1SCMC

Structure of the regulatory domain of scallop myosin at 2.8 angstroms resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
149
structure length
149
Chain Sequence
SQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN HEAVY CHAIN
publication title Structure of the regulatory domain of scallop myosin at 2.8 A resolution.
pubmed doi rcsb
source organism Argopecten irradians
molecule tags Calcium-binding protein
total genus 37
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 1994-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1scmC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1scmC02
3A4UB 2KI6C 2L0PA 3K21A 1R6PA 4F0ZB 1IG5A 5PALA 3JVTB 3DVKA 3HCMA 1OZSA 2LCPA 2LM5A 4M2PA 2PASA 2M3WA 1M39A 1DT7B 1IQ3A 4ORAB 3PATA 4PCWA 3QRXA 1ZUZA 1TCFA 1QX2A 1ZMZA 3DD4A 2PVBA 4MLWA 1PULA 1UHNA 4GGFA 4WQ3A 2NCPA 1F71A 1EL4A 1K95A 1M63B 2A4JA 4HRHA 1CFCA 2JWWA 2LLUA 1KK8B 3OB2B 2I94A 2WC8A 3TS5C 3ZWHA 4MBEA 5DKNA 1Y6WA 3PN7C 2K7BA 4M2QA 3NSIA 4BY4A 1DJYA 4DS7A 1MXEA 4TNCA 3C1VA 2BBMA 5BPJA 4HSZA 1UWOA 1B47A 3PFVA 5AXIA 4ORCB 1AJ4A 1JF0A 3O78A 1NCZA 1XYDA 1NX1A 1PK0D 3WHUB 1KSOA 2LMVA 1LA3A 1B8LA 3M0WA 1CNPA 1UHHA 2JZIA 2LAPA 1SNLA 5KTYA 5HKZA 2M8UA 4MZJA 1MF8B 2ZNEA 1NWDA 2L2EA 1FI5A 1KWOB 1V1GA 3EK4A 3NXAA 3PALA 2BL0B 3EKHA 1CDLA 1YX7A 3DVJA 1ALVA 1GJYA 3CWGA 4XJKA 4CPVA 1AJ5A 1YR5A 4XJKB 3WNXB 1RK9A 1K93D 5CSIA 4AOMA 1TNWA 2Y4QA 1HT9A 3I5HC 3DVEA 1KFXL 2CCMA 1ZFSA 2NCOA 1K9KA 2R2IA 1CFPA 1M46A 5DKRA 1WRZA 1JF2A 2E30A 2KSPA 2CBLA 3BOWA 3CR4X 5TNCA 1C07A 2L4HA 2NLNA 2M1UA 2KI6D 1EH2A 1GGZA 1JFJA 3BOWB 3LCPC 1YRUB 1SYMA 2MLEC 2JULA 3AAJA 3OX6A 1CDMA 2M7NA 2ZNDA 1NX0A 4PDZA 2B1UA 2LMTA 1PSRA 5JOLA 1J7RA 1DJXA 3SIAA 3GK2A 1A4PA 1DF0A 4NDDA 4XYNA 2LC5A 1JSAA 3VRNA 1DF0B 1XK4C 1FW4A 4IL1A 1WLMA 2M1KB 4QJ5B 1QLKA 3LK0A 2JXCA 4GUKA 1LINA 2K7CA 3SG7A 1B8CA 1BR1B 2HQWA 1C7WA 1XK4A 2F8PA 1LVCD 2K2FA 3BUOB 3SIBA 2MBXA 1HQVA 1DGUA 3IQQA 1B8RA 3D0YA 3IQOA 5K89A 1CDNA 2JT8A 2LVKA 3EKJA 1IKUA 1SK6D 4C0KA 2F2OA 2MAZA 3D0YB 2I7AA 1IQ5A 3ICBA 2LHLA 4YI9A 2KAVA 1CFDA 2JOJA 1F70A 1B4CA 1SBJA 2BKHB 3I5IC 1WLZA 1K94A 2BE4A 2EGDA 3I5GC 4PHKA 2LHIA 1DVIA 2KBIA 3SG3A 1NX3A 1QXPA 1W7JB 1QS7A 3OB1B 1KFUS 1H8BA 2SASA 4YGDB 1OZOA 1K9UA 5I2OA 1KQMB 1MR8A 1AUIB 2H2KA 4YBHB 1K9PA 3KPXA 4N1FA 1MWNA 3ZNIA 5IBWA 1SR6B 4ETOA 3AAKA 3CR2A 1B9AA 1UHIA 4YGAA 1QATA 5AANA 1Y0VH 1DJZA 4QJ4B 2BCXA 3O2PA 4YGCB 3WHTB 3SG5A 1NP8A 1XVJA 1TOPA 4YGEB 1WDCC 2L50A 4D1EA 2M7LA 1J7QA 1AVSA 2MLFC 4MZKA 1EG3A 1WRLA 2LE9B 1KK7Z 1QV0A 1S1EA 3BUNB 4PE7A 1CB1A 1TNXA 1SY9A 1Q80A 4A4CA 3LLEA 5ER5A 1PRWA 1R2UA 1WDCB 2BCAA 4M2OA 2OTGC 5I2LA 1Y1XA 1OMVA 2PMYA 2ZFDA 2KFHA 4P5OE 2JRFA 1RECA 2Y1MA 2ZRSA 3SG4A 3I5FC 3TS5B 1JC2A 2P6BB 1IJ5A 4Q04A 1MUXA 3E3RA 3PLFB 3PN7B 4CIDA 4UPGA 2MHHA 1A03A 1CLLA 1XFYO 2FCDA 1IJ6A 1M45A 2NZ0A 1KK7Y 3OX5A 2BKIB 4C0LA 1CMGA 3CS1A 1AP4A 2MRDA 3IF7A 1TNQA 3EK8A 5HLVA 2WNDA 5FYXA 1EG4A 1KSMA 1TIZA 3OHMB 4QJ3B 1AK8A 1S26D 1QIWA 1F54A 4P2YB 5F6TA 3BUWB 1UP5A 1PSBA 3LK1A 5AFPA 1PVBA 2GGMA 1DGVA 2CTNA 1NPQA 1UUSA 1F55A 1DJIA 1XFXO 1DMOA 1UHKA 4YGBB 1IGVA 2FJUB 4FTGA 1NCXA 1JBAA 3O6BA 3D10A 3FWCA 3TDIA 1BG1A 2JT0A 4ICBA 2KAXA 3CR5X 1QJTA 2WCBA 3SG2A 3I5HB 3EVRA 4BY5A 2L51A 5KU1A 3FS7A 2F33A 2JT3A 2MJWB 4MEWA 2LLSA 1MXLC 2H61C 3PSRA 4ORBB 2BCBA 1V1FA 2I2RE 1N65A 4I5LB 3RLZA 1MQ1A 1N2DA 4GGNA 1VRKA 3GK4X 2QPTA 3H4SE 2LLTA 5G08A 1OMDA 1K90D 1TRFA 1BR4B 2JNXA 1FBVA 2E6WA 5J3XA 5B8IB 1ZACA 1BODA 1OSAA 3EVVA 2EC6C 4MSPA 3TUYC 1FI6A 4GPLB 2ZN8A 1SL8A 3VROA 4GBAA 1XA5A 2WOSA 1B1GA 2NXQA 3PM8A 4PE1A 4PHJA 1ZOTB 2K7DA 1QLSA 3HX4A 3KO0A 4YI8A 3WXAA 5HKYA 2LVJA 1CKKA 2QACA 2GV5A 4OVNF 2BBNA 4MVFA 5D69A 1K8UA 2V53A 4N1GA 1LXFC 4NDCA 4I5JA 5DKQA 1QTXA 2ZN9A 1QV1A 3RM1A 1A2XA 3BXKA 5CSFA 1J55A 1S5GZ 2K61A 3GOFA 1YRTB 2LP2A 1TCOB 3KF9A 2JC2A 3I5IB 3I5GB 1YVLA 2LANA 2KQYA 3TDUA 2I18A 2JTZA 1NSHA 2KBMA 1QASA 1OOJA 3CTNA 2ZRTA 1BT6A 3VRPA 2O5GA 2PRUA 3EK7A 1CTRA 3VRQA 4DRWA 2BE6A 1ODBA 3MSEB 3A8RA 2M49B 1Y1UA 4GFTA 4MN0A 2KQ6A 2KAYA 1D1OA 1NCYA 1A75A 1C7VA 1LA0A 4YRUA 2JTTA 4ZCUA 4PE4A 3JVTC 1A75B 1QX5B 2K7OA 2L98A 4R1EA 4PHMA 2F3YA 1DJWA 5AEQA 2KNEA 1JUOA 1BLQA 3VGOA 1SCMC 2KOTA 4WQ2A 4CFRA 4ZCVA 3AKBA 1JWDA 1RWYA 1S36A 1SMGA 1S5GY 1WY9A 1J1DA 2SCPA 5CPVA 1SKTA 2F2PA 1S6IA 1YTZC 2PALA 4GGFC 5KSZA 1F8HA 2EHBA 1BF5A 1KFUL 1KK8C 1SCMB 5I2QA 3KHEA 4MRXA 1IH0A 1K96A 1RFJA 2KDHA 2Y5IA 4JPZB 3AKAA 1CFFA 1B7TZ 4DUQA 2K0JA 2OTGB 1QVIZ 2LVIA 3BQ3A 3CZTX 3LL8B 5GQQC 4A4BA 1L2OC 1XFUO 2WORA 2OPOA 1BOCA 1CM1A 2AMIA 1J7PA 1N0YA 1CM4A 1SL9A 4MRYA 4OCIA 1U5IA 2JQ6A 4N5XA 1YURA 3FWBA 3I5FB 1U5IB 4E68A 1DJGA 2BECA 1KFXS 2LP3A 4HRGA 3DVMA 1L2OB 3NSKA 4DCKA 1UURA 3CGAA 1XFZO 2M29A 2LUXA 1BJFA 2LMUA 4I5KA 4PHNA 2L4IA 1SCVA 3TDZA 1KWOC 1F4QA 4FQOA 4GAOA 1QX7A 3TZ1A 2BL0C 4AQJA 5D7FA 4DIRA 2M97A 3SJSA 4HREE 1YVHA 1DJHA 1TTXA 2VRGA 1B7TY 2KI4C 1QVIY 1JFKA 4OKHA 1UHJA 2LUCA 1LKJA 2L5XB 1CMFA 4PE0A 2COLB 1BU3A 1NYAA 2GGZA 3BUMB 3DF0A 3FIAA 2JNFA 2AAOA 4I5NB 2WCFA 2KI4B 1KQVA 1EJ3A 1NX2A 1J1EA 2F3ZA 3DF0B 2HETA 5HLOA 3NSLA 4NDBA 1G33A 3GK1A 5ER4X 2PSRA 1XFWO 5JJGA 2LV7A 2ZKMX 1RTP1 1KCYA 2KGBC 2RGIA 4JWQA 4CFQA 2IS9A 2O60A 4MZLA 1L7ZA 2H61A 1XO5A 1CLMA 2TN4A 1J7OA 1CDPA 1X02A 4C0JA 2AUCA 2D8NA 3VRRA 1TNPA 1Y1AA 1H4BA 1G8IA 4OV2A 2MA2A 1EXRA 1ALWA 2WCEA 2JPTA 1BMOA 4GNKB 4CLNA 3CLNA 4NQGA 2FCEA 3F45A 2CXJA 2EC6B 3KEVA 4U8DA 3TUYB 1W7IB 1YUSA 4L9MA 2M0RA 1E8AA 3OP0A 4WRIA 5CSNA 1YUTA 2K8MB 3EVUA 5HKWA 2HF5A 1QIVA 2HQ8A 1OE9B 1K2HA 2KFGA 2JU0A 1S3PA 1AHRA 1M31A 3JTDC 2KYFA 3BYAA 4OR9B 4USLA 1A29A 3NSOA 5CSJA 5AERA 1XFVO 1SRAA 1OMRA 2LNKA 1WRKA 1PALA 1RROA 2DOQA 2FOTA 4PALA 1GQMA 2KFFA 3JTDB 3O4YA 3SG6A 5HYDA 2KYCA 2LVVA 2M9GA 2HPSA 2JXLA 2KHNA 1GGWA 1OQPA 2KGRA 2OS8C 4AQIA 1KQMC 1NIWA 3BUXB 2Y1NA 1CLBA 2G2BA 1FPWA 2Q91A 2CT9A 1RJVA 2Q4UA 1DTLA 1SR6C 1TN4A 4JQ0D 1F4OA 1G4YR 1S6JA 1IWQA 1PVAA 1YX8A 1MHOA 1YUUA 1S6CA 1FF1A 2OS8B 2ISDA 2CNPA 1SW8A 5I8NA 2G9BA 2K2AA 1IRJA 1SPYA 1NUBA 1SL7A
chains in the Genus database with same CATH superfamily
3A4UB 2KI6C 2L0PA 3K21A 1R6PA 4F0ZB 1IG5A 5PALA 3JVTB 3DVKA 3HCMA 1OZSA 2LCPA 2LM5A 4M2PA 2PASA 2M3WA 1M39A 1DT7B 1IQ3A 4ORAB 3RZSA 3PATA 4PCWA 3QRXA 1ZUZA 1TCFA 1QX2A 2L2CA 2BNXA 1ZMZA 3DD4A 2PVBA 4MLWA 1PULA 1UHNA 4GGFA 2WCMA 2NCPA 4WQ3A 1F71A 1EL4A 1K95A 1M63B 2A4JA 4HRHA 1CFCA 2JWWA 2LLUA 1KK8B 2WCJA 3B87A 3OB2B 2I94A 2FJYA 2WC8A 3B86A 3TS5C 3ZWHA 4MBEA 5DKNA 1Y6WA 1GM0A 3PN7C 2K7BA 4M2QA 3NSIA 4BY4A 1DJYA 5FI6A 4DS7A 1MXEA 4TNCA 3C1VA 2BBMA 3D74A 5BPJA 4HSZA 1UWOA 1B47A 3PFVA 5AXIA 4ORCB 1AJ4A 1JF0A 3O78A 1NCZA 1XYDA 1NX1A 1PK0D 3WHUB 1KSOA 4JKTA 2KLDA 2LMVA 3R1PA 1LA3A 2WCLA 1B8LA 1OOHA 3M0WA 1CNPA 1UHHA 2JZIA 2LAPA 1SNLA 5KTYA 5HKZA 2M8UA 4MZJA 3S0DA 1MF8B 2ZNEA 1NWDA 2L2EA 1FI5A 1KWOB 1V1GA 3EK4A 3NXAA 3PALA 2BL0B 3EKHA 1CDLA 1YX7A 3DVJA 1ALVA 1GJYA 3CWGA 3PJIA 4XJKA 4CPVA 1AJ5A 1YR5A 4XJKB 3WNXB 1RK9A 1K93D 5CSIA 3S0AA 4AOMA 4PT1A 1TNWA 2Y4QA 1HT9A 3I5HC 3DVEA 1KFXL 2CCMA 1ZFSA 2NCOA 2P70A 1K9KA 2R2IA 2WC6A 1C3YA 1M46A 1CFPA 5DKRA 1WRZA 1JF2A 2E30A 2KSPA 2CBLA 3BOWA 3CR4X 5TNCA 1ORGA 1C07A 2L4HA 2NLNA 2M1UA 2KI6D 1EH2A 1GGZA 1JFJA 3BOWB 3LCPC 1YRUB 1SYMA 3CZ0A 2MLEC 2JULA 3AAJA 3OX6A 1CDMA 2M7NA 2ZNDA 1NX0A 4PDZA 2B1UA 2LMTA 1PSRA 5JOLA 1J7RA 1DJXA 3SIAA 3GK2A 1A4PA 1DF0A 4NDDA 4XYNA 2LC5A 1JSAA 3VRNA 1DF0B 1DEKA 1XK4C 1FW4A 3FE9A 4IL1A 1WLMA 2M1KB 4QJ5B 1QLKA 3LK0A 2JXCA 3R72A 2QEOA 4GUKA 1LINA 2K7CA 3R1VA 3SG7A 3UNWA 1B8CA 1BR1B 2HQWA 1C7WA 1XK4A 2KPHA 2F8PA 3IVTA 1LVCD 2K2FA 3BUOB 3SIBA 2MBXA 1HQVA 1DGUA 3IQQA 1B8RA 3D0YA 3IQOA 2WCHA 5K89A 1CDNA 2JT8A 2LVKA 3EKJA 3DXLA 1IKUA 1SK6D 4C0KA 2F2OA 2MAZA 3D0YB 2I7AA 1IQ5A 3ICBA 2LHLA 4YI9A 2KAVA 1CFDA 4OZDA 3BFBA 2JOJA 1F70A 3DZTA 1B4CA 1SBJA 2KLEA 2BKHB 3I5IC 1WLZA 1K94A 2BE4A 2EGDA 3I5GC 4PHKA 2LHIA 1DVIA 2KBIA 3SG3A 1NX3A 1QXPA 1W7JB 1QS7A 3OB1B 1KFUS 1H8BA 3BFAA 2SASA 4YGDB 1OZOA 1DELA 1K9UA 1KQMB 1MR8A 5I2OA 1AUIB 1P28A 2H2KA 4YBHB 1K9PA 1SSEB 3KPXA 4N1FA 1MWNA 3ZNIA 5IBWA 1SR6B 4ETOA 3FE8A 3AAKA 3CR2A 1B9AA 1UHIA 4YGAA 1QATA 5AANA 1Y0VH 1DJZA 4QJ4B 2BCXA 3O2PA 4YGCB 3WHTB 3SG5A 1NP8A 1XVJA 1TOPA 4YGEB 1WDCC 2L50A 4D1EA 2M7LA 1J7QA 1AVSA 2MLFC 4MZKA 1EG3A 1WRLA 1TUZA 2LE9B 5D3OA 1KK7Z 1QV0A 1S1EA 3BUNB 4PE7A 1CB1A 1TNXA 1SY9A 1Q80A 4A4CA 3LLEA 1Z4HA 4FQTA 5ER5A 1PRWA 3OGNA 1R2UA 1WDCB 2BCAA 4M2OA 1LS8A 2OTGC 3EG5B 5I2LA 1Y1XA 1OMVA 2PMYA 2ZFDA 2KFHA 4P5OE 2JRFA 4IJ7A 1RECA 2Y1MA 3K1EA 5EL2A 2ZRSA 3SG4A 3I5FC 3TS5B 1JC2A 2P6BB 1IJ5A 4Q04A 1MUXA 3E3RA 3PLFB 3PN7B 4CIDA 4UPGA 2MHHA 3D77A 1A03A 1CLLA 1XFYO 2FCDA 1IJ6A 1M45A 2NZ0A 1KK7Y 3OX5A 2BKIB 4C0LA 1CMGA 3CS1A 1AP4A 2MRDA 3IF7A 1TNQA 3EK8A 5HLVA 2WNDA 5FYXA 1EG4A 1KSMA 1TIZA 3OHMB 4QJ3B 1AK8A 1S26D 1QIWA 1F54A 3FE6A 2WC5A 4P2YB 5F6TA 4INWA 3BUWB 1UP5A 2ERBA 1PSBA 3LK1A 5AFPA 1PVBA 2GGMA 2PQLA 1DGVA 2CTNA 1NPQA 2QEHA 1UUSA 1F55A 1DJIA 2K60A 1XFXO 2PYQA 1DMOA 1UHKA 4YGBB 1IGVA 2FJUB 4FTGA 1NCXA 1JBAA 3O6BA 3D10A 3FWCA 3TDIA 1BG1A 2JT0A 4ICBA 2KAXA 3CR5X 1QJTA 2WCBA 3SG2A 3I5HB 3EVRA 4BY5A 2L51A 3BFHA 5KU1A 3FS7A 2F33A 2JT3A 2MJWB 3CDNA 4MEWA 2LLSA 1MXLC 2H61C 3O4XA 5FI2A 3PSRA 4ORBB 2BCBA 1V1FA 2I2RE 1N65A 4I5LB 1T14A 3RLZA 1MQ1A 1N2DA 4GGNA 5DICA 1VRKA 3GK4X 2QPTA 3H4SE 2LLTA 5G08A 1OMDA 1K90D 1TRFA 3DY9A 1BR4B 2JNXA 1FBVA 2E6WA 5J3XA 5B8IB 1ZACA 1BODA 1OSAA 3EVVA 1C3ZA 2EC6C 4MSPA 3TUYC 1Z2CB 1FI6A 4GPLB 2ZN8A 1SL8A 2GTEA 3Q8IA 3VROA 4GBAA 1XA5A 2QDIA 2WOSA 1B1GA 3CZ2A 2NXQA 3CZ1A 3PM8A 4PE1A 4PHJA 3NHTA 1ZOTB 2K7DA 1QLSA 3HX4A 3KO0A 4YI8A 3WXAA 5HKYA 2LVJA 1CKKA 2QACA 2GV5A 4OVNF 2BBNA 4MVFA 5D69A 1K8UA 2V53A 4N1GA 1LXFC 4NDCA 4I5JA 5DKQA 1QTXA 3NGVA 2ZN9A 1QV1A 3RM1A 1A2XA 3BXKA 3CYZA 5CSFA 1J55A 1S5GZ 2K61A 3GOFA 1YRTB 2LP2A 1TCOB 3KF9A 2JC2A 3I5IB 3I5GB 3SS4A 3S0FA 1YVLA 2LANA 2KQYA 3TDUA 2I18A 2JTZA 3L47A 1NSHA 2KBMA 1QASA 1OOJA 3CTNA 2ZRTA 1BT6A 3VRPA 2O5GA 2PRUA 3BJHA 1CTRA 3EK7A 3VRQA 4DRWA 2BE6A 1ODBA 3MSEB 3A8RA 2M49B 1Y1UA 4GFTA 4MN0A 2KQ6A 2KAYA 1D1OA 1NCYA 1A75A 3B88A 1LA0A 4YRUA 1C7VA 2JTTA 4ZCUA 4PE4A 3JVTC 3DYEA 1A75B 1QX5B 2K7OA 2L98A 4R1EA 4PHMA 2F3YA 1DJWA 2WCKA 5AEQA 2KNEA 1JUOA 5FI7A 3VGOA 1SCMC 2KOTA 1BLQA 4INXA 4WQ2A 4CFRA 4ZCVA 3AKBA 1JWDA 1RWYA 1S36A 1SMGA 1S5GY 1WY9A 3V2LA 1XFRA 1J1DA 2SCPA 5CPVA 1SKTA 1IIOA 2F2PA 1S6IA 1YTZC 2PALA 4GGFC 5KSZA 1F8HA 2EHBA 1BF5A 1KFUL 1KK8C 1SCMB 5I2QA 3KHEA 4MRXA 1IH0A 3UO9A 1K96A 1RFJA 2KDHA 2Y5IA 4JPZB 3AKAA 5I94A 1CFFA 1B7TZ 4DUQA 2K0JA 2OTGB 1QVIZ 2LVIA 3BQ3A 3CZTX 3LL8B 5GQQC 4A4BA 1L2OC 1XFUO 2WORA 2OPOA 1BOCA 1CM1A 2AMIA 1J7PA 1N0YA 1CM4A 1SL9A 3CABA 4MRYA 4OCIA 1U5IA 2BAPA 2JQ6A 4N5XA 1YURA 3FWBA 3I5FB 1U5IB 4E68A 1DJGA 2BECA 3S0BA 1KFXS 2LP3A 4HRGA 3DVMA 1L2OB 3NSKA 4DCKA 1UURA 3CGAA 1XFZO 2M29A 2LUXA 1BJFA 2LMUA 4I5KA 4PHNA 2L4IA 1SCVA 3TDZA 3QMEA 1KWOC 1F4QA 4FQOA 4GAOA 1QX7A 3TZ1A 2BL0C 4AQJA 5D7FA 4DIRA 2M97A 3SJSA 4HREE 1YVHA 1DJHA 1TTXA 2VRGA 1B7TY 2KI4C 3D76A 1QVIY 1JFKA 4OKHA 1DQEA 1UHJA 2LUCA 1LKJA 2L5XB 1CMFA 4PE0A 2COLB 4KYNA 1BU3A 3D75A 4F7FA 1NYAA 2GGZA 3BUMB 3DF0A 3FIAA 2JNFA 2AAOA 4I5NB 2WCFA 2KI4B 1KQVA 1EJ3A 1NX2A 1J1EA 2F3ZA 3DF0B 2HETA 3PM2A 3NSLA 3L4LA 4NDBA 1G33A 5HLOA 3GK1A 3D73A 3B6XA 2PSRA 5ER4X 1XFWO 5JJGA 2LV7A 3SS5A 2ZKMX 3SS3A 1RTP1 1KCYA 2KGBC 2RGIA 3L4AA 4JWQA 4CFQA 2IS9A 2O60A 2QEVA 1L7ZA 4JD9A 4MZLA 2H61A 1XO5A 1CLMA 1TWOA 1OW4A 1OOGA 2TN4A 1OOFA 1J7OA 1CDPA 1X02A 4C0JA 2AUCA 2D8NA 3OBVA 3VRRA 1TNPA 1OOIX 3N7HA 1Y1AA 1H4BA 1G8IA 3NHIA 4OV2A 2MA2A 1EXRA 1ALWA 2WCEA 1QWVA 2H8VA 2JPTA 1BMOA 4GNKB 4CLNA 3CLNA 3VB1A 4NQGA 2FCEA 3F45A 2CXJA 2EC6B 3KEVA 4U8DA 3TUYB 1W7IB 1YUSA 4L9MA 2M0RA 1E8AA 3OP0A 4WRIA 5CSNA 1YUTA 3S0GA 2K8MB 1DC1A 3EVUA 2YGUA 5HKWA 2HF5A 1QIVA 2HQ8A 1OE9B 1W9ZA 1K2HA 2KFGA 2JU0A 1S3PA 3S0EA 1AHRA 1M31A 3JTDC 2KYFA 3BYAA 4OR9B 4USLA 1A29A 3NSOA 5CSJA 5AERA 1XFVO 3D78A 1SRAA 1OMRA 2LNKA 1WRKA 1PALA 3B7AA 1RROA 2DOQA 2FOTA 4PALA 1GQMA 3R1OA 2KFFA 3JTDB 3O4YA 3SG6A 5HYDA 2KYCA 2LVVA 2M9GA 2HPSA 2JXLA 2KHNA 1GGWA 1OQPA 2QEBA 2KGRA 2OS8C 4AQIA 5HL1A 1KQMC 1NIWA 3BUXB 2Y1NA 1CLBA 2G2BA 1FPWA 2Q91A 2JPOA 2CT9A 1RJVA 2Q4UA 2L5YA 2P71A 1DTLA 1SR6C 1TN4A 1TUJA 4JQ0D 1F4OA 1G4YR 1S6JA 1IWQA 1PVAA 1YX8A 1MHOA 1YUUA 1S6CA 1FF1A 2OS8B 2ISDA 2CNPA 1SW8A 5I8NA 2G9BA 2K2AA 1IRJA 1SPYA 1NUBA 1SL7A
chains in the Genus database with same CATH topology
3A4UB 2KI6C 2L0PA 3K21A 1R6PA 4F0ZB 1IG5A 5PALA 3JVTB 3DVKA 3HCMA 1OZSA 2LCPA 2LM5A 4M2PA 2PASA 2M3WA 1M39A 1DT7B 1IQ3A 4ORAB 3PATA 4PCWA 3QRXA 1ZUZA 1TCFA 1QX2A 1ZMZA 3DD4A 2PVBA 4MLWA 1PULA 1UHNA 4GGFA 4WQ3A 2NCPA 1F71A 1EL4A 1K95A 1M63B 2A4JA 4HRHA 1CFCA 2JWWA 2LLUA 1KK8B 3OB2B 2I94A 2WC8A 3TS5C 3ZWHA 4MBEA 5DKNA 1Y6WA 3PN7C 2K7BA 4M2QA 3NSIA 4BY4A 1DJYA 4DS7A 1MXEA 4TNCA 3C1VA 2BBMA 5BPJA 4HSZA 1UWOA 1B47A 3PFVA 5AXIA 4ORCB 1AJ4A 1JF0A 3O78A 1NCZA 1XYDA 1NX1A 1PK0D 3WHUB 1KSOA 2LMVA 1LA3A 1B8LA 3M0WA 1CNPA 1UHHA 2JZIA 2LAPA 1SNLA 5KTYA 5HKZA 2M8UA 4MZJA 1MF8B 2ZNEA 1NWDA 2L2EA 1FI5A 1KWOB 1V1GA 3EK4A 3NXAA 3PALA 2BL0B 3EKHA 1CDLA 1YX7A 3DVJA 1ALVA 1GJYA 3CWGA 4XJKA 4CPVA 1AJ5A 1YR5A 4XJKB 3WNXB 1RK9A 1K93D 5CSIA 4AOMA 1TNWA 2Y4QA 1HT9A 3I5HC 3DVEA 1KFXL 2CCMA 1ZFSA 2NCOA 1K9KA 2R2IA 1CFPA 1M46A 5DKRA 1WRZA 1JF2A 2E30A 2KSPA 2CBLA 3BOWA 3CR4X 5TNCA 1C07A 2L4HA 2NLNA 2M1UA 2KI6D 1EH2A 1GGZA 1JFJA 3BOWB 3LCPC 1YRUB 1SYMA 2MLEC 2JULA 3AAJA 3OX6A 1CDMA 2M7NA 2ZNDA 1NX0A 4PDZA 2B1UA 2LMTA 1PSRA 5JOLA 1J7RA 1DJXA 3SIAA 3GK2A 1A4PA 1DF0A 4NDDA 4XYNA 2LC5A 1JSAA 3VRNA 1DF0B 1XK4C 1FW4A 4IL1A 1WLMA 2M1KB 4QJ5B 1QLKA 3LK0A 2JXCA 4GUKA 1LINA 2K7CA 3SG7A 1B8CA 1BR1B 2HQWA 1C7WA 1XK4A 2F8PA 1LVCD 2K2FA 3BUOB 3SIBA 2MBXA 1HQVA 1DGUA 3IQQA 1B8RA 3D0YA 3IQOA 5K89A 1CDNA 2JT8A 2LVKA 3EKJA 1IKUA 1SK6D 4C0KA 2F2OA 2MAZA 3D0YB 2I7AA 1IQ5A 3ICBA 2LHLA 4YI9A 2KAVA 1CFDA 2JOJA 1F70A 1B4CA 1SBJA 2BKHB 3I5IC 1WLZA 1K94A 2BE4A 2EGDA 3I5GC 4PHKA 2LHIA 1DVIA 2KBIA 3SG3A 1NX3A 1QXPA 1W7JB 1QS7A 3OB1B 1KFUS 1H8BA 2SASA 4YGDB 1OZOA 1K9UA 5I2OA 1KQMB 1MR8A 1AUIB 2H2KA 4YBHB 1K9PA 3KPXA 4N1FA 1MWNA 3ZNIA 5IBWA 1SR6B 4ETOA 3AAKA 3CR2A 1B9AA 1UHIA 4YGAA 1QATA 5AANA 1Y0VH 1DJZA 4QJ4B 2BCXA 3O2PA 4YGCB 3WHTB 3SG5A 1NP8A 1XVJA 1TOPA 4YGEB 1WDCC 2L50A 4D1EA 2M7LA 1J7QA 1AVSA 2MLFC 4MZKA 1EG3A 1WRLA 2LE9B 1KK7Z 1QV0A 1S1EA 3BUNB 4PE7A 1CB1A 1TNXA 1SY9A 1Q80A 4A4CA 3LLEA 5ER5A 1PRWA 1R2UA 1WDCB 2BCAA 4M2OA 2OTGC 5I2LA 1Y1XA 1OMVA 2PMYA 2ZFDA 2KFHA 4P5OE 2JRFA 1RECA 2Y1MA 2ZRSA 3SG4A 3I5FC 3TS5B 1JC2A 2P6BB 1IJ5A 4Q04A 1MUXA 3E3RA 3PLFB 3PN7B 4CIDA 4UPGA 2MHHA 1A03A 1CLLA 1XFYO 2FCDA 1IJ6A 1M45A 2NZ0A 1KK7Y 3OX5A 2BKIB 4C0LA 1CMGA 3CS1A 1AP4A 2MRDA 3IF7A 1TNQA 3EK8A 5HLVA 2WNDA 5FYXA 1EG4A 1KSMA 1TIZA 3OHMB 4QJ3B 1AK8A 1S26D 1QIWA 1F54A 4P2YB 5F6TA 3BUWB 1UP5A 1PSBA 3LK1A 5AFPA 1PVBA 2GGMA 1DGVA 2CTNA 1NPQA 1UUSA 1F55A 1DJIA 1XFXO 1DMOA 1UHKA 4YGBB 1IGVA 2FJUB 4FTGA 1NCXA 1JBAA 3O6BA 3D10A 3FWCA 3TDIA 1BG1A 2JT0A 4ICBA 2KAXA 3CR5X 1QJTA 2WCBA 3SG2A 3I5HB 3EVRA 4BY5A 2L51A 5KU1A 3FS7A 2F33A 2JT3A 2MJWB 4MEWA 2LLSA 1MXLC 2H61C 3PSRA 4ORBB 2BCBA 1V1FA 2I2RE 1N65A 4I5LB 3RLZA 1MQ1A 1N2DA 4GGNA 1VRKA 3GK4X 2QPTA 3H4SE 2LLTA 5G08A 1OMDA 1K90D 1TRFA 1BR4B 2JNXA 1FBVA 2E6WA 5J3XA 5B8IB 1ZACA 1BODA 1OSAA 3EVVA 2EC6C 4MSPA 3TUYC 1FI6A 4GPLB 2ZN8A 1SL8A 3VROA 4GBAA 1XA5A 2WOSA 1B1GA 2NXQA 3PM8A 4PE1A 4PHJA 1ZOTB 2K7DA 1QLSA 3HX4A 3KO0A 4YI8A 3WXAA 5HKYA 2LVJA 1CKKA 2QACA 2GV5A 4OVNF 2BBNA 4MVFA 5D69A 1K8UA 2V53A 4N1GA 1LXFC 4NDCA 4I5JA 5DKQA 1QTXA 2ZN9A 1QV1A 3RM1A 1A2XA 3BXKA 5CSFA 1J55A 1S5GZ 2K61A 3GOFA 1YRTB 2LP2A 1TCOB 3KF9A 2JC2A 3I5IB 3I5GB 1YVLA 2LANA 2KQYA 3TDUA 2I18A 2JTZA 1NSHA 2KBMA 1QASA 1OOJA 3CTNA 2ZRTA 1BT6A 3VRPA 2O5GA 2PRUA 3EK7A 1CTRA 3VRQA 4DRWA 2BE6A 1ODBA 3MSEB 3A8RA 2M49B 1Y1UA 4GFTA 4MN0A 2KQ6A 2KAYA 1D1OA 1NCYA 1A75A 1C7VA 1LA0A 4YRUA 2JTTA 4ZCUA 4PE4A 3JVTC 1A75B 1QX5B 2K7OA 2L98A 4R1EA 4PHMA 2F3YA 1DJWA 5AEQA 2KNEA 1JUOA 1BLQA 3VGOA 1SCMC 2KOTA 4WQ2A 4CFRA 4ZCVA 3AKBA 1JWDA 1RWYA 1S36A 1SMGA 1S5GY 1WY9A 1J1DA 2SCPA 5CPVA 1SKTA 2F2PA 1S6IA 1YTZC 2PALA 4GGFC 5KSZA 1F8HA 2EHBA 1BF5A 1KFUL 1KK8C 1SCMB 5I2QA 3KHEA 4MRXA 1IH0A 1K96A 1RFJA 2KDHA 2Y5IA 4JPZB 3AKAA 1CFFA 1B7TZ 4DUQA 2K0JA 2OTGB 1QVIZ 2LVIA 3BQ3A 3CZTX 3LL8B 5GQQC 4A4BA 1L2OC 1XFUO 2WORA 2OPOA 1BOCA 1CM1A 2AMIA 1J7PA 1N0YA 1CM4A 1SL9A 4MRYA 4OCIA 1U5IA 2JQ6A 4N5XA 1YURA 3FWBA 3I5FB 1U5IB 4E68A 1DJGA 2BECA 1KFXS 2LP3A 4HRGA 3DVMA 1L2OB 3NSKA 4DCKA 1UURA 3CGAA 1XFZO 2M29A 2LUXA 1BJFA 2LMUA 4I5KA 4PHNA 2L4IA 1SCVA 3TDZA 1KWOC 1F4QA 4FQOA 4GAOA 1QX7A 3TZ1A 2BL0C 4AQJA 5D7FA 4DIRA 2M97A 3SJSA 4HREE 1YVHA 1DJHA 1TTXA 2VRGA 1B7TY 2KI4C 1QVIY 1JFKA 4OKHA 1UHJA 2LUCA 1LKJA 2L5XB 1CMFA 4PE0A 2COLB 1BU3A 1NYAA 2GGZA 3BUMB 3DF0A 3FIAA 2JNFA 2AAOA 4I5NB 2WCFA 2KI4B 1KQVA 1EJ3A 1NX2A 1J1EA 2F3ZA 3DF0B 2HETA 5HLOA 3NSLA 4NDBA 1G33A 3GK1A 5ER4X 2PSRA 1XFWO 5JJGA 2LV7A 2ZKMX 1RTP1 1KCYA 2KGBC 2RGIA 4JWQA 4CFQA 2IS9A 2O60A 4MZLA 1L7ZA 2H61A 1XO5A 1CLMA 2TN4A 1J7OA 1CDPA 1X02A 4C0JA 2AUCA 2D8NA 3VRRA 1TNPA 1Y1AA 1H4BA 1G8IA 4OV2A 2MA2A 1EXRA 1ALWA 2WCEA 2JPTA 1BMOA 4GNKB 4CLNA 3CLNA 4NQGA 2FCEA 3F45A 2CXJA 2EC6B 3KEVA 4U8DA 3TUYB 1W7IB 1YUSA 4L9MA 2M0RA 1E8AA 3OP0A 4WRIA 5CSNA 1YUTA 2K8MB 3EVUA 5HKWA 2HF5A 1QIVA 2HQ8A 1OE9B 1K2HA 2KFGA 2JU0A 1S3PA 1AHRA 1M31A 3JTDC 2KYFA 3BYAA 4OR9B 4USLA 1A29A 3NSOA 5CSJA 5AERA 1XFVO 1SRAA 1OMRA 2LNKA 1WRKA 1PALA 1RROA 2DOQA 2FOTA 4PALA 1GQMA 2KFFA 3JTDB 3O4YA 3SG6A 5HYDA 2KYCA 2LVVA 2M9GA 2HPSA 2JXLA 2KHNA 1GGWA 1OQPA 2KGRA 2OS8C 4AQIA 1KQMC 1NIWA 3BUXB 2Y1NA 1CLBA 2G2BA 1FPWA 2Q91A 2CT9A 1RJVA 2Q4UA 1DTLA 1SR6C 1TN4A 4JQ0D 1F4OA 1G4YR 1S6JA 1IWQA 1PVAA 1YX8A 1MHOA 1YUUA 1S6CA 1FF1A 2OS8B 2ISDA 2CNPA 1SW8A 5I8NA 2G9BA 2K2AA 1IRJA 1SPYA 1NUBA 1SL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A4U B;  2KI6 C;  2L0P A;  3K21 A;  1R6P A;  4F0Z B;  1IG5 A;  5PAL A;  3JVT B;  3DVK A;  3HCM A;  1OZS A;  2LCP A;  2LM5 A;  4M2P A;  2PAS A;  2M3W A;  1M39 A;  1DT7 B;  1IQ3 A;  4ORA B;  3PAT A;  4PCW A;  3QRX A;  1ZUZ A;  1TCF A;  1QX2 A;  1ZMZ A;  3DD4 A;  2PVB A;  4MLW A;  1PUL A;  1UHN A;  4GGF A;  4WQ3 A;  2NCP A;  1F71 A;  1EL4 A;  1K95 A;  1M63 B;  2A4J A;  4HRH A;  1CFC A;  2JWW A;  2LLU A;  1KK8 B;  3OB2 B;  2I94 A;  2WC8 A;  3TS5 C;  3ZWH A;  4MBE A;  5DKN A;  1Y6W A;  3PN7 C;  2K7B A;  4M2Q A;  3NSI A;  4BY4 A;  1DJY A;  4DS7 A;  1MXE A;  4TNC A;  3C1V A;  2BBM A;  5BPJ A;  4HSZ A;  1UWO A;  1B47 A;  3PFV A;  5AXI A;  4ORC B;  1AJ4 A;  1JF0 A;  3O78 A;  1NCZ A;  1XYD A;  1NX1 A;  1PK0 D;  3WHU B;  1KSO A;  2LMV A;  1LA3 A;  1B8L A;  3M0W A;  1CNP A;  1UHH A;  2JZI A;  2LAP A;  1SNL A;  5KTY A;  5HKZ A;  2M8U A;  4MZJ A;  1MF8 B;  2ZNE A;  1NWD A;  2L2E A;  1FI5 A;  1KWO B;  1V1G A;  3EK4 A;  3NXA A;  3PAL A;  2BL0 B;  3EKH A;  1CDL A;  1YX7 A;  3DVJ A;  1ALV A;  1GJY A;  3CWG A;  4XJK A;  4CPV A;  1AJ5 A;  1YR5 A;  4XJK B;  3WNX B;  1RK9 A;  1K93 D;  5CSI A;  4AOM A;  1TNW A;  2Y4Q A;  1HT9 A;  3I5H C;  3DVE A;  1KFX L;  2CCM A;  1ZFS A;  2NCO A;  1K9K A;  2R2I A;  1CFP A;  1M46 A;  5DKR A;  1WRZ A;  1JF2 A;  2E30 A;  2KSP A;  2CBL A;  3BOW A;  3CR4 X;  5TNC A;  1C07 A;  2L4H A;  2NLN A;  2M1U A;  2KI6 D;  1EH2 A;  1GGZ A;  1JFJ A;  3BOW B;  3LCP C;  1YRU B;  1SYM A;  2MLE C;  2JUL A;  3AAJ A;  3OX6 A;  1CDM A;  2M7N A;  2ZND A;  1NX0 A;  4PDZ A;  2B1U A;  2LMT A;  1PSR A;  5JOL A;  1J7R A;  1DJX A;  3SIA A;  3GK2 A;  1A4P A;  1DF0 A;  4NDD A;  4XYN A;  2LC5 A;  1JSA A;  3VRN A;  1DF0 B;  1XK4 C;  1FW4 A;  4IL1 A;  1WLM A;  2M1K B;  4QJ5 B;  1QLK A;  3LK0 A;  2JXC A;  4GUK A;  1LIN A;  2K7C A;  3SG7 A;  1B8C A;  1BR1 B;  2HQW A;  1C7W A;  1XK4 A;  2F8P A;  1LVC D;  2K2F A;  3BUO B;  3SIB A;  2MBX A;  1HQV A;  1DGU A;  3IQQ A;  1B8R A;  3D0Y A;  3IQO A;  5K89 A;  1CDN A;  2JT8 A;  2LVK A;  3EKJ A;  1IKU A;  1SK6 D;  4C0K A;  2F2O A;  2MAZ A;  3D0Y B;  2I7A A;  1IQ5 A;  3ICB A;  2LHL A;  4YI9 A;  2KAV A;  1CFD A;  2JOJ A;  1F70 A;  1B4C A;  1SBJ A;  2BKH B;  3I5I C;  1WLZ A;  1K94 A;  2BE4 A;  2EGD A;  3I5G C;  4PHK A;  2LHI A;  1DVI A;  2KBI A;  3SG3 A;  1NX3 A;  1QXP A;  1W7J B;  1QS7 A;  3OB1 B;  1KFU S;  1H8B A;  2SAS A;  4YGD B;  1OZO A;  1K9U A;  5I2O A;  1KQM B;  1MR8 A;  1AUI B;  2H2K A;  4YBH B;  1K9P A;  3KPX A;  4N1F A;  1MWN A;  3ZNI A;  5IBW A;  1SR6 B;  4ETO A;  3AAK A;  3CR2 A;  1B9A A;  1UHI A;  4YGA A;  1QAT A;  5AAN A;  1Y0V H;  1DJZ A;  4QJ4 B;  2BCX A;  3O2P A;  4YGC B;  3WHT B;  3SG5 A;  1NP8 A;  1XVJ A;  1TOP A;  4YGE B;  1WDC C;  2L50 A;  4D1E A;  2M7L A;  1J7Q A;  1AVS A;  2MLF C;  4MZK A;  1EG3 A;  1WRL A;  2LE9 B;  1KK7 Z;  1QV0 A;  1S1E A;  3BUN B;  4PE7 A;  1CB1 A;  1TNX A;  1SY9 A;  1Q80 A;  4A4C A;  3LLE A;  5ER5 A;  1PRW A;  1R2U A;  1WDC B;  2BCA A;  4M2O A;  2OTG C;  5I2L A;  1Y1X A;  1OMV A;  2PMY A;  2ZFD A;  2KFH A;  4P5O E;  2JRF A;  1REC A;  2Y1M A;  2ZRS A;  3SG4 A;  3I5F C;  3TS5 B;  1JC2 A;  2P6B B;  1IJ5 A;  4Q04 A;  1MUX A;  3E3R A;  3PLF B;  3PN7 B;  4CID A;  4UPG A;  2MHH A;  1A03 A;  1CLL A;  1XFY O;  2FCD A;  1IJ6 A;  1M45 A;  2NZ0 A;  1KK7 Y;  3OX5 A;  2BKI B;  4C0L A;  1CMG A;  3CS1 A;  1AP4 A;  2MRD A;  3IF7 A;  1TNQ A;  3EK8 A;  5HLV A;  2WND A;  5FYX A;  1EG4 A;  1KSM A;  1TIZ A;  3OHM B;  4QJ3 B;  1AK8 A;  1S26 D;  1QIW A;  1F54 A;  4P2Y B;  5F6T A;  3BUW B;  1UP5 A;  1PSB A;  3LK1 A;  5AFP A;  1PVB A;  2GGM A;  1DGV A;  2CTN A;  1NPQ A;  1UUS A;  1F55 A;  1DJI A;  1XFX O;  1DMO A;  1UHK A;  4YGB B;  1IGV A;  2FJU B;  4FTG A;  1NCX A;  1JBA A;  3O6B A;  3D10 A;  3FWC A;  3TDI A;  1BG1 A;  2JT0 A;  4ICB A;  2KAX A;  3CR5 X;  1QJT A;  2WCB A;  3SG2 A;  3I5H B;  3EVR A;  4BY5 A;  2L51 A;  5KU1 A;  3FS7 A;  2F33 A;  2JT3 A;  2MJW B;  4MEW A;  2LLS A;  1MXL C;  2H61 C;  3PSR A;  4ORB B;  2BCB A;  1V1F A;  2I2R E;  1N65 A;  4I5L B;  3RLZ A;  1MQ1 A;  1N2D A;  4GGN A;  1VRK A;  3GK4 X;  2QPT A;  3H4S E;  2LLT A;  5G08 A;  1OMD A;  1K90 D;  1TRF A;  1BR4 B;  2JNX A;  1FBV A;  2E6W A;  5J3X A;  5B8I B;  1ZAC A;  1BOD A;  1OSA A;  3EVV A;  2EC6 C;  4MSP A;  3TUY C;  1FI6 A;  4GPL B;  2ZN8 A;  1SL8 A;  3VRO A;  4GBA A;  1XA5 A;  2WOS A;  1B1G A;  2NXQ A;  3PM8 A;  4PE1 A;  4PHJ A;  1ZOT B;  2K7D A;  1QLS A;  3HX4 A;  3KO0 A;  4YI8 A;  3WXA A;  5HKY A;  2LVJ A;  1CKK A;  2QAC A;  2GV5 A;  4OVN F;  2BBN A;  4MVF A;  5D69 A;  1K8U A;  2V53 A;  4N1G A;  1LXF C;  4NDC A;  4I5J A;  5DKQ A;  1QTX A;  2ZN9 A;  1QV1 A;  3RM1 A;  1A2X A;  3BXK A;  5CSF A;  1J55 A;  1S5G Z;  2K61 A;  3GOF A;  1YRT B;  2LP2 A;  1TCO B;  3KF9 A;  2JC2 A;  3I5I B;  3I5G B;  1YVL A;  2LAN A;  2KQY A;  3TDU A;  2I18 A;  2JTZ A;  1NSH A;  2KBM A;  1QAS A;  1OOJ A;  3CTN A;  2ZRT A;  1BT6 A;  3VRP A;  2O5G A;  2PRU A;  3EK7 A;  1CTR A;  3VRQ A;  4DRW A;  2BE6 A;  1ODB A;  3MSE B;  3A8R A;  2M49 B;  1Y1U A;  4GFT A;  4MN0 A;  2KQ6 A;  2KAY A;  1D1O A;  1NCY A;  1A75 A;  1C7V A;  1LA0 A;  4YRU A;  2JTT A;  4ZCU A;  4PE4 A;  3JVT C;  1A75 B;  1QX5 B;  2K7O A;  2L98 A;  4R1E A;  4PHM A;  2F3Y A;  1DJW A;  5AEQ A;  2KNE A;  1JUO A;  1BLQ A;  3VGO A;  1SCM C;  2KOT A;  4WQ2 A;  4CFR A;  4ZCV A;  3AKB A;  1JWD A;  1RWY A;  1S36 A;  1SMG A;  1S5G Y;  1WY9 A;  1J1D A;  2SCP A;  5CPV A;  1SKT A;  2F2P A;  1S6I A;  1YTZ C;  2PAL A;  4GGF C;  5KSZ A;  1F8H A;  2EHB A;  1BF5 A;  1KFU L;  1KK8 C;  1SCM B;  5I2Q A;  3KHE A;  4MRX A;  1IH0 A;  1K96 A;  1RFJ A;  2KDH A;  2Y5I A;  4JPZ B;  3AKA A;  1CFF A;  1B7T Z;  4DUQ A;  2K0J A;  2OTG B;  1QVI Z;  2LVI A;  3BQ3 A;  3CZT X;  3LL8 B;  5GQQ C;  4A4B A;  1L2O C;  1XFU O;  2WOR A;  2OPO A;  1BOC A;  1CM1 A;  2AMI A;  1J7P A;  1N0Y A;  1CM4 A;  1SL9 A;  4MRY A;  4OCI A;  1U5I A;  2JQ6 A;  4N5X A;  1YUR A;  3FWB A;  3I5F B;  1U5I B;  4E68 A;  1DJG A;  2BEC A;  1KFX S;  2LP3 A;  4HRG A;  3DVM A;  1L2O B;  3NSK A;  4DCK A;  1UUR A;  3CGA A;  1XFZ O;  2M29 A;  2LUX A;  1BJF A;  2LMU A;  4I5K A;  4PHN A;  2L4I A;  1SCV A;  3TDZ A;  1KWO C;  1F4Q A;  4FQO A;  4GAO A;  1QX7 A;  3TZ1 A;  2BL0 C;  4AQJ A;  5D7F A;  4DIR A;  2M97 A;  3SJS A;  4HRE E;  1YVH A;  1DJH A;  1TTX A;  2VRG A;  1B7T Y;  2KI4 C;  1QVI Y;  1JFK A;  4OKH A;  1UHJ A;  2LUC A;  1LKJ A;  2L5X B;  1CMF A;  4PE0 A;  2COL B;  1BU3 A;  1NYA A;  2GGZ A;  3BUM B;  3DF0 A;  3FIA A;  2JNF A;  2AAO A;  4I5N B;  2WCF A;  2KI4 B;  1KQV A;  1EJ3 A;  1NX2 A;  1J1E A;  2F3Z A;  3DF0 B;  2HET A;  5HLO A;  3NSL A;  4NDB A;  1G33 A;  3GK1 A;  5ER4 X;  2PSR A;  1XFW O;  5JJG A;  2LV7 A;  2ZKM X;  1RTP 1;  1KCY A;  2KGB C;  2RGI A;  4JWQ A;  4CFQ A;  2IS9 A;  2O60 A;  4MZL A;  1L7Z A;  2H61 A;  1XO5 A;  1CLM A;  2TN4 A;  1J7O A;  1CDP A;  1X02 A;  4C0J A;  2AUC A;  2D8N A;  3VRR A;  1TNP A;  1Y1A A;  1H4B A;  1G8I A;  4OV2 A;  2MA2 A;  1EXR A;  1ALW A;  2WCE A;  2JPT A;  1BMO A;  4GNK B;  4CLN A;  3CLN A;  4NQG A;  2FCE A;  3F45 A;  2CXJ A;  2EC6 B;  3KEV A;  4U8D A;  3TUY B;  1W7I B;  1YUS A;  4L9M A;  2M0R A;  1E8A A;  3OP0 A;  4WRI A;  5CSN A;  1YUT A;  2K8M B;  3EVU A;  5HKW A;  2HF5 A;  1QIV A;  2HQ8 A;  1OE9 B;  1K2H A;  2KFG A;  2JU0 A;  1S3P A;  1AHR A;  1M31 A;  3JTD C;  2KYF A;  3BYA A;  4OR9 B;  4USL A;  1A29 A;  3NSO A;  5CSJ A;  5AER A;  1XFV O;  1SRA A;  1OMR A;  2LNK A;  1WRK A;  1PAL A;  1RRO A;  2DOQ A;  2FOT A;  4PAL A;  1GQM A;  2KFF A;  3JTD B;  3O4Y A;  3SG6 A;  5HYD A;  2KYC A;  2LVV A;  2M9G A;  2HPS A;  2JXL A;  2KHN A;  1GGW A;  1OQP A;  2KGR A;  2OS8 C;  4AQI A;  1KQM C;  1NIW A;  3BUX B;  2Y1N A;  1CLB A;  2G2B A;  1FPW A;  2Q91 A;  2CT9 A;  1RJV A;  2Q4U A;  1DTL A;  1SR6 C;  1TN4 A;  4JQ0 D;  1F4O A;  1G4Y R;  1S6J A;  1IWQ A;  1PVA A;  1YX8 A;  1MHO A;  1YUU A;  1S6C A;  1FF1 A;  2OS8 B;  2ISD A;  2CNP A;  1SW8 A;  5I8N A;  2G9B A;  2K2A A;  1IRJ A;  1SPY A;  1NUB A;  1SL7 A; 
#chains in the Genus database with same CATH topology
 3A4U B;  2KI6 C;  2L0P A;  3K21 A;  1R6P A;  4F0Z B;  1IG5 A;  5PAL A;  3JVT B;  3DVK A;  3HCM A;  1OZS A;  2LCP A;  2LM5 A;  4M2P A;  2PAS A;  2M3W A;  1M39 A;  1DT7 B;  1IQ3 A;  4ORA B;  3RZS A;  3PAT A;  4PCW A;  3QRX A;  1ZUZ A;  1TCF A;  1QX2 A;  2L2C A;  2BNX A;  1ZMZ A;  3DD4 A;  2PVB A;  4MLW A;  1PUL A;  1UHN A;  4GGF A;  2WCM A;  2NCP A;  4WQ3 A;  1F71 A;  1EL4 A;  1K95 A;  1M63 B;  2A4J A;  4HRH A;  1CFC A;  2JWW A;  2LLU A;  1KK8 B;  2WCJ A;  3B87 A;  3OB2 B;  2I94 A;  2FJY A;  2WC8 A;  3B86 A;  3TS5 C;  3ZWH A;  4MBE A;  5DKN A;  1Y6W A;  1GM0 A;  3PN7 C;  2K7B A;  4M2Q A;  3NSI A;  4BY4 A;  1DJY A;  5FI6 A;  4DS7 A;  1MXE A;  4TNC A;  3C1V A;  2BBM A;  3D74 A;  5BPJ A;  4HSZ A;  1UWO A;  1B47 A;  3PFV A;  5AXI A;  4ORC B;  1AJ4 A;  1JF0 A;  3O78 A;  1NCZ A;  1XYD A;  1NX1 A;  1PK0 D;  3WHU B;  1KSO A;  4JKT A;  2KLD A;  2LMV A;  3R1P A;  1LA3 A;  2WCL A;  1B8L A;  1OOH A;  3M0W A;  1CNP A;  1UHH A;  2JZI A;  2LAP A;  1SNL A;  5KTY A;  5HKZ A;  2M8U A;  4MZJ A;  3S0D A;  1MF8 B;  2ZNE A;  1NWD A;  2L2E A;  1FI5 A;  1KWO B;  1V1G A;  3EK4 A;  3NXA A;  3PAL A;  2BL0 B;  3EKH A;  1CDL A;  1YX7 A;  3DVJ A;  1ALV A;  1GJY A;  3CWG A;  3PJI A;  4XJK A;  4CPV A;  1AJ5 A;  1YR5 A;  4XJK B;  3WNX B;  1RK9 A;  1K93 D;  5CSI A;  3S0A A;  4AOM A;  4PT1 A;  1TNW A;  2Y4Q A;  1HT9 A;  3I5H C;  3DVE A;  1KFX L;  2CCM A;  1ZFS A;  2NCO A;  2P70 A;  1K9K A;  2R2I A;  2WC6 A;  1C3Y A;  1M46 A;  1CFP A;  5DKR A;  1WRZ A;  1JF2 A;  2E30 A;  2KSP A;  2CBL A;  3BOW A;  3CR4 X;  5TNC A;  1ORG A;  1C07 A;  2L4H A;  2NLN A;  2M1U A;  2KI6 D;  1EH2 A;  1GGZ A;  1JFJ A;  3BOW B;  3LCP C;  1YRU B;  1SYM A;  3CZ0 A;  2MLE C;  2JUL A;  3AAJ A;  3OX6 A;  1CDM A;  2M7N A;  2ZND A;  1NX0 A;  4PDZ A;  2B1U A;  2LMT A;  1PSR A;  5JOL A;  1J7R A;  1DJX A;  3SIA A;  3GK2 A;  1A4P A;  1DF0 A;  4NDD A;  4XYN A;  2LC5 A;  1JSA A;  3VRN A;  1DF0 B;  1DEK A;  1XK4 C;  1FW4 A;  3FE9 A;  4IL1 A;  1WLM A;  2M1K B;  4QJ5 B;  1QLK A;  3LK0 A;  2JXC A;  3R72 A;  2QEO A;  4GUK A;  1LIN A;  2K7C A;  3R1V A;  3SG7 A;  3UNW A;  1B8C A;  1BR1 B;  2HQW A;  1C7W A;  1XK4 A;  2KPH A;  2F8P A;  3IVT A;  1LVC D;  2K2F A;  3BUO B;  3SIB A;  2MBX A;  1HQV A;  1DGU A;  3IQQ A;  1B8R A;  3D0Y A;  3IQO A;  2WCH A;  5K89 A;  1CDN A;  2JT8 A;  2LVK A;  3EKJ A;  3DXL A;  1IKU A;  1SK6 D;  4C0K A;  2F2O A;  2MAZ A;  3D0Y B;  2I7A A;  1IQ5 A;  3ICB A;  2LHL A;  4YI9 A;  2KAV A;  1CFD A;  4OZD A;  3BFB A;  2JOJ A;  1F70 A;  3DZT A;  1B4C A;  1SBJ A;  2KLE A;  2BKH B;  3I5I C;  1WLZ A;  1K94 A;  2BE4 A;  2EGD A;  3I5G C;  4PHK A;  2LHI A;  1DVI A;  2KBI A;  3SG3 A;  1NX3 A;  1QXP A;  1W7J B;  1QS7 A;  3OB1 B;  1KFU S;  1H8B A;  3BFA A;  2SAS A;  4YGD B;  1OZO A;  1DEL A;  1K9U A;  1KQM B;  1MR8 A;  5I2O A;  1AUI B;  1P28 A;  2H2K A;  4YBH B;  1K9P A;  1SSE B;  3KPX A;  4N1F A;  1MWN A;  3ZNI A;  5IBW A;  1SR6 B;  4ETO A;  3FE8 A;  3AAK A;  3CR2 A;  1B9A A;  1UHI A;  4YGA A;  1QAT A;  5AAN A;  1Y0V H;  1DJZ A;  4QJ4 B;  2BCX A;  3O2P A;  4YGC B;  3WHT B;  3SG5 A;  1NP8 A;  1XVJ A;  1TOP A;  4YGE B;  1WDC C;  2L50 A;  4D1E A;  2M7L A;  1J7Q A;  1AVS A;  2MLF C;  4MZK A;  1EG3 A;  1WRL A;  1TUZ A;  2LE9 B;  5D3O A;  1KK7 Z;  1QV0 A;  1S1E A;  3BUN B;  4PE7 A;  1CB1 A;  1TNX A;  1SY9 A;  1Q80 A;  4A4C A;  3LLE A;  1Z4H A;  4FQT A;  5ER5 A;  1PRW A;  3OGN A;  1R2U A;  1WDC B;  2BCA A;  4M2O A;  1LS8 A;  2OTG C;  3EG5 B;  5I2L A;  1Y1X A;  1OMV A;  2PMY A;  2ZFD A;  2KFH A;  4P5O E;  2JRF A;  4IJ7 A;  1REC A;  2Y1M A;  3K1E A;  5EL2 A;  2ZRS A;  3SG4 A;  3I5F C;  3TS5 B;  1JC2 A;  2P6B B;  1IJ5 A;  4Q04 A;  1MUX A;  3E3R A;  3PLF B;  3PN7 B;  4CID A;  4UPG A;  2MHH A;  3D77 A;  1A03 A;  1CLL A;  1XFY O;  2FCD A;  1IJ6 A;  1M45 A;  2NZ0 A;  1KK7 Y;  3OX5 A;  2BKI B;  4C0L A;  1CMG A;  3CS1 A;  1AP4 A;  2MRD A;  3IF7 A;  1TNQ A;  3EK8 A;  5HLV A;  2WND A;  5FYX A;  1EG4 A;  1KSM A;  1TIZ A;  3OHM B;  4QJ3 B;  1AK8 A;  1S26 D;  1QIW A;  1F54 A;  3FE6 A;  2WC5 A;  4P2Y B;  5F6T A;  4INW A;  3BUW B;  1UP5 A;  2ERB A;  1PSB A;  3LK1 A;  5AFP A;  1PVB A;  2GGM A;  2PQL A;  1DGV A;  2CTN A;  1NPQ A;  2QEH A;  1UUS A;  1F55 A;  1DJI A;  2K60 A;  1XFX O;  2PYQ A;  1DMO A;  1UHK A;  4YGB B;  1IGV A;  2FJU B;  4FTG A;  1NCX A;  1JBA A;  3O6B A;  3D10 A;  3FWC A;  3TDI A;  1BG1 A;  2JT0 A;  4ICB A;  2KAX A;  3CR5 X;  1QJT A;  2WCB A;  3SG2 A;  3I5H B;  3EVR A;  4BY5 A;  2L51 A;  3BFH A;  5KU1 A;  3FS7 A;  2F33 A;  2JT3 A;  2MJW B;  3CDN A;  4MEW A;  2LLS A;  1MXL C;  2H61 C;  3O4X A;  5FI2 A;  3PSR A;  4ORB B;  2BCB A;  1V1F A;  2I2R E;  1N65 A;  4I5L B;  1T14 A;  3RLZ A;  1MQ1 A;  1N2D A;  4GGN A;  5DIC A;  1VRK A;  3GK4 X;  2QPT A;  3H4S E;  2LLT A;  5G08 A;  1OMD A;  1K90 D;  1TRF A;  3DY9 A;  1BR4 B;  2JNX A;  1FBV A;  2E6W A;  5J3X A;  5B8I B;  1ZAC A;  1BOD A;  1OSA A;  3EVV A;  1C3Z A;  2EC6 C;  4MSP A;  3TUY C;  1Z2C B;  1FI6 A;  4GPL B;  2ZN8 A;  1SL8 A;  2GTE A;  3Q8I A;  3VRO A;  4GBA A;  1XA5 A;  2QDI A;  2WOS A;  1B1G A;  3CZ2 A;  2NXQ A;  3CZ1 A;  3PM8 A;  4PE1 A;  4PHJ A;  3NHT A;  1ZOT B;  2K7D A;  1QLS A;  3HX4 A;  3KO0 A;  4YI8 A;  3WXA A;  5HKY A;  2LVJ A;  1CKK A;  2QAC A;  2GV5 A;  4OVN F;  2BBN A;  4MVF A;  5D69 A;  1K8U A;  2V53 A;  4N1G A;  1LXF C;  4NDC A;  4I5J A;  5DKQ A;  1QTX A;  3NGV A;  2ZN9 A;  1QV1 A;  3RM1 A;  1A2X A;  3BXK A;  3CYZ A;  5CSF A;  1J55 A;  1S5G Z;  2K61 A;  3GOF A;  1YRT B;  2LP2 A;  1TCO B;  3KF9 A;  2JC2 A;  3I5I B;  3I5G B;  3SS4 A;  3S0F A;  1YVL A;  2LAN A;  2KQY A;  3TDU A;  2I18 A;  2JTZ A;  3L47 A;  1NSH A;  2KBM A;  1QAS A;  1OOJ A;  3CTN A;  2ZRT A;  1BT6 A;  3VRP A;  2O5G A;  2PRU A;  3BJH A;  1CTR A;  3EK7 A;  3VRQ A;  4DRW A;  2BE6 A;  1ODB A;  3MSE B;  3A8R A;  2M49 B;  1Y1U A;  4GFT A;  4MN0 A;  2KQ6 A;  2KAY A;  1D1O A;  1NCY A;  1A75 A;  3B88 A;  1LA0 A;  4YRU A;  1C7V A;  2JTT A;  4ZCU A;  4PE4 A;  3JVT C;  3DYE A;  1A75 B;  1QX5 B;  2K7O A;  2L98 A;  4R1E A;  4PHM A;  2F3Y A;  1DJW A;  2WCK A;  5AEQ A;  2KNE A;  1JUO A;  5FI7 A;  3VGO A;  1SCM C;  2KOT A;  1BLQ A;  4INX A;  4WQ2 A;  4CFR A;  4ZCV A;  3AKB A;  1JWD A;  1RWY A;  1S36 A;  1SMG A;  1S5G Y;  1WY9 A;  3V2L A;  1XFR A;  1J1D A;  2SCP A;  5CPV A;  1SKT A;  1IIO A;  2F2P A;  1S6I A;  1YTZ C;  2PAL A;  4GGF C;  5KSZ A;  1F8H A;  2EHB A;  1BF5 A;  1KFU L;  1KK8 C;  1SCM B;  5I2Q A;  3KHE A;  4MRX A;  1IH0 A;  3UO9 A;  1K96 A;  1RFJ A;  2KDH A;  2Y5I A;  4JPZ B;  3AKA A;  5I94 A;  1CFF A;  1B7T Z;  4DUQ A;  2K0J A;  2OTG B;  1QVI Z;  2LVI A;  3BQ3 A;  3CZT X;  3LL8 B;  5GQQ C;  4A4B A;  1L2O C;  1XFU O;  2WOR A;  2OPO A;  1BOC A;  1CM1 A;  2AMI A;  1J7P A;  1N0Y A;  1CM4 A;  1SL9 A;  3CAB A;  4MRY A;  4OCI A;  1U5I A;  2BAP A;  2JQ6 A;  4N5X A;  1YUR A;  3FWB A;  3I5F B;  1U5I B;  4E68 A;  1DJG A;  2BEC A;  3S0B A;  1KFX S;  2LP3 A;  4HRG A;  3DVM A;  1L2O B;  3NSK A;  4DCK A;  1UUR A;  3CGA A;  1XFZ O;  2M29 A;  2LUX A;  1BJF A;  2LMU A;  4I5K A;  4PHN A;  2L4I A;  1SCV A;  3TDZ A;  3QME A;  1KWO C;  1F4Q A;  4FQO A;  4GAO A;  1QX7 A;  3TZ1 A;  2BL0 C;  4AQJ A;  5D7F A;  4DIR A;  2M97 A;  3SJS A;  4HRE E;  1YVH A;  1DJH A;  1TTX A;  2VRG A;  1B7T Y;  2KI4 C;  3D76 A;  1QVI Y;  1JFK A;  4OKH A;  1DQE A;  1UHJ A;  2LUC A;  1LKJ A;  2L5X B;  1CMF A;  4PE0 A;  2COL B;  4KYN A;  1BU3 A;  3D75 A;  4F7F A;  1NYA A;  2GGZ A;  3BUM B;  3DF0 A;  3FIA A;  2JNF A;  2AAO A;  4I5N B;  2WCF A;  2KI4 B;  1KQV A;  1EJ3 A;  1NX2 A;  1J1E A;  2F3Z A;  3DF0 B;  2HET A;  3PM2 A;  3NSL A;  3L4L A;  4NDB A;  1G33 A;  5HLO A;  3GK1 A;  3D73 A;  3B6X A;  2PSR A;  5ER4 X;  1XFW O;  5JJG A;  2LV7 A;  3SS5 A;  2ZKM X;  3SS3 A;  1RTP 1;  1KCY A;  2KGB C;  2RGI A;  3L4A A;  4JWQ A;  4CFQ A;  2IS9 A;  2O60 A;  2QEV A;  1L7Z A;  4JD9 A;  4MZL A;  2H61 A;  1XO5 A;  1CLM A;  1TWO A;  1OW4 A;  1OOG A;  2TN4 A;  1OOF A;  1J7O A;  1CDP A;  1X02 A;  4C0J A;  2AUC A;  2D8N A;  3OBV A;  3VRR A;  1TNP A;  1OOI X;  3N7H A;  1Y1A A;  1H4B A;  1G8I A;  3NHI A;  4OV2 A;  2MA2 A;  1EXR A;  1ALW A;  2WCE A;  1QWV A;  2H8V A;  2JPT A;  1BMO A;  4GNK B;  4CLN A;  3CLN A;  3VB1 A;  4NQG A;  2FCE A;  3F45 A;  2CXJ A;  2EC6 B;  3KEV A;  4U8D A;  3TUY B;  1W7I B;  1YUS A;  4L9M A;  2M0R A;  1E8A A;  3OP0 A;  4WRI A;  5CSN A;  1YUT A;  3S0G A;  2K8M B;  1DC1 A;  3EVU A;  2YGU A;  5HKW A;  2HF5 A;  1QIV A;  2HQ8 A;  1OE9 B;  1W9Z A;  1K2H A;  2KFG A;  2JU0 A;  1S3P A;  3S0E A;  1AHR A;  1M31 A;  3JTD C;  2KYF A;  3BYA A;  4OR9 B;  4USL A;  1A29 A;  3NSO A;  5CSJ A;  5AER A;  1XFV O;  3D78 A;  1SRA A;  1OMR A;  2LNK A;  1WRK A;  1PAL A;  3B7A A;  1RRO A;  2DOQ A;  2FOT A;  4PAL A;  1GQM A;  3R1O A;  2KFF A;  3JTD B;  3O4Y A;  3SG6 A;  5HYD A;  2KYC A;  2LVV A;  2M9G A;  2HPS A;  2JXL A;  2KHN A;  1GGW A;  1OQP A;  2QEB A;  2KGR A;  2OS8 C;  4AQI A;  5HL1 A;  1KQM C;  1NIW A;  3BUX B;  2Y1N A;  1CLB A;  2G2B A;  1FPW A;  2Q91 A;  2JPO A;  2CT9 A;  1RJV A;  2Q4U A;  2L5Y A;  2P71 A;  1DTL A;  1SR6 C;  1TN4 A;  1TUJ A;  4JQ0 D;  1F4O A;  1G4Y R;  1S6J A;  1IWQ A;  1PVA A;  1YX8 A;  1MHO A;  1YUU A;  1S6C A;  1FF1 A;  2OS8 B;  2ISD A;  2CNP A;  1SW8 A;  5I8N A;  2G9B A;  2K2A A;  1IRJ A;  1SPY A;  1NUB A;  1SL7 A; 
#chains in the Genus database with same CATH homology
 3A4U B;  2KI6 C;  2L0P A;  3K21 A;  1R6P A;  4F0Z B;  1IG5 A;  5PAL A;  3JVT B;  3DVK A;  3HCM A;  1OZS A;  2LCP A;  2LM5 A;  4M2P A;  2PAS A;  2M3W A;  1M39 A;  1DT7 B;  1IQ3 A;  4ORA B;  3PAT A;  4PCW A;  3QRX A;  1ZUZ A;  1TCF A;  1QX2 A;  1ZMZ A;  3DD4 A;  2PVB A;  4MLW A;  1PUL A;  1UHN A;  4GGF A;  4WQ3 A;  2NCP A;  1F71 A;  1EL4 A;  1K95 A;  1M63 B;  2A4J A;  4HRH A;  1CFC A;  2JWW A;  2LLU A;  1KK8 B;  3OB2 B;  2I94 A;  2WC8 A;  3TS5 C;  3ZWH A;  4MBE A;  5DKN A;  1Y6W A;  3PN7 C;  2K7B A;  4M2Q A;  3NSI A;  4BY4 A;  1DJY A;  4DS7 A;  1MXE A;  4TNC A;  3C1V A;  2BBM A;  5BPJ A;  4HSZ A;  1UWO A;  1B47 A;  3PFV A;  5AXI A;  4ORC B;  1AJ4 A;  1JF0 A;  3O78 A;  1NCZ A;  1XYD A;  1NX1 A;  1PK0 D;  3WHU B;  1KSO A;  2LMV A;  1LA3 A;  1B8L A;  3M0W A;  1CNP A;  1UHH A;  2JZI A;  2LAP A;  1SNL A;  5KTY A;  5HKZ A;  2M8U A;  4MZJ A;  1MF8 B;  2ZNE A;  1NWD A;  2L2E A;  1FI5 A;  1KWO B;  1V1G A;  3EK4 A;  3NXA A;  3PAL A;  2BL0 B;  3EKH A;  1CDL A;  1YX7 A;  3DVJ A;  1ALV A;  1GJY A;  3CWG A;  4XJK A;  4CPV A;  1AJ5 A;  1YR5 A;  4XJK B;  3WNX B;  1RK9 A;  1K93 D;  5CSI A;  4AOM A;  1TNW A;  2Y4Q A;  1HT9 A;  3I5H C;  3DVE A;  1KFX L;  2CCM A;  1ZFS A;  2NCO A;  1K9K A;  2R2I A;  1CFP A;  1M46 A;  5DKR A;  1WRZ A;  1JF2 A;  2E30 A;  2KSP A;  2CBL A;  3BOW A;  3CR4 X;  5TNC A;  1C07 A;  2L4H A;  2NLN A;  2M1U A;  2KI6 D;  1EH2 A;  1GGZ A;  1JFJ A;  3BOW B;  3LCP C;  1YRU B;  1SYM A;  2MLE C;  2JUL A;  3AAJ A;  3OX6 A;  1CDM A;  2M7N A;  2ZND A;  1NX0 A;  4PDZ A;  2B1U A;  2LMT A;  1PSR A;  5JOL A;  1J7R A;  1DJX A;  3SIA A;  3GK2 A;  1A4P A;  1DF0 A;  4NDD A;  4XYN A;  2LC5 A;  1JSA A;  3VRN A;  1DF0 B;  1XK4 C;  1FW4 A;  4IL1 A;  1WLM A;  2M1K B;  4QJ5 B;  1QLK A;  3LK0 A;  2JXC A;  4GUK A;  1LIN A;  2K7C A;  3SG7 A;  1B8C A;  1BR1 B;  2HQW A;  1C7W A;  1XK4 A;  2F8P A;  1LVC D;  2K2F A;  3BUO B;  3SIB A;  2MBX A;  1HQV A;  1DGU A;  3IQQ A;  1B8R A;  3D0Y A;  3IQO A;  5K89 A;  1CDN A;  2JT8 A;  2LVK A;  3EKJ A;  1IKU A;  1SK6 D;  4C0K A;  2F2O A;  2MAZ A;  3D0Y B;  2I7A A;  1IQ5 A;  3ICB A;  2LHL A;  4YI9 A;  2KAV A;  1CFD A;  2JOJ A;  1F70 A;  1B4C A;  1SBJ A;  2BKH B;  3I5I C;  1WLZ A;  1K94 A;  2BE4 A;  2EGD A;  3I5G C;  4PHK A;  2LHI A;  1DVI A;  2KBI A;  3SG3 A;  1NX3 A;  1QXP A;  1W7J B;  1QS7 A;  3OB1 B;  1KFU S;  1H8B A;  2SAS A;  4YGD B;  1OZO A;  1K9U A;  5I2O A;  1KQM B;  1MR8 A;  1AUI B;  2H2K A;  4YBH B;  1K9P A;  3KPX A;  4N1F A;  1MWN A;  3ZNI A;  5IBW A;  1SR6 B;  4ETO A;  3AAK A;  3CR2 A;  1B9A A;  1UHI A;  4YGA A;  1QAT A;  5AAN A;  1Y0V H;  1DJZ A;  4QJ4 B;  2BCX A;  3O2P A;  4YGC B;  3WHT B;  3SG5 A;  1NP8 A;  1XVJ A;  1TOP A;  4YGE B;  1WDC C;  2L50 A;  4D1E A;  2M7L A;  1J7Q A;  1AVS A;  2MLF C;  4MZK A;  1EG3 A;  1WRL A;  2LE9 B;  1KK7 Z;  1QV0 A;  1S1E A;  3BUN B;  4PE7 A;  1CB1 A;  1TNX A;  1SY9 A;  1Q80 A;  4A4C A;  3LLE A;  5ER5 A;  1PRW A;  1R2U A;  1WDC B;  2BCA A;  4M2O A;  2OTG C;  5I2L A;  1Y1X A;  1OMV A;  2PMY A;  2ZFD A;  2KFH A;  4P5O E;  2JRF A;  1REC A;  2Y1M A;  2ZRS A;  3SG4 A;  3I5F C;  3TS5 B;  1JC2 A;  2P6B B;  1IJ5 A;  4Q04 A;  1MUX A;  3E3R A;  3PLF B;  3PN7 B;  4CID A;  4UPG A;  2MHH A;  1A03 A;  1CLL A;  1XFY O;  2FCD A;  1IJ6 A;  1M45 A;  2NZ0 A;  1KK7 Y;  3OX5 A;  2BKI B;  4C0L A;  1CMG A;  3CS1 A;  1AP4 A;  2MRD A;  3IF7 A;  1TNQ A;  3EK8 A;  5HLV A;  2WND A;  5FYX A;  1EG4 A;  1KSM A;  1TIZ A;  3OHM B;  4QJ3 B;  1AK8 A;  1S26 D;  1QIW A;  1F54 A;  4P2Y B;  5F6T A;  3BUW B;  1UP5 A;  1PSB A;  3LK1 A;  5AFP A;  1PVB A;  2GGM A;  1DGV A;  2CTN A;  1NPQ A;  1UUS A;  1F55 A;  1DJI A;  1XFX O;  1DMO A;  1UHK A;  4YGB B;  1IGV A;  2FJU B;  4FTG A;  1NCX A;  1JBA A;  3O6B A;  3D10 A;  3FWC A;  3TDI A;  1BG1 A;  2JT0 A;  4ICB A;  2KAX A;  3CR5 X;  1QJT A;  2WCB A;  3SG2 A;  3I5H B;  3EVR A;  4BY5 A;  2L51 A;  5KU1 A;  3FS7 A;  2F33 A;  2JT3 A;  2MJW B;  4MEW A;  2LLS A;  1MXL C;  2H61 C;  3PSR A;  4ORB B;  2BCB A;  1V1F A;  2I2R E;  1N65 A;  4I5L B;  3RLZ A;  1MQ1 A;  1N2D A;  4GGN A;  1VRK A;  3GK4 X;  2QPT A;  3H4S E;  2LLT A;  5G08 A;  1OMD A;  1K90 D;  1TRF A;  1BR4 B;  2JNX A;  1FBV A;  2E6W A;  5J3X A;  5B8I B;  1ZAC A;  1BOD A;  1OSA A;  3EVV A;  2EC6 C;  4MSP A;  3TUY C;  1FI6 A;  4GPL B;  2ZN8 A;  1SL8 A;  3VRO A;  4GBA A;  1XA5 A;  2WOS A;  1B1G A;  2NXQ A;  3PM8 A;  4PE1 A;  4PHJ A;  1ZOT B;  2K7D A;  1QLS A;  3HX4 A;  3KO0 A;  4YI8 A;  3WXA A;  5HKY A;  2LVJ A;  1CKK A;  2QAC A;  2GV5 A;  4OVN F;  2BBN A;  4MVF A;  5D69 A;  1K8U A;  2V53 A;  4N1G A;  1LXF C;  4NDC A;  4I5J A;  5DKQ A;  1QTX A;  2ZN9 A;  1QV1 A;  3RM1 A;  1A2X A;  3BXK A;  5CSF A;  1J55 A;  1S5G Z;  2K61 A;  3GOF A;  1YRT B;  2LP2 A;  1TCO B;  3KF9 A;  2JC2 A;  3I5I B;  3I5G B;  1YVL A;  2LAN A;  2KQY A;  3TDU A;  2I18 A;  2JTZ A;  1NSH A;  2KBM A;  1QAS A;  1OOJ A;  3CTN A;  2ZRT A;  1BT6 A;  3VRP A;  2O5G A;  2PRU A;  3EK7 A;  1CTR A;  3VRQ A;  4DRW A;  2BE6 A;  1ODB A;  3MSE B;  3A8R A;  2M49 B;  1Y1U A;  4GFT A;  4MN0 A;  2KQ6 A;  2KAY A;  1D1O A;  1NCY A;  1A75 A;  1C7V A;  1LA0 A;  4YRU A;  2JTT A;  4ZCU A;  4PE4 A;  3JVT C;  1A75 B;  1QX5 B;  2K7O A;  2L98 A;  4R1E A;  4PHM A;  2F3Y A;  1DJW A;  5AEQ A;  2KNE A;  1JUO A;  1BLQ A;  3VGO A;  1SCM C;  2KOT A;  4WQ2 A;  4CFR A;  4ZCV A;  3AKB A;  1JWD A;  1RWY A;  1S36 A;  1SMG A;  1S5G Y;  1WY9 A;  1J1D A;  2SCP A;  5CPV A;  1SKT A;  2F2P A;  1S6I A;  1YTZ C;  2PAL A;  4GGF C;  5KSZ A;  1F8H A;  2EHB A;  1BF5 A;  1KFU L;  1KK8 C;  1SCM B;  5I2Q A;  3KHE A;  4MRX A;  1IH0 A;  1K96 A;  1RFJ A;  2KDH A;  2Y5I A;  4JPZ B;  3AKA A;  1CFF A;  1B7T Z;  4DUQ A;  2K0J A;  2OTG B;  1QVI Z;  2LVI A;  3BQ3 A;  3CZT X;  3LL8 B;  5GQQ C;  4A4B A;  1L2O C;  1XFU O;  2WOR A;  2OPO A;  1BOC A;  1CM1 A;  2AMI A;  1J7P A;  1N0Y A;  1CM4 A;  1SL9 A;  4MRY A;  4OCI A;  1U5I A;  2JQ6 A;  4N5X A;  1YUR A;  3FWB A;  3I5F B;  1U5I B;  4E68 A;  1DJG A;  2BEC A;  1KFX S;  2LP3 A;  4HRG A;  3DVM A;  1L2O B;  3NSK A;  4DCK A;  1UUR A;  3CGA A;  1XFZ O;  2M29 A;  2LUX A;  1BJF A;  2LMU A;  4I5K A;  4PHN A;  2L4I A;  1SCV A;  3TDZ A;  1KWO C;  1F4Q A;  4FQO A;  4GAO A;  1QX7 A;  3TZ1 A;  2BL0 C;  4AQJ A;  5D7F A;  4DIR A;  2M97 A;  3SJS A;  4HRE E;  1YVH A;  1DJH A;  1TTX A;  2VRG A;  1B7T Y;  2KI4 C;  1QVI Y;  1JFK A;  4OKH A;  1UHJ A;  2LUC A;  1LKJ A;  2L5X B;  1CMF A;  4PE0 A;  2COL B;  1BU3 A;  1NYA A;  2GGZ A;  3BUM B;  3DF0 A;  3FIA A;  2JNF A;  2AAO A;  4I5N B;  2WCF A;  2KI4 B;  1KQV A;  1EJ3 A;  1NX2 A;  1J1E A;  2F3Z A;  3DF0 B;  2HET A;  5HLO A;  3NSL A;  4NDB A;  1G33 A;  3GK1 A;  5ER4 X;  2PSR A;  1XFW O;  5JJG A;  2LV7 A;  2ZKM X;  1RTP 1;  1KCY A;  2KGB C;  2RGI A;  4JWQ A;  4CFQ A;  2IS9 A;  2O60 A;  4MZL A;  1L7Z A;  2H61 A;  1XO5 A;  1CLM A;  2TN4 A;  1J7O A;  1CDP A;  1X02 A;  4C0J A;  2AUC A;  2D8N A;  3VRR A;  1TNP A;  1Y1A A;  1H4B A;  1G8I A;  4OV2 A;  2MA2 A;  1EXR A;  1ALW A;  2WCE A;  2JPT A;  1BMO A;  4GNK B;  4CLN A;  3CLN A;  4NQG A;  2FCE A;  3F45 A;  2CXJ A;  2EC6 B;  3KEV A;  4U8D A;  3TUY B;  1W7I B;  1YUS A;  4L9M A;  2M0R A;  1E8A A;  3OP0 A;  4WRI A;  5CSN A;  1YUT A;  2K8M B;  3EVU A;  5HKW A;  2HF5 A;  1QIV A;  2HQ8 A;  1OE9 B;  1K2H A;  2KFG A;  2JU0 A;  1S3P A;  1AHR A;  1M31 A;  3JTD C;  2KYF A;  3BYA A;  4OR9 B;  4USL A;  1A29 A;  3NSO A;  5CSJ A;  5AER A;  1XFV O;  1SRA A;  1OMR A;  2LNK A;  1WRK A;  1PAL A;  1RRO A;  2DOQ A;  2FOT A;  4PAL A;  1GQM A;  2KFF A;  3JTD B;  3O4Y A;  3SG6 A;  5HYD A;  2KYC A;  2LVV A;  2M9G A;  2HPS A;  2JXL A;  2KHN A;  1GGW A;  1OQP A;  2KGR A;  2OS8 C;  4AQI A;  1KQM C;  1NIW A;  3BUX B;  2Y1N A;  1CLB A;  2G2B A;  1FPW A;  2Q91 A;  2CT9 A;  1RJV A;  2Q4U A;  1DTL A;  1SR6 C;  1TN4 A;  4JQ0 D;  1F4O A;  1G4Y R;  1S6J A;  1IWQ A;  1PVA A;  1YX8 A;  1MHO A;  1YUU A;  1S6C A;  1FF1 A;  2OS8 B;  2ISD A;  2CNP A;  1SW8 A;  5I8N A;  2G9B A;  2K2A A;  1IRJ A;  1SPY A;  1NUB A;  1SL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...