1SCMC

Structure of the regulatory domain of scallop myosin at 2.8 angstroms resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
149
structure length
149
Chain Sequence
SQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords MYOSIN HEAVY CHAIN
publication title Structure of the regulatory domain of scallop myosin at 2.8 A resolution.
pubmed doi rcsb
source organism Argopecten irradians
total genus 37
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 1994-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1scmC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1scmC02
2KGBC 4GBAA 4WQ2A 3KHEA 1SBJA 2BBNA 2LVIA 3TDZA 4NQGA 2NLNA 1F55A 1UHHA 1Y0VH 2NCOA 4OR9B 3ZWHA 2KSPA 1MHOA 1DJWA 1L7ZA 1K94A 4JQ0D 1UUSA 3NSOA 4AQJA 1AK8A 2ZRSA 1BR4B 4IL1A 4MN0A 1H8BA 4ETOA 4CFQA 1UHNA 5I8NA 1WRLA 1ZMZA 4PDZA 3FS7A 2A4JA 1BJFA 1PRWA 1PVAA 3TDIA 2KAYA 4XYNA 1KQMC 1J1DA 4A4BA 1M45A 1BU3A 1JBAA 1CDPA 2LP2A 4CFRA 4M2QA 1SR6C 4N1GA 4D1EA 3BUOB 2K7DA 2JU0A 2OS8B 1OOJA 2AAOA 1TNXA 4ORBB 1D1OA 3AKAA 3EVVA 1NPQA 1TNPA 2I7AA 1RK9A 4DS7A 4AOMA 2M1KB 4GPLB 3MSEB 1K93D 3SG7A 2CXJA 1G33A 1TNQA 1DVIA 1PSBA 2FCDA 2Y1MA 2LMTA 3GK1A 4M2PA 3CZTX 1PALA 1SY9A 3O78A 1CTRA 1B7TY 3EKHA 4I5KA 1N2DA 1N65A 1NWDA 1EJ3A 1YX7A 1MQ1A 1QIVA 2KOTA 2LP3A 4DCKA 1FI5A 1IQ5A 1OMRA 2G2BA 5PALA 1EXRA 2CCMA 2F3YA 3M0WA 3IF7A 4YGEB 2H2KA 2WCEA 3ICBA 2LMVA 1XFUO 1SCVA 4C0KA 1AP4A 1A75A 4YGBB 2LLUA 3VRRA 1QLKA 3I5FB 3ZNIA 3EVUA 1G8IA 1IKUA 1AHRA 2LC5A 1KFXL 4JPZB 4MSPA 1KQVA 1NIWA 2KNEA 2JT8A 3K21A 1J55A 3AAJA 1TNWA 2ZNEA 1XA5A 2PALA 1S3PA 1XK4A 2M9GA 1YUSA 1XO5A 2M8UA 1SMGA 1EH2A 3DVKA 4I5LB 3VRPA 1TOPA 3E3RA 1K2HA 1NYAA 2HQWA 4PALA 2LV7A 1M39A 5D7FA 1B7TZ 3CS1A 2LVJA 1FI6A 2AMIA 2BE4A 1Y1XA 2M3WA 1G4YR 1OMDA 4M2OA 3WHTB 2F2PA 2KBIA 4MZLA 3PSRA 4L9MA 3RLZA 4OV2A 2JPTA 1SR6B 1NUBA 3PLFB 5CSJA 2FOTA 2JZIA 2L4IA 2F2OA 3DVMA 3DD4A 3VRNA 4TNCA 4NDDA 1B9AA 2K2AA 2LVVA 5I2LA 1F54A 3VGOA 1AJ4A 2KQYA 5HKZA 3KEVA 4CPVA 1F4QA 2KBMA 5D69A 2ZN8A 1OQPA 2CBLA 4ORAB 3SG6A 1RROA 4QJ4B 1JSAA 5GQQC 2KFHA 2B1UA 1SYMA 2KI4B 2D8NA 4BY4A 5AEQA 1A75B 1AJ5A 3SJSA 2LMUA 3BUNB 4GNKB 1CM4A 1N0YA 1CLBA 4MZJA 3NSIA 1K96A 4Q04A 1KSMA 2M49B 5B8IB 4N1FA 1OE9B 1IRJA 1CDMA 1JF2A 1S6IA 1YVHA 2K0JA 3BOWB 3TDUA 5AERA 2L4HA 4DIRA 3RM1A 3BQ3A 4F0ZB 2L5XB 1OZSA 1XFVO 1F70A 2LNKA 5I2OA 1S5GZ 2I18A 4PHNA 2Q91A 2HF5A 1IWQA 3I5FC 5HLOA 1IQ3A 1YR5A 5HLVA 3C1VA 1KWOC 1OZOA 1C7WA 3EK7A 1NSHA 3NSKA 4C0LA 1SKTA 1AUIB 4P5OE 2P6BB 1TTXA 2WOSA 1KFUS 1NX3A 1S6CA 1CMGA 3GK4X 1WLMA 4CLNA 1OSAA 2LE9B 1K9UA 3PN7B 3BUXB 1CB1A 2AUCA 3AAKA 1JUOA 1JFKA 1B8RA 1ZFSA 3O2PA 2K61A 1DMOA 5IBWA 5BPJA 1BT6A 1YUTA 3DVEA 3TS5C 1WLZA 4A4CA 1C07A 1IJ6A 2QPTA 1RJVA 1HT9A 4PHKA 4CIDA 3PATA 2L51A 2ZNDA 3VROA 3DVJA 3HCMA 1RECA 2MBXA 1S26D 2ZN9A 1WY9A 1IG5A 1TCFA 2WC8A 4ZCUA 1BLQA 2KAVA 4PHJA 5CPVA 1XVJA 1TRFA 2E6WA 3OX5A 3BUMB 4WRIA 1UP5A 1XFYO 4MRYA 4ORCB 1SL9A 2BL0B 3NXAA 2KI4C 2HETA 2V53A 1V1FA 1A29A 1CMFA 2MRDA 2WNDA 3FWCA 2LM5A 1VRKA 4N5XA 4PE0A 1W7IB 1PVBA 1OMVA 1SRAA 3OP0A 4YGAA 1LINA 1S36A 2LVKA 2LLSA 1J7QA 1XK4C 2KHNA 5F6TA 2MHHA 1KWOB 1NX2A 3JTDB 2L2EA 1JWDA 1ALVA 1J7RA 1KK8B 2L50A 1XFZO 1QV1A 1Q80A 2H61A 3SG3A 1Y6WA 3CR2A 2MA2A 4YGDB 1SNLA 2FCEA 5CSIA 4AQIA 4GGFA 1W7JB 2O60A 4FQOA 1K9PA 1NP8A 2CT9A 2WORA 3SIBA 1CLLA 1BOCA 2JNXA 5HKYA 1M46A 1QTXA 2LLTA 4P2YB 3CGAA 2LHLA 1B47A 1J7OA 3OHMB 1JFJA 1FW4A 2HPSA 3TS5B 1E8AA 2KFFA 3AKBA 5HKWA 4QJ5B 2Q4UA 3PN7C 1L2OB 3HX4A 5KTYA 4BY5A 4I5JA 2GV5A 1LA3A 1A2XA 4HRHA 1CDNA 2WCBA 4PHMA 1B4CA 3LLEA 2EHBA 1UURA 2BCBA 3D10A 1S5GY 4OVNF 2I94A 3LK0A 2LUXA 1QX2A 1KSOA 3EKJA 2O5GA 1Y1UA 1CNPA 3TZ1A 1YTZC 1S1EA 2COLB 4MEWA 1YVLA 1UHIA 2KYFA 5ER5A 1IH0A 1F4OA 4ZCVA 4GAOA 1PULA 1KFUL 3PFVA 2ISDA 2TN4A 4QJ3B 1GGZA 3I5HB 5CSNA 3DF0A 2BECA 1BR1B 1J1EA 1FF1A 2KI6C 2NXQA 2SCPA 4E68A 3I5IC 1KCYA 1TCOB 3EK4A 1FPWA 4GUKA 1ZOTB 2LANA 5KU1A 2F8PA 1GJYA 2BL0C 1QASA 2HQ8A 2K7OA 2K8MB 3KPXA 1KFXS 1K8UA 1FBVA 4HRGA 1DF0A 1DTLA 2PMYA 1DJYA 4OCIA 4NDBA 4DRWA 4JWQA 1ALWA 2EC6B 3KO0A 1QLSA 3OB2B 4MBEA 2MLFC 1CM1A 1QATA 1QX5B 4YBHB 2JXCA 4FTGA 2PRUA 1K95A 2Y4QA 1DGVA 2KGRA 3WHUB 1QIWA 2M1UA 1XFXO 2KAXA 2PVBA 3CR5X 3JTDC 1QS7A 4YI9A 1KK8C 5AANA 1F8HA 2JULA 2KI6D 1IJ5A 2FJUB 3QRXA 2JRFA 4YGCB 3JVTB 5AFPA 4WQ3A 2JTZA 1S6JA 1CKKA 1NCXA 2E30A 2M7LA 1XFWO 1YX8A 1QVIY 1SCMB 1Y1AA 3O6BA 1ODBA 1BG1A 2M0RA 3D0YA 3LCPC 1B1GA 1A03A 4NDCA 1CFDA 1TIZA 3NSLA 2JT3A 1L2OC 3SG2A 2CNPA 4MVFA 2MJWB 3SIAA 1WRKA 2L98A 3DF0B 1QX7A 1DJHA 4I5NB 1CFPA 1DT7B 4C0JA 3GK2A 3H4SE 3OB1B 4GFTA 2DOQA 3I5GC 1PSRA 1DF0B 2OTGC 2QACA 1UHJA 2VRGA 2OPOA 2CTNA 3CTNA 5KSZA 3A4UB 1R6PA 3BXKA 3I5IB 2LUCA 5G08A 2SASA 2GGMA 1BODA 1SL7A 3TUYB 1X02A 2BKHB 1NX1A 1QVIZ 2LCPA 3I5HC 1WDCB 1XYDA 2K7BA 4PE4A 2KYCA 1KK7Y 1YURA 1WRZA 1DJGA 4DUQA 1MUXA 3EVRA 1MXLC 1HQVA 1F71A 2JNFA 1B8CA 4ICBA 3BYAA 2R2IA 2H61C 2RGIA 1SPYA 2BBMA 2EC6C 2K7CA 2I2RE 2ZFDA 4GGFC 4HSZA 5AXIA 1M63B 1DJZA 2M29A 2NZ0A 1V1GA 1UWOA 2JTTA 1EG3A 3VRQA 2Y1NA 3F45A 1GGWA 4USLA 2MAZA 1IGVA 2BE6A 2BKIB 2LAPA 3LK1A 4U8DA 3PM8A 5DKQA 5JOLA 1NCZA 5K89A 3D0YB 1B8LA 1LXFC 3JVTC 5JJGA 2Y5IA 1AVSA 4XJKA 2L0PA 3SG5A 2MLEC 1SL8A 1MXEA 1ZUZA 3IQQA 1KK7Z 2F33A 3PALA 1YRUB 2JWWA 1TN4A 2EGDA 2JOJA 3BOWA 1SCMC 3WNXB 2LHIA 4HREE 2JXLA 4YRUA 3KF9A 3IQOA 1U5IA 2NCPA 3I5GB 2GGZA 1BMOA 1RFJA 3LL8B 4OKHA 2OTGB 3A8RA 1SW8A 1LA0A 5J3XA 3EK8A 5CSFA 3FIAA 5ER4X 5DKRA 3SG4A 2KQ6A 1CFFA 1KQMB 2ZRTA 1CFCA 2KDHA 1CDLA 1H4BA 5FYXA 1GQMA 3BUWB 4GGNA 1C7VA 2WCFA 5HYDA 2ZKMX 3CR4X 1PK0D 5DKNA 1K90D 1R2UA 1DJXA 2PSRA 1QXPA 1LVCD 1RTP1 1CLMA 1NCYA 1RWYA 2IS9A 5TNCA 2BCAA 3TUYC 1QV0A 1JC2A 1EG4A 1WDCC 1SK6D 3GOFA 4PE1A 3WXAA 1EL4A 2KFGA 2OS8C 4R1EA 3O4YA 2JC2A 1UHKA 1ZACA 5I2QA 1DJIA 1BF5A 3FWBA 1LKJA 4XJKB 1A4PA 4PE7A 1JF0A 1MR8A 4YI8A 2PASA 2JQ6A 4MZKA 1NX0A 2M97A 2K2FA 1DGUA 4MLWA 1MWNA 4MRXA 3OX6A 4PCWA 4UPGA 2G9BA 1YRTB 1J7PA 3CWGA 1M31A 1MF8B 1QJTA 1U5IB 1K9KA 1YUUA 2F3ZA 2M7NA 3CLNA 2BCXA 2JT0A
chains in the Genus database with same CATH superfamily
2KGBC 4GBAA 4WQ2A 3KHEA 1SBJA 2BBNA 2LVIA 3TDZA 4NQGA 1DELA 2NLNA 1F55A 1UHHA 1Y0VH 2NCOA 4OR9B 3ZWHA 3B88A 2KSPA 1MHOA 1DJWA 1L7ZA 1K94A 4JQ0D 1UUSA 3NSOA 2BNXA 4AQJA 1AK8A 2ZRSA 1BR4B 4IL1A 4MN0A 1H8BA 4ETOA 4CFQA 5FI7A 1UHNA 5I8NA 1WRLA 1ZMZA 3S0FA 4PDZA 1LS8A 2JPOA 3FS7A 2A4JA 1BJFA 1PRWA 1PVAA 3TDIA 2KAYA 4XYNA 1KQMC 1J1DA 4A4BA 1M45A 1BU3A 1JBAA 1CDPA 2LP2A 4CFRA 4M2QA 1SR6C 4N1GA 3DY9A 4D1EA 3BUOB 2K7DA 2JU0A 2OS8B 3PJIA 1OOJA 2AAOA 1TNXA 2BAPA 4ORBB 1D1OA 3AKAA 3EVVA 1NPQA 1TNPA 2I7AA 1RK9A 4DS7A 4AOMA 2M1KB 4GPLB 3MSEB 1K93D 5I94A 3SG7A 2CXJA 1G33A 1TNQA 1DVIA 1PSBA 2FCDA 2Y1MA 2LMTA 3GK1A 4M2PA 3CZTX 1PALA 1SY9A 4KYNA 3O78A 1CTRA 1B7TY 3EKHA 4I5KA 4IJ7A 1N2DA 1N65A 1NWDA 1EJ3A 1YX7A 1MQ1A 1QIVA 2KOTA 2LP3A 3OBVA 4DCKA 1IQ5A 1OMRA 2G2BA 1GM0A 5PALA 1EXRA 2CCMA 2F3YA 3M0WA 1FI5A 3IF7A 4YGEB 2H2KA 2WCEA 3ICBA 2LMVA 1XFUO 1SCVA 4C0KA 1AP4A 1A75A 4YGBB 2LLUA 3VRRA 1QLKA 3I5FB 3ZNIA 3EVUA 3BFBA 1G8IA 1IKUA 1AHRA 2LC5A 1KFXL 4JPZB 3SS4A 4MSPA 1KQVA 3DZTA 1NIWA 2KNEA 3D73A 3S0DA 2JT8A 3K21A 1J55A 3AAJA 1TNWA 3S0EA 2ZNEA 1XA5A 2PALA 3S0AA 1S3PA 1XK4A 2M9GA 1YUSA 3PM2A 1XO5A 2M8UA 1SMGA 1EH2A 3DVKA 4I5LB 3VRPA 1TOPA 3E3RA 1K2HA 1NYAA 2HQWA 4PALA 2LV7A 1M39A 3L4LA 5D7FA 1B7TZ 3CS1A 2LVJA 3FE8A 1FI6A 2AMIA 2BE4A 3L4AA 1Y1XA 2M3WA 1G4YR 1OMDA 4M2OA 3WHTB 2H8VA 2F2PA 2KBIA 3NGVA 2WCJA 4MZLA 3PSRA 4L9MA 3RLZA 4OV2A 2JPTA 1SR6B 1NUBA 3PLFB 5CSJA 2FOTA 2JZIA 2K60A 2L4IA 2F2OA 3DVMA 3DD4A 2QEOA 3VRNA 4TNCA 4NDDA 1B9AA 2K2AA 2LVVA 5I2LA 3L47A 3VGOA 1F54A 1SSEB 1AJ4A 2KQYA 2WC5A 3KEVA 5HKZA 4CPVA 1F4QA 2KBMA 5D69A 2ZN8A 1OQPA 2CBLA 4F7FA 3B7AA 4ORAB 3SG6A 1RROA 4QJ4B 1JSAA 5GQQC 2KFHA 2B1UA 1SYMA 2KI4B 2D8NA 4BY4A 5AEQA 1A75B 1AJ5A 3SJSA 2LMUA 3BUNB 4GNKB 1CM4A 2WCLA 1N0YA 1CLBA 4MZJA 3NSIA 1K96A 4Q04A 1KSMA 2M49B 4JD9A 4N1FA 5B8IB 3N7HA 1OE9B 1IRJA 1CDMA 1JF2A 1S6IA 1YVHA 2K0JA 3BOWB 3TDUA 5AERA 2L4HA 3CYZA 3O4XA 3RM1A 4DIRA 3BQ3A 4F0ZB 2L5XB 1OZSA 1XFVO 1F70A 2LNKA 5I2OA 1S5GZ 2I18A 4PHNA 2Q91A 2HF5A 1IWQA 3I5FC 5HLOA 3BFAA 1IQ3A 1YR5A 5HLVA 3C1VA 3R1OA 1KWOC 1OZOA 1C7WA 3EK7A 1NSHA 3NSKA 1QWVA 4C0LA 1SKTA 3VB1A 1AUIB 4P5OE 2P6BB 1TTXA 2WOSA 1KFUS 1NX3A 1S6CA 1CMGA 3BJHA 3GK4X 1WLMA 5D3OA 1OSAA 4CLNA 2LE9B 1K9UA 3PN7B 3BUXB 1CB1A 2AUCA 3AAKA 1JUOA 1JFKA 1B8RA 1ZFSA 3O2PA 2K61A 1DMOA 5IBWA 5BPJA 1BT6A 1YUTA 3DVEA 3TS5C 1WLZA 4A4CA 1C07A 1IJ6A 2QPTA 1RJVA 1HT9A 4PHKA 4CIDA 3PATA 2L51A 2ZNDA 3VROA 3DVJA 3HCMA 1RECA 2MBXA 1S26D 2ZN9A 1WY9A 3DXLA 1IG5A 1TCFA 2WC8A 4ZCUA 1BLQA 2KAVA 3SS3A 4INWA 4PHJA 5CPVA 1OOIX 1XVJA 1TRFA 2E6WA 3OX5A 3EG5B 3BUMB 4WRIA 1UP5A 1XFYO 4MRYA 4ORCB 1SL9A 3B87A 3CZ0A 2BL0B 3NXAA 2KI4C 2WCMA 2HETA 2QEBA 2V53A 1V1FA 1A29A 1CMFA 2MRDA 2WNDA 3DYEA 2WCKA 3FWCA 2LM5A 1VRKA 4N5XA 4PE0A 1W7IB 1PVBA 3FE9A 1OMVA 1SRAA 3OP0A 4YGAA 1LINA 1S36A 2LVKA 3NHTA 3D78A 2LLSA 1J7QA 1XK4C 2FJYA 2KHNA 2MHHA 1KWOB 1NX2A 5F6TA 3JTDB 2L2EA 1JWDA 1ALVA 1J7RA 1KK8B 2L50A 1XFZO 1QV1A 1Q80A 2QDIA 2H61A 3SG3A 1Y6WA 3CR2A 2MA2A 4YGDB 1SNLA 2FCEA 5CSIA 4AQIA 4GGFA 1W7JB 2O60A 3R72A 4FQOA 1K9PA 1NP8A 2CT9A 2WORA 3SIBA 1CLLA 1BOCA 5HL1A 2JNXA 5HKYA 1M46A 1QTXA 4FQTA 2LLTA 4P2YB 3CGAA 2LHLA 1B47A 4JKTA 1J7OA 3OHMB 1JFJA 1FW4A 2HPSA 3TS5B 1E8AA 2KFFA 3NHIA 1TUZA 3AKBA 5HKWA 2KLEA 3CDNA 4QJ5B 2Q4UA 3PN7C 1L2OB 3HX4A 5KTYA 4BY5A 4I5JA 2GV5A 4INXA 1LA3A 1A2XA 3Q8IA 2PQLA 4HRHA 2WCBA 1CDNA 2P71A 4PHMA 1B4CA 3LLEA 2EHBA 1UURA 2BCBA 2WCHA 1S5GY 3D10A 4OVNF 2I94A 3LK0A 2LUXA 1QX2A 1KSOA 3EKJA 2O5GA 1Y1UA 1CNPA 3TZ1A 1YTZC 1S1EA 2COLB 4MEWA 1YVLA 1UHIA 2KYFA 1OOGA 5ER5A 1IH0A 1F4OA 4ZCVA 4GAOA 1PULA 1KFUL 3PFVA 3QMEA 2ISDA 2TN4A 4QJ3B 1GGZA 3I5HB 5CSNA 3DF0A 2BECA 1BR1B 1J1EA 1FF1A 2KI6C 2NXQA 3S0BA 2SCPA 3R1VA 4E68A 3CZ1A 3I5IC 1KCYA 1TCOB 3EK4A 1FPWA 4GUKA 1ZOTB 2LANA 5KU1A 2F8PA 1GJYA 2BL0C 1QASA 2HQ8A 2K7OA 2K8MB 3KPXA 1KFXS 1K8UA 1FBVA 4HRGA 1DF0A 1DTLA 2PMYA 1DJYA 4OCIA 4NDBA 5DICA 4DRWA 4JWQA 1ALWA 2EC6B 3KO0A 3B6XA 1QLSA 3OB2B 4MBEA 2MLFC 1CM1A 1QATA 1C3ZA 3D77A 1QX5B 4YBHB 2JXCA 4FTGA 2PRUA 1K95A 2Y4QA 1DGVA 2KGRA 3WHUB 1QIWA 2M1UA 1XFXO 2KAXA 2PVBA 3CR5X 3JTDC 1QS7A 4YI9A 1KK8C 5AANA 1F8HA 2JULA 2GTEA 2KI6D 1IJ5A 2FJUB 3V2LA 3QRXA 2JRFA 4YGCB 3JVTB 1OOHA 5AFPA 4WQ3A 2JTZA 1S6JA 1CKKA 1NCXA 2E30A 2M7LA 3SS5A 1XFWO 1YX8A 1QVIY 1SCMB 1Y1AA 3O6BA 1ODBA 2L2CA 1BG1A 2M0RA 3D0YA 3LCPC 1B1GA 1A03A 4NDCA 1CFDA 1TIZA 3NSLA 2JT3A 1L2OC 5FI6A 3SG2A 3OGNA 2CNPA 4MVFA 2MJWB 3SIAA 1WRKA 2L98A 3D74A 3DF0B 3FE6A 3CZ2A 1QX7A 2KLDA 3D76A 1DJHA 4I5NB 1CFPA 1DT7B 4C0JA 3GK2A 3H4SE 3OB1B 4GFTA 2DOQA 3I5GC 1PSRA 1DF0B 1Z4HA 2OTGC 2QACA 1UHJA 2VRGA 2OPOA 2CTNA 3CTNA 5KSZA 3A4UB 1R6PA 3BXKA 3I5IB 3S0GA 1DEKA 2LUCA 5G08A 2SASA 2GGMA 1BODA 1SL7A 3TUYB 1X02A 1QVIZ 1NX1A 2BKHB 2LCPA 3I5HC 1WDCB 1XYDA 2K7BA 4PE4A 2KYCA 1KK7Y 1YURA 1WRZA 1DJGA 1Z2CB 2QEVA 4DUQA 1MUXA 3EVRA 1MXLC 1HQVA 3CABA 1F71A 2JNFA 5EL2A 1B8CA 4ICBA 3BYAA 3B86A 2R2IA 2H61C 2RGIA 3UNWA 1SPYA 2BBMA 1T14A 2EC6C 2I2RE 2K7CA 1DC1A 4PT1A 2ZFDA 4GGFC 4HSZA 5AXIA 1M63B 1DJZA 2M29A 2NZ0A 2PYQA 2ERBA 1V1GA 1UWOA 2JTTA 1EG3A 3VRQA 2Y1NA 3F45A 1GGWA 3RZSA 4USLA 2MAZA 1IGVA 2BE6A 2BKIB 2LAPA 3LK1A 4U8DA 3PM8A 5DKQA 5JOLA 1NCZA 5K89A 3D0YB 1B8LA 1LXFC 1OW4A 3JVTC 5JJGA 2Y5IA 1AVSA 2QEHA 3IVTA 4XJKA 2L0PA 3SG5A 2MLEC 1SL8A 1MXEA 1ZUZA 3IQQA 1KK7Z 2F33A 3PALA 1YRUB 2JWWA 2L5YA 1TN4A 2EGDA 2JOJA 3BOWA 1SCMC 3WNXB 3K1EA 2LHIA 4HREE 2YGUA 2JXLA 2WC6A 4YRUA 5FI2A 3KF9A 3IQOA 1U5IA 2NCPA 2P70A 2GGZA 3I5GB 1IIOA 1BMOA 1RFJA 3LL8B 4OKHA 2OTGB 3A8RA 1SW8A 1LA0A 5J3XA 3EK8A 5CSFA 1ORGA 3FIAA 5ER4X 5DKRA 3SG4A 2KQ6A 1CFFA 1KQMB 2ZRTA 1CFCA 2KDHA 1CDLA 1H4BA 5FYXA 1GQMA 3R1PA 3BUWB 4GGNA 1C7VA 1TWOA 1W9ZA 2WCFA 5HYDA 1C3YA 2ZKMX 3CR4X 1PK0D 5DKNA 1K90D 1R2UA 1DJXA 2PSRA 3D75A 1QXPA 1LVCD 1RTP1 3UO9A 1CLMA 1NCYA 1RWYA 2IS9A 5TNCA 2BCAA 3TUYC 1QV0A 1JC2A 1EG4A 1WDCC 1SK6D 3GOFA 4OZDA 4PE1A 3WXAA 1EL4A 2KFGA 2OS8C 1DQEA 3O4YA 4R1EA 2JC2A 1UHKA 1ZACA 1XFRA 5I2QA 1DJIA 1BF5A 3FWBA 1LKJA 4XJKB 2KPHA 1P28A 1A4PA 4PE7A 1JF0A 1MR8A 1OOFA 2PASA 4YI8A 2JQ6A 4MZKA 1NX0A 2M97A 2K2FA 1DGUA 4MLWA 1MWNA 4MRXA 3OX6A 4PCWA 4UPGA 2G9BA 1YRTB 1J7PA 3BFHA 3CWGA 1M31A 1TUJA 1MF8B 1QJTA 1U5IB 1K9KA 1YUUA 2F3ZA 2M7NA 3CLNA 2BCXA 2JT0A
chains in the Genus database with same CATH topology
2KGBC 4GBAA 4WQ2A 3KHEA 1SBJA 2BBNA 2LVIA 3TDZA 4NQGA 2NLNA 1F55A 1UHHA 1Y0VH 2NCOA 4OR9B 3ZWHA 2KSPA 1MHOA 1DJWA 1L7ZA 1K94A 4JQ0D 1UUSA 3NSOA 4AQJA 1AK8A 2ZRSA 1BR4B 4IL1A 4MN0A 1H8BA 4ETOA 4CFQA 1UHNA 5I8NA 1WRLA 1ZMZA 4PDZA 3FS7A 2A4JA 1BJFA 1PRWA 1PVAA 3TDIA 2KAYA 4XYNA 1KQMC 1J1DA 4A4BA 1M45A 1BU3A 1JBAA 1CDPA 2LP2A 4CFRA 4M2QA 1SR6C 4N1GA 4D1EA 3BUOB 2K7DA 2JU0A 2OS8B 1OOJA 2AAOA 1TNXA 4ORBB 1D1OA 3AKAA 3EVVA 1NPQA 1TNPA 2I7AA 1RK9A 4DS7A 4AOMA 2M1KB 4GPLB 3MSEB 1K93D 3SG7A 2CXJA 1G33A 1TNQA 1DVIA 1PSBA 2FCDA 2Y1MA 2LMTA 3GK1A 4M2PA 3CZTX 1PALA 1SY9A 3O78A 1CTRA 1B7TY 3EKHA 4I5KA 1N2DA 1N65A 1NWDA 1EJ3A 1YX7A 1MQ1A 1QIVA 2KOTA 2LP3A 4DCKA 1FI5A 1IQ5A 1OMRA 2G2BA 5PALA 1EXRA 2CCMA 2F3YA 3M0WA 3IF7A 4YGEB 2H2KA 2WCEA 3ICBA 2LMVA 1XFUO 1SCVA 4C0KA 1AP4A 1A75A 4YGBB 2LLUA 3VRRA 1QLKA 3I5FB 3ZNIA 3EVUA 1G8IA 1IKUA 1AHRA 2LC5A 1KFXL 4JPZB 4MSPA 1KQVA 1NIWA 2KNEA 2JT8A 3K21A 1J55A 3AAJA 1TNWA 2ZNEA 1XA5A 2PALA 1S3PA 1XK4A 2M9GA 1YUSA 1XO5A 2M8UA 1SMGA 1EH2A 3DVKA 4I5LB 3VRPA 1TOPA 3E3RA 1K2HA 1NYAA 2HQWA 4PALA 2LV7A 1M39A 5D7FA 1B7TZ 3CS1A 2LVJA 1FI6A 2AMIA 2BE4A 1Y1XA 2M3WA 1G4YR 1OMDA 4M2OA 3WHTB 2F2PA 2KBIA 4MZLA 3PSRA 4L9MA 3RLZA 4OV2A 2JPTA 1SR6B 1NUBA 3PLFB 5CSJA 2FOTA 2JZIA 2L4IA 2F2OA 3DVMA 3DD4A 3VRNA 4TNCA 4NDDA 1B9AA 2K2AA 2LVVA 5I2LA 1F54A 3VGOA 1AJ4A 2KQYA 5HKZA 3KEVA 4CPVA 1F4QA 2KBMA 5D69A 2ZN8A 1OQPA 2CBLA 4ORAB 3SG6A 1RROA 4QJ4B 1JSAA 5GQQC 2KFHA 2B1UA 1SYMA 2KI4B 2D8NA 4BY4A 5AEQA 1A75B 1AJ5A 3SJSA 2LMUA 3BUNB 4GNKB 1CM4A 1N0YA 1CLBA 4MZJA 3NSIA 1K96A 4Q04A 1KSMA 2M49B 5B8IB 4N1FA 1OE9B 1IRJA 1CDMA 1JF2A 1S6IA 1YVHA 2K0JA 3BOWB 3TDUA 5AERA 2L4HA 4DIRA 3RM1A 3BQ3A 4F0ZB 2L5XB 1OZSA 1XFVO 1F70A 2LNKA 5I2OA 1S5GZ 2I18A 4PHNA 2Q91A 2HF5A 1IWQA 3I5FC 5HLOA 1IQ3A 1YR5A 5HLVA 3C1VA 1KWOC 1OZOA 1C7WA 3EK7A 1NSHA 3NSKA 4C0LA 1SKTA 1AUIB 4P5OE 2P6BB 1TTXA 2WOSA 1KFUS 1NX3A 1S6CA 1CMGA 3GK4X 1WLMA 4CLNA 1OSAA 2LE9B 1K9UA 3PN7B 3BUXB 1CB1A 2AUCA 3AAKA 1JUOA 1JFKA 1B8RA 1ZFSA 3O2PA 2K61A 1DMOA 5IBWA 5BPJA 1BT6A 1YUTA 3DVEA 3TS5C 1WLZA 4A4CA 1C07A 1IJ6A 2QPTA 1RJVA 1HT9A 4PHKA 4CIDA 3PATA 2L51A 2ZNDA 3VROA 3DVJA 3HCMA 1RECA 2MBXA 1S26D 2ZN9A 1WY9A 1IG5A 1TCFA 2WC8A 4ZCUA 1BLQA 2KAVA 4PHJA 5CPVA 1XVJA 1TRFA 2E6WA 3OX5A 3BUMB 4WRIA 1UP5A 1XFYO 4MRYA 4ORCB 1SL9A 2BL0B 3NXAA 2KI4C 2HETA 2V53A 1V1FA 1A29A 1CMFA 2MRDA 2WNDA 3FWCA 2LM5A 1VRKA 4N5XA 4PE0A 1W7IB 1PVBA 1OMVA 1SRAA 3OP0A 4YGAA 1LINA 1S36A 2LVKA 2LLSA 1J7QA 1XK4C 2KHNA 5F6TA 2MHHA 1KWOB 1NX2A 3JTDB 2L2EA 1JWDA 1ALVA 1J7RA 1KK8B 2L50A 1XFZO 1QV1A 1Q80A 2H61A 3SG3A 1Y6WA 3CR2A 2MA2A 4YGDB 1SNLA 2FCEA 5CSIA 4AQIA 4GGFA 1W7JB 2O60A 4FQOA 1K9PA 1NP8A 2CT9A 2WORA 3SIBA 1CLLA 1BOCA 2JNXA 5HKYA 1M46A 1QTXA 2LLTA 4P2YB 3CGAA 2LHLA 1B47A 1J7OA 3OHMB 1JFJA 1FW4A 2HPSA 3TS5B 1E8AA 2KFFA 3AKBA 5HKWA 4QJ5B 2Q4UA 3PN7C 1L2OB 3HX4A 5KTYA 4BY5A 4I5JA 2GV5A 1LA3A 1A2XA 4HRHA 1CDNA 2WCBA 4PHMA 1B4CA 3LLEA 2EHBA 1UURA 2BCBA 3D10A 1S5GY 4OVNF 2I94A 3LK0A 2LUXA 1QX2A 1KSOA 3EKJA 2O5GA 1Y1UA 1CNPA 3TZ1A 1YTZC 1S1EA 2COLB 4MEWA 1YVLA 1UHIA 2KYFA 5ER5A 1IH0A 1F4OA 4ZCVA 4GAOA 1PULA 1KFUL 3PFVA 2ISDA 2TN4A 4QJ3B 1GGZA 3I5HB 5CSNA 3DF0A 2BECA 1BR1B 1J1EA 1FF1A 2KI6C 2NXQA 2SCPA 4E68A 3I5IC 1KCYA 1TCOB 3EK4A 1FPWA 4GUKA 1ZOTB 2LANA 5KU1A 2F8PA 1GJYA 2BL0C 1QASA 2HQ8A 2K7OA 2K8MB 3KPXA 1KFXS 1K8UA 1FBVA 4HRGA 1DF0A 1DTLA 2PMYA 1DJYA 4OCIA 4NDBA 4DRWA 4JWQA 1ALWA 2EC6B 3KO0A 1QLSA 3OB2B 4MBEA 2MLFC 1CM1A 1QATA 1QX5B 4YBHB 2JXCA 4FTGA 2PRUA 1K95A 2Y4QA 1DGVA 2KGRA 3WHUB 1QIWA 2M1UA 1XFXO 2KAXA 2PVBA 3CR5X 3JTDC 1QS7A 4YI9A 1KK8C 5AANA 1F8HA 2JULA 2KI6D 1IJ5A 2FJUB 3QRXA 2JRFA 4YGCB 3JVTB 5AFPA 4WQ3A 2JTZA 1S6JA 1CKKA 1NCXA 2E30A 2M7LA 1XFWO 1YX8A 1QVIY 1SCMB 1Y1AA 3O6BA 1ODBA 1BG1A 2M0RA 3D0YA 3LCPC 1B1GA 1A03A 4NDCA 1CFDA 1TIZA 3NSLA 2JT3A 1L2OC 3SG2A 2CNPA 4MVFA 2MJWB 3SIAA 1WRKA 2L98A 3DF0B 1QX7A 1DJHA 4I5NB 1CFPA 1DT7B 4C0JA 3GK2A 3H4SE 3OB1B 4GFTA 2DOQA 3I5GC 1PSRA 1DF0B 2OTGC 2QACA 1UHJA 2VRGA 2OPOA 2CTNA 3CTNA 5KSZA 3A4UB 1R6PA 3BXKA 3I5IB 2LUCA 5G08A 2SASA 2GGMA 1BODA 1SL7A 3TUYB 1X02A 2BKHB 1NX1A 1QVIZ 2LCPA 3I5HC 1WDCB 1XYDA 2K7BA 4PE4A 2KYCA 1KK7Y 1YURA 1WRZA 1DJGA 4DUQA 1MUXA 3EVRA 1MXLC 1HQVA 1F71A 2JNFA 1B8CA 4ICBA 3BYAA 2R2IA 2H61C 2RGIA 1SPYA 2BBMA 2EC6C 2K7CA 2I2RE 2ZFDA 4GGFC 4HSZA 5AXIA 1M63B 1DJZA 2M29A 2NZ0A 1V1GA 1UWOA 2JTTA 1EG3A 3VRQA 2Y1NA 3F45A 1GGWA 4USLA 2MAZA 1IGVA 2BE6A 2BKIB 2LAPA 3LK1A 4U8DA 3PM8A 5DKQA 5JOLA 1NCZA 5K89A 3D0YB 1B8LA 1LXFC 3JVTC 5JJGA 2Y5IA 1AVSA 4XJKA 2L0PA 3SG5A 2MLEC 1SL8A 1MXEA 1ZUZA 3IQQA 1KK7Z 2F33A 3PALA 1YRUB 2JWWA 1TN4A 2EGDA 2JOJA 3BOWA 1SCMC 3WNXB 2LHIA 4HREE 2JXLA 4YRUA 3KF9A 3IQOA 1U5IA 2NCPA 3I5GB 2GGZA 1BMOA 1RFJA 3LL8B 4OKHA 2OTGB 3A8RA 1SW8A 1LA0A 5J3XA 3EK8A 5CSFA 3FIAA 5ER4X 5DKRA 3SG4A 2KQ6A 1CFFA 1KQMB 2ZRTA 1CFCA 2KDHA 1CDLA 1H4BA 5FYXA 1GQMA 3BUWB 4GGNA 1C7VA 2WCFA 5HYDA 2ZKMX 3CR4X 1PK0D 5DKNA 1K90D 1R2UA 1DJXA 2PSRA 1QXPA 1LVCD 1RTP1 1CLMA 1NCYA 1RWYA 2IS9A 5TNCA 2BCAA 3TUYC 1QV0A 1JC2A 1EG4A 1WDCC 1SK6D 3GOFA 4PE1A 3WXAA 1EL4A 2KFGA 2OS8C 4R1EA 3O4YA 2JC2A 1UHKA 1ZACA 5I2QA 1DJIA 1BF5A 3FWBA 1LKJA 4XJKB 1A4PA 4PE7A 1JF0A 1MR8A 4YI8A 2PASA 2JQ6A 4MZKA 1NX0A 2M97A 2K2FA 1DGUA 4MLWA 1MWNA 4MRXA 3OX6A 4PCWA 4UPGA 2G9BA 1YRTB 1J7PA 3CWGA 1M31A 1MF8B 1QJTA 1U5IB 1K9KA 1YUUA 2F3ZA 2M7NA 3CLNA 2BCXA 2JT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGB C;  4GBA A;  4WQ2 A;  3KHE A;  1SBJ A;  2BBN A;  2LVI A;  3TDZ A;  4NQG A;  2NLN A;  1F55 A;  1UHH A;  1Y0V H;  2NCO A;  4OR9 B;  3ZWH A;  2KSP A;  1MHO A;  1DJW A;  1L7Z A;  1K94 A;  4JQ0 D;  1UUS A;  3NSO A;  4AQJ A;  1AK8 A;  2ZRS A;  1BR4 B;  4IL1 A;  4MN0 A;  1H8B A;  4ETO A;  4CFQ A;  1UHN A;  5I8N A;  1WRL A;  1ZMZ A;  4PDZ A;  3FS7 A;  2A4J A;  1BJF A;  1PRW A;  1PVA A;  3TDI A;  2KAY A;  4XYN A;  1KQM C;  1J1D A;  4A4B A;  1M45 A;  1BU3 A;  1JBA A;  1CDP A;  2LP2 A;  4CFR A;  4M2Q A;  1SR6 C;  4N1G A;  4D1E A;  3BUO B;  2K7D A;  2JU0 A;  2OS8 B;  1OOJ A;  2AAO A;  1TNX A;  4ORB B;  1D1O A;  3AKA A;  3EVV A;  1NPQ A;  1TNP A;  2I7A A;  1RK9 A;  4DS7 A;  4AOM A;  2M1K B;  4GPL B;  3MSE B;  1K93 D;  3SG7 A;  2CXJ A;  1G33 A;  1TNQ A;  1DVI A;  1PSB A;  2FCD A;  2Y1M A;  2LMT A;  3GK1 A;  4M2P A;  3CZT X;  1PAL A;  1SY9 A;  3O78 A;  1CTR A;  1B7T Y;  3EKH A;  4I5K A;  1N2D A;  1N65 A;  1NWD A;  1EJ3 A;  1YX7 A;  1MQ1 A;  1QIV A;  2KOT A;  2LP3 A;  4DCK A;  1FI5 A;  1IQ5 A;  1OMR A;  2G2B A;  5PAL A;  1EXR A;  2CCM A;  2F3Y A;  3M0W A;  3IF7 A;  4YGE B;  2H2K A;  2WCE A;  3ICB A;  2LMV A;  1XFU O;  1SCV A;  4C0K A;  1AP4 A;  1A75 A;  4YGB B;  2LLU A;  3VRR A;  1QLK A;  3I5F B;  3ZNI A;  3EVU A;  1G8I A;  1IKU A;  1AHR A;  2LC5 A;  1KFX L;  4JPZ B;  4MSP A;  1KQV A;  1NIW A;  2KNE A;  2JT8 A;  3K21 A;  1J55 A;  3AAJ A;  1TNW A;  2ZNE A;  1XA5 A;  2PAL A;  1S3P A;  1XK4 A;  2M9G A;  1YUS A;  1XO5 A;  2M8U A;  1SMG A;  1EH2 A;  3DVK A;  4I5L B;  3VRP A;  1TOP A;  3E3R A;  1K2H A;  1NYA A;  2HQW A;  4PAL A;  2LV7 A;  1M39 A;  5D7F A;  1B7T Z;  3CS1 A;  2LVJ A;  1FI6 A;  2AMI A;  2BE4 A;  1Y1X A;  2M3W A;  1G4Y R;  1OMD A;  4M2O A;  3WHT B;  2F2P A;  2KBI A;  4MZL A;  3PSR A;  4L9M A;  3RLZ A;  4OV2 A;  2JPT A;  1SR6 B;  1NUB A;  3PLF B;  5CSJ A;  2FOT A;  2JZI A;  2L4I A;  2F2O A;  3DVM A;  3DD4 A;  3VRN A;  4TNC A;  4NDD A;  1B9A A;  2K2A A;  2LVV A;  5I2L A;  1F54 A;  3VGO A;  1AJ4 A;  2KQY A;  5HKZ A;  3KEV A;  4CPV A;  1F4Q A;  2KBM A;  5D69 A;  2ZN8 A;  1OQP A;  2CBL A;  4ORA B;  3SG6 A;  1RRO A;  4QJ4 B;  1JSA A;  5GQQ C;  2KFH A;  2B1U A;  1SYM A;  2KI4 B;  2D8N A;  4BY4 A;  5AEQ A;  1A75 B;  1AJ5 A;  3SJS A;  2LMU A;  3BUN B;  4GNK B;  1CM4 A;  1N0Y A;  1CLB A;  4MZJ A;  3NSI A;  1K96 A;  4Q04 A;  1KSM A;  2M49 B;  5B8I B;  4N1F A;  1OE9 B;  1IRJ A;  1CDM A;  1JF2 A;  1S6I A;  1YVH A;  2K0J A;  3BOW B;  3TDU A;  5AER A;  2L4H A;  4DIR A;  3RM1 A;  3BQ3 A;  4F0Z B;  2L5X B;  1OZS A;  1XFV O;  1F70 A;  2LNK A;  5I2O A;  1S5G Z;  2I18 A;  4PHN A;  2Q91 A;  2HF5 A;  1IWQ A;  3I5F C;  5HLO A;  1IQ3 A;  1YR5 A;  5HLV A;  3C1V A;  1KWO C;  1OZO A;  1C7W A;  3EK7 A;  1NSH A;  3NSK A;  4C0L A;  1SKT A;  1AUI B;  4P5O E;  2P6B B;  1TTX A;  2WOS A;  1KFU S;  1NX3 A;  1S6C A;  1CMG A;  3GK4 X;  1WLM A;  4CLN A;  1OSA A;  2LE9 B;  1K9U A;  3PN7 B;  3BUX B;  1CB1 A;  2AUC A;  3AAK A;  1JUO A;  1JFK A;  1B8R A;  1ZFS A;  3O2P A;  2K61 A;  1DMO A;  5IBW A;  5BPJ A;  1BT6 A;  1YUT A;  3DVE A;  3TS5 C;  1WLZ A;  4A4C A;  1C07 A;  1IJ6 A;  2QPT A;  1RJV A;  1HT9 A;  4PHK A;  4CID A;  3PAT A;  2L51 A;  2ZND A;  3VRO A;  3DVJ A;  3HCM A;  1REC A;  2MBX A;  1S26 D;  2ZN9 A;  1WY9 A;  1IG5 A;  1TCF A;  2WC8 A;  4ZCU A;  1BLQ A;  2KAV A;  4PHJ A;  5CPV A;  1XVJ A;  1TRF A;  2E6W A;  3OX5 A;  3BUM B;  4WRI A;  1UP5 A;  1XFY O;  4MRY A;  4ORC B;  1SL9 A;  2BL0 B;  3NXA A;  2KI4 C;  2HET A;  2V53 A;  1V1F A;  1A29 A;  1CMF A;  2MRD A;  2WND A;  3FWC A;  2LM5 A;  1VRK A;  4N5X A;  4PE0 A;  1W7I B;  1PVB A;  1OMV A;  1SRA A;  3OP0 A;  4YGA A;  1LIN A;  1S36 A;  2LVK A;  2LLS A;  1J7Q A;  1XK4 C;  2KHN A;  5F6T A;  2MHH A;  1KWO B;  1NX2 A;  3JTD B;  2L2E A;  1JWD A;  1ALV A;  1J7R A;  1KK8 B;  2L50 A;  1XFZ O;  1QV1 A;  1Q80 A;  2H61 A;  3SG3 A;  1Y6W A;  3CR2 A;  2MA2 A;  4YGD B;  1SNL A;  2FCE A;  5CSI A;  4AQI A;  4GGF A;  1W7J B;  2O60 A;  4FQO A;  1K9P A;  1NP8 A;  2CT9 A;  2WOR A;  3SIB A;  1CLL A;  1BOC A;  2JNX A;  5HKY A;  1M46 A;  1QTX A;  2LLT A;  4P2Y B;  3CGA A;  2LHL A;  1B47 A;  1J7O A;  3OHM B;  1JFJ A;  1FW4 A;  2HPS A;  3TS5 B;  1E8A A;  2KFF A;  3AKB A;  5HKW A;  4QJ5 B;  2Q4U A;  3PN7 C;  1L2O B;  3HX4 A;  5KTY A;  4BY5 A;  4I5J A;  2GV5 A;  1LA3 A;  1A2X A;  4HRH A;  1CDN A;  2WCB A;  4PHM A;  1B4C A;  3LLE A;  2EHB A;  1UUR A;  2BCB A;  3D10 A;  1S5G Y;  4OVN F;  2I94 A;  3LK0 A;  2LUX A;  1QX2 A;  1KSO A;  3EKJ A;  2O5G A;  1Y1U A;  1CNP A;  3TZ1 A;  1YTZ C;  1S1E A;  2COL B;  4MEW A;  1YVL A;  1UHI A;  2KYF A;  5ER5 A;  1IH0 A;  1F4O A;  4ZCV A;  4GAO A;  1PUL A;  1KFU L;  3PFV A;  2ISD A;  2TN4 A;  4QJ3 B;  1GGZ A;  3I5H B;  5CSN A;  3DF0 A;  2BEC A;  1BR1 B;  1J1E A;  1FF1 A;  2KI6 C;  2NXQ A;  2SCP A;  4E68 A;  3I5I C;  1KCY A;  1TCO B;  3EK4 A;  1FPW A;  4GUK A;  1ZOT B;  2LAN A;  5KU1 A;  2F8P A;  1GJY A;  2BL0 C;  1QAS A;  2HQ8 A;  2K7O A;  2K8M B;  3KPX A;  1KFX S;  1K8U A;  1FBV A;  4HRG A;  1DF0 A;  1DTL A;  2PMY A;  1DJY A;  4OCI A;  4NDB A;  4DRW A;  4JWQ A;  1ALW A;  2EC6 B;  3KO0 A;  1QLS A;  3OB2 B;  4MBE A;  2MLF C;  1CM1 A;  1QAT A;  1QX5 B;  4YBH B;  2JXC A;  4FTG A;  2PRU A;  1K95 A;  2Y4Q A;  1DGV A;  2KGR A;  3WHU B;  1QIW A;  2M1U A;  1XFX O;  2KAX A;  2PVB A;  3CR5 X;  3JTD C;  1QS7 A;  4YI9 A;  1KK8 C;  5AAN A;  1F8H A;  2JUL A;  2KI6 D;  1IJ5 A;  2FJU B;  3QRX A;  2JRF A;  4YGC B;  3JVT B;  5AFP A;  4WQ3 A;  2JTZ A;  1S6J A;  1CKK A;  1NCX A;  2E30 A;  2M7L A;  1XFW O;  1YX8 A;  1QVI Y;  1SCM B;  1Y1A A;  3O6B A;  1ODB A;  1BG1 A;  2M0R A;  3D0Y A;  3LCP C;  1B1G A;  1A03 A;  4NDC A;  1CFD A;  1TIZ A;  3NSL A;  2JT3 A;  1L2O C;  3SG2 A;  2CNP A;  4MVF A;  2MJW B;  3SIA A;  1WRK A;  2L98 A;  3DF0 B;  1QX7 A;  1DJH A;  4I5N B;  1CFP A;  1DT7 B;  4C0J A;  3GK2 A;  3H4S E;  3OB1 B;  4GFT A;  2DOQ A;  3I5G C;  1PSR A;  1DF0 B;  2OTG C;  2QAC A;  1UHJ A;  2VRG A;  2OPO A;  2CTN A;  3CTN A;  5KSZ A;  3A4U B;  1R6P A;  3BXK A;  3I5I B;  2LUC A;  5G08 A;  2SAS A;  2GGM A;  1BOD A;  1SL7 A;  3TUY B;  1X02 A;  2BKH B;  1NX1 A;  1QVI Z;  2LCP A;  3I5H C;  1WDC B;  1XYD A;  2K7B A;  4PE4 A;  2KYC A;  1KK7 Y;  1YUR A;  1WRZ A;  1DJG A;  4DUQ A;  1MUX A;  3EVR A;  1MXL C;  1HQV A;  1F71 A;  2JNF A;  1B8C A;  4ICB A;  3BYA A;  2R2I A;  2H61 C;  2RGI A;  1SPY A;  2BBM A;  2EC6 C;  2K7C A;  2I2R E;  2ZFD A;  4GGF C;  4HSZ A;  5AXI A;  1M63 B;  1DJZ A;  2M29 A;  2NZ0 A;  1V1G A;  1UWO A;  2JTT A;  1EG3 A;  3VRQ A;  2Y1N A;  3F45 A;  1GGW A;  4USL A;  2MAZ A;  1IGV A;  2BE6 A;  2BKI B;  2LAP A;  3LK1 A;  4U8D A;  3PM8 A;  5DKQ A;  5JOL A;  1NCZ A;  5K89 A;  3D0Y B;  1B8L A;  1LXF C;  3JVT C;  5JJG A;  2Y5I A;  1AVS A;  4XJK A;  2L0P A;  3SG5 A;  2MLE C;  1SL8 A;  1MXE A;  1ZUZ A;  3IQQ A;  1KK7 Z;  2F33 A;  3PAL A;  1YRU B;  2JWW A;  1TN4 A;  2EGD A;  2JOJ A;  3BOW A;  1SCM C;  3WNX B;  2LHI A;  4HRE E;  2JXL A;  4YRU A;  3KF9 A;  3IQO A;  1U5I A;  2NCP A;  3I5G B;  2GGZ A;  1BMO A;  1RFJ A;  3LL8 B;  4OKH A;  2OTG B;  3A8R A;  1SW8 A;  1LA0 A;  5J3X A;  3EK8 A;  5CSF A;  3FIA A;  5ER4 X;  5DKR A;  3SG4 A;  2KQ6 A;  1CFF A;  1KQM B;  2ZRT A;  1CFC A;  2KDH A;  1CDL A;  1H4B A;  5FYX A;  1GQM A;  3BUW B;  4GGN A;  1C7V A;  2WCF A;  5HYD A;  2ZKM X;  3CR4 X;  1PK0 D;  5DKN A;  1K90 D;  1R2U A;  1DJX A;  2PSR A;  1QXP A;  1LVC D;  1RTP 1;  1CLM A;  1NCY A;  1RWY A;  2IS9 A;  5TNC A;  2BCA A;  3TUY C;  1QV0 A;  1JC2 A;  1EG4 A;  1WDC C;  1SK6 D;  3GOF A;  4PE1 A;  3WXA A;  1EL4 A;  2KFG A;  2OS8 C;  4R1E A;  3O4Y A;  2JC2 A;  1UHK A;  1ZAC A;  5I2Q A;  1DJI A;  1BF5 A;  3FWB A;  1LKJ A;  4XJK B;  1A4P A;  4PE7 A;  1JF0 A;  1MR8 A;  4YI8 A;  2PAS A;  2JQ6 A;  4MZK A;  1NX0 A;  2M97 A;  2K2F A;  1DGU A;  4MLW A;  1MWN A;  4MRX A;  3OX6 A;  4PCW A;  4UPG A;  2G9B A;  1YRT B;  1J7P A;  3CWG A;  1M31 A;  1MF8 B;  1QJT A;  1U5I B;  1K9K A;  1YUU A;  2F3Z A;  2M7N A;  3CLN A;  2BCX A;  2JT0 A; 
#chains in the Genus database with same CATH topology
 2KGB C;  4GBA A;  4WQ2 A;  3KHE A;  1SBJ A;  2BBN A;  2LVI A;  3TDZ A;  4NQG A;  1DEL A;  2NLN A;  1F55 A;  1UHH A;  1Y0V H;  2NCO A;  4OR9 B;  3ZWH A;  3B88 A;  2KSP A;  1MHO A;  1DJW A;  1L7Z A;  1K94 A;  4JQ0 D;  1UUS A;  3NSO A;  2BNX A;  4AQJ A;  1AK8 A;  2ZRS A;  1BR4 B;  4IL1 A;  4MN0 A;  1H8B A;  4ETO A;  4CFQ A;  5FI7 A;  1UHN A;  5I8N A;  1WRL A;  1ZMZ A;  3S0F A;  4PDZ A;  1LS8 A;  2JPO A;  3FS7 A;  2A4J A;  1BJF A;  1PRW A;  1PVA A;  3TDI A;  2KAY A;  4XYN A;  1KQM C;  1J1D A;  4A4B A;  1M45 A;  1BU3 A;  1JBA A;  1CDP A;  2LP2 A;  4CFR A;  4M2Q A;  1SR6 C;  4N1G A;  3DY9 A;  4D1E A;  3BUO B;  2K7D A;  2JU0 A;  2OS8 B;  3PJI A;  1OOJ A;  2AAO A;  1TNX A;  2BAP A;  4ORB B;  1D1O A;  3AKA A;  3EVV A;  1NPQ A;  1TNP A;  2I7A A;  1RK9 A;  4DS7 A;  4AOM A;  2M1K B;  4GPL B;  3MSE B;  1K93 D;  5I94 A;  3SG7 A;  2CXJ A;  1G33 A;  1TNQ A;  1DVI A;  1PSB A;  2FCD A;  2Y1M A;  2LMT A;  3GK1 A;  4M2P A;  3CZT X;  1PAL A;  1SY9 A;  4KYN A;  3O78 A;  1CTR A;  1B7T Y;  3EKH A;  4I5K A;  4IJ7 A;  1N2D A;  1N65 A;  1NWD A;  1EJ3 A;  1YX7 A;  1MQ1 A;  1QIV A;  2KOT A;  2LP3 A;  3OBV A;  4DCK A;  1IQ5 A;  1OMR A;  2G2B A;  1GM0 A;  5PAL A;  1EXR A;  2CCM A;  2F3Y A;  3M0W A;  1FI5 A;  3IF7 A;  4YGE B;  2H2K A;  2WCE A;  3ICB A;  2LMV A;  1XFU O;  1SCV A;  4C0K A;  1AP4 A;  1A75 A;  4YGB B;  2LLU A;  3VRR A;  1QLK A;  3I5F B;  3ZNI A;  3EVU A;  3BFB A;  1G8I A;  1IKU A;  1AHR A;  2LC5 A;  1KFX L;  4JPZ B;  3SS4 A;  4MSP A;  1KQV A;  3DZT A;  1NIW A;  2KNE A;  3D73 A;  3S0D A;  2JT8 A;  3K21 A;  1J55 A;  3AAJ A;  1TNW A;  3S0E A;  2ZNE A;  1XA5 A;  2PAL A;  3S0A A;  1S3P A;  1XK4 A;  2M9G A;  1YUS A;  3PM2 A;  1XO5 A;  2M8U A;  1SMG A;  1EH2 A;  3DVK A;  4I5L B;  3VRP A;  1TOP A;  3E3R A;  1K2H A;  1NYA A;  2HQW A;  4PAL A;  2LV7 A;  1M39 A;  3L4L A;  5D7F A;  1B7T Z;  3CS1 A;  2LVJ A;  3FE8 A;  1FI6 A;  2AMI A;  2BE4 A;  3L4A A;  1Y1X A;  2M3W A;  1G4Y R;  1OMD A;  4M2O A;  3WHT B;  2H8V A;  2F2P A;  2KBI A;  3NGV A;  2WCJ A;  4MZL A;  3PSR A;  4L9M A;  3RLZ A;  4OV2 A;  2JPT A;  1SR6 B;  1NUB A;  3PLF B;  5CSJ A;  2FOT A;  2JZI A;  2K60 A;  2L4I A;  2F2O A;  3DVM A;  3DD4 A;  2QEO A;  3VRN A;  4TNC A;  4NDD A;  1B9A A;  2K2A A;  2LVV A;  5I2L A;  3L47 A;  3VGO A;  1F54 A;  1SSE B;  1AJ4 A;  2KQY A;  2WC5 A;  3KEV A;  5HKZ A;  4CPV A;  1F4Q A;  2KBM A;  5D69 A;  2ZN8 A;  1OQP A;  2CBL A;  4F7F A;  3B7A A;  4ORA B;  3SG6 A;  1RRO A;  4QJ4 B;  1JSA A;  5GQQ C;  2KFH A;  2B1U A;  1SYM A;  2KI4 B;  2D8N A;  4BY4 A;  5AEQ A;  1A75 B;  1AJ5 A;  3SJS A;  2LMU A;  3BUN B;  4GNK B;  1CM4 A;  2WCL A;  1N0Y A;  1CLB A;  4MZJ A;  3NSI A;  1K96 A;  4Q04 A;  1KSM A;  2M49 B;  4JD9 A;  4N1F A;  5B8I B;  3N7H A;  1OE9 B;  1IRJ A;  1CDM A;  1JF2 A;  1S6I A;  1YVH A;  2K0J A;  3BOW B;  3TDU A;  5AER A;  2L4H A;  3CYZ A;  3O4X A;  3RM1 A;  4DIR A;  3BQ3 A;  4F0Z B;  2L5X B;  1OZS A;  1XFV O;  1F70 A;  2LNK A;  5I2O A;  1S5G Z;  2I18 A;  4PHN A;  2Q91 A;  2HF5 A;  1IWQ A;  3I5F C;  5HLO A;  3BFA A;  1IQ3 A;  1YR5 A;  5HLV A;  3C1V A;  3R1O A;  1KWO C;  1OZO A;  1C7W A;  3EK7 A;  1NSH A;  3NSK A;  1QWV A;  4C0L A;  1SKT A;  3VB1 A;  1AUI B;  4P5O E;  2P6B B;  1TTX A;  2WOS A;  1KFU S;  1NX3 A;  1S6C A;  1CMG A;  3BJH A;  3GK4 X;  1WLM A;  5D3O A;  1OSA A;  4CLN A;  2LE9 B;  1K9U A;  3PN7 B;  3BUX B;  1CB1 A;  2AUC A;  3AAK A;  1JUO A;  1JFK A;  1B8R A;  1ZFS A;  3O2P A;  2K61 A;  1DMO A;  5IBW A;  5BPJ A;  1BT6 A;  1YUT A;  3DVE A;  3TS5 C;  1WLZ A;  4A4C A;  1C07 A;  1IJ6 A;  2QPT A;  1RJV A;  1HT9 A;  4PHK A;  4CID A;  3PAT A;  2L51 A;  2ZND A;  3VRO A;  3DVJ A;  3HCM A;  1REC A;  2MBX A;  1S26 D;  2ZN9 A;  1WY9 A;  3DXL A;  1IG5 A;  1TCF A;  2WC8 A;  4ZCU A;  1BLQ A;  2KAV A;  3SS3 A;  4INW A;  4PHJ A;  5CPV A;  1OOI X;  1XVJ A;  1TRF A;  2E6W A;  3OX5 A;  3EG5 B;  3BUM B;  4WRI A;  1UP5 A;  1XFY O;  4MRY A;  4ORC B;  1SL9 A;  3B87 A;  3CZ0 A;  2BL0 B;  3NXA A;  2KI4 C;  2WCM A;  2HET A;  2QEB A;  2V53 A;  1V1F A;  1A29 A;  1CMF A;  2MRD A;  2WND A;  3DYE A;  2WCK A;  3FWC A;  2LM5 A;  1VRK A;  4N5X A;  4PE0 A;  1W7I B;  1PVB A;  3FE9 A;  1OMV A;  1SRA A;  3OP0 A;  4YGA A;  1LIN A;  1S36 A;  2LVK A;  3NHT A;  3D78 A;  2LLS A;  1J7Q A;  1XK4 C;  2FJY A;  2KHN A;  2MHH A;  1KWO B;  1NX2 A;  5F6T A;  3JTD B;  2L2E A;  1JWD A;  1ALV A;  1J7R A;  1KK8 B;  2L50 A;  1XFZ O;  1QV1 A;  1Q80 A;  2QDI A;  2H61 A;  3SG3 A;  1Y6W A;  3CR2 A;  2MA2 A;  4YGD B;  1SNL A;  2FCE A;  5CSI A;  4AQI A;  4GGF A;  1W7J B;  2O60 A;  3R72 A;  4FQO A;  1K9P A;  1NP8 A;  2CT9 A;  2WOR A;  3SIB A;  1CLL A;  1BOC A;  5HL1 A;  2JNX A;  5HKY A;  1M46 A;  1QTX A;  4FQT A;  2LLT A;  4P2Y B;  3CGA A;  2LHL A;  1B47 A;  4JKT A;  1J7O A;  3OHM B;  1JFJ A;  1FW4 A;  2HPS A;  3TS5 B;  1E8A A;  2KFF A;  3NHI A;  1TUZ A;  3AKB A;  5HKW A;  2KLE A;  3CDN A;  4QJ5 B;  2Q4U A;  3PN7 C;  1L2O B;  3HX4 A;  5KTY A;  4BY5 A;  4I5J A;  2GV5 A;  4INX A;  1LA3 A;  1A2X A;  3Q8I A;  2PQL A;  4HRH A;  2WCB A;  1CDN A;  2P71 A;  4PHM A;  1B4C A;  3LLE A;  2EHB A;  1UUR A;  2BCB A;  2WCH A;  1S5G Y;  3D10 A;  4OVN F;  2I94 A;  3LK0 A;  2LUX A;  1QX2 A;  1KSO A;  3EKJ A;  2O5G A;  1Y1U A;  1CNP A;  3TZ1 A;  1YTZ C;  1S1E A;  2COL B;  4MEW A;  1YVL A;  1UHI A;  2KYF A;  1OOG A;  5ER5 A;  1IH0 A;  1F4O A;  4ZCV A;  4GAO A;  1PUL A;  1KFU L;  3PFV A;  3QME A;  2ISD A;  2TN4 A;  4QJ3 B;  1GGZ A;  3I5H B;  5CSN A;  3DF0 A;  2BEC A;  1BR1 B;  1J1E A;  1FF1 A;  2KI6 C;  2NXQ A;  3S0B A;  2SCP A;  3R1V A;  4E68 A;  3CZ1 A;  3I5I C;  1KCY A;  1TCO B;  3EK4 A;  1FPW A;  4GUK A;  1ZOT B;  2LAN A;  5KU1 A;  2F8P A;  1GJY A;  2BL0 C;  1QAS A;  2HQ8 A;  2K7O A;  2K8M B;  3KPX A;  1KFX S;  1K8U A;  1FBV A;  4HRG A;  1DF0 A;  1DTL A;  2PMY A;  1DJY A;  4OCI A;  4NDB A;  5DIC A;  4DRW A;  4JWQ A;  1ALW A;  2EC6 B;  3KO0 A;  3B6X A;  1QLS A;  3OB2 B;  4MBE A;  2MLF C;  1CM1 A;  1QAT A;  1C3Z A;  3D77 A;  1QX5 B;  4YBH B;  2JXC A;  4FTG A;  2PRU A;  1K95 A;  2Y4Q A;  1DGV A;  2KGR A;  3WHU B;  1QIW A;  2M1U A;  1XFX O;  2KAX A;  2PVB A;  3CR5 X;  3JTD C;  1QS7 A;  4YI9 A;  1KK8 C;  5AAN A;  1F8H A;  2JUL A;  2GTE A;  2KI6 D;  1IJ5 A;  2FJU B;  3V2L A;  3QRX A;  2JRF A;  4YGC B;  3JVT B;  1OOH A;  5AFP A;  4WQ3 A;  2JTZ A;  1S6J A;  1CKK A;  1NCX A;  2E30 A;  2M7L A;  3SS5 A;  1XFW O;  1YX8 A;  1QVI Y;  1SCM B;  1Y1A A;  3O6B A;  1ODB A;  2L2C A;  1BG1 A;  2M0R A;  3D0Y A;  3LCP C;  1B1G A;  1A03 A;  4NDC A;  1CFD A;  1TIZ A;  3NSL A;  2JT3 A;  1L2O C;  5FI6 A;  3SG2 A;  3OGN A;  2CNP A;  4MVF A;  2MJW B;  3SIA A;  1WRK A;  2L98 A;  3D74 A;  3DF0 B;  3FE6 A;  3CZ2 A;  1QX7 A;  2KLD A;  3D76 A;  1DJH A;  4I5N B;  1CFP A;  1DT7 B;  4C0J A;  3GK2 A;  3H4S E;  3OB1 B;  4GFT A;  2DOQ A;  3I5G C;  1PSR A;  1DF0 B;  1Z4H A;  2OTG C;  2QAC A;  1UHJ A;  2VRG A;  2OPO A;  2CTN A;  3CTN A;  5KSZ A;  3A4U B;  1R6P A;  3BXK A;  3I5I B;  3S0G A;  1DEK A;  2LUC A;  5G08 A;  2SAS A;  2GGM A;  1BOD A;  1SL7 A;  3TUY B;  1X02 A;  1QVI Z;  1NX1 A;  2BKH B;  2LCP A;  3I5H C;  1WDC B;  1XYD A;  2K7B A;  4PE4 A;  2KYC A;  1KK7 Y;  1YUR A;  1WRZ A;  1DJG A;  1Z2C B;  2QEV A;  4DUQ A;  1MUX A;  3EVR A;  1MXL C;  1HQV A;  3CAB A;  1F71 A;  2JNF A;  5EL2 A;  1B8C A;  4ICB A;  3BYA A;  3B86 A;  2R2I A;  2H61 C;  2RGI A;  3UNW A;  1SPY A;  2BBM A;  1T14 A;  2EC6 C;  2I2R E;  2K7C A;  1DC1 A;  4PT1 A;  2ZFD A;  4GGF C;  4HSZ A;  5AXI A;  1M63 B;  1DJZ A;  2M29 A;  2NZ0 A;  2PYQ A;  2ERB A;  1V1G A;  1UWO A;  2JTT A;  1EG3 A;  3VRQ A;  2Y1N A;  3F45 A;  1GGW A;  3RZS A;  4USL A;  2MAZ A;  1IGV A;  2BE6 A;  2BKI B;  2LAP A;  3LK1 A;  4U8D A;  3PM8 A;  5DKQ A;  5JOL A;  1NCZ A;  5K89 A;  3D0Y B;  1B8L A;  1LXF C;  1OW4 A;  3JVT C;  5JJG A;  2Y5I A;  1AVS A;  2QEH A;  3IVT A;  4XJK A;  2L0P A;  3SG5 A;  2MLE C;  1SL8 A;  1MXE A;  1ZUZ A;  3IQQ A;  1KK7 Z;  2F33 A;  3PAL A;  1YRU B;  2JWW A;  2L5Y A;  1TN4 A;  2EGD A;  2JOJ A;  3BOW A;  1SCM C;  3WNX B;  3K1E A;  2LHI A;  4HRE E;  2YGU A;  2JXL A;  2WC6 A;  4YRU A;  5FI2 A;  3KF9 A;  3IQO A;  1U5I A;  2NCP A;  2P70 A;  2GGZ A;  3I5G B;  1IIO A;  1BMO A;  1RFJ A;  3LL8 B;  4OKH A;  2OTG B;  3A8R A;  1SW8 A;  1LA0 A;  5J3X A;  3EK8 A;  5CSF A;  1ORG A;  3FIA A;  5ER4 X;  5DKR A;  3SG4 A;  2KQ6 A;  1CFF A;  1KQM B;  2ZRT A;  1CFC A;  2KDH A;  1CDL A;  1H4B A;  5FYX A;  1GQM A;  3R1P A;  3BUW B;  4GGN A;  1C7V A;  1TWO A;  1W9Z A;  2WCF A;  5HYD A;  1C3Y A;  2ZKM X;  3CR4 X;  1PK0 D;  5DKN A;  1K90 D;  1R2U A;  1DJX A;  2PSR A;  3D75 A;  1QXP A;  1LVC D;  1RTP 1;  3UO9 A;  1CLM A;  1NCY A;  1RWY A;  2IS9 A;  5TNC A;  2BCA A;  3TUY C;  1QV0 A;  1JC2 A;  1EG4 A;  1WDC C;  1SK6 D;  3GOF A;  4OZD A;  4PE1 A;  3WXA A;  1EL4 A;  2KFG A;  2OS8 C;  1DQE A;  3O4Y A;  4R1E A;  2JC2 A;  1UHK A;  1ZAC A;  1XFR A;  5I2Q A;  1DJI A;  1BF5 A;  3FWB A;  1LKJ A;  4XJK B;  2KPH A;  1P28 A;  1A4P A;  4PE7 A;  1JF0 A;  1MR8 A;  1OOF A;  2PAS A;  4YI8 A;  2JQ6 A;  4MZK A;  1NX0 A;  2M97 A;  2K2F A;  1DGU A;  4MLW A;  1MWN A;  4MRX A;  3OX6 A;  4PCW A;  4UPG A;  2G9B A;  1YRT B;  1J7P A;  3BFH A;  3CWG A;  1M31 A;  1TUJ A;  1MF8 B;  1QJT A;  1U5I B;  1K9K A;  1YUU A;  2F3Z A;  2M7N A;  3CLN A;  2BCX A;  2JT0 A; 
#chains in the Genus database with same CATH homology
 2KGB C;  4GBA A;  4WQ2 A;  3KHE A;  1SBJ A;  2BBN A;  2LVI A;  3TDZ A;  4NQG A;  2NLN A;  1F55 A;  1UHH A;  1Y0V H;  2NCO A;  4OR9 B;  3ZWH A;  2KSP A;  1MHO A;  1DJW A;  1L7Z A;  1K94 A;  4JQ0 D;  1UUS A;  3NSO A;  4AQJ A;  1AK8 A;  2ZRS A;  1BR4 B;  4IL1 A;  4MN0 A;  1H8B A;  4ETO A;  4CFQ A;  1UHN A;  5I8N A;  1WRL A;  1ZMZ A;  4PDZ A;  3FS7 A;  2A4J A;  1BJF A;  1PRW A;  1PVA A;  3TDI A;  2KAY A;  4XYN A;  1KQM C;  1J1D A;  4A4B A;  1M45 A;  1BU3 A;  1JBA A;  1CDP A;  2LP2 A;  4CFR A;  4M2Q A;  1SR6 C;  4N1G A;  4D1E A;  3BUO B;  2K7D A;  2JU0 A;  2OS8 B;  1OOJ A;  2AAO A;  1TNX A;  4ORB B;  1D1O A;  3AKA A;  3EVV A;  1NPQ A;  1TNP A;  2I7A A;  1RK9 A;  4DS7 A;  4AOM A;  2M1K B;  4GPL B;  3MSE B;  1K93 D;  3SG7 A;  2CXJ A;  1G33 A;  1TNQ A;  1DVI A;  1PSB A;  2FCD A;  2Y1M A;  2LMT A;  3GK1 A;  4M2P A;  3CZT X;  1PAL A;  1SY9 A;  3O78 A;  1CTR A;  1B7T Y;  3EKH A;  4I5K A;  1N2D A;  1N65 A;  1NWD A;  1EJ3 A;  1YX7 A;  1MQ1 A;  1QIV A;  2KOT A;  2LP3 A;  4DCK A;  1FI5 A;  1IQ5 A;  1OMR A;  2G2B A;  5PAL A;  1EXR A;  2CCM A;  2F3Y A;  3M0W A;  3IF7 A;  4YGE B;  2H2K A;  2WCE A;  3ICB A;  2LMV A;  1XFU O;  1SCV A;  4C0K A;  1AP4 A;  1A75 A;  4YGB B;  2LLU A;  3VRR A;  1QLK A;  3I5F B;  3ZNI A;  3EVU A;  1G8I A;  1IKU A;  1AHR A;  2LC5 A;  1KFX L;  4JPZ B;  4MSP A;  1KQV A;  1NIW A;  2KNE A;  2JT8 A;  3K21 A;  1J55 A;  3AAJ A;  1TNW A;  2ZNE A;  1XA5 A;  2PAL A;  1S3P A;  1XK4 A;  2M9G A;  1YUS A;  1XO5 A;  2M8U A;  1SMG A;  1EH2 A;  3DVK A;  4I5L B;  3VRP A;  1TOP A;  3E3R A;  1K2H A;  1NYA A;  2HQW A;  4PAL A;  2LV7 A;  1M39 A;  5D7F A;  1B7T Z;  3CS1 A;  2LVJ A;  1FI6 A;  2AMI A;  2BE4 A;  1Y1X A;  2M3W A;  1G4Y R;  1OMD A;  4M2O A;  3WHT B;  2F2P A;  2KBI A;  4MZL A;  3PSR A;  4L9M A;  3RLZ A;  4OV2 A;  2JPT A;  1SR6 B;  1NUB A;  3PLF B;  5CSJ A;  2FOT A;  2JZI A;  2L4I A;  2F2O A;  3DVM A;  3DD4 A;  3VRN A;  4TNC A;  4NDD A;  1B9A A;  2K2A A;  2LVV A;  5I2L A;  1F54 A;  3VGO A;  1AJ4 A;  2KQY A;  5HKZ A;  3KEV A;  4CPV A;  1F4Q A;  2KBM A;  5D69 A;  2ZN8 A;  1OQP A;  2CBL A;  4ORA B;  3SG6 A;  1RRO A;  4QJ4 B;  1JSA A;  5GQQ C;  2KFH A;  2B1U A;  1SYM A;  2KI4 B;  2D8N A;  4BY4 A;  5AEQ A;  1A75 B;  1AJ5 A;  3SJS A;  2LMU A;  3BUN B;  4GNK B;  1CM4 A;  1N0Y A;  1CLB A;  4MZJ A;  3NSI A;  1K96 A;  4Q04 A;  1KSM A;  2M49 B;  5B8I B;  4N1F A;  1OE9 B;  1IRJ A;  1CDM A;  1JF2 A;  1S6I A;  1YVH A;  2K0J A;  3BOW B;  3TDU A;  5AER A;  2L4H A;  4DIR A;  3RM1 A;  3BQ3 A;  4F0Z B;  2L5X B;  1OZS A;  1XFV O;  1F70 A;  2LNK A;  5I2O A;  1S5G Z;  2I18 A;  4PHN A;  2Q91 A;  2HF5 A;  1IWQ A;  3I5F C;  5HLO A;  1IQ3 A;  1YR5 A;  5HLV A;  3C1V A;  1KWO C;  1OZO A;  1C7W A;  3EK7 A;  1NSH A;  3NSK A;  4C0L A;  1SKT A;  1AUI B;  4P5O E;  2P6B B;  1TTX A;  2WOS A;  1KFU S;  1NX3 A;  1S6C A;  1CMG A;  3GK4 X;  1WLM A;  4CLN A;  1OSA A;  2LE9 B;  1K9U A;  3PN7 B;  3BUX B;  1CB1 A;  2AUC A;  3AAK A;  1JUO A;  1JFK A;  1B8R A;  1ZFS A;  3O2P A;  2K61 A;  1DMO A;  5IBW A;  5BPJ A;  1BT6 A;  1YUT A;  3DVE A;  3TS5 C;  1WLZ A;  4A4C A;  1C07 A;  1IJ6 A;  2QPT A;  1RJV A;  1HT9 A;  4PHK A;  4CID A;  3PAT A;  2L51 A;  2ZND A;  3VRO A;  3DVJ A;  3HCM A;  1REC A;  2MBX A;  1S26 D;  2ZN9 A;  1WY9 A;  1IG5 A;  1TCF A;  2WC8 A;  4ZCU A;  1BLQ A;  2KAV A;  4PHJ A;  5CPV A;  1XVJ A;  1TRF A;  2E6W A;  3OX5 A;  3BUM B;  4WRI A;  1UP5 A;  1XFY O;  4MRY A;  4ORC B;  1SL9 A;  2BL0 B;  3NXA A;  2KI4 C;  2HET A;  2V53 A;  1V1F A;  1A29 A;  1CMF A;  2MRD A;  2WND A;  3FWC A;  2LM5 A;  1VRK A;  4N5X A;  4PE0 A;  1W7I B;  1PVB A;  1OMV A;  1SRA A;  3OP0 A;  4YGA A;  1LIN A;  1S36 A;  2LVK A;  2LLS A;  1J7Q A;  1XK4 C;  2KHN A;  5F6T A;  2MHH A;  1KWO B;  1NX2 A;  3JTD B;  2L2E A;  1JWD A;  1ALV A;  1J7R A;  1KK8 B;  2L50 A;  1XFZ O;  1QV1 A;  1Q80 A;  2H61 A;  3SG3 A;  1Y6W A;  3CR2 A;  2MA2 A;  4YGD B;  1SNL A;  2FCE A;  5CSI A;  4AQI A;  4GGF A;  1W7J B;  2O60 A;  4FQO A;  1K9P A;  1NP8 A;  2CT9 A;  2WOR A;  3SIB A;  1CLL A;  1BOC A;  2JNX A;  5HKY A;  1M46 A;  1QTX A;  2LLT A;  4P2Y B;  3CGA A;  2LHL A;  1B47 A;  1J7O A;  3OHM B;  1JFJ A;  1FW4 A;  2HPS A;  3TS5 B;  1E8A A;  2KFF A;  3AKB A;  5HKW A;  4QJ5 B;  2Q4U A;  3PN7 C;  1L2O B;  3HX4 A;  5KTY A;  4BY5 A;  4I5J A;  2GV5 A;  1LA3 A;  1A2X A;  4HRH A;  1CDN A;  2WCB A;  4PHM A;  1B4C A;  3LLE A;  2EHB A;  1UUR A;  2BCB A;  3D10 A;  1S5G Y;  4OVN F;  2I94 A;  3LK0 A;  2LUX A;  1QX2 A;  1KSO A;  3EKJ A;  2O5G A;  1Y1U A;  1CNP A;  3TZ1 A;  1YTZ C;  1S1E A;  2COL B;  4MEW A;  1YVL A;  1UHI A;  2KYF A;  5ER5 A;  1IH0 A;  1F4O A;  4ZCV A;  4GAO A;  1PUL A;  1KFU L;  3PFV A;  2ISD A;  2TN4 A;  4QJ3 B;  1GGZ A;  3I5H B;  5CSN A;  3DF0 A;  2BEC A;  1BR1 B;  1J1E A;  1FF1 A;  2KI6 C;  2NXQ A;  2SCP A;  4E68 A;  3I5I C;  1KCY A;  1TCO B;  3EK4 A;  1FPW A;  4GUK A;  1ZOT B;  2LAN A;  5KU1 A;  2F8P A;  1GJY A;  2BL0 C;  1QAS A;  2HQ8 A;  2K7O A;  2K8M B;  3KPX A;  1KFX S;  1K8U A;  1FBV A;  4HRG A;  1DF0 A;  1DTL A;  2PMY A;  1DJY A;  4OCI A;  4NDB A;  4DRW A;  4JWQ A;  1ALW A;  2EC6 B;  3KO0 A;  1QLS A;  3OB2 B;  4MBE A;  2MLF C;  1CM1 A;  1QAT A;  1QX5 B;  4YBH B;  2JXC A;  4FTG A;  2PRU A;  1K95 A;  2Y4Q A;  1DGV A;  2KGR A;  3WHU B;  1QIW A;  2M1U A;  1XFX O;  2KAX A;  2PVB A;  3CR5 X;  3JTD C;  1QS7 A;  4YI9 A;  1KK8 C;  5AAN A;  1F8H A;  2JUL A;  2KI6 D;  1IJ5 A;  2FJU B;  3QRX A;  2JRF A;  4YGC B;  3JVT B;  5AFP A;  4WQ3 A;  2JTZ A;  1S6J A;  1CKK A;  1NCX A;  2E30 A;  2M7L A;  1XFW O;  1YX8 A;  1QVI Y;  1SCM B;  1Y1A A;  3O6B A;  1ODB A;  1BG1 A;  2M0R A;  3D0Y A;  3LCP C;  1B1G A;  1A03 A;  4NDC A;  1CFD A;  1TIZ A;  3NSL A;  2JT3 A;  1L2O C;  3SG2 A;  2CNP A;  4MVF A;  2MJW B;  3SIA A;  1WRK A;  2L98 A;  3DF0 B;  1QX7 A;  1DJH A;  4I5N B;  1CFP A;  1DT7 B;  4C0J A;  3GK2 A;  3H4S E;  3OB1 B;  4GFT A;  2DOQ A;  3I5G C;  1PSR A;  1DF0 B;  2OTG C;  2QAC A;  1UHJ A;  2VRG A;  2OPO A;  2CTN A;  3CTN A;  5KSZ A;  3A4U B;  1R6P A;  3BXK A;  3I5I B;  2LUC A;  5G08 A;  2SAS A;  2GGM A;  1BOD A;  1SL7 A;  3TUY B;  1X02 A;  2BKH B;  1NX1 A;  1QVI Z;  2LCP A;  3I5H C;  1WDC B;  1XYD A;  2K7B A;  4PE4 A;  2KYC A;  1KK7 Y;  1YUR A;  1WRZ A;  1DJG A;  4DUQ A;  1MUX A;  3EVR A;  1MXL C;  1HQV A;  1F71 A;  2JNF A;  1B8C A;  4ICB A;  3BYA A;  2R2I A;  2H61 C;  2RGI A;  1SPY A;  2BBM A;  2EC6 C;  2K7C A;  2I2R E;  2ZFD A;  4GGF C;  4HSZ A;  5AXI A;  1M63 B;  1DJZ A;  2M29 A;  2NZ0 A;  1V1G A;  1UWO A;  2JTT A;  1EG3 A;  3VRQ A;  2Y1N A;  3F45 A;  1GGW A;  4USL A;  2MAZ A;  1IGV A;  2BE6 A;  2BKI B;  2LAP A;  3LK1 A;  4U8D A;  3PM8 A;  5DKQ A;  5JOL A;  1NCZ A;  5K89 A;  3D0Y B;  1B8L A;  1LXF C;  3JVT C;  5JJG A;  2Y5I A;  1AVS A;  4XJK A;  2L0P A;  3SG5 A;  2MLE C;  1SL8 A;  1MXE A;  1ZUZ A;  3IQQ A;  1KK7 Z;  2F33 A;  3PAL A;  1YRU B;  2JWW A;  1TN4 A;  2EGD A;  2JOJ A;  3BOW A;  1SCM C;  3WNX B;  2LHI A;  4HRE E;  2JXL A;  4YRU A;  3KF9 A;  3IQO A;  1U5I A;  2NCP A;  3I5G B;  2GGZ A;  1BMO A;  1RFJ A;  3LL8 B;  4OKH A;  2OTG B;  3A8R A;  1SW8 A;  1LA0 A;  5J3X A;  3EK8 A;  5CSF A;  3FIA A;  5ER4 X;  5DKR A;  3SG4 A;  2KQ6 A;  1CFF A;  1KQM B;  2ZRT A;  1CFC A;  2KDH A;  1CDL A;  1H4B A;  5FYX A;  1GQM A;  3BUW B;  4GGN A;  1C7V A;  2WCF A;  5HYD A;  2ZKM X;  3CR4 X;  1PK0 D;  5DKN A;  1K90 D;  1R2U A;  1DJX A;  2PSR A;  1QXP A;  1LVC D;  1RTP 1;  1CLM A;  1NCY A;  1RWY A;  2IS9 A;  5TNC A;  2BCA A;  3TUY C;  1QV0 A;  1JC2 A;  1EG4 A;  1WDC C;  1SK6 D;  3GOF A;  4PE1 A;  3WXA A;  1EL4 A;  2KFG A;  2OS8 C;  4R1E A;  3O4Y A;  2JC2 A;  1UHK A;  1ZAC A;  5I2Q A;  1DJI A;  1BF5 A;  3FWB A;  1LKJ A;  4XJK B;  1A4P A;  4PE7 A;  1JF0 A;  1MR8 A;  4YI8 A;  2PAS A;  2JQ6 A;  4MZK A;  1NX0 A;  2M97 A;  2K2F A;  1DGU A;  4MLW A;  1MWN A;  4MRX A;  3OX6 A;  4PCW A;  4UPG A;  2G9B A;  1YRT B;  1J7P A;  3CWG A;  1M31 A;  1MF8 B;  1QJT A;  1U5I B;  1K9K A;  1YUU A;  2F3Z A;  2M7N A;  3CLN A;  2BCX A;  2JT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...