1SCMC

Structure of the regulatory domain of scallop myosin at 2.8 angstroms resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
149
structure length
149
Chain Sequence
SQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN HEAVY CHAIN
publication title Structure of the regulatory domain of scallop myosin at 2.8 A resolution.
pubmed doi rcsb
source organism Argopecten irradians
molecule tags Calcium-binding protein
total genus 37
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 1994-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1scmC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1scmC02
3KEVA 2SCPA 4IL1A 1KSMA 3DVJA 1SCMB 2MA2A 2COLB 1TNXA 1G33A 3KHEA 1QX7A 1KFUS 2E6WA 1DF0B 4MRXA 2LV7A 1YVLA 1CM4A 3EKHA 3BYAA 4I5JA 3VROA 1BT6A 1YX7A 4YRUA 4C0LA 3AAJA 1BODA 1JBAA 3CGAA 3NSKA 1AK8A 5CSNA 1LVCD 1RROA 2CTNA 5ER4X 2LLSA 2HQ8A 1DJZA 4MSPA 4N1GA 1H4BA 1NCZA 1YRTB 2KFGA 4L9MA 2FCDA 3TZ1A 3CWGA 1A29A 1BJFA 1Y6WA 1BMOA 2WNDA 2Y1NA 1WRZA 1SCMC 5I2QA 3GOFA 1H8BA 2JULA 1YTZC 2M0RA 3O78A 1C7WA 1XFUO 1XYDA 1KFXS 1UWOA 4P5OE 1SCVA 2EC6B 1J55A 1YVHA 4UPGA 3OHMB 3SG2A 1A4PA 1K8UA 3NXAA 3BUNB 1MR8A 3DVEA 2LANA 3AAKA 4MZLA 2ZRSA 1CMFA 2O60A 3DVKA 1UP5A 4U8DA 1JC2A 3I5GC 4GPLB 2BBMA 2MRDA 3EVVA 1LINA 2JXCA 2KYFA 1B47A 1LXFC 5CPVA 1S6CA 2PALA 5CSFA 2L50A 2I18A 4PHNA 4OKHA 1UHHA 3DF0B 1SL9A 3LCPC 1OMVA 2JNFA 1MXEA 5B8IB 3HX4A 1J7QA 2EC6C 1CDMA 2K2AA 2WOSA 5IBWA 1JSAA 1S6JA 4E68A 1KWOB 3TUYC 4GNKB 1V1GA 4ORAB 2NCOA 3PN7C 3LLEA 1QJTA 1M46A 3DF0A 3JVTB 2LUXA 4TNCA 5HLOA 1B8LA 1IQ5A 2Y4QA 1S1EA 1NCXA 3SG6A 2LNKA 4YGCB 1AJ5A 1E8AA 2JU0A 4PHKA 3PLFB 4HRGA 5AERA 2KQYA 3E3RA 4MRYA 2KAXA 4GUKA 1AHRA 2LM5A 1UHKA 3NSLA 2DOQA 2L4IA 4GAOA 4Q04A 1CDNA 3SIAA 2OS8B 1FBVA 1J7RA 1NX2A 1S5GY 2NCPA 1NCYA 1KWOC 3SIBA 1JF0A 3KF9A 1G4YR 1N0YA 1NIWA 1SMGA 5GQQC 2L4HA 1CNPA 5CSIA 1CM1A 3JVTC 1BF5A 1OQPA 1WRLA 4M2PA 1C7VA 2ISDA 2P6BB 2JRFA 2I94A 4NQGA 2KHNA 1C07A 1CFPA 3I5FB 1F4QA 2JWWA 1JWDA 4PHMA 2NXQA 1QS7A 2KFFA 3D0YB 3PM8A 2F8PA 2OS8C 3EKJA 3VRQA 5JJGA 1Y1XA 2F2OA 1VRKA 2H61A 5D7FA 2WCBA 4HREE 2CNPA 1WRKA 1V1FA 2LHIA 3SG3A 2MAZA 1EL4A 1DVIA 1TRFA 2M97A 2K7BA 4WQ3A 1XVJA 4PCWA 2CXJA 2LVKA 2H61C 2JT3A 4XYNA 1QV1A 1KCYA 2OPOA 2WC8A 3D0YA 3EVRA 1IRJA 3IQOA 3TDZA 5AXIA 4WQ2A 3I5FC 2BECA 2BCAA 1SK6D 1PSRA 4P2YB 1K9PA 1HQVA 3FS7A 5HKYA 1K96A 2KI4B 1B4CA 4YBHB 5KU1A 1U5IA 1N2DA 4MLWA 3DD4A 1SL7A 4GGNA 1CLLA 1KK8B 4ZCUA 2LVJA 1TN4A 3BOWB 2OTGB 4CPVA 1QX5B 4FTGA 4ICBA 2KBMA 1WLZA 3CTNA 1CFFA 2M9GA 1YUUA 2CBLA 2JNXA 4GFTA 1XA5A 1DF0A 2F3YA 4GBAA 3C1VA 2M8UA 4QJ5B 1RWYA 3CLNA 1EXRA 2ZN9A 1GGZA 1MQ1A 1TNQA 1Y1AA 1A2XA 1YX8A 2BBNA 4DS7A 1AP4A 4I5LB 5DKNA 2Y5IA 2LHLA 2FJUB 3BOWA 3RM1A 1DJGA 1TNWA 4AQIA 1FI6A 1FPWA 2NLNA 1J7PA 2KBIA 1DJHA 1K9UA 5PALA 1QVIZ 3HCMA 2I7AA 2KI4C 3FIAA 1EG4A 2PMYA 2PSRA 1WLMA 1MWNA 3F45A 4M2OA 3WHUB 5BPJA 1YUTA 2KFHA 1MXLC 1B8CA 1KK8C 2OTGC 3CS1A 3VRRA 1TNPA 5DKRA 3I5IB 1S6IA 1CFDA 1NPQA 3OP0A 2EHBA 4OV2A 4A4CA 1ZUZA 3WHTB 1QLKA 2WORA 5HKZA 1EH2A 2KSPA 3A8RA 2FOTA 4YGAA 4OCIA 5AANA 3ZNIA 4XJKB 5AFPA 1NX3A 3TS5B 2KOTA 1YURA 3EVUA 1AUIB 3BUMB 4DIRA 1BR1B 1KK7Y 5TNCA 2K7OA 1R2UA 2K61A 1A75B 2BCBA 3WXAA 5CSJA 1B7TZ 3RLZA 3SG7A 3SG5A 1XO5A 1PVBA 3I5IC 1K94A 2LMTA 3LK0A 1K2HA 4ORCB 1Q80A 1D1OA 2LMUA 4F0ZB 2CT9A 3OX6A 3GK2A 1XFZO 1DTLA 1B8RA 2KI6D 4PE7A 1NWDA 1Y1UA 3BUWB 3CZTX 1HT9A 1ALWA 1A75A 1PALA 1CMGA 1RFJA 5JOLA 4D1EA 4MEWA 3H4SE 2JT0A 2K0JA 3TS5C 1IGVA 1OMRA 1MHOA 3FWCA 4PALA 4ZCVA 4MVFA 1K9KA 2SASA 1K93D 4I5NB 1WDCB 1F54A 1PULA 1TCFA 3EK4A 2ZNDA 1PRWA 2PVBA 4ORBB 1BR4B 2O5GA 3PATA 4YGDB 3VRPA 2Y1MA 3IF7A 2KGRA 5I8NA 2D8NA 1KSOA 1NX1A 1TCOB 4ETOA 4PE1A 1IQ3A 1AJ4A 1S26D 3VGOA 2LVVA 2F3ZA 2KYCA 1GGWA 2M1UA 2EGDA 3A4UB 1TTXA 1ZACA 3O4YA 3BQ3A 4PDZA 1IWQA 1OSAA 1TIZA 5FYXA 2L2EA 3OB1B 3TDIA 1ZFSA 1NX0A 1QXPA 2K7DA 4I5KA 4FQOA 5I2LA 1S36A 2JQ6A 2KGBC 2AAOA 1QV0A 2K8MB 1PVAA 2BKIB 2LP2A 4JPZB 4CFQA 1OZSA 2TN4A 3OB2B 4USLA 2E30A 4A4BA 1NSHA 4NDCA 3BUXB 1RECA 4OVNF 2GGMA 1QASA 4JWQA 1M63B 5G08A 1F4OA 2FCEA 4NDBA 5KSZA 1QIVA 2ZFDA 1QVIY 2MBXA 2WCFA 2JOJA 1DMOA 2LE9B 3AKBA 2M3WA 1YUSA 2MJWB 3K21A 1DGUA 2M29A 2KQ6A 1R6PA 3CR4X 4JQ0D 3AKAA 1XK4A 4R1EA 1JF2A 1LA3A 2I2RE 1NP8A 3CR5X 3SJSA 5DKQA 2JTTA 2L98A 2QACA 3DVMA 1EJ3A 2AMIA 5F6TA 2H2KA 5I2OA 1WY9A 1M45A 1BOCA 1Y0VH 1XK4C 4GGFA 1YRUB 3WNXB 1JUOA 1MUXA 2JTZA 3PSRA 1OZOA 2MLFC 3O6BA 3GK4X 2ZKMX 4AOMA 5D69A 1ZOTB 2M7NA 4WRIA 1IG5A 1B1GA 3I5GB 4YGEB 1IJ6A 4YGBB 4PE0A 4GGFC 1AVSA 1F70A 2JXLA 1FW4A 2M7LA 1B7TY 1PSBA 2ZRTA 2JT8A 1DJWA 4N1FA 5J3XA 2KNEA 1J1EA 3JTDB 1QLSA 1SNLA 1TOPA 4MN0A 1CTRA 4N5XA 2RGIA 1S3PA 3KPXA 4MZJA 1B9AA 1W7IB 1PK0D 2KI6C 1UHIA 1CB1A 2AUCA 2ZN8A 1JFKA 2GGZA 3PFVA 2BL0B 5HKWA 3NSIA 1RJVA 2B1UA 2HETA 2KAYA 1SL8A 1IKUA 5HLVA 2NZ0A 1CLBA 1DJYA 1ALVA 3TUYB 1L7ZA 2JPTA 5ER5A 1RTP1 2BE6A 2R2IA 1FF1A 5K89A 3PN7B 4HSZA 1W7JB 2LVIA 3ICBA 1SR6B 1JFJA 2G2BA 2PRUA 1F55A 1UHNA 2ZNEA 4XJKA 4CFRA 1KQMB 3JTDC 1F71A 1NYAA 2KDHA 1KFUL 1M31A 1OE9B 1QX2A 1EG3A 2F33A 1L2OB 3CR2A 2HQWA 2PASA 1DGVA 2L0PA 4MBEA 5AEQA 1SPYA 4C0JA 2HPSA 3MSEB 3EK8A 3I5HB 1M39A 2BL0C 1XFWO 1DJXA 1XFVO 4CLNA 4CIDA 3KO0A 4C0KA 1YR5A 2K2FA 1K95A 2JZIA 2M1KB 4QJ3B 1MF8B 1UUSA 5HYDA 1CFCA 1BG1A 1SR6C 3PALA 1SY9A 4NDDA 2LC5A 2GV5A 2MHHA 1DT7B 1NUBA 2L5XB 2A4JA 2WCEA 1KQMC 2MLEC 1N65A 1F8HA 3BUOB 1QTXA 2QPTA 1QATA 1KFXL 1BU3A 1L2OC 2HF5A 3LL8B 1KQVA 3NSOA 3OX5A 4YI8A 4BY5A 1K90D 1KK7Z 4PE4A 3I5HC 1FI5A 2F2PA 2BCXA 2LP3A 3IQQA 4MZKA 4M2QA 4DCKA 2L51A 4DRWA 3LK1A 1J1DA 3O2PA 1CDLA 4BY4A 1OMDA 4AQJA 4YI9A 3QRXA 1A03A 3BXKA 1IJ5A 2M49B 1WDCC 3SG4A 1GQMA 1UHJA 3FWBA 3D10A 3EK7A 1CLMA 2BKHB 2VRGA 1SBJA 1RK9A 2K7CA 1DJIA 2G9BA 2LLUA 2BE4A 2LAPA 1ODBA 3M0WA 1XFYO 1CDPA 3ZWHA 4QJ4B 1IH0A 4HRHA 1SW8A 3VRNA 2LMVA 1X02A 1SRAA 1CKKA 2Q4UA 2LLTA 1SYMA 1S5GZ 1UURA 1XFXO 2LUCA 3GK1A 2V53A 3TDUA 2KAVA 1J7OA 2JC2A 2LCPA 4OR9B 1BLQA 1LA0A 4PHJA 1OOJA 2CCMA 1G8IA 1GJYA 1QIWA 4DUQA 2IS9A 1ZMZA 2Q91A 1U5IB 5KTYA 1SKTA 1LKJA
chains in the Genus database with same CATH superfamily
3KEVA 2SCPA 4IL1A 1KSMA 3DVJA 1SCMB 2MA2A 2COLB 1TNXA 1G33A 3KHEA 1QX7A 1KFUS 2E6WA 4FQTA 1DF0B 4MRXA 2LV7A 2WC5A 3V2LA 1YVLA 2WCLA 1CM4A 3EKHA 3BYAA 4I5JA 3VROA 1BT6A 1YX7A 4YRUA 4C0LA 1Z2CB 1SSEB 3AAJA 1BODA 1JBAA 3CGAA 3NSKA 1AK8A 2KLDA 5CSNA 1LVCD 1RROA 2CTNA 5ER4X 2LLSA 2HQ8A 1DJZA 4INWA 4MSPA 3OBVA 3SS5A 4N1GA 1H4BA 1NCZA 1YRTB 2KFGA 4L9MA 2FCDA 4KYNA 3TZ1A 3CWGA 1A29A 1BJFA 1Y6WA 1BMOA 2WNDA 2Y1NA 3DZTA 3FE8A 1WRZA 1SCMC 5I2QA 3GOFA 1H8BA 2JULA 1YTZC 2M0RA 3O78A 5D3OA 1C7WA 1XFUO 1XYDA 4OZDA 1KFXS 1UWOA 4P5OE 1DQEA 1SCVA 2EC6B 1J55A 1YVHA 3S0GA 3VB1A 4UPGA 5DICA 3OHMB 3SG2A 1A4PA 5FI6A 1K8UA 3NXAA 3BUNB 1MR8A 3DVEA 2LANA 3AAKA 4MZLA 2ZRSA 1CMFA 2O60A 3DVKA 3R72A 1UP5A 4U8DA 1JC2A 3D75A 3I5GC 4IJ7A 3CZ0A 4GPLB 2BBMA 2MRDA 3EVVA 1LINA 2JXCA 2KYFA 1B47A 1LXFC 1OOHA 1S6CA 5CPVA 2PALA 5CSFA 2L50A 2I18A 2WCJA 3CABA 3NGVA 4OKHA 4PHNA 1UHHA 3DF0B 1SL9A 3LCPC 1OMVA 2JNFA 1MXEA 5B8IB 3HX4A 1J7QA 2EC6C 1CDMA 2BAPA 2K2AA 2KLEA 1LKJA 2WOSA 5IBWA 1JSAA 5EL2A 1S6JA 4E68A 1KWOB 3TUYC 5FI7A 4GNKB 1V1GA 1OOGA 4ORAB 3FE6A 2NCOA 3PN7C 3LLEA 1QJTA 1M46A 3DF0A 3JVTB 2LUXA 4TNCA 5HLOA 1B8LA 1IQ5A 2Y4QA 1S1EA 1NCXA 3CZ1A 3SG6A 2LNKA 4YGCB 1AJ5A 1E8AA 2JU0A 4PHKA 3PLFB 4HRGA 2BNXA 5AERA 2KQYA 3E3RA 4MRYA 2KAXA 4JKTA 4GUKA 1AHRA 2LM5A 1UHKA 3NSLA 2DOQA 2L4IA 4GAOA 4Q04A 1CDNA 3SIAA 2OS8B 1FBVA 1J7RA 1NX2A 1S5GY 2NCPA 2FJYA 1NCYA 1KWOC 3SIBA 1OW4A 1JF0A 3KF9A 1G4YR 1N0YA 1NIWA 1SMGA 3R1OA 5GQQC 2L4HA 1CNPA 5CSIA 1CM1A 3JVTC 1BF5A 1OQPA 1WRLA 4M2PA 1C7VA 2ISDA 2P6BB 1TWOA 2JRFA 2I94A 4NQGA 2KHNA 1C07A 2QEOA 1CFPA 2QEVA 3I5FB 1F4QA 2JWWA 3QMEA 4PHMA 1JWDA 2NXQA 1QS7A 2KFFA 3D0YB 3PM8A 2F8PA 3S0EA 2OS8C 3EKJA 3L47A 3VRQA 5JJGA 2WCHA 1Y1XA 2F2OA 1VRKA 2H61A 5D7FA 2WCBA 4HREE 2CNPA 1WRKA 1V1FA 2LHIA 3SG3A 2MAZA 2WC6A 1EL4A 1DVIA 1TRFA 2M97A 2K7BA 4WQ3A 1XVJA 4PCWA 2CXJA 2LVKA 2H61C 2JT3A 4XYNA 1QV1A 1KCYA 2OPOA 2WC8A 3D0YA 3EVRA 1IRJA 3IQOA 3L4AA 3TDZA 5AXIA 4WQ2A 1OOFA 3I5FC 2BECA 2BCAA 1SK6D 1PSRA 4P2YB 1K9PA 1HQVA 3FS7A 5HKYA 1K96A 2ERBA 2KI4B 1B4CA 4YBHB 5KU1A 1U5IA 1N2DA 4MLWA 3DD4A 1SL7A 4GGNA 3DYEA 1CLLA 1KK8B 4ZCUA 2LVJA 1TN4A 3BOWB 2OTGB 4CPVA 1QX5B 4FTGA 3IVTA 4ICBA 2KBMA 1ORGA 1WLZA 3CTNA 1CFFA 2M9GA 1YUUA 2CBLA 2JNXA 4GFTA 1XA5A 1DF0A 2F3YA 4GBAA 3C1VA 2M8UA 4QJ5B 1RWYA 3CLNA 1EXRA 2ZN9A 1GGZA 1MQ1A 2K60A 1TNQA 1Y1AA 1A2XA 1YX8A 2BBNA 4DS7A 1AP4A 4I5LB 5DKNA 2Y5IA 2LHLA 2FJUB 3BOWA 3RM1A 1DJGA 1TNWA 4AQIA 1FI6A 1FPWA 2NLNA 1J7PA 2L5YA 2KBIA 1DJHA 1K9UA 3D76A 5PALA 1QVIZ 3HCMA 2I7AA 2KI4C 3FIAA 1EG4A 2PMYA 2PSRA 1WLMA 1MWNA 3F45A 4M2OA 3WHUB 5BPJA 1YUTA 2KFHA 1MXLC 1B8CA 1KK8C 3BFBA 2OTGC 3CS1A 3VRRA 1TNPA 5DKRA 3I5IB 1S6IA 1CFDA 1NPQA 3OP0A 2EHBA 4OV2A 3UO9A 1ZUZA 4A4CA 2PQLA 3DXLA 3WHTB 1QLKA 2WORA 5HKZA 1EH2A 2KSPA 3A8RA 2FOTA 3S0AA 4YGAA 2P71A 4OCIA 5AANA 3ZNIA 4XJKB 5AFPA 1NX3A 5HL1A 3TS5B 2KOTA 1YURA 4PT1A 3EVUA 1AUIB 3BUMB 4DIRA 1BR1B 1KK7Y 5TNCA 2K7OA 1R2UA 3R1PA 1XFRA 2K61A 1A75B 2BCBA 3WXAA 5CSJA 1B7TZ 3RLZA 3SG7A 4JD9A 1XO5A 3SG5A 1IIOA 1PVBA 3I5IC 1K94A 2LMTA 3LK0A 1K2HA 4ORCB 1Q80A 3FE9A 1D1OA 2LMUA 3SS4A 4F0ZB 2CT9A 3OX6A 3GK2A 1XFZO 1DTLA 1B8RA 2KI6D 4PE7A 1NWDA 1LS8A 1Y1UA 3BUWB 3CZTX 1HT9A 1ALWA 1A75A 1PALA 1CMGA 1RFJA 5JOLA 4D1EA 4MEWA 3H4SE 2JT0A 2K0JA 3TS5C 1IGVA 1OMRA 3B86A 1MHOA 3FWCA 4PALA 4ZCVA 3S0FA 4MVFA 1K9KA 2SASA 1K93D 4I5NB 1WDCB 1F54A 1C3ZA 1PULA 1TCFA 3EK4A 2ZNDA 1T14A 1PRWA 2PVBA 3B7AA 1BR4B 4ORBB 2O5GA 3PATA 4YGDB 3VRPA 3R1VA 2Y1MA 3IF7A 2KGRA 5I8NA 2D8NA 1KSOA 1NX1A 1TCOB 2H8VA 4ETOA 4PE1A 1OOIX 1IQ3A 3RZSA 1AJ4A 1S26D 3VGOA 2LVVA 2F3ZA 2KYCA 1GGWA 2M1UA 2EGDA 3A4UB 1TTXA 1ZACA 3O4YA 3BQ3A 3Q8IA 4PDZA 1IWQA 1OSAA 1TIZA 5FYXA 1C3YA 2L2EA 3OB1B 3TDIA 1ZFSA 1NX0A 1QXPA 2K7DA 4I5KA 4FQOA 5I2LA 1S36A 2JQ6A 2KGBC 2AAOA 1QV0A 1DELA 2K8MB 3S0BA 1PVAA 2BKIB 2LP2A 3EG5B 4JPZB 4CFQA 1OZSA 2TN4A 3OB2B 4USLA 2E30A 4A4BA 1NSHA 4NDCA 3BUXB 1RECA 4OVNF 3S0DA 2GGMA 1QASA 4JWQA 1M63B 3D74A 1F4OA 5G08A 2FCEA 4NDBA 4F7FA 5KSZA 1QIVA 2ZFDA 1TUJA 1QVIY 3BFAA 2MBXA 2WCFA 2JOJA 1DMOA 2LE9B 3AKBA 2M3WA 1YUSA 2MJWB 3K21A 1DGUA 2M29A 2KQ6A 1R6PA 5I94A 3CR4X 4JQ0D 3AKAA 3K1EA 1DC1A 1XK4A 4R1EA 1JF2A 1LA3A 2I2RE 1NP8A 3CR5X 3SJSA 5DKQA 2JTTA 2L98A 2QACA 3NHIA 3DVMA 1EJ3A 2AMIA 5F6TA 2H2KA 5I2OA 1WY9A 1M45A 1BOCA 1Y0VH 1XK4C 4GGFA 1YRUB 2QDIA 1JUOA 1MUXA 2JTZA 3WNXB 3PSRA 1OZOA 2MLFC 3O6BA 3GK4X 2ZKMX 4AOMA 5D69A 1ZOTB 2M7NA 4WRIA 1IG5A 1B1GA 3I5GB 3B88A 4YGEB 1IJ6A 4YGBB 4PE0A 4GGFC 1AVSA 3UNWA 1F70A 2JXLA 2KPHA 1FW4A 2M7LA 1B7TY 1PSBA 2ZRTA 2JT8A 2WCKA 1DJWA 4N1FA 5J3XA 2KNEA 1J1EA 3JTDB 1QLSA 1SNLA 1TOPA 4MN0A 1W9ZA 3O4XA 1CTRA 3NHTA 4N5XA 2RGIA 1S3PA 3KPXA 4MZJA 1B9AA 1W7IB 1PK0D 2KI6C 3DY9A 1UHIA 1CB1A 2AUCA 2ZN8A 1JFKA 2GGZA 2GTEA 2BL0B 3PFVA 5HKWA 3NSIA 1RJVA 2B1UA 2HETA 2KAYA 1SL8A 1IKUA 5HLVA 2NZ0A 1CLBA 3PM2A 1DJYA 1ALVA 3TUYB 1DEKA 1L7ZA 2QEBA 2JPTA 5ER5A 1RTP1 2BE6A 2R2IA 1FF1A 5K89A 3PN7B 4HSZA 1W7JB 2LVIA 3ICBA 1SR6B 1JFJA 2G2BA 2PRUA 3D73A 3PJIA 2P70A 1F55A 1UHNA 2ZNEA 4XJKA 4CFRA 1KQMB 2PYQA 3JTDC 1F71A 1NYAA 2KDHA 1KFUL 1M31A 1OE9B 1QX2A 1EG3A 1P28A 1QWVA 2F33A 1L2OB 3CR2A 2HQWA 2PASA 1DGVA 2L0PA 4MBEA 1TUZA 1SPYA 5AEQA 2HPSA 3MSEB 3EK8A 3N7HA 4C0JA 3I5HB 5FI2A 1M39A 1XFWO 2BL0C 1DJXA 1XFVO 4CLNA 4CIDA 3KO0A 4C0KA 1YR5A 2K2FA 1GM0A 1K95A 2JZIA 2M1KB 4QJ3B 1MF8B 1UUSA 5HYDA 1CFCA 2QEHA 1BG1A 1SR6C 2L2CA 3PALA 1SY9A 4NDDA 2LC5A 2GV5A 2MHHA 1DT7B 1NUBA 2L5XB 2A4JA 2WCEA 3B87A 1KQMC 3D77A 2MLEC 1N65A 1F8HA 3BUOB 1QTXA 2WCMA 2QPTA 1QATA 1KFXL 1BU3A 1L2OC 2HF5A 3LL8B 1KQVA 2JPOA 3NSOA 3OX5A 4YI8A 3D78A 1K90D 1KK7Z 4PE4A 3I5HC 4BY5A 1FI5A 2F2PA 2BCXA 2LP3A 3IQQA 4MZKA 4M2QA 4DCKA 2L51A 4DRWA 3LK1A 1J1DA 3O2PA 1CDLA 4BY4A 1OMDA 4AQJA 4YI9A 3QRXA 1A03A 3BXKA 1IJ5A 2M49B 1WDCC 3SG4A 1GQMA 1UHJA 3FWBA 3SS3A 3D10A 3EK7A 1CLMA 2BKHB 2VRGA 1SBJA 1RK9A 2K7CA 1DJIA 2G9BA 2LLUA 2BE4A 2LAPA 1ODBA 3M0WA 1XFYO 1CDPA 3ZWHA 4QJ4B 1IH0A 4HRHA 1SW8A 3VRNA 2LMVA 1X02A 1SRAA 1CKKA 3CYZA 2Q4UA 2LLTA 1SYMA 1S5GZ 2YGUA 1UURA 3CDNA 1XFXO 2LUCA 3GK1A 2V53A 3TDUA 2KAVA 1J7OA 3OGNA 3BJHA 2JC2A 2LCPA 4INXA 4OR9B 1BLQA 1LA0A 3CZ2A 4PHJA 1OOJA 2CCMA 1G8IA 1GJYA 1QIWA 4DUQA 2IS9A 3B6XA 1ZMZA 2Q91A 3BFHA 1U5IB 5KTYA 1SKTA 3L4LA 1Z4HA
chains in the Genus database with same CATH topology
3KEVA 2SCPA 4IL1A 1KSMA 3DVJA 1SCMB 2MA2A 2COLB 1TNXA 1G33A 3KHEA 1QX7A 1KFUS 2E6WA 1DF0B 4MRXA 2LV7A 1YVLA 1CM4A 3EKHA 3BYAA 4I5JA 3VROA 1BT6A 1YX7A 4YRUA 4C0LA 3AAJA 1BODA 1JBAA 3CGAA 3NSKA 1AK8A 5CSNA 1LVCD 1RROA 2CTNA 5ER4X 2LLSA 2HQ8A 1DJZA 4MSPA 4N1GA 1H4BA 1NCZA 1YRTB 2KFGA 4L9MA 2FCDA 3TZ1A 3CWGA 1A29A 1BJFA 1Y6WA 1BMOA 2WNDA 2Y1NA 1WRZA 1SCMC 5I2QA 3GOFA 1H8BA 2JULA 1YTZC 2M0RA 3O78A 1C7WA 1XFUO 1XYDA 1KFXS 1UWOA 4P5OE 1SCVA 2EC6B 1J55A 1YVHA 4UPGA 3OHMB 3SG2A 1A4PA 1K8UA 3NXAA 3BUNB 1MR8A 3DVEA 2LANA 3AAKA 4MZLA 2ZRSA 1CMFA 2O60A 3DVKA 1UP5A 4U8DA 1JC2A 3I5GC 4GPLB 2BBMA 2MRDA 3EVVA 1LINA 2JXCA 2KYFA 1B47A 1LXFC 5CPVA 1S6CA 2PALA 5CSFA 2L50A 2I18A 4PHNA 4OKHA 1UHHA 3DF0B 1SL9A 3LCPC 1OMVA 2JNFA 1MXEA 5B8IB 3HX4A 1J7QA 2EC6C 1CDMA 2K2AA 2WOSA 5IBWA 1JSAA 1S6JA 4E68A 1KWOB 3TUYC 4GNKB 1V1GA 4ORAB 2NCOA 3PN7C 3LLEA 1QJTA 1M46A 3DF0A 3JVTB 2LUXA 4TNCA 5HLOA 1B8LA 1IQ5A 2Y4QA 1S1EA 1NCXA 3SG6A 2LNKA 4YGCB 1AJ5A 1E8AA 2JU0A 4PHKA 3PLFB 4HRGA 5AERA 2KQYA 3E3RA 4MRYA 2KAXA 4GUKA 1AHRA 2LM5A 1UHKA 3NSLA 2DOQA 2L4IA 4GAOA 4Q04A 1CDNA 3SIAA 2OS8B 1FBVA 1J7RA 1NX2A 1S5GY 2NCPA 1NCYA 1KWOC 3SIBA 1JF0A 3KF9A 1G4YR 1N0YA 1NIWA 1SMGA 5GQQC 2L4HA 1CNPA 5CSIA 1CM1A 3JVTC 1BF5A 1OQPA 1WRLA 4M2PA 1C7VA 2ISDA 2P6BB 2JRFA 2I94A 4NQGA 2KHNA 1C07A 1CFPA 3I5FB 1F4QA 2JWWA 1JWDA 4PHMA 2NXQA 1QS7A 2KFFA 3D0YB 3PM8A 2F8PA 2OS8C 3EKJA 3VRQA 5JJGA 1Y1XA 2F2OA 1VRKA 2H61A 5D7FA 2WCBA 4HREE 2CNPA 1WRKA 1V1FA 2LHIA 3SG3A 2MAZA 1EL4A 1DVIA 1TRFA 2M97A 2K7BA 4WQ3A 1XVJA 4PCWA 2CXJA 2LVKA 2H61C 2JT3A 4XYNA 1QV1A 1KCYA 2OPOA 2WC8A 3D0YA 3EVRA 1IRJA 3IQOA 3TDZA 5AXIA 4WQ2A 3I5FC 2BECA 2BCAA 1SK6D 1PSRA 4P2YB 1K9PA 1HQVA 3FS7A 5HKYA 1K96A 2KI4B 1B4CA 4YBHB 5KU1A 1U5IA 1N2DA 4MLWA 3DD4A 1SL7A 4GGNA 1CLLA 1KK8B 4ZCUA 2LVJA 1TN4A 3BOWB 2OTGB 4CPVA 1QX5B 4FTGA 4ICBA 2KBMA 1WLZA 3CTNA 1CFFA 2M9GA 1YUUA 2CBLA 2JNXA 4GFTA 1XA5A 1DF0A 2F3YA 4GBAA 3C1VA 2M8UA 4QJ5B 1RWYA 3CLNA 1EXRA 2ZN9A 1GGZA 1MQ1A 1TNQA 1Y1AA 1A2XA 1YX8A 2BBNA 4DS7A 1AP4A 4I5LB 5DKNA 2Y5IA 2LHLA 2FJUB 3BOWA 3RM1A 1DJGA 1TNWA 4AQIA 1FI6A 1FPWA 2NLNA 1J7PA 2KBIA 1DJHA 1K9UA 5PALA 1QVIZ 3HCMA 2I7AA 2KI4C 3FIAA 1EG4A 2PMYA 2PSRA 1WLMA 1MWNA 3F45A 4M2OA 3WHUB 5BPJA 1YUTA 2KFHA 1MXLC 1B8CA 1KK8C 2OTGC 3CS1A 3VRRA 1TNPA 5DKRA 3I5IB 1S6IA 1CFDA 1NPQA 3OP0A 2EHBA 4OV2A 4A4CA 1ZUZA 3WHTB 1QLKA 2WORA 5HKZA 1EH2A 2KSPA 3A8RA 2FOTA 4YGAA 4OCIA 5AANA 3ZNIA 4XJKB 5AFPA 1NX3A 3TS5B 2KOTA 1YURA 3EVUA 1AUIB 3BUMB 4DIRA 1BR1B 1KK7Y 5TNCA 2K7OA 1R2UA 2K61A 1A75B 2BCBA 3WXAA 5CSJA 1B7TZ 3RLZA 3SG7A 3SG5A 1XO5A 1PVBA 3I5IC 1K94A 2LMTA 3LK0A 1K2HA 4ORCB 1Q80A 1D1OA 2LMUA 4F0ZB 2CT9A 3OX6A 3GK2A 1XFZO 1DTLA 1B8RA 2KI6D 4PE7A 1NWDA 1Y1UA 3BUWB 3CZTX 1HT9A 1ALWA 1A75A 1PALA 1CMGA 1RFJA 5JOLA 4D1EA 4MEWA 3H4SE 2JT0A 2K0JA 3TS5C 1IGVA 1OMRA 1MHOA 3FWCA 4PALA 4ZCVA 4MVFA 1K9KA 2SASA 1K93D 4I5NB 1WDCB 1F54A 1PULA 1TCFA 3EK4A 2ZNDA 1PRWA 2PVBA 4ORBB 1BR4B 2O5GA 3PATA 4YGDB 3VRPA 2Y1MA 3IF7A 2KGRA 5I8NA 2D8NA 1KSOA 1NX1A 1TCOB 4ETOA 4PE1A 1IQ3A 1AJ4A 1S26D 3VGOA 2LVVA 2F3ZA 2KYCA 1GGWA 2M1UA 2EGDA 3A4UB 1TTXA 1ZACA 3O4YA 3BQ3A 4PDZA 1IWQA 1OSAA 1TIZA 5FYXA 2L2EA 3OB1B 3TDIA 1ZFSA 1NX0A 1QXPA 2K7DA 4I5KA 4FQOA 5I2LA 1S36A 2JQ6A 2KGBC 2AAOA 1QV0A 2K8MB 1PVAA 2BKIB 2LP2A 4JPZB 4CFQA 1OZSA 2TN4A 3OB2B 4USLA 2E30A 4A4BA 1NSHA 4NDCA 3BUXB 1RECA 4OVNF 2GGMA 1QASA 4JWQA 1M63B 5G08A 1F4OA 2FCEA 4NDBA 5KSZA 1QIVA 2ZFDA 1QVIY 2MBXA 2WCFA 2JOJA 1DMOA 2LE9B 3AKBA 2M3WA 1YUSA 2MJWB 3K21A 1DGUA 2M29A 2KQ6A 1R6PA 3CR4X 4JQ0D 3AKAA 1XK4A 4R1EA 1JF2A 1LA3A 2I2RE 1NP8A 3CR5X 3SJSA 5DKQA 2JTTA 2L98A 2QACA 3DVMA 1EJ3A 2AMIA 5F6TA 2H2KA 5I2OA 1WY9A 1M45A 1BOCA 1Y0VH 1XK4C 4GGFA 1YRUB 3WNXB 1JUOA 1MUXA 2JTZA 3PSRA 1OZOA 2MLFC 3O6BA 3GK4X 2ZKMX 4AOMA 5D69A 1ZOTB 2M7NA 4WRIA 1IG5A 1B1GA 3I5GB 4YGEB 1IJ6A 4YGBB 4PE0A 4GGFC 1AVSA 1F70A 2JXLA 1FW4A 2M7LA 1B7TY 1PSBA 2ZRTA 2JT8A 1DJWA 4N1FA 5J3XA 2KNEA 1J1EA 3JTDB 1QLSA 1SNLA 1TOPA 4MN0A 1CTRA 4N5XA 2RGIA 1S3PA 3KPXA 4MZJA 1B9AA 1W7IB 1PK0D 2KI6C 1UHIA 1CB1A 2AUCA 2ZN8A 1JFKA 2GGZA 3PFVA 2BL0B 5HKWA 3NSIA 1RJVA 2B1UA 2HETA 2KAYA 1SL8A 1IKUA 5HLVA 2NZ0A 1CLBA 1DJYA 1ALVA 3TUYB 1L7ZA 2JPTA 5ER5A 1RTP1 2BE6A 2R2IA 1FF1A 5K89A 3PN7B 4HSZA 1W7JB 2LVIA 3ICBA 1SR6B 1JFJA 2G2BA 2PRUA 1F55A 1UHNA 2ZNEA 4XJKA 4CFRA 1KQMB 3JTDC 1F71A 1NYAA 2KDHA 1KFUL 1M31A 1OE9B 1QX2A 1EG3A 2F33A 1L2OB 3CR2A 2HQWA 2PASA 1DGVA 2L0PA 4MBEA 5AEQA 1SPYA 4C0JA 2HPSA 3MSEB 3EK8A 3I5HB 1M39A 2BL0C 1XFWO 1DJXA 1XFVO 4CLNA 4CIDA 3KO0A 4C0KA 1YR5A 2K2FA 1K95A 2JZIA 2M1KB 4QJ3B 1MF8B 1UUSA 5HYDA 1CFCA 1BG1A 1SR6C 3PALA 1SY9A 4NDDA 2LC5A 2GV5A 2MHHA 1DT7B 1NUBA 2L5XB 2A4JA 2WCEA 1KQMC 2MLEC 1N65A 1F8HA 3BUOB 1QTXA 2QPTA 1QATA 1KFXL 1BU3A 1L2OC 2HF5A 3LL8B 1KQVA 3NSOA 3OX5A 4YI8A 4BY5A 1K90D 1KK7Z 4PE4A 3I5HC 1FI5A 2F2PA 2BCXA 2LP3A 3IQQA 4MZKA 4M2QA 4DCKA 2L51A 4DRWA 3LK1A 1J1DA 3O2PA 1CDLA 4BY4A 1OMDA 4AQJA 4YI9A 3QRXA 1A03A 3BXKA 1IJ5A 2M49B 1WDCC 3SG4A 1GQMA 1UHJA 3FWBA 3D10A 3EK7A 1CLMA 2BKHB 2VRGA 1SBJA 1RK9A 2K7CA 1DJIA 2G9BA 2LLUA 2BE4A 2LAPA 1ODBA 3M0WA 1XFYO 1CDPA 3ZWHA 4QJ4B 1IH0A 4HRHA 1SW8A 3VRNA 2LMVA 1X02A 1SRAA 1CKKA 2Q4UA 2LLTA 1SYMA 1S5GZ 1UURA 1XFXO 2LUCA 3GK1A 2V53A 3TDUA 2KAVA 1J7OA 2JC2A 2LCPA 4OR9B 1BLQA 1LA0A 4PHJA 1OOJA 2CCMA 1G8IA 1GJYA 1QIWA 4DUQA 2IS9A 1ZMZA 2Q91A 1U5IB 5KTYA 1SKTA 1LKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KEV A;  2SCP A;  4IL1 A;  1KSM A;  3DVJ A;  1SCM B;  2MA2 A;  2COL B;  1TNX A;  1G33 A;  3KHE A;  1QX7 A;  1KFU S;  2E6W A;  1DF0 B;  4MRX A;  2LV7 A;  1YVL A;  1CM4 A;  3EKH A;  3BYA A;  4I5J A;  3VRO A;  1BT6 A;  1YX7 A;  4YRU A;  4C0L A;  3AAJ A;  1BOD A;  1JBA A;  3CGA A;  3NSK A;  1AK8 A;  5CSN A;  1LVC D;  1RRO A;  2CTN A;  5ER4 X;  2LLS A;  2HQ8 A;  1DJZ A;  4MSP A;  4N1G A;  1H4B A;  1NCZ A;  1YRT B;  2KFG A;  4L9M A;  2FCD A;  3TZ1 A;  3CWG A;  1A29 A;  1BJF A;  1Y6W A;  1BMO A;  2WND A;  2Y1N A;  1WRZ A;  1SCM C;  5I2Q A;  3GOF A;  1H8B A;  2JUL A;  1YTZ C;  2M0R A;  3O78 A;  1C7W A;  1XFU O;  1XYD A;  1KFX S;  1UWO A;  4P5O E;  1SCV A;  2EC6 B;  1J55 A;  1YVH A;  4UPG A;  3OHM B;  3SG2 A;  1A4P A;  1K8U A;  3NXA A;  3BUN B;  1MR8 A;  3DVE A;  2LAN A;  3AAK A;  4MZL A;  2ZRS A;  1CMF A;  2O60 A;  3DVK A;  1UP5 A;  4U8D A;  1JC2 A;  3I5G C;  4GPL B;  2BBM A;  2MRD A;  3EVV A;  1LIN A;  2JXC A;  2KYF A;  1B47 A;  1LXF C;  5CPV A;  1S6C A;  2PAL A;  5CSF A;  2L50 A;  2I18 A;  4PHN A;  4OKH A;  1UHH A;  3DF0 B;  1SL9 A;  3LCP C;  1OMV A;  2JNF A;  1MXE A;  5B8I B;  3HX4 A;  1J7Q A;  2EC6 C;  1CDM A;  2K2A A;  2WOS A;  5IBW A;  1JSA A;  1S6J A;  4E68 A;  1KWO B;  3TUY C;  4GNK B;  1V1G A;  4ORA B;  2NCO A;  3PN7 C;  3LLE A;  1QJT A;  1M46 A;  3DF0 A;  3JVT B;  2LUX A;  4TNC A;  5HLO A;  1B8L A;  1IQ5 A;  2Y4Q A;  1S1E A;  1NCX A;  3SG6 A;  2LNK A;  4YGC B;  1AJ5 A;  1E8A A;  2JU0 A;  4PHK A;  3PLF B;  4HRG A;  5AER A;  2KQY A;  3E3R A;  4MRY A;  2KAX A;  4GUK A;  1AHR A;  2LM5 A;  1UHK A;  3NSL A;  2DOQ A;  2L4I A;  4GAO A;  4Q04 A;  1CDN A;  3SIA A;  2OS8 B;  1FBV A;  1J7R A;  1NX2 A;  1S5G Y;  2NCP A;  1NCY A;  1KWO C;  3SIB A;  1JF0 A;  3KF9 A;  1G4Y R;  1N0Y A;  1NIW A;  1SMG A;  5GQQ C;  2L4H A;  1CNP A;  5CSI A;  1CM1 A;  3JVT C;  1BF5 A;  1OQP A;  1WRL A;  4M2P A;  1C7V A;  2ISD A;  2P6B B;  2JRF A;  2I94 A;  4NQG A;  2KHN A;  1C07 A;  1CFP A;  3I5F B;  1F4Q A;  2JWW A;  1JWD A;  4PHM A;  2NXQ A;  1QS7 A;  2KFF A;  3D0Y B;  3PM8 A;  2F8P A;  2OS8 C;  3EKJ A;  3VRQ A;  5JJG A;  1Y1X A;  2F2O A;  1VRK A;  2H61 A;  5D7F A;  2WCB A;  4HRE E;  2CNP A;  1WRK A;  1V1F A;  2LHI A;  3SG3 A;  2MAZ A;  1EL4 A;  1DVI A;  1TRF A;  2M97 A;  2K7B A;  4WQ3 A;  1XVJ A;  4PCW A;  2CXJ A;  2LVK A;  2H61 C;  2JT3 A;  4XYN A;  1QV1 A;  1KCY A;  2OPO A;  2WC8 A;  3D0Y A;  3EVR A;  1IRJ A;  3IQO A;  3TDZ A;  5AXI A;  4WQ2 A;  3I5F C;  2BEC A;  2BCA A;  1SK6 D;  1PSR A;  4P2Y B;  1K9P A;  1HQV A;  3FS7 A;  5HKY A;  1K96 A;  2KI4 B;  1B4C A;  4YBH B;  5KU1 A;  1U5I A;  1N2D A;  4MLW A;  3DD4 A;  1SL7 A;  4GGN A;  1CLL A;  1KK8 B;  4ZCU A;  2LVJ A;  1TN4 A;  3BOW B;  2OTG B;  4CPV A;  1QX5 B;  4FTG A;  4ICB A;  2KBM A;  1WLZ A;  3CTN A;  1CFF A;  2M9G A;  1YUU A;  2CBL A;  2JNX A;  4GFT A;  1XA5 A;  1DF0 A;  2F3Y A;  4GBA A;  3C1V A;  2M8U A;  4QJ5 B;  1RWY A;  3CLN A;  1EXR A;  2ZN9 A;  1GGZ A;  1MQ1 A;  1TNQ A;  1Y1A A;  1A2X A;  1YX8 A;  2BBN A;  4DS7 A;  1AP4 A;  4I5L B;  5DKN A;  2Y5I A;  2LHL A;  2FJU B;  3BOW A;  3RM1 A;  1DJG A;  1TNW A;  4AQI A;  1FI6 A;  1FPW A;  2NLN A;  1J7P A;  2KBI A;  1DJH A;  1K9U A;  5PAL A;  1QVI Z;  3HCM A;  2I7A A;  2KI4 C;  3FIA A;  1EG4 A;  2PMY A;  2PSR A;  1WLM A;  1MWN A;  3F45 A;  4M2O A;  3WHU B;  5BPJ A;  1YUT A;  2KFH A;  1MXL C;  1B8C A;  1KK8 C;  2OTG C;  3CS1 A;  3VRR A;  1TNP A;  5DKR A;  3I5I B;  1S6I A;  1CFD A;  1NPQ A;  3OP0 A;  2EHB A;  4OV2 A;  4A4C A;  1ZUZ A;  3WHT B;  1QLK A;  2WOR A;  5HKZ A;  1EH2 A;  2KSP A;  3A8R A;  2FOT A;  4YGA A;  4OCI A;  5AAN A;  3ZNI A;  4XJK B;  5AFP A;  1NX3 A;  3TS5 B;  2KOT A;  1YUR A;  3EVU A;  1AUI B;  3BUM B;  4DIR A;  1BR1 B;  1KK7 Y;  5TNC A;  2K7O A;  1R2U A;  2K61 A;  1A75 B;  2BCB A;  3WXA A;  5CSJ A;  1B7T Z;  3RLZ A;  3SG7 A;  3SG5 A;  1XO5 A;  1PVB A;  3I5I C;  1K94 A;  2LMT A;  3LK0 A;  1K2H A;  4ORC B;  1Q80 A;  1D1O A;  2LMU A;  4F0Z B;  2CT9 A;  3OX6 A;  3GK2 A;  1XFZ O;  1DTL A;  1B8R A;  2KI6 D;  4PE7 A;  1NWD A;  1Y1U A;  3BUW B;  3CZT X;  1HT9 A;  1ALW A;  1A75 A;  1PAL A;  1CMG A;  1RFJ A;  5JOL A;  4D1E A;  4MEW A;  3H4S E;  2JT0 A;  2K0J A;  3TS5 C;  1IGV A;  1OMR A;  1MHO A;  3FWC A;  4PAL A;  4ZCV A;  4MVF A;  1K9K A;  2SAS A;  1K93 D;  4I5N B;  1WDC B;  1F54 A;  1PUL A;  1TCF A;  3EK4 A;  2ZND A;  1PRW A;  2PVB A;  4ORB B;  1BR4 B;  2O5G A;  3PAT A;  4YGD B;  3VRP A;  2Y1M A;  3IF7 A;  2KGR A;  5I8N A;  2D8N A;  1KSO A;  1NX1 A;  1TCO B;  4ETO A;  4PE1 A;  1IQ3 A;  1AJ4 A;  1S26 D;  3VGO A;  2LVV A;  2F3Z A;  2KYC A;  1GGW A;  2M1U A;  2EGD A;  3A4U B;  1TTX A;  1ZAC A;  3O4Y A;  3BQ3 A;  4PDZ A;  1IWQ A;  1OSA A;  1TIZ A;  5FYX A;  2L2E A;  3OB1 B;  3TDI A;  1ZFS A;  1NX0 A;  1QXP A;  2K7D A;  4I5K A;  4FQO A;  5I2L A;  1S36 A;  2JQ6 A;  2KGB C;  2AAO A;  1QV0 A;  2K8M B;  1PVA A;  2BKI B;  2LP2 A;  4JPZ B;  4CFQ A;  1OZS A;  2TN4 A;  3OB2 B;  4USL A;  2E30 A;  4A4B A;  1NSH A;  4NDC A;  3BUX B;  1REC A;  4OVN F;  2GGM A;  1QAS A;  4JWQ A;  1M63 B;  5G08 A;  1F4O A;  2FCE A;  4NDB A;  5KSZ A;  1QIV A;  2ZFD A;  1QVI Y;  2MBX A;  2WCF A;  2JOJ A;  1DMO A;  2LE9 B;  3AKB A;  2M3W A;  1YUS A;  2MJW B;  3K21 A;  1DGU A;  2M29 A;  2KQ6 A;  1R6P A;  3CR4 X;  4JQ0 D;  3AKA A;  1XK4 A;  4R1E A;  1JF2 A;  1LA3 A;  2I2R E;  1NP8 A;  3CR5 X;  3SJS A;  5DKQ A;  2JTT A;  2L98 A;  2QAC A;  3DVM A;  1EJ3 A;  2AMI A;  5F6T A;  2H2K A;  5I2O A;  1WY9 A;  1M45 A;  1BOC A;  1Y0V H;  1XK4 C;  4GGF A;  1YRU B;  3WNX B;  1JUO A;  1MUX A;  2JTZ A;  3PSR A;  1OZO A;  2MLF C;  3O6B A;  3GK4 X;  2ZKM X;  4AOM A;  5D69 A;  1ZOT B;  2M7N A;  4WRI A;  1IG5 A;  1B1G A;  3I5G B;  4YGE B;  1IJ6 A;  4YGB B;  4PE0 A;  4GGF C;  1AVS A;  1F70 A;  2JXL A;  1FW4 A;  2M7L A;  1B7T Y;  1PSB A;  2ZRT A;  2JT8 A;  1DJW A;  4N1F A;  5J3X A;  2KNE A;  1J1E A;  3JTD B;  1QLS A;  1SNL A;  1TOP A;  4MN0 A;  1CTR A;  4N5X A;  2RGI A;  1S3P A;  3KPX A;  4MZJ A;  1B9A A;  1W7I B;  1PK0 D;  2KI6 C;  1UHI A;  1CB1 A;  2AUC A;  2ZN8 A;  1JFK A;  2GGZ A;  3PFV A;  2BL0 B;  5HKW A;  3NSI A;  1RJV A;  2B1U A;  2HET A;  2KAY A;  1SL8 A;  1IKU A;  5HLV A;  2NZ0 A;  1CLB A;  1DJY A;  1ALV A;  3TUY B;  1L7Z A;  2JPT A;  5ER5 A;  1RTP 1;  2BE6 A;  2R2I A;  1FF1 A;  5K89 A;  3PN7 B;  4HSZ A;  1W7J B;  2LVI A;  3ICB A;  1SR6 B;  1JFJ A;  2G2B A;  2PRU A;  1F55 A;  1UHN A;  2ZNE A;  4XJK A;  4CFR A;  1KQM B;  3JTD C;  1F71 A;  1NYA A;  2KDH A;  1KFU L;  1M31 A;  1OE9 B;  1QX2 A;  1EG3 A;  2F33 A;  1L2O B;  3CR2 A;  2HQW A;  2PAS A;  1DGV A;  2L0P A;  4MBE A;  5AEQ A;  1SPY A;  4C0J A;  2HPS A;  3MSE B;  3EK8 A;  3I5H B;  1M39 A;  2BL0 C;  1XFW O;  1DJX A;  1XFV O;  4CLN A;  4CID A;  3KO0 A;  4C0K A;  1YR5 A;  2K2F A;  1K95 A;  2JZI A;  2M1K B;  4QJ3 B;  1MF8 B;  1UUS A;  5HYD A;  1CFC A;  1BG1 A;  1SR6 C;  3PAL A;  1SY9 A;  4NDD A;  2LC5 A;  2GV5 A;  2MHH A;  1DT7 B;  1NUB A;  2L5X B;  2A4J A;  2WCE A;  1KQM C;  2MLE C;  1N65 A;  1F8H A;  3BUO B;  1QTX A;  2QPT A;  1QAT A;  1KFX L;  1BU3 A;  1L2O C;  2HF5 A;  3LL8 B;  1KQV A;  3NSO A;  3OX5 A;  4YI8 A;  4BY5 A;  1K90 D;  1KK7 Z;  4PE4 A;  3I5H C;  1FI5 A;  2F2P A;  2BCX A;  2LP3 A;  3IQQ A;  4MZK A;  4M2Q A;  4DCK A;  2L51 A;  4DRW A;  3LK1 A;  1J1D A;  3O2P A;  1CDL A;  4BY4 A;  1OMD A;  4AQJ A;  4YI9 A;  3QRX A;  1A03 A;  3BXK A;  1IJ5 A;  2M49 B;  1WDC C;  3SG4 A;  1GQM A;  1UHJ A;  3FWB A;  3D10 A;  3EK7 A;  1CLM A;  2BKH B;  2VRG A;  1SBJ A;  1RK9 A;  2K7C A;  1DJI A;  2G9B A;  2LLU A;  2BE4 A;  2LAP A;  1ODB A;  3M0W A;  1XFY O;  1CDP A;  3ZWH A;  4QJ4 B;  1IH0 A;  4HRH A;  1SW8 A;  3VRN A;  2LMV A;  1X02 A;  1SRA A;  1CKK A;  2Q4U A;  2LLT A;  1SYM A;  1S5G Z;  1UUR A;  1XFX O;  2LUC A;  3GK1 A;  2V53 A;  3TDU A;  2KAV A;  1J7O A;  2JC2 A;  2LCP A;  4OR9 B;  1BLQ A;  1LA0 A;  4PHJ A;  1OOJ A;  2CCM A;  1G8I A;  1GJY A;  1QIW A;  4DUQ A;  2IS9 A;  1ZMZ A;  2Q91 A;  1U5I B;  5KTY A;  1SKT A;  1LKJ A; 
#chains in the Genus database with same CATH topology
 3KEV A;  2SCP A;  4IL1 A;  1KSM A;  3DVJ A;  1SCM B;  2MA2 A;  2COL B;  1TNX A;  1G33 A;  3KHE A;  1QX7 A;  1KFU S;  2E6W A;  4FQT A;  1DF0 B;  4MRX A;  2LV7 A;  2WC5 A;  3V2L A;  1YVL A;  2WCL A;  1CM4 A;  3EKH A;  3BYA A;  4I5J A;  3VRO A;  1BT6 A;  1YX7 A;  4YRU A;  4C0L A;  1Z2C B;  1SSE B;  3AAJ A;  1BOD A;  1JBA A;  3CGA A;  3NSK A;  1AK8 A;  2KLD A;  5CSN A;  1LVC D;  1RRO A;  2CTN A;  5ER4 X;  2LLS A;  2HQ8 A;  1DJZ A;  4INW A;  4MSP A;  3OBV A;  3SS5 A;  4N1G A;  1H4B A;  1NCZ A;  1YRT B;  2KFG A;  4L9M A;  2FCD A;  4KYN A;  3TZ1 A;  3CWG A;  1A29 A;  1BJF A;  1Y6W A;  1BMO A;  2WND A;  2Y1N A;  3DZT A;  3FE8 A;  1WRZ A;  1SCM C;  5I2Q A;  3GOF A;  1H8B A;  2JUL A;  1YTZ C;  2M0R A;  3O78 A;  5D3O A;  1C7W A;  1XFU O;  1XYD A;  4OZD A;  1KFX S;  1UWO A;  4P5O E;  1DQE A;  1SCV A;  2EC6 B;  1J55 A;  1YVH A;  3S0G A;  3VB1 A;  4UPG A;  5DIC A;  3OHM B;  3SG2 A;  1A4P A;  5FI6 A;  1K8U A;  3NXA A;  3BUN B;  1MR8 A;  3DVE A;  2LAN A;  3AAK A;  4MZL A;  2ZRS A;  1CMF A;  2O60 A;  3DVK A;  3R72 A;  1UP5 A;  4U8D A;  1JC2 A;  3D75 A;  3I5G C;  4IJ7 A;  3CZ0 A;  4GPL B;  2BBM A;  2MRD A;  3EVV A;  1LIN A;  2JXC A;  2KYF A;  1B47 A;  1LXF C;  1OOH A;  1S6C A;  5CPV A;  2PAL A;  5CSF A;  2L50 A;  2I18 A;  2WCJ A;  3CAB A;  3NGV A;  4OKH A;  4PHN A;  1UHH A;  3DF0 B;  1SL9 A;  3LCP C;  1OMV A;  2JNF A;  1MXE A;  5B8I B;  3HX4 A;  1J7Q A;  2EC6 C;  1CDM A;  2BAP A;  2K2A A;  2KLE A;  1LKJ A;  2WOS A;  5IBW A;  1JSA A;  5EL2 A;  1S6J A;  4E68 A;  1KWO B;  3TUY C;  5FI7 A;  4GNK B;  1V1G A;  1OOG A;  4ORA B;  3FE6 A;  2NCO A;  3PN7 C;  3LLE A;  1QJT A;  1M46 A;  3DF0 A;  3JVT B;  2LUX A;  4TNC A;  5HLO A;  1B8L A;  1IQ5 A;  2Y4Q A;  1S1E A;  1NCX A;  3CZ1 A;  3SG6 A;  2LNK A;  4YGC B;  1AJ5 A;  1E8A A;  2JU0 A;  4PHK A;  3PLF B;  4HRG A;  2BNX A;  5AER A;  2KQY A;  3E3R A;  4MRY A;  2KAX A;  4JKT A;  4GUK A;  1AHR A;  2LM5 A;  1UHK A;  3NSL A;  2DOQ A;  2L4I A;  4GAO A;  4Q04 A;  1CDN A;  3SIA A;  2OS8 B;  1FBV A;  1J7R A;  1NX2 A;  1S5G Y;  2NCP A;  2FJY A;  1NCY A;  1KWO C;  3SIB A;  1OW4 A;  1JF0 A;  3KF9 A;  1G4Y R;  1N0Y A;  1NIW A;  1SMG A;  3R1O A;  5GQQ C;  2L4H A;  1CNP A;  5CSI A;  1CM1 A;  3JVT C;  1BF5 A;  1OQP A;  1WRL A;  4M2P A;  1C7V A;  2ISD A;  2P6B B;  1TWO A;  2JRF A;  2I94 A;  4NQG A;  2KHN A;  1C07 A;  2QEO A;  1CFP A;  2QEV A;  3I5F B;  1F4Q A;  2JWW A;  3QME A;  4PHM A;  1JWD A;  2NXQ A;  1QS7 A;  2KFF A;  3D0Y B;  3PM8 A;  2F8P A;  3S0E A;  2OS8 C;  3EKJ A;  3L47 A;  3VRQ A;  5JJG A;  2WCH A;  1Y1X A;  2F2O A;  1VRK A;  2H61 A;  5D7F A;  2WCB A;  4HRE E;  2CNP A;  1WRK A;  1V1F A;  2LHI A;  3SG3 A;  2MAZ A;  2WC6 A;  1EL4 A;  1DVI A;  1TRF A;  2M97 A;  2K7B A;  4WQ3 A;  1XVJ A;  4PCW A;  2CXJ A;  2LVK A;  2H61 C;  2JT3 A;  4XYN A;  1QV1 A;  1KCY A;  2OPO A;  2WC8 A;  3D0Y A;  3EVR A;  1IRJ A;  3IQO A;  3L4A A;  3TDZ A;  5AXI A;  4WQ2 A;  1OOF A;  3I5F C;  2BEC A;  2BCA A;  1SK6 D;  1PSR A;  4P2Y B;  1K9P A;  1HQV A;  3FS7 A;  5HKY A;  1K96 A;  2ERB A;  2KI4 B;  1B4C A;  4YBH B;  5KU1 A;  1U5I A;  1N2D A;  4MLW A;  3DD4 A;  1SL7 A;  4GGN A;  3DYE A;  1CLL A;  1KK8 B;  4ZCU A;  2LVJ A;  1TN4 A;  3BOW B;  2OTG B;  4CPV A;  1QX5 B;  4FTG A;  3IVT A;  4ICB A;  2KBM A;  1ORG A;  1WLZ A;  3CTN A;  1CFF A;  2M9G A;  1YUU A;  2CBL A;  2JNX A;  4GFT A;  1XA5 A;  1DF0 A;  2F3Y A;  4GBA A;  3C1V A;  2M8U A;  4QJ5 B;  1RWY A;  3CLN A;  1EXR A;  2ZN9 A;  1GGZ A;  1MQ1 A;  2K60 A;  1TNQ A;  1Y1A A;  1A2X A;  1YX8 A;  2BBN A;  4DS7 A;  1AP4 A;  4I5L B;  5DKN A;  2Y5I A;  2LHL A;  2FJU B;  3BOW A;  3RM1 A;  1DJG A;  1TNW A;  4AQI A;  1FI6 A;  1FPW A;  2NLN A;  1J7P A;  2L5Y A;  2KBI A;  1DJH A;  1K9U A;  3D76 A;  5PAL A;  1QVI Z;  3HCM A;  2I7A A;  2KI4 C;  3FIA A;  1EG4 A;  2PMY A;  2PSR A;  1WLM A;  1MWN A;  3F45 A;  4M2O A;  3WHU B;  5BPJ A;  1YUT A;  2KFH A;  1MXL C;  1B8C A;  1KK8 C;  3BFB A;  2OTG C;  3CS1 A;  3VRR A;  1TNP A;  5DKR A;  3I5I B;  1S6I A;  1CFD A;  1NPQ A;  3OP0 A;  2EHB A;  4OV2 A;  3UO9 A;  1ZUZ A;  4A4C A;  2PQL A;  3DXL A;  3WHT B;  1QLK A;  2WOR A;  5HKZ A;  1EH2 A;  2KSP A;  3A8R A;  2FOT A;  3S0A A;  4YGA A;  2P71 A;  4OCI A;  5AAN A;  3ZNI A;  4XJK B;  5AFP A;  1NX3 A;  5HL1 A;  3TS5 B;  2KOT A;  1YUR A;  4PT1 A;  3EVU A;  1AUI B;  3BUM B;  4DIR A;  1BR1 B;  1KK7 Y;  5TNC A;  2K7O A;  1R2U A;  3R1P A;  1XFR A;  2K61 A;  1A75 B;  2BCB A;  3WXA A;  5CSJ A;  1B7T Z;  3RLZ A;  3SG7 A;  4JD9 A;  1XO5 A;  3SG5 A;  1IIO A;  1PVB A;  3I5I C;  1K94 A;  2LMT A;  3LK0 A;  1K2H A;  4ORC B;  1Q80 A;  3FE9 A;  1D1O A;  2LMU A;  3SS4 A;  4F0Z B;  2CT9 A;  3OX6 A;  3GK2 A;  1XFZ O;  1DTL A;  1B8R A;  2KI6 D;  4PE7 A;  1NWD A;  1LS8 A;  1Y1U A;  3BUW B;  3CZT X;  1HT9 A;  1ALW A;  1A75 A;  1PAL A;  1CMG A;  1RFJ A;  5JOL A;  4D1E A;  4MEW A;  3H4S E;  2JT0 A;  2K0J A;  3TS5 C;  1IGV A;  1OMR A;  3B86 A;  1MHO A;  3FWC A;  4PAL A;  4ZCV A;  3S0F A;  4MVF A;  1K9K A;  2SAS A;  1K93 D;  4I5N B;  1WDC B;  1F54 A;  1C3Z A;  1PUL A;  1TCF A;  3EK4 A;  2ZND A;  1T14 A;  1PRW A;  2PVB A;  3B7A A;  1BR4 B;  4ORB B;  2O5G A;  3PAT A;  4YGD B;  3VRP A;  3R1V A;  2Y1M A;  3IF7 A;  2KGR A;  5I8N A;  2D8N A;  1KSO A;  1NX1 A;  1TCO B;  2H8V A;  4ETO A;  4PE1 A;  1OOI X;  1IQ3 A;  3RZS A;  1AJ4 A;  1S26 D;  3VGO A;  2LVV A;  2F3Z A;  2KYC A;  1GGW A;  2M1U A;  2EGD A;  3A4U B;  1TTX A;  1ZAC A;  3O4Y A;  3BQ3 A;  3Q8I A;  4PDZ A;  1IWQ A;  1OSA A;  1TIZ A;  5FYX A;  1C3Y A;  2L2E A;  3OB1 B;  3TDI A;  1ZFS A;  1NX0 A;  1QXP A;  2K7D A;  4I5K A;  4FQO A;  5I2L A;  1S36 A;  2JQ6 A;  2KGB C;  2AAO A;  1QV0 A;  1DEL A;  2K8M B;  3S0B A;  1PVA A;  2BKI B;  2LP2 A;  3EG5 B;  4JPZ B;  4CFQ A;  1OZS A;  2TN4 A;  3OB2 B;  4USL A;  2E30 A;  4A4B A;  1NSH A;  4NDC A;  3BUX B;  1REC A;  4OVN F;  3S0D A;  2GGM A;  1QAS A;  4JWQ A;  1M63 B;  3D74 A;  1F4O A;  5G08 A;  2FCE A;  4NDB A;  4F7F A;  5KSZ A;  1QIV A;  2ZFD A;  1TUJ A;  1QVI Y;  3BFA A;  2MBX A;  2WCF A;  2JOJ A;  1DMO A;  2LE9 B;  3AKB A;  2M3W A;  1YUS A;  2MJW B;  3K21 A;  1DGU A;  2M29 A;  2KQ6 A;  1R6P A;  5I94 A;  3CR4 X;  4JQ0 D;  3AKA A;  3K1E A;  1DC1 A;  1XK4 A;  4R1E A;  1JF2 A;  1LA3 A;  2I2R E;  1NP8 A;  3CR5 X;  3SJS A;  5DKQ A;  2JTT A;  2L98 A;  2QAC A;  3NHI A;  3DVM A;  1EJ3 A;  2AMI A;  5F6T A;  2H2K A;  5I2O A;  1WY9 A;  1M45 A;  1BOC A;  1Y0V H;  1XK4 C;  4GGF A;  1YRU B;  2QDI A;  1JUO A;  1MUX A;  2JTZ A;  3WNX B;  3PSR A;  1OZO A;  2MLF C;  3O6B A;  3GK4 X;  2ZKM X;  4AOM A;  5D69 A;  1ZOT B;  2M7N A;  4WRI A;  1IG5 A;  1B1G A;  3I5G B;  3B88 A;  4YGE B;  1IJ6 A;  4YGB B;  4PE0 A;  4GGF C;  1AVS A;  3UNW A;  1F70 A;  2JXL A;  2KPH A;  1FW4 A;  2M7L A;  1B7T Y;  1PSB A;  2ZRT A;  2JT8 A;  2WCK A;  1DJW A;  4N1F A;  5J3X A;  2KNE A;  1J1E A;  3JTD B;  1QLS A;  1SNL A;  1TOP A;  4MN0 A;  1W9Z A;  3O4X A;  1CTR A;  3NHT A;  4N5X A;  2RGI A;  1S3P A;  3KPX A;  4MZJ A;  1B9A A;  1W7I B;  1PK0 D;  2KI6 C;  3DY9 A;  1UHI A;  1CB1 A;  2AUC A;  2ZN8 A;  1JFK A;  2GGZ A;  2GTE A;  2BL0 B;  3PFV A;  5HKW A;  3NSI A;  1RJV A;  2B1U A;  2HET A;  2KAY A;  1SL8 A;  1IKU A;  5HLV A;  2NZ0 A;  1CLB A;  3PM2 A;  1DJY A;  1ALV A;  3TUY B;  1DEK A;  1L7Z A;  2QEB A;  2JPT A;  5ER5 A;  1RTP 1;  2BE6 A;  2R2I A;  1FF1 A;  5K89 A;  3PN7 B;  4HSZ A;  1W7J B;  2LVI A;  3ICB A;  1SR6 B;  1JFJ A;  2G2B A;  2PRU A;  3D73 A;  3PJI A;  2P70 A;  1F55 A;  1UHN A;  2ZNE A;  4XJK A;  4CFR A;  1KQM B;  2PYQ A;  3JTD C;  1F71 A;  1NYA A;  2KDH A;  1KFU L;  1M31 A;  1OE9 B;  1QX2 A;  1EG3 A;  1P28 A;  1QWV A;  2F33 A;  1L2O B;  3CR2 A;  2HQW A;  2PAS A;  1DGV A;  2L0P A;  4MBE A;  1TUZ A;  1SPY A;  5AEQ A;  2HPS A;  3MSE B;  3EK8 A;  3N7H A;  4C0J A;  3I5H B;  5FI2 A;  1M39 A;  1XFW O;  2BL0 C;  1DJX A;  1XFV O;  4CLN A;  4CID A;  3KO0 A;  4C0K A;  1YR5 A;  2K2F A;  1GM0 A;  1K95 A;  2JZI A;  2M1K B;  4QJ3 B;  1MF8 B;  1UUS A;  5HYD A;  1CFC A;  2QEH A;  1BG1 A;  1SR6 C;  2L2C A;  3PAL A;  1SY9 A;  4NDD A;  2LC5 A;  2GV5 A;  2MHH A;  1DT7 B;  1NUB A;  2L5X B;  2A4J A;  2WCE A;  3B87 A;  1KQM C;  3D77 A;  2MLE C;  1N65 A;  1F8H A;  3BUO B;  1QTX A;  2WCM A;  2QPT A;  1QAT A;  1KFX L;  1BU3 A;  1L2O C;  2HF5 A;  3LL8 B;  1KQV A;  2JPO A;  3NSO A;  3OX5 A;  4YI8 A;  3D78 A;  1K90 D;  1KK7 Z;  4PE4 A;  3I5H C;  4BY5 A;  1FI5 A;  2F2P A;  2BCX A;  2LP3 A;  3IQQ A;  4MZK A;  4M2Q A;  4DCK A;  2L51 A;  4DRW A;  3LK1 A;  1J1D A;  3O2P A;  1CDL A;  4BY4 A;  1OMD A;  4AQJ A;  4YI9 A;  3QRX A;  1A03 A;  3BXK A;  1IJ5 A;  2M49 B;  1WDC C;  3SG4 A;  1GQM A;  1UHJ A;  3FWB A;  3SS3 A;  3D10 A;  3EK7 A;  1CLM A;  2BKH B;  2VRG A;  1SBJ A;  1RK9 A;  2K7C A;  1DJI A;  2G9B A;  2LLU A;  2BE4 A;  2LAP A;  1ODB A;  3M0W A;  1XFY O;  1CDP A;  3ZWH A;  4QJ4 B;  1IH0 A;  4HRH A;  1SW8 A;  3VRN A;  2LMV A;  1X02 A;  1SRA A;  1CKK A;  3CYZ A;  2Q4U A;  2LLT A;  1SYM A;  1S5G Z;  2YGU A;  1UUR A;  3CDN A;  1XFX O;  2LUC A;  3GK1 A;  2V53 A;  3TDU A;  2KAV A;  1J7O A;  3OGN A;  3BJH A;  2JC2 A;  2LCP A;  4INX A;  4OR9 B;  1BLQ A;  1LA0 A;  3CZ2 A;  4PHJ A;  1OOJ A;  2CCM A;  1G8I A;  1GJY A;  1QIW A;  4DUQ A;  2IS9 A;  3B6X A;  1ZMZ A;  2Q91 A;  3BFH A;  1U5I B;  5KTY A;  1SKT A;  3L4L A;  1Z4H A; 
#chains in the Genus database with same CATH homology
 3KEV A;  2SCP A;  4IL1 A;  1KSM A;  3DVJ A;  1SCM B;  2MA2 A;  2COL B;  1TNX A;  1G33 A;  3KHE A;  1QX7 A;  1KFU S;  2E6W A;  1DF0 B;  4MRX A;  2LV7 A;  1YVL A;  1CM4 A;  3EKH A;  3BYA A;  4I5J A;  3VRO A;  1BT6 A;  1YX7 A;  4YRU A;  4C0L A;  3AAJ A;  1BOD A;  1JBA A;  3CGA A;  3NSK A;  1AK8 A;  5CSN A;  1LVC D;  1RRO A;  2CTN A;  5ER4 X;  2LLS A;  2HQ8 A;  1DJZ A;  4MSP A;  4N1G A;  1H4B A;  1NCZ A;  1YRT B;  2KFG A;  4L9M A;  2FCD A;  3TZ1 A;  3CWG A;  1A29 A;  1BJF A;  1Y6W A;  1BMO A;  2WND A;  2Y1N A;  1WRZ A;  1SCM C;  5I2Q A;  3GOF A;  1H8B A;  2JUL A;  1YTZ C;  2M0R A;  3O78 A;  1C7W A;  1XFU O;  1XYD A;  1KFX S;  1UWO A;  4P5O E;  1SCV A;  2EC6 B;  1J55 A;  1YVH A;  4UPG A;  3OHM B;  3SG2 A;  1A4P A;  1K8U A;  3NXA A;  3BUN B;  1MR8 A;  3DVE A;  2LAN A;  3AAK A;  4MZL A;  2ZRS A;  1CMF A;  2O60 A;  3DVK A;  1UP5 A;  4U8D A;  1JC2 A;  3I5G C;  4GPL B;  2BBM A;  2MRD A;  3EVV A;  1LIN A;  2JXC A;  2KYF A;  1B47 A;  1LXF C;  5CPV A;  1S6C A;  2PAL A;  5CSF A;  2L50 A;  2I18 A;  4PHN A;  4OKH A;  1UHH A;  3DF0 B;  1SL9 A;  3LCP C;  1OMV A;  2JNF A;  1MXE A;  5B8I B;  3HX4 A;  1J7Q A;  2EC6 C;  1CDM A;  2K2A A;  2WOS A;  5IBW A;  1JSA A;  1S6J A;  4E68 A;  1KWO B;  3TUY C;  4GNK B;  1V1G A;  4ORA B;  2NCO A;  3PN7 C;  3LLE A;  1QJT A;  1M46 A;  3DF0 A;  3JVT B;  2LUX A;  4TNC A;  5HLO A;  1B8L A;  1IQ5 A;  2Y4Q A;  1S1E A;  1NCX A;  3SG6 A;  2LNK A;  4YGC B;  1AJ5 A;  1E8A A;  2JU0 A;  4PHK A;  3PLF B;  4HRG A;  5AER A;  2KQY A;  3E3R A;  4MRY A;  2KAX A;  4GUK A;  1AHR A;  2LM5 A;  1UHK A;  3NSL A;  2DOQ A;  2L4I A;  4GAO A;  4Q04 A;  1CDN A;  3SIA A;  2OS8 B;  1FBV A;  1J7R A;  1NX2 A;  1S5G Y;  2NCP A;  1NCY A;  1KWO C;  3SIB A;  1JF0 A;  3KF9 A;  1G4Y R;  1N0Y A;  1NIW A;  1SMG A;  5GQQ C;  2L4H A;  1CNP A;  5CSI A;  1CM1 A;  3JVT C;  1BF5 A;  1OQP A;  1WRL A;  4M2P A;  1C7V A;  2ISD A;  2P6B B;  2JRF A;  2I94 A;  4NQG A;  2KHN A;  1C07 A;  1CFP A;  3I5F B;  1F4Q A;  2JWW A;  1JWD A;  4PHM A;  2NXQ A;  1QS7 A;  2KFF A;  3D0Y B;  3PM8 A;  2F8P A;  2OS8 C;  3EKJ A;  3VRQ A;  5JJG A;  1Y1X A;  2F2O A;  1VRK A;  2H61 A;  5D7F A;  2WCB A;  4HRE E;  2CNP A;  1WRK A;  1V1F A;  2LHI A;  3SG3 A;  2MAZ A;  1EL4 A;  1DVI A;  1TRF A;  2M97 A;  2K7B A;  4WQ3 A;  1XVJ A;  4PCW A;  2CXJ A;  2LVK A;  2H61 C;  2JT3 A;  4XYN A;  1QV1 A;  1KCY A;  2OPO A;  2WC8 A;  3D0Y A;  3EVR A;  1IRJ A;  3IQO A;  3TDZ A;  5AXI A;  4WQ2 A;  3I5F C;  2BEC A;  2BCA A;  1SK6 D;  1PSR A;  4P2Y B;  1K9P A;  1HQV A;  3FS7 A;  5HKY A;  1K96 A;  2KI4 B;  1B4C A;  4YBH B;  5KU1 A;  1U5I A;  1N2D A;  4MLW A;  3DD4 A;  1SL7 A;  4GGN A;  1CLL A;  1KK8 B;  4ZCU A;  2LVJ A;  1TN4 A;  3BOW B;  2OTG B;  4CPV A;  1QX5 B;  4FTG A;  4ICB A;  2KBM A;  1WLZ A;  3CTN A;  1CFF A;  2M9G A;  1YUU A;  2CBL A;  2JNX A;  4GFT A;  1XA5 A;  1DF0 A;  2F3Y A;  4GBA A;  3C1V A;  2M8U A;  4QJ5 B;  1RWY A;  3CLN A;  1EXR A;  2ZN9 A;  1GGZ A;  1MQ1 A;  1TNQ A;  1Y1A A;  1A2X A;  1YX8 A;  2BBN A;  4DS7 A;  1AP4 A;  4I5L B;  5DKN A;  2Y5I A;  2LHL A;  2FJU B;  3BOW A;  3RM1 A;  1DJG A;  1TNW A;  4AQI A;  1FI6 A;  1FPW A;  2NLN A;  1J7P A;  2KBI A;  1DJH A;  1K9U A;  5PAL A;  1QVI Z;  3HCM A;  2I7A A;  2KI4 C;  3FIA A;  1EG4 A;  2PMY A;  2PSR A;  1WLM A;  1MWN A;  3F45 A;  4M2O A;  3WHU B;  5BPJ A;  1YUT A;  2KFH A;  1MXL C;  1B8C A;  1KK8 C;  2OTG C;  3CS1 A;  3VRR A;  1TNP A;  5DKR A;  3I5I B;  1S6I A;  1CFD A;  1NPQ A;  3OP0 A;  2EHB A;  4OV2 A;  4A4C A;  1ZUZ A;  3WHT B;  1QLK A;  2WOR A;  5HKZ A;  1EH2 A;  2KSP A;  3A8R A;  2FOT A;  4YGA A;  4OCI A;  5AAN A;  3ZNI A;  4XJK B;  5AFP A;  1NX3 A;  3TS5 B;  2KOT A;  1YUR A;  3EVU A;  1AUI B;  3BUM B;  4DIR A;  1BR1 B;  1KK7 Y;  5TNC A;  2K7O A;  1R2U A;  2K61 A;  1A75 B;  2BCB A;  3WXA A;  5CSJ A;  1B7T Z;  3RLZ A;  3SG7 A;  3SG5 A;  1XO5 A;  1PVB A;  3I5I C;  1K94 A;  2LMT A;  3LK0 A;  1K2H A;  4ORC B;  1Q80 A;  1D1O A;  2LMU A;  4F0Z B;  2CT9 A;  3OX6 A;  3GK2 A;  1XFZ O;  1DTL A;  1B8R A;  2KI6 D;  4PE7 A;  1NWD A;  1Y1U A;  3BUW B;  3CZT X;  1HT9 A;  1ALW A;  1A75 A;  1PAL A;  1CMG A;  1RFJ A;  5JOL A;  4D1E A;  4MEW A;  3H4S E;  2JT0 A;  2K0J A;  3TS5 C;  1IGV A;  1OMR A;  1MHO A;  3FWC A;  4PAL A;  4ZCV A;  4MVF A;  1K9K A;  2SAS A;  1K93 D;  4I5N B;  1WDC B;  1F54 A;  1PUL A;  1TCF A;  3EK4 A;  2ZND A;  1PRW A;  2PVB A;  4ORB B;  1BR4 B;  2O5G A;  3PAT A;  4YGD B;  3VRP A;  2Y1M A;  3IF7 A;  2KGR A;  5I8N A;  2D8N A;  1KSO A;  1NX1 A;  1TCO B;  4ETO A;  4PE1 A;  1IQ3 A;  1AJ4 A;  1S26 D;  3VGO A;  2LVV A;  2F3Z A;  2KYC A;  1GGW A;  2M1U A;  2EGD A;  3A4U B;  1TTX A;  1ZAC A;  3O4Y A;  3BQ3 A;  4PDZ A;  1IWQ A;  1OSA A;  1TIZ A;  5FYX A;  2L2E A;  3OB1 B;  3TDI A;  1ZFS A;  1NX0 A;  1QXP A;  2K7D A;  4I5K A;  4FQO A;  5I2L A;  1S36 A;  2JQ6 A;  2KGB C;  2AAO A;  1QV0 A;  2K8M B;  1PVA A;  2BKI B;  2LP2 A;  4JPZ B;  4CFQ A;  1OZS A;  2TN4 A;  3OB2 B;  4USL A;  2E30 A;  4A4B A;  1NSH A;  4NDC A;  3BUX B;  1REC A;  4OVN F;  2GGM A;  1QAS A;  4JWQ A;  1M63 B;  5G08 A;  1F4O A;  2FCE A;  4NDB A;  5KSZ A;  1QIV A;  2ZFD A;  1QVI Y;  2MBX A;  2WCF A;  2JOJ A;  1DMO A;  2LE9 B;  3AKB A;  2M3W A;  1YUS A;  2MJW B;  3K21 A;  1DGU A;  2M29 A;  2KQ6 A;  1R6P A;  3CR4 X;  4JQ0 D;  3AKA A;  1XK4 A;  4R1E A;  1JF2 A;  1LA3 A;  2I2R E;  1NP8 A;  3CR5 X;  3SJS A;  5DKQ A;  2JTT A;  2L98 A;  2QAC A;  3DVM A;  1EJ3 A;  2AMI A;  5F6T A;  2H2K A;  5I2O A;  1WY9 A;  1M45 A;  1BOC A;  1Y0V H;  1XK4 C;  4GGF A;  1YRU B;  3WNX B;  1JUO A;  1MUX A;  2JTZ A;  3PSR A;  1OZO A;  2MLF C;  3O6B A;  3GK4 X;  2ZKM X;  4AOM A;  5D69 A;  1ZOT B;  2M7N A;  4WRI A;  1IG5 A;  1B1G A;  3I5G B;  4YGE B;  1IJ6 A;  4YGB B;  4PE0 A;  4GGF C;  1AVS A;  1F70 A;  2JXL A;  1FW4 A;  2M7L A;  1B7T Y;  1PSB A;  2ZRT A;  2JT8 A;  1DJW A;  4N1F A;  5J3X A;  2KNE A;  1J1E A;  3JTD B;  1QLS A;  1SNL A;  1TOP A;  4MN0 A;  1CTR A;  4N5X A;  2RGI A;  1S3P A;  3KPX A;  4MZJ A;  1B9A A;  1W7I B;  1PK0 D;  2KI6 C;  1UHI A;  1CB1 A;  2AUC A;  2ZN8 A;  1JFK A;  2GGZ A;  3PFV A;  2BL0 B;  5HKW A;  3NSI A;  1RJV A;  2B1U A;  2HET A;  2KAY A;  1SL8 A;  1IKU A;  5HLV A;  2NZ0 A;  1CLB A;  1DJY A;  1ALV A;  3TUY B;  1L7Z A;  2JPT A;  5ER5 A;  1RTP 1;  2BE6 A;  2R2I A;  1FF1 A;  5K89 A;  3PN7 B;  4HSZ A;  1W7J B;  2LVI A;  3ICB A;  1SR6 B;  1JFJ A;  2G2B A;  2PRU A;  1F55 A;  1UHN A;  2ZNE A;  4XJK A;  4CFR A;  1KQM B;  3JTD C;  1F71 A;  1NYA A;  2KDH A;  1KFU L;  1M31 A;  1OE9 B;  1QX2 A;  1EG3 A;  2F33 A;  1L2O B;  3CR2 A;  2HQW A;  2PAS A;  1DGV A;  2L0P A;  4MBE A;  5AEQ A;  1SPY A;  4C0J A;  2HPS A;  3MSE B;  3EK8 A;  3I5H B;  1M39 A;  2BL0 C;  1XFW O;  1DJX A;  1XFV O;  4CLN A;  4CID A;  3KO0 A;  4C0K A;  1YR5 A;  2K2F A;  1K95 A;  2JZI A;  2M1K B;  4QJ3 B;  1MF8 B;  1UUS A;  5HYD A;  1CFC A;  1BG1 A;  1SR6 C;  3PAL A;  1SY9 A;  4NDD A;  2LC5 A;  2GV5 A;  2MHH A;  1DT7 B;  1NUB A;  2L5X B;  2A4J A;  2WCE A;  1KQM C;  2MLE C;  1N65 A;  1F8H A;  3BUO B;  1QTX A;  2QPT A;  1QAT A;  1KFX L;  1BU3 A;  1L2O C;  2HF5 A;  3LL8 B;  1KQV A;  3NSO A;  3OX5 A;  4YI8 A;  4BY5 A;  1K90 D;  1KK7 Z;  4PE4 A;  3I5H C;  1FI5 A;  2F2P A;  2BCX A;  2LP3 A;  3IQQ A;  4MZK A;  4M2Q A;  4DCK A;  2L51 A;  4DRW A;  3LK1 A;  1J1D A;  3O2P A;  1CDL A;  4BY4 A;  1OMD A;  4AQJ A;  4YI9 A;  3QRX A;  1A03 A;  3BXK A;  1IJ5 A;  2M49 B;  1WDC C;  3SG4 A;  1GQM A;  1UHJ A;  3FWB A;  3D10 A;  3EK7 A;  1CLM A;  2BKH B;  2VRG A;  1SBJ A;  1RK9 A;  2K7C A;  1DJI A;  2G9B A;  2LLU A;  2BE4 A;  2LAP A;  1ODB A;  3M0W A;  1XFY O;  1CDP A;  3ZWH A;  4QJ4 B;  1IH0 A;  4HRH A;  1SW8 A;  3VRN A;  2LMV A;  1X02 A;  1SRA A;  1CKK A;  2Q4U A;  2LLT A;  1SYM A;  1S5G Z;  1UUR A;  1XFX O;  2LUC A;  3GK1 A;  2V53 A;  3TDU A;  2KAV A;  1J7O A;  2JC2 A;  2LCP A;  4OR9 B;  1BLQ A;  1LA0 A;  4PHJ A;  1OOJ A;  2CCM A;  1G8I A;  1GJY A;  1QIW A;  4DUQ A;  2IS9 A;  1ZMZ A;  2Q91 A;  1U5I B;  5KTY A;  1SKT A;  1LKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...