2KI6C

The fgf1-s100a13-c2a hetero-hexameric complex structure: a component in the non-classical pathway for fgf1 secretion
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
b'MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synaptotagmin-1
publication title The heterohexameric complex structure, a component in the non-classical pathway for fibroblast growth factor 1 (FGF1) secretion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 35
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ki6C00
2KI6D 2Y5IA 4QJ5B 1YX7A 2FCEA 5HKWA 3VRRA 2L98A 2LVJA 3PATA 2RGIA 1F54A 1BT6A 3OP0A 1JF0A 1V1GA 1ALWA 1IG5A 1CM1A 2DOQA 1WLZA 2WORA 4MN0A 4BY4A 1NX2A 3TDZA 1NIWA 1EXRA 2M1UA 3PN7C 1B8CA 1SKTA 4CFQA 2LANA 5CSFA 2EHBA 2F33A 1IQ3A 4ORCB 1WLMA 4I5KA 2SCPA 2MHHA 2GV5A 1GGZA 1R6PA 2BCBA 1OMDA 2KBIA 2LVVA 1NUBA 1S1EA 3HX4A 3I5HB 1CFCA 2K7DA 2KFHA 1E8AA 1NX0A 2ZRTA 1KSOA 1YVLA 1IJ6A 3VGOA 3O2PA 1Y1UA 4NDCA 1Y1XA 2I94A 2WCBA 2M97A 1RWYA 3OB2B 5KSZA 1LXFC 4MBEA 4M2QA 2HETA 1EL4A 1BODA 1AJ5A 1YR5A 5HKYA 1UHNA 1D1OA 1SL8A 4FTGA 3OB1B 5I2LA 2E6WA 3TUYC 1SW8A 5PALA 1R2UA 5DKQA 2NCPA 5AXIA 4YBHB 3SG6A 3MSEB 2COLB 2H61C 5G08A 1TCFA 3K21A 5HLVA 1DJGA 2BL0C 4R1EA 1DT7B 2EC6C 2KYCA 3LK0A 1SYMA 2A4JA 3BUNB 4PHNA 2MLFC 2KAXA 2JT0A 2MAZA 2PVBA 2JWWA 1J1EA 1ODBA 4OV2A 3PN7B 4QJ3B 2WCEA 5GQQC 2HF5A 2JT3A 1QIVA 1JUOA 3VRPA 2M3WA 5AEQA 1B1GA 1BF5A 1QLSA 1BMOA 2KI4C 4ORBB 4YGDB 4MZLA 1A2XA 2LC5A 2EGDA 1PK0D 1CNPA 1YURA 1CMGA 4MZJA 1X02A 1JFJA 2QACA 2JZIA 3O78A 1NX3A 1U5IA 2L4IA 2SASA 4OR9B 5CPVA 2JRFA 2BCXA 1FBVA 4DIRA 1Y0VH 2NLNA 1CLMA 4A4CA 1A03A 1F8HA 4C0KA 3SIBA 3I5GC 2BCAA 2ZKMX 1YX8A 3GK2A 3O4YA 3TUYB 1JC2A 2AMIA 4DUQA 2HPSA 1NYAA 2KFGA 1GQMA 1KWOC 1S26D 2OTGC 1EH2A 1K2HA 3EK7A 3CGAA 1J1DA 1BR4B 2BL0B 2K2FA 3NSKA 1IGVA 1UHHA 1YUSA 3LK1A 1KQMB 2TN4A 1CFDA 4I5LB 4GAOA 2LHLA 1SBJA 2F3YA 1Y1AA 2PSRA 2M1KB 3DVEA 1K9KA 4I5JA 4HRGA 1TOPA 2CTNA 4YI8A 3WHTB 3A4UB 1AVSA 4M2OA 3CLNA 2H2KA 2Q4UA 1FI6A 2K7OA 2JTTA 1SNLA 2KI4B 1IRJA 1W7JB 5HLOA 1KCYA 4PE1A 1NP8A 1WRZA 1DJHA 1RK9A 4PE4A 1KFXS 1A29A 2JNFA 3A8RA 3BYAA 4YGBB 1SCVA 2KHNA 4WQ3A 2LHIA 3I5GB 2WNDA 3DF0A 1PVAA 1UP5A 2KYFA 2M0RA 2M8UA 4GUKA 4XJKA 1C7VA 3EK8A 1WRLA 2LM5A 1YUUA 2Y4QA 1KWOB 3D0YA 2OTGB 2LUXA 1W7IB 1CMFA 2CBLA 4JWQA 2LE9B 2I18A 1AUIB 4DCKA 1QV1A 4ZCVA 1MWNA 4PHJA 1DJYA 2V53A 5HYDA 1L7ZA 1BR1B 5BPJA 5I2QA 4N1GA 4GFTA 1SK6D 2E30A 3DVMA 1XYDA 4NDBA 3JTDC 3RLZA 2JC2A 1TIZA 4ICBA 3O6BA 2F8PA 2LMUA 1K9PA 2BKHB 2FOTA 1A4PA 1QIWA 3EK4A 4MRYA 1PSBA 2KAYA 2WCFA 3BUOB 2FJUB 3KHEA 1J55A 1B7TZ 2KQYA 5JOLA 2O60A 2KGRA 1UHJA 2NZ0A 1RJVA 1MXEA 3IQQA 5TNCA 1AHRA 1SL9A 1F4QA 1QXPA 2LVKA 2O5GA 1SY9A 1XA5A 3SG2A 1EG3A 2KFFA 1S6IA 2KSPA 2BBMA 1RECA 1WRKA 4NDDA 1AP4A 1S36A 1YRTB 2HQWA 1OE9B 1KK7Z 2Q91A 1F4OA 3CR2A 1CM4A 3DF0B 4XJKB 1M31A 1S5GZ 1SPYA 2WOSA 4N5XA 2FCDA 1S3PA 5I2OA 2M7LA 3D0YB 2ZNEA 5FYXA 1ZMZA 1KSMA 1B8LA 2GGMA 2L0PA 4USLA 2JT8A 2PASA 1OMRA 2K2AA 4F0ZB 1NX1A 4CPVA 1KK8C 1RROA 2MJWB 3DVJA 1IJ5A 1SCMB 5D69A 1KQMC 1DJIA 2OS8C 3KO0A 4XYNA 3SG3A 4HRHA 4GBAA 1QV0A 2VRGA 1TNPA 1Y6WA 1K8UA 4PDZA 1XFYO 3JTDB 1CDPA 4YGCB 1TN4A 3LLEA 4YGEB 4CIDA 1SL7A 3ZWHA 4GGNA 2MA2A 1TRFA 2JU0A 1OQPA 1JBAA 2KQ6A 1F55A 5CSIA 5J3XA 1B8RA 1H4BA 1DJWA 1CLLA 2Y1MA 1K93D 1CDNA 2Y1NA 2HQ8A 3BXKA 4M2PA 1XFWO 4L9MA 2K61A 3EVUA 1JF2A 1BG1A 3CS1A 2LV7A 3NSOA 1DF0A 5ER5A 1EG4A 1PRWA 2F2OA 3PM8A 1XO5A 4Q04A 4P5OE 3SG4A 1B9AA 1QJTA 1JSAA 1Q80A 4PHMA 1OSAA 3I5FC 2LP2A 3M0WA 3GK4X 1SMGA 3D10A 3ZNIA 3CR4X 1CTRA 1KK8B 5F6TA 3BUMB 1G8IA 2KGBC 1G4YR 1K94A 2OS8B 4I5NB 2K0JA 1YUTA 2LNKA 4MRXA 1N2DA 3IF7A 1XFXO 1B4CA 3TS5C 4A4BA 3AKBA 4PE0A 4HREE 4PALA 2LMTA 1OMVA 3E3RA 4UPGA 2L4HA 1MUXA 1TNQA 1QX7A 1SR6B 2BE6A 2L51A 3HCMA 4D1EA 1MF8B 2KDHA 1L2OB 1M45A 1DMOA 3PSRA 5AFPA 1MXLC 1ALVA 1V1FA 1U5IB 1QASA 2JTZA 5IBWA 3AKAA 1J7OA 1LKJA 1IKUA 4MEWA 1B7TY 1XK4A 3BOWA 1SRAA 1J7RA 1BU3A 1ZOTB 3EVVA 3SG7A 3I5IB 3IQOA 1XFVO 2F2PA 2LVIA 1AJ4A 3I5FB 4WRIA 1NCYA 4ZCUA 1NCZA 2M9GA 1OOJA 1NWDA 4WQ2A 1QTXA 1UWOA 5DKNA 1KK7Y 3KPXA 2PALA 1SCMC 2K7BA 4GGFA 4GGFC 1S5GY 4ETOA 2ZRSA 2CNPA 3TS5B 5I8NA 5AERA 1OZSA 1S6JA 1UURA 4OVNF 1K95A 3C1VA 2NCOA 2IS9A 3GK1A 2KI6C 3SG5A 4AQIA 1BOCA 4JPZB 4BY5A 4C0JA 2CXJA 5CSNA 2ISDA 5HKZA 4HSZA 1QVIZ 2BKIB 1ZACA 2P6BB 3CZTX 4GPLB 1DTLA 1UHIA 2K7CA 2MBXA 3KF9A 1XFZO 5KU1A 1QX2A 3OX5A 2K8MB 3EVRA 3JVTC 3H4SE 4N1FA 3BOWB 3FWBA 1FI5A 3TDUA 1QX5B 3CR5X 1CB1A 1NSHA 5CSJA 2R2IA 2PRUA 1JFKA 5B8IB 4P2YB 2MRDA 3SJSA 3BUWB 5D7FA 1F70A 2L5XB 1LINA 2QPTA 1J7QA 3BUXB 1YRUB 1HQVA 3CWGA 4DS7A 2G2BA 1S6CA 3EKHA 4PHKA 1MR8A 2LLUA 1CFPA 1RFJA 1GJYA 2F3ZA 2LCPA 3TZ1A 2CCMA 3TDIA 1H8BA 3PFVA 2D8NA 1MQ1A 2M7NA 1GGWA 1OZOA 3F45A 1A75A 2OPOA 2ZN8A 4IL1A 1K90D 1SR6C 4ORAB 4AOMA 1ZFSA 1DGUA 4CFRA 1L2OC 2LP3A 2H61A 3OHMB 1IH0A 1TTXA 2BE4A 1BLQA 1C7WA 3CTNA 3FS7A 1BJFA 1N0YA 3JVTB 1M63B 1PALA 1CDMA 2KNEA 1WDCC 2LMVA 2NXQA 1NCXA 1CKKA 1RTP1 4JQ0D 3I5IC 1AK8A 1CLBA 1YVHA 4YI9A 1B47A 2JOJA 3AAKA 3DD4A 1TCOB 4OCIA 2LAPA 2M29A 3OX6A 2LLSA 1FF1A 3NSIA 1YTZC 1UHKA 3AAJA 4OKHA 1PVBA 1WY9A 1XVJA 4C0LA 4YGAA 2I2RE 4FQOA 4YRUA 3PLFB 2B1UA 1QLKA 2ZFDA 1FW4A 3ICBA 3WHUB 2WC8A 1G33A 1TNWA 2AAOA 2JXLA 5JJGA 3RM1A 2AUCA 2M49B 1A75B 1MHOA 1JWDA 3KEVA 1EJ3A 1IWQA 1KFXL 2BECA 1KFUL 4MSPA 3BQ3A 1IQ5A 1DGVA 3QRXA 3WNXB 2ZNDA 2EC6B 3NXAA 2GGZA 3DVKA 3LL8B 4MZKA 5DKRA 2LLTA 2JXCA 3LCPC 1UUSA 1TNXA 2JNXA 1J7PA 1LA3A 1QVIY 4QJ4B 3VRNA 1N65A 1QATA 1WDCB 1DF0B 1XK4C 1KQVA 2PMYA 1QS7A 1VRKA 4AQJA 1CFFA 2KAVA 1M46A 2LUCA 2JULA 4GNKB 1F71A 4NQGA 4E68A 1M39A 2MLEC 1FPWA 3I5HC 5KTYA 3VRQA 1LVCD 2I7AA 2JQ6A 4U8DA 1ZUZA 3FIAA 3NSLA 5AANA 1CDLA 2JPTA 4CLNA 1K9UA 1NPQA 3GOFA 2BBNA 3SIAA 1DJZA 1DJXA 1KFUS 4MVFA 4PE7A 1DVIA 2L50A 4DRWA 1C07A 2G9BA 1HT9A 1K96A 1PULA 2ZN9A 1XFUO 5ER4X 3PALA 4MLWA 1PSRA 2L2EA 4TNCA 3VROA 3WXAA 3FWCA 5K89A 2KOTA 2KBMA 3EKJA 2CT9A 1LA0A 4PCWA
chains in the Genus database with same CATH superfamily
2KI6D 2KLEA 2Y5IA 3CZ0A 4QJ5B 2GTEA 1YX7A 2FCEA 5HKWA 3VRRA 2L98A 2LVJA 3PATA 2RGIA 1F54A 1BT6A 3OP0A 3RZSA 2L2CA 1JF0A 1V1GA 4INXA 1ALWA 1IG5A 1CM1A 2DOQA 1WLZA 2WORA 4MN0A 4BY4A 1NX2A 3B88A 3TDZA 1NIWA 2KPHA 1EXRA 2M1UA 3S0GA 3PN7C 1B8CA 1SKTA 4CFQA 2LANA 5CSFA 3L4AA 2EHBA 2F33A 1IQ3A 4ORCB 1WLMA 4I5KA 2SCPA 3FE9A 2MHHA 2GV5A 1GGZA 1R6PA 2BCBA 1OMDA 2KBIA 2LVVA 1NUBA 1S1EA 3HX4A 2QEBA 3I5HB 1CFCA 2K7DA 2KFHA 2K60A 1E8AA 1NX0A 2ZRTA 1KSOA 1YVLA 1IJ6A 3VGOA 3O2PA 1Y1UA 4NDCA 1Y1XA 2I94A 2WCBA 2M97A 1RWYA 3OB2B 4IJ7A 5KSZA 1LXFC 3IVTA 4MBEA 4M2QA 3CYZA 2HETA 1EL4A 1BODA 1AJ5A 1YR5A 5HKYA 3R1OA 1UHNA 1D1OA 1SL8A 4FTGA 3OB1B 5I2LA 2E6WA 3TUYC 1C3YA 1SW8A 5PALA 1R2UA 5DKQA 2NCPA 5AXIA 4YBHB 3SG6A 3PM2A 3MSEB 1SSEB 2COLB 2H61C 4FQTA 1TCFA 3K21A 5G08A 1DJGA 2BL0C 5HLVA 1XFRA 4R1EA 1DT7B 2EC6C 2KYCA 3LK0A 1SYMA 2A4JA 3BUNB 4PHNA 2MLFC 2KAXA 2JT0A 2MAZA 2PVBA 2JWWA 1J1EA 1ODBA 4OV2A 3PN7B 4QJ3B 2WCEA 5GQQC 2HF5A 1T14A 2JT3A 1QIVA 1JUOA 3VRPA 2M3WA 3DYEA 5AEQA 2WCJA 1BF5A 1B1GA 1QLSA 1BMOA 3S0EA 2KI4C 4ORBB 4YGDB 4JD9A 4MZLA 1A2XA 5DICA 2LC5A 2EGDA 1PK0D 1CNPA 1YURA 1CMGA 4MZJA 1X02A 3SS4A 1JFJA 1ORGA 2QACA 2JZIA 3O78A 1NX3A 1U5IA 2L4IA 2SASA 4OR9B 5CPVA 2JRFA 2BCXA 3S0BA 1FBVA 4DIRA 1Y0VH 2NLNA 1CLMA 3BFAA 4A4CA 1A03A 1F8HA 4C0KA 3SIBA 1TUJA 3I5GC 3BFHA 2BCAA 2ZKMX 1YX8A 3GK2A 3O4YA 1Z2CB 3TUYB 2AMIA 4DUQA 1JC2A 2HPSA 1NYAA 2KFGA 1GQMA 1KWOC 1S26D 2OTGC 1EH2A 1K2HA 3EK7A 3CGAA 2WCKA 1J1DA 1BR4B 2BL0B 2K2FA 3NSKA 3O4XA 1IGVA 1UHHA 1YUSA 3LK1A 1KQMB 2TN4A 1CFDA 4I5LB 4GAOA 2LHLA 1SBJA 2F3YA 1Y1AA 3B86A 2PSRA 2M1KB 3DVEA 1K9KA 4I5JA 4HRGA 1TOPA 1LS8A 2CTNA 4YI8A 3WHTB 3A4UB 3BJHA 1AVSA 4M2OA 3CLNA 2H2KA 2Q4UA 1FI6A 2K7OA 4INWA 2JTTA 1SNLA 2KI4B 1IRJA 1W7JB 5HLOA 1KCYA 4PE1A 2BAPA 1NP8A 1WRZA 3S0AA 3S0DA 1DJHA 1RK9A 4PE4A 1KFXS 1OOGA 1A29A 3B6XA 2JNFA 3A8RA 3BYAA 4YGBB 1SCVA 2KHNA 3DZTA 4WQ3A 2LHIA 3I5GB 2WNDA 3D75A 3DF0A 1PVAA 1UP5A 2KYFA 2M0RA 2M8UA 4GUKA 4PT1A 4XJKA 3CABA 3EK8A 1C7VA 1WRLA 2LM5A 1YUUA 2Y4QA 1KWOB 3D0YA 2OTGB 2LUXA 1W7IB 1CMFA 2CBLA 4JWQA 2LE9B 2I18A 3R1VA 1AUIB 4DCKA 1QV1A 4ZCVA 1MWNA 4PHJA 1DJYA 2V53A 5HYDA 1L7ZA 1BR1B 5BPJA 5I2QA 3NHIA 4N1GA 4GFTA 1SK6D 2E30A 2WC5A 1XYDA 3DVMA 3JTDC 4NDBA 3RLZA 2JC2A 1TIZA 4ICBA 3O6BA 2F8PA 2LMUA 1K9PA 2BKHB 2FOTA 1A4PA 1QIWA 3EK4A 4JKTA 4MRYA 1PSBA 2KAYA 2WCFA 3BUOB 3V2LA 2FJUB 3KHEA 1J55A 1B7TZ 3L4LA 2KQYA 5JOLA 2O60A 2KGRA 1UHJA 2NZ0A 1RJVA 1MXEA 2ERBA 3IQQA 1AHRA 1SL9A 5TNCA 1F4QA 1QXPA 2LVKA 2O5GA 1SY9A 1XA5A 3SG2A 1EG3A 2KFFA 1S6IA 2KSPA 2BBMA 3NGVA 1RECA 1WRKA 4NDDA 1AP4A 1S36A 1YRTB 2HQWA 1OE9B 1KK7Z 2Q91A 1F4OA 3CR2A 1CM4A 3DF0B 4XJKB 1M31A 1S5GZ 1SPYA 2WOSA 4N5XA 2FCDA 1S3PA 5I2OA 2M7LA 3D0YB 2ZNEA 2WCLA 5FYXA 1ZMZA 1KSMA 1B8LA 2GGMA 2L0PA 4USLA 2JT8A 2PASA 1OMRA 2K2AA 4F0ZB 1NX1A 4CPVA 1KK8C 1RROA 2MJWB 3DVJA 1IJ5A 1SCMB 5D69A 1KQMC 1DJIA 2OS8C 3KO0A 4XYNA 2H8VA 3SG3A 4HRHA 4GBAA 1QV0A 2VRGA 1TNPA 1Y6WA 1K8UA 3K1EA 1XFYO 2PYQA 1CDPA 3JTDB 1TN4A 3LLEA 4PDZA 4YGEB 4YGCB 1SL7A 3ZWHA 3NHTA 4GGNA 2MA2A 1TRFA 1P28A 2JU0A 1OQPA 1JBAA 2KQ6A 3DXLA 3L47A 1F55A 5CSIA 5J3XA 1B8RA 2QEOA 3OBVA 1H4BA 1DJWA 1CLLA 2QEVA 2Y1MA 1K93D 1CDNA 3QMEA 3R72A 2Y1NA 2HQ8A 3BXKA 2PQLA 1XFWO 4M2PA 4L9MA 2K61A 3EVUA 1JF2A 1BG1A 3CS1A 2LV7A 3NSOA 1DF0A 5ER5A 1EG4A 1PRWA 2F2OA 3PM8A 1XO5A 4Q04A 4P5OE 3SG4A 5FI6A 1B9AA 1QJTA 1JSAA 1Q80A 4PHMA 1OSAA 3CZ2A 3I5FC 2LP2A 3M0WA 2QEHA 3GK4X 1DEKA 1SMGA 3D10A 3ZNIA 3CR4X 1CTRA 1KK8B 5F6TA 1C3ZA 3BUMB 1G8IA 2KGBC 1G4YR 1K94A 2OS8B 1DC1A 4I5NB 2K0JA 1YUTA 2LNKA 4MRXA 1N2DA 3D74A 3IF7A 1XFXO 1B4CA 3TS5C 4A4BA 2WCMA 3AKBA 4PE0A 4HREE 2P71A 4PALA 2LMTA 1OMVA 3E3RA 4UPGA 3UNWA 2L4HA 1MUXA 1TNQA 1QX7A 1SR6B 2BE6A 2L51A 3HCMA 4D1EA 1MF8B 1OOHA 3VB1A 2KDHA 1L2OB 1M45A 1DMOA 3PSRA 3D76A 5AFPA 1MXLC 1ALVA 1GM0A 1V1FA 1U5IB 3CZ1A 5I94A 1QASA 2JTZA 5IBWA 3AKAA 1J7OA 3R1PA 1LKJA 1IKUA 4MEWA 1B7TY 1XK4A 3BOWA 1SRAA 1J7RA 5D3OA 1BU3A 1ZOTB 3EVVA 3SG7A 3I5IB 3IQOA 1XFVO 2F2PA 2LVIA 1AJ4A 3I5FB 4OZDA 4WRIA 1NCYA 4ZCUA 1NCZA 2M9GA 1OOJA 1NWDA 1OOIX 4WQ2A 1QTXA 1UWOA 2KLDA 5DKNA 1KK7Y 3KPXA 2PALA 1SCMC 2K7BA 4GGFA 4GGFC 1S5GY 4ETOA 2ZRSA 2CNPA 3TS5B 5I8NA 3FE6A 5AERA 1OZSA 1S6JA 1UURA 1Z4HA 3SS5A 4OVNF 1K95A 3C1VA 2NCOA 2IS9A 3GK1A 2KI6C 3SG5A 4AQIA 1QWVA 1BOCA 4JPZB 3Q8IA 4BY5A 4C0JA 2CXJA 5CSNA 2ISDA 5HKZA 4HSZA 1QVIZ 2BKIB 2P70A 1ZACA 2P6BB 3CZTX 4GPLB 1DTLA 5HL1A 1UHIA 2K7CA 3D78A 3KF9A 2MBXA 1XFZO 5KU1A 1QX2A 5FI2A 3OX5A 2K8MB 3B87A 3EG5B 3EVRA 3H4SE 3JVTC 4N1FA 3BOWB 3DY9A 5FI7A 3FWBA 1FI5A 3TDUA 1QX5B 3CR5X 3UO9A 1CB1A 1NSHA 5CSJA 2R2IA 2PRUA 3B7AA 1JFKA 5B8IB 4P2YB 2MRDA 3SJSA 3BUWB 5D7FA 1F70A 2L5XB 1LINA 2QPTA 1J7QA 3BUXB 1YRUB 1HQVA 3CWGA 4DS7A 2G2BA 2FJYA 1S6CA 3EKHA 4PHKA 1MR8A 2LLUA 1CFPA 1RFJA 1GJYA 2F3ZA 2LCPA 3TZ1A 2CCMA 3TDIA 1H8BA 3PFVA 2D8NA 1MQ1A 2M7NA 1GGWA 1OZOA 3F45A 1A75A 2OPOA 2ZN8A 4IL1A 1K90D 1SR6C 4ORAB 4AOMA 1ZFSA 1DGUA 4CFRA 1W9ZA 3PJIA 1L2OC 2LP3A 2H61A 3FE8A 3OHMB 5EL2A 1IH0A 1TTXA 2BE4A 1BLQA 1C7WA 3CTNA 3D73A 1BJFA 3FS7A 1N0YA 4CIDA 3OGNA 3D77A 3JVTB 1M63B 1PALA 1CDMA 2KNEA 1WDCC 2LMVA 1DELA 2NXQA 1NCXA 2WC6A 1TUZA 1RTP1 1CKKA 4JQ0D 3I5IC 1AK8A 1CLBA 1YVHA 4YI9A 1B47A 2JOJA 3AAKA 3DD4A 1TCOB 4OCIA 2LAPA 2M29A 3OX6A 2LLSA 1FF1A 3NSIA 3S0FA 1YTZC 1UHKA 3AAJA 4OKHA 1PVBA 1WY9A 1XVJA 4C0LA 4YGAA 2I2RE 4FQOA 4YRUA 3PLFB 2B1UA 1QLKA 2ZFDA 1FW4A 3ICBA 3WHUB 2WC8A 1G33A 1TNWA 2AAOA 2JXLA 5JJGA 3RM1A 2AUCA 2M49B 1A75B 1MHOA 2BNXA 2L5YA 1JWDA 3KEVA 1EJ3A 1IWQA 1KFXL 2BECA 2WCHA 1KFUL 1DQEA 3N7HA 3BQ3A 4MSPA 4F7FA 1TWOA 1IQ5A 1DGVA 3QRXA 3WNXB 1OW4A 2ZNDA 2EC6B 3NXAA 2GGZA 3DVKA 3LL8B 4MZKA 5DKRA 1IIOA 2LLTA 2JXCA 3LCPC 1UUSA 1TNXA 2JNXA 2YGUA 2QDIA 1J7PA 1LA3A 1QVIY 4QJ4B 3VRNA 1N65A 1QATA 1WDCB 1DF0B 1XK4C 3SS3A 1KQVA 2PMYA 1QS7A 3BFBA 1VRKA 4AQJA 1CFFA 2KAVA 1M46A 2LUCA 1OOFA 2JULA 4GNKB 1F71A 4NQGA 4E68A 1M39A 2MLEC 1FPWA 3I5HC 5KTYA 4KYNA 1LVCD 2I7AA 2JQ6A 3CDNA 1ZUZA 3FIAA 3NSLA 4U8DA 3VRQA 5AANA 1CDLA 2JPTA 4CLNA 1K9UA 1NPQA 3GOFA 2BBNA 3SIAA 1DJZA 1DJXA 1KFUS 4MVFA 4PE7A 1DVIA 2L50A 4DRWA 1C07A 2G9BA 1HT9A 1K96A 1PULA 2ZN9A 1XFUO 5ER4X 3PALA 4MLWA 1PSRA 2L2EA 4TNCA 3VROA 3WXAA 3FWCA 5K89A 2KOTA 2KBMA 2JPOA 3EKJA 2CT9A 1LA0A 4PCWA
chains in the Genus database with same CATH topology
2KI6D 2Y5IA 4QJ5B 1YX7A 2FCEA 5HKWA 3VRRA 2L98A 2LVJA 3PATA 2RGIA 1F54A 1BT6A 3OP0A 1JF0A 1V1GA 1ALWA 1IG5A 1CM1A 2DOQA 1WLZA 2WORA 4MN0A 4BY4A 1NX2A 3TDZA 1NIWA 1EXRA 2M1UA 3PN7C 1B8CA 1SKTA 4CFQA 2LANA 5CSFA 2EHBA 2F33A 1IQ3A 4ORCB 1WLMA 4I5KA 2SCPA 2MHHA 2GV5A 1GGZA 1R6PA 2BCBA 1OMDA 2KBIA 2LVVA 1NUBA 1S1EA 3HX4A 3I5HB 1CFCA 2K7DA 2KFHA 1E8AA 1NX0A 2ZRTA 1KSOA 1YVLA 1IJ6A 3VGOA 3O2PA 1Y1UA 4NDCA 1Y1XA 2I94A 2WCBA 2M97A 1RWYA 3OB2B 5KSZA 1LXFC 4MBEA 4M2QA 2HETA 1EL4A 1BODA 1AJ5A 1YR5A 5HKYA 1UHNA 1D1OA 1SL8A 4FTGA 3OB1B 5I2LA 2E6WA 3TUYC 1SW8A 5PALA 1R2UA 5DKQA 2NCPA 5AXIA 4YBHB 3SG6A 3MSEB 2COLB 2H61C 5G08A 1TCFA 3K21A 5HLVA 1DJGA 2BL0C 4R1EA 1DT7B 2EC6C 2KYCA 3LK0A 1SYMA 2A4JA 3BUNB 4PHNA 2MLFC 2KAXA 2JT0A 2MAZA 2PVBA 2JWWA 1J1EA 1ODBA 4OV2A 3PN7B 4QJ3B 2WCEA 5GQQC 2HF5A 2JT3A 1QIVA 1JUOA 3VRPA 2M3WA 5AEQA 1B1GA 1BF5A 1QLSA 1BMOA 2KI4C 4ORBB 4YGDB 4MZLA 1A2XA 2LC5A 2EGDA 1PK0D 1CNPA 1YURA 1CMGA 4MZJA 1X02A 1JFJA 2QACA 2JZIA 3O78A 1NX3A 1U5IA 2L4IA 2SASA 4OR9B 5CPVA 2JRFA 2BCXA 1FBVA 4DIRA 1Y0VH 2NLNA 1CLMA 4A4CA 1A03A 1F8HA 4C0KA 3SIBA 3I5GC 2BCAA 2ZKMX 1YX8A 3GK2A 3O4YA 3TUYB 1JC2A 2AMIA 4DUQA 2HPSA 1NYAA 2KFGA 1GQMA 1KWOC 1S26D 2OTGC 1EH2A 1K2HA 3EK7A 3CGAA 1J1DA 1BR4B 2BL0B 2K2FA 3NSKA 1IGVA 1UHHA 1YUSA 3LK1A 1KQMB 2TN4A 1CFDA 4I5LB 4GAOA 2LHLA 1SBJA 2F3YA 1Y1AA 2PSRA 2M1KB 3DVEA 1K9KA 4I5JA 4HRGA 1TOPA 2CTNA 4YI8A 3WHTB 3A4UB 1AVSA 4M2OA 3CLNA 2H2KA 2Q4UA 1FI6A 2K7OA 2JTTA 1SNLA 2KI4B 1IRJA 1W7JB 5HLOA 1KCYA 4PE1A 1NP8A 1WRZA 1DJHA 1RK9A 4PE4A 1KFXS 1A29A 2JNFA 3A8RA 3BYAA 4YGBB 1SCVA 2KHNA 4WQ3A 2LHIA 3I5GB 2WNDA 3DF0A 1PVAA 1UP5A 2KYFA 2M0RA 2M8UA 4GUKA 4XJKA 1C7VA 3EK8A 1WRLA 2LM5A 1YUUA 2Y4QA 1KWOB 3D0YA 2OTGB 2LUXA 1W7IB 1CMFA 2CBLA 4JWQA 2LE9B 2I18A 1AUIB 4DCKA 1QV1A 4ZCVA 1MWNA 4PHJA 1DJYA 2V53A 5HYDA 1L7ZA 1BR1B 5BPJA 5I2QA 4N1GA 4GFTA 1SK6D 2E30A 3DVMA 1XYDA 4NDBA 3JTDC 3RLZA 2JC2A 1TIZA 4ICBA 3O6BA 2F8PA 2LMUA 1K9PA 2BKHB 2FOTA 1A4PA 1QIWA 3EK4A 4MRYA 1PSBA 2KAYA 2WCFA 3BUOB 2FJUB 3KHEA 1J55A 1B7TZ 2KQYA 5JOLA 2O60A 2KGRA 1UHJA 2NZ0A 1RJVA 1MXEA 3IQQA 5TNCA 1AHRA 1SL9A 1F4QA 1QXPA 2LVKA 2O5GA 1SY9A 1XA5A 3SG2A 1EG3A 2KFFA 1S6IA 2KSPA 2BBMA 1RECA 1WRKA 4NDDA 1AP4A 1S36A 1YRTB 2HQWA 1OE9B 1KK7Z 2Q91A 1F4OA 3CR2A 1CM4A 3DF0B 4XJKB 1M31A 1S5GZ 1SPYA 2WOSA 4N5XA 2FCDA 1S3PA 5I2OA 2M7LA 3D0YB 2ZNEA 5FYXA 1ZMZA 1KSMA 1B8LA 2GGMA 2L0PA 4USLA 2JT8A 2PASA 1OMRA 2K2AA 4F0ZB 1NX1A 4CPVA 1KK8C 1RROA 2MJWB 3DVJA 1IJ5A 1SCMB 5D69A 1KQMC 1DJIA 2OS8C 3KO0A 4XYNA 3SG3A 4HRHA 4GBAA 1QV0A 2VRGA 1TNPA 1Y6WA 1K8UA 4PDZA 1XFYO 3JTDB 1CDPA 4YGCB 1TN4A 3LLEA 4YGEB 4CIDA 1SL7A 3ZWHA 4GGNA 2MA2A 1TRFA 2JU0A 1OQPA 1JBAA 2KQ6A 1F55A 5CSIA 5J3XA 1B8RA 1H4BA 1DJWA 1CLLA 2Y1MA 1K93D 1CDNA 2Y1NA 2HQ8A 3BXKA 4M2PA 1XFWO 4L9MA 2K61A 3EVUA 1JF2A 1BG1A 3CS1A 2LV7A 3NSOA 1DF0A 5ER5A 1EG4A 1PRWA 2F2OA 3PM8A 1XO5A 4Q04A 4P5OE 3SG4A 1B9AA 1QJTA 1JSAA 1Q80A 4PHMA 1OSAA 3I5FC 2LP2A 3M0WA 3GK4X 1SMGA 3D10A 3ZNIA 3CR4X 1CTRA 1KK8B 5F6TA 3BUMB 1G8IA 2KGBC 1G4YR 1K94A 2OS8B 4I5NB 2K0JA 1YUTA 2LNKA 4MRXA 1N2DA 3IF7A 1XFXO 1B4CA 3TS5C 4A4BA 3AKBA 4PE0A 4HREE 4PALA 2LMTA 1OMVA 3E3RA 4UPGA 2L4HA 1MUXA 1TNQA 1QX7A 1SR6B 2BE6A 2L51A 3HCMA 4D1EA 1MF8B 2KDHA 1L2OB 1M45A 1DMOA 3PSRA 5AFPA 1MXLC 1ALVA 1V1FA 1U5IB 1QASA 2JTZA 5IBWA 3AKAA 1J7OA 1LKJA 1IKUA 4MEWA 1B7TY 1XK4A 3BOWA 1SRAA 1J7RA 1BU3A 1ZOTB 3EVVA 3SG7A 3I5IB 3IQOA 1XFVO 2F2PA 2LVIA 1AJ4A 3I5FB 4WRIA 1NCYA 4ZCUA 1NCZA 2M9GA 1OOJA 1NWDA 4WQ2A 1QTXA 1UWOA 5DKNA 1KK7Y 3KPXA 2PALA 1SCMC 2K7BA 4GGFA 4GGFC 1S5GY 4ETOA 2ZRSA 2CNPA 3TS5B 5I8NA 5AERA 1OZSA 1S6JA 1UURA 4OVNF 1K95A 3C1VA 2NCOA 2IS9A 3GK1A 2KI6C 3SG5A 4AQIA 1BOCA 4JPZB 4BY5A 4C0JA 2CXJA 5CSNA 2ISDA 5HKZA 4HSZA 1QVIZ 2BKIB 1ZACA 2P6BB 3CZTX 4GPLB 1DTLA 1UHIA 2K7CA 2MBXA 3KF9A 1XFZO 5KU1A 1QX2A 3OX5A 2K8MB 3EVRA 3JVTC 3H4SE 4N1FA 3BOWB 3FWBA 1FI5A 3TDUA 1QX5B 3CR5X 1CB1A 1NSHA 5CSJA 2R2IA 2PRUA 1JFKA 5B8IB 4P2YB 2MRDA 3SJSA 3BUWB 5D7FA 1F70A 2L5XB 1LINA 2QPTA 1J7QA 3BUXB 1YRUB 1HQVA 3CWGA 4DS7A 2G2BA 1S6CA 3EKHA 4PHKA 1MR8A 2LLUA 1CFPA 1RFJA 1GJYA 2F3ZA 2LCPA 3TZ1A 2CCMA 3TDIA 1H8BA 3PFVA 2D8NA 1MQ1A 2M7NA 1GGWA 1OZOA 3F45A 1A75A 2OPOA 2ZN8A 4IL1A 1K90D 1SR6C 4ORAB 4AOMA 1ZFSA 1DGUA 4CFRA 1L2OC 2LP3A 2H61A 3OHMB 1IH0A 1TTXA 2BE4A 1BLQA 1C7WA 3CTNA 3FS7A 1BJFA 1N0YA 3JVTB 1M63B 1PALA 1CDMA 2KNEA 1WDCC 2LMVA 2NXQA 1NCXA 1CKKA 1RTP1 4JQ0D 3I5IC 1AK8A 1CLBA 1YVHA 4YI9A 1B47A 2JOJA 3AAKA 3DD4A 1TCOB 4OCIA 2LAPA 2M29A 3OX6A 2LLSA 1FF1A 3NSIA 1YTZC 1UHKA 3AAJA 4OKHA 1PVBA 1WY9A 1XVJA 4C0LA 4YGAA 2I2RE 4FQOA 4YRUA 3PLFB 2B1UA 1QLKA 2ZFDA 1FW4A 3ICBA 3WHUB 2WC8A 1G33A 1TNWA 2AAOA 2JXLA 5JJGA 3RM1A 2AUCA 2M49B 1A75B 1MHOA 1JWDA 3KEVA 1EJ3A 1IWQA 1KFXL 2BECA 1KFUL 4MSPA 3BQ3A 1IQ5A 1DGVA 3QRXA 3WNXB 2ZNDA 2EC6B 3NXAA 2GGZA 3DVKA 3LL8B 4MZKA 5DKRA 2LLTA 2JXCA 3LCPC 1UUSA 1TNXA 2JNXA 1J7PA 1LA3A 1QVIY 4QJ4B 3VRNA 1N65A 1QATA 1WDCB 1DF0B 1XK4C 1KQVA 2PMYA 1QS7A 1VRKA 4AQJA 1CFFA 2KAVA 1M46A 2LUCA 2JULA 4GNKB 1F71A 4NQGA 4E68A 1M39A 2MLEC 1FPWA 3I5HC 5KTYA 3VRQA 1LVCD 2I7AA 2JQ6A 4U8DA 1ZUZA 3FIAA 3NSLA 5AANA 1CDLA 2JPTA 4CLNA 1K9UA 1NPQA 3GOFA 2BBNA 3SIAA 1DJZA 1DJXA 1KFUS 4MVFA 4PE7A 1DVIA 2L50A 4DRWA 1C07A 2G9BA 1HT9A 1K96A 1PULA 2ZN9A 1XFUO 5ER4X 3PALA 4MLWA 1PSRA 2L2EA 4TNCA 3VROA 3WXAA 3FWCA 5K89A 2KOTA 2KBMA 3EKJA 2CT9A 1LA0A 4PCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI6 D;  2Y5I A;  4QJ5 B;  1YX7 A;  2FCE A;  5HKW A;  3VRR A;  2L98 A;  2LVJ A;  3PAT A;  2RGI A;  1F54 A;  1BT6 A;  3OP0 A;  1JF0 A;  1V1G A;  1ALW A;  1IG5 A;  1CM1 A;  2DOQ A;  1WLZ A;  2WOR A;  4MN0 A;  4BY4 A;  1NX2 A;  3TDZ A;  1NIW A;  1EXR A;  2M1U A;  3PN7 C;  1B8C A;  1SKT A;  4CFQ A;  2LAN A;  5CSF A;  2EHB A;  2F33 A;  1IQ3 A;  4ORC B;  1WLM A;  4I5K A;  2SCP A;  2MHH A;  2GV5 A;  1GGZ A;  1R6P A;  2BCB A;  1OMD A;  2KBI A;  2LVV A;  1NUB A;  1S1E A;  3HX4 A;  3I5H B;  1CFC A;  2K7D A;  2KFH A;  1E8A A;  1NX0 A;  2ZRT A;  1KSO A;  1YVL A;  1IJ6 A;  3VGO A;  3O2P A;  1Y1U A;  4NDC A;  1Y1X A;  2I94 A;  2WCB A;  2M97 A;  1RWY A;  3OB2 B;  5KSZ A;  1LXF C;  4MBE A;  4M2Q A;  2HET A;  1EL4 A;  1BOD A;  1AJ5 A;  1YR5 A;  5HKY A;  1UHN A;  1D1O A;  1SL8 A;  4FTG A;  3OB1 B;  5I2L A;  2E6W A;  3TUY C;  1SW8 A;  5PAL A;  1R2U A;  5DKQ A;  2NCP A;  5AXI A;  4YBH B;  3SG6 A;  3MSE B;  2COL B;  2H61 C;  5G08 A;  1TCF A;  3K21 A;  5HLV A;  1DJG A;  2BL0 C;  4R1E A;  1DT7 B;  2EC6 C;  2KYC A;  3LK0 A;  1SYM A;  2A4J A;  3BUN B;  4PHN A;  2MLF C;  2KAX A;  2JT0 A;  2MAZ A;  2PVB A;  2JWW A;  1J1E A;  1ODB A;  4OV2 A;  3PN7 B;  4QJ3 B;  2WCE A;  5GQQ C;  2HF5 A;  2JT3 A;  1QIV A;  1JUO A;  3VRP A;  2M3W A;  5AEQ A;  1B1G A;  1BF5 A;  1QLS A;  1BMO A;  2KI4 C;  4ORB B;  4YGD B;  4MZL A;  1A2X A;  2LC5 A;  2EGD A;  1PK0 D;  1CNP A;  1YUR A;  1CMG A;  4MZJ A;  1X02 A;  1JFJ A;  2QAC A;  2JZI A;  3O78 A;  1NX3 A;  1U5I A;  2L4I A;  2SAS A;  4OR9 B;  5CPV A;  2JRF A;  2BCX A;  1FBV A;  4DIR A;  1Y0V H;  2NLN A;  1CLM A;  4A4C A;  1A03 A;  1F8H A;  4C0K A;  3SIB A;  3I5G C;  2BCA A;  2ZKM X;  1YX8 A;  3GK2 A;  3O4Y A;  3TUY B;  1JC2 A;  2AMI A;  4DUQ A;  2HPS A;  1NYA A;  2KFG A;  1GQM A;  1KWO C;  1S26 D;  2OTG C;  1EH2 A;  1K2H A;  3EK7 A;  3CGA A;  1J1D A;  1BR4 B;  2BL0 B;  2K2F A;  3NSK A;  1IGV A;  1UHH A;  1YUS A;  3LK1 A;  1KQM B;  2TN4 A;  1CFD A;  4I5L B;  4GAO A;  2LHL A;  1SBJ A;  2F3Y A;  1Y1A A;  2PSR A;  2M1K B;  3DVE A;  1K9K A;  4I5J A;  4HRG A;  1TOP A;  2CTN A;  4YI8 A;  3WHT B;  3A4U B;  1AVS A;  4M2O A;  3CLN A;  2H2K A;  2Q4U A;  1FI6 A;  2K7O A;  2JTT A;  1SNL A;  2KI4 B;  1IRJ A;  1W7J B;  5HLO A;  1KCY A;  4PE1 A;  1NP8 A;  1WRZ A;  1DJH A;  1RK9 A;  4PE4 A;  1KFX S;  1A29 A;  2JNF A;  3A8R A;  3BYA A;  4YGB B;  1SCV A;  2KHN A;  4WQ3 A;  2LHI A;  3I5G B;  2WND A;  3DF0 A;  1PVA A;  1UP5 A;  2KYF A;  2M0R A;  2M8U A;  4GUK A;  4XJK A;  1C7V A;  3EK8 A;  1WRL A;  2LM5 A;  1YUU A;  2Y4Q A;  1KWO B;  3D0Y A;  2OTG B;  2LUX A;  1W7I B;  1CMF A;  2CBL A;  4JWQ A;  2LE9 B;  2I18 A;  1AUI B;  4DCK A;  1QV1 A;  4ZCV A;  1MWN A;  4PHJ A;  1DJY A;  2V53 A;  5HYD A;  1L7Z A;  1BR1 B;  5BPJ A;  5I2Q A;  4N1G A;  4GFT A;  1SK6 D;  2E30 A;  3DVM A;  1XYD A;  4NDB A;  3JTD C;  3RLZ A;  2JC2 A;  1TIZ A;  4ICB A;  3O6B A;  2F8P A;  2LMU A;  1K9P A;  2BKH B;  2FOT A;  1A4P A;  1QIW A;  3EK4 A;  4MRY A;  1PSB A;  2KAY A;  2WCF A;  3BUO B;  2FJU B;  3KHE A;  1J55 A;  1B7T Z;  2KQY A;  5JOL A;  2O60 A;  2KGR A;  1UHJ A;  2NZ0 A;  1RJV A;  1MXE A;  3IQQ A;  5TNC A;  1AHR A;  1SL9 A;  1F4Q A;  1QXP A;  2LVK A;  2O5G A;  1SY9 A;  1XA5 A;  3SG2 A;  1EG3 A;  2KFF A;  1S6I A;  2KSP A;  2BBM A;  1REC A;  1WRK A;  4NDD A;  1AP4 A;  1S36 A;  1YRT B;  2HQW A;  1OE9 B;  1KK7 Z;  2Q91 A;  1F4O A;  3CR2 A;  1CM4 A;  3DF0 B;  4XJK B;  1M31 A;  1S5G Z;  1SPY A;  2WOS A;  4N5X A;  2FCD A;  1S3P A;  5I2O A;  2M7L A;  3D0Y B;  2ZNE A;  5FYX A;  1ZMZ A;  1KSM A;  1B8L A;  2GGM A;  2L0P A;  4USL A;  2JT8 A;  2PAS A;  1OMR A;  2K2A A;  4F0Z B;  1NX1 A;  4CPV A;  1KK8 C;  1RRO A;  2MJW B;  3DVJ A;  1IJ5 A;  1SCM B;  5D69 A;  1KQM C;  1DJI A;  2OS8 C;  3KO0 A;  4XYN A;  3SG3 A;  4HRH A;  4GBA A;  1QV0 A;  2VRG A;  1TNP A;  1Y6W A;  1K8U A;  4PDZ A;  1XFY O;  3JTD B;  1CDP A;  4YGC B;  1TN4 A;  3LLE A;  4YGE B;  4CID A;  1SL7 A;  3ZWH A;  4GGN A;  2MA2 A;  1TRF A;  2JU0 A;  1OQP A;  1JBA A;  2KQ6 A;  1F55 A;  5CSI A;  5J3X A;  1B8R A;  1H4B A;  1DJW A;  1CLL A;  2Y1M A;  1K93 D;  1CDN A;  2Y1N A;  2HQ8 A;  3BXK A;  4M2P A;  1XFW O;  4L9M A;  2K61 A;  3EVU A;  1JF2 A;  1BG1 A;  3CS1 A;  2LV7 A;  3NSO A;  1DF0 A;  5ER5 A;  1EG4 A;  1PRW A;  2F2O A;  3PM8 A;  1XO5 A;  4Q04 A;  4P5O E;  3SG4 A;  1B9A A;  1QJT A;  1JSA A;  1Q80 A;  4PHM A;  1OSA A;  3I5F C;  2LP2 A;  3M0W A;  3GK4 X;  1SMG A;  3D10 A;  3ZNI A;  3CR4 X;  1CTR A;  1KK8 B;  5F6T A;  3BUM B;  1G8I A;  2KGB C;  1G4Y R;  1K94 A;  2OS8 B;  4I5N B;  2K0J A;  1YUT A;  2LNK A;  4MRX A;  1N2D A;  3IF7 A;  1XFX O;  1B4C A;  3TS5 C;  4A4B A;  3AKB A;  4PE0 A;  4HRE E;  4PAL A;  2LMT A;  1OMV A;  3E3R A;  4UPG A;  2L4H A;  1MUX A;  1TNQ A;  1QX7 A;  1SR6 B;  2BE6 A;  2L51 A;  3HCM A;  4D1E A;  1MF8 B;  2KDH A;  1L2O B;  1M45 A;  1DMO A;  3PSR A;  5AFP A;  1MXL C;  1ALV A;  1V1F A;  1U5I B;  1QAS A;  2JTZ A;  5IBW A;  3AKA A;  1J7O A;  1LKJ A;  1IKU A;  4MEW A;  1B7T Y;  1XK4 A;  3BOW A;  1SRA A;  1J7R A;  1BU3 A;  1ZOT B;  3EVV A;  3SG7 A;  3I5I B;  3IQO A;  1XFV O;  2F2P A;  2LVI A;  1AJ4 A;  3I5F B;  4WRI A;  1NCY A;  4ZCU A;  1NCZ A;  2M9G A;  1OOJ A;  1NWD A;  4WQ2 A;  1QTX A;  1UWO A;  5DKN A;  1KK7 Y;  3KPX A;  2PAL A;  1SCM C;  2K7B A;  4GGF A;  4GGF C;  1S5G Y;  4ETO A;  2ZRS A;  2CNP A;  3TS5 B;  5I8N A;  5AER A;  1OZS A;  1S6J A;  1UUR A;  4OVN F;  1K95 A;  3C1V A;  2NCO A;  2IS9 A;  3GK1 A;  2KI6 C;  3SG5 A;  4AQI A;  1BOC A;  4JPZ B;  4BY5 A;  4C0J A;  2CXJ A;  5CSN A;  2ISD A;  5HKZ A;  4HSZ A;  1QVI Z;  2BKI B;  1ZAC A;  2P6B B;  3CZT X;  4GPL B;  1DTL A;  1UHI A;  2K7C A;  2MBX A;  3KF9 A;  1XFZ O;  5KU1 A;  1QX2 A;  3OX5 A;  2K8M B;  3EVR A;  3JVT C;  3H4S E;  4N1F A;  3BOW B;  3FWB A;  1FI5 A;  3TDU A;  1QX5 B;  3CR5 X;  1CB1 A;  1NSH A;  5CSJ A;  2R2I A;  2PRU A;  1JFK A;  5B8I B;  4P2Y B;  2MRD A;  3SJS A;  3BUW B;  5D7F A;  1F70 A;  2L5X B;  1LIN A;  2QPT A;  1J7Q A;  3BUX B;  1YRU B;  1HQV A;  3CWG A;  4DS7 A;  2G2B A;  1S6C A;  3EKH A;  4PHK A;  1MR8 A;  2LLU A;  1CFP A;  1RFJ A;  1GJY A;  2F3Z A;  2LCP A;  3TZ1 A;  2CCM A;  3TDI A;  1H8B A;  3PFV A;  2D8N A;  1MQ1 A;  2M7N A;  1GGW A;  1OZO A;  3F45 A;  1A75 A;  2OPO A;  2ZN8 A;  4IL1 A;  1K90 D;  1SR6 C;  4ORA B;  4AOM A;  1ZFS A;  1DGU A;  4CFR A;  1L2O C;  2LP3 A;  2H61 A;  3OHM B;  1IH0 A;  1TTX A;  2BE4 A;  1BLQ A;  1C7W A;  3CTN A;  3FS7 A;  1BJF A;  1N0Y A;  3JVT B;  1M63 B;  1PAL A;  1CDM A;  2KNE A;  1WDC C;  2LMV A;  2NXQ A;  1NCX A;  1CKK A;  1RTP 1;  4JQ0 D;  3I5I C;  1AK8 A;  1CLB A;  1YVH A;  4YI9 A;  1B47 A;  2JOJ A;  3AAK A;  3DD4 A;  1TCO B;  4OCI A;  2LAP A;  2M29 A;  3OX6 A;  2LLS A;  1FF1 A;  3NSI A;  1YTZ C;  1UHK A;  3AAJ A;  4OKH A;  1PVB A;  1WY9 A;  1XVJ A;  4C0L A;  4YGA A;  2I2R E;  4FQO A;  4YRU A;  3PLF B;  2B1U A;  1QLK A;  2ZFD A;  1FW4 A;  3ICB A;  3WHU B;  2WC8 A;  1G33 A;  1TNW A;  2AAO A;  2JXL A;  5JJG A;  3RM1 A;  2AUC A;  2M49 B;  1A75 B;  1MHO A;  1JWD A;  3KEV A;  1EJ3 A;  1IWQ A;  1KFX L;  2BEC A;  1KFU L;  4MSP A;  3BQ3 A;  1IQ5 A;  1DGV A;  3QRX A;  3WNX B;  2ZND A;  2EC6 B;  3NXA A;  2GGZ A;  3DVK A;  3LL8 B;  4MZK A;  5DKR A;  2LLT A;  2JXC A;  3LCP C;  1UUS A;  1TNX A;  2JNX A;  1J7P A;  1LA3 A;  1QVI Y;  4QJ4 B;  3VRN A;  1N65 A;  1QAT A;  1WDC B;  1DF0 B;  1XK4 C;  1KQV A;  2PMY A;  1QS7 A;  1VRK A;  4AQJ A;  1CFF A;  2KAV A;  1M46 A;  2LUC A;  2JUL A;  4GNK B;  1F71 A;  4NQG A;  4E68 A;  1M39 A;  2MLE C;  1FPW A;  3I5H C;  5KTY A;  3VRQ A;  1LVC D;  2I7A A;  2JQ6 A;  4U8D A;  1ZUZ A;  3FIA A;  3NSL A;  5AAN A;  1CDL A;  2JPT A;  4CLN A;  1K9U A;  1NPQ A;  3GOF A;  2BBN A;  3SIA A;  1DJZ A;  1DJX A;  1KFU S;  4MVF A;  4PE7 A;  1DVI A;  2L50 A;  4DRW A;  1C07 A;  2G9B A;  1HT9 A;  1K96 A;  1PUL A;  2ZN9 A;  1XFU O;  5ER4 X;  3PAL A;  4MLW A;  1PSR A;  2L2E A;  4TNC A;  3VRO A;  3WXA A;  3FWC A;  5K89 A;  2KOT A;  2KBM A;  3EKJ A;  2CT9 A;  1LA0 A;  4PCW A; 
#chains in the Genus database with same CATH topology
 2KI6 D;  2KLE A;  2Y5I A;  3CZ0 A;  4QJ5 B;  2GTE A;  1YX7 A;  2FCE A;  5HKW A;  3VRR A;  2L98 A;  2LVJ A;  3PAT A;  2RGI A;  1F54 A;  1BT6 A;  3OP0 A;  3RZS A;  2L2C A;  1JF0 A;  1V1G A;  4INX A;  1ALW A;  1IG5 A;  1CM1 A;  2DOQ A;  1WLZ A;  2WOR A;  4MN0 A;  4BY4 A;  1NX2 A;  3B88 A;  3TDZ A;  1NIW A;  2KPH A;  1EXR A;  2M1U A;  3S0G A;  3PN7 C;  1B8C A;  1SKT A;  4CFQ A;  2LAN A;  5CSF A;  3L4A A;  2EHB A;  2F33 A;  1IQ3 A;  4ORC B;  1WLM A;  4I5K A;  2SCP A;  3FE9 A;  2MHH A;  2GV5 A;  1GGZ A;  1R6P A;  2BCB A;  1OMD A;  2KBI A;  2LVV A;  1NUB A;  1S1E A;  3HX4 A;  2QEB A;  3I5H B;  1CFC A;  2K7D A;  2KFH A;  2K60 A;  1E8A A;  1NX0 A;  2ZRT A;  1KSO A;  1YVL A;  1IJ6 A;  3VGO A;  3O2P A;  1Y1U A;  4NDC A;  1Y1X A;  2I94 A;  2WCB A;  2M97 A;  1RWY A;  3OB2 B;  4IJ7 A;  5KSZ A;  1LXF C;  3IVT A;  4MBE A;  4M2Q A;  3CYZ A;  2HET A;  1EL4 A;  1BOD A;  1AJ5 A;  1YR5 A;  5HKY A;  3R1O A;  1UHN A;  1D1O A;  1SL8 A;  4FTG A;  3OB1 B;  5I2L A;  2E6W A;  3TUY C;  1C3Y A;  1SW8 A;  5PAL A;  1R2U A;  5DKQ A;  2NCP A;  5AXI A;  4YBH B;  3SG6 A;  3PM2 A;  3MSE B;  1SSE B;  2COL B;  2H61 C;  4FQT A;  1TCF A;  3K21 A;  5G08 A;  1DJG A;  2BL0 C;  5HLV A;  1XFR A;  4R1E A;  1DT7 B;  2EC6 C;  2KYC A;  3LK0 A;  1SYM A;  2A4J A;  3BUN B;  4PHN A;  2MLF C;  2KAX A;  2JT0 A;  2MAZ A;  2PVB A;  2JWW A;  1J1E A;  1ODB A;  4OV2 A;  3PN7 B;  4QJ3 B;  2WCE A;  5GQQ C;  2HF5 A;  1T14 A;  2JT3 A;  1QIV A;  1JUO A;  3VRP A;  2M3W A;  3DYE A;  5AEQ A;  2WCJ A;  1BF5 A;  1B1G A;  1QLS A;  1BMO A;  3S0E A;  2KI4 C;  4ORB B;  4YGD B;  4JD9 A;  4MZL A;  1A2X A;  5DIC A;  2LC5 A;  2EGD A;  1PK0 D;  1CNP A;  1YUR A;  1CMG A;  4MZJ A;  1X02 A;  3SS4 A;  1JFJ A;  1ORG A;  2QAC A;  2JZI A;  3O78 A;  1NX3 A;  1U5I A;  2L4I A;  2SAS A;  4OR9 B;  5CPV A;  2JRF A;  2BCX A;  3S0B A;  1FBV A;  4DIR A;  1Y0V H;  2NLN A;  1CLM A;  3BFA A;  4A4C A;  1A03 A;  1F8H A;  4C0K A;  3SIB A;  1TUJ A;  3I5G C;  3BFH A;  2BCA A;  2ZKM X;  1YX8 A;  3GK2 A;  3O4Y A;  1Z2C B;  3TUY B;  2AMI A;  4DUQ A;  1JC2 A;  2HPS A;  1NYA A;  2KFG A;  1GQM A;  1KWO C;  1S26 D;  2OTG C;  1EH2 A;  1K2H A;  3EK7 A;  3CGA A;  2WCK A;  1J1D A;  1BR4 B;  2BL0 B;  2K2F A;  3NSK A;  3O4X A;  1IGV A;  1UHH A;  1YUS A;  3LK1 A;  1KQM B;  2TN4 A;  1CFD A;  4I5L B;  4GAO A;  2LHL A;  1SBJ A;  2F3Y A;  1Y1A A;  3B86 A;  2PSR A;  2M1K B;  3DVE A;  1K9K A;  4I5J A;  4HRG A;  1TOP A;  1LS8 A;  2CTN A;  4YI8 A;  3WHT B;  3A4U B;  3BJH A;  1AVS A;  4M2O A;  3CLN A;  2H2K A;  2Q4U A;  1FI6 A;  2K7O A;  4INW A;  2JTT A;  1SNL A;  2KI4 B;  1IRJ A;  1W7J B;  5HLO A;  1KCY A;  4PE1 A;  2BAP A;  1NP8 A;  1WRZ A;  3S0A A;  3S0D A;  1DJH A;  1RK9 A;  4PE4 A;  1KFX S;  1OOG A;  1A29 A;  3B6X A;  2JNF A;  3A8R A;  3BYA A;  4YGB B;  1SCV A;  2KHN A;  3DZT A;  4WQ3 A;  2LHI A;  3I5G B;  2WND A;  3D75 A;  3DF0 A;  1PVA A;  1UP5 A;  2KYF A;  2M0R A;  2M8U A;  4GUK A;  4PT1 A;  4XJK A;  3CAB A;  3EK8 A;  1C7V A;  1WRL A;  2LM5 A;  1YUU A;  2Y4Q A;  1KWO B;  3D0Y A;  2OTG B;  2LUX A;  1W7I B;  1CMF A;  2CBL A;  4JWQ A;  2LE9 B;  2I18 A;  3R1V A;  1AUI B;  4DCK A;  1QV1 A;  4ZCV A;  1MWN A;  4PHJ A;  1DJY A;  2V53 A;  5HYD A;  1L7Z A;  1BR1 B;  5BPJ A;  5I2Q A;  3NHI A;  4N1G A;  4GFT A;  1SK6 D;  2E30 A;  2WC5 A;  1XYD A;  3DVM A;  3JTD C;  4NDB A;  3RLZ A;  2JC2 A;  1TIZ A;  4ICB A;  3O6B A;  2F8P A;  2LMU A;  1K9P A;  2BKH B;  2FOT A;  1A4P A;  1QIW A;  3EK4 A;  4JKT A;  4MRY A;  1PSB A;  2KAY A;  2WCF A;  3BUO B;  3V2L A;  2FJU B;  3KHE A;  1J55 A;  1B7T Z;  3L4L A;  2KQY A;  5JOL A;  2O60 A;  2KGR A;  1UHJ A;  2NZ0 A;  1RJV A;  1MXE A;  2ERB A;  3IQQ A;  1AHR A;  1SL9 A;  5TNC A;  1F4Q A;  1QXP A;  2LVK A;  2O5G A;  1SY9 A;  1XA5 A;  3SG2 A;  1EG3 A;  2KFF A;  1S6I A;  2KSP A;  2BBM A;  3NGV A;  1REC A;  1WRK A;  4NDD A;  1AP4 A;  1S36 A;  1YRT B;  2HQW A;  1OE9 B;  1KK7 Z;  2Q91 A;  1F4O A;  3CR2 A;  1CM4 A;  3DF0 B;  4XJK B;  1M31 A;  1S5G Z;  1SPY A;  2WOS A;  4N5X A;  2FCD A;  1S3P A;  5I2O A;  2M7L A;  3D0Y B;  2ZNE A;  2WCL A;  5FYX A;  1ZMZ A;  1KSM A;  1B8L A;  2GGM A;  2L0P A;  4USL A;  2JT8 A;  2PAS A;  1OMR A;  2K2A A;  4F0Z B;  1NX1 A;  4CPV A;  1KK8 C;  1RRO A;  2MJW B;  3DVJ A;  1IJ5 A;  1SCM B;  5D69 A;  1KQM C;  1DJI A;  2OS8 C;  3KO0 A;  4XYN A;  2H8V A;  3SG3 A;  4HRH A;  4GBA A;  1QV0 A;  2VRG A;  1TNP A;  1Y6W A;  1K8U A;  3K1E A;  1XFY O;  2PYQ A;  1CDP A;  3JTD B;  1TN4 A;  3LLE A;  4PDZ A;  4YGE B;  4YGC B;  1SL7 A;  3ZWH A;  3NHT A;  4GGN A;  2MA2 A;  1TRF A;  1P28 A;  2JU0 A;  1OQP A;  1JBA A;  2KQ6 A;  3DXL A;  3L47 A;  1F55 A;  5CSI A;  5J3X A;  1B8R A;  2QEO A;  3OBV A;  1H4B A;  1DJW A;  1CLL A;  2QEV A;  2Y1M A;  1K93 D;  1CDN A;  3QME A;  3R72 A;  2Y1N A;  2HQ8 A;  3BXK A;  2PQL A;  1XFW O;  4M2P A;  4L9M A;  2K61 A;  3EVU A;  1JF2 A;  1BG1 A;  3CS1 A;  2LV7 A;  3NSO A;  1DF0 A;  5ER5 A;  1EG4 A;  1PRW A;  2F2O A;  3PM8 A;  1XO5 A;  4Q04 A;  4P5O E;  3SG4 A;  5FI6 A;  1B9A A;  1QJT A;  1JSA A;  1Q80 A;  4PHM A;  1OSA A;  3CZ2 A;  3I5F C;  2LP2 A;  3M0W A;  2QEH A;  3GK4 X;  1DEK A;  1SMG A;  3D10 A;  3ZNI A;  3CR4 X;  1CTR A;  1KK8 B;  5F6T A;  1C3Z A;  3BUM B;  1G8I A;  2KGB C;  1G4Y R;  1K94 A;  2OS8 B;  1DC1 A;  4I5N B;  2K0J A;  1YUT A;  2LNK A;  4MRX A;  1N2D A;  3D74 A;  3IF7 A;  1XFX O;  1B4C A;  3TS5 C;  4A4B A;  2WCM A;  3AKB A;  4PE0 A;  4HRE E;  2P71 A;  4PAL A;  2LMT A;  1OMV A;  3E3R A;  4UPG A;  3UNW A;  2L4H A;  1MUX A;  1TNQ A;  1QX7 A;  1SR6 B;  2BE6 A;  2L51 A;  3HCM A;  4D1E A;  1MF8 B;  1OOH A;  3VB1 A;  2KDH A;  1L2O B;  1M45 A;  1DMO A;  3PSR A;  3D76 A;  5AFP A;  1MXL C;  1ALV A;  1GM0 A;  1V1F A;  1U5I B;  3CZ1 A;  5I94 A;  1QAS A;  2JTZ A;  5IBW A;  3AKA A;  1J7O A;  3R1P A;  1LKJ A;  1IKU A;  4MEW A;  1B7T Y;  1XK4 A;  3BOW A;  1SRA A;  1J7R A;  5D3O A;  1BU3 A;  1ZOT B;  3EVV A;  3SG7 A;  3I5I B;  3IQO A;  1XFV O;  2F2P A;  2LVI A;  1AJ4 A;  3I5F B;  4OZD A;  4WRI A;  1NCY A;  4ZCU A;  1NCZ A;  2M9G A;  1OOJ A;  1NWD A;  1OOI X;  4WQ2 A;  1QTX A;  1UWO A;  2KLD A;  5DKN A;  1KK7 Y;  3KPX A;  2PAL A;  1SCM C;  2K7B A;  4GGF A;  4GGF C;  1S5G Y;  4ETO A;  2ZRS A;  2CNP A;  3TS5 B;  5I8N A;  3FE6 A;  5AER A;  1OZS A;  1S6J A;  1UUR A;  1Z4H A;  3SS5 A;  4OVN F;  1K95 A;  3C1V A;  2NCO A;  2IS9 A;  3GK1 A;  2KI6 C;  3SG5 A;  4AQI A;  1QWV A;  1BOC A;  4JPZ B;  3Q8I A;  4BY5 A;  4C0J A;  2CXJ A;  5CSN A;  2ISD A;  5HKZ A;  4HSZ A;  1QVI Z;  2BKI B;  2P70 A;  1ZAC A;  2P6B B;  3CZT X;  4GPL B;  1DTL A;  5HL1 A;  1UHI A;  2K7C A;  3D78 A;  3KF9 A;  2MBX A;  1XFZ O;  5KU1 A;  1QX2 A;  5FI2 A;  3OX5 A;  2K8M B;  3B87 A;  3EG5 B;  3EVR A;  3H4S E;  3JVT C;  4N1F A;  3BOW B;  3DY9 A;  5FI7 A;  3FWB A;  1FI5 A;  3TDU A;  1QX5 B;  3CR5 X;  3UO9 A;  1CB1 A;  1NSH A;  5CSJ A;  2R2I A;  2PRU A;  3B7A A;  1JFK A;  5B8I B;  4P2Y B;  2MRD A;  3SJS A;  3BUW B;  5D7F A;  1F70 A;  2L5X B;  1LIN A;  2QPT A;  1J7Q A;  3BUX B;  1YRU B;  1HQV A;  3CWG A;  4DS7 A;  2G2B A;  2FJY A;  1S6C A;  3EKH A;  4PHK A;  1MR8 A;  2LLU A;  1CFP A;  1RFJ A;  1GJY A;  2F3Z A;  2LCP A;  3TZ1 A;  2CCM A;  3TDI A;  1H8B A;  3PFV A;  2D8N A;  1MQ1 A;  2M7N A;  1GGW A;  1OZO A;  3F45 A;  1A75 A;  2OPO A;  2ZN8 A;  4IL1 A;  1K90 D;  1SR6 C;  4ORA B;  4AOM A;  1ZFS A;  1DGU A;  4CFR A;  1W9Z A;  3PJI A;  1L2O C;  2LP3 A;  2H61 A;  3FE8 A;  3OHM B;  5EL2 A;  1IH0 A;  1TTX A;  2BE4 A;  1BLQ A;  1C7W A;  3CTN A;  3D73 A;  1BJF A;  3FS7 A;  1N0Y A;  4CID A;  3OGN A;  3D77 A;  3JVT B;  1M63 B;  1PAL A;  1CDM A;  2KNE A;  1WDC C;  2LMV A;  1DEL A;  2NXQ A;  1NCX A;  2WC6 A;  1TUZ A;  1RTP 1;  1CKK A;  4JQ0 D;  3I5I C;  1AK8 A;  1CLB A;  1YVH A;  4YI9 A;  1B47 A;  2JOJ A;  3AAK A;  3DD4 A;  1TCO B;  4OCI A;  2LAP A;  2M29 A;  3OX6 A;  2LLS A;  1FF1 A;  3NSI A;  3S0F A;  1YTZ C;  1UHK A;  3AAJ A;  4OKH A;  1PVB A;  1WY9 A;  1XVJ A;  4C0L A;  4YGA A;  2I2R E;  4FQO A;  4YRU A;  3PLF B;  2B1U A;  1QLK A;  2ZFD A;  1FW4 A;  3ICB A;  3WHU B;  2WC8 A;  1G33 A;  1TNW A;  2AAO A;  2JXL A;  5JJG A;  3RM1 A;  2AUC A;  2M49 B;  1A75 B;  1MHO A;  2BNX A;  2L5Y A;  1JWD A;  3KEV A;  1EJ3 A;  1IWQ A;  1KFX L;  2BEC A;  2WCH A;  1KFU L;  1DQE A;  3N7H A;  3BQ3 A;  4MSP A;  4F7F A;  1TWO A;  1IQ5 A;  1DGV A;  3QRX A;  3WNX B;  1OW4 A;  2ZND A;  2EC6 B;  3NXA A;  2GGZ A;  3DVK A;  3LL8 B;  4MZK A;  5DKR A;  1IIO A;  2LLT A;  2JXC A;  3LCP C;  1UUS A;  1TNX A;  2JNX A;  2YGU A;  2QDI A;  1J7P A;  1LA3 A;  1QVI Y;  4QJ4 B;  3VRN A;  1N65 A;  1QAT A;  1WDC B;  1DF0 B;  1XK4 C;  3SS3 A;  1KQV A;  2PMY A;  1QS7 A;  3BFB A;  1VRK A;  4AQJ A;  1CFF A;  2KAV A;  1M46 A;  2LUC A;  1OOF A;  2JUL A;  4GNK B;  1F71 A;  4NQG A;  4E68 A;  1M39 A;  2MLE C;  1FPW A;  3I5H C;  5KTY A;  4KYN A;  1LVC D;  2I7A A;  2JQ6 A;  3CDN A;  1ZUZ A;  3FIA A;  3NSL A;  4U8D A;  3VRQ A;  5AAN A;  1CDL A;  2JPT A;  4CLN A;  1K9U A;  1NPQ A;  3GOF A;  2BBN A;  3SIA A;  1DJZ A;  1DJX A;  1KFU S;  4MVF A;  4PE7 A;  1DVI A;  2L50 A;  4DRW A;  1C07 A;  2G9B A;  1HT9 A;  1K96 A;  1PUL A;  2ZN9 A;  1XFU O;  5ER4 X;  3PAL A;  4MLW A;  1PSR A;  2L2E A;  4TNC A;  3VRO A;  3WXA A;  3FWC A;  5K89 A;  2KOT A;  2KBM A;  2JPO A;  3EKJ A;  2CT9 A;  1LA0 A;  4PCW A; 
#chains in the Genus database with same CATH homology
 2KI6 D;  2Y5I A;  4QJ5 B;  1YX7 A;  2FCE A;  5HKW A;  3VRR A;  2L98 A;  2LVJ A;  3PAT A;  2RGI A;  1F54 A;  1BT6 A;  3OP0 A;  1JF0 A;  1V1G A;  1ALW A;  1IG5 A;  1CM1 A;  2DOQ A;  1WLZ A;  2WOR A;  4MN0 A;  4BY4 A;  1NX2 A;  3TDZ A;  1NIW A;  1EXR A;  2M1U A;  3PN7 C;  1B8C A;  1SKT A;  4CFQ A;  2LAN A;  5CSF A;  2EHB A;  2F33 A;  1IQ3 A;  4ORC B;  1WLM A;  4I5K A;  2SCP A;  2MHH A;  2GV5 A;  1GGZ A;  1R6P A;  2BCB A;  1OMD A;  2KBI A;  2LVV A;  1NUB A;  1S1E A;  3HX4 A;  3I5H B;  1CFC A;  2K7D A;  2KFH A;  1E8A A;  1NX0 A;  2ZRT A;  1KSO A;  1YVL A;  1IJ6 A;  3VGO A;  3O2P A;  1Y1U A;  4NDC A;  1Y1X A;  2I94 A;  2WCB A;  2M97 A;  1RWY A;  3OB2 B;  5KSZ A;  1LXF C;  4MBE A;  4M2Q A;  2HET A;  1EL4 A;  1BOD A;  1AJ5 A;  1YR5 A;  5HKY A;  1UHN A;  1D1O A;  1SL8 A;  4FTG A;  3OB1 B;  5I2L A;  2E6W A;  3TUY C;  1SW8 A;  5PAL A;  1R2U A;  5DKQ A;  2NCP A;  5AXI A;  4YBH B;  3SG6 A;  3MSE B;  2COL B;  2H61 C;  5G08 A;  1TCF A;  3K21 A;  5HLV A;  1DJG A;  2BL0 C;  4R1E A;  1DT7 B;  2EC6 C;  2KYC A;  3LK0 A;  1SYM A;  2A4J A;  3BUN B;  4PHN A;  2MLF C;  2KAX A;  2JT0 A;  2MAZ A;  2PVB A;  2JWW A;  1J1E A;  1ODB A;  4OV2 A;  3PN7 B;  4QJ3 B;  2WCE A;  5GQQ C;  2HF5 A;  2JT3 A;  1QIV A;  1JUO A;  3VRP A;  2M3W A;  5AEQ A;  1B1G A;  1BF5 A;  1QLS A;  1BMO A;  2KI4 C;  4ORB B;  4YGD B;  4MZL A;  1A2X A;  2LC5 A;  2EGD A;  1PK0 D;  1CNP A;  1YUR A;  1CMG A;  4MZJ A;  1X02 A;  1JFJ A;  2QAC A;  2JZI A;  3O78 A;  1NX3 A;  1U5I A;  2L4I A;  2SAS A;  4OR9 B;  5CPV A;  2JRF A;  2BCX A;  1FBV A;  4DIR A;  1Y0V H;  2NLN A;  1CLM A;  4A4C A;  1A03 A;  1F8H A;  4C0K A;  3SIB A;  3I5G C;  2BCA A;  2ZKM X;  1YX8 A;  3GK2 A;  3O4Y A;  3TUY B;  1JC2 A;  2AMI A;  4DUQ A;  2HPS A;  1NYA A;  2KFG A;  1GQM A;  1KWO C;  1S26 D;  2OTG C;  1EH2 A;  1K2H A;  3EK7 A;  3CGA A;  1J1D A;  1BR4 B;  2BL0 B;  2K2F A;  3NSK A;  1IGV A;  1UHH A;  1YUS A;  3LK1 A;  1KQM B;  2TN4 A;  1CFD A;  4I5L B;  4GAO A;  2LHL A;  1SBJ A;  2F3Y A;  1Y1A A;  2PSR A;  2M1K B;  3DVE A;  1K9K A;  4I5J A;  4HRG A;  1TOP A;  2CTN A;  4YI8 A;  3WHT B;  3A4U B;  1AVS A;  4M2O A;  3CLN A;  2H2K A;  2Q4U A;  1FI6 A;  2K7O A;  2JTT A;  1SNL A;  2KI4 B;  1IRJ A;  1W7J B;  5HLO A;  1KCY A;  4PE1 A;  1NP8 A;  1WRZ A;  1DJH A;  1RK9 A;  4PE4 A;  1KFX S;  1A29 A;  2JNF A;  3A8R A;  3BYA A;  4YGB B;  1SCV A;  2KHN A;  4WQ3 A;  2LHI A;  3I5G B;  2WND A;  3DF0 A;  1PVA A;  1UP5 A;  2KYF A;  2M0R A;  2M8U A;  4GUK A;  4XJK A;  1C7V A;  3EK8 A;  1WRL A;  2LM5 A;  1YUU A;  2Y4Q A;  1KWO B;  3D0Y A;  2OTG B;  2LUX A;  1W7I B;  1CMF A;  2CBL A;  4JWQ A;  2LE9 B;  2I18 A;  1AUI B;  4DCK A;  1QV1 A;  4ZCV A;  1MWN A;  4PHJ A;  1DJY A;  2V53 A;  5HYD A;  1L7Z A;  1BR1 B;  5BPJ A;  5I2Q A;  4N1G A;  4GFT A;  1SK6 D;  2E30 A;  3DVM A;  1XYD A;  4NDB A;  3JTD C;  3RLZ A;  2JC2 A;  1TIZ A;  4ICB A;  3O6B A;  2F8P A;  2LMU A;  1K9P A;  2BKH B;  2FOT A;  1A4P A;  1QIW A;  3EK4 A;  4MRY A;  1PSB A;  2KAY A;  2WCF A;  3BUO B;  2FJU B;  3KHE A;  1J55 A;  1B7T Z;  2KQY A;  5JOL A;  2O60 A;  2KGR A;  1UHJ A;  2NZ0 A;  1RJV A;  1MXE A;  3IQQ A;  5TNC A;  1AHR A;  1SL9 A;  1F4Q A;  1QXP A;  2LVK A;  2O5G A;  1SY9 A;  1XA5 A;  3SG2 A;  1EG3 A;  2KFF A;  1S6I A;  2KSP A;  2BBM A;  1REC A;  1WRK A;  4NDD A;  1AP4 A;  1S36 A;  1YRT B;  2HQW A;  1OE9 B;  1KK7 Z;  2Q91 A;  1F4O A;  3CR2 A;  1CM4 A;  3DF0 B;  4XJK B;  1M31 A;  1S5G Z;  1SPY A;  2WOS A;  4N5X A;  2FCD A;  1S3P A;  5I2O A;  2M7L A;  3D0Y B;  2ZNE A;  5FYX A;  1ZMZ A;  1KSM A;  1B8L A;  2GGM A;  2L0P A;  4USL A;  2JT8 A;  2PAS A;  1OMR A;  2K2A A;  4F0Z B;  1NX1 A;  4CPV A;  1KK8 C;  1RRO A;  2MJW B;  3DVJ A;  1IJ5 A;  1SCM B;  5D69 A;  1KQM C;  1DJI A;  2OS8 C;  3KO0 A;  4XYN A;  3SG3 A;  4HRH A;  4GBA A;  1QV0 A;  2VRG A;  1TNP A;  1Y6W A;  1K8U A;  4PDZ A;  1XFY O;  3JTD B;  1CDP A;  4YGC B;  1TN4 A;  3LLE A;  4YGE B;  4CID A;  1SL7 A;  3ZWH A;  4GGN A;  2MA2 A;  1TRF A;  2JU0 A;  1OQP A;  1JBA A;  2KQ6 A;  1F55 A;  5CSI A;  5J3X A;  1B8R A;  1H4B A;  1DJW A;  1CLL A;  2Y1M A;  1K93 D;  1CDN A;  2Y1N A;  2HQ8 A;  3BXK A;  4M2P A;  1XFW O;  4L9M A;  2K61 A;  3EVU A;  1JF2 A;  1BG1 A;  3CS1 A;  2LV7 A;  3NSO A;  1DF0 A;  5ER5 A;  1EG4 A;  1PRW A;  2F2O A;  3PM8 A;  1XO5 A;  4Q04 A;  4P5O E;  3SG4 A;  1B9A A;  1QJT A;  1JSA A;  1Q80 A;  4PHM A;  1OSA A;  3I5F C;  2LP2 A;  3M0W A;  3GK4 X;  1SMG A;  3D10 A;  3ZNI A;  3CR4 X;  1CTR A;  1KK8 B;  5F6T A;  3BUM B;  1G8I A;  2KGB C;  1G4Y R;  1K94 A;  2OS8 B;  4I5N B;  2K0J A;  1YUT A;  2LNK A;  4MRX A;  1N2D A;  3IF7 A;  1XFX O;  1B4C A;  3TS5 C;  4A4B A;  3AKB A;  4PE0 A;  4HRE E;  4PAL A;  2LMT A;  1OMV A;  3E3R A;  4UPG A;  2L4H A;  1MUX A;  1TNQ A;  1QX7 A;  1SR6 B;  2BE6 A;  2L51 A;  3HCM A;  4D1E A;  1MF8 B;  2KDH A;  1L2O B;  1M45 A;  1DMO A;  3PSR A;  5AFP A;  1MXL C;  1ALV A;  1V1F A;  1U5I B;  1QAS A;  2JTZ A;  5IBW A;  3AKA A;  1J7O A;  1LKJ A;  1IKU A;  4MEW A;  1B7T Y;  1XK4 A;  3BOW A;  1SRA A;  1J7R A;  1BU3 A;  1ZOT B;  3EVV A;  3SG7 A;  3I5I B;  3IQO A;  1XFV O;  2F2P A;  2LVI A;  1AJ4 A;  3I5F B;  4WRI A;  1NCY A;  4ZCU A;  1NCZ A;  2M9G A;  1OOJ A;  1NWD A;  4WQ2 A;  1QTX A;  1UWO A;  5DKN A;  1KK7 Y;  3KPX A;  2PAL A;  1SCM C;  2K7B A;  4GGF A;  4GGF C;  1S5G Y;  4ETO A;  2ZRS A;  2CNP A;  3TS5 B;  5I8N A;  5AER A;  1OZS A;  1S6J A;  1UUR A;  4OVN F;  1K95 A;  3C1V A;  2NCO A;  2IS9 A;  3GK1 A;  2KI6 C;  3SG5 A;  4AQI A;  1BOC A;  4JPZ B;  4BY5 A;  4C0J A;  2CXJ A;  5CSN A;  2ISD A;  5HKZ A;  4HSZ A;  1QVI Z;  2BKI B;  1ZAC A;  2P6B B;  3CZT X;  4GPL B;  1DTL A;  1UHI A;  2K7C A;  2MBX A;  3KF9 A;  1XFZ O;  5KU1 A;  1QX2 A;  3OX5 A;  2K8M B;  3EVR A;  3JVT C;  3H4S E;  4N1F A;  3BOW B;  3FWB A;  1FI5 A;  3TDU A;  1QX5 B;  3CR5 X;  1CB1 A;  1NSH A;  5CSJ A;  2R2I A;  2PRU A;  1JFK A;  5B8I B;  4P2Y B;  2MRD A;  3SJS A;  3BUW B;  5D7F A;  1F70 A;  2L5X B;  1LIN A;  2QPT A;  1J7Q A;  3BUX B;  1YRU B;  1HQV A;  3CWG A;  4DS7 A;  2G2B A;  1S6C A;  3EKH A;  4PHK A;  1MR8 A;  2LLU A;  1CFP A;  1RFJ A;  1GJY A;  2F3Z A;  2LCP A;  3TZ1 A;  2CCM A;  3TDI A;  1H8B A;  3PFV A;  2D8N A;  1MQ1 A;  2M7N A;  1GGW A;  1OZO A;  3F45 A;  1A75 A;  2OPO A;  2ZN8 A;  4IL1 A;  1K90 D;  1SR6 C;  4ORA B;  4AOM A;  1ZFS A;  1DGU A;  4CFR A;  1L2O C;  2LP3 A;  2H61 A;  3OHM B;  1IH0 A;  1TTX A;  2BE4 A;  1BLQ A;  1C7W A;  3CTN A;  3FS7 A;  1BJF A;  1N0Y A;  3JVT B;  1M63 B;  1PAL A;  1CDM A;  2KNE A;  1WDC C;  2LMV A;  2NXQ A;  1NCX A;  1CKK A;  1RTP 1;  4JQ0 D;  3I5I C;  1AK8 A;  1CLB A;  1YVH A;  4YI9 A;  1B47 A;  2JOJ A;  3AAK A;  3DD4 A;  1TCO B;  4OCI A;  2LAP A;  2M29 A;  3OX6 A;  2LLS A;  1FF1 A;  3NSI A;  1YTZ C;  1UHK A;  3AAJ A;  4OKH A;  1PVB A;  1WY9 A;  1XVJ A;  4C0L A;  4YGA A;  2I2R E;  4FQO A;  4YRU A;  3PLF B;  2B1U A;  1QLK A;  2ZFD A;  1FW4 A;  3ICB A;  3WHU B;  2WC8 A;  1G33 A;  1TNW A;  2AAO A;  2JXL A;  5JJG A;  3RM1 A;  2AUC A;  2M49 B;  1A75 B;  1MHO A;  1JWD A;  3KEV A;  1EJ3 A;  1IWQ A;  1KFX L;  2BEC A;  1KFU L;  4MSP A;  3BQ3 A;  1IQ5 A;  1DGV A;  3QRX A;  3WNX B;  2ZND A;  2EC6 B;  3NXA A;  2GGZ A;  3DVK A;  3LL8 B;  4MZK A;  5DKR A;  2LLT A;  2JXC A;  3LCP C;  1UUS A;  1TNX A;  2JNX A;  1J7P A;  1LA3 A;  1QVI Y;  4QJ4 B;  3VRN A;  1N65 A;  1QAT A;  1WDC B;  1DF0 B;  1XK4 C;  1KQV A;  2PMY A;  1QS7 A;  1VRK A;  4AQJ A;  1CFF A;  2KAV A;  1M46 A;  2LUC A;  2JUL A;  4GNK B;  1F71 A;  4NQG A;  4E68 A;  1M39 A;  2MLE C;  1FPW A;  3I5H C;  5KTY A;  3VRQ A;  1LVC D;  2I7A A;  2JQ6 A;  4U8D A;  1ZUZ A;  3FIA A;  3NSL A;  5AAN A;  1CDL A;  2JPT A;  4CLN A;  1K9U A;  1NPQ A;  3GOF A;  2BBN A;  3SIA A;  1DJZ A;  1DJX A;  1KFU S;  4MVF A;  4PE7 A;  1DVI A;  2L50 A;  4DRW A;  1C07 A;  2G9B A;  1HT9 A;  1K96 A;  1PUL A;  2ZN9 A;  1XFU O;  5ER4 X;  3PAL A;  4MLW A;  1PSR A;  2L2E A;  4TNC A;  3VRO A;  3WXA A;  3FWC A;  5K89 A;  2KOT A;  2KBM A;  3EKJ A;  2CT9 A;  1LA0 A;  4PCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...