2KI6C

The fgf1-s100a13-c2a hetero-hexameric complex structure: a component in the non-classical pathway for fgf1 secretion
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synaptotagmin-1
publication title The heterohexameric complex structure, a component in the non-classical pathway for fibroblast growth factor 1 (FGF1) secretion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 35
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ki6C00
3M0WA 4NDDA 4DCKA 2O60A 3JTDC 4DS7A 4MZJA 3TUYC 2LC5A 1ZACA 4QJ5B 5HLOA 2KI6C 3NXAA 1J55A 1YVHA 2JU0A 4NDBA 1B9AA 4E68A 1J7OA 2JTZA 4U8DA 3DVMA 1G8IA 1S5GZ 1JFJA 1K96A 3F45A 4JQ0D 4CPVA 1RK9A 1S26D 2FCEA 1X02A 2KYCA 1JC2A 2MLFC 4P2YB 1XYDA 2JNFA 1PVBA 1QS7A 1N65A 1SKTA 3OB1B 5J3XA 2WC8A 1LKJA 2F8PA 1IQ3A 4A4BA 1DTLA 2MJWB 1QXPA 4ORBB 4OV2A 5AERA 2BECA 1FBVA 4ORAB 5F6TA 4OKHA 1JFKA 1AJ5A 2OTGC 1EG3A 4P5OE 2FOTA 1SL8A 4WRIA 2KNEA 1EH2A 1KK8C 2LVVA 4HSZA 2M29A 2PALA 5HKZA 3EK8A 1BMOA 2NXQA 1QJTA 4OVNF 4Q04A 3FWCA 2ZNEA 1ALVA 3EVRA 1QTXA 1NX3A 1NX2A 2NZ0A 1HT9A 5KU1A 1QV1A 1QASA 5DKQA 1JF0A 3DF0A 2JULA 2MA2A 3A4UB 4C0LA 1B8CA 2I18A 2WORA 4WQ3A 3SJSA 1KFUS 1RROA 2JTTA 1K94A 3KEVA 5HLVA 3ZWHA 1BG1A 1A4PA 1PULA 2GV5A 1J1EA 2KAYA 1KK7Y 2KAVA 2KI4C 4PHMA 3A8RA 3I5IC 1FI6A 1CM1A 1WDCC 2SASA 3IQOA 3NSLA 1B7TZ 3TS5C 2E30A 2K7CA 2KDHA 2COLB 3FWBA 1XFXO 1DF0B 1K93D 3EKHA 1GQMA 1DJWA 1WRZA 5AEQA 2DOQA 4GGFA 3BUOB 2A4JA 4UPGA 1YX8A 1MF8B 1S6CA 1TRFA 1YR5A 2JXLA 2TN4A 2JOJA 3O78A 2MHHA 3OX5A 2BCXA 1TNWA 1XFUO 3WHUB 3GK2A 4N1FA 1K8UA 1AK8A 1XFYO 4JPZB 3EK7A 4CLNA 1B7TY 1YUTA 3GK4X 1TNQA 1OSAA 4R1EA 4YRUA 3I5FB 4ORCB 5JJGA 3GOFA 1UHKA 3PN7C 1MWNA 1NCZA 3EKJA 4AOMA 2K7BA 4YGDB 1NIWA 2M97A 1SRAA 2QACA 1ZMZA 3DF0B 2ZRTA 2LE9B 1BR4B 3BYAA 4USLA 1F4QA 1CLBA 2LMUA 4C0KA 5KSZA 2R2IA 2MRDA 3O4YA 2EC6C 1SCVA 4M2PA 1QLSA 2JZIA 3ICBA 2BBMA 5PALA 4NDCA 1CFFA 1EJ3A 3VRRA 2JRFA 2BL0B 3CR2A 1C07A 4HRGA 1CDNA 1UWOA 5K89A 4YGEB 2ISDA 2IS9A 1OMRA 1ZOTB 1QX7A 1KSOA 2KQ6A 1N0YA 3TZ1A 5I2QA 2BE4A 1UHNA 2M3WA 4QJ3B 3SG6A 3IQQA 2K7OA 4M2QA 1LA0A 1QX5B 3O2PA 4F0ZB 3NSKA 5FYXA 1WRKA 2ZN8A 1CTRA 4OCIA 2KGRA 3IF7A 2D8NA 3BUWB 1DJYA 1SW8A 3FIAA 1EXRA 5CSIA 5CSJA 3LK0A 4CIDA 4L9MA 3CWGA 1NX0A 2L51A 1MXLC 4M2OA 4GAOA 1CDPA 1KFUL 2H61C 1F55A 3I5HC 3WXAA 1DGVA 1L2OB 1Y0VH 1K90D 1BLQA 1CMFA 1M39A 1AUIB 1K9KA 1J7PA 1OZSA 1K2HA 4BY5A 2PRUA 1JSAA 1FI5A 4FQOA 3OB2B 2SCPA 1UURA 2BE6A 3CZTX 1MQ1A 1SBJA 1KCYA 1B8LA 1CLMA 5HKWA 1KSMA 3RM1A 1J7QA 1K9UA 1XK4A 2M49B 2WCEA 2CCMA 1UHJA 3KHEA 3H4SE 2WNDA 4D1EA 1YTZC 4AQJA 1SR6B 4QJ4B 1KWOB 2FJUB 2MBXA 2PASA 2M9GA 1QIWA 2JWWA 2LV7A 1CDLA 4JWQA 1BJFA 3OX6A 1KK7Z 4PE0A 5JOLA 1D1OA 1DMOA 2NCOA 3O6BA 1H8BA 5KTYA 5I2OA 1J1DA 1C7VA 2OS8B 2QPTA 3PSRA 2LHLA 4PDZA 1SL7A 1F54A 1FW4A 1C7WA 1FPWA 2L50A 3OP0A 2LNKA 1YUUA 2M7NA 1L2OC 1KQVA 2BCBA 3SIBA 1XFWO 2KQYA 1SCMB 4PE4A 1S36A 2F3ZA 2KGBC 2L0PA 2LLUA 4XJKA 1YURA 2FCDA 1TCFA 3MSEB 1BR1B 4PHJA 2AMIA 2KSPA 1QX2A 2G2BA 3NSOA 3DVJA 3RLZA 1CMGA 2E6WA 3KF9A 1BOCA 4WQ2A 3OHMB 1WLZA 1S1EA 1YVLA 4PE7A 2JNXA 2KOTA 2LANA 1BU3A 2V53A 4I5NB 3WNXB 1NWDA 2LCPA 2JXCA 2LAPA 5CPVA 3GK1A 2L4IA 2ZNDA 4YGBB 2OPOA 2WCFA 3WHTB 1NUBA 2OS8C 1V1GA 3JVTB 1RECA 1B4CA 3VGOA 1R2UA 1YRTB 2KFFA 1DJGA 3AKBA 3AKAA 1IRJA 3CLNA 5AXIA 1IKUA 1Y1UA 2F33A 1WRLA 3KO0A 2CNPA 4GNKB 2LVKA 2KAXA 1Q80A 3AAKA 5G08A 1XFZO 2Q4UA 1IWQA 1OMDA 1AP4A 2LUXA 2LMVA 1KQMB 2LMTA 1HQVA 1W7IB 3ZNIA 4ETOA 1MXEA 2KBIA 3SG5A 3E3RA 4DUQA 1DJIA 1B47A 1KFXS 1MUXA 4XJKB 4CFQA 1GGWA 1TNXA 3EK4A 1F71A 1FF1A 2MAZA 2HQWA 2CTNA 1IH0A 1L7ZA 4A4CA 3BQ3A 1GJYA 3CGAA 2M0RA 4HREE 4MZKA 5CSNA 4MN0A 2G9BA 2Y4QA 2ZKMX 3VRNA 1M45A 2PSRA 5GQQC 1H4BA 2LP2A 4C0JA 1S6IA 2K8MB 1PSRA 3BOWA 1RWYA 1IGVA 1LVCD 1MR8A 1RJVA 1WLMA 2JPTA 3I5FC 4GFTA 1F4OA 1JWDA 2M1KB 2WCBA 1SMGA 4YGAA 1W7JB 3CTNA 3PATA 1UHIA 1E8AA 1KQMC 1TN4A 1A2XA 1NPQA 2GGMA 2K61A 4PHKA 2LLSA 1YRUB 3SG4A 3CR4X 4GBAA 1EL4A 3KPXA 4ICBA 5TNCA 5HKYA 1AHRA 1IJ5A 4PCWA 2CXJA 3SG2A 4MBEA 1CFDA 1DJXA 1ALWA 2AUCA 1QIVA 1M46A 2JT3A 3C1VA 2BL0C 2I2RE 3PLFB 2M1UA 4GUKA 4DRWA 5HYDA 1SPYA 2HF5A 2HPSA 3PALA 2L5XB 2O5GA 1CM4A 1SYMA 1CDMA 1F70A 1G33A 1KK8B 1XVJA 2M8UA 1QATA 1LINA 2KHNA 1TTXA 2M7LA 4GGFC 1BF5A 1A29A 3AAJA 3BUNB 1NCXA 3VROA 2PVBA 3I5GB 1S6JA 2L2EA 1SY9A 1AJ4A 2LM5A 3BUXB 1CFPA 1CB1A 1NP8A 4YGCB 3HX4A 2LLTA 3CR5X 3LL8B 3BOWB 3LCPC 1NSHA 2CBLA 1JF2A 1K95A 2GGZA 4YBHB 5DKRA 1M63B 1DJHA 3PM8A 2MLEC 2P6BB 2JC2A 1U5IA 1DF0A 1RFJA 3D0YA 4ZCUA 4MEWA 3TDUA 3SIAA 4HRHA 1K9PA 2K2AA 3QRXA 1S5GY 2I94A 2KI4B 2JT0A 3I5IB 1A75A 2HQ8A 1SNLA 1WDCB 4PE1A 2BKHB 3DVEA 1ODBA 2H2KA 3TS5B 1QV0A 4IL1A 4CFRA 2VRGA 1XA5A 1QLKA 4OR9B 1KFXL 2F3YA 1B8RA 5D7FA 1QVIZ 2HETA 3BXKA 2KBMA 4MSPA 3I5GC 1J7RA 1LA3A 4MRYA 3FS7A 2Y1MA 5IBWA 1PK0D 2JQ6A 1SR6C 5BPJA 1KWOC 1DT7B 3HCMA 1UUSA 4N5XA 1G4YR 1DGUA 1Y1AA 4MZLA 1IQ5A 2LVIA 2KFGA 2BCAA 5I2LA 4N1GA 4AQIA 3LLEA 1VRKA 1TIZA 1XO5A 4YI8A 3BUMB 4NQGA 2CT9A 1CNPA 1OOJA 2K2FA 4YI9A 1WY9A 5AFPA 5B8IB 1CLLA 1LXFC 3PN7B 3VRQA 1QVIY 1A03A 2H61A 2L4HA 2LVJA 1S3PA 4FTGA 1SCMC 2F2PA 3D10A 1EG4A 2LUCA 5DKNA 1UHHA 4I5JA 4MRXA 2F2OA 5I8NA 2KFHA 2WOSA 2NLNA 2EC6B 3CS1A 1U5IB 2Y5IA 5CSFA 3D0YB 1ZFSA 1SK6D 1TOPA 3SG3A 2ZFDA 1CKKA 2Y1NA 5ER4X 1CFCA 1PVAA 2JT8A 1A75B 1M31A 1PSBA 3LK1A 1JUOA 2I7AA 3EVUA 1GGZA 1IG5A 1TCOB 3EVVA 1OMVA 3NSIA 1Y6WA 2K7DA 2ZRSA 2Q91A 4I5LB 2ZN9A 4DIRA 3JVTC 1XK4C 2BBNA 2KYFA 4PHNA 1V1FA 3VRPA 2KI6D 3SG7A 3TDZA 1N2DA 3JTDB 4I5KA 3TUYB 1OE9B 1NCYA 1Y1XA 1PALA 2EGDA 1NYAA 1IJ6A 5D69A 3DVKA 4GGNA 1JBAA 1MHOA 3PFVA 5AANA 1YX7A 4BY4A 4ZCVA 1UP5A 2EHBA 2LHIA 2BKIB 3DD4A 3K21A 4PALA 1RTP1 1AVSA 1R6PA 1ZUZA 2RGIA 3I5HB 1B1GA 1BT6A 1XFVO 4TNCA 2K0JA 1PRWA 4GPLB 4MLWA 3TDIA 1OQPA 2L98A 2B1UA 2NCPA 1OZOA 4MVFA 1TNPA 1DJZA 1NX1A 2AAOA 2LP3A 2PMYA 1YUSA 2OTGB 4XYNA 1DVIA 1F8HA 1BODA 1SL9A 5ER5A
chains in the Genus database with same CATH superfamily
3M0WA 4NDDA 4DCKA 2O60A 3JTDC 1TWOA 4MZJA 4DS7A 2LC5A 3TUYC 1ZACA 4QJ5B 5HLOA 5DICA 2QDIA 2KI6C 3NXAA 1J55A 1YVHA 2JU0A 4NDBA 1B9AA 4E68A 1J7OA 2JTZA 4U8DA 3DVMA 1G8IA 1S5GZ 1QWVA 3R72A 1K96A 3F45A 4JKTA 4JQ0D 1JFJA 4CPVA 4F7FA 1RK9A 1S26D 2FCEA 4INWA 1X02A 2KYCA 1JC2A 2MLFC 4P2YB 1XYDA 2JNFA 1PVBA 1QS7A 3NGVA 1N65A 1SKTA 3OB1B 5J3XA 3SS4A 2WC8A 1LKJA 2F8PA 3L47A 4A4BA 1IQ3A 1DTLA 2MJWB 1QXPA 4ORBB 4OV2A 3S0DA 5AERA 2BECA 1FBVA 4ORAB 5F6TA 4OKHA 1JFKA 1AJ5A 1W9ZA 2OTGC 1EG3A 4P5OE 2FOTA 3R1VA 1SL8A 4WRIA 2KNEA 3S0GA 1EH2A 1KK8C 2LVVA 3D76A 2WC6A 2M29A 2PALA 4HSZA 5HKZA 3EK8A 1BMOA 2NXQA 1QJTA 3CZ2A 4OVNF 3FWCA 4Q04A 2ZNEA 1ALVA 3EVRA 2WCKA 3RZSA 1QTXA 1NX3A 1NX2A 2NZ0A 1HT9A 3FE8A 5KU1A 1QV1A 1QASA 5DKQA 1JF0A 2QEHA 3DF0A 2JULA 2MA2A 3A4UB 4C0LA 1B8CA 2I18A 2WORA 4WQ3A 3B7AA 3SJSA 1KFUS 1RROA 2JTTA 1K94A 3KEVA 5HLVA 3ZWHA 1BG1A 3DXLA 1A4PA 1PULA 2GV5A 1J1EA 2KAYA 1KK7Y 2KAVA 3FE9A 2KI4C 4PHMA 3A8RA 3I5IC 1FI6A 1CM1A 1WDCC 2SASA 3IQOA 3NSLA 3L4LA 1B7TZ 3TS5C 2E30A 2K7CA 2JPOA 2KDHA 2COLB 3FWBA 1XFXO 1DF0B 1K93D 3EKHA 1GQMA 1DJWA 1WRZA 3CYZA 5AEQA 2DOQA 4GGFA 3BUOB 2A4JA 4UPGA 1DEKA 1YX8A 1MF8B 1S6CA 1TRFA 1YR5A 2JXLA 2TN4A 2JOJA 3O78A 2MHHA 3OX5A 2BCXA 1TNWA 1XFUO 3WHUB 3GK2A 4N1FA 1K8UA 1AK8A 1XFYO 2FJYA 3EK7A 4JPZB 4CLNA 1B7TY 1YUTA 3GK4X 1TNQA 1OSAA 4R1EA 4YRUA 3I5FB 4ORCB 5JJGA 3GOFA 1UHKA 3PN7C 1MWNA 1NCZA 3EKJA 4AOMA 3D77A 2K7BA 4YGDB 3D78A 1NIWA 2M97A 2KLEA 1SRAA 2QACA 1ZMZA 3DF0B 2ZRTA 2LE9B 1BR4B 3BYAA 4USLA 1F4QA 3CABA 2LMUA 4C0KA 1CLBA 5KSZA 2R2IA 2MRDA 3O4YA 2EC6C 3CZ1A 1SCVA 4M2PA 1QLSA 2JZIA 3ICBA 2BBMA 5PALA 4NDCA 1CFFA 1EJ3A 3VRRA 2JRFA 2BL0B 3CR2A 1C07A 4HRGA 1CDNA 1OOHA 1UWOA 5K89A 4YGEB 2ISDA 3NHIA 2IS9A 1OMRA 1ZOTB 1IIOA 1QX7A 1KSOA 1OW4A 2KQ6A 1N0YA 3TZ1A 5I2QA 2BE4A 1UHNA 2M3WA 4QJ3B 3SG6A 3IQQA 2K7OA 4M2QA 1LA0A 1QX5B 3B88A 3O2PA 4F0ZB 3NSKA 1GM0A 5FYXA 1WRKA 2ZN8A 1CTRA 4OCIA 2KGRA 3IF7A 2D8NA 3BUWB 1DJYA 1SW8A 3O4XA 3FIAA 1EXRA 5CSIA 5CSJA 2KPHA 3LK0A 4CIDA 4L9MA 5HL1A 3CWGA 1NX0A 2L51A 1MXLC 4M2OA 4GAOA 4INXA 1CDPA 1KFUL 3D75A 2H61C 1F55A 3I5HC 3WXAA 1DGVA 1L2OB 1Y0VH 1K90D 1BLQA 1CMFA 1M39A 1AUIB 1K9KA 1J7PA 1OZSA 1K2HA 4BY5A 2PRUA 1JSAA 1FI5A 4FQOA 3OB2B 2SCPA 1UURA 2BE6A 3CZTX 3UO9A 1MQ1A 1SBJA 3Q8IA 1B8LA 1CLMA 3L4AA 1KCYA 5HKWA 1KSMA 3BFBA 3RM1A 1P28A 1J7QA 1K9UA 1XK4A 2M49B 2WCEA 2CCMA 1UHJA 3KHEA 3H4SE 2WNDA 3CZ0A 1YTZC 4AQJA 4D1EA 1SR6B 4QJ4B 1KWOB 2FJUB 2MBXA 2PASA 2M9GA 1QIWA 2JWWA 2LV7A 1CDLA 4JWQA 1BJFA 3OX6A 1KK7Z 4PE0A 5JOLA 1D1OA 4JD9A 2NCOA 1DMOA 3O6BA 1H8BA 5KTYA 1TUJA 1J1DA 5I2OA 2OS8B 2QPTA 3PSRA 2LHLA 4PDZA 1SL7A 1C7VA 1FW4A 1C7WA 1FPWA 2L50A 3OP0A 1DELA 2LNKA 5EL2A 1YUUA 2M7NA 5FI6A 1L2OC 1KQVA 2BCBA 3SIBA 1XFWO 2KQYA 3OBVA 1SCMB 4PE4A 1S36A 2F3ZA 2KGBC 2L0PA 2LLUA 1T14A 4XJKA 1YURA 2FCDA 1TCFA 3MSEB 1BR1B 4PHJA 2AMIA 2KSPA 1QX2A 2G2BA 3NSOA 3DVJA 3RLZA 1CMGA 3PJIA 2E6WA 3KF9A 1BOCA 4WQ2A 3OHMB 1WLZA 1S1EA 1YVLA 4PE7A 2JNXA 3B87A 2QEOA 2KOTA 2LANA 1BU3A 3PM2A 2V53A 4I5NB 3WNXB 1NWDA 2LCPA 2JXCA 2LAPA 5CPVA 3GK1A 2L4IA 2ZNDA 4YGBB 2PYQA 2OPOA 2WCFA 3WHTB 1NUBA 2WCMA 1Z4HA 2OS8C 1V1GA 3JVTB 3S0BA 1RECA 3DYEA 1B4CA 3VGOA 1R2UA 1LS8A 1YRTB 3QMEA 2KFFA 1DJGA 3AKBA 3AKAA 1IRJA 3CLNA 5FI7A 5AXIA 1IKUA 1Y1UA 2F33A 1WRLA 3KO0A 2CNPA 4GNKB 2LVKA 2KAXA 1Q80A 3AAKA 5G08A 1XFZO 2Q4UA 1IWQA 1OMDA 1AP4A 2LUXA 2LMVA 1KQMB 2LMTA 1HQVA 1W7IB 3ZNIA 4ETOA 1MXEA 2KBIA 3SG5A 3E3RA 4DUQA 1DJIA 1B47A 1KFXS 1MUXA 4XJKB 4CFQA 1GGWA 1TNXA 3S0EA 3EK4A 1F71A 1FF1A 2MAZA 2HQWA 2CTNA 1IH0A 1C3ZA 1L7ZA 4A4CA 3BQ3A 1GJYA 3CGAA 2M0RA 4FQTA 4HREE 4MZKA 5CSNA 3K1EA 4MN0A 1TUZA 2G9BA 2Y4QA 2K60A 2ZKMX 1M45A 2PSRA 5GQQC 3VRNA 2LP2A 4C0JA 1H4BA 1S6IA 2K8MB 1PSRA 3BOWA 1RWYA 1ORGA 1IGVA 1LVCD 1MR8A 1RJVA 1WLMA 2JPTA 3I5FC 4GFTA 1F4OA 1JWDA 2M1KB 2QEBA 2WCBA 1SMGA 4YGAA 1W7JB 3CTNA 5D3OA 2BAPA 2QEVA 1UHIA 3PATA 1E8AA 1KQMC 1TN4A 1A2XA 1NPQA 2GGMA 2K61A 2GTEA 4PHKA 2LLSA 1YRUB 3SG4A 3CR4X 4GBAA 1EL4A 3UNWA 3KPXA 4ICBA 5TNCA 5HKYA 1OOGA 1AHRA 1IJ5A 4PCWA 2CXJA 3SG2A 1OOFA 2L5YA 4MBEA 1CFDA 1DJXA 1ALWA 2AUCA 1QIVA 1M46A 2JT3A 3C1VA 2BL0C 2I2RE 3PLFB 3S0AA 2M1UA 4GUKA 4DRWA 5HYDA 2L2CA 1SPYA 2HF5A 2HPSA 2P71A 3PALA 2L5XB 2O5GA 1CM4A 1SYMA 1CDMA 1F70A 1G33A 1KK8B 1XVJA 2M8UA 1QATA 1LINA 2KHNA 1TTXA 2M7LA 4GGFC 1BF5A 1A29A 3AAJA 3BUNB 1NCXA 3VROA 2PVBA 3I5GB 1S6JA 2L2EA 1SY9A 1AJ4A 2LM5A 3BUXB 1CFPA 1CB1A 3V2LA 1NP8A 4YGCB 3HX4A 2LLTA 4PT1A 3CR5X 3LL8B 3BOWB 3SS3A 3LCPC 3OGNA 1NSHA 2CBLA 1JF2A 1K95A 2GGZA 4YBHB 5DKRA 1M63B 1DJHA 3PM8A 2MLEC 2P6BB 4OZDA 3SS5A 2JC2A 1U5IA 1DF0A 1RFJA 3D0YA 3B6XA 4ZCUA 4MEWA 3TDUA 2YGUA 3SIAA 4HRHA 1K9PA 2K2AA 3QRXA 1S5GY 2I94A 2KI4B 3IVTA 3S0FA 2JT0A 3I5IB 1A75A 2BNXA 1SNLA 1WDCB 2HQ8A 2WCLA 2BKHB 4PE1A 3DVEA 1ODBA 2H2KA 3TS5B 1QV0A 4IL1A 1F54A 4CFRA 2VRGA 1XA5A 1QLKA 3CDNA 3DZTA 1KFXL 2H8VA 3N7HA 2F3YA 4IJ7A 1B8RA 4OR9B 5D7FA 1QVIZ 2HETA 3BXKA 2KBMA 4MSPA 3I5GC 5I94A 1J7RA 3DY9A 1LA3A 2WCHA 4MRYA 3FS7A 2Y1MA 5IBWA 1PK0D 2JQ6A 1SR6C 5BPJA 1KWOC 1DT7B 3HCMA 1UUSA 3NHTA 1G4YR 1DGUA 4N5XA 1Y1AA 4MZLA 1IQ5A 2LVIA 2KFGA 2BCAA 5I2LA 4N1GA 4AQIA 3LLEA 1VRKA 1TIZA 1XO5A 4YI8A 3BUMB 4NQGA 2CT9A 1CNPA 1OOJA 2K2FA 4YI9A 1WY9A 5AFPA 5B8IB 1CLLA 1LXFC 3PN7B 3VRQA 1QVIY 1A03A 2H61A 2L4HA 2LVJA 1S3PA 4FTGA 1SCMC 2F2PA 3D10A 1EG4A 2LUCA 5DKNA 1UHHA 3BJHA 4I5JA 4MRXA 2F2OA 5I8NA 2KFHA 2WOSA 2NLNA 2EC6B 3D74A 1Z2CB 3CS1A 1U5IB 2Y5IA 5CSFA 1SSEB 3D0YB 1ZFSA 1SK6D 1TOPA 3SG3A 2ZFDA 1CKKA 2Y1NA 5ER4X 1CFCA 1PVAA 2JT8A 1A75B 1M31A 1PSBA 3BFHA 3LK1A 1JUOA 5FI2A 2I7AA 3EVUA 1GGZA 1IG5A 1TCOB 3EVVA 1OMVA 3NSIA 1Y6WA 2K7DA 2ZRSA 2Q91A 4I5LB 1XFRA 2ZN9A 4DIRA 1DC1A 1DQEA 3JVTC 1XK4C 2BBNA 2KYFA 4PHNA 1V1FA 1C3YA 3VRPA 2KI6D 3SG7A 3TDZA 3FE6A 1N2DA 3JTDB 4I5KA 3TUYB 1OE9B 1NCYA 1Y1XA 1PALA 2EGDA 1NYAA 1IJ6A 5D69A 2ERBA 3DVKA 3EG5B 4GGNA 1JBAA 1MHOA 3PFVA 3R1PA 5AANA 1YX7A 4BY4A 4ZCVA 1UP5A 2EHBA 1OOIX 2LHIA 2BKIB 3DD4A 3B86A 3K21A 4PALA 1RTP1 3BFAA 1AVSA 1R6PA 1ZUZA 2RGIA 3I5HB 1B1GA 2KLDA 1BT6A 1XFVO 2WCJA 2K0JA 4TNCA 2PQLA 1PRWA 4GPLB 4KYNA 2P70A 4MLWA 1OQPA 2L98A 2B1UA 3TDIA 2NCPA 1OZOA 4MVFA 1TNPA 3R1OA 1DJZA 3VB1A 1NX1A 2AAOA 2WC5A 2LP3A 2PMYA 1YUSA 2OTGB 4XYNA 1DVIA 1F8HA 1BODA 3D73A 1SL9A 5ER5A
chains in the Genus database with same CATH topology
3M0WA 4NDDA 4DCKA 2O60A 3JTDC 4DS7A 4MZJA 3TUYC 2LC5A 1ZACA 4QJ5B 5HLOA 2KI6C 3NXAA 1J55A 1YVHA 2JU0A 4NDBA 1B9AA 4E68A 1J7OA 2JTZA 4U8DA 3DVMA 1G8IA 1S5GZ 1JFJA 1K96A 3F45A 4JQ0D 4CPVA 1RK9A 1S26D 2FCEA 1X02A 2KYCA 1JC2A 2MLFC 4P2YB 1XYDA 2JNFA 1PVBA 1QS7A 1N65A 1SKTA 3OB1B 5J3XA 2WC8A 1LKJA 2F8PA 1IQ3A 4A4BA 1DTLA 2MJWB 1QXPA 4ORBB 4OV2A 5AERA 2BECA 1FBVA 4ORAB 5F6TA 4OKHA 1JFKA 1AJ5A 2OTGC 1EG3A 4P5OE 2FOTA 1SL8A 4WRIA 2KNEA 1EH2A 1KK8C 2LVVA 4HSZA 2M29A 2PALA 5HKZA 3EK8A 1BMOA 2NXQA 1QJTA 4OVNF 4Q04A 3FWCA 2ZNEA 1ALVA 3EVRA 1QTXA 1NX3A 1NX2A 2NZ0A 1HT9A 5KU1A 1QV1A 1QASA 5DKQA 1JF0A 3DF0A 2JULA 2MA2A 3A4UB 4C0LA 1B8CA 2I18A 2WORA 4WQ3A 3SJSA 1KFUS 1RROA 2JTTA 1K94A 3KEVA 5HLVA 3ZWHA 1BG1A 1A4PA 1PULA 2GV5A 1J1EA 2KAYA 1KK7Y 2KAVA 2KI4C 4PHMA 3A8RA 3I5IC 1FI6A 1CM1A 1WDCC 2SASA 3IQOA 3NSLA 1B7TZ 3TS5C 2E30A 2K7CA 2KDHA 2COLB 3FWBA 1XFXO 1DF0B 1K93D 3EKHA 1GQMA 1DJWA 1WRZA 5AEQA 2DOQA 4GGFA 3BUOB 2A4JA 4UPGA 1YX8A 1MF8B 1S6CA 1TRFA 1YR5A 2JXLA 2TN4A 2JOJA 3O78A 2MHHA 3OX5A 2BCXA 1TNWA 1XFUO 3WHUB 3GK2A 4N1FA 1K8UA 1AK8A 1XFYO 4JPZB 3EK7A 4CLNA 1B7TY 1YUTA 3GK4X 1TNQA 1OSAA 4R1EA 4YRUA 3I5FB 4ORCB 5JJGA 3GOFA 1UHKA 3PN7C 1MWNA 1NCZA 3EKJA 4AOMA 2K7BA 4YGDB 1NIWA 2M97A 1SRAA 2QACA 1ZMZA 3DF0B 2ZRTA 2LE9B 1BR4B 3BYAA 4USLA 1F4QA 1CLBA 2LMUA 4C0KA 5KSZA 2R2IA 2MRDA 3O4YA 2EC6C 1SCVA 4M2PA 1QLSA 2JZIA 3ICBA 2BBMA 5PALA 4NDCA 1CFFA 1EJ3A 3VRRA 2JRFA 2BL0B 3CR2A 1C07A 4HRGA 1CDNA 1UWOA 5K89A 4YGEB 2ISDA 2IS9A 1OMRA 1ZOTB 1QX7A 1KSOA 2KQ6A 1N0YA 3TZ1A 5I2QA 2BE4A 1UHNA 2M3WA 4QJ3B 3SG6A 3IQQA 2K7OA 4M2QA 1LA0A 1QX5B 3O2PA 4F0ZB 3NSKA 5FYXA 1WRKA 2ZN8A 1CTRA 4OCIA 2KGRA 3IF7A 2D8NA 3BUWB 1DJYA 1SW8A 3FIAA 1EXRA 5CSIA 5CSJA 3LK0A 4CIDA 4L9MA 3CWGA 1NX0A 2L51A 1MXLC 4M2OA 4GAOA 1CDPA 1KFUL 2H61C 1F55A 3I5HC 3WXAA 1DGVA 1L2OB 1Y0VH 1K90D 1BLQA 1CMFA 1M39A 1AUIB 1K9KA 1J7PA 1OZSA 1K2HA 4BY5A 2PRUA 1JSAA 1FI5A 4FQOA 3OB2B 2SCPA 1UURA 2BE6A 3CZTX 1MQ1A 1SBJA 1KCYA 1B8LA 1CLMA 5HKWA 1KSMA 3RM1A 1J7QA 1K9UA 1XK4A 2M49B 2WCEA 2CCMA 1UHJA 3KHEA 3H4SE 2WNDA 4D1EA 1YTZC 4AQJA 1SR6B 4QJ4B 1KWOB 2FJUB 2MBXA 2PASA 2M9GA 1QIWA 2JWWA 2LV7A 1CDLA 4JWQA 1BJFA 3OX6A 1KK7Z 4PE0A 5JOLA 1D1OA 1DMOA 2NCOA 3O6BA 1H8BA 5KTYA 5I2OA 1J1DA 1C7VA 2OS8B 2QPTA 3PSRA 2LHLA 4PDZA 1SL7A 1F54A 1FW4A 1C7WA 1FPWA 2L50A 3OP0A 2LNKA 1YUUA 2M7NA 1L2OC 1KQVA 2BCBA 3SIBA 1XFWO 2KQYA 1SCMB 4PE4A 1S36A 2F3ZA 2KGBC 2L0PA 2LLUA 4XJKA 1YURA 2FCDA 1TCFA 3MSEB 1BR1B 4PHJA 2AMIA 2KSPA 1QX2A 2G2BA 3NSOA 3DVJA 3RLZA 1CMGA 2E6WA 3KF9A 1BOCA 4WQ2A 3OHMB 1WLZA 1S1EA 1YVLA 4PE7A 2JNXA 2KOTA 2LANA 1BU3A 2V53A 4I5NB 3WNXB 1NWDA 2LCPA 2JXCA 2LAPA 5CPVA 3GK1A 2L4IA 2ZNDA 4YGBB 2OPOA 2WCFA 3WHTB 1NUBA 2OS8C 1V1GA 3JVTB 1RECA 1B4CA 3VGOA 1R2UA 1YRTB 2KFFA 1DJGA 3AKBA 3AKAA 1IRJA 3CLNA 5AXIA 1IKUA 1Y1UA 2F33A 1WRLA 3KO0A 2CNPA 4GNKB 2LVKA 2KAXA 1Q80A 3AAKA 5G08A 1XFZO 2Q4UA 1IWQA 1OMDA 1AP4A 2LUXA 2LMVA 1KQMB 2LMTA 1HQVA 1W7IB 3ZNIA 4ETOA 1MXEA 2KBIA 3SG5A 3E3RA 4DUQA 1DJIA 1B47A 1KFXS 1MUXA 4XJKB 4CFQA 1GGWA 1TNXA 3EK4A 1F71A 1FF1A 2MAZA 2HQWA 2CTNA 1IH0A 1L7ZA 4A4CA 3BQ3A 1GJYA 3CGAA 2M0RA 4HREE 4MZKA 5CSNA 4MN0A 2G9BA 2Y4QA 2ZKMX 3VRNA 1M45A 2PSRA 5GQQC 1H4BA 2LP2A 4C0JA 1S6IA 2K8MB 1PSRA 3BOWA 1RWYA 1IGVA 1LVCD 1MR8A 1RJVA 1WLMA 2JPTA 3I5FC 4GFTA 1F4OA 1JWDA 2M1KB 2WCBA 1SMGA 4YGAA 1W7JB 3CTNA 3PATA 1UHIA 1E8AA 1KQMC 1TN4A 1A2XA 1NPQA 2GGMA 2K61A 4PHKA 2LLSA 1YRUB 3SG4A 3CR4X 4GBAA 1EL4A 3KPXA 4ICBA 5TNCA 5HKYA 1AHRA 1IJ5A 4PCWA 2CXJA 3SG2A 4MBEA 1CFDA 1DJXA 1ALWA 2AUCA 1QIVA 1M46A 2JT3A 3C1VA 2BL0C 2I2RE 3PLFB 2M1UA 4GUKA 4DRWA 5HYDA 1SPYA 2HF5A 2HPSA 3PALA 2L5XB 2O5GA 1CM4A 1SYMA 1CDMA 1F70A 1G33A 1KK8B 1XVJA 2M8UA 1QATA 1LINA 2KHNA 1TTXA 2M7LA 4GGFC 1BF5A 1A29A 3AAJA 3BUNB 1NCXA 3VROA 2PVBA 3I5GB 1S6JA 2L2EA 1SY9A 1AJ4A 2LM5A 3BUXB 1CFPA 1CB1A 1NP8A 4YGCB 3HX4A 2LLTA 3CR5X 3LL8B 3BOWB 3LCPC 1NSHA 2CBLA 1JF2A 1K95A 2GGZA 4YBHB 5DKRA 1M63B 1DJHA 3PM8A 2MLEC 2P6BB 2JC2A 1U5IA 1DF0A 1RFJA 3D0YA 4ZCUA 4MEWA 3TDUA 3SIAA 4HRHA 1K9PA 2K2AA 3QRXA 1S5GY 2I94A 2KI4B 2JT0A 3I5IB 1A75A 2HQ8A 1SNLA 1WDCB 4PE1A 2BKHB 3DVEA 1ODBA 2H2KA 3TS5B 1QV0A 4IL1A 4CFRA 2VRGA 1XA5A 1QLKA 4OR9B 1KFXL 2F3YA 1B8RA 5D7FA 1QVIZ 2HETA 3BXKA 2KBMA 4MSPA 3I5GC 1J7RA 1LA3A 4MRYA 3FS7A 2Y1MA 5IBWA 1PK0D 2JQ6A 1SR6C 5BPJA 1KWOC 1DT7B 3HCMA 1UUSA 4N5XA 1G4YR 1DGUA 1Y1AA 4MZLA 1IQ5A 2LVIA 2KFGA 2BCAA 5I2LA 4N1GA 4AQIA 3LLEA 1VRKA 1TIZA 1XO5A 4YI8A 3BUMB 4NQGA 2CT9A 1CNPA 1OOJA 2K2FA 4YI9A 1WY9A 5AFPA 5B8IB 1CLLA 1LXFC 3PN7B 3VRQA 1QVIY 1A03A 2H61A 2L4HA 2LVJA 1S3PA 4FTGA 1SCMC 2F2PA 3D10A 1EG4A 2LUCA 5DKNA 1UHHA 4I5JA 4MRXA 2F2OA 5I8NA 2KFHA 2WOSA 2NLNA 2EC6B 3CS1A 1U5IB 2Y5IA 5CSFA 3D0YB 1ZFSA 1SK6D 1TOPA 3SG3A 2ZFDA 1CKKA 2Y1NA 5ER4X 1CFCA 1PVAA 2JT8A 1A75B 1M31A 1PSBA 3LK1A 1JUOA 2I7AA 3EVUA 1GGZA 1IG5A 1TCOB 3EVVA 1OMVA 3NSIA 1Y6WA 2K7DA 2ZRSA 2Q91A 4I5LB 2ZN9A 4DIRA 3JVTC 1XK4C 2BBNA 2KYFA 4PHNA 1V1FA 3VRPA 2KI6D 3SG7A 3TDZA 1N2DA 3JTDB 4I5KA 3TUYB 1OE9B 1NCYA 1Y1XA 1PALA 2EGDA 1NYAA 1IJ6A 5D69A 3DVKA 4GGNA 1JBAA 1MHOA 3PFVA 5AANA 1YX7A 4BY4A 4ZCVA 1UP5A 2EHBA 2LHIA 2BKIB 3DD4A 3K21A 4PALA 1RTP1 1AVSA 1R6PA 1ZUZA 2RGIA 3I5HB 1B1GA 1BT6A 1XFVO 4TNCA 2K0JA 1PRWA 4GPLB 4MLWA 3TDIA 1OQPA 2L98A 2B1UA 2NCPA 1OZOA 4MVFA 1TNPA 1DJZA 1NX1A 2AAOA 2LP3A 2PMYA 1YUSA 2OTGB 4XYNA 1DVIA 1F8HA 1BODA 1SL9A 5ER5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0W A;  4NDD A;  4DCK A;  2O60 A;  3JTD C;  4DS7 A;  4MZJ A;  3TUY C;  2LC5 A;  1ZAC A;  4QJ5 B;  5HLO A;  2KI6 C;  3NXA A;  1J55 A;  1YVH A;  2JU0 A;  4NDB A;  1B9A A;  4E68 A;  1J7O A;  2JTZ A;  4U8D A;  3DVM A;  1G8I A;  1S5G Z;  1JFJ A;  1K96 A;  3F45 A;  4JQ0 D;  4CPV A;  1RK9 A;  1S26 D;  2FCE A;  1X02 A;  2KYC A;  1JC2 A;  2MLF C;  4P2Y B;  1XYD A;  2JNF A;  1PVB A;  1QS7 A;  1N65 A;  1SKT A;  3OB1 B;  5J3X A;  2WC8 A;  1LKJ A;  2F8P A;  1IQ3 A;  4A4B A;  1DTL A;  2MJW B;  1QXP A;  4ORB B;  4OV2 A;  5AER A;  2BEC A;  1FBV A;  4ORA B;  5F6T A;  4OKH A;  1JFK A;  1AJ5 A;  2OTG C;  1EG3 A;  4P5O E;  2FOT A;  1SL8 A;  4WRI A;  2KNE A;  1EH2 A;  1KK8 C;  2LVV A;  4HSZ A;  2M29 A;  2PAL A;  5HKZ A;  3EK8 A;  1BMO A;  2NXQ A;  1QJT A;  4OVN F;  4Q04 A;  3FWC A;  2ZNE A;  1ALV A;  3EVR A;  1QTX A;  1NX3 A;  1NX2 A;  2NZ0 A;  1HT9 A;  5KU1 A;  1QV1 A;  1QAS A;  5DKQ A;  1JF0 A;  3DF0 A;  2JUL A;  2MA2 A;  3A4U B;  4C0L A;  1B8C A;  2I18 A;  2WOR A;  4WQ3 A;  3SJS A;  1KFU S;  1RRO A;  2JTT A;  1K94 A;  3KEV A;  5HLV A;  3ZWH A;  1BG1 A;  1A4P A;  1PUL A;  2GV5 A;  1J1E A;  2KAY A;  1KK7 Y;  2KAV A;  2KI4 C;  4PHM A;  3A8R A;  3I5I C;  1FI6 A;  1CM1 A;  1WDC C;  2SAS A;  3IQO A;  3NSL A;  1B7T Z;  3TS5 C;  2E30 A;  2K7C A;  2KDH A;  2COL B;  3FWB A;  1XFX O;  1DF0 B;  1K93 D;  3EKH A;  1GQM A;  1DJW A;  1WRZ A;  5AEQ A;  2DOQ A;  4GGF A;  3BUO B;  2A4J A;  4UPG A;  1YX8 A;  1MF8 B;  1S6C A;  1TRF A;  1YR5 A;  2JXL A;  2TN4 A;  2JOJ A;  3O78 A;  2MHH A;  3OX5 A;  2BCX A;  1TNW A;  1XFU O;  3WHU B;  3GK2 A;  4N1F A;  1K8U A;  1AK8 A;  1XFY O;  4JPZ B;  3EK7 A;  4CLN A;  1B7T Y;  1YUT A;  3GK4 X;  1TNQ A;  1OSA A;  4R1E A;  4YRU A;  3I5F B;  4ORC B;  5JJG A;  3GOF A;  1UHK A;  3PN7 C;  1MWN A;  1NCZ A;  3EKJ A;  4AOM A;  2K7B A;  4YGD B;  1NIW A;  2M97 A;  1SRA A;  2QAC A;  1ZMZ A;  3DF0 B;  2ZRT A;  2LE9 B;  1BR4 B;  3BYA A;  4USL A;  1F4Q A;  1CLB A;  2LMU A;  4C0K A;  5KSZ A;  2R2I A;  2MRD A;  3O4Y A;  2EC6 C;  1SCV A;  4M2P A;  1QLS A;  2JZI A;  3ICB A;  2BBM A;  5PAL A;  4NDC A;  1CFF A;  1EJ3 A;  3VRR A;  2JRF A;  2BL0 B;  3CR2 A;  1C07 A;  4HRG A;  1CDN A;  1UWO A;  5K89 A;  4YGE B;  2ISD A;  2IS9 A;  1OMR A;  1ZOT B;  1QX7 A;  1KSO A;  2KQ6 A;  1N0Y A;  3TZ1 A;  5I2Q A;  2BE4 A;  1UHN A;  2M3W A;  4QJ3 B;  3SG6 A;  3IQQ A;  2K7O A;  4M2Q A;  1LA0 A;  1QX5 B;  3O2P A;  4F0Z B;  3NSK A;  5FYX A;  1WRK A;  2ZN8 A;  1CTR A;  4OCI A;  2KGR A;  3IF7 A;  2D8N A;  3BUW B;  1DJY A;  1SW8 A;  3FIA A;  1EXR A;  5CSI A;  5CSJ A;  3LK0 A;  4CID A;  4L9M A;  3CWG A;  1NX0 A;  2L51 A;  1MXL C;  4M2O A;  4GAO A;  1CDP A;  1KFU L;  2H61 C;  1F55 A;  3I5H C;  3WXA A;  1DGV A;  1L2O B;  1Y0V H;  1K90 D;  1BLQ A;  1CMF A;  1M39 A;  1AUI B;  1K9K A;  1J7P A;  1OZS A;  1K2H A;  4BY5 A;  2PRU A;  1JSA A;  1FI5 A;  4FQO A;  3OB2 B;  2SCP A;  1UUR A;  2BE6 A;  3CZT X;  1MQ1 A;  1SBJ A;  1KCY A;  1B8L A;  1CLM A;  5HKW A;  1KSM A;  3RM1 A;  1J7Q A;  1K9U A;  1XK4 A;  2M49 B;  2WCE A;  2CCM A;  1UHJ A;  3KHE A;  3H4S E;  2WND A;  4D1E A;  1YTZ C;  4AQJ A;  1SR6 B;  4QJ4 B;  1KWO B;  2FJU B;  2MBX A;  2PAS A;  2M9G A;  1QIW A;  2JWW A;  2LV7 A;  1CDL A;  4JWQ A;  1BJF A;  3OX6 A;  1KK7 Z;  4PE0 A;  5JOL A;  1D1O A;  1DMO A;  2NCO A;  3O6B A;  1H8B A;  5KTY A;  5I2O A;  1J1D A;  1C7V A;  2OS8 B;  2QPT A;  3PSR A;  2LHL A;  4PDZ A;  1SL7 A;  1F54 A;  1FW4 A;  1C7W A;  1FPW A;  2L50 A;  3OP0 A;  2LNK A;  1YUU A;  2M7N A;  1L2O C;  1KQV A;  2BCB A;  3SIB A;  1XFW O;  2KQY A;  1SCM B;  4PE4 A;  1S36 A;  2F3Z A;  2KGB C;  2L0P A;  2LLU A;  4XJK A;  1YUR A;  2FCD A;  1TCF A;  3MSE B;  1BR1 B;  4PHJ A;  2AMI A;  2KSP A;  1QX2 A;  2G2B A;  3NSO A;  3DVJ A;  3RLZ A;  1CMG A;  2E6W A;  3KF9 A;  1BOC A;  4WQ2 A;  3OHM B;  1WLZ A;  1S1E A;  1YVL A;  4PE7 A;  2JNX A;  2KOT A;  2LAN A;  1BU3 A;  2V53 A;  4I5N B;  3WNX B;  1NWD A;  2LCP A;  2JXC A;  2LAP A;  5CPV A;  3GK1 A;  2L4I A;  2ZND A;  4YGB B;  2OPO A;  2WCF A;  3WHT B;  1NUB A;  2OS8 C;  1V1G A;  3JVT B;  1REC A;  1B4C A;  3VGO A;  1R2U A;  1YRT B;  2KFF A;  1DJG A;  3AKB A;  3AKA A;  1IRJ A;  3CLN A;  5AXI A;  1IKU A;  1Y1U A;  2F33 A;  1WRL A;  3KO0 A;  2CNP A;  4GNK B;  2LVK A;  2KAX A;  1Q80 A;  3AAK A;  5G08 A;  1XFZ O;  2Q4U A;  1IWQ A;  1OMD A;  1AP4 A;  2LUX A;  2LMV A;  1KQM B;  2LMT A;  1HQV A;  1W7I B;  3ZNI A;  4ETO A;  1MXE A;  2KBI A;  3SG5 A;  3E3R A;  4DUQ A;  1DJI A;  1B47 A;  1KFX S;  1MUX A;  4XJK B;  4CFQ A;  1GGW A;  1TNX A;  3EK4 A;  1F71 A;  1FF1 A;  2MAZ A;  2HQW A;  2CTN A;  1IH0 A;  1L7Z A;  4A4C A;  3BQ3 A;  1GJY A;  3CGA A;  2M0R A;  4HRE E;  4MZK A;  5CSN A;  4MN0 A;  2G9B A;  2Y4Q A;  2ZKM X;  3VRN A;  1M45 A;  2PSR A;  5GQQ C;  1H4B A;  2LP2 A;  4C0J A;  1S6I A;  2K8M B;  1PSR A;  3BOW A;  1RWY A;  1IGV A;  1LVC D;  1MR8 A;  1RJV A;  1WLM A;  2JPT A;  3I5F C;  4GFT A;  1F4O A;  1JWD A;  2M1K B;  2WCB A;  1SMG A;  4YGA A;  1W7J B;  3CTN A;  3PAT A;  1UHI A;  1E8A A;  1KQM C;  1TN4 A;  1A2X A;  1NPQ A;  2GGM A;  2K61 A;  4PHK A;  2LLS A;  1YRU B;  3SG4 A;  3CR4 X;  4GBA A;  1EL4 A;  3KPX A;  4ICB A;  5TNC A;  5HKY A;  1AHR A;  1IJ5 A;  4PCW A;  2CXJ A;  3SG2 A;  4MBE A;  1CFD A;  1DJX A;  1ALW A;  2AUC A;  1QIV A;  1M46 A;  2JT3 A;  3C1V A;  2BL0 C;  2I2R E;  3PLF B;  2M1U A;  4GUK A;  4DRW A;  5HYD A;  1SPY A;  2HF5 A;  2HPS A;  3PAL A;  2L5X B;  2O5G A;  1CM4 A;  1SYM A;  1CDM A;  1F70 A;  1G33 A;  1KK8 B;  1XVJ A;  2M8U A;  1QAT A;  1LIN A;  2KHN A;  1TTX A;  2M7L A;  4GGF C;  1BF5 A;  1A29 A;  3AAJ A;  3BUN B;  1NCX A;  3VRO A;  2PVB A;  3I5G B;  1S6J A;  2L2E A;  1SY9 A;  1AJ4 A;  2LM5 A;  3BUX B;  1CFP A;  1CB1 A;  1NP8 A;  4YGC B;  3HX4 A;  2LLT A;  3CR5 X;  3LL8 B;  3BOW B;  3LCP C;  1NSH A;  2CBL A;  1JF2 A;  1K95 A;  2GGZ A;  4YBH B;  5DKR A;  1M63 B;  1DJH A;  3PM8 A;  2MLE C;  2P6B B;  2JC2 A;  1U5I A;  1DF0 A;  1RFJ A;  3D0Y A;  4ZCU A;  4MEW A;  3TDU A;  3SIA A;  4HRH A;  1K9P A;  2K2A A;  3QRX A;  1S5G Y;  2I94 A;  2KI4 B;  2JT0 A;  3I5I B;  1A75 A;  2HQ8 A;  1SNL A;  1WDC B;  4PE1 A;  2BKH B;  3DVE A;  1ODB A;  2H2K A;  3TS5 B;  1QV0 A;  4IL1 A;  4CFR A;  2VRG A;  1XA5 A;  1QLK A;  4OR9 B;  1KFX L;  2F3Y A;  1B8R A;  5D7F A;  1QVI Z;  2HET A;  3BXK A;  2KBM A;  4MSP A;  3I5G C;  1J7R A;  1LA3 A;  4MRY A;  3FS7 A;  2Y1M A;  5IBW A;  1PK0 D;  2JQ6 A;  1SR6 C;  5BPJ A;  1KWO C;  1DT7 B;  3HCM A;  1UUS A;  4N5X A;  1G4Y R;  1DGU A;  1Y1A A;  4MZL A;  1IQ5 A;  2LVI A;  2KFG A;  2BCA A;  5I2L A;  4N1G A;  4AQI A;  3LLE A;  1VRK A;  1TIZ A;  1XO5 A;  4YI8 A;  3BUM B;  4NQG A;  2CT9 A;  1CNP A;  1OOJ A;  2K2F A;  4YI9 A;  1WY9 A;  5AFP A;  5B8I B;  1CLL A;  1LXF C;  3PN7 B;  3VRQ A;  1QVI Y;  1A03 A;  2H61 A;  2L4H A;  2LVJ A;  1S3P A;  4FTG A;  1SCM C;  2F2P A;  3D10 A;  1EG4 A;  2LUC A;  5DKN A;  1UHH A;  4I5J A;  4MRX A;  2F2O A;  5I8N A;  2KFH A;  2WOS A;  2NLN A;  2EC6 B;  3CS1 A;  1U5I B;  2Y5I A;  5CSF A;  3D0Y B;  1ZFS A;  1SK6 D;  1TOP A;  3SG3 A;  2ZFD A;  1CKK A;  2Y1N A;  5ER4 X;  1CFC A;  1PVA A;  2JT8 A;  1A75 B;  1M31 A;  1PSB A;  3LK1 A;  1JUO A;  2I7A A;  3EVU A;  1GGZ A;  1IG5 A;  1TCO B;  3EVV A;  1OMV A;  3NSI A;  1Y6W A;  2K7D A;  2ZRS A;  2Q91 A;  4I5L B;  2ZN9 A;  4DIR A;  3JVT C;  1XK4 C;  2BBN A;  2KYF A;  4PHN A;  1V1F A;  3VRP A;  2KI6 D;  3SG7 A;  3TDZ A;  1N2D A;  3JTD B;  4I5K A;  3TUY B;  1OE9 B;  1NCY A;  1Y1X A;  1PAL A;  2EGD A;  1NYA A;  1IJ6 A;  5D69 A;  3DVK A;  4GGN A;  1JBA A;  1MHO A;  3PFV A;  5AAN A;  1YX7 A;  4BY4 A;  4ZCV A;  1UP5 A;  2EHB A;  2LHI A;  2BKI B;  3DD4 A;  3K21 A;  4PAL A;  1RTP 1;  1AVS A;  1R6P A;  1ZUZ A;  2RGI A;  3I5H B;  1B1G A;  1BT6 A;  1XFV O;  4TNC A;  2K0J A;  1PRW A;  4GPL B;  4MLW A;  3TDI A;  1OQP A;  2L98 A;  2B1U A;  2NCP A;  1OZO A;  4MVF A;  1TNP A;  1DJZ A;  1NX1 A;  2AAO A;  2LP3 A;  2PMY A;  1YUS A;  2OTG B;  4XYN A;  1DVI A;  1F8H A;  1BOD A;  1SL9 A;  5ER5 A; 
#chains in the Genus database with same CATH topology
 3M0W A;  4NDD A;  4DCK A;  2O60 A;  3JTD C;  1TWO A;  4MZJ A;  4DS7 A;  2LC5 A;  3TUY C;  1ZAC A;  4QJ5 B;  5HLO A;  5DIC A;  2QDI A;  2KI6 C;  3NXA A;  1J55 A;  1YVH A;  2JU0 A;  4NDB A;  1B9A A;  4E68 A;  1J7O A;  2JTZ A;  4U8D A;  3DVM A;  1G8I A;  1S5G Z;  1QWV A;  3R72 A;  1K96 A;  3F45 A;  4JKT A;  4JQ0 D;  1JFJ A;  4CPV A;  4F7F A;  1RK9 A;  1S26 D;  2FCE A;  4INW A;  1X02 A;  2KYC A;  1JC2 A;  2MLF C;  4P2Y B;  1XYD A;  2JNF A;  1PVB A;  1QS7 A;  3NGV A;  1N65 A;  1SKT A;  3OB1 B;  5J3X A;  3SS4 A;  2WC8 A;  1LKJ A;  2F8P A;  3L47 A;  4A4B A;  1IQ3 A;  1DTL A;  2MJW B;  1QXP A;  4ORB B;  4OV2 A;  3S0D A;  5AER A;  2BEC A;  1FBV A;  4ORA B;  5F6T A;  4OKH A;  1JFK A;  1AJ5 A;  1W9Z A;  2OTG C;  1EG3 A;  4P5O E;  2FOT A;  3R1V A;  1SL8 A;  4WRI A;  2KNE A;  3S0G A;  1EH2 A;  1KK8 C;  2LVV A;  3D76 A;  2WC6 A;  2M29 A;  2PAL A;  4HSZ A;  5HKZ A;  3EK8 A;  1BMO A;  2NXQ A;  1QJT A;  3CZ2 A;  4OVN F;  3FWC A;  4Q04 A;  2ZNE A;  1ALV A;  3EVR A;  2WCK A;  3RZS A;  1QTX A;  1NX3 A;  1NX2 A;  2NZ0 A;  1HT9 A;  3FE8 A;  5KU1 A;  1QV1 A;  1QAS A;  5DKQ A;  1JF0 A;  2QEH A;  3DF0 A;  2JUL A;  2MA2 A;  3A4U B;  4C0L A;  1B8C A;  2I18 A;  2WOR A;  4WQ3 A;  3B7A A;  3SJS A;  1KFU S;  1RRO A;  2JTT A;  1K94 A;  3KEV A;  5HLV A;  3ZWH A;  1BG1 A;  3DXL A;  1A4P A;  1PUL A;  2GV5 A;  1J1E A;  2KAY A;  1KK7 Y;  2KAV A;  3FE9 A;  2KI4 C;  4PHM A;  3A8R A;  3I5I C;  1FI6 A;  1CM1 A;  1WDC C;  2SAS A;  3IQO A;  3NSL A;  3L4L A;  1B7T Z;  3TS5 C;  2E30 A;  2K7C A;  2JPO A;  2KDH A;  2COL B;  3FWB A;  1XFX O;  1DF0 B;  1K93 D;  3EKH A;  1GQM A;  1DJW A;  1WRZ A;  3CYZ A;  5AEQ A;  2DOQ A;  4GGF A;  3BUO B;  2A4J A;  4UPG A;  1DEK A;  1YX8 A;  1MF8 B;  1S6C A;  1TRF A;  1YR5 A;  2JXL A;  2TN4 A;  2JOJ A;  3O78 A;  2MHH A;  3OX5 A;  2BCX A;  1TNW A;  1XFU O;  3WHU B;  3GK2 A;  4N1F A;  1K8U A;  1AK8 A;  1XFY O;  2FJY A;  3EK7 A;  4JPZ B;  4CLN A;  1B7T Y;  1YUT A;  3GK4 X;  1TNQ A;  1OSA A;  4R1E A;  4YRU A;  3I5F B;  4ORC B;  5JJG A;  3GOF A;  1UHK A;  3PN7 C;  1MWN A;  1NCZ A;  3EKJ A;  4AOM A;  3D77 A;  2K7B A;  4YGD B;  3D78 A;  1NIW A;  2M97 A;  2KLE A;  1SRA A;  2QAC A;  1ZMZ A;  3DF0 B;  2ZRT A;  2LE9 B;  1BR4 B;  3BYA A;  4USL A;  1F4Q A;  3CAB A;  2LMU A;  4C0K A;  1CLB A;  5KSZ A;  2R2I A;  2MRD A;  3O4Y A;  2EC6 C;  3CZ1 A;  1SCV A;  4M2P A;  1QLS A;  2JZI A;  3ICB A;  2BBM A;  5PAL A;  4NDC A;  1CFF A;  1EJ3 A;  3VRR A;  2JRF A;  2BL0 B;  3CR2 A;  1C07 A;  4HRG A;  1CDN A;  1OOH A;  1UWO A;  5K89 A;  4YGE B;  2ISD A;  3NHI A;  2IS9 A;  1OMR A;  1ZOT B;  1IIO A;  1QX7 A;  1KSO A;  1OW4 A;  2KQ6 A;  1N0Y A;  3TZ1 A;  5I2Q A;  2BE4 A;  1UHN A;  2M3W A;  4QJ3 B;  3SG6 A;  3IQQ A;  2K7O A;  4M2Q A;  1LA0 A;  1QX5 B;  3B88 A;  3O2P A;  4F0Z B;  3NSK A;  1GM0 A;  5FYX A;  1WRK A;  2ZN8 A;  1CTR A;  4OCI A;  2KGR A;  3IF7 A;  2D8N A;  3BUW B;  1DJY A;  1SW8 A;  3O4X A;  3FIA A;  1EXR A;  5CSI A;  5CSJ A;  2KPH A;  3LK0 A;  4CID A;  4L9M A;  5HL1 A;  3CWG A;  1NX0 A;  2L51 A;  1MXL C;  4M2O A;  4GAO A;  4INX A;  1CDP A;  1KFU L;  3D75 A;  2H61 C;  1F55 A;  3I5H C;  3WXA A;  1DGV A;  1L2O B;  1Y0V H;  1K90 D;  1BLQ A;  1CMF A;  1M39 A;  1AUI B;  1K9K A;  1J7P A;  1OZS A;  1K2H A;  4BY5 A;  2PRU A;  1JSA A;  1FI5 A;  4FQO A;  3OB2 B;  2SCP A;  1UUR A;  2BE6 A;  3CZT X;  3UO9 A;  1MQ1 A;  1SBJ A;  3Q8I A;  1B8L A;  1CLM A;  3L4A A;  1KCY A;  5HKW A;  1KSM A;  3BFB A;  3RM1 A;  1P28 A;  1J7Q A;  1K9U A;  1XK4 A;  2M49 B;  2WCE A;  2CCM A;  1UHJ A;  3KHE A;  3H4S E;  2WND A;  3CZ0 A;  1YTZ C;  4AQJ A;  4D1E A;  1SR6 B;  4QJ4 B;  1KWO B;  2FJU B;  2MBX A;  2PAS A;  2M9G A;  1QIW A;  2JWW A;  2LV7 A;  1CDL A;  4JWQ A;  1BJF A;  3OX6 A;  1KK7 Z;  4PE0 A;  5JOL A;  1D1O A;  4JD9 A;  2NCO A;  1DMO A;  3O6B A;  1H8B A;  5KTY A;  1TUJ A;  1J1D A;  5I2O A;  2OS8 B;  2QPT A;  3PSR A;  2LHL A;  4PDZ A;  1SL7 A;  1C7V A;  1FW4 A;  1C7W A;  1FPW A;  2L50 A;  3OP0 A;  1DEL A;  2LNK A;  5EL2 A;  1YUU A;  2M7N A;  5FI6 A;  1L2O C;  1KQV A;  2BCB A;  3SIB A;  1XFW O;  2KQY A;  3OBV A;  1SCM B;  4PE4 A;  1S36 A;  2F3Z A;  2KGB C;  2L0P A;  2LLU A;  1T14 A;  4XJK A;  1YUR A;  2FCD A;  1TCF A;  3MSE B;  1BR1 B;  4PHJ A;  2AMI A;  2KSP A;  1QX2 A;  2G2B A;  3NSO A;  3DVJ A;  3RLZ A;  1CMG A;  3PJI A;  2E6W A;  3KF9 A;  1BOC A;  4WQ2 A;  3OHM B;  1WLZ A;  1S1E A;  1YVL A;  4PE7 A;  2JNX A;  3B87 A;  2QEO A;  2KOT A;  2LAN A;  1BU3 A;  3PM2 A;  2V53 A;  4I5N B;  3WNX B;  1NWD A;  2LCP A;  2JXC A;  2LAP A;  5CPV A;  3GK1 A;  2L4I A;  2ZND A;  4YGB B;  2PYQ A;  2OPO A;  2WCF A;  3WHT B;  1NUB A;  2WCM A;  1Z4H A;  2OS8 C;  1V1G A;  3JVT B;  3S0B A;  1REC A;  3DYE A;  1B4C A;  3VGO A;  1R2U A;  1LS8 A;  1YRT B;  3QME A;  2KFF A;  1DJG A;  3AKB A;  3AKA A;  1IRJ A;  3CLN A;  5FI7 A;  5AXI A;  1IKU A;  1Y1U A;  2F33 A;  1WRL A;  3KO0 A;  2CNP A;  4GNK B;  2LVK A;  2KAX A;  1Q80 A;  3AAK A;  5G08 A;  1XFZ O;  2Q4U A;  1IWQ A;  1OMD A;  1AP4 A;  2LUX A;  2LMV A;  1KQM B;  2LMT A;  1HQV A;  1W7I B;  3ZNI A;  4ETO A;  1MXE A;  2KBI A;  3SG5 A;  3E3R A;  4DUQ A;  1DJI A;  1B47 A;  1KFX S;  1MUX A;  4XJK B;  4CFQ A;  1GGW A;  1TNX A;  3S0E A;  3EK4 A;  1F71 A;  1FF1 A;  2MAZ A;  2HQW A;  2CTN A;  1IH0 A;  1C3Z A;  1L7Z A;  4A4C A;  3BQ3 A;  1GJY A;  3CGA A;  2M0R A;  4FQT A;  4HRE E;  4MZK A;  5CSN A;  3K1E A;  4MN0 A;  1TUZ A;  2G9B A;  2Y4Q A;  2K60 A;  2ZKM X;  1M45 A;  2PSR A;  5GQQ C;  3VRN A;  2LP2 A;  4C0J A;  1H4B A;  1S6I A;  2K8M B;  1PSR A;  3BOW A;  1RWY A;  1ORG A;  1IGV A;  1LVC D;  1MR8 A;  1RJV A;  1WLM A;  2JPT A;  3I5F C;  4GFT A;  1F4O A;  1JWD A;  2M1K B;  2QEB A;  2WCB A;  1SMG A;  4YGA A;  1W7J B;  3CTN A;  5D3O A;  2BAP A;  2QEV A;  1UHI A;  3PAT A;  1E8A A;  1KQM C;  1TN4 A;  1A2X A;  1NPQ A;  2GGM A;  2K61 A;  2GTE A;  4PHK A;  2LLS A;  1YRU B;  3SG4 A;  3CR4 X;  4GBA A;  1EL4 A;  3UNW A;  3KPX A;  4ICB A;  5TNC A;  5HKY A;  1OOG A;  1AHR A;  1IJ5 A;  4PCW A;  2CXJ A;  3SG2 A;  1OOF A;  2L5Y A;  4MBE A;  1CFD A;  1DJX A;  1ALW A;  2AUC A;  1QIV A;  1M46 A;  2JT3 A;  3C1V A;  2BL0 C;  2I2R E;  3PLF B;  3S0A A;  2M1U A;  4GUK A;  4DRW A;  5HYD A;  2L2C A;  1SPY A;  2HF5 A;  2HPS A;  2P71 A;  3PAL A;  2L5X B;  2O5G A;  1CM4 A;  1SYM A;  1CDM A;  1F70 A;  1G33 A;  1KK8 B;  1XVJ A;  2M8U A;  1QAT A;  1LIN A;  2KHN A;  1TTX A;  2M7L A;  4GGF C;  1BF5 A;  1A29 A;  3AAJ A;  3BUN B;  1NCX A;  3VRO A;  2PVB A;  3I5G B;  1S6J A;  2L2E A;  1SY9 A;  1AJ4 A;  2LM5 A;  3BUX B;  1CFP A;  1CB1 A;  3V2L A;  1NP8 A;  4YGC B;  3HX4 A;  2LLT A;  4PT1 A;  3CR5 X;  3LL8 B;  3BOW B;  3SS3 A;  3LCP C;  3OGN A;  1NSH A;  2CBL A;  1JF2 A;  1K95 A;  2GGZ A;  4YBH B;  5DKR A;  1M63 B;  1DJH A;  3PM8 A;  2MLE C;  2P6B B;  4OZD A;  3SS5 A;  2JC2 A;  1U5I A;  1DF0 A;  1RFJ A;  3D0Y A;  3B6X A;  4ZCU A;  4MEW A;  3TDU A;  2YGU A;  3SIA A;  4HRH A;  1K9P A;  2K2A A;  3QRX A;  1S5G Y;  2I94 A;  2KI4 B;  3IVT A;  3S0F A;  2JT0 A;  3I5I B;  1A75 A;  2BNX A;  1SNL A;  1WDC B;  2HQ8 A;  2WCL A;  2BKH B;  4PE1 A;  3DVE A;  1ODB A;  2H2K A;  3TS5 B;  1QV0 A;  4IL1 A;  1F54 A;  4CFR A;  2VRG A;  1XA5 A;  1QLK A;  3CDN A;  3DZT A;  1KFX L;  2H8V A;  3N7H A;  2F3Y A;  4IJ7 A;  1B8R A;  4OR9 B;  5D7F A;  1QVI Z;  2HET A;  3BXK A;  2KBM A;  4MSP A;  3I5G C;  5I94 A;  1J7R A;  3DY9 A;  1LA3 A;  2WCH A;  4MRY A;  3FS7 A;  2Y1M A;  5IBW A;  1PK0 D;  2JQ6 A;  1SR6 C;  5BPJ A;  1KWO C;  1DT7 B;  3HCM A;  1UUS A;  3NHT A;  1G4Y R;  1DGU A;  4N5X A;  1Y1A A;  4MZL A;  1IQ5 A;  2LVI A;  2KFG A;  2BCA A;  5I2L A;  4N1G A;  4AQI A;  3LLE A;  1VRK A;  1TIZ A;  1XO5 A;  4YI8 A;  3BUM B;  4NQG A;  2CT9 A;  1CNP A;  1OOJ A;  2K2F A;  4YI9 A;  1WY9 A;  5AFP A;  5B8I B;  1CLL A;  1LXF C;  3PN7 B;  3VRQ A;  1QVI Y;  1A03 A;  2H61 A;  2L4H A;  2LVJ A;  1S3P A;  4FTG A;  1SCM C;  2F2P A;  3D10 A;  1EG4 A;  2LUC A;  5DKN A;  1UHH A;  3BJH A;  4I5J A;  4MRX A;  2F2O A;  5I8N A;  2KFH A;  2WOS A;  2NLN A;  2EC6 B;  3D74 A;  1Z2C B;  3CS1 A;  1U5I B;  2Y5I A;  5CSF A;  1SSE B;  3D0Y B;  1ZFS A;  1SK6 D;  1TOP A;  3SG3 A;  2ZFD A;  1CKK A;  2Y1N A;  5ER4 X;  1CFC A;  1PVA A;  2JT8 A;  1A75 B;  1M31 A;  1PSB A;  3BFH A;  3LK1 A;  1JUO A;  5FI2 A;  2I7A A;  3EVU A;  1GGZ A;  1IG5 A;  1TCO B;  3EVV A;  1OMV A;  3NSI A;  1Y6W A;  2K7D A;  2ZRS A;  2Q91 A;  4I5L B;  1XFR A;  2ZN9 A;  4DIR A;  1DC1 A;  1DQE A;  3JVT C;  1XK4 C;  2BBN A;  2KYF A;  4PHN A;  1V1F A;  1C3Y A;  3VRP A;  2KI6 D;  3SG7 A;  3TDZ A;  3FE6 A;  1N2D A;  3JTD B;  4I5K A;  3TUY B;  1OE9 B;  1NCY A;  1Y1X A;  1PAL A;  2EGD A;  1NYA A;  1IJ6 A;  5D69 A;  2ERB A;  3DVK A;  3EG5 B;  4GGN A;  1JBA A;  1MHO A;  3PFV A;  3R1P A;  5AAN A;  1YX7 A;  4BY4 A;  4ZCV A;  1UP5 A;  2EHB A;  1OOI X;  2LHI A;  2BKI B;  3DD4 A;  3B86 A;  3K21 A;  4PAL A;  1RTP 1;  3BFA A;  1AVS A;  1R6P A;  1ZUZ A;  2RGI A;  3I5H B;  1B1G A;  2KLD A;  1BT6 A;  1XFV O;  2WCJ A;  2K0J A;  4TNC A;  2PQL A;  1PRW A;  4GPL B;  4KYN A;  2P70 A;  4MLW A;  1OQP A;  2L98 A;  2B1U A;  3TDI A;  2NCP A;  1OZO A;  4MVF A;  1TNP A;  3R1O A;  1DJZ A;  3VB1 A;  1NX1 A;  2AAO A;  2WC5 A;  2LP3 A;  2PMY A;  1YUS A;  2OTG B;  4XYN A;  1DVI A;  1F8H A;  1BOD A;  3D73 A;  1SL9 A;  5ER5 A; 
#chains in the Genus database with same CATH homology
 3M0W A;  4NDD A;  4DCK A;  2O60 A;  3JTD C;  4DS7 A;  4MZJ A;  3TUY C;  2LC5 A;  1ZAC A;  4QJ5 B;  5HLO A;  2KI6 C;  3NXA A;  1J55 A;  1YVH A;  2JU0 A;  4NDB A;  1B9A A;  4E68 A;  1J7O A;  2JTZ A;  4U8D A;  3DVM A;  1G8I A;  1S5G Z;  1JFJ A;  1K96 A;  3F45 A;  4JQ0 D;  4CPV A;  1RK9 A;  1S26 D;  2FCE A;  1X02 A;  2KYC A;  1JC2 A;  2MLF C;  4P2Y B;  1XYD A;  2JNF A;  1PVB A;  1QS7 A;  1N65 A;  1SKT A;  3OB1 B;  5J3X A;  2WC8 A;  1LKJ A;  2F8P A;  1IQ3 A;  4A4B A;  1DTL A;  2MJW B;  1QXP A;  4ORB B;  4OV2 A;  5AER A;  2BEC A;  1FBV A;  4ORA B;  5F6T A;  4OKH A;  1JFK A;  1AJ5 A;  2OTG C;  1EG3 A;  4P5O E;  2FOT A;  1SL8 A;  4WRI A;  2KNE A;  1EH2 A;  1KK8 C;  2LVV A;  4HSZ A;  2M29 A;  2PAL A;  5HKZ A;  3EK8 A;  1BMO A;  2NXQ A;  1QJT A;  4OVN F;  4Q04 A;  3FWC A;  2ZNE A;  1ALV A;  3EVR A;  1QTX A;  1NX3 A;  1NX2 A;  2NZ0 A;  1HT9 A;  5KU1 A;  1QV1 A;  1QAS A;  5DKQ A;  1JF0 A;  3DF0 A;  2JUL A;  2MA2 A;  3A4U B;  4C0L A;  1B8C A;  2I18 A;  2WOR A;  4WQ3 A;  3SJS A;  1KFU S;  1RRO A;  2JTT A;  1K94 A;  3KEV A;  5HLV A;  3ZWH A;  1BG1 A;  1A4P A;  1PUL A;  2GV5 A;  1J1E A;  2KAY A;  1KK7 Y;  2KAV A;  2KI4 C;  4PHM A;  3A8R A;  3I5I C;  1FI6 A;  1CM1 A;  1WDC C;  2SAS A;  3IQO A;  3NSL A;  1B7T Z;  3TS5 C;  2E30 A;  2K7C A;  2KDH A;  2COL B;  3FWB A;  1XFX O;  1DF0 B;  1K93 D;  3EKH A;  1GQM A;  1DJW A;  1WRZ A;  5AEQ A;  2DOQ A;  4GGF A;  3BUO B;  2A4J A;  4UPG A;  1YX8 A;  1MF8 B;  1S6C A;  1TRF A;  1YR5 A;  2JXL A;  2TN4 A;  2JOJ A;  3O78 A;  2MHH A;  3OX5 A;  2BCX A;  1TNW A;  1XFU O;  3WHU B;  3GK2 A;  4N1F A;  1K8U A;  1AK8 A;  1XFY O;  4JPZ B;  3EK7 A;  4CLN A;  1B7T Y;  1YUT A;  3GK4 X;  1TNQ A;  1OSA A;  4R1E A;  4YRU A;  3I5F B;  4ORC B;  5JJG A;  3GOF A;  1UHK A;  3PN7 C;  1MWN A;  1NCZ A;  3EKJ A;  4AOM A;  2K7B A;  4YGD B;  1NIW A;  2M97 A;  1SRA A;  2QAC A;  1ZMZ A;  3DF0 B;  2ZRT A;  2LE9 B;  1BR4 B;  3BYA A;  4USL A;  1F4Q A;  1CLB A;  2LMU A;  4C0K A;  5KSZ A;  2R2I A;  2MRD A;  3O4Y A;  2EC6 C;  1SCV A;  4M2P A;  1QLS A;  2JZI A;  3ICB A;  2BBM A;  5PAL A;  4NDC A;  1CFF A;  1EJ3 A;  3VRR A;  2JRF A;  2BL0 B;  3CR2 A;  1C07 A;  4HRG A;  1CDN A;  1UWO A;  5K89 A;  4YGE B;  2ISD A;  2IS9 A;  1OMR A;  1ZOT B;  1QX7 A;  1KSO A;  2KQ6 A;  1N0Y A;  3TZ1 A;  5I2Q A;  2BE4 A;  1UHN A;  2M3W A;  4QJ3 B;  3SG6 A;  3IQQ A;  2K7O A;  4M2Q A;  1LA0 A;  1QX5 B;  3O2P A;  4F0Z B;  3NSK A;  5FYX A;  1WRK A;  2ZN8 A;  1CTR A;  4OCI A;  2KGR A;  3IF7 A;  2D8N A;  3BUW B;  1DJY A;  1SW8 A;  3FIA A;  1EXR A;  5CSI A;  5CSJ A;  3LK0 A;  4CID A;  4L9M A;  3CWG A;  1NX0 A;  2L51 A;  1MXL C;  4M2O A;  4GAO A;  1CDP A;  1KFU L;  2H61 C;  1F55 A;  3I5H C;  3WXA A;  1DGV A;  1L2O B;  1Y0V H;  1K90 D;  1BLQ A;  1CMF A;  1M39 A;  1AUI B;  1K9K A;  1J7P A;  1OZS A;  1K2H A;  4BY5 A;  2PRU A;  1JSA A;  1FI5 A;  4FQO A;  3OB2 B;  2SCP A;  1UUR A;  2BE6 A;  3CZT X;  1MQ1 A;  1SBJ A;  1KCY A;  1B8L A;  1CLM A;  5HKW A;  1KSM A;  3RM1 A;  1J7Q A;  1K9U A;  1XK4 A;  2M49 B;  2WCE A;  2CCM A;  1UHJ A;  3KHE A;  3H4S E;  2WND A;  4D1E A;  1YTZ C;  4AQJ A;  1SR6 B;  4QJ4 B;  1KWO B;  2FJU B;  2MBX A;  2PAS A;  2M9G A;  1QIW A;  2JWW A;  2LV7 A;  1CDL A;  4JWQ A;  1BJF A;  3OX6 A;  1KK7 Z;  4PE0 A;  5JOL A;  1D1O A;  1DMO A;  2NCO A;  3O6B A;  1H8B A;  5KTY A;  5I2O A;  1J1D A;  1C7V A;  2OS8 B;  2QPT A;  3PSR A;  2LHL A;  4PDZ A;  1SL7 A;  1F54 A;  1FW4 A;  1C7W A;  1FPW A;  2L50 A;  3OP0 A;  2LNK A;  1YUU A;  2M7N A;  1L2O C;  1KQV A;  2BCB A;  3SIB A;  1XFW O;  2KQY A;  1SCM B;  4PE4 A;  1S36 A;  2F3Z A;  2KGB C;  2L0P A;  2LLU A;  4XJK A;  1YUR A;  2FCD A;  1TCF A;  3MSE B;  1BR1 B;  4PHJ A;  2AMI A;  2KSP A;  1QX2 A;  2G2B A;  3NSO A;  3DVJ A;  3RLZ A;  1CMG A;  2E6W A;  3KF9 A;  1BOC A;  4WQ2 A;  3OHM B;  1WLZ A;  1S1E A;  1YVL A;  4PE7 A;  2JNX A;  2KOT A;  2LAN A;  1BU3 A;  2V53 A;  4I5N B;  3WNX B;  1NWD A;  2LCP A;  2JXC A;  2LAP A;  5CPV A;  3GK1 A;  2L4I A;  2ZND A;  4YGB B;  2OPO A;  2WCF A;  3WHT B;  1NUB A;  2OS8 C;  1V1G A;  3JVT B;  1REC A;  1B4C A;  3VGO A;  1R2U A;  1YRT B;  2KFF A;  1DJG A;  3AKB A;  3AKA A;  1IRJ A;  3CLN A;  5AXI A;  1IKU A;  1Y1U A;  2F33 A;  1WRL A;  3KO0 A;  2CNP A;  4GNK B;  2LVK A;  2KAX A;  1Q80 A;  3AAK A;  5G08 A;  1XFZ O;  2Q4U A;  1IWQ A;  1OMD A;  1AP4 A;  2LUX A;  2LMV A;  1KQM B;  2LMT A;  1HQV A;  1W7I B;  3ZNI A;  4ETO A;  1MXE A;  2KBI A;  3SG5 A;  3E3R A;  4DUQ A;  1DJI A;  1B47 A;  1KFX S;  1MUX A;  4XJK B;  4CFQ A;  1GGW A;  1TNX A;  3EK4 A;  1F71 A;  1FF1 A;  2MAZ A;  2HQW A;  2CTN A;  1IH0 A;  1L7Z A;  4A4C A;  3BQ3 A;  1GJY A;  3CGA A;  2M0R A;  4HRE E;  4MZK A;  5CSN A;  4MN0 A;  2G9B A;  2Y4Q A;  2ZKM X;  3VRN A;  1M45 A;  2PSR A;  5GQQ C;  1H4B A;  2LP2 A;  4C0J A;  1S6I A;  2K8M B;  1PSR A;  3BOW A;  1RWY A;  1IGV A;  1LVC D;  1MR8 A;  1RJV A;  1WLM A;  2JPT A;  3I5F C;  4GFT A;  1F4O A;  1JWD A;  2M1K B;  2WCB A;  1SMG A;  4YGA A;  1W7J B;  3CTN A;  3PAT A;  1UHI A;  1E8A A;  1KQM C;  1TN4 A;  1A2X A;  1NPQ A;  2GGM A;  2K61 A;  4PHK A;  2LLS A;  1YRU B;  3SG4 A;  3CR4 X;  4GBA A;  1EL4 A;  3KPX A;  4ICB A;  5TNC A;  5HKY A;  1AHR A;  1IJ5 A;  4PCW A;  2CXJ A;  3SG2 A;  4MBE A;  1CFD A;  1DJX A;  1ALW A;  2AUC A;  1QIV A;  1M46 A;  2JT3 A;  3C1V A;  2BL0 C;  2I2R E;  3PLF B;  2M1U A;  4GUK A;  4DRW A;  5HYD A;  1SPY A;  2HF5 A;  2HPS A;  3PAL A;  2L5X B;  2O5G A;  1CM4 A;  1SYM A;  1CDM A;  1F70 A;  1G33 A;  1KK8 B;  1XVJ A;  2M8U A;  1QAT A;  1LIN A;  2KHN A;  1TTX A;  2M7L A;  4GGF C;  1BF5 A;  1A29 A;  3AAJ A;  3BUN B;  1NCX A;  3VRO A;  2PVB A;  3I5G B;  1S6J A;  2L2E A;  1SY9 A;  1AJ4 A;  2LM5 A;  3BUX B;  1CFP A;  1CB1 A;  1NP8 A;  4YGC B;  3HX4 A;  2LLT A;  3CR5 X;  3LL8 B;  3BOW B;  3LCP C;  1NSH A;  2CBL A;  1JF2 A;  1K95 A;  2GGZ A;  4YBH B;  5DKR A;  1M63 B;  1DJH A;  3PM8 A;  2MLE C;  2P6B B;  2JC2 A;  1U5I A;  1DF0 A;  1RFJ A;  3D0Y A;  4ZCU A;  4MEW A;  3TDU A;  3SIA A;  4HRH A;  1K9P A;  2K2A A;  3QRX A;  1S5G Y;  2I94 A;  2KI4 B;  2JT0 A;  3I5I B;  1A75 A;  2HQ8 A;  1SNL A;  1WDC B;  4PE1 A;  2BKH B;  3DVE A;  1ODB A;  2H2K A;  3TS5 B;  1QV0 A;  4IL1 A;  4CFR A;  2VRG A;  1XA5 A;  1QLK A;  4OR9 B;  1KFX L;  2F3Y A;  1B8R A;  5D7F A;  1QVI Z;  2HET A;  3BXK A;  2KBM A;  4MSP A;  3I5G C;  1J7R A;  1LA3 A;  4MRY A;  3FS7 A;  2Y1M A;  5IBW A;  1PK0 D;  2JQ6 A;  1SR6 C;  5BPJ A;  1KWO C;  1DT7 B;  3HCM A;  1UUS A;  4N5X A;  1G4Y R;  1DGU A;  1Y1A A;  4MZL A;  1IQ5 A;  2LVI A;  2KFG A;  2BCA A;  5I2L A;  4N1G A;  4AQI A;  3LLE A;  1VRK A;  1TIZ A;  1XO5 A;  4YI8 A;  3BUM B;  4NQG A;  2CT9 A;  1CNP A;  1OOJ A;  2K2F A;  4YI9 A;  1WY9 A;  5AFP A;  5B8I B;  1CLL A;  1LXF C;  3PN7 B;  3VRQ A;  1QVI Y;  1A03 A;  2H61 A;  2L4H A;  2LVJ A;  1S3P A;  4FTG A;  1SCM C;  2F2P A;  3D10 A;  1EG4 A;  2LUC A;  5DKN A;  1UHH A;  4I5J A;  4MRX A;  2F2O A;  5I8N A;  2KFH A;  2WOS A;  2NLN A;  2EC6 B;  3CS1 A;  1U5I B;  2Y5I A;  5CSF A;  3D0Y B;  1ZFS A;  1SK6 D;  1TOP A;  3SG3 A;  2ZFD A;  1CKK A;  2Y1N A;  5ER4 X;  1CFC A;  1PVA A;  2JT8 A;  1A75 B;  1M31 A;  1PSB A;  3LK1 A;  1JUO A;  2I7A A;  3EVU A;  1GGZ A;  1IG5 A;  1TCO B;  3EVV A;  1OMV A;  3NSI A;  1Y6W A;  2K7D A;  2ZRS A;  2Q91 A;  4I5L B;  2ZN9 A;  4DIR A;  3JVT C;  1XK4 C;  2BBN A;  2KYF A;  4PHN A;  1V1F A;  3VRP A;  2KI6 D;  3SG7 A;  3TDZ A;  1N2D A;  3JTD B;  4I5K A;  3TUY B;  1OE9 B;  1NCY A;  1Y1X A;  1PAL A;  2EGD A;  1NYA A;  1IJ6 A;  5D69 A;  3DVK A;  4GGN A;  1JBA A;  1MHO A;  3PFV A;  5AAN A;  1YX7 A;  4BY4 A;  4ZCV A;  1UP5 A;  2EHB A;  2LHI A;  2BKI B;  3DD4 A;  3K21 A;  4PAL A;  1RTP 1;  1AVS A;  1R6P A;  1ZUZ A;  2RGI A;  3I5H B;  1B1G A;  1BT6 A;  1XFV O;  4TNC A;  2K0J A;  1PRW A;  4GPL B;  4MLW A;  3TDI A;  1OQP A;  2L98 A;  2B1U A;  2NCP A;  1OZO A;  4MVF A;  1TNP A;  1DJZ A;  1NX1 A;  2AAO A;  2LP3 A;  2PMY A;  1YUS A;  2OTG B;  4XYN A;  1DVI A;  1F8H A;  1BOD A;  1SL9 A;  5ER5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...