2KI6C

The fgf1-s100a13-c2a hetero-hexameric complex structure: a component in the non-classical pathway for fgf1 secretion
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Synaptotagmin-1
publication title The heterohexameric complex structure, a component in the non-classical pathway for fibroblast growth factor 1 (FGF1) secretion.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ki6C00
2MAZA 1TCFA 3JTDB 2BBMA 1H4BA 2M8UA 3RLZA 3SIAA 1KK8C 2A4JA 2JPTA 1C7WA 1FPWA 4NQGA 1S1EA 1TCOB 1WRKA 2ZRSA 5I2LA 1TNQA 4YI9A 1S5GZ 2WCBA 1C07A 2LVJA 4OVNF 3D0YB 4GGNA 3DVMA 1AP4A 3A8RA 2LLSA 2NXQA 1MUXA 2KBIA 2KAYA 2K0JA 2LM5A 3AAJA 1DVIA 1HQVA 4ICBA 1YVHA 5CSNA 1DJHA 1PULA 3KPXA 3F45A 5ER5A 3O6BA 3OB2B 3VGOA 2BL0B 3AKBA 4I5KA 4R1EA 1YUSA 2PALA 3TUYB 1ZACA 4PE0A 1UHJA 3DF0A 4DCKA 1SY9A 2KI6D 1QX7A 2QACA 2M29A 2KNEA 1CTRA 1WRLA 3WNXB 4UPGA 4WQ3A 1IQ5A 2SCPA 2D8NA 2EC6B 4GGFC 1W7IB 5AERA 1DTLA 1K9KA 1KQMC 3SG2A 2COLB 1UHHA 4PHJA 4YGDB 1NX2A 4QJ5B 1M63B 1ZFSA 2M9GA 1RJVA 2ZFDA 1CDPA 2K7CA 2OS8B 5DKQA 1OE9B 1ZOTB 1SCMC 1CFFA 2KAVA 1JC2A 3TDIA 1DF0B 1JF0A 4QJ3B 2LHLA 3SG6A 1RECA 1M39A 1LKJA 1AHRA 1XFUO 1QIVA 2M97A 1UHKA 5I8NA 2F8PA 1KQVA 4A4CA 1K95A 1TNXA 1AJ4A 3I5FC 2BECA 2JC2A 5PALA 2FCDA 1CM1A 5HKWA 2LV7A 1QVIY 4ORBB 3CS1A 1NCZA 2CNPA 2JT0A 1BT6A 4C0KA 2ZN8A 1J7QA 2JT3A 5HKZA 1PVBA 1S36A 2NLNA 3KO0A 4CLNA 1DGVA 2K61A 2LMVA 4YBHB 1K96A 4QJ4B 2M49B 4BY5A 4MRXA 4PALA 1CFDA 5K89A 1CDMA 3OX6A 4U8DA 1SYMA 3EVRA 5I2QA 2I2RE 2Y1MA 1EJ3A 1S26D 2KFFA 1SBJA 4XJKB 1U5IA 2HQWA 3NSLA 4DIRA 3CGAA 1CDNA 2K7OA 1XA5A 1OMRA 1KSOA 1Y1UA 1EH2A 1V1FA 3BOWB 1E8AA 1Q80A 2KI6C 2CBLA 2ZN9A 1QTXA 3DVEA 3FS7A 4ORCB 4PDZA 4Q04A 1QX2A 1UHNA 1NX1A 2ZNDA 5I2OA 3IQQA 4HRHA 4AQJA 1G4YR 1Y1AA 4GFTA 4CFRA 1F8HA 1B4CA 1JF2A 2F2PA 2MBXA 2LLTA 2B1UA 3I5IB 1MXEA 1MXLC 3WHUB 1CMGA 2K2FA 2Q4UA 5AEQA 1Y6WA 3GK1A 1AUIB 4JWQA 1XFZO 5CSIA 5IBWA 1QIWA 2G2BA 3EKJA 3PN7B 4L9MA 3VRRA 2H61C 2QPTA 4MEWA 1B7TY 1ZMZA 4HSZA 1LINA 2G9BA 2LE9B 1XVJA 4GAOA 2ZRTA 5AANA 1PK0D 1QATA 1BF5A 1BU3A 3C1VA 3CLNA 3CWGA 4A4BA 3DD4A 2H2KA 3VRQA 1H8BA 4NDBA 2LMTA 2PASA 1ALWA 1DF0A 3LCPC 1DJZA 5JJGA 1WLMA 1UWOA 1IH0A 3PALA 2MHHA 2K7DA 1F4OA 4PE1A 1EL4A 1U5IB 1KK7Z 5HLOA 2BE4A 1LA0A 3DVKA 1BJFA 1SW8A 4P2YB 1L2OB 3VRNA 3AAKA 3I5GB 3IF7A 2L50A 3AKAA 2IS9A 1D1OA 3GOFA 4ZCUA 2WCEA 2JTZA 1K9PA 1G33A 1CLMA 2L2EA 4JQ0D 2R2IA 1SCVA 2K8MB 3VROA 1F71A 1PALA 2F3ZA 2JXLA 2KI4B 5D69A 1X02A 3SIBA 4CIDA 3JVTB 1NX0A 4MLWA 1SL8A 1SR6B 2NZ0A 1Y0VH 3CR4X 2VRGA 1KWOB 4OCIA 3I5HB 4PE7A 1RFJA 1KSMA 2JNXA 2Y5IA 4GGFA 4XJKA 3CZTX 1XFYO 5GQQC 1L7ZA 1N2DA 5F6TA 2FOTA 3PLFB 1K93D 2WOSA 4GNKB 4YI8A 4I5JA 4DRWA 2LUCA 2WCFA 3A4UB 1SL9A 3BOWA 4N1FA 1MF8B 1NIWA 4HREE 1ODBA 2BE6A 4PCWA 2KFHA 1YURA 4GBAA 1NYAA 1S5GY 1KK8B 1LXFC 3BUXB 2I94A 5CSFA 4I5NB 3PATA 2JZIA 1DJWA 1GGZA 4MBEA 1K8UA 1B9AA 1SKTA 4ZCVA 1R6PA 1WRZA 4YGBB 3NXAA 5CSJA 1IG5A 1CM4A 2BCBA 3TS5C 4C0JA 1AK8A 3OP0A 3WHTB 2PMYA 4M2PA 2FJUB 2O60A 3EKHA 1CNPA 4NDDA 4YRUA 1F70A 4E68A 4WRIA 2MLEC 3ZWHA 2WC8A 3GK2A 1WDCC 4FTGA 1VRKA 1GJYA 3K21A 4MZLA 5KU1A 1K2HA 1J55A 2LVIA 2NCOA 1UURA 1CLBA 1DJYA 4MZJA 1YR5A 3EVUA 1KQMB 2ZNEA 1FW4A 1KCYA 2L0PA 4N5XA 1SK6D 2JOJA 1XFWO 3OB1B 2BKHB 2LP3A 3D10A 3FIAA 1EG4A 1FBVA 2OTGC 2WORA 1GQMA 3O78A 1MWNA 5JOLA 2KQ6A 1SCMB 1GGWA 2K2AA 3KHEA 2O5GA 4OV2A 3H4SE 1JWDA 3KEVA 2ISDA 5ER4X 1BMOA 1W7JB 1JUOA 3RM1A 1NUBA 1IQ3A 2GV5A 3PSRA 4DUQA 1IKUA 4MSPA 1N0YA 1NCXA 1QASA 1A4PA 4GPLB 2L4HA 3JTDC 5HKYA 1YX8A 2F3YA 3FWCA 1CB1A 5CPVA 3KF9A 3VRPA 3I5FB 2BCAA 2JQ6A 2AMIA 1NP8A 1CFCA 1K94A 1EXRA 2LAPA 1J1DA 3BQ3A 4USLA 1TTXA 2WNDA 1SPYA 2I7AA 1S6CA 4I5LB 4ETOA 1BODA 1F55A 1XYDA 1B8LA 2EHBA 2ZKMX 1MR8A 4CPVA 2I18A 3HX4A 1KFUL 1IWQA 1C7VA 1R2UA 1BR4B 1RROA 1A2XA 2EGDA 2BL0C 4WQ2A 1PVAA 1YTZC 3EK7A 2JXCA 3TUYC 2CTNA 2F2OA 3HCMA 4HRGA 1DJIA 1K9UA 3QRXA 3BUWB 1XK4C 1DGUA 1KFUS 2JULA 2LMUA 2KBMA 1OOJA 4P5OE 3O2PA 4YGCB 2EC6C 2LNKA 3LK0A 1DJGA 3TDZA 5J3XA 1QXPA 3BXKA 2KGRA 2JT8A 1SRAA 3EK4A 2CCMA 4PE4A 1AJ5A 4GUKA 1S3PA 1JFJA 2Q91A 1LVCD 2OS8C 4YGAA 4TNCA 2V53A 2KYFA 2PRUA 5AXIA 1IJ5A 1CDLA 3EVVA 3ICBA 5KTYA 2KYCA 5D7FA 3MSEB 2SASA 4CFQA 1BG1A 5G08A 1A29A 3CTNA 3SJSA 4MVFA 2LUXA 4AOMA 3IQOA 2K7BA 5DKNA 2LVVA 3TDUA 1OZOA 2FCEA 2BCXA 2P6BB 1J7OA 2M0RA 2L51A 4ORAB 4F0ZB 1NWDA 5HLVA 4BY4A 1NCYA 1QJTA 1A75A 1RWYA 3M0WA 2HETA 4M2QA 5KSZA 3OX5A 2CXJA 3CR2A 2F33A 2LHIA 1IRJA 1ZUZA 2L4IA 1OZSA 2M1KB 1JSAA 1YUTA 4NDCA 5FYXA 1QVIZ 2Y4QA 1J1EA 1YVLA 2BBNA 1G8IA 1KK7Y 2LLUA 1XO5A 2KSPA 2LANA 1QV1A 1QS7A 1B47A 2L98A 1F54A 1DMOA 3SG3A 2JRFA 1SMGA 1YUUA 4PHMA 1TIZA 2LVKA 1CLLA 2M7NA 1LA3A 4OKHA 5B8IB 2LP2A 3E3RA 5TNCA 1EG3A 2KQYA 2KOTA 2NCPA 3FWBA 1TNPA 3LLEA 4M2OA 3PM8A 2E30A 1NX3A 1JFKA 1WY9A 1IJ6A 1OMDA 3OHMB 2HPSA 4MZKA 1N65A 1S6IA 1M46A 1JBAA 1TN4A 2MA2A 3I5IC 3SG5A 4AQIA 2KGBC 2KAXA 1MHOA 1NPQA 3TZ1A 2GGZA 2M7LA 1J7RA 1A75B 2PSRA 2JNFA 3PN7C 2AUCA 4N1GA 3NSOA 1IGVA 2JU0A 3EK8A 3WXAA 3ZNIA 4D1EA 1QX5B 4DS7A 1CFPA 2MLFC 2MRDA 1XFXO 1B8RA 1B7TZ 1XFVO 2MJWB 1OQPA 1WLZA 1UUSA 3BUOB 5BPJA 1BLQA 3LL8B 1QV0A 3DF0B 1PSBA 2RGIA 4MN0A 1YRTB 3O4YA 2KDHA 2GGMA 5DKRA 1YRUB 1NSHA 2HF5A 1KFXL 1M31A 3CR5X 1S6JA 2JTTA 1B1GA 1L2OC 3I5GC 3D0YA 2H61A 3GK4X 4MRYA 1B8CA 2OPOA 3TS5B 2M3WA 1FI5A 1ALVA 1TNWA 1DJXA 5AFPA 2KFGA 1F4QA 1KFXS 3DVJA 3NSIA 4PHNA 5HYDA 1FF1A 1TRFA 3LK1A 1RK9A 1WDCB 4YGEB 1UHIA 4C0LA 1K90D 2TN4A 2KI4C 2AAOA 3NSKA 4XYNA 3SG4A 1AVSA 1MQ1A 1OMVA 2L5XB 2HQ8A 3JVTC 1SL7A 1SR6C 4OR9B 1QLSA 1XK4A 1J7PA 1KWOC 2M1UA 3I5HC 1M45A 1FI6A 4PHKA 1SNLA 1BOCA 4JPZB 1CMFA 1A03A 1V1GA 1CKKA 3BUMB 1PRWA 3SG7A 2CT9A 1HT9A 2OTGB 1BR1B 2JWWA 2PVBA 1UP5A 3BUNB 2Y1NA 1OSAA 2DOQA 2BKIB 1QLKA 1DT7B 1TOPA 2LC5A 1PSRA 2LCPA 1YX7A 3BYAA 3PFVA 1RTP1 2E6WA 4FQOA 2KHNA 4IL1A 1Y1XA
chains in the Genus database with same CATH superfamily
2MAZA 1TCFA 3JTDB 2BBMA 1H4BA 2M8UA 3RLZA 3D78A 4INXA 3SIAA 1KK8C 2A4JA 2JPTA 1C7WA 5D3OA 1FPWA 4NQGA 1S1EA 1TCOB 1WRKA 2ZRSA 3D74A 5I2LA 1TNQA 4YI9A 3CABA 1S5GZ 2WCBA 1C07A 2LVJA 4OVNF 2WCLA 3D0YB 3DVMA 4GGNA 4INWA 3A8RA 1AP4A 2LLSA 2NXQA 3BFHA 2BAPA 1MUXA 2KBIA 2KAYA 2K0JA 2LM5A 3AAJA 1DVIA 1HQVA 4ICBA 1YVHA 5CSNA 1DJHA 1PULA 3KPXA 3F45A 5ER5A 3O6BA 3OB2B 3VGOA 2BL0B 3AKBA 3L4LA 4I5KA 1YUSA 2PALA 1DEKA 4R1EA 2ERBA 1ZACA 4PE0A 3TUYB 1UHJA 3DF0A 4DCKA 3B86A 1SY9A 2KI6D 1QX7A 2QACA 3R72A 2M29A 2KNEA 1CTRA 1WRLA 3WNXB 4UPGA 4WQ3A 1IQ5A 2SCPA 2D8NA 2EC6B 4GGFC 1W7IB 5AERA 1DTLA 1K9KA 1KQMC 3SG2A 2COLB 1UHHA 4PHJA 4YGDB 1NX2A 4QJ5B 1M63B 1ZFSA 5EL2A 3BFBA 2M9GA 1RJVA 2ZFDA 1CDPA 2K7CA 2OS8B 5DKQA 5FI6A 1OE9B 1ZOTB 1SCMC 1CFFA 2KAVA 1JC2A 3TDIA 1DF0B 1JF0A 4QJ3B 2LHLA 3SG6A 1RECA 1M39A 4OZDA 1LKJA 1AHRA 1XFUO 1QIVA 2M97A 1UHKA 5I8NA 2F8PA 4IJ7A 1KQVA 4A4CA 1K95A 1TNXA 1AJ4A 1DQEA 3I5FC 2BECA 2JC2A 5PALA 2FCDA 1CM1A 5HKWA 3CYZA 2LV7A 1OOIX 1QVIY 4ORBB 3PJIA 3CS1A 1NCZA 2CNPA 2JT0A 1BT6A 4C0KA 2ZN8A 1J7QA 2JT3A 5HKZA 1PVBA 1S36A 3K1EA 2NLNA 3KO0A 3OBVA 4CLNA 1DGVA 2K61A 2LMVA 4YBHB 1K96A 4QJ4B 2M49B 4BY5A 4MRXA 4PALA 1CFDA 5K89A 1CDMA 3OX6A 4U8DA 3RZSA 1SYMA 3EVRA 5I2QA 2I2RE 2Y1MA 1EJ3A 3S0BA 1S26D 2KFFA 1SBJA 4XJKB 1U5IA 2HQWA 3NSLA 5FI2A 2QDIA 3L4AA 4DIRA 3CGAA 1CDNA 2K7OA 1XA5A 1OMRA 1KSOA 1Y1UA 1EH2A 1V1FA 2WCMA 3BOWB 1E8AA 1Q80A 2KI6C 2CBLA 2ZN9A 1QTXA 3DVEA 3FS7A 4ORCB 4PDZA 4Q04A 1QX2A 1UHNA 1NX1A 2ZNDA 5I2OA 3IQQA 4HRHA 4AQJA 1G4YR 1Y1AA 4GFTA 4CFRA 3FE9A 1F8HA 1B4CA 1JF2A 2F2PA 2MBXA 2LLTA 2B1UA 3I5IB 1IIOA 1MXEA 1MXLC 2L2CA 3WHUB 1CMGA 2PYQA 2K2FA 2Q4UA 5AEQA 1Y6WA 3GK1A 1AUIB 4JWQA 1XFZO 5CSIA 5IBWA 1QIWA 2G2BA 3EKJA 5DICA 3PN7B 4L9MA 3VRRA 2H61C 2QPTA 4MEWA 1B7TY 1ZMZA 4HSZA 1LINA 2G9BA 2LE9B 1XVJA 2WCHA 2ZRTA 4GAOA 5AANA 1PK0D 1QATA 1BF5A 1BU3A 3C1VA 3CLNA 3CWGA 4A4BA 3DD4A 2H2KA 3VRQA 1H8BA 4NDBA 2LMTA 2PASA 1ALWA 1DF0A 3LCPC 1DJZA 5JJGA 1WLMA 1UWOA 1IH0A 3PALA 2MHHA 2K7DA 1F4OA 4PE1A 1EL4A 1U5IB 1KK7Z 5HLOA 2BE4A 1LA0A 3DVKA 1BJFA 1SW8A 4P2YB 1L2OB 3VRNA 3AAKA 3I5GB 3IF7A 3S0DA 2L50A 3AKAA 3D75A 2IS9A 1D1OA 3GOFA 4ZCUA 3SS5A 3B7AA 2WCEA 2JTZA 1K9PA 1G33A 2QEVA 1CLMA 2L2EA 3S0GA 4JQ0D 2R2IA 1SCVA 2K8MB 3VROA 1F71A 1PALA 2F3ZA 3FE8A 1XFRA 2JXLA 2KI4B 5D69A 1X02A 3SIBA 4CIDA 3JVTB 1NX0A 4MLWA 1SL8A 1SR6B 2NZ0A 1Y0VH 3CR4X 3BJHA 2VRGA 1KWOB 4OCIA 2KPHA 3I5HB 4PE7A 1P28A 1RFJA 1KSMA 2JNXA 2Y5IA 4GGFA 4XJKA 3CZTX 1XFYO 5GQQC 1L7ZA 1N2DA 5F6TA 2FOTA 3PLFB 1K93D 2WOSA 4GNKB 4YI8A 4I5JA 4DRWA 2LUCA 2WCFA 1C3YA 3A4UB 1SL9A 1SSEB 3BOWA 2WC6A 4N1FA 1MF8B 1NIWA 3IVTA 4HREE 1ODBA 2BE6A 4PCWA 2KFHA 3CZ0A 1YURA 4GBAA 1NYAA 1OOFA 1S5GY 1KK8B 1LXFC 1QWVA 3L47A 3BUXB 2I94A 5CSFA 1TUJA 4I5NB 3OGNA 3PATA 2JZIA 1DJWA 1GGZA 4MBEA 1K8UA 3B6XA 1B9AA 1SKTA 4ZCVA 2K60A 1R6PA 4JKTA 1WRZA 4YGBB 3NXAA 5I94A 5CSJA 1IG5A 1CM4A 2BCBA 3TS5C 4C0JA 1AK8A 3OP0A 3WHTB 2PMYA 4M2PA 2FJUB 2O60A 3EKHA 1CNPA 3R1VA 4NDDA 4YRUA 1F70A 4E68A 3N7HA 2MLEC 4WRIA 3ZWHA 3NHTA 2WC8A 3GK2A 1WDCC 5FI7A 4FTGA 1VRKA 1GJYA 3K21A 4MZLA 5KU1A 1K2HA 1J55A 3DZTA 2LVIA 2NCOA 1UURA 1CLBA 1DJYA 4MZJA 1YR5A 3EVUA 1KQMB 2ZNEA 1FW4A 1KCYA 2L0PA 4N5XA 3NHIA 1SK6D 2JOJA 1XFWO 3OB1B 2BKHB 2LP3A 3D10A 3FIAA 1DELA 1EG4A 1FBVA 2OTGC 2WORA 1GQMA 3O78A 1MWNA 5JOLA 2KQ6A 1SCMB 2QEBA 3UNWA 1GGWA 2K2AA 3KHEA 2O5GA 4OV2A 3H4SE 1JWDA 3KEVA 2ISDA 5ER4X 1BMOA 1W7JB 2PQLA 1JUOA 3CZ1A 3RM1A 1NUBA 2P71A 1IQ3A 2GV5A 3PSRA 4DUQA 1IKUA 4MSPA 1N0YA 1NCXA 1QASA 3B87A 1A4PA 4GPLB 2L4HA 4PT1A 3JTDC 5HKYA 1YX8A 2F3YA 3FE6A 3FWCA 1CB1A 5CPVA 3KF9A 3VRPA 3I5FB 2BCAA 2JQ6A 2AMIA 1NP8A 3CZ2A 1CFCA 1K94A 1EXRA 2H8VA 1J1DA 2LAPA 3BQ3A 1TTXA 2WNDA 1SPYA 2I7AA 1S6CA 3CDNA 4I5LB 4USLA 4ETOA 1BODA 1XYDA 1B8LA 2EHBA 2ZKMX 1MR8A 4CPVA 2I18A 3HX4A 1F55A 1KFUL 1IWQA 1C7VA 1R2UA 1BR4B 3PM2A 1RROA 5HL1A 1W9ZA 2FJYA 1A2XA 2EGDA 2BL0C 4WQ2A 1PVAA 1YTZC 3EK7A 2JXCA 3TUYC 2CTNA 2F2OA 3HCMA 4HRGA 1DJIA 1K9UA 3QRXA 2KLEA 3BUWB 1XK4C 4JD9A 1DGUA 1KFUS 2JULA 2LMUA 2KBMA 1OOJA 4P5OE 3O2PA 4YGCB 2EC6C 2LNKA 3EG5B 1DJGA 3LK0A 3TDZA 5J3XA 3Q8IA 1QXPA 3BXKA 2KGRA 2L5YA 2JT8A 1SRAA 3EK4A 2CCMA 4PE4A 1AJ5A 4GUKA 1S3PA 1JFJA 2Q91A 1LVCD 2OS8C 1OW4A 4TNCA 4YGAA 2V53A 2KYFA 2PRUA 5AXIA 1IJ5A 1CDLA 3EVVA 3ICBA 5KTYA 2KYCA 3D76A 5D7FA 3MSEB 1TWOA 2SASA 4CFQA 5G08A 1BG1A 1A29A 3CTNA 3SJSA 4MVFA 2LUXA 2GTEA 4AOMA 3IQOA 2K7BA 5DKNA 2LVVA 3TDUA 1OZOA 2FCEA 2BCXA 2P6BB 2QEOA 4F7FA 1J7OA 2M0RA 2WCJA 1Z2CB 1Z4HA 2L51A 4ORAB 4F0ZB 3S0FA 1NWDA 5HLVA 4BY4A 1NCYA 1QJTA 1A75A 1RWYA 3M0WA 2HETA 4M2QA 5KSZA 3OX5A 2CXJA 3CR2A 2F33A 2LHIA 1IRJA 1ZUZA 2L4IA 3SS3A 1OZSA 2M1KB 1JSAA 1YUTA 3D77A 4NDCA 5FYXA 1QVIZ 2Y4QA 1J1EA 1YVLA 2BBNA 1G8IA 3R1PA 1KK7Y 2LLUA 1XO5A 2KSPA 2LANA 1QV1A 3S0AA 1QS7A 1B47A 2L98A 1F54A 1DMOA 3SG3A 2JRFA 1SMGA 1YUUA 4PHMA 1TIZA 2LVKA 1DC1A 3B88A 1CLLA 2M7NA 1LA3A 4OKHA 5B8IB 2LP2A 3E3RA 5TNCA 1EG3A 2KQYA 2KOTA 2NCPA 3FWBA 1TNPA 3LLEA 4M2OA 1GM0A 3PM8A 2E30A 1TUZA 1NX3A 1JFKA 4FQTA 1WY9A 1IJ6A 1OMDA 3OHMB 2HPSA 4MZKA 1N65A 1S6IA 2KLDA 3SS4A 1M46A 1JBAA 1TN4A 2MA2A 3I5IC 4KYNA 3SG5A 4AQIA 3BFAA 2KGBC 2KAXA 1MHOA 1NPQA 3TZ1A 2GGZA 2M7LA 1J7RA 1A75B 2PSRA 2JNFA 3D73A 3PN7C 2AUCA 2WCKA 4N1GA 3NSOA 1IGVA 2JU0A 3EK8A 3WXAA 3ZNIA 4D1EA 1QX5B 4DS7A 1CFPA 2MLFC 2MRDA 1XFXO 1B8RA 1B7TZ 1XFVO 3R1OA 2MJWB 1OQPA 1WLZA 1UUSA 3BUOB 5BPJA 1BLQA 3LL8B 1QV0A 3DF0B 1PSBA 2RGIA 4MN0A 3VB1A 1YRTB 1OOHA 3O4YA 2KDHA 2GGMA 5DKRA 1C3ZA 1YRUB 3V2LA 1OOGA 1NSHA 2HF5A 1KFXL 2QEHA 1M31A 3CR5X 1S6JA 2JTTA 2P70A 1B1GA 1L2OC 3I5GC 3D0YA 2BNXA 2H61A 3GK4X 4MRYA 1B8CA 2OPOA 3TS5B 2M3WA 1FI5A 1ORGA 1ALVA 1TNWA 1DJXA 3S0EA 5AFPA 2KFGA 1F4QA 1KFXS 3DVJA 3NSIA 4PHNA 2YGUA 5HYDA 1FF1A 1TRFA 3LK1A 1RK9A 1WDCB 3O4XA 1UHIA 4YGEB 1LS8A 4C0LA 1K90D 2TN4A 2KI4C 2AAOA 3NSKA 4XYNA 3SG4A 1AVSA 1MQ1A 1OMVA 2L5XB 2HQ8A 3JVTC 1SL7A 1SR6C 4OR9B 1QLSA 1XK4A 1J7PA 1KWOC 2M1UA 3I5HC 1M45A 1FI6A 1T14A 4PHKA 1SNLA 1BOCA 3NGVA 4JPZB 1A03A 1V1GA 3DXLA 3BUMB 1CMFA 1CKKA 2WC5A 1PRWA 3SG7A 3UO9A 2CT9A 1HT9A 2OTGB 1BR1B 2JWWA 2PVBA 1UP5A 3BUNB 2Y1NA 1OSAA 2DOQA 2BKIB 1QLKA 1DT7B 3DYEA 1TOPA 3QMEA 2JPOA 1PSRA 2LC5A 1YX7A 2LCPA 3BYAA 3DY9A 3PFVA 1RTP1 2E6WA 4FQOA 2KHNA 4IL1A 1Y1XA
chains in the Genus database with same CATH topology
2MAZA 1TCFA 3JTDB 2BBMA 1H4BA 2M8UA 3RLZA 3SIAA 1KK8C 2A4JA 2JPTA 1C7WA 1FPWA 4NQGA 1S1EA 1TCOB 1WRKA 2ZRSA 5I2LA 1TNQA 4YI9A 1S5GZ 2WCBA 1C07A 2LVJA 4OVNF 3D0YB 4GGNA 3DVMA 1AP4A 3A8RA 2LLSA 2NXQA 1MUXA 2KBIA 2KAYA 2K0JA 2LM5A 3AAJA 1DVIA 1HQVA 4ICBA 1YVHA 5CSNA 1DJHA 1PULA 3KPXA 3F45A 5ER5A 3O6BA 3OB2B 3VGOA 2BL0B 3AKBA 4I5KA 4R1EA 1YUSA 2PALA 3TUYB 1ZACA 4PE0A 1UHJA 3DF0A 4DCKA 1SY9A 2KI6D 1QX7A 2QACA 2M29A 2KNEA 1CTRA 1WRLA 3WNXB 4UPGA 4WQ3A 1IQ5A 2SCPA 2D8NA 2EC6B 4GGFC 1W7IB 5AERA 1DTLA 1K9KA 1KQMC 3SG2A 2COLB 1UHHA 4PHJA 4YGDB 1NX2A 4QJ5B 1M63B 1ZFSA 2M9GA 1RJVA 2ZFDA 1CDPA 2K7CA 2OS8B 5DKQA 1OE9B 1ZOTB 1SCMC 1CFFA 2KAVA 1JC2A 3TDIA 1DF0B 1JF0A 4QJ3B 2LHLA 3SG6A 1RECA 1M39A 1LKJA 1AHRA 1XFUO 1QIVA 2M97A 1UHKA 5I8NA 2F8PA 1KQVA 4A4CA 1K95A 1TNXA 1AJ4A 3I5FC 2BECA 2JC2A 5PALA 2FCDA 1CM1A 5HKWA 2LV7A 1QVIY 4ORBB 3CS1A 1NCZA 2CNPA 2JT0A 1BT6A 4C0KA 2ZN8A 1J7QA 2JT3A 5HKZA 1PVBA 1S36A 2NLNA 3KO0A 4CLNA 1DGVA 2K61A 2LMVA 4YBHB 1K96A 4QJ4B 2M49B 4BY5A 4MRXA 4PALA 1CFDA 5K89A 1CDMA 3OX6A 4U8DA 1SYMA 3EVRA 5I2QA 2I2RE 2Y1MA 1EJ3A 1S26D 2KFFA 1SBJA 4XJKB 1U5IA 2HQWA 3NSLA 4DIRA 3CGAA 1CDNA 2K7OA 1XA5A 1OMRA 1KSOA 1Y1UA 1EH2A 1V1FA 3BOWB 1E8AA 1Q80A 2KI6C 2CBLA 2ZN9A 1QTXA 3DVEA 3FS7A 4ORCB 4PDZA 4Q04A 1QX2A 1UHNA 1NX1A 2ZNDA 5I2OA 3IQQA 4HRHA 4AQJA 1G4YR 1Y1AA 4GFTA 4CFRA 1F8HA 1B4CA 1JF2A 2F2PA 2MBXA 2LLTA 2B1UA 3I5IB 1MXEA 1MXLC 3WHUB 1CMGA 2K2FA 2Q4UA 5AEQA 1Y6WA 3GK1A 1AUIB 4JWQA 1XFZO 5CSIA 5IBWA 1QIWA 2G2BA 3EKJA 3PN7B 4L9MA 3VRRA 2H61C 2QPTA 4MEWA 1B7TY 1ZMZA 4HSZA 1LINA 2G9BA 2LE9B 1XVJA 4GAOA 2ZRTA 5AANA 1PK0D 1QATA 1BF5A 1BU3A 3C1VA 3CLNA 3CWGA 4A4BA 3DD4A 2H2KA 3VRQA 1H8BA 4NDBA 2LMTA 2PASA 1ALWA 1DF0A 3LCPC 1DJZA 5JJGA 1WLMA 1UWOA 1IH0A 3PALA 2MHHA 2K7DA 1F4OA 4PE1A 1EL4A 1U5IB 1KK7Z 5HLOA 2BE4A 1LA0A 3DVKA 1BJFA 1SW8A 4P2YB 1L2OB 3VRNA 3AAKA 3I5GB 3IF7A 2L50A 3AKAA 2IS9A 1D1OA 3GOFA 4ZCUA 2WCEA 2JTZA 1K9PA 1G33A 1CLMA 2L2EA 4JQ0D 2R2IA 1SCVA 2K8MB 3VROA 1F71A 1PALA 2F3ZA 2JXLA 2KI4B 5D69A 1X02A 3SIBA 4CIDA 3JVTB 1NX0A 4MLWA 1SL8A 1SR6B 2NZ0A 1Y0VH 3CR4X 2VRGA 1KWOB 4OCIA 3I5HB 4PE7A 1RFJA 1KSMA 2JNXA 2Y5IA 4GGFA 4XJKA 3CZTX 1XFYO 5GQQC 1L7ZA 1N2DA 5F6TA 2FOTA 3PLFB 1K93D 2WOSA 4GNKB 4YI8A 4I5JA 4DRWA 2LUCA 2WCFA 3A4UB 1SL9A 3BOWA 4N1FA 1MF8B 1NIWA 4HREE 1ODBA 2BE6A 4PCWA 2KFHA 1YURA 4GBAA 1NYAA 1S5GY 1KK8B 1LXFC 3BUXB 2I94A 5CSFA 4I5NB 3PATA 2JZIA 1DJWA 1GGZA 4MBEA 1K8UA 1B9AA 1SKTA 4ZCVA 1R6PA 1WRZA 4YGBB 3NXAA 5CSJA 1IG5A 1CM4A 2BCBA 3TS5C 4C0JA 1AK8A 3OP0A 3WHTB 2PMYA 4M2PA 2FJUB 2O60A 3EKHA 1CNPA 4NDDA 4YRUA 1F70A 4E68A 4WRIA 2MLEC 3ZWHA 2WC8A 3GK2A 1WDCC 4FTGA 1VRKA 1GJYA 3K21A 4MZLA 5KU1A 1K2HA 1J55A 2LVIA 2NCOA 1UURA 1CLBA 1DJYA 4MZJA 1YR5A 3EVUA 1KQMB 2ZNEA 1FW4A 1KCYA 2L0PA 4N5XA 1SK6D 2JOJA 1XFWO 3OB1B 2BKHB 2LP3A 3D10A 3FIAA 1EG4A 1FBVA 2OTGC 2WORA 1GQMA 3O78A 1MWNA 5JOLA 2KQ6A 1SCMB 1GGWA 2K2AA 3KHEA 2O5GA 4OV2A 3H4SE 1JWDA 3KEVA 2ISDA 5ER4X 1BMOA 1W7JB 1JUOA 3RM1A 1NUBA 1IQ3A 2GV5A 3PSRA 4DUQA 1IKUA 4MSPA 1N0YA 1NCXA 1QASA 1A4PA 4GPLB 2L4HA 3JTDC 5HKYA 1YX8A 2F3YA 3FWCA 1CB1A 5CPVA 3KF9A 3VRPA 3I5FB 2BCAA 2JQ6A 2AMIA 1NP8A 1CFCA 1K94A 1EXRA 2LAPA 1J1DA 3BQ3A 4USLA 1TTXA 2WNDA 1SPYA 2I7AA 1S6CA 4I5LB 4ETOA 1BODA 1F55A 1XYDA 1B8LA 2EHBA 2ZKMX 1MR8A 4CPVA 2I18A 3HX4A 1KFUL 1IWQA 1C7VA 1R2UA 1BR4B 1RROA 1A2XA 2EGDA 2BL0C 4WQ2A 1PVAA 1YTZC 3EK7A 2JXCA 3TUYC 2CTNA 2F2OA 3HCMA 4HRGA 1DJIA 1K9UA 3QRXA 3BUWB 1XK4C 1DGUA 1KFUS 2JULA 2LMUA 2KBMA 1OOJA 4P5OE 3O2PA 4YGCB 2EC6C 2LNKA 3LK0A 1DJGA 3TDZA 5J3XA 1QXPA 3BXKA 2KGRA 2JT8A 1SRAA 3EK4A 2CCMA 4PE4A 1AJ5A 4GUKA 1S3PA 1JFJA 2Q91A 1LVCD 2OS8C 4YGAA 4TNCA 2V53A 2KYFA 2PRUA 5AXIA 1IJ5A 1CDLA 3EVVA 3ICBA 5KTYA 2KYCA 5D7FA 3MSEB 2SASA 4CFQA 1BG1A 5G08A 1A29A 3CTNA 3SJSA 4MVFA 2LUXA 4AOMA 3IQOA 2K7BA 5DKNA 2LVVA 3TDUA 1OZOA 2FCEA 2BCXA 2P6BB 1J7OA 2M0RA 2L51A 4ORAB 4F0ZB 1NWDA 5HLVA 4BY4A 1NCYA 1QJTA 1A75A 1RWYA 3M0WA 2HETA 4M2QA 5KSZA 3OX5A 2CXJA 3CR2A 2F33A 2LHIA 1IRJA 1ZUZA 2L4IA 1OZSA 2M1KB 1JSAA 1YUTA 4NDCA 5FYXA 1QVIZ 2Y4QA 1J1EA 1YVLA 2BBNA 1G8IA 1KK7Y 2LLUA 1XO5A 2KSPA 2LANA 1QV1A 1QS7A 1B47A 2L98A 1F54A 1DMOA 3SG3A 2JRFA 1SMGA 1YUUA 4PHMA 1TIZA 2LVKA 1CLLA 2M7NA 1LA3A 4OKHA 5B8IB 2LP2A 3E3RA 5TNCA 1EG3A 2KQYA 2KOTA 2NCPA 3FWBA 1TNPA 3LLEA 4M2OA 3PM8A 2E30A 1NX3A 1JFKA 1WY9A 1IJ6A 1OMDA 3OHMB 2HPSA 4MZKA 1N65A 1S6IA 1M46A 1JBAA 1TN4A 2MA2A 3I5IC 3SG5A 4AQIA 2KGBC 2KAXA 1MHOA 1NPQA 3TZ1A 2GGZA 2M7LA 1J7RA 1A75B 2PSRA 2JNFA 3PN7C 2AUCA 4N1GA 3NSOA 1IGVA 2JU0A 3EK8A 3WXAA 3ZNIA 4D1EA 1QX5B 4DS7A 1CFPA 2MLFC 2MRDA 1XFXO 1B8RA 1B7TZ 1XFVO 2MJWB 1OQPA 1WLZA 1UUSA 3BUOB 5BPJA 1BLQA 3LL8B 1QV0A 3DF0B 1PSBA 2RGIA 4MN0A 1YRTB 3O4YA 2KDHA 2GGMA 5DKRA 1YRUB 1NSHA 2HF5A 1KFXL 1M31A 3CR5X 1S6JA 2JTTA 1B1GA 1L2OC 3I5GC 3D0YA 2H61A 3GK4X 4MRYA 1B8CA 2OPOA 3TS5B 2M3WA 1FI5A 1ALVA 1TNWA 1DJXA 5AFPA 2KFGA 1F4QA 1KFXS 3DVJA 3NSIA 4PHNA 5HYDA 1FF1A 1TRFA 3LK1A 1RK9A 1WDCB 4YGEB 1UHIA 4C0LA 1K90D 2TN4A 2KI4C 2AAOA 3NSKA 4XYNA 3SG4A 1AVSA 1MQ1A 1OMVA 2L5XB 2HQ8A 3JVTC 1SL7A 1SR6C 4OR9B 1QLSA 1XK4A 1J7PA 1KWOC 2M1UA 3I5HC 1M45A 1FI6A 4PHKA 1SNLA 1BOCA 4JPZB 1CMFA 1A03A 1V1GA 1CKKA 3BUMB 1PRWA 3SG7A 2CT9A 1HT9A 2OTGB 1BR1B 2JWWA 2PVBA 1UP5A 3BUNB 2Y1NA 1OSAA 2DOQA 2BKIB 1QLKA 1DT7B 1TOPA 2LC5A 1PSRA 2LCPA 1YX7A 3BYAA 3PFVA 1RTP1 2E6WA 4FQOA 2KHNA 4IL1A 1Y1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MAZ A;  1TCF A;  3JTD B;  2BBM A;  1H4B A;  2M8U A;  3RLZ A;  3SIA A;  1KK8 C;  2A4J A;  2JPT A;  1C7W A;  1FPW A;  4NQG A;  1S1E A;  1TCO B;  1WRK A;  2ZRS A;  5I2L A;  1TNQ A;  4YI9 A;  1S5G Z;  2WCB A;  1C07 A;  2LVJ A;  4OVN F;  3D0Y B;  4GGN A;  3DVM A;  1AP4 A;  3A8R A;  2LLS A;  2NXQ A;  1MUX A;  2KBI A;  2KAY A;  2K0J A;  2LM5 A;  3AAJ A;  1DVI A;  1HQV A;  4ICB A;  1YVH A;  5CSN A;  1DJH A;  1PUL A;  3KPX A;  3F45 A;  5ER5 A;  3O6B A;  3OB2 B;  3VGO A;  2BL0 B;  3AKB A;  4I5K A;  4R1E A;  1YUS A;  2PAL A;  3TUY B;  1ZAC A;  4PE0 A;  1UHJ A;  3DF0 A;  4DCK A;  1SY9 A;  2KI6 D;  1QX7 A;  2QAC A;  2M29 A;  2KNE A;  1CTR A;  1WRL A;  3WNX B;  4UPG A;  4WQ3 A;  1IQ5 A;  2SCP A;  2D8N A;  2EC6 B;  4GGF C;  1W7I B;  5AER A;  1DTL A;  1K9K A;  1KQM C;  3SG2 A;  2COL B;  1UHH A;  4PHJ A;  4YGD B;  1NX2 A;  4QJ5 B;  1M63 B;  1ZFS A;  2M9G A;  1RJV A;  2ZFD A;  1CDP A;  2K7C A;  2OS8 B;  5DKQ A;  1OE9 B;  1ZOT B;  1SCM C;  1CFF A;  2KAV A;  1JC2 A;  3TDI A;  1DF0 B;  1JF0 A;  4QJ3 B;  2LHL A;  3SG6 A;  1REC A;  1M39 A;  1LKJ A;  1AHR A;  1XFU O;  1QIV A;  2M97 A;  1UHK A;  5I8N A;  2F8P A;  1KQV A;  4A4C A;  1K95 A;  1TNX A;  1AJ4 A;  3I5F C;  2BEC A;  2JC2 A;  5PAL A;  2FCD A;  1CM1 A;  5HKW A;  2LV7 A;  1QVI Y;  4ORB B;  3CS1 A;  1NCZ A;  2CNP A;  2JT0 A;  1BT6 A;  4C0K A;  2ZN8 A;  1J7Q A;  2JT3 A;  5HKZ A;  1PVB A;  1S36 A;  2NLN A;  3KO0 A;  4CLN A;  1DGV A;  2K61 A;  2LMV A;  4YBH B;  1K96 A;  4QJ4 B;  2M49 B;  4BY5 A;  4MRX A;  4PAL A;  1CFD A;  5K89 A;  1CDM A;  3OX6 A;  4U8D A;  1SYM A;  3EVR A;  5I2Q A;  2I2R E;  2Y1M A;  1EJ3 A;  1S26 D;  2KFF A;  1SBJ A;  4XJK B;  1U5I A;  2HQW A;  3NSL A;  4DIR A;  3CGA A;  1CDN A;  2K7O A;  1XA5 A;  1OMR A;  1KSO A;  1Y1U A;  1EH2 A;  1V1F A;  3BOW B;  1E8A A;  1Q80 A;  2KI6 C;  2CBL A;  2ZN9 A;  1QTX A;  3DVE A;  3FS7 A;  4ORC B;  4PDZ A;  4Q04 A;  1QX2 A;  1UHN A;  1NX1 A;  2ZND A;  5I2O A;  3IQQ A;  4HRH A;  4AQJ A;  1G4Y R;  1Y1A A;  4GFT A;  4CFR A;  1F8H A;  1B4C A;  1JF2 A;  2F2P A;  2MBX A;  2LLT A;  2B1U A;  3I5I B;  1MXE A;  1MXL C;  3WHU B;  1CMG A;  2K2F A;  2Q4U A;  5AEQ A;  1Y6W A;  3GK1 A;  1AUI B;  4JWQ A;  1XFZ O;  5CSI A;  5IBW A;  1QIW A;  2G2B A;  3EKJ A;  3PN7 B;  4L9M A;  3VRR A;  2H61 C;  2QPT A;  4MEW A;  1B7T Y;  1ZMZ A;  4HSZ A;  1LIN A;  2G9B A;  2LE9 B;  1XVJ A;  4GAO A;  2ZRT A;  5AAN A;  1PK0 D;  1QAT A;  1BF5 A;  1BU3 A;  3C1V A;  3CLN A;  3CWG A;  4A4B A;  3DD4 A;  2H2K A;  3VRQ A;  1H8B A;  4NDB A;  2LMT A;  2PAS A;  1ALW A;  1DF0 A;  3LCP C;  1DJZ A;  5JJG A;  1WLM A;  1UWO A;  1IH0 A;  3PAL A;  2MHH A;  2K7D A;  1F4O A;  4PE1 A;  1EL4 A;  1U5I B;  1KK7 Z;  5HLO A;  2BE4 A;  1LA0 A;  3DVK A;  1BJF A;  1SW8 A;  4P2Y B;  1L2O B;  3VRN A;  3AAK A;  3I5G B;  3IF7 A;  2L50 A;  3AKA A;  2IS9 A;  1D1O A;  3GOF A;  4ZCU A;  2WCE A;  2JTZ A;  1K9P A;  1G33 A;  1CLM A;  2L2E A;  4JQ0 D;  2R2I A;  1SCV A;  2K8M B;  3VRO A;  1F71 A;  1PAL A;  2F3Z A;  2JXL A;  2KI4 B;  5D69 A;  1X02 A;  3SIB A;  4CID A;  3JVT B;  1NX0 A;  4MLW A;  1SL8 A;  1SR6 B;  2NZ0 A;  1Y0V H;  3CR4 X;  2VRG A;  1KWO B;  4OCI A;  3I5H B;  4PE7 A;  1RFJ A;  1KSM A;  2JNX A;  2Y5I A;  4GGF A;  4XJK A;  3CZT X;  1XFY O;  5GQQ C;  1L7Z A;  1N2D A;  5F6T A;  2FOT A;  3PLF B;  1K93 D;  2WOS A;  4GNK B;  4YI8 A;  4I5J A;  4DRW A;  2LUC A;  2WCF A;  3A4U B;  1SL9 A;  3BOW A;  4N1F A;  1MF8 B;  1NIW A;  4HRE E;  1ODB A;  2BE6 A;  4PCW A;  2KFH A;  1YUR A;  4GBA A;  1NYA A;  1S5G Y;  1KK8 B;  1LXF C;  3BUX B;  2I94 A;  5CSF A;  4I5N B;  3PAT A;  2JZI A;  1DJW A;  1GGZ A;  4MBE A;  1K8U A;  1B9A A;  1SKT A;  4ZCV A;  1R6P A;  1WRZ A;  4YGB B;  3NXA A;  5CSJ A;  1IG5 A;  1CM4 A;  2BCB A;  3TS5 C;  4C0J A;  1AK8 A;  3OP0 A;  3WHT B;  2PMY A;  4M2P A;  2FJU B;  2O60 A;  3EKH A;  1CNP A;  4NDD A;  4YRU A;  1F70 A;  4E68 A;  4WRI A;  2MLE C;  3ZWH A;  2WC8 A;  3GK2 A;  1WDC C;  4FTG A;  1VRK A;  1GJY A;  3K21 A;  4MZL A;  5KU1 A;  1K2H A;  1J55 A;  2LVI A;  2NCO A;  1UUR A;  1CLB A;  1DJY A;  4MZJ A;  1YR5 A;  3EVU A;  1KQM B;  2ZNE A;  1FW4 A;  1KCY A;  2L0P A;  4N5X A;  1SK6 D;  2JOJ A;  1XFW O;  3OB1 B;  2BKH B;  2LP3 A;  3D10 A;  3FIA A;  1EG4 A;  1FBV A;  2OTG C;  2WOR A;  1GQM A;  3O78 A;  1MWN A;  5JOL A;  2KQ6 A;  1SCM B;  1GGW A;  2K2A A;  3KHE A;  2O5G A;  4OV2 A;  3H4S E;  1JWD A;  3KEV A;  2ISD A;  5ER4 X;  1BMO A;  1W7J B;  1JUO A;  3RM1 A;  1NUB A;  1IQ3 A;  2GV5 A;  3PSR A;  4DUQ A;  1IKU A;  4MSP A;  1N0Y A;  1NCX A;  1QAS A;  1A4P A;  4GPL B;  2L4H A;  3JTD C;  5HKY A;  1YX8 A;  2F3Y A;  3FWC A;  1CB1 A;  5CPV A;  3KF9 A;  3VRP A;  3I5F B;  2BCA A;  2JQ6 A;  2AMI A;  1NP8 A;  1CFC A;  1K94 A;  1EXR A;  2LAP A;  1J1D A;  3BQ3 A;  4USL A;  1TTX A;  2WND A;  1SPY A;  2I7A A;  1S6C A;  4I5L B;  4ETO A;  1BOD A;  1F55 A;  1XYD A;  1B8L A;  2EHB A;  2ZKM X;  1MR8 A;  4CPV A;  2I18 A;  3HX4 A;  1KFU L;  1IWQ A;  1C7V A;  1R2U A;  1BR4 B;  1RRO A;  1A2X A;  2EGD A;  2BL0 C;  4WQ2 A;  1PVA A;  1YTZ C;  3EK7 A;  2JXC A;  3TUY C;  2CTN A;  2F2O A;  3HCM A;  4HRG A;  1DJI A;  1K9U A;  3QRX A;  3BUW B;  1XK4 C;  1DGU A;  1KFU S;  2JUL A;  2LMU A;  2KBM A;  1OOJ A;  4P5O E;  3O2P A;  4YGC B;  2EC6 C;  2LNK A;  3LK0 A;  1DJG A;  3TDZ A;  5J3X A;  1QXP A;  3BXK A;  2KGR A;  2JT8 A;  1SRA A;  3EK4 A;  2CCM A;  4PE4 A;  1AJ5 A;  4GUK A;  1S3P A;  1JFJ A;  2Q91 A;  1LVC D;  2OS8 C;  4YGA A;  4TNC A;  2V53 A;  2KYF A;  2PRU A;  5AXI A;  1IJ5 A;  1CDL A;  3EVV A;  3ICB A;  5KTY A;  2KYC A;  5D7F A;  3MSE B;  2SAS A;  4CFQ A;  1BG1 A;  5G08 A;  1A29 A;  3CTN A;  3SJS A;  4MVF A;  2LUX A;  4AOM A;  3IQO A;  2K7B A;  5DKN A;  2LVV A;  3TDU A;  1OZO A;  2FCE A;  2BCX A;  2P6B B;  1J7O A;  2M0R A;  2L51 A;  4ORA B;  4F0Z B;  1NWD A;  5HLV A;  4BY4 A;  1NCY A;  1QJT A;  1A75 A;  1RWY A;  3M0W A;  2HET A;  4M2Q A;  5KSZ A;  3OX5 A;  2CXJ A;  3CR2 A;  2F33 A;  2LHI A;  1IRJ A;  1ZUZ A;  2L4I A;  1OZS A;  2M1K B;  1JSA A;  1YUT A;  4NDC A;  5FYX A;  1QVI Z;  2Y4Q A;  1J1E A;  1YVL A;  2BBN A;  1G8I A;  1KK7 Y;  2LLU A;  1XO5 A;  2KSP A;  2LAN A;  1QV1 A;  1QS7 A;  1B47 A;  2L98 A;  1F54 A;  1DMO A;  3SG3 A;  2JRF A;  1SMG A;  1YUU A;  4PHM A;  1TIZ A;  2LVK A;  1CLL A;  2M7N A;  1LA3 A;  4OKH A;  5B8I B;  2LP2 A;  3E3R A;  5TNC A;  1EG3 A;  2KQY A;  2KOT A;  2NCP A;  3FWB A;  1TNP A;  3LLE A;  4M2O A;  3PM8 A;  2E30 A;  1NX3 A;  1JFK A;  1WY9 A;  1IJ6 A;  1OMD A;  3OHM B;  2HPS A;  4MZK A;  1N65 A;  1S6I A;  1M46 A;  1JBA A;  1TN4 A;  2MA2 A;  3I5I C;  3SG5 A;  4AQI A;  2KGB C;  2KAX A;  1MHO A;  1NPQ A;  3TZ1 A;  2GGZ A;  2M7L A;  1J7R A;  1A75 B;  2PSR A;  2JNF A;  3PN7 C;  2AUC A;  4N1G A;  3NSO A;  1IGV A;  2JU0 A;  3EK8 A;  3WXA A;  3ZNI A;  4D1E A;  1QX5 B;  4DS7 A;  1CFP A;  2MLF C;  2MRD A;  1XFX O;  1B8R A;  1B7T Z;  1XFV O;  2MJW B;  1OQP A;  1WLZ A;  1UUS A;  3BUO B;  5BPJ A;  1BLQ A;  3LL8 B;  1QV0 A;  3DF0 B;  1PSB A;  2RGI A;  4MN0 A;  1YRT B;  3O4Y A;  2KDH A;  2GGM A;  5DKR A;  1YRU B;  1NSH A;  2HF5 A;  1KFX L;  1M31 A;  3CR5 X;  1S6J A;  2JTT A;  1B1G A;  1L2O C;  3I5G C;  3D0Y A;  2H61 A;  3GK4 X;  4MRY A;  1B8C A;  2OPO A;  3TS5 B;  2M3W A;  1FI5 A;  1ALV A;  1TNW A;  1DJX A;  5AFP A;  2KFG A;  1F4Q A;  1KFX S;  3DVJ A;  3NSI A;  4PHN A;  5HYD A;  1FF1 A;  1TRF A;  3LK1 A;  1RK9 A;  1WDC B;  4YGE B;  1UHI A;  4C0L A;  1K90 D;  2TN4 A;  2KI4 C;  2AAO A;  3NSK A;  4XYN A;  3SG4 A;  1AVS A;  1MQ1 A;  1OMV A;  2L5X B;  2HQ8 A;  3JVT C;  1SL7 A;  1SR6 C;  4OR9 B;  1QLS A;  1XK4 A;  1J7P A;  1KWO C;  2M1U A;  3I5H C;  1M45 A;  1FI6 A;  4PHK A;  1SNL A;  1BOC A;  4JPZ B;  1CMF A;  1A03 A;  1V1G A;  1CKK A;  3BUM B;  1PRW A;  3SG7 A;  2CT9 A;  1HT9 A;  2OTG B;  1BR1 B;  2JWW A;  2PVB A;  1UP5 A;  3BUN B;  2Y1N A;  1OSA A;  2DOQ A;  2BKI B;  1QLK A;  1DT7 B;  1TOP A;  2LC5 A;  1PSR A;  2LCP A;  1YX7 A;  3BYA A;  3PFV A;  1RTP 1;  2E6W A;  4FQO A;  2KHN A;  4IL1 A;  1Y1X A; 
#chains in the Genus database with same CATH topology
 2MAZ A;  1TCF A;  3JTD B;  2BBM A;  1H4B A;  2M8U A;  3RLZ A;  3D78 A;  4INX A;  3SIA A;  1KK8 C;  2A4J A;  2JPT A;  1C7W A;  5D3O A;  1FPW A;  4NQG A;  1S1E A;  1TCO B;  1WRK A;  2ZRS A;  3D74 A;  5I2L A;  1TNQ A;  4YI9 A;  3CAB A;  1S5G Z;  2WCB A;  1C07 A;  2LVJ A;  4OVN F;  2WCL A;  3D0Y B;  3DVM A;  4GGN A;  4INW A;  3A8R A;  1AP4 A;  2LLS A;  2NXQ A;  3BFH A;  2BAP A;  1MUX A;  2KBI A;  2KAY A;  2K0J A;  2LM5 A;  3AAJ A;  1DVI A;  1HQV A;  4ICB A;  1YVH A;  5CSN A;  1DJH A;  1PUL A;  3KPX A;  3F45 A;  5ER5 A;  3O6B A;  3OB2 B;  3VGO A;  2BL0 B;  3AKB A;  3L4L A;  4I5K A;  1YUS A;  2PAL A;  1DEK A;  4R1E A;  2ERB A;  1ZAC A;  4PE0 A;  3TUY B;  1UHJ A;  3DF0 A;  4DCK A;  3B86 A;  1SY9 A;  2KI6 D;  1QX7 A;  2QAC A;  3R72 A;  2M29 A;  2KNE A;  1CTR A;  1WRL A;  3WNX B;  4UPG A;  4WQ3 A;  1IQ5 A;  2SCP A;  2D8N A;  2EC6 B;  4GGF C;  1W7I B;  5AER A;  1DTL A;  1K9K A;  1KQM C;  3SG2 A;  2COL B;  1UHH A;  4PHJ A;  4YGD B;  1NX2 A;  4QJ5 B;  1M63 B;  1ZFS A;  5EL2 A;  3BFB A;  2M9G A;  1RJV A;  2ZFD A;  1CDP A;  2K7C A;  2OS8 B;  5DKQ A;  5FI6 A;  1OE9 B;  1ZOT B;  1SCM C;  1CFF A;  2KAV A;  1JC2 A;  3TDI A;  1DF0 B;  1JF0 A;  4QJ3 B;  2LHL A;  3SG6 A;  1REC A;  1M39 A;  4OZD A;  1LKJ A;  1AHR A;  1XFU O;  1QIV A;  2M97 A;  1UHK A;  5I8N A;  2F8P A;  4IJ7 A;  1KQV A;  4A4C A;  1K95 A;  1TNX A;  1AJ4 A;  1DQE A;  3I5F C;  2BEC A;  2JC2 A;  5PAL A;  2FCD A;  1CM1 A;  5HKW A;  3CYZ A;  2LV7 A;  1OOI X;  1QVI Y;  4ORB B;  3PJI A;  3CS1 A;  1NCZ A;  2CNP A;  2JT0 A;  1BT6 A;  4C0K A;  2ZN8 A;  1J7Q A;  2JT3 A;  5HKZ A;  1PVB A;  1S36 A;  3K1E A;  2NLN A;  3KO0 A;  3OBV A;  4CLN A;  1DGV A;  2K61 A;  2LMV A;  4YBH B;  1K96 A;  4QJ4 B;  2M49 B;  4BY5 A;  4MRX A;  4PAL A;  1CFD A;  5K89 A;  1CDM A;  3OX6 A;  4U8D A;  3RZS A;  1SYM A;  3EVR A;  5I2Q A;  2I2R E;  2Y1M A;  1EJ3 A;  3S0B A;  1S26 D;  2KFF A;  1SBJ A;  4XJK B;  1U5I A;  2HQW A;  3NSL A;  5FI2 A;  2QDI A;  3L4A A;  4DIR A;  3CGA A;  1CDN A;  2K7O A;  1XA5 A;  1OMR A;  1KSO A;  1Y1U A;  1EH2 A;  1V1F A;  2WCM A;  3BOW B;  1E8A A;  1Q80 A;  2KI6 C;  2CBL A;  2ZN9 A;  1QTX A;  3DVE A;  3FS7 A;  4ORC B;  4PDZ A;  4Q04 A;  1QX2 A;  1UHN A;  1NX1 A;  2ZND A;  5I2O A;  3IQQ A;  4HRH A;  4AQJ A;  1G4Y R;  1Y1A A;  4GFT A;  4CFR A;  3FE9 A;  1F8H A;  1B4C A;  1JF2 A;  2F2P A;  2MBX A;  2LLT A;  2B1U A;  3I5I B;  1IIO A;  1MXE A;  1MXL C;  2L2C A;  3WHU B;  1CMG A;  2PYQ A;  2K2F A;  2Q4U A;  5AEQ A;  1Y6W A;  3GK1 A;  1AUI B;  4JWQ A;  1XFZ O;  5CSI A;  5IBW A;  1QIW A;  2G2B A;  3EKJ A;  5DIC A;  3PN7 B;  4L9M A;  3VRR A;  2H61 C;  2QPT A;  4MEW A;  1B7T Y;  1ZMZ A;  4HSZ A;  1LIN A;  2G9B A;  2LE9 B;  1XVJ A;  2WCH A;  2ZRT A;  4GAO A;  5AAN A;  1PK0 D;  1QAT A;  1BF5 A;  1BU3 A;  3C1V A;  3CLN A;  3CWG A;  4A4B A;  3DD4 A;  2H2K A;  3VRQ A;  1H8B A;  4NDB A;  2LMT A;  2PAS A;  1ALW A;  1DF0 A;  3LCP C;  1DJZ A;  5JJG A;  1WLM A;  1UWO A;  1IH0 A;  3PAL A;  2MHH A;  2K7D A;  1F4O A;  4PE1 A;  1EL4 A;  1U5I B;  1KK7 Z;  5HLO A;  2BE4 A;  1LA0 A;  3DVK A;  1BJF A;  1SW8 A;  4P2Y B;  1L2O B;  3VRN A;  3AAK A;  3I5G B;  3IF7 A;  3S0D A;  2L50 A;  3AKA A;  3D75 A;  2IS9 A;  1D1O A;  3GOF A;  4ZCU A;  3SS5 A;  3B7A A;  2WCE A;  2JTZ A;  1K9P A;  1G33 A;  2QEV A;  1CLM A;  2L2E A;  3S0G A;  4JQ0 D;  2R2I A;  1SCV A;  2K8M B;  3VRO A;  1F71 A;  1PAL A;  2F3Z A;  3FE8 A;  1XFR A;  2JXL A;  2KI4 B;  5D69 A;  1X02 A;  3SIB A;  4CID A;  3JVT B;  1NX0 A;  4MLW A;  1SL8 A;  1SR6 B;  2NZ0 A;  1Y0V H;  3CR4 X;  3BJH A;  2VRG A;  1KWO B;  4OCI A;  2KPH A;  3I5H B;  4PE7 A;  1P28 A;  1RFJ A;  1KSM A;  2JNX A;  2Y5I A;  4GGF A;  4XJK A;  3CZT X;  1XFY O;  5GQQ C;  1L7Z A;  1N2D A;  5F6T A;  2FOT A;  3PLF B;  1K93 D;  2WOS A;  4GNK B;  4YI8 A;  4I5J A;  4DRW A;  2LUC A;  2WCF A;  1C3Y A;  3A4U B;  1SL9 A;  1SSE B;  3BOW A;  2WC6 A;  4N1F A;  1MF8 B;  1NIW A;  3IVT A;  4HRE E;  1ODB A;  2BE6 A;  4PCW A;  2KFH A;  3CZ0 A;  1YUR A;  4GBA A;  1NYA A;  1OOF A;  1S5G Y;  1KK8 B;  1LXF C;  1QWV A;  3L47 A;  3BUX B;  2I94 A;  5CSF A;  1TUJ A;  4I5N B;  3OGN A;  3PAT A;  2JZI A;  1DJW A;  1GGZ A;  4MBE A;  1K8U A;  3B6X A;  1B9A A;  1SKT A;  4ZCV A;  2K60 A;  1R6P A;  4JKT A;  1WRZ A;  4YGB B;  3NXA A;  5I94 A;  5CSJ A;  1IG5 A;  1CM4 A;  2BCB A;  3TS5 C;  4C0J A;  1AK8 A;  3OP0 A;  3WHT B;  2PMY A;  4M2P A;  2FJU B;  2O60 A;  3EKH A;  1CNP A;  3R1V A;  4NDD A;  4YRU A;  1F70 A;  4E68 A;  3N7H A;  2MLE C;  4WRI A;  3ZWH A;  3NHT A;  2WC8 A;  3GK2 A;  1WDC C;  5FI7 A;  4FTG A;  1VRK A;  1GJY A;  3K21 A;  4MZL A;  5KU1 A;  1K2H A;  1J55 A;  3DZT A;  2LVI A;  2NCO A;  1UUR A;  1CLB A;  1DJY A;  4MZJ A;  1YR5 A;  3EVU A;  1KQM B;  2ZNE A;  1FW4 A;  1KCY A;  2L0P A;  4N5X A;  3NHI A;  1SK6 D;  2JOJ A;  1XFW O;  3OB1 B;  2BKH B;  2LP3 A;  3D10 A;  3FIA A;  1DEL A;  1EG4 A;  1FBV A;  2OTG C;  2WOR A;  1GQM A;  3O78 A;  1MWN A;  5JOL A;  2KQ6 A;  1SCM B;  2QEB A;  3UNW A;  1GGW A;  2K2A A;  3KHE A;  2O5G A;  4OV2 A;  3H4S E;  1JWD A;  3KEV A;  2ISD A;  5ER4 X;  1BMO A;  1W7J B;  2PQL A;  1JUO A;  3CZ1 A;  3RM1 A;  1NUB A;  2P71 A;  1IQ3 A;  2GV5 A;  3PSR A;  4DUQ A;  1IKU A;  4MSP A;  1N0Y A;  1NCX A;  1QAS A;  3B87 A;  1A4P A;  4GPL B;  2L4H A;  4PT1 A;  3JTD C;  5HKY A;  1YX8 A;  2F3Y A;  3FE6 A;  3FWC A;  1CB1 A;  5CPV A;  3KF9 A;  3VRP A;  3I5F B;  2BCA A;  2JQ6 A;  2AMI A;  1NP8 A;  3CZ2 A;  1CFC A;  1K94 A;  1EXR A;  2H8V A;  1J1D A;  2LAP A;  3BQ3 A;  1TTX A;  2WND A;  1SPY A;  2I7A A;  1S6C A;  3CDN A;  4I5L B;  4USL A;  4ETO A;  1BOD A;  1XYD A;  1B8L A;  2EHB A;  2ZKM X;  1MR8 A;  4CPV A;  2I18 A;  3HX4 A;  1F55 A;  1KFU L;  1IWQ A;  1C7V A;  1R2U A;  1BR4 B;  3PM2 A;  1RRO A;  5HL1 A;  1W9Z A;  2FJY A;  1A2X A;  2EGD A;  2BL0 C;  4WQ2 A;  1PVA A;  1YTZ C;  3EK7 A;  2JXC A;  3TUY C;  2CTN A;  2F2O A;  3HCM A;  4HRG A;  1DJI A;  1K9U A;  3QRX A;  2KLE A;  3BUW B;  1XK4 C;  4JD9 A;  1DGU A;  1KFU S;  2JUL A;  2LMU A;  2KBM A;  1OOJ A;  4P5O E;  3O2P A;  4YGC B;  2EC6 C;  2LNK A;  3EG5 B;  1DJG A;  3LK0 A;  3TDZ A;  5J3X A;  3Q8I A;  1QXP A;  3BXK A;  2KGR A;  2L5Y A;  2JT8 A;  1SRA A;  3EK4 A;  2CCM A;  4PE4 A;  1AJ5 A;  4GUK A;  1S3P A;  1JFJ A;  2Q91 A;  1LVC D;  2OS8 C;  1OW4 A;  4TNC A;  4YGA A;  2V53 A;  2KYF A;  2PRU A;  5AXI A;  1IJ5 A;  1CDL A;  3EVV A;  3ICB A;  5KTY A;  2KYC A;  3D76 A;  5D7F A;  3MSE B;  1TWO A;  2SAS A;  4CFQ A;  5G08 A;  1BG1 A;  1A29 A;  3CTN A;  3SJS A;  4MVF A;  2LUX A;  2GTE A;  4AOM A;  3IQO A;  2K7B A;  5DKN A;  2LVV A;  3TDU A;  1OZO A;  2FCE A;  2BCX A;  2P6B B;  2QEO A;  4F7F A;  1J7O A;  2M0R A;  2WCJ A;  1Z2C B;  1Z4H A;  2L51 A;  4ORA B;  4F0Z B;  3S0F A;  1NWD A;  5HLV A;  4BY4 A;  1NCY A;  1QJT A;  1A75 A;  1RWY A;  3M0W A;  2HET A;  4M2Q A;  5KSZ A;  3OX5 A;  2CXJ A;  3CR2 A;  2F33 A;  2LHI A;  1IRJ A;  1ZUZ A;  2L4I A;  3SS3 A;  1OZS A;  2M1K B;  1JSA A;  1YUT A;  3D77 A;  4NDC A;  5FYX A;  1QVI Z;  2Y4Q A;  1J1E A;  1YVL A;  2BBN A;  1G8I A;  3R1P A;  1KK7 Y;  2LLU A;  1XO5 A;  2KSP A;  2LAN A;  1QV1 A;  3S0A A;  1QS7 A;  1B47 A;  2L98 A;  1F54 A;  1DMO A;  3SG3 A;  2JRF A;  1SMG A;  1YUU A;  4PHM A;  1TIZ A;  2LVK A;  1DC1 A;  3B88 A;  1CLL A;  2M7N A;  1LA3 A;  4OKH A;  5B8I B;  2LP2 A;  3E3R A;  5TNC A;  1EG3 A;  2KQY A;  2KOT A;  2NCP A;  3FWB A;  1TNP A;  3LLE A;  4M2O A;  1GM0 A;  3PM8 A;  2E30 A;  1TUZ A;  1NX3 A;  1JFK A;  4FQT A;  1WY9 A;  1IJ6 A;  1OMD A;  3OHM B;  2HPS A;  4MZK A;  1N65 A;  1S6I A;  2KLD A;  3SS4 A;  1M46 A;  1JBA A;  1TN4 A;  2MA2 A;  3I5I C;  4KYN A;  3SG5 A;  4AQI A;  3BFA A;  2KGB C;  2KAX A;  1MHO A;  1NPQ A;  3TZ1 A;  2GGZ A;  2M7L A;  1J7R A;  1A75 B;  2PSR A;  2JNF A;  3D73 A;  3PN7 C;  2AUC A;  2WCK A;  4N1G A;  3NSO A;  1IGV A;  2JU0 A;  3EK8 A;  3WXA A;  3ZNI A;  4D1E A;  1QX5 B;  4DS7 A;  1CFP A;  2MLF C;  2MRD A;  1XFX O;  1B8R A;  1B7T Z;  1XFV O;  3R1O A;  2MJW B;  1OQP A;  1WLZ A;  1UUS A;  3BUO B;  5BPJ A;  1BLQ A;  3LL8 B;  1QV0 A;  3DF0 B;  1PSB A;  2RGI A;  4MN0 A;  3VB1 A;  1YRT B;  1OOH A;  3O4Y A;  2KDH A;  2GGM A;  5DKR A;  1C3Z A;  1YRU B;  3V2L A;  1OOG A;  1NSH A;  2HF5 A;  1KFX L;  2QEH A;  1M31 A;  3CR5 X;  1S6J A;  2JTT A;  2P70 A;  1B1G A;  1L2O C;  3I5G C;  3D0Y A;  2BNX A;  2H61 A;  3GK4 X;  4MRY A;  1B8C A;  2OPO A;  3TS5 B;  2M3W A;  1FI5 A;  1ORG A;  1ALV A;  1TNW A;  1DJX A;  3S0E A;  5AFP A;  2KFG A;  1F4Q A;  1KFX S;  3DVJ A;  3NSI A;  4PHN A;  2YGU A;  5HYD A;  1FF1 A;  1TRF A;  3LK1 A;  1RK9 A;  1WDC B;  3O4X A;  1UHI A;  4YGE B;  1LS8 A;  4C0L A;  1K90 D;  2TN4 A;  2KI4 C;  2AAO A;  3NSK A;  4XYN A;  3SG4 A;  1AVS A;  1MQ1 A;  1OMV A;  2L5X B;  2HQ8 A;  3JVT C;  1SL7 A;  1SR6 C;  4OR9 B;  1QLS A;  1XK4 A;  1J7P A;  1KWO C;  2M1U A;  3I5H C;  1M45 A;  1FI6 A;  1T14 A;  4PHK A;  1SNL A;  1BOC A;  3NGV A;  4JPZ B;  1A03 A;  1V1G A;  3DXL A;  3BUM B;  1CMF A;  1CKK A;  2WC5 A;  1PRW A;  3SG7 A;  3UO9 A;  2CT9 A;  1HT9 A;  2OTG B;  1BR1 B;  2JWW A;  2PVB A;  1UP5 A;  3BUN B;  2Y1N A;  1OSA A;  2DOQ A;  2BKI B;  1QLK A;  1DT7 B;  3DYE A;  1TOP A;  3QME A;  2JPO A;  1PSR A;  2LC5 A;  1YX7 A;  2LCP A;  3BYA A;  3DY9 A;  3PFV A;  1RTP 1;  2E6W A;  4FQO A;  2KHN A;  4IL1 A;  1Y1X A; 
#chains in the Genus database with same CATH homology
 2MAZ A;  1TCF A;  3JTD B;  2BBM A;  1H4B A;  2M8U A;  3RLZ A;  3SIA A;  1KK8 C;  2A4J A;  2JPT A;  1C7W A;  1FPW A;  4NQG A;  1S1E A;  1TCO B;  1WRK A;  2ZRS A;  5I2L A;  1TNQ A;  4YI9 A;  1S5G Z;  2WCB A;  1C07 A;  2LVJ A;  4OVN F;  3D0Y B;  4GGN A;  3DVM A;  1AP4 A;  3A8R A;  2LLS A;  2NXQ A;  1MUX A;  2KBI A;  2KAY A;  2K0J A;  2LM5 A;  3AAJ A;  1DVI A;  1HQV A;  4ICB A;  1YVH A;  5CSN A;  1DJH A;  1PUL A;  3KPX A;  3F45 A;  5ER5 A;  3O6B A;  3OB2 B;  3VGO A;  2BL0 B;  3AKB A;  4I5K A;  4R1E A;  1YUS A;  2PAL A;  3TUY B;  1ZAC A;  4PE0 A;  1UHJ A;  3DF0 A;  4DCK A;  1SY9 A;  2KI6 D;  1QX7 A;  2QAC A;  2M29 A;  2KNE A;  1CTR A;  1WRL A;  3WNX B;  4UPG A;  4WQ3 A;  1IQ5 A;  2SCP A;  2D8N A;  2EC6 B;  4GGF C;  1W7I B;  5AER A;  1DTL A;  1K9K A;  1KQM C;  3SG2 A;  2COL B;  1UHH A;  4PHJ A;  4YGD B;  1NX2 A;  4QJ5 B;  1M63 B;  1ZFS A;  2M9G A;  1RJV A;  2ZFD A;  1CDP A;  2K7C A;  2OS8 B;  5DKQ A;  1OE9 B;  1ZOT B;  1SCM C;  1CFF A;  2KAV A;  1JC2 A;  3TDI A;  1DF0 B;  1JF0 A;  4QJ3 B;  2LHL A;  3SG6 A;  1REC A;  1M39 A;  1LKJ A;  1AHR A;  1XFU O;  1QIV A;  2M97 A;  1UHK A;  5I8N A;  2F8P A;  1KQV A;  4A4C A;  1K95 A;  1TNX A;  1AJ4 A;  3I5F C;  2BEC A;  2JC2 A;  5PAL A;  2FCD A;  1CM1 A;  5HKW A;  2LV7 A;  1QVI Y;  4ORB B;  3CS1 A;  1NCZ A;  2CNP A;  2JT0 A;  1BT6 A;  4C0K A;  2ZN8 A;  1J7Q A;  2JT3 A;  5HKZ A;  1PVB A;  1S36 A;  2NLN A;  3KO0 A;  4CLN A;  1DGV A;  2K61 A;  2LMV A;  4YBH B;  1K96 A;  4QJ4 B;  2M49 B;  4BY5 A;  4MRX A;  4PAL A;  1CFD A;  5K89 A;  1CDM A;  3OX6 A;  4U8D A;  1SYM A;  3EVR A;  5I2Q A;  2I2R E;  2Y1M A;  1EJ3 A;  1S26 D;  2KFF A;  1SBJ A;  4XJK B;  1U5I A;  2HQW A;  3NSL A;  4DIR A;  3CGA A;  1CDN A;  2K7O A;  1XA5 A;  1OMR A;  1KSO A;  1Y1U A;  1EH2 A;  1V1F A;  3BOW B;  1E8A A;  1Q80 A;  2KI6 C;  2CBL A;  2ZN9 A;  1QTX A;  3DVE A;  3FS7 A;  4ORC B;  4PDZ A;  4Q04 A;  1QX2 A;  1UHN A;  1NX1 A;  2ZND A;  5I2O A;  3IQQ A;  4HRH A;  4AQJ A;  1G4Y R;  1Y1A A;  4GFT A;  4CFR A;  1F8H A;  1B4C A;  1JF2 A;  2F2P A;  2MBX A;  2LLT A;  2B1U A;  3I5I B;  1MXE A;  1MXL C;  3WHU B;  1CMG A;  2K2F A;  2Q4U A;  5AEQ A;  1Y6W A;  3GK1 A;  1AUI B;  4JWQ A;  1XFZ O;  5CSI A;  5IBW A;  1QIW A;  2G2B A;  3EKJ A;  3PN7 B;  4L9M A;  3VRR A;  2H61 C;  2QPT A;  4MEW A;  1B7T Y;  1ZMZ A;  4HSZ A;  1LIN A;  2G9B A;  2LE9 B;  1XVJ A;  4GAO A;  2ZRT A;  5AAN A;  1PK0 D;  1QAT A;  1BF5 A;  1BU3 A;  3C1V A;  3CLN A;  3CWG A;  4A4B A;  3DD4 A;  2H2K A;  3VRQ A;  1H8B A;  4NDB A;  2LMT A;  2PAS A;  1ALW A;  1DF0 A;  3LCP C;  1DJZ A;  5JJG A;  1WLM A;  1UWO A;  1IH0 A;  3PAL A;  2MHH A;  2K7D A;  1F4O A;  4PE1 A;  1EL4 A;  1U5I B;  1KK7 Z;  5HLO A;  2BE4 A;  1LA0 A;  3DVK A;  1BJF A;  1SW8 A;  4P2Y B;  1L2O B;  3VRN A;  3AAK A;  3I5G B;  3IF7 A;  2L50 A;  3AKA A;  2IS9 A;  1D1O A;  3GOF A;  4ZCU A;  2WCE A;  2JTZ A;  1K9P A;  1G33 A;  1CLM A;  2L2E A;  4JQ0 D;  2R2I A;  1SCV A;  2K8M B;  3VRO A;  1F71 A;  1PAL A;  2F3Z A;  2JXL A;  2KI4 B;  5D69 A;  1X02 A;  3SIB A;  4CID A;  3JVT B;  1NX0 A;  4MLW A;  1SL8 A;  1SR6 B;  2NZ0 A;  1Y0V H;  3CR4 X;  2VRG A;  1KWO B;  4OCI A;  3I5H B;  4PE7 A;  1RFJ A;  1KSM A;  2JNX A;  2Y5I A;  4GGF A;  4XJK A;  3CZT X;  1XFY O;  5GQQ C;  1L7Z A;  1N2D A;  5F6T A;  2FOT A;  3PLF B;  1K93 D;  2WOS A;  4GNK B;  4YI8 A;  4I5J A;  4DRW A;  2LUC A;  2WCF A;  3A4U B;  1SL9 A;  3BOW A;  4N1F A;  1MF8 B;  1NIW A;  4HRE E;  1ODB A;  2BE6 A;  4PCW A;  2KFH A;  1YUR A;  4GBA A;  1NYA A;  1S5G Y;  1KK8 B;  1LXF C;  3BUX B;  2I94 A;  5CSF A;  4I5N B;  3PAT A;  2JZI A;  1DJW A;  1GGZ A;  4MBE A;  1K8U A;  1B9A A;  1SKT A;  4ZCV A;  1R6P A;  1WRZ A;  4YGB B;  3NXA A;  5CSJ A;  1IG5 A;  1CM4 A;  2BCB A;  3TS5 C;  4C0J A;  1AK8 A;  3OP0 A;  3WHT B;  2PMY A;  4M2P A;  2FJU B;  2O60 A;  3EKH A;  1CNP A;  4NDD A;  4YRU A;  1F70 A;  4E68 A;  4WRI A;  2MLE C;  3ZWH A;  2WC8 A;  3GK2 A;  1WDC C;  4FTG A;  1VRK A;  1GJY A;  3K21 A;  4MZL A;  5KU1 A;  1K2H A;  1J55 A;  2LVI A;  2NCO A;  1UUR A;  1CLB A;  1DJY A;  4MZJ A;  1YR5 A;  3EVU A;  1KQM B;  2ZNE A;  1FW4 A;  1KCY A;  2L0P A;  4N5X A;  1SK6 D;  2JOJ A;  1XFW O;  3OB1 B;  2BKH B;  2LP3 A;  3D10 A;  3FIA A;  1EG4 A;  1FBV A;  2OTG C;  2WOR A;  1GQM A;  3O78 A;  1MWN A;  5JOL A;  2KQ6 A;  1SCM B;  1GGW A;  2K2A A;  3KHE A;  2O5G A;  4OV2 A;  3H4S E;  1JWD A;  3KEV A;  2ISD A;  5ER4 X;  1BMO A;  1W7J B;  1JUO A;  3RM1 A;  1NUB A;  1IQ3 A;  2GV5 A;  3PSR A;  4DUQ A;  1IKU A;  4MSP A;  1N0Y A;  1NCX A;  1QAS A;  1A4P A;  4GPL B;  2L4H A;  3JTD C;  5HKY A;  1YX8 A;  2F3Y A;  3FWC A;  1CB1 A;  5CPV A;  3KF9 A;  3VRP A;  3I5F B;  2BCA A;  2JQ6 A;  2AMI A;  1NP8 A;  1CFC A;  1K94 A;  1EXR A;  2LAP A;  1J1D A;  3BQ3 A;  4USL A;  1TTX A;  2WND A;  1SPY A;  2I7A A;  1S6C A;  4I5L B;  4ETO A;  1BOD A;  1F55 A;  1XYD A;  1B8L A;  2EHB A;  2ZKM X;  1MR8 A;  4CPV A;  2I18 A;  3HX4 A;  1KFU L;  1IWQ A;  1C7V A;  1R2U A;  1BR4 B;  1RRO A;  1A2X A;  2EGD A;  2BL0 C;  4WQ2 A;  1PVA A;  1YTZ C;  3EK7 A;  2JXC A;  3TUY C;  2CTN A;  2F2O A;  3HCM A;  4HRG A;  1DJI A;  1K9U A;  3QRX A;  3BUW B;  1XK4 C;  1DGU A;  1KFU S;  2JUL A;  2LMU A;  2KBM A;  1OOJ A;  4P5O E;  3O2P A;  4YGC B;  2EC6 C;  2LNK A;  3LK0 A;  1DJG A;  3TDZ A;  5J3X A;  1QXP A;  3BXK A;  2KGR A;  2JT8 A;  1SRA A;  3EK4 A;  2CCM A;  4PE4 A;  1AJ5 A;  4GUK A;  1S3P A;  1JFJ A;  2Q91 A;  1LVC D;  2OS8 C;  4YGA A;  4TNC A;  2V53 A;  2KYF A;  2PRU A;  5AXI A;  1IJ5 A;  1CDL A;  3EVV A;  3ICB A;  5KTY A;  2KYC A;  5D7F A;  3MSE B;  2SAS A;  4CFQ A;  1BG1 A;  5G08 A;  1A29 A;  3CTN A;  3SJS A;  4MVF A;  2LUX A;  4AOM A;  3IQO A;  2K7B A;  5DKN A;  2LVV A;  3TDU A;  1OZO A;  2FCE A;  2BCX A;  2P6B B;  1J7O A;  2M0R A;  2L51 A;  4ORA B;  4F0Z B;  1NWD A;  5HLV A;  4BY4 A;  1NCY A;  1QJT A;  1A75 A;  1RWY A;  3M0W A;  2HET A;  4M2Q A;  5KSZ A;  3OX5 A;  2CXJ A;  3CR2 A;  2F33 A;  2LHI A;  1IRJ A;  1ZUZ A;  2L4I A;  1OZS A;  2M1K B;  1JSA A;  1YUT A;  4NDC A;  5FYX A;  1QVI Z;  2Y4Q A;  1J1E A;  1YVL A;  2BBN A;  1G8I A;  1KK7 Y;  2LLU A;  1XO5 A;  2KSP A;  2LAN A;  1QV1 A;  1QS7 A;  1B47 A;  2L98 A;  1F54 A;  1DMO A;  3SG3 A;  2JRF A;  1SMG A;  1YUU A;  4PHM A;  1TIZ A;  2LVK A;  1CLL A;  2M7N A;  1LA3 A;  4OKH A;  5B8I B;  2LP2 A;  3E3R A;  5TNC A;  1EG3 A;  2KQY A;  2KOT A;  2NCP A;  3FWB A;  1TNP A;  3LLE A;  4M2O A;  3PM8 A;  2E30 A;  1NX3 A;  1JFK A;  1WY9 A;  1IJ6 A;  1OMD A;  3OHM B;  2HPS A;  4MZK A;  1N65 A;  1S6I A;  1M46 A;  1JBA A;  1TN4 A;  2MA2 A;  3I5I C;  3SG5 A;  4AQI A;  2KGB C;  2KAX A;  1MHO A;  1NPQ A;  3TZ1 A;  2GGZ A;  2M7L A;  1J7R A;  1A75 B;  2PSR A;  2JNF A;  3PN7 C;  2AUC A;  4N1G A;  3NSO A;  1IGV A;  2JU0 A;  3EK8 A;  3WXA A;  3ZNI A;  4D1E A;  1QX5 B;  4DS7 A;  1CFP A;  2MLF C;  2MRD A;  1XFX O;  1B8R A;  1B7T Z;  1XFV O;  2MJW B;  1OQP A;  1WLZ A;  1UUS A;  3BUO B;  5BPJ A;  1BLQ A;  3LL8 B;  1QV0 A;  3DF0 B;  1PSB A;  2RGI A;  4MN0 A;  1YRT B;  3O4Y A;  2KDH A;  2GGM A;  5DKR A;  1YRU B;  1NSH A;  2HF5 A;  1KFX L;  1M31 A;  3CR5 X;  1S6J A;  2JTT A;  1B1G A;  1L2O C;  3I5G C;  3D0Y A;  2H61 A;  3GK4 X;  4MRY A;  1B8C A;  2OPO A;  3TS5 B;  2M3W A;  1FI5 A;  1ALV A;  1TNW A;  1DJX A;  5AFP A;  2KFG A;  1F4Q A;  1KFX S;  3DVJ A;  3NSI A;  4PHN A;  5HYD A;  1FF1 A;  1TRF A;  3LK1 A;  1RK9 A;  1WDC B;  4YGE B;  1UHI A;  4C0L A;  1K90 D;  2TN4 A;  2KI4 C;  2AAO A;  3NSK A;  4XYN A;  3SG4 A;  1AVS A;  1MQ1 A;  1OMV A;  2L5X B;  2HQ8 A;  3JVT C;  1SL7 A;  1SR6 C;  4OR9 B;  1QLS A;  1XK4 A;  1J7P A;  1KWO C;  2M1U A;  3I5H C;  1M45 A;  1FI6 A;  4PHK A;  1SNL A;  1BOC A;  4JPZ B;  1CMF A;  1A03 A;  1V1G A;  1CKK A;  3BUM B;  1PRW A;  3SG7 A;  2CT9 A;  1HT9 A;  2OTG B;  1BR1 B;  2JWW A;  2PVB A;  1UP5 A;  3BUN B;  2Y1N A;  1OSA A;  2DOQ A;  2BKI B;  1QLK A;  1DT7 B;  1TOP A;  2LC5 A;  1PSR A;  2LCP A;  1YX7 A;  3BYA A;  3PFV A;  1RTP 1;  2E6W A;  4FQO A;  2KHN A;  4IL1 A;  1Y1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...