK6D 5AEQA 2Q91A 2L0PA 1NUBA 1NX1A 3BUWB 4QJ5B 1YRTB 3I5HC 5B8IB 2KFHA 2MA2A 1AJ5A 1X02A 4GFTA 1H4BA 1JFKA 1J7PA 1RK9A 1PRWA 2P6BB 2PSRA 1C7VA 1FW4A 1YX7A 1FI5A 1MXLC 2LCPA 1PALA 3EVUA 1XFWO 4GBAA 1XK4C 2BE6A 2SCPA 3BUMB 4ORAB 3KPXA 2ISDA 1IQ3A 4BY4A 1PVAA 1RTP1 3PALA 3GK2A 5KU1A 1IGVA 2LM5A 4MVFA 3VRNA 3K21A 3KEVA 4HSZA 1TNXA 4WRIA 5TNCA 2Y5IA 3LK1A 4GGFA 5CSJA 3OP0A 1BG1A 2ZN8A 1JFJA 2LMTA 1QV1A 2JULA 2OTGC 3DVKA 2EC6C 1SCMB 3SG6A 4ZCUA 1K96A 1XYDA 2MLFC 1B8LA 3OB1B 1SRAA 2K0JA 2EGDA 3I5IB 2K7BA 1WLMA 2WCEA 3O6BA 4MRYA 1A2XA 3KF9A 5CSFA 4UPGA 1YVHA 4DRWA 3TDIA 4OKHA 4CFQA 3WHTB 1PK0D 1CFPA 2L98A 1OMVA 1DJGA 3CZTX 5FYXA 5IBWA 4C0JA 2ZRTA 1QVIZ 2QPTA 1OSAA 1SW8A 2H61A 2LLUA 1L2OC 1FF1A 1WY9A 2RGIA 4JQ0D 1SBJA 1B7TZ 4WQ2A 1DF0A 3PN7C 3DVJA 1CFDA 2BL0C 1N65A 1OMRA 2MHHA 2JPTA 2LC5A 4HRGA 2JTTA 3QRXA 2L4IA 1Y1AA 2LE9B 1DJWA 1K9PA 2H2KA 1B1GA 1RJVA 2KOTA 2MAZA 2CNPA 1BF5A 3LL8B 1BU3A 1TCOB 2MBXA 1G4YR 1ALWA 2JNXA 3D0YA 3I5HB 1UUSA 3KHEA 1B4CA 3EVRA 5JJGA 1XVJA 3CGAA 1QX7A 2Y1MA 1TNPA 1Y1XA 2GV5A 3CLNA 2BKHB 1UWOA 3VROA 4PCWA 5F6TA 2LHIA 4MEWA 1BJFA 4MZKA 1JUOA 2FCDA 2ZRSA 1AHRA 1EG3A 1L7ZA 2OPOA 1GJYA 5KTYA 1CB1A 3I5IC 1FI6A 2JOJA 1RFJA 3ICBA 2A4JA 1QATA 1SY9A 3E3RA 1RECA 3NSOA 1SPYA 1UURA 3DF0B 1DMOA 1NX2A 1DJZA 1EH2A 3AAKA 1KWOC 5I2OA 1C7WA 1K90D 2HQWA 2EC6B 3C1VA 4DUQA 4YI9A 5J3XA 1Y1UA 1QLSA 1YVLA 1NIWA 5PALA 3RLZA 1OMDA 1QIWA 3TDUA 4GGNA 1R6PA 3DVMA 5AERA 2KFFA 3VRRA 4PHNA 2PRUA 3GK4X 1K93D 3TUYC 3OHMB 1UHIA 1J1DA 1XFXO 1PVBA 1YURA 1JF0A 5CPVA 4AQJA 1TCFA 3WXAA 2I2RE 1MR8A 2K8MB 2KAYA 4QJ3B 1HT9A 1QLKA 1QVIY 2LP3A 1LA3A 1PSBA 2LUCA 2KHNA 1KQVA 1B7TY 1CM4A 1QJTA 4P2YB 2GGMA 3D10A 1NCYA 1L2OB 1IRJA 1J7RA 1K9UA 1MF8B 1XK4A 2KFGA 2NCPA 4DIRA 1YUUA 5HYDA 1MXEA 3PN7B 2BL0B 1BODA 1G8IA 1PULA 1SL7A 2HETA 2L51A 1S1EA 2LLSA 2BCXA 1CDMA 2KAXA 3DF0A 1MWNA 3AAJA 1TRFA 2AAOA 2JZIA 4JPZB 1K9KA 2BCAA 2ZFDA 2BECA 2KDHA 2L5XB 4PHJA 3O4YA 2Q4UA 1OE9B 3NSIA 1CMFA 1SNLA 2K2AA 4YGEB 4CIDA 2M0RA 2AMIA 3A4UB 4MLWA 4MZJA 4PE7A 1AVSA 1Q80A 1JSAA 4HREE 3VGOA 2PMYA 1KK8B 1S36A 4QJ4B 3CR2A 3HCMA 4CFRA 1Y6WA 2K7OA 1D1OA 3JTDC 1XFZO 1DJYA 1AUIB 4M2QA 3OX6A 3SIAA 1NPQA 1NCXA 3DD4A 2AUCA 1G33A 1YUTA 2VRGA 1F4QA 2KYFA 2JNFA 1A03A 3BOWB 1XFUO 3O2PA 1SL8A 2L4HA 2M7LA 2HF5A 5I8NA 5HLOA 3CWGA 4TNCA 4A4BA 4M2PA 3OB2B 1NYAA 5D7FA 1KWOB 1S3PA 1FBVA 3H4SE 3I5FB 4N1FA 3SG3A 3PATA 3BXKA 1UHJA 1AP4A 2F3YA 1NCZA 4DCKA 1KSMA 1IJ6A 2O60A 3GOFA 4WQ3A 2LAPA 2F8PA 3AKAA 1V1GA 4XJKB 1UHNA 2BE4A 3TUYB 3VRQA 1JWDA 5K89A 3SG4A 4C0LA 3DVEA 2HQ8A 1QIVA 4NDDA 1BOCA 2M1UA 4OV2A 5BPJA 2LMVA 4ETOA 2JU0A 1YRUB 2M49B 4YGDB 1KSOA 3IQQA 1QASA 2KQ6A 4MSPA 4PHMA 4YGCB 4GAOA 3CR5X 1C07A 2PASA 1GGWA 4OR9B 5AANA 5CSNA 4P5OE 1A29A 1BR1B 1J55A 1LVCD 2NXQA 1KK8C 2WNDA 1CDPA 1S6IA 1LINA 4I5JA 4MRXA 4I5KA 3BYAA 4ZCVA 1YTZC 3BOWA 1CM1A 5JOLA 1UP5A 2JXLA 3BUNB 1MUXA 2DOQA 1UHHA 1AK8A 5D69A 2WOSA 1J1EA 1E8AA 1DTLA 1TTXA 2OS8C 1CLBA 5HKZA 2D8NA 1CDNA 3IQOA 1IKUA 4CPVA 1KCYA 2BKIB 1F4OA 2LANA 4A4CA 3I5FC 1SKTA 3FWCA 4GNKB 2KAVA 1DGUA 2KGBC 2M97A 3JTDB 3ZWHA 1NX3A 2TN4A 4D1EA 1KFUS 1M45A 2M1KB 1H8BA 2LVVA 4YGAA 1KFXL 1DJIA 1CTRA 1EG4A 2PALA 3AKBA 2KI4C 2EHBA 2M7NA 2JWWA 2IS9A 1CFFA 1JF2A 2JT3A 2WCBA 2LVJA 1SYMA 1K94A 1IWQA 4YI8A 5HKYA 2LP2A 3IF7A 3WHUB 1PSRA 4CLNA 1JC2A 2JT8A 1J7OA 4PDZA 3BUOB 1Y0VH 1RROA 4PE1A 4BY5A 2MLEC 1DVIA 2PVBA 2F2OA 5HLVA 4FQOA 3BQ3A 1TNQA 1W7IB 1ZACA 1M46A 2NLNA 4MZLA 5ER4X 1B8RA 4YBHB 2I94A 1WDCB 1QTXA 1CDLA 2JC2A 1TNWA 2L2EA 2LVIA 2M9GA 1TIZA 2F2PA 2ZKMX 3OX5A 1SMGA 3PM8A 3I5GB 1K2HA 2KGRA 1OQPA 3FWBA 1OOJA 4M2OA 4NDCA 1BR4B 1K8UA 3CS1A 4IL1A 1NX0A 1WLZA 4YRUA 4ICBA 1YX8A 2WC8A 1W7JB 1SL9A 3PFVA 2M29A 2M3WA 3TZ1A 3LLEA 1QX2A 4JWQA 4HRHA 4E68A 1SR6B 2LNKA 1BT6A 4L9MA 1QV0A 1B9AA 1IQ5A 3NSKA 1DF0B 2KI6C 1KFUL 2CXJA 2I7AA 1OZSA 3NSLA 2JXCA 3EVVA 2CBLA 3GK1A 3JVTC 2BBNA 2OS8B 1EXRA 4MN0A 2JTZA 3NXAA 3FS7A 5AXIA 3A8RA 3EKHA 1VRKA 1TN4A 1XA5A 1ZUZA 1S26D 1IJ5A 1S5GZ 1OZOA 1GGZA 5KSZA 1CNPA 2LHLA 1DJHA 1FPWA 3FIAA 2I18A 3SIBA 1F54A 3D0YB 2JQ6A 2NZ0A 1F8HA 3SJSA 4GUKA 2K7DA 4YGBB 1KFXS 1MHOA 4GGFC 1LA0A 4PE0A 5DKNA 3SG2A 1ZOTB 2K7CA 1B47A 2KI4B 3CR4X 2Y4QA 3EK4A 5ER5A 1JBAA 1KK7Z 4OCIA 1IH0A 1KQMB 2KSPA 1WDCC 2NCOA 2E30A 1U5IB 4DS7A 4N5XA 2HPSA 2G9BA 4XYNA 3SG7A 2E6WA 1CMGA 3I5GC 3TDZA 3EK7A 4PHKA 2K2FA 2MRDA 1DGVA 1M31A 1NP8A 1ODBA 1K95A 1N0YA 2BBMA 2LMUA 1WRLA 1M39A 2KBIA 2KYCA 4AOMA 1XO5A 3TS5B 1V1FA 1DT7B 4N1GA 1SCVA 1ZFSA 1CKKA 4NQGA 3ZNIA 1R2UA 1QXPA 2ZNEA 1F70A 1XFVO 1EJ3A 2F3ZA 2ZN9A 1SR6C 1S6CA 2H61C 2WCFA 3F45A 5I2QA 2SASA 2CCMA 1HQVA 1A75B 2MJWB 4FTGA 3PLFB 4USLA 2LVKA 1AJ4A 2B1UA 4MBEA 2WORA 1A4PA 2KNEA 1LXFC 1BLQA 5I2LA 4I5LB 1QX5B 2KBMA 3VRPA 2O5GA 2Y1NA 4XJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F33 A;  3EK8 A;  5DKR A;  1IG5 A;  1CFC A;  1WRZ A;  2K61 A;  1N2D A;  2LLT A;  1F71 A;  1F55 A;  1SCM C;  1YR5 A;  2FJU B;  1ALV A;  1NSH A;  2GGZ A;  5DKQ A;  1U5I A;  1NWD A;  3CTN A;  2ZND A;  3LK0 A;  3M0W A;  2BCB A;  2LV7 A;  2V53 A;  4AQI A;  3HX4 A;  2CT9 A;  3JVT B;  1DJX A;  1MQ1 A;  1KQM C;  1S6J A;  1CLM A;  1LKJ A;  1S5G Y;  1YUS A;  3BUX B;  3PSR A;  4U8D A;  1RWY A;  2G2B A;  4C0K A;  2R2I A;  1QS7 A;  2LUX A;  2JRF A;  3KO0 A;  1GQM A;  2COL B;  4ORC B;  4PAL A;  5GQQ C;  2OTG B;  3LCP C;  1EL4 A;  1CLL A;  1UHK A;  1WRK A;  4GPL B;  2M8U A;  1ZMZ A;  1TOP A;  4Q04 A;  4I5N B;  5G08 A;  3TS5 C;  2FCE A;  1KK7 Y;  1BMO A;  2L50 A;  3RM1 A;  4ORB B;  4F0Z B;  1A75 A;  5CSI A;  1M63 B;  3EKJ A;  4OVN F;  2QAC A;  5AFP A;  1J7Q A;  2KI6 D;  4PE4 A;  2CTN A;  4NDB A;  3WNX B;  2KQY A;  3SG5 A;  3MSE B;  3O78 A;  2JT0 A;  1B8C A;  1XFY O;  2FOT A;  4R1E A;  5HKW A;  1SK6 D;  5AEQ A;  2Q91 A;  2L0P A;  1NUB A;  1NX1 A;  3BUW B;  4QJ5 B;  1YRT B;  3I5H C;  5B8I B;  2KFH A;  2MA2 A;  1AJ5 A;  1X02 A;  4GFT A;  1H4B A;  1JFK A;  1J7P A;  1RK9 A;  1PRW A;  2P6B B;  2PSR A;  1C7V A;  1FW4 A;  1YX7 A;  1FI5 A;  1MXL C;  2LCP A;  1PAL A;  3EVU A;  1XFW O;  4GBA A;  1XK4 C;  2BE6 A;  2SCP A;  3BUM B;  4ORA B;  3KPX A;  2ISD A;  1IQ3 A;  4BY4 A;  1PVA A;  1RTP 1;  3PAL A;  3GK2 A;  5KU1 A;  1IGV A;  2LM5 A;  4MVF A;  3VRN A;  3K21 A;  3KEV A;  4HSZ A;  1TNX A;  4WRI A;  5TNC A;  2Y5I A;  3LK1 A;  4GGF A;  5CSJ A;  3OP0 A;  1BG1 A;  2ZN8 A;  1JFJ A;  2LMT A;  1QV1 A;  2JUL A;  2OTG C;  3DVK A;  2EC6 C;  1SCM B;  3SG6 A;  4ZCU A;  1K96 A;  1XYD A;  2MLF C;  1B8L A;  3OB1 B;  1SRA A;  2K0J A;  2EGD A;  3I5I B;  2K7B A;  1WLM A;  2WCE A;  3O6B A;  4MRY A;  1A2X A;  3KF9 A;  5CSF A;  4UPG A;  1YVH A;  4DRW A;  3TDI A;  4OKH A;  4CFQ A;  3WHT B;  1PK0 D;  1CFP A;  2L98 A;  1OMV A;  1DJG A;  3CZT X;  5FYX A;  5IBW A;  4C0J A;  2ZRT A;  1QVI Z;  2QPT A;  1OSA A;  1SW8 A;  2H61 A;  2LLU A;  1L2O C;  1FF1 A;  1WY9 A;  2RGI A;  4JQ0 D;  1SBJ A;  1B7T Z;  4WQ2 A;  1DF0 A;  3PN7 C;  3DVJ A;  1CFD A;  2BL0 C;  1N65 A;  1OMR A;  2MHH A;  2JPT A;  2LC5 A;  4HRG A;  2JTT A;  3QRX A;  2L4I A;  1Y1A A;  2LE9 B;  1DJW A;  1K9P A;  2H2K A;  1B1G A;  1RJV A;  2KOT A;  2MAZ A;  2CNP A;  1BF5 A;  3LL8 B;  1BU3 A;  1TCO B;  2MBX A;  1G4Y R;  1ALW A;  2JNX A;  3D0Y A;  3I5H B;  1UUS A;  3KHE A;  1B4C A;  3EVR A;  5JJG A;  1XVJ A;  3CGA A;  1QX7 A;  2Y1M A;  1TNP A;  1Y1X A;  2GV5 A;  3CLN A;  2BKH B;  1UWO A;  3VRO A;  4PCW A;  5F6T A;  2LHI A;  4MEW A;  1BJF A;  4MZK A;  1JUO A;  2FCD A;  2ZRS A;  1AHR A;  1EG3 A;  1L7Z A;  2OPO A;  1GJY A;  5KTY A;  1CB1 A;  3I5I C;  1FI6 A;  2JOJ A;  1RFJ A;  3ICB A;  2A4J A;  1QAT A;  1SY9 A;  3E3R A;  1REC A;  3NSO A;  1SPY A;  1UUR A;  3DF0 B;  1DMO A;  1NX2 A;  1DJZ A;  1EH2 A;  3AAK A;  1KWO C;  5I2O A;  1C7W A;  1K90 D;  2HQW A;  2EC6 B;  3C1V A;  4DUQ A;  4YI9 A;  5J3X A;  1Y1U A;  1QLS A;  1YVL A;  1NIW A;  5PAL A;  3RLZ A;  1OMD A;  1QIW A;  3TDU A;  4GGN A;  1R6P A;  3DVM A;  5AER A;  2KFF A;  3VRR A;  4PHN A;  2PRU A;  3GK4 X;  1K93 D;  3TUY C;  3OHM B;  1UHI A;  1J1D A;  1XFX O;  1PVB A;  1YUR A;  1JF0 A;  5CPV A;  4AQJ A;  1TCF A;  3WXA A;  2I2R E;  1MR8 A;  2K8M B;  2KAY A;  4QJ3 B;  1HT9 A;  1QLK A;  1QVI Y;  2LP3 A;  1LA3 A;  1PSB A;  2LUC A;  2KHN A;  1KQV A;  1B7T Y;  1CM4 A;  1QJT A;  4P2Y B;  2GGM A;  3D10 A;  1NCY A;  1L2O B;  1IRJ A;  1J7R A;  1K9U A;  1MF8 B;  1XK4 A;  2KFG A;  2NCP A;  4DIR A;  1YUU A;  5HYD A;  1MXE A;  3PN7 B;  2BL0 B;  1BOD A;  1G8I A;  1PUL A;  1SL7 A;  2HET A;  2L51 A;  1S1E A;  2LLS A;  2BCX A;  1CDM A;  2KAX A;  3DF0 A;  1MWN A;  3AAJ A;  1TRF A;  2AAO A;  2JZI A;  4JPZ B;  1K9K A;  2BCA A;  2ZFD A;  2BEC A;  2KDH A;  2L5X B;  4PHJ A;  3O4Y A;  2Q4U A;  1OE9 B;  3NSI A;  1CMF A;  1SNL A;  2K2A A;  4YGE B;  4CID A;  2M0R A;  2AMI A;  3A4U B;  4MLW A;  4MZJ A;  4PE7 A;  1AVS A;  1Q80 A;  1JSA A;  4HRE E;  3VGO A;  2PMY A;  1KK8 B;  1S36 A;  4QJ4 B;  3CR2 A;  3HCM A;  4CFR A;  1Y6W A;  2K7O A;  1D1O A;  3JTD C;  1XFZ O;  1DJY A;  1AUI B;  4M2Q A;  3OX6 A;  3SIA A;  1NPQ A;  1NCX A;  3DD4 A;  2AUC A;  1G33 A;  1YUT A;  2VRG A;  1F4Q A;  2KYF A;  2JNF A;  1A03 A;  3BOW B;  1XFU O;  3O2P A;  1SL8 A;  2L4H A;  2M7L A;  2HF5 A;  5I8N A;  5HLO A;  3CWG A;  4TNC A;  4A4B A;  4M2P A;  3OB2 B;  1NYA A;  5D7F A;  1KWO B;  1S3P A;  1FBV A;  3H4S E;  3I5F B;  4N1F A;  3SG3 A;  3PAT A;  3BXK A;  1UHJ A;  1AP4 A;  2F3Y A;  1NCZ A;  4DCK A;  1KSM A;  1IJ6 A;  2O60 A;  3GOF A;  4WQ3 A;  2LAP A;  2F8P A;  3AKA A;  1V1G A;  4XJK B;  1UHN A;  2BE4 A;  3TUY B;  3VRQ A;  1JWD A;  5K89 A;  3SG4 A;  4C0L A;  3DVE A;  2HQ8 A;  1QIV A;  4NDD A;  1BOC A;  2M1U A;  4OV2 A;  5BPJ A;  2LMV A;  4ETO A;  2JU0 A;  1YRU B;  2M49 B;  4YGD B;  1KSO A;  3IQQ A;  1QAS A;  2KQ6 A;  4MSP A;  4PHM A;  4YGC B;  4GAO A;  3CR5 X;  1C07 A;  2PAS A;  1GGW A;  4OR9 B;  5AAN A;  5CSN A;  4P5O E;  1A29 A;  1BR1 B;  1J55 A;  1LVC D;  2NXQ A;  1KK8 C;  2WND A;  1CDP A;  1S6I A;  1LIN A;  4I5J A;  4MRX A;  4I5K A;  3BYA A;  4ZCV A;  1YTZ C;  3BOW A;  1CM1 A;  5JOL A;  1UP5 A;  2JXL A;  3BUN B;  1MUX A;  2DOQ A;  1UHH A;  1AK8 A;  5D69 A;  2WOS A;  1J1E A;  1E8A A;  1DTL A;  1TTX A;  2OS8 C;  1CLB A;  5HKZ A;  2D8N A;  1CDN A;  3IQO A;  1IKU A;  4CPV A;  1KCY A;  2BKI B;  1F4O A;  2LAN A;  4A4C A;  3I5F C;  1SKT A;  3FWC A;  4GNK B;  2KAV A;  1DGU A;  2KGB C;  2M97 A;  3JTD B;  3ZWH A;  1NX3 A;  2TN4 A;  4D1E A;  1KFU S;  1M45 A;  2M1K B;  1H8B A;  2LVV A;  4YGA A;  1KFX L;  1DJI A;  1CTR A;  1EG4 A;  2PAL A;  3AKB A;  2KI4 C;  2EHB A;  2M7N A;  2JWW A;  2IS9 A;  1CFF A;  1JF2 A;  2JT3 A;  2WCB A;  2LVJ A;  1SYM A;  1K94 A;  1IWQ A;  4YI8 A;  5HKY A;  2LP2 A;  3IF7 A;  3WHU B;  1PSR A;  4CLN A;  1JC2 A;  2JT8 A;  1J7O A;  4PDZ A;  3BUO B;  1Y0V H;  1RRO A;  4PE1 A;  4BY5 A;  2MLE C;  1DVI A;  2PVB A;  2F2O A;  5HLV A;  4FQO A;  3BQ3 A;  1TNQ A;  1W7I B;  1ZAC A;  1M46 A;  2NLN A;  4MZL A;  5ER4 X;  1B8R A;  4YBH B;  2I94 A;  1WDC B;  1QTX A;  1CDL A;  2JC2 A;  1TNW A;  2L2E A;  2LVI A;  2M9G A;  1TIZ A;  2F2P A;  2ZKM X;  3OX5 A;  1SMG A;  3PM8 A;  3I5G B;  1K2H A;  2KGR A;  1OQP A;  3FWB A;  1OOJ A;  4M2O A;  4NDC A;  1BR4 B;  1K8U A;  3CS1 A;  4IL1 A;  1NX0 A;  1WLZ A;  4YRU A;  4ICB A;  1YX8 A;  2WC8 A;  1W7J B;  1SL9 A;  3PFV A;  2M29 A;  2M3W A;  3TZ1 A;  3LLE A;  1QX2 A;  4JWQ A;  4HRH A;  4E68 A;  1SR6 B;  2LNK A;  1BT6 A;  4L9M A;  1QV0 A;  1B9A A;  1IQ5 A;  3NSK A;  1DF0 B;  2KI6 C;  1KFU L;  2CXJ A;  2I7A A;  1OZS A;  3NSL A;  2JXC A;  3EVV A;  2CBL A;  3GK1 A;  3JVT C;  2BBN A;  2OS8 B;  1EXR A;  4MN0 A;  2JTZ A;  3NXA A;  3FS7 A;  5AXI A;  3A8R A;  3EKH A;  1VRK A;  1TN4 A;  1XA5 A;  1ZUZ A;  1S26 D;  1IJ5 A;  1S5G Z;  1OZO A;  1GGZ A;  5KSZ A;  1CNP A;  2LHL A;  1DJH A;  1FPW A;  3FIA A;  2I18 A;  3SIB A;  1F54 A;  3D0Y B;  2JQ6 A;  2NZ0 A;  1F8H A;  3SJS A;  4GUK A;  2K7D A;  4YGB B;  1KFX S;  1MHO A;  4GGF C;  1LA0 A;  4PE0 A;  5DKN A;  3SG2 A;  1ZOT B;  2K7C A;  1B47 A;  2KI4 B;  3CR4 X;  2Y4Q A;  3EK4 A;  5ER5 A;  1JBA A;  1KK7 Z;  4OCI A;  1IH0 A;  1KQM B;  2KSP A;  1WDC C;  2NCO A;  2E30 A;  1U5I B;  4DS7 A;  4N5X A;  2HPS A;  2G9B A;  4XYN A;  3SG7 A;  2E6W A;  1CMG A;  3I5G C;  3TDZ A;  3EK7 A;  4PHK A;  2K2F A;  2MRD A;  1DGV A;  1M31 A;  1NP8 A;  1ODB A;  1K95 A;  1N0Y A;  2BBM A;  2LMU A;  1WRL A;  1M39 A;  2KBI A;  2KYC A;  4AOM A;  1XO5 A;  3TS5 B;  1V1F A;  1DT7 B;  4N1G A;  1SCV A;  1ZFS A;  1CKK A;  4NQG A;  3ZNI A;  1R2U A;  1QXP A;  2ZNE A;  1F70 A;  1XFV O;  1EJ3 A;  2F3Z A;  2ZN9 A;  1SR6 C;  1S6C A;  2H61 C;  2WCF A;  3F45 A;  5I2Q A;  2SAS A;  2CCM A;  1HQV A;  1A75 B;  2MJW B;  4FTG A;  3PLF B;  4USL A;  2LVK A;  1AJ4 A;  2B1U A;  4MBE A;  2WOR A;  1A4P A;  2KNE A;  1LXF C;  1BLQ A;  5I2L A;  4I5L B;  1QX5 B;  2KBM A;  3VRP A;  2O5G A;  2Y1N A;  4XJK A; 
#chains in the Genus database with same CATH topology
 2F33 A;  3D78 A;  3EK8 A;  5DKR A;  1IG5 A;  1CFC A;  1WRZ A;  2K61 A;  1N2D A;  2LLT A;  1F71 A;  1F55 A;  1SCM C;  1YR5 A;  2FJU B;  1ALV A;  1NSH A;  2GGZ A;  3FE8 A;  1U5I A;  1NWD A;  5DKQ A;  3CTN A;  3RZS A;  2ZND A;  3LK0 A;  3M0W A;  2BCB A;  2LV7 A;  2V53 A;  4AQI A;  3HX4 A;  2CT9 A;  3JVT B;  1DJX A;  1MQ1 A;  1KQM C;  1S6J A;  1CLM A;  1LKJ A;  1S5G Y;  1YUS A;  3BUX B;  3PSR A;  4U8D A;  1RWY A;  2G2B A;  4OZD A;  4C0K A;  2R2I A;  4PT1 A;  3FE9 A;  1QS7 A;  2LUX A;  2JRF A;  3KO0 A;  1GQM A;  2COL B;  4ORC B;  3CYZ A;  4PAL A;  5GQQ C;  2OTG B;  3LCP C;  1EL4 A;  1CLL A;  1UHK A;  1WRK A;  4GPL B;  2M8U A;  1ZMZ A;  1TOP A;  4Q04 A;  4I5N B;  5G08 A;  3TS5 C;  2FCE A;  1KK7 Y;  1BMO A;  2L50 A;  2WCK A;  3RM1 A;  3UO9 A;  4ORB B;  4F0Z B;  1A75 A;  3D74 A;  5CSI A;  1QWV A;  1M63 B;  3EKJ A;  4OVN F;  2QAC A;  5AFP A;  1J7Q A;  3N7H A;  2KI6 D;  4PE4 A;  2CTN A;  1P28 A;  4NDB A;  3WNX B;  2KQY A;  3SG5 A;  3MSE B;  3O78 A;  2JT0 A;  1B8C A;  1XFY O;  2FOT A;  4R1E A;  5HKW A;  1DQE A;  1SK6 D;  5AEQ A;  2Q91 A;  2L0P A;  3K1E A;  2YGU A;  1NUB A;  1NX1 A;  3BUW B;  4QJ5 B;  1YRT B;  3I5H C;  5B8I B;  2KFH A;  2MA2 A;  1AJ5 A;  1X02 A;  3S0E A;  4GFT A;  1H4B A;  1JFK A;  1J7P A;  1RK9 A;  1PRW A;  2P6B B;  2PSR A;  1C7V A;  1FW4 A;  1YX7 A;  1FI5 A;  1MXL C;  1DC1 A;  2LCP A;  1PAL A;  3EVU A;  1XFW O;  4GBA A;  1XK4 C;  1T14 A;  1XFR A;  2BE6 A;  2SCP A;  3BUM B;  4ORA B;  3KPX A;  2ISD A;  1IQ3 A;  4BY4 A;  3B86 A;  3D76 A;  1PVA A;  1RTP 1;  3PAL A;  3GK2 A;  5KU1 A;  1IGV A;  2LM5 A;  4MVF A;  3VRN A;  2KPH A;  2QEH A;  3K21 A;  3KEV A;  4HSZ A;  1TNX A;  4WRI A;  5TNC A;  2Y5I A;  3LK1 A;  4GGF A;  2GTE A;  3OP0 A;  5CSJ A;  2ZN8 A;  2BAP A;  1BG1 A;  1JFJ A;  2LMT A;  4INX A;  1QV1 A;  2JUL A;  2OTG C;  3DVK A;  2EC6 C;  1SCM B;  3SG6 A;  4ZCU A;  1K96 A;  1XYD A;  2MLF C;  1B8L A;  1Z4H A;  3L4L A;  3OB1 B;  1SRA A;  1DEK A;  2K0J A;  2EGD A;  3I5I B;  2K7B A;  3NHI A;  1WLM A;  2WCE A;  3O6B A;  4MRY A;  1A2X A;  3KF9 A;  5CSF A;  4UPG A;  1YVH A;  4DRW A;  3BFA A;  3TDI A;  4OKH A;  4CFQ A;  3WHT B;  2FJY A;  1PK0 D;  1CFP A;  2L98 A;  2WCL A;  1OMV A;  3IVT A;  1DJG A;  3CZT X;  5FYX A;  5IBW A;  4C0J A;  2ZRT A;  1QVI Z;  2QPT A;  1OSA A;  1SW8 A;  2H61 A;  2LLU A;  1L2O C;  1FF1 A;  1WY9 A;  2RGI A;  2L2C A;  4JQ0 D;  1SBJ A;  1B7T Z;  4WQ2 A;  1DF0 A;  3PN7 C;  3DVJ A;  1CFD A;  5EL2 A;  2BL0 C;  1N65 A;  1OMR A;  2MHH A;  3L4A A;  4JD9 A;  2JPT A;  2LC5 A;  4HRG A;  2JTT A;  3QRX A;  2L4I A;  1Y1A A;  2LE9 B;  1DJW A;  1K9P A;  2H2K A;  1B1G A;  1RJV A;  2KOT A;  2MAZ A;  2CNP A;  3CDN A;  3NGV A;  3R72 A;  3LL8 B;  1BU3 A;  1TCO B;  2MBX A;  4F7F A;  1BF5 A;  1G4Y R;  1ALW A;  2JNX A;  3D0Y A;  3I5H B;  1UUS A;  3VB1 A;  3KHE A;  1B4C A;  3EVR A;  5JJG A;  1XVJ A;  3CGA A;  1QX7 A;  2Y1M A;  1TNP A;  1Y1X A;  2GV5 A;  3CLN A;  2BKH B;  1UWO A;  3VRO A;  4PCW A;  5F6T A;  3O4X A;  2LHI A;  4MEW A;  1BJF A;  5D3O A;  4MZK A;  1JUO A;  2FCD A;  2ZRS A;  1AHR A;  1EG3 A;  1L7Z A;  2OPO A;  1GJY A;  5KTY A;  3B7A A;  1CB1 A;  3I5I C;  1FI6 A;  2ERB A;  2JOJ A;  1RFJ A;  1C3Z A;  3ICB A;  2A4J A;  1QAT A;  1SY9 A;  3E3R A;  1REC A;  2P71 A;  3NSO A;  1SPY A;  1UUR A;  3DF0 B;  2K60 A;  1DMO A;  1NX2 A;  1DJZ A;  1EH2 A;  3AAK A;  1KWO C;  5I2O A;  1C7W A;  1K90 D;  2HQW A;  2EC6 B;  3C1V A;  4DUQ A;  4YI9 A;  3D75 A;  1Y1U A;  1QLS A;  1YVL A;  1LS8 A;  1NIW A;  5J3X A;  1OMD A;  5PAL A;  3RLZ A;  1QIW A;  3TDU A;  4GGN A;  1R6P A;  3DVM A;  5AER A;  2KFF A;  3VRR A;  4PHN A;  1TUZ A;  2PRU A;  3GK4 X;  1K93 D;  2WCH A;  3OHM B;  1UHI A;  3TUY C;  1J1D A;  1XFX O;  1PVB A;  1YUR A;  3S0B A;  1JF0 A;  4INW A;  5CPV A;  1TCF A;  2L5Y A;  2I2R E;  1MR8 A;  2K8M B;  2KAY A;  4QJ3 B;  3WXA A;  2QEO A;  2WC6 A;  1HT9 A;  1QLK A;  1QVI Y;  2H8V A;  1LA3 A;  2LP3 A;  1PSB A;  2LUC A;  2KHN A;  1KQV A;  1B7T Y;  1CM4 A;  1QJT A;  4P2Y B;  2GGM A;  3BFH A;  3D10 A;  1NCY A;  1L2O B;  1IRJ A;  1J7R A;  1K9U A;  1MF8 B;  1XK4 A;  2JPO A;  2KFG A;  2NCP A;  4IJ7 A;  4DIR A;  1YUU A;  5HYD A;  1MXE A;  3OBV A;  3PN7 B;  2BL0 B;  1BOD A;  1G8I A;  1PUL A;  1SL7 A;  2HET A;  1DEL A;  2L51 A;  4AQJ A;  1S1E A;  2LLS A;  2BCX A;  1CDM A;  2KAX A;  3DF0 A;  1MWN A;  3AAJ A;  1TRF A;  2AAO A;  2JZI A;  4JPZ B;  1K9K A;  2BCA A;  2ZFD A;  2BEC A;  2KDH A;  2L5X B;  3CZ2 A;  3DXL A;  4PHJ A;  3O4Y A;  2Q4U A;  1OE9 B;  3UNW A;  3NSI A;  1CMF A;  1SNL A;  2K2A A;  5I94 A;  4YGE B;  4CID A;  2M0R A;  2AMI A;  3A4U B;  4MLW A;  4MZJ A;  4PE7 A;  1AVS A;  2QEB A;  1Q80 A;  1JSA A;  4HRE E;  3VGO A;  2PMY A;  4KYN A;  1KK8 B;  1S36 A;  2PQL A;  4QJ4 B;  5HL1 A;  3CR2 A;  3HCM A;  4CFR A;  1Y6W A;  2K7O A;  1D1O A;  3JTD C;  1XFZ O;  1DJY A;  1AUI B;  4M2Q A;  3Q8I A;  3OX6 A;  3SIA A;  1NPQ A;  1NCX A;  3DD4 A;  2AUC A;  1G33 A;  1YUT A;  2VRG A;  1F4Q A;  2KYF A;  2JNF A;  3D73 A;  1A03 A;  3BOW B;  1XFU O;  2KLD A;  3O2P A;  1SL8 A;  5FI2 A;  2L4H A;  2M7L A;  2HF5 A;  5I8N A;  5HLO A;  3CWG A;  4TNC A;  3EG5 B;  4A4B A;  4M2P A;  3OB2 B;  1NYA A;  5D7F A;  1KWO B;  1S3P A;  1FBV A;  2P70 A;  3H4S E;  3I5F B;  4N1F A;  3PAT A;  3BXK A;  1UHJ A;  1AP4 A;  2F3Y A;  3PM2 A;  1NCZ A;  4DCK A;  1KSM A;  1IJ6 A;  2O60 A;  3DY9 A;  3GOF A;  2LAP A;  4WQ3 A;  5FI7 A;  2F8P A;  3S0F A;  3AKA A;  1V1G A;  4XJK B;  1UHN A;  2BE4 A;  3TUY B;  3VRQ A;  1JWD A;  5K89 A;  3SG4 A;  4C0L A;  3DVE A;  2HQ8 A;  1QIV A;  4NDD A;  3OGN A;  2M1U A;  1BOC A;  4OV2 A;  5BPJ A;  2LMV A;  4ETO A;  2JU0 A;  3FE6 A;  1YRU B;  2M49 B;  4YGD B;  1KSO A;  3IQQ A;  1QAS A;  2KQ6 A;  4MSP A;  4PHM A;  4YGC B;  4GAO A;  3CR5 X;  1C07 A;  2PAS A;  1GGW A;  4OR9 B;  5AAN A;  5CSN A;  4P5O E;  1A29 A;  1OOF A;  1BR1 B;  1J55 A;  1LVC D;  2NXQ A;  1KK8 C;  2WND A;  1CDP A;  1S6I A;  1LIN A;  1SSE B;  1W9Z A;  3D77 A;  4I5K A;  3BYA A;  4I5J A;  4MRX A;  1C3Y A;  4ZCV A;  1YTZ C;  1Z2C B;  3BOW A;  1CM1 A;  5JOL A;  1UP5 A;  2JXL A;  3BUN B;  3R1V A;  1GM0 A;  1MUX A;  3SS3 A;  2DOQ A;  1UHH A;  3PJI A;  3B6X A;  3R1P A;  1AK8 A;  5D69 A;  2WOS A;  1J1E A;  1E8A A;  1DTL A;  1TTX A;  2WCJ A;  2OS8 C;  1CLB A;  5DIC A;  5HKZ A;  2D8N A;  1CDN A;  3IQO A;  1IKU A;  4CPV A;  1KCY A;  2BKI B;  1F4O A;  2LAN A;  4A4C A;  2WC5 A;  3I5F C;  2WCM A;  1SKT A;  3FWC A;  4GNK B;  2KAV A;  1DGU A;  4JKT A;  3SG3 A;  2KGB C;  2M97 A;  3JTD B;  3ZWH A;  1NX3 A;  2TN4 A;  4D1E A;  1KFU S;  1M45 A;  2M1K B;  1H8B A;  2LVV A;  3DYE A;  3BJH A;  1KFX L;  1DJI A;  1CTR A;  1EG4 A;  2BNX A;  2PAL A;  3AKB A;  2KI4 C;  2EHB A;  1IIO A;  2M7N A;  3CAB A;  2JWW A;  4FQT A;  2IS9 A;  1CFF A;  1JF2 A;  2JT3 A;  2WCB A;  2LVJ A;  1SYM A;  1K94 A;  1IWQ A;  4YI8 A;  5HKY A;  2LP2 A;  3IF7 A;  3WHU B;  1OOH A;  1PSR A;  4CLN A;  1JC2 A;  2JT8 A;  1J7O A;  4PDZ A;  2QEV A;  4YGA A;  3BUO B;  1Y0V H;  1RRO A;  3DZT A;  2KLE A;  4PE1 A;  1OOI X;  2MLE C;  4BY5 A;  1DVI A;  2PVB A;  2F2O A;  5HLV A;  4FQO A;  3NHT A;  3BQ3 A;  1TNQ A;  1W7I B;  1ZAC A;  1M46 A;  2NLN A;  4MZL A;  5ER4 X;  1B8R A;  3V2L A;  4YBH B;  2I94 A;  1WDC B;  1QTX A;  1CDL A;  2JC2 A;  1TNW A;  2L2E A;  2LVI A;  2M9G A;  1TIZ A;  2F2P A;  2PYQ A;  2ZKM X;  1SMG A;  3OX5 A;  3PM8 A;  3I5G B;  1K2H A;  2KGR A;  1OQP A;  3FWB A;  1OOJ A;  3S0G A;  4M2O A;  1OW4 A;  1BR4 B;  4NDC A;  1K8U A;  3CS1 A;  3B87 A;  4IL1 A;  1NX0 A;  1WLZ A;  4YRU A;  4ICB A;  1YX8 A;  2WC8 A;  1W7J B;  1SL9 A;  3PFV A;  2M29 A;  2M3W A;  3TZ1 A;  3LLE A;  1QX2 A;  4JWQ A;  4HRH A;  4E68 A;  1SR6 B;  2LNK A;  1BT6 A;  4L9M A;  1QV0 A;  1B9A A;  1IQ5 A;  3NSK A;  1DF0 B;  2KI6 C;  1KFU L;  2CXJ A;  3S0D A;  2I7A A;  1OZS A;  3NSL A;  2JXC A;  3EVV A;  2CBL A;  2QDI A;  3GK1 A;  3JVT C;  2BBN A;  2OS8 B;  1EXR A;  4MN0 A;  2JTZ A;  3NXA A;  3FS7 A;  5AXI A;  3A8R A;  3EKH A;  1VRK A;  3CZ0 A;  1TN4 A;  1XA5 A;  3SS4 A;  1ZUZ A;  1S26 D;  1IJ5 A;  1S5G Z;  1OZO A;  1GGZ A;  5KSZ A;  1CNP A;  3B88 A;  2LHL A;  1DJH A;  1FPW A;  3FIA A;  2I18 A;  3SIB A;  1F54 A;  3D0Y B;  2JQ6 A;  2NZ0 A;  1F8H A;  3SJS A;  4GUK A;  2K7D A;  4YGB B;  1KFX S;  1MHO A;  4GGF C;  1LA0 A;  4PE0 A;  5DKN A;  3SG2 A;  1ZOT B;  2K7C A;  1B47 A;  1TUJ A;  2KI4 B;  2Y4Q A;  3CR4 X;  3EK4 A;  3QME A;  5ER5 A;  3S0A A;  1JBA A;  1KK7 Z;  4OCI A;  1IH0 A;  1KQM B;  2KSP A;  1WDC C;  2NCO A;  2E30 A;  1U5I B;  4DS7 A;  1TWO A;  3L47 A;  4N5X A;  2HPS A;  2G9B A;  4XYN A;  3SG7 A;  2E6W A;  1CMG A;  3I5G C;  3TDZ A;  3EK7 A;  4PHK A;  1ORG A;  2K2F A;  2MRD A;  1DGV A;  1M31 A;  1NP8 A;  1ODB A;  1K95 A;  1N0Y A;  2BBM A;  2LMU A;  1WRL A;  1M39 A;  2KBI A;  2KYC A;  4AOM A;  1OOG A;  1XO5 A;  1V1F A;  3TS5 B;  1DT7 B;  4N1G A;  1SCV A;  1ZFS A;  1CKK A;  4NQG A;  3ZNI A;  1R2U A;  1QXP A;  2ZNE A;  3SS5 A;  1F70 A;  1XFV O;  1EJ3 A;  2F3Z A;  2ZN9 A;  1SR6 C;  1S6C A;  2H61 C;  2WCF A;  3F45 A;  5I2Q A;  2SAS A;  2CCM A;  3BFB A;  1HQV A;  1A75 B;  2MJW B;  4FTG A;  3PLF B;  3CZ1 A;  4USL A;  2LVK A;  1AJ4 A;  2B1U A;  4MBE A;  2WOR A;  1A4P A;  2KNE A;  1LXF C;  1BLQ A;  5I2L A;  5FI6 A;  4I5L B;  1QX5 B;  2KBM A;  3R1O A;  3VRP A;  2O5G A;  2Y1N A;  4XJK A; 
#chains in the Genus database with same CATH homology
 2F33 A;  3EK8 A;  5DKR A;  1IG5 A;  1CFC A;  1WRZ A;  2K61 A;  1N2D A;  2LLT A;  1F71 A;  1F55 A;  1SCM C;  1YR5 A;  2FJU B;  1ALV A;  1NSH A;  2GGZ A;  5DKQ A;  1U5I A;  1NWD A;  3CTN A;  2ZND A;  3LK0 A;  3M0W A;  2BCB A;  2LV7 A;  2V53 A;  4AQI A;  3HX4 A;  2CT9 A;  3JVT B;  1DJX A;  1MQ1 A;  1KQM C;  1S6J A;  1CLM A;  1LKJ A;  1S5G Y;  1YUS A;  3BUX B;  3PSR A;  4U8D A;  1RWY A;  2G2B A;  4C0K A;  2R2I A;  1QS7 A;  2LUX A;  2JRF A;  3KO0 A;  1GQM A;  2COL B;  4ORC B;  4PAL A;  5GQQ C;  2OTG B;  3LCP C;  1EL4 A;  1CLL A;  1UHK A;  1WRK A;  4GPL B;  2M8U A;  1ZMZ A;  1TOP A;  4Q04 A;  4I5N B;  5G08 A;  3TS5 C;  2FCE A;  1KK7 Y;  1BMO A;  2L50 A;  3RM1 A;  4ORB B;  4F0Z B;  1A75 A;  5CSI A;  1M63 B;  3EKJ A;  4OVN F;  2QAC A;  5AFP A;  1J7Q A;  2KI6 D;  4PE4 A;  2CTN A;  4NDB A;  3WNX B;  2KQY A;  3SG5 A;  3MSE B;  3O78 A;  2JT0 A;  1B8C A;  1XFY O;  2FOT A;  4R1E A;  5HKW A;  1SK6 D;  5AEQ A;  2Q91 A;  2L0P A;  1NUB A;  1NX1 A;  3BUW B;  4QJ5 B;  1YRT B;  3I5H C;  5B8I B;  2KFH A;  2MA2 A;  1AJ5 A;  1X02 A;  4GFT A;  1H4B A;  1JFK A;  1J7P A;  1RK9 A;  1PRW A;  2P6B B;  2PSR A;  1C7V A;  1FW4 A;  1YX7 A;  1FI5 A;  1MXL C;  2LCP A;  1PAL A;  3EVU A;  1XFW O;  4GBA A;  1XK4 C;  2BE6 A;  2SCP A;  3BUM B;  4ORA B;  3KPX A;  2ISD A;  1IQ3 A;  4BY4 A;  1PVA A;  1RTP 1;  3PAL A;  3GK2 A;  5KU1 A;  1IGV A;  2LM5 A;  4MVF A;  3VRN A;  3K21 A;  3KEV A;  4HSZ A;  1TNX A;  4WRI A;  5TNC A;  2Y5I A;  3LK1 A;  4GGF A;  5CSJ A;  3OP0 A;  1BG1 A;  2ZN8 A;  1JFJ A;  2LMT A;  1QV1 A;  2JUL A;  2OTG C;  3DVK A;  2EC6 C;  1SCM B;  3SG6 A;  4ZCU A;  1K96 A;  1XYD A;  2MLF C;  1B8L A;  3OB1 B;  1SRA A;  2K0J A;  2EGD A;  3I5I B;  2K7B A;  1WLM A;  2WCE A;  3O6B A;  4MRY A;  1A2X A;  3KF9 A;  5CSF A;  4UPG A;  1YVH A;  4DRW A;  3TDI A;  4OKH A;  4CFQ A;  3WHT B;  1PK0 D;  1CFP A;  2L98 A;  1OMV A;  1DJG A;  3CZT X;  5FYX A;  5IBW A;  4C0J A;  2ZRT A;  1QVI Z;  2QPT A;  1OSA A;  1SW8 A;  2H61 A;  2LLU A;  1L2O C;  1FF1 A;  1WY9 A;  2RGI A;  4JQ0 D;  1SBJ A;  1B7T Z;  4WQ2 A;  1DF0 A;  3PN7 C;  3DVJ A;  1CFD A;  2BL0 C;  1N65 A;  1OMR A;  2MHH A;  2JPT A;  2LC5 A;  4HRG A;  2JTT A;  3QRX A;  2L4I A;  1Y1A A;  2LE9 B;  1DJW A;  1K9P A;  2H2K A;  1B1G A;  1RJV A;  2KOT A;  2MAZ A;  2CNP A;  1BF5 A;  3LL8 B;  1BU3 A;  1TCO B;  2MBX A;  1G4Y R;  1ALW A;  2JNX A;  3D0Y A;  3I5H B;  1UUS A;  3KHE A;  1B4C A;  3EVR A;  5JJG A;  1XVJ A;  3CGA A;  1QX7 A;  2Y1M A;  1TNP A;  1Y1X A;  2GV5 A;  3CLN A;  2BKH B;  1UWO A;  3VRO A;  4PCW A;  5F6T A;  2LHI A;  4MEW A;  1BJF A;  4MZK A;  1JUO A;  2FCD A;  2ZRS A;  1AHR A;  1EG3 A;  1L7Z A;  2OPO A;  1GJY A;  5KTY A;  1CB1 A;  3I5I C;  1FI6 A;  2JOJ A;  1RFJ A;  3ICB A;  2A4J A;  1QAT A;  1SY9 A;  3E3R A;  1REC A;  3NSO A;  1SPY A;  1UUR A;  3DF0 B;  1DMO A;  1NX2 A;  1DJZ A;  1EH2 A;  3AAK A;  1KWO C;  5I2O A;  1C7W A;  1K90 D;  2HQW A;  2EC6 B;  3C1V A;  4DUQ A;  4YI9 A;  5J3X A;  1Y1U A;  1QLS A;  1YVL A;  1NIW A;  5PAL A;  3RLZ A;  1OMD A;  1QIW A;  3TDU A;  4GGN A;  1R6P A;  3DVM A;  5AER A;  2KFF A;  3VRR A;  4PHN A;  2PRU A;  3GK4 X;  1K93 D;  3TUY C;  3OHM B;  1UHI A;  1J1D A;  1XFX O;  1PVB A;  1YUR A;  1JF0 A;  5CPV A;  4AQJ A;  1TCF A;  3WXA A;  2I2R E;  1MR8 A;  2K8M B;  2KAY A;  4QJ3 B;  1HT9 A;  1QLK A;  1QVI Y;  2LP3 A;  1LA3 A;  1PSB A;  2LUC A;  2KHN A;  1KQV A;  1B7T Y;  1CM4 A;  1QJT A;  4P2Y B;  2GGM A;  3D10 A;  1NCY A;  1L2O B;  1IRJ A;  1J7R A;  1K9U A;  1MF8 B;  1XK4 A;  2KFG A;  2NCP A;  4DIR A;  1YUU A;  5HYD A;  1MXE A;  3PN7 B;  2BL0 B;  1BOD A;  1G8I A;  1PUL A;  1SL7 A;  2HET A;  2L51 A;  1S1E A;  2LLS A;  2BCX A;  1CDM A;  2KAX A;  3DF0 A;  1MWN A;  3AAJ A;  1TRF A;  2AAO A;  2JZI A;  4JPZ B;  1K9K A;  2BCA A;  2ZFD A;  2BEC A;  2KDH A;  2L5X B;  4PHJ A;  3O4Y A;  2Q4U A;  1OE9 B;  3NSI A;  1CMF A;  1SNL A;  2K2A A;  4YGE B;  4CID A;  2M0R A;  2AMI A;  3A4U B;  4MLW A;  4MZJ A;  4PE7 A;  1AVS A;  1Q80 A;  1JSA A;  4HRE E;  3VGO A;  2PMY A;  1KK8 B;  1S36 A;  4QJ4 B;  3CR2 A;  3HCM A;  4CFR A;  1Y6W A;  2K7O A;  1D1O A;  3JTD C;  1XFZ O;  1DJY A;  1AUI B;  4M2Q A;  3OX6 A;  3SIA A;  1NPQ A;  1NCX A;  3DD4 A;  2AUC A;  1G33 A;  1YUT A;  2VRG A;  1F4Q A;  2KYF A;  2JNF A;  1A03 A;  3BOW B;  1XFU O;  3O2P A;  1SL8 A;  2L4H A;  2M7L A;  2HF5 A;  5I8N A;  5HLO A;  3CWG A;  4TNC A;  4A4B A;  4M2P A;  3OB2 B;  1NYA A;  5D7F A;  1KWO B;  1S3P A;  1FBV A;  3H4S E;  3I5F B;  4N1F A;  3SG3 A;  3PAT A;  3BXK A;  1UHJ A;  1AP4 A;  2F3Y A;  1NCZ A;  4DCK A;  1KSM A;  1IJ6 A;  2O60 A;  3GOF A;  4WQ3 A;  2LAP A;  2F8P A;  3AKA A;  1V1G A;  4XJK B;  1UHN A;  2BE4 A;  3TUY B;  3VRQ A;  1JWD A;  5K89 A;  3SG4 A;  4C0L A;  3DVE A;  2HQ8 A;  1QIV A;  4NDD A;  1BOC A;  2M1U A;  4OV2 A;  5BPJ A;  2LMV A;  4ETO A;  2JU0 A;  1YRU B;  2M49 B;  4YGD B;  1KSO A;  3IQQ A;  1QAS A;  2KQ6 A;  4MSP A;  4PHM A;  4YGC B;  4GAO A;  3CR5 X;  1C07 A;  2PAS A;  1GGW A;  4OR9 B;  5AAN A;  5CSN A;  4P5O E;  1A29 A;  1BR1 B;  1J55 A;  1LVC D;  2NXQ A;  1KK8 C;  2WND A;  1CDP A;  1S6I A;  1LIN A;  4I5J A;  4MRX A;  4I5K A;  3BYA A;  4ZCV A;  1YTZ C;  3BOW A;  1CM1 A;  5JOL A;  1UP5 A;  2JXL A;  3BUN B;  1MUX A;  2DOQ A;  1UHH A;  1AK8 A;  5D69 A;  2WOS A;  1J1E A;  1E8A A;  1DTL A;  1TTX A;  2OS8 C;  1CLB A;  5HKZ A;  2D8N A;  1CDN A;  3IQO A;  1IKU A;  4CPV A;  1KCY A;  2BKI B;  1F4O A;  2LAN A;  4A4C A;  3I5F C;  1SKT A;  3FWC A;  4GNK B;  2KAV A;  1DGU A;  2KGB C;  2M97 A;  3JTD B;  3ZWH A;  1NX3 A;  2TN4 A;  4D1E A;  1KFU S;  1M45 A;  2M1K B;  1H8B A;  2LVV A;  4YGA A;  1KFX L;  1DJI A;  1CTR A;  1EG4 A;  2PAL A;  3AKB A;  2KI4 C;  2EHB A;  2M7N A;  2JWW A;  2IS9 A;  1CFF A;  1JF2 A;  2JT3 A;  2WCB A;  2LVJ A;  1SYM A;  1K94 A;  1IWQ A;  4YI8 A;  5HKY A;  2LP2 A;  3IF7 A;  3WHU B;  1PSR A;  4CLN A;  1JC2 A;  2JT8 A;  1J7O A;  4PDZ A;  3BUO B;  1Y0V H;  1RRO A;  4PE1 A;  4BY5 A;  2MLE C;  1DVI A;  2PVB A;  2F2O A;  5HLV A;  4FQO A;  3BQ3 A;  1TNQ A;  1W7I B;  1ZAC A;  1M46 A;  2NLN A;  4MZL A;  5ER4 X;  1B8R A;  4YBH B;  2I94 A;  1WDC B;  1QTX A;  1CDL A;  2JC2 A;  1TNW A;  2L2E A;  2LVI A;  2M9G A;  1TIZ A;  2F2P A;  2ZKM X;  3OX5 A;  1SMG A;  3PM8 A;  3I5G B;  1K2H A;  2KGR A;  1OQP A;  3FWB A;  1OOJ A;  4M2O A;  4NDC A;  1BR4 B;  1K8U A;  3CS1 A;  4IL1 A;  1NX0 A;  1WLZ A;  4YRU A;  4ICB A;  1YX8 A;  2WC8 A;  1W7J B;  1SL9 A;  3PFV A;  2M29 A;  2M3W A;  3TZ1 A;  3LLE A;  1QX2 A;  4JWQ A;  4HRH A;  4E68 A;  1SR6 B;  2LNK A;  1BT6 A;  4L9M A;  1QV0 A;  1B9A A;  1IQ5 A;  3NSK A;  1DF0 B;  2KI6 C;  1KFU L;  2CXJ A;  2I7A A;  1OZS A;  3NSL A;  2JXC A;  3EVV A;  2CBL A;  3GK1 A;  3JVT C;  2BBN A;  2OS8 B;  1EXR A;  4MN0 A;  2JTZ A;  3NXA A;  3FS7 A;  5AXI A;  3A8R A;  3EKH A;  1VRK A;  1TN4 A;  1XA5 A;  1ZUZ A;  1S26 D;  1IJ5 A;  1S5G Z;  1OZO A;  1GGZ A;  5KSZ A;  1CNP A;  2LHL A;  1DJH A;  1FPW A;  3FIA A;  2I18 A;  3SIB A;  1F54 A;  3D0Y B;  2JQ6 A;  2NZ0 A;  1F8H A;  3SJS A;  4GUK A;  2K7D A;  4YGB B;  1KFX S;  1MHO A;  4GGF C;  1LA0 A;  4PE0 A;  5DKN A;  3SG2 A;  1ZOT B;  2K7C A;  1B47 A;  2KI4 B;  3CR4 X;  2Y4Q A;  3EK4 A;  5ER5 A;  1JBA A;  1KK7 Z;  4OCI A;  1IH0 A;  1KQM B;  2KSP A;  1WDC C;  2NCO A;  2E30 A;  1U5I B;  4DS7 A;  4N5X A;  2HPS A;  2G9B A;  4XYN A;  3SG7 A;  2E6W A;  1CMG A;  3I5G C;  3TDZ A;  3EK7 A;  4PHK A;  2K2F A;  2MRD A;  1DGV A;  1M31 A;  1NP8 A;  1ODB A;  1K95 A;  1N0Y A;  2BBM A;  2LMU A;  1WRL A;  1M39 A;  2KBI A;  2KYC A;  4AOM A;  1XO5 A;  3TS5 B;  1V1F A;  1DT7 B;  4N1G A;  1SCV A;  1ZFS A;  1CKK A;  4NQG A;  3ZNI A;  1R2U A;  1QXP A;  2ZNE A;  1F70 A;  1XFV O;  1EJ3 A;  2F3Z A;  2ZN9 A;  1SR6 C;  1S6C A;  2H61 C;  2WCF A;  3F45 A;  5I2Q A;  2SAS A;  2CCM A;  1HQV A;  1A75 B;  2MJW B;  4FTG A;  3PLF B;  4USL A;  2LVK A;  1AJ4 A;  2B1U A;  4MBE A;  2WOR A;  1A4P A;  2KNE A;  1LXF C;  1BLQ A;  5I2L A;  4I5L B;  1QX5 B;  2KBM A;  3VRP A;  2O5G A;  2Y1N A;  4XJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...