2OTGB

Rigor-like structures of muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
141
structure length
141
Chain Sequence
PQKQIQEMKEAFTMIDQNRDGFIDINDLKEMFSSLGRTPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFGMFDELDTKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIKGSGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
publication title Rigor-like Structures from Muscle Myosins Reveal Key Mechanical Elements in the Transduction Pathways of This Allosteric Motor.
pubmed doi rcsb
molecule tags Contractile protein
total genus 36
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2otgB02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2otgB01
2FCEA 1S5GZ 1SRAA 1WY9A 3QRXA 5DKQA 1CDPA 1K8UA 1MQ1A 5HKYA 2KFFA 1CLMA 4N1GA 2K7CA 3JVTB 1YX8A 1S1EA 2KNEA 2MRDA 2KI6C 2JPTA 3EKJA 2F8PA 2BE4A 3BUOB 3CR5X 3DF0A 4WQ3A 3O4YA 2MA2A 1F55A 1S3PA 1FI5A 1EG3A 3KEVA 2KI6D 2I7AA 1KWOC 1BJFA 1KFUS 1SL8A 2EC6C 3PALA 1LKJA 4DRWA 1CLBA 2KI4B 2L4HA 3FWCA 3BXKA 1IKUA 2WNDA 3SIBA 1ZMZA 1CMFA 1K9KA 2O60A 1NCXA 2KGRA 2OTGC 5DKNA 1TNPA 4GNKB 1M39A 1NCYA 4OV2A 5HLOA 3OX5A 3OX6A 1UURA 3ZNIA 2BECA 1WRLA 4OR9B 2EGDA 3O78A 1B47A 1RWYA 3EVVA 4IL1A 1IQ5A 4USLA 4CFRA 5I8NA 1KWOB 4OCIA 2JULA 1OSAA 1OOJA 2EC6B 2LNKA 2M7NA 1YTZC 2HETA 2LHLA 1NPQA 1DJWA 1PULA 1B9AA 2KOTA 4CIDA 5ER5A 2JWWA 1WDCC 2OTGB 4M2PA 3GK2A 5KU1A 1B8RA 2AAOA 4F0ZB 2EHBA 2KGBC 2LLSA 2LM5A 2V53A 4MN0A 3BYAA 4GBAA 2AMIA 2M1KB 4QJ3B 4YGAA 1B1GA 2KAYA 4U8DA 4A4CA 2HPSA 1C7VA 4MZJA 1S6CA 1JSAA 1YVLA 2CNPA 1YR5A 2KAXA 5HYDA 1AJ4A 1E8AA 3RLZA 1MHOA 3NXAA 4PE4A 3KHEA 4YBHB 2Y5IA 5AXIA 1G4YR 1C7WA 3CLNA 5I2LA 1WDCB 3JTDC 1H4BA 2GGZA 3EVUA 2PVBA 4YGBB 4TNCA 4I5LB 1NWDA 1JBAA 3SJSA 1RTP1 2LMUA 2FJUB 1A29A 3K21A 3EK7A 3TUYC 2F2PA 4MRXA 1H8BA 3I5HC 3HX4A 1CDMA 1KQMC 2L4IA 2JOJA 3PLFB 1J1EA 4GFTA 1XYDA 1SCMC 3NSLA 3VRRA 1EJ3A 4CLNA 1W7IB 1ZOTB 1L2OC 3CR2A 2CXJA 2OPOA 1TN4A 2JQ6A 1UHJA 2DOQA 5KSZA 2JT3A 3JTDB 2COLB 1M46A 1OE9B 1FF1A 1S6JA 2JTZA 1XA5A 1CFDA 4ZCVA 1K9PA 1AJ5A 1QLKA 3RM1A 5PALA 1TTXA 2L51A 4MRYA 1U5IB 2HF5A 2RGIA 2KSPA 3LK1A 2BCXA 2AUCA 1Y0VH 2M1UA 2Y4QA 4M2OA 4PE7A 1TOPA 1F54A 3I5HB 5AANA 3OHMB 2F33A 1KQMB 1PSBA 2LMVA 3DVMA 1TNXA 1DJIA 4NDBA 1JWDA 2JU0A 2KHNA 1IGVA 3LL8B 1FBVA 4GGFC 4MLWA 1TCOB 1F4QA 3VGOA 1SYMA 4YI9A 1PVAA 4PHMA 2JRFA 3AKBA 3CR4X 1KFXL 5CSIA 2BBMA 2NZ0A 1LA0A 1YRUB 2MHHA 1ZFSA 4YRUA 2CTNA 1KK7Y 2PMYA 3DF0B 1KK8C 1BR1B 1J7QA 1F8HA 2Q91A 3AAJA 4N1FA 1SNLA 5CSJA 2HQWA 4NQGA 1K94A 1K96A 1K9UA 1NX2A 1RECA 1NSHA 1G33A 3NSKA 1QV1A 3PM8A 3BUXB 2MLFC 4GGFA 1B4CA 1SCVA 1BODA 1QVIZ 5HLVA 4PHNA 3WHTB 3ICBA 1BG1A 4XJKA 2K7BA 3I5FC 2K8MB 2GGMA 3FWBA 2CCMA 2M0RA 2M9GA 1J7OA 2WCFA 1WRZA 1RFJA 2LCPA 4MVFA 2L50A 3TZ1A 1IQ3A 2WORA 4I5JA 3HCMA 5HKWA 3CS1A 4OKHA 1TNWA 1NX1A 1SR6C 1FW4A 2LAPA 5AEQA 1QX5B 2LVJA 1DF0B 2LLTA 3KPXA 1F71A 3DVEA 4P5OE 5K89A 2Y1MA 4HRGA 4ETOA 1IWQA 3SG4A 1Y1XA 3LLEA 3I5FB 2BCBA 4ORCB 1F70A 1MF8B 1XFWO 1DTLA 2KQYA 1UHIA 4PE0A 1LA3A 1DF0A 1UP5A 5CPVA 2OS8C 3PSRA 1KSMA 2ZFDA 3FS7A 1SBJA 4PDZA 2JZIA 4MZKA 1IH0A 1UHHA 3SG5A 1R6PA 1FPWA 1L7ZA 1DJGA 1WLMA 5BPJA 1SKTA 4BY4A 4C0LA 2TN4A 1UWOA 1YUUA 2ZNEA 3CZTX 2L5XB 1DGVA 4E68A 4FQOA 1K95A 1N0YA 2KFHA 1CFPA 1YUTA 1LINA 1TRFA 2Y1NA 3KO0A 1CDNA 5HKZA 3IQOA 2JC2A 1JUOA 3F45A 1NIWA 2BBNA 3D0YA 1SL7A 2OS8B 1K2HA 2JNFA 1RK9A 4A4BA 1OMVA 2M29A 4YGDB 1QXPA 4C0KA 1EXRA 4HRHA 1IJ6A 1B8CA 5IBWA 1QTXA 3A4UB 1R2UA 1UHKA 1QV0A 1YX7A 1Y1UA 5CSFA 1QX2A 5B8IB 3SIAA 3PN7C 4ZCUA 5J3XA 2BKHB 1AP4A 1S5GY 2PASA 4FTGA 4HREE 2LVVA 1LXFC 2JXLA 4MSPA 1CB1A 1BF5A 1IG5A 4UPGA 2BCAA 3VRNA 1CM4A 1KQVA 3CGAA 1BT6A 1S26D 1A03A 1SL9A 1V1GA 1Q80A 4Q04A 3EKHA 4PHJA 1K93D 1SK6D 3BUWB 1Y1AA 1PRWA 3PN7B 3TUYB 5JJGA 2PRUA 1SY9A 5CSNA 2JTTA 2KBMA 3SG7A 1NUBA 2LE9B 3TDIA 2K7DA 4QJ5B 1EG4A 1SCMB 1B8LA 2NCPA 4N5XA 1L2OB 1J55A 3LCPC 1ZACA 1MXLC 1RROA 4PALA 5AFPA 1DGUA 3DD4A 4WQ2A 1BOCA 3TDUA 1KSOA 1N65A 3WXAA 2ZKMX 4OVNF 1DT7B 5KTYA 1B7TY 4ORAB 1D1OA 1NCZA 2KDHA 1CFFA 2KFGA 5D69A 1CMGA 1GGZA 2QPTA 2LUXA 2I94A 2QACA 2SASA 3WHUB 1XO5A 3SG2A 3GK1A 1GGWA 1XFZO 1G8IA 4PCWA 4XYNA 1BMOA 3TS5C 1DJXA 5AERA 2BKIB 1OMRA 1KFUL 3O6BA 4XJKB 1CNPA 4MZLA 3PATA 4DS7A 1UHNA 1XFUO 4PHKA 1DJYA 1JF0A 1QATA 2LMTA 1XVJA 3MSEB 4NDCA 3BQ3A 1NX3A 4YGCB 2KI4C 2VRGA 2LVIA 1IRJA 2R2IA 1S6IA 2MJWB 5ER4X 3OB2B 1KFXS 1GQMA 1KK8B 4D1EA 2K0JA 1ALVA 2K7OA 3KF9A 1NX0A 4GUKA 3TS5B 5DKRA 1MR8A 2L0PA 2Q4UA 1JFKA 1M63B 3BOWB 5I2QA 1WRKA 2IS9A 5JOLA 2PSRA 2JXCA 1NP8A 4JPZB 3PFVA 2LUCA 3GK4X 2HQ8A 2P6BB 1CDLA 1UUSA 4R1EA 1BR4B 4NDDA 2LP3A 3BOWA 2F3YA 2L98A 3IF7A 1TCFA 5GQQC 2K2FA 4HSZA 3I5IC 1OQPA 4MBEA 1AK8A 1A4PA 5G08A 1J7PA 1C07A 4YI8A 1K90D 3AAKA 1HQVA 1DMOA 2ZN9A 3NSOA 2G2BA 2KBIA 1ODBA 2CT9A 4WRIA 1CFCA 2H61C 2LLUA 4DUQA 4P2YB 1SR6B 1MXEA 1B7TZ 3EK4A 2I2RE 1YVHA 2LHIA 3LK0A 1PSRA 1WLZA 1TIZA 1J7RA 2LVKA 3D0YB 1XFYO 2BL0C 2MAZA 4C0JA 2WC8A 3BUNB 1XK4C 3CTNA 1KK7Z 4QJ4B 3IQQA 4JQ0D 1PALA 1QIWA 4YGEB 3DVJA 3I5IB 3SG6A 4ORBB 1QS7A 1CLLA 4GPLB 3OB1B 1QIVA 2ISDA 4JWQA 1YURA 4BY5A 1M31A 2O5GA 4AQJA 2A4JA 4I5NB 1MUXA 1Y6WA 2F2OA 1MWNA 2ZNDA 2D8NA 3EK8A 4DCKA 1GJYA 1DJZA 2BL0B 2FOTA 2ZRSA 1KCYA 1YUSA 1LVCD 2KYFA 1DVIA 2H61A 1NYAA 1QASA 3EVRA 2WCBA 3C1VA 2K2AA 1A2XA 2FCDA 1IJ5A 1A75B 2F3ZA 2LC5A 2H2KA 2NLNA 1ALWA 1RJVA 3VROA 1XK4A 2NXQA 2NCOA 2KYCA 2E6WA 1PK0D 1AVSA 4ICBA 4PE1A 1AHRA 3O2PA 5D7FA 2L2EA 1W7JB 2GV5A 1A75A 3M0WA 1ZUZA 3I5GC 1CTRA 4MEWA 1CKKA 3TDZA 1QVIY 1YRTB 2CBLA 2JT8A 1SW8A 1V1FA 3A8RA 1SPYA 2MLEC 2WOSA 2E30A 3WNXB 1EL4A 1X02A 3VRQA 1XFXO 4CFQA 2WCEA 1JF2A 4AQIA 4L9MA 4CPVA 2ZRTA 1PVBA 5F6TA 3DVKA 2MBXA 2M97A 3FIAA 3VRPA 5I2OA 2KAVA 2KQ6A 1J1DA 1DJHA 2LP2A 1SMGA 1HT9A 2JT0A 4M2QA 3I5GB 2I18A 1QX7A 2SCPA 3SG3A 2B1UA 3H4SE 2BE6A 1N2DA 3GOFA 3CWGA 1XFVO 2JNXA 3E3RA 3NSIA 3BUMB 1FI6A 1BLQA 2M8UA 4GAOA 5FYXA 1OZSA 1S36A 3JVTC 1QLSA 1U5IA 1AUIB 1JFJA 1BU3A 2M3WA 1QJTA 3OP0A 1TNQA 4I5KA 3ZWHA 2LV7A 2PALA 4DIRA 1JC2A 2M49B 2K61A 4AOMA 3AKAA 1CM1A 1OMDA 2M7LA 5TNCA 1EH2A 1OZOA 1VRKA 2G9BA 2ZN8A 1F4OA 4GGNA 3D10A 2LANA 1M45A
chains in the Genus database with same CATH superfamily
1XFRA 1S5GZ 1SRAA 1WY9A 2FCEA 3QRXA 1CDPA 2K60A 5DKQA 3O4XA 1K8UA 1MQ1A 5HKYA 2KFFA 1CLMA 4N1GA 2K7CA 3JVTB 1YX8A 1S1EA 2KNEA 3D78A 2MRDA 3QMEA 1TUZA 2JPTA 2KI6C 4PT1A 5I94A 3EKJA 2F8PA 2BE4A 3BUOB 3CR5X 3DF0A 4WQ3A 3O4YA 2MA2A 1F55A 1IIOA 1S3PA 1FI5A 1EG3A 3KEVA 2KI6D 2I7AA 1KWOC 1BJFA 1KFUS 1SL8A 2EC6C 3PALA 1LKJA 4DRWA 1CLBA 2KI4B 2L4HA 3FWCA 3BXKA 1IKUA 2WNDA 5DICA 3SIBA 1ZMZA 1CMFA 1K9KA 2O60A 1NCXA 2KGRA 2OTGC 5DKNA 1TNPA 4GNKB 1M39A 1NCYA 4OV2A 2QDIA 5HLOA 3OX5A 3OX6A 3CZ1A 1UURA 3ZNIA 2BECA 1WRLA 3B87A 4OR9B 2EGDA 3O78A 1B47A 1RWYA 3EVVA 3N7HA 1IQ5A 4IL1A 4USLA 4CFRA 5I8NA 1KWOB 4OCIA 2JULA 1OSAA 1OOJA 2EC6B 2LNKA 4INWA 2M7NA 1YTZC 2HETA 1OOHA 2LHLA 1NPQA 1DJWA 1PULA 1B9AA 2KOTA 4CIDA 5ER5A 2JWWA 1WDCC 2OTGB 4M2PA 3GK2A 5KU1A 1B8RA 2AAOA 4F0ZB 2EHBA 2KGBC 2LLSA 2LM5A 2V53A 4MN0A 5EL2A 3BYAA 4GBAA 2AMIA 2M1KB 4QJ3B 4YGAA 1B1GA 2KAYA 4U8DA 4A4CA 2HPSA 1C7VA 4MZJA 1S6CA 1JSAA 1YVLA 2CNPA 1OW4A 1YR5A 2KAXA 5HYDA 1AJ4A 2KPHA 3D77A 1E8AA 3RLZA 1MHOA 3NXAA 4PE4A 3KHEA 4YBHB 2Y5IA 5AXIA 1G4YR 1C7WA 3CLNA 2QEOA 5I2LA 3DXLA 1WDCB 3JTDC 1H4BA 2WCLA 1W9ZA 2GGZA 3EVUA 2PVBA 4YGBB 4TNCA 4I5LB 1NWDA 1JBAA 5FI2A 3SJSA 1RTP1 2LMUA 2FJUB 3R72A 1A29A 3K21A 4KYNA 3EK7A 3TUYC 2F2PA 4MRXA 1H8BA 3I5HC 3FE8A 3HX4A 1CDMA 1KQMC 2L4IA 2JOJA 3PLFB 1J1EA 4GFTA 1XYDA 1SCMC 3NSLA 3VRRA 1EJ3A 4CLNA 1W7IB 1ZOTB 1L2OC 3CR2A 2CXJA 2OPOA 1TN4A 2JQ6A 2BAPA 1UHJA 2DOQA 5KSZA 2JT3A 2WCMA 3JTDB 2COLB 1M46A 1OE9B 1FF1A 1S6JA 2JTZA 1XA5A 1CFDA 4ZCVA 1K9PA 1AJ5A 1QLKA 3RM1A 5PALA 1TTXA 2L51A 4MRYA 1U5IB 2HF5A 2RGIA 2KSPA 3LK1A 2BCXA 2AUCA 1Y0VH 2M1UA 2Y4QA 3B88A 4M2OA 2KLEA 1TOPA 4PE7A 1F54A 1Z2CB 3I5HB 5AANA 3OHMB 2F33A 1KQMB 1PSBA 2WC5A 2LMVA 3DVMA 3SS3A 1TNXA 1DJIA 4NDBA 1JWDA 2JU0A 2KHNA 1IGVA 3LL8B 1FBVA 4GGFC 4MLWA 1TCOB 4JKTA 1F4QA 3VGOA 1SYMA 4YI9A 1PVAA 2QEHA 4PHMA 3CABA 1GM0A 2JRFA 3AKBA 3IVTA 3CR4X 1KFXL 5CSIA 1P28A 2BBMA 2NZ0A 1LA0A 3L47A 1YRUB 2MHHA 3CYZA 1ZFSA 4YRUA 3CZ0A 3K1EA 2CTNA 1KK7Y 2PMYA 3DF0B 1KK8C 1BR1B 1J7QA 1F8HA 2Q91A 3AAJA 4N1FA 1SNLA 5CSJA 2HQWA 4NQGA 1K94A 1K96A 1K9UA 1NX2A 1RECA 1NSHA 1G33A 3NSKA 1QV1A 3PM8A 3BUXB 2MLFC 4GGFA 1B4CA 1SCVA 1BODA 1QVIZ 5HLVA 4PHNA 3WHTB 3ICBA 1BG1A 4XJKA 2GTEA 2K7BA 3I5FC 2K8MB 3B86A 2GGMA 3FWBA 2CCMA 1TWOA 2M0RA 2M9GA 1J7OA 2WCFA 1WRZA 1RFJA 2LCPA 4MVFA 2L50A 3TZ1A 1IQ3A 2WORA 4I5JA 3HCMA 5HKWA 3L4LA 3BJHA 3CS1A 1Z4HA 4OKHA 1TNWA 1NX1A 1SR6C 1FW4A 2LAPA 5AEQA 1QX5B 2LVJA 1DF0B 2LLTA 1C3ZA 3KPXA 1F71A 2WC6A 3DVEA 4P5OE 5K89A 2Y1MA 4HRGA 4ETOA 1IWQA 1OOIX 3SG4A 1Y1XA 3LLEA 3I5FB 2BCBA 3PJIA 2L5YA 4ORCB 1F70A 1MF8B 1XFWO 1DTLA 2KQYA 1UHIA 4PE0A 1LA3A 1DF0A 3D75A 1UP5A 5CPVA 2OS8C 3PSRA 1KSMA 2ZFDA 3FS7A 1SBJA 4PDZA 2JZIA 4MZKA 1IH0A 1UHHA 3SG5A 1R6PA 1FPWA 1L7ZA 1DJGA 1WLMA 5BPJA 1SKTA 4BY4A 2WCHA 4C0LA 2TN4A 1UWOA 1YUUA 2ZNEA 2ERBA 2L5XB 1DGVA 3CZTX 4E68A 4FQOA 1K95A 1N0YA 2KFHA 1CFPA 1YUTA 1LINA 1TRFA 3D74A 3B7AA 2Y1NA 3KO0A 1C3YA 1CDNA 5HKZA 3IQOA 2JC2A 1JUOA 3F45A 1NIWA 2BBNA 3D0YA 1SL7A 2OS8B 1K2HA 2JNFA 4INXA 1RK9A 4A4BA 1OMVA 2YGUA 2M29A 4YGDB 1QXPA 4C0KA 1EXRA 4HRHA 1IJ6A 1B8CA 3CDNA 1QTXA 4IJ7A 3A4UB 1R2UA 1UHKA 3V2LA 5IBWA 1QV0A 1YX7A 1Y1UA 5CSFA 1QX2A 5B8IB 3SIAA 3PN7C 4ZCUA 5J3XA 2BKHB 3NHTA 1AP4A 1S5GY 2PASA 4FTGA 4HREE 2LVVA 3D73A 1LXFC 2JXLA 3Q8IA 3FE6A 4MSPA 1CB1A 1BF5A 1IG5A 4UPGA 2BCAA 3VRNA 1CM4A 1KQVA 3CGAA 1BT6A 1S26D 1A03A 1SL9A 1V1GA 1Q80A 4Q04A 3EKHA 4PHJA 4OZDA 1K93D 1SK6D 3BUWB 1Y1AA 1PRWA 3PN7B 3TUYB 5JJGA 2PRUA 1SY9A 5CSNA 2JTTA 2KBMA 3SG7A 3UO9A 1NUBA 2LE9B 3TDIA 2K7DA 4QJ5B 1EG4A 1SCMB 1B8LA 2NCPA 5HL1A 4N5XA 1L2OB 1J55A 3LCPC 1ZACA 1MXLC 1RROA 2PYQA 4PALA 5AFPA 1DGUA 3DD4A 4WQ2A 1BOCA 3TDUA 1KSOA 1N65A 3WXAA 2ZKMX 4OVNF 1DT7B 2QEVA 5KTYA 1B7TY 4ORAB 1DEKA 1D1OA 1NCZA 2KDHA 1CFFA 2KFGA 3L4AA 3NHIA 5D69A 1CMGA 3CZ2A 1GGZA 2QPTA 2LUXA 2I94A 2QACA 2SASA 3WHUB 1XO5A 2WCJA 3GK1A 3SG2A 1XFZO 1GGWA 1G8IA 4PCWA 4XYNA 1BMOA 3TS5C 1DJXA 5AERA 2BKIB 1OMRA 1KFUL 3O6BA 4XJKB 1CNPA 4MZLA 3PATA 4DS7A 3SS5A 1UHNA 5FI6A 1XFUO 4PHKA 1DJYA 1JF0A 1QATA 2LMTA 1XVJA 3MSEB 5FI7A 4NDCA 3BQ3A 1NX3A 4YGCB 2KI4C 2VRGA 2LVIA 1IRJA 1LS8A 1T14A 2R2IA 1S6IA 2MJWB 5ER4X 3OB2B 1KFXS 1ORGA 1GQMA 1KK8B 2QEBA 2K0JA 4D1EA 1ALVA 2K7OA 3KF9A 1NX0A 1DC1A 4GUKA 3OGNA 3TS5B 5DKRA 2PQLA 1MR8A 2L0PA 2Q4UA 3BFAA 1JFKA 1M63B 3BOWB 5I2QA 1WRKA 2IS9A 5JOLA 2PSRA 2JXCA 1TUJA 1NP8A 4JPZB 3PFVA 2LUCA 3GK4X 2HQ8A 2P6BB 1CDLA 1UUSA 4R1EA 1BR4B 4NDDA 3BFHA 2LP3A 3BOWA 2F3YA 2L98A 3IF7A 3SS4A 1TCFA 5GQQC 3VB1A 2K2FA 4HSZA 3I5IC 1OQPA 4MBEA 1AK8A 1A4PA 5G08A 1J7PA 1C07A 4YI8A 3S0GA 1K90D 3AAKA 1HQVA 1DMOA 2KLDA 2ZN9A 3NSOA 2JPOA 2G2BA 2KBIA 1ODBA 5D3OA 1DQEA 3S0BA 2CT9A 2P71A 4WRIA 2H61C 1CFCA 2LLUA 4DUQA 4P2YB 1SR6B 1MXEA 1B7TZ 3EK4A 2I2RE 1YVHA 2LHIA 3LK0A 1OOFA 1PSRA 1WLZA 1TIZA 1J7RA 2LVKA 3D0YB 3OBVA 1XFYO 2BL0C 2MAZA 4C0JA 2WC8A 3BUNB 1XK4C 3CTNA 1KK7Z 4QJ4B 3RZSA 3IQQA 4JQ0D 1PALA 1QIWA 4YGEB 2WCKA 3DVJA 3I5IB 3SG6A 4ORBB 1QS7A 1CLLA 4GPLB 3OB1B 1QIVA 2ISDA 4JWQA 1YURA 4BY5A 4F7FA 3R1VA 1QWVA 1M31A 2O5GA 4AQJA 2A4JA 4I5NB 3EG5B 1MUXA 1Y6WA 2F2OA 1MWNA 2ZNDA 2D8NA 3EK8A 4DCKA 1GJYA 1DJZA 2BL0B 2FOTA 2ZRSA 1KCYA 1YUSA 3FE9A 1LVCD 2KYFA 1DVIA 2H61A 1NYAA 1QASA 3EVRA 2WCBA 3C1VA 3S0DA 2K2AA 1A2XA 3B6XA 2FCDA 1IJ5A 1A75B 2F3ZA 3S0EA 2LC5A 2H2KA 2NLNA 1ALWA 1RJVA 3VROA 1XK4A 2NXQA 2NCOA 2KYCA 2E6WA 1PK0D 1AVSA 2FJYA 4ICBA 4PE1A 3S0AA 1AHRA 3O2PA 5D7FA 2L2EA 1W7JB 2GV5A 1A75A 3D76A 1ZUZA 3M0WA 3I5GC 3UNWA 3R1OA 1CTRA 1OOGA 4MEWA 3DY9A 3BFBA 1CKKA 2P70A 1QVIY 1YRTB 3TDZA 1SSEB 2CBLA 2JT8A 1SW8A 1V1FA 3A8RA 1SPYA 2MLEC 2WOSA 1DELA 2E30A 3DYEA 3WNXB 1EL4A 1X02A 3VRQA 1XFXO 4CFQA 2WCEA 4FQTA 1JF2A 4AQIA 4L9MA 4CPVA 2ZRTA 1PVBA 5F6TA 3DVKA 3R1PA 2M97A 2MBXA 3FIAA 3VRPA 5I2OA 2KAVA 2KQ6A 1J1DA 1DJHA 2LP2A 1SMGA 1HT9A 2JT0A 4M2QA 2H8VA 3I5GB 2I18A 1QX7A 2SCPA 3SG3A 2B1UA 3H4SE 2BE6A 3NGVA 1N2DA 3GOFA 2L2CA 3CWGA 1XFVO 2JNXA 3E3RA 3NSIA 3BUMB 1FI6A 1BLQA 2M8UA 4GAOA 5FYXA 1OZSA 1S36A 3JVTC 1QLSA 1U5IA 1AUIB 2BNXA 1JFJA 1BU3A 2M3WA 1QJTA 3OP0A 1TNQA 4I5KA 3ZWHA 2LV7A 2PALA 4DIRA 3S0FA 2M49B 2K61A 4AOMA 1JC2A 3AKAA 1CM1A 4JD9A 1OMDA 2M7LA 5TNCA 1EH2A 3DZTA 1OZOA 3PM2A 1VRKA 2G9BA 2ZN8A 1F4OA 4GGNA 3D10A 2LANA 1M45A
chains in the Genus database with same CATH topology
2FCEA 1S5GZ 1SRAA 1WY9A 3QRXA 5DKQA 1CDPA 1K8UA 1MQ1A 5HKYA 2KFFA 1CLMA 4N1GA 2K7CA 3JVTB 1YX8A 1S1EA 2KNEA 2MRDA 2KI6C 2JPTA 3EKJA 2F8PA 2BE4A 3BUOB 3CR5X 3DF0A 4WQ3A 3O4YA 2MA2A 1F55A 1S3PA 1FI5A 1EG3A 3KEVA 2KI6D 2I7AA 1KWOC 1BJFA 1KFUS 1SL8A 2EC6C 3PALA 1LKJA 4DRWA 1CLBA 2KI4B 2L4HA 3FWCA 3BXKA 1IKUA 2WNDA 3SIBA 1ZMZA 1CMFA 1K9KA 2O60A 1NCXA 2KGRA 2OTGC 5DKNA 1TNPA 4GNKB 1M39A 1NCYA 4OV2A 5HLOA 3OX5A 3OX6A 1UURA 3ZNIA 2BECA 1WRLA 4OR9B 2EGDA 3O78A 1B47A 1RWYA 3EVVA 4IL1A 1IQ5A 4USLA 4CFRA 5I8NA 1KWOB 4OCIA 2JULA 1OSAA 1OOJA 2EC6B 2LNKA 2M7NA 1YTZC 2HETA 2LHLA 1NPQA 1DJWA 1PULA 1B9AA 2KOTA 4CIDA 5ER5A 2JWWA 1WDCC 2OTGB 4M2PA 3GK2A 5KU1A 1B8RA 2AAOA 4F0ZB 2EHBA 2KGBC 2LLSA 2LM5A 2V53A 4MN0A 3BYAA 4GBAA 2AMIA 2M1KB 4QJ3B 4YGAA 1B1GA 2KAYA 4U8DA 4A4CA 2HPSA 1C7VA 4MZJA 1S6CA 1JSAA 1YVLA 2CNPA 1YR5A 2KAXA 5HYDA 1AJ4A 1E8AA 3RLZA 1MHOA 3NXAA 4PE4A 3KHEA 4YBHB 2Y5IA 5AXIA 1G4YR 1C7WA 3CLNA 5I2LA 1WDCB 3JTDC 1H4BA 2GGZA 3EVUA 2PVBA 4YGBB 4TNCA 4I5LB 1NWDA 1JBAA 3SJSA 1RTP1 2LMUA 2FJUB 1A29A 3K21A 3EK7A 3TUYC 2F2PA 4MRXA 1H8BA 3I5HC 3HX4A 1CDMA 1KQMC 2L4IA 2JOJA 3PLFB 1J1EA 4GFTA 1XYDA 1SCMC 3NSLA 3VRRA 1EJ3A 4CLNA 1W7IB 1ZOTB 1L2OC 3CR2A 2CXJA 2OPOA 1TN4A 2JQ6A 1UHJA 2DOQA 5KSZA 2JT3A 3JTDB 2COLB 1M46A 1OE9B 1FF1A 1S6JA 2JTZA 1XA5A 1CFDA 4ZCVA 1K9PA 1AJ5A 1QLKA 3RM1A 5PALA 1TTXA 2L51A 4MRYA 1U5IB 2HF5A 2RGIA 2KSPA 3LK1A 2BCXA 2AUCA 1Y0VH 2M1UA 2Y4QA 4M2OA 4PE7A 1TOPA 1F54A 3I5HB 5AANA 3OHMB 2F33A 1KQMB 1PSBA 2LMVA 3DVMA 1TNXA 1DJIA 4NDBA 1JWDA 2JU0A 2KHNA 1IGVA 3LL8B 1FBVA 4GGFC 4MLWA 1TCOB 1F4QA 3VGOA 1SYMA 4YI9A 1PVAA 4PHMA 2JRFA 3AKBA 3CR4X 1KFXL 5CSIA 2BBMA 2NZ0A 1LA0A 1YRUB 2MHHA 1ZFSA 4YRUA 2CTNA 1KK7Y 2PMYA 3DF0B 1KK8C 1BR1B 1J7QA 1F8HA 2Q91A 3AAJA 4N1FA 1SNLA 5CSJA 2HQWA 4NQGA 1K94A 1K96A 1K9UA 1NX2A 1RECA 1NSHA 1G33A 3NSKA 1QV1A 3PM8A 3BUXB 2MLFC 4GGFA 1B4CA 1SCVA 1BODA 1QVIZ 5HLVA 4PHNA 3WHTB 3ICBA 1BG1A 4XJKA 2K7BA 3I5FC 2K8MB 2GGMA 3FWBA 2CCMA 2M0RA 2M9GA 1J7OA 2WCFA 1WRZA 1RFJA 2LCPA 4MVFA 2L50A 3TZ1A 1IQ3A 2WORA 4I5JA 3HCMA 5HKWA 3CS1A 4OKHA 1TNWA 1NX1A 1SR6C 1FW4A 2LAPA 5AEQA 1QX5B 2LVJA 1DF0B 2LLTA 3KPXA 1F71A 3DVEA 4P5OE 5K89A 2Y1MA 4HRGA 4ETOA 1IWQA 3SG4A 1Y1XA 3LLEA 3I5FB 2BCBA 4ORCB 1F70A 1MF8B 1XFWO 1DTLA 2KQYA 1UHIA 4PE0A 1LA3A 1DF0A 1UP5A 5CPVA 2OS8C 3PSRA 1KSMA 2ZFDA 3FS7A 1SBJA 4PDZA 2JZIA 4MZKA 1IH0A 1UHHA 3SG5A 1R6PA 1FPWA 1L7ZA 1DJGA 1WLMA 5BPJA 1SKTA 4BY4A 4C0LA 2TN4A 1UWOA 1YUUA 2ZNEA 3CZTX 2L5XB 1DGVA 4E68A 4FQOA 1K95A 1N0YA 2KFHA 1CFPA 1YUTA 1LINA 1TRFA 2Y1NA 3KO0A 1CDNA 5HKZA 3IQOA 2JC2A 1JUOA 3F45A 1NIWA 2BBNA 3D0YA 1SL7A 2OS8B 1K2HA 2JNFA 1RK9A 4A4BA 1OMVA 2M29A 4YGDB 1QXPA 4C0KA 1EXRA 4HRHA 1IJ6A 1B8CA 5IBWA 1QTXA 3A4UB 1R2UA 1UHKA 1QV0A 1YX7A 1Y1UA 5CSFA 1QX2A 5B8IB 3SIAA 3PN7C 4ZCUA 5J3XA 2BKHB 1AP4A 1S5GY 2PASA 4FTGA 4HREE 2LVVA 1LXFC 2JXLA 4MSPA 1CB1A 1BF5A 1IG5A 4UPGA 2BCAA 3VRNA 1CM4A 1KQVA 3CGAA 1BT6A 1S26D 1A03A 1SL9A 1V1GA 1Q80A 4Q04A 3EKHA 4PHJA 1K93D 1SK6D 3BUWB 1Y1AA 1PRWA 3PN7B 3TUYB 5JJGA 2PRUA 1SY9A 5CSNA 2JTTA 2KBMA 3SG7A 1NUBA 2LE9B 3TDIA 2K7DA 4QJ5B 1EG4A 1SCMB 1B8LA 2NCPA 4N5XA 1L2OB 1J55A 3LCPC 1ZACA 1MXLC 1RROA 4PALA 5AFPA 1DGUA 3DD4A 4WQ2A 1BOCA 3TDUA 1KSOA 1N65A 3WXAA 2ZKMX 4OVNF 1DT7B 5KTYA 1B7TY 4ORAB 1D1OA 1NCZA 2KDHA 1CFFA 2KFGA 5D69A 1CMGA 1GGZA 2QPTA 2LUXA 2I94A 2QACA 2SASA 3WHUB 1XO5A 3SG2A 3GK1A 1GGWA 1XFZO 1G8IA 4PCWA 4XYNA 1BMOA 3TS5C 1DJXA 5AERA 2BKIB 1OMRA 1KFUL 3O6BA 4XJKB 1CNPA 4MZLA 3PATA 4DS7A 1UHNA 1XFUO 4PHKA 1DJYA 1JF0A 1QATA 2LMTA 1XVJA 3MSEB 4NDCA 3BQ3A 1NX3A 4YGCB 2KI4C 2VRGA 2LVIA 1IRJA 2R2IA 1S6IA 2MJWB 5ER4X 3OB2B 1KFXS 1GQMA 1KK8B 4D1EA 2K0JA 1ALVA 2K7OA 3KF9A 1NX0A 4GUKA 3TS5B 5DKRA 1MR8A 2L0PA 2Q4UA 1JFKA 1M63B 3BOWB 5I2QA 1WRKA 2IS9A 5JOLA 2PSRA 2JXCA 1NP8A 4JPZB 3PFVA 2LUCA 3GK4X 2HQ8A 2P6BB 1CDLA 1UUSA 4R1EA 1BR4B 4NDDA 2LP3A 3BOWA 2F3YA 2L98A 3IF7A 1TCFA 5GQQC 2K2FA 4HSZA 3I5IC 1OQPA 4MBEA 1AK8A 1A4PA 5G08A 1J7PA 1C07A 4YI8A 1K90D 3AAKA 1HQVA 1DMOA 2ZN9A 3NSOA 2G2BA 2KBIA 1ODBA 2CT9A 4WRIA 1CFCA 2H61C 2LLUA 4DUQA 4P2YB 1SR6B 1MXEA 1B7TZ 3EK4A 2I2RE 1YVHA 2LHIA 3LK0A 1PSRA 1WLZA 1TIZA 1J7RA 2LVKA 3D0YB 1XFYO 2BL0C 2MAZA 4C0JA 2WC8A 3BUNB 1XK4C 3CTNA 1KK7Z 4QJ4B 3IQQA 4JQ0D 1PALA 1QIWA 4YGEB 3DVJA 3I5IB 3SG6A 4ORBB 1QS7A 1CLLA 4GPLB 3OB1B 1QIVA 2ISDA 4JWQA 1YURA 4BY5A 1M31A 2O5GA 4AQJA 2A4JA 4I5NB 1MUXA 1Y6WA 2F2OA 1MWNA 2ZNDA 2D8NA 3EK8A 4DCKA 1GJYA 1DJZA 2BL0B 2FOTA 2ZRSA 1KCYA 1YUSA 1LVCD 2KYFA 1DVIA 2H61A 1NYAA 1QASA 3EVRA 2WCBA 3C1VA 2K2AA 1A2XA 2FCDA 1IJ5A 1A75B 2F3ZA 2LC5A 2H2KA 2NLNA 1ALWA 1RJVA 3VROA 1XK4A 2NXQA 2NCOA 2KYCA 2E6WA 1PK0D 1AVSA 4ICBA 4PE1A 1AHRA 3O2PA 5D7FA 2L2EA 1W7JB 2GV5A 1A75A 3M0WA 1ZUZA 3I5GC 1CTRA 4MEWA 1CKKA 3TDZA 1QVIY 1YRTB 2CBLA 2JT8A 1SW8A 1V1FA 3A8RA 1SPYA 2MLEC 2WOSA 2E30A 3WNXB 1EL4A 1X02A 3VRQA 1XFXO 4CFQA 2WCEA 1JF2A 4AQIA 4L9MA 4CPVA 2ZRTA 1PVBA 5F6TA 3DVKA 2MBXA 2M97A 3FIAA 3VRPA 5I2OA 2KAVA 2KQ6A 1J1DA 1DJHA 2LP2A 1SMGA 1HT9A 2JT0A 4M2QA 3I5GB 2I18A 1QX7A 2SCPA 3SG3A 2B1UA 3H4SE 2BE6A 1N2DA 3GOFA 3CWGA 1XFVO 2JNXA 3E3RA 3NSIA 3BUMB 1FI6A 1BLQA 2M8UA 4GAOA 5FYXA 1OZSA 1S36A 3JVTC 1QLSA 1U5IA 1AUIB 1JFJA 1BU3A 2M3WA 1QJTA 3OP0A 1TNQA 4I5KA 3ZWHA 2LV7A 2PALA 4DIRA 1JC2A 2M49B 2K61A 4AOMA 3AKAA 1CM1A 1OMDA 2M7LA 5TNCA 1EH2A 1OZOA 1VRKA 2G9BA 2ZN8A 1F4OA 4GGNA 3D10A 2LANA 1M45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCE A;  1S5G Z;  1SRA A;  1WY9 A;  3QRX A;  5DKQ A;  1CDP A;  1K8U A;  1MQ1 A;  5HKY A;  2KFF A;  1CLM A;  4N1G A;  2K7C A;  3JVT B;  1YX8 A;  1S1E A;  2KNE A;  2MRD A;  2KI6 C;  2JPT A;  3EKJ A;  2F8P A;  2BE4 A;  3BUO B;  3CR5 X;  3DF0 A;  4WQ3 A;  3O4Y A;  2MA2 A;  1F55 A;  1S3P A;  1FI5 A;  1EG3 A;  3KEV A;  2KI6 D;  2I7A A;  1KWO C;  1BJF A;  1KFU S;  1SL8 A;  2EC6 C;  3PAL A;  1LKJ A;  4DRW A;  1CLB A;  2KI4 B;  2L4H A;  3FWC A;  3BXK A;  1IKU A;  2WND A;  3SIB A;  1ZMZ A;  1CMF A;  1K9K A;  2O60 A;  1NCX A;  2KGR A;  2OTG C;  5DKN A;  1TNP A;  4GNK B;  1M39 A;  1NCY A;  4OV2 A;  5HLO A;  3OX5 A;  3OX6 A;  1UUR A;  3ZNI A;  2BEC A;  1WRL A;  4OR9 B;  2EGD A;  3O78 A;  1B47 A;  1RWY A;  3EVV A;  4IL1 A;  1IQ5 A;  4USL A;  4CFR A;  5I8N A;  1KWO B;  4OCI A;  2JUL A;  1OSA A;  1OOJ A;  2EC6 B;  2LNK A;  2M7N A;  1YTZ C;  2HET A;  2LHL A;  1NPQ A;  1DJW A;  1PUL A;  1B9A A;  2KOT A;  4CID A;  5ER5 A;  2JWW A;  1WDC C;  2OTG B;  4M2P A;  3GK2 A;  5KU1 A;  1B8R A;  2AAO A;  4F0Z B;  2EHB A;  2KGB C;  2LLS A;  2LM5 A;  2V53 A;  4MN0 A;  3BYA A;  4GBA A;  2AMI A;  2M1K B;  4QJ3 B;  4YGA A;  1B1G A;  2KAY A;  4U8D A;  4A4C A;  2HPS A;  1C7V A;  4MZJ A;  1S6C A;  1JSA A;  1YVL A;  2CNP A;  1YR5 A;  2KAX A;  5HYD A;  1AJ4 A;  1E8A A;  3RLZ A;  1MHO A;  3NXA A;  4PE4 A;  3KHE A;  4YBH B;  2Y5I A;  5AXI A;  1G4Y R;  1C7W A;  3CLN A;  5I2L A;  1WDC B;  3JTD C;  1H4B A;  2GGZ A;  3EVU A;  2PVB A;  4YGB B;  4TNC A;  4I5L B;  1NWD A;  1JBA A;  3SJS A;  1RTP 1;  2LMU A;  2FJU B;  1A29 A;  3K21 A;  3EK7 A;  3TUY C;  2F2P A;  4MRX A;  1H8B A;  3I5H C;  3HX4 A;  1CDM A;  1KQM C;  2L4I A;  2JOJ A;  3PLF B;  1J1E A;  4GFT A;  1XYD A;  1SCM C;  3NSL A;  3VRR A;  1EJ3 A;  4CLN A;  1W7I B;  1ZOT B;  1L2O C;  3CR2 A;  2CXJ A;  2OPO A;  1TN4 A;  2JQ6 A;  1UHJ A;  2DOQ A;  5KSZ A;  2JT3 A;  3JTD B;  2COL B;  1M46 A;  1OE9 B;  1FF1 A;  1S6J A;  2JTZ A;  1XA5 A;  1CFD A;  4ZCV A;  1K9P A;  1AJ5 A;  1QLK A;  3RM1 A;  5PAL A;  1TTX A;  2L51 A;  4MRY A;  1U5I B;  2HF5 A;  2RGI A;  2KSP A;  3LK1 A;  2BCX A;  2AUC A;  1Y0V H;  2M1U A;  2Y4Q A;  4M2O A;  4PE7 A;  1TOP A;  1F54 A;  3I5H B;  5AAN A;  3OHM B;  2F33 A;  1KQM B;  1PSB A;  2LMV A;  3DVM A;  1TNX A;  1DJI A;  4NDB A;  1JWD A;  2JU0 A;  2KHN A;  1IGV A;  3LL8 B;  1FBV A;  4GGF C;  4MLW A;  1TCO B;  1F4Q A;  3VGO A;  1SYM A;  4YI9 A;  1PVA A;  4PHM A;  2JRF A;  3AKB A;  3CR4 X;  1KFX L;  5CSI A;  2BBM A;  2NZ0 A;  1LA0 A;  1YRU B;  2MHH A;  1ZFS A;  4YRU A;  2CTN A;  1KK7 Y;  2PMY A;  3DF0 B;  1KK8 C;  1BR1 B;  1J7Q A;  1F8H A;  2Q91 A;  3AAJ A;  4N1F A;  1SNL A;  5CSJ A;  2HQW A;  4NQG A;  1K94 A;  1K96 A;  1K9U A;  1NX2 A;  1REC A;  1NSH A;  1G33 A;  3NSK A;  1QV1 A;  3PM8 A;  3BUX B;  2MLF C;  4GGF A;  1B4C A;  1SCV A;  1BOD A;  1QVI Z;  5HLV A;  4PHN A;  3WHT B;  3ICB A;  1BG1 A;  4XJK A;  2K7B A;  3I5F C;  2K8M B;  2GGM A;  3FWB A;  2CCM A;  2M0R A;  2M9G A;  1J7O A;  2WCF A;  1WRZ A;  1RFJ A;  2LCP A;  4MVF A;  2L50 A;  3TZ1 A;  1IQ3 A;  2WOR A;  4I5J A;  3HCM A;  5HKW A;  3CS1 A;  4OKH A;  1TNW A;  1NX1 A;  1SR6 C;  1FW4 A;  2LAP A;  5AEQ A;  1QX5 B;  2LVJ A;  1DF0 B;  2LLT A;  3KPX A;  1F71 A;  3DVE A;  4P5O E;  5K89 A;  2Y1M A;  4HRG A;  4ETO A;  1IWQ A;  3SG4 A;  1Y1X A;  3LLE A;  3I5F B;  2BCB A;  4ORC B;  1F70 A;  1MF8 B;  1XFW O;  1DTL A;  2KQY A;  1UHI A;  4PE0 A;  1LA3 A;  1DF0 A;  1UP5 A;  5CPV A;  2OS8 C;  3PSR A;  1KSM A;  2ZFD A;  3FS7 A;  1SBJ A;  4PDZ A;  2JZI A;  4MZK A;  1IH0 A;  1UHH A;  3SG5 A;  1R6P A;  1FPW A;  1L7Z A;  1DJG A;  1WLM A;  5BPJ A;  1SKT A;  4BY4 A;  4C0L A;  2TN4 A;  1UWO A;  1YUU A;  2ZNE A;  3CZT X;  2L5X B;  1DGV A;  4E68 A;  4FQO A;  1K95 A;  1N0Y A;  2KFH A;  1CFP A;  1YUT A;  1LIN A;  1TRF A;  2Y1N A;  3KO0 A;  1CDN A;  5HKZ A;  3IQO A;  2JC2 A;  1JUO A;  3F45 A;  1NIW A;  2BBN A;  3D0Y A;  1SL7 A;  2OS8 B;  1K2H A;  2JNF A;  1RK9 A;  4A4B A;  1OMV A;  2M29 A;  4YGD B;  1QXP A;  4C0K A;  1EXR A;  4HRH A;  1IJ6 A;  1B8C A;  5IBW A;  1QTX A;  3A4U B;  1R2U A;  1UHK A;  1QV0 A;  1YX7 A;  1Y1U A;  5CSF A;  1QX2 A;  5B8I B;  3SIA A;  3PN7 C;  4ZCU A;  5J3X A;  2BKH B;  1AP4 A;  1S5G Y;  2PAS A;  4FTG A;  4HRE E;  2LVV A;  1LXF C;  2JXL A;  4MSP A;  1CB1 A;  1BF5 A;  1IG5 A;  4UPG A;  2BCA A;  3VRN A;  1CM4 A;  1KQV A;  3CGA A;  1BT6 A;  1S26 D;  1A03 A;  1SL9 A;  1V1G A;  1Q80 A;  4Q04 A;  3EKH A;  4PHJ A;  1K93 D;  1SK6 D;  3BUW B;  1Y1A A;  1PRW A;  3PN7 B;  3TUY B;  5JJG A;  2PRU A;  1SY9 A;  5CSN A;  2JTT A;  2KBM A;  3SG7 A;  1NUB A;  2LE9 B;  3TDI A;  2K7D A;  4QJ5 B;  1EG4 A;  1SCM B;  1B8L A;  2NCP A;  4N5X A;  1L2O B;  1J55 A;  3LCP C;  1ZAC A;  1MXL C;  1RRO A;  4PAL A;  5AFP A;  1DGU A;  3DD4 A;  4WQ2 A;  1BOC A;  3TDU A;  1KSO A;  1N65 A;  3WXA A;  2ZKM X;  4OVN F;  1DT7 B;  5KTY A;  1B7T Y;  4ORA B;  1D1O A;  1NCZ A;  2KDH A;  1CFF A;  2KFG A;  5D69 A;  1CMG A;  1GGZ A;  2QPT A;  2LUX A;  2I94 A;  2QAC A;  2SAS A;  3WHU B;  1XO5 A;  3SG2 A;  3GK1 A;  1GGW A;  1XFZ O;  1G8I A;  4PCW A;  4XYN A;  1BMO A;  3TS5 C;  1DJX A;  5AER A;  2BKI B;  1OMR A;  1KFU L;  3O6B A;  4XJK B;  1CNP A;  4MZL A;  3PAT A;  4DS7 A;  1UHN A;  1XFU O;  4PHK A;  1DJY A;  1JF0 A;  1QAT A;  2LMT A;  1XVJ A;  3MSE B;  4NDC A;  3BQ3 A;  1NX3 A;  4YGC B;  2KI4 C;  2VRG A;  2LVI A;  1IRJ A;  2R2I A;  1S6I A;  2MJW B;  5ER4 X;  3OB2 B;  1KFX S;  1GQM A;  1KK8 B;  4D1E A;  2K0J A;  1ALV A;  2K7O A;  3KF9 A;  1NX0 A;  4GUK A;  3TS5 B;  5DKR A;  1MR8 A;  2L0P A;  2Q4U A;  1JFK A;  1M63 B;  3BOW B;  5I2Q A;  1WRK A;  2IS9 A;  5JOL A;  2PSR A;  2JXC A;  1NP8 A;  4JPZ B;  3PFV A;  2LUC A;  3GK4 X;  2HQ8 A;  2P6B B;  1CDL A;  1UUS A;  4R1E A;  1BR4 B;  4NDD A;  2LP3 A;  3BOW A;  2F3Y A;  2L98 A;  3IF7 A;  1TCF A;  5GQQ C;  2K2F A;  4HSZ A;  3I5I C;  1OQP A;  4MBE A;  1AK8 A;  1A4P A;  5G08 A;  1J7P A;  1C07 A;  4YI8 A;  1K90 D;  3AAK A;  1HQV A;  1DMO A;  2ZN9 A;  3NSO A;  2G2B A;  2KBI A;  1ODB A;  2CT9 A;  4WRI A;  1CFC A;  2H61 C;  2LLU A;  4DUQ A;  4P2Y B;  1SR6 B;  1MXE A;  1B7T Z;  3EK4 A;  2I2R E;  1YVH A;  2LHI A;  3LK0 A;  1PSR A;  1WLZ A;  1TIZ A;  1J7R A;  2LVK A;  3D0Y B;  1XFY O;  2BL0 C;  2MAZ A;  4C0J A;  2WC8 A;  3BUN B;  1XK4 C;  3CTN A;  1KK7 Z;  4QJ4 B;  3IQQ A;  4JQ0 D;  1PAL A;  1QIW A;  4YGE B;  3DVJ A;  3I5I B;  3SG6 A;  4ORB B;  1QS7 A;  1CLL A;  4GPL B;  3OB1 B;  1QIV A;  2ISD A;  4JWQ A;  1YUR A;  4BY5 A;  1M31 A;  2O5G A;  4AQJ A;  2A4J A;  4I5N B;  1MUX A;  1Y6W A;  2F2O A;  1MWN A;  2ZND A;  2D8N A;  3EK8 A;  4DCK A;  1GJY A;  1DJZ A;  2BL0 B;  2FOT A;  2ZRS A;  1KCY A;  1YUS A;  1LVC D;  2KYF A;  1DVI A;  2H61 A;  1NYA A;  1QAS A;  3EVR A;  2WCB A;  3C1V A;  2K2A A;  1A2X A;  2FCD A;  1IJ5 A;  1A75 B;  2F3Z A;  2LC5 A;  2H2K A;  2NLN A;  1ALW A;  1RJV A;  3VRO A;  1XK4 A;  2NXQ A;  2NCO A;  2KYC A;  2E6W A;  1PK0 D;  1AVS A;  4ICB A;  4PE1 A;  1AHR A;  3O2P A;  5D7F A;  2L2E A;  1W7J B;  2GV5 A;  1A75 A;  3M0W A;  1ZUZ A;  3I5G C;  1CTR A;  4MEW A;  1CKK A;  3TDZ A;  1QVI Y;  1YRT B;  2CBL A;  2JT8 A;  1SW8 A;  1V1F A;  3A8R A;  1SPY A;  2MLE C;  2WOS A;  2E30 A;  3WNX B;  1EL4 A;  1X02 A;  3VRQ A;  1XFX O;  4CFQ A;  2WCE A;  1JF2 A;  4AQI A;  4L9M A;  4CPV A;  2ZRT A;  1PVB A;  5F6T A;  3DVK A;  2MBX A;  2M97 A;  3FIA A;  3VRP A;  5I2O A;  2KAV A;  2KQ6 A;  1J1D A;  1DJH A;  2LP2 A;  1SMG A;  1HT9 A;  2JT0 A;  4M2Q A;  3I5G B;  2I18 A;  1QX7 A;  2SCP A;  3SG3 A;  2B1U A;  3H4S E;  2BE6 A;  1N2D A;  3GOF A;  3CWG A;  1XFV O;  2JNX A;  3E3R A;  3NSI A;  3BUM B;  1FI6 A;  1BLQ A;  2M8U A;  4GAO A;  5FYX A;  1OZS A;  1S36 A;  3JVT C;  1QLS A;  1U5I A;  1AUI B;  1JFJ A;  1BU3 A;  2M3W A;  1QJT A;  3OP0 A;  1TNQ A;  4I5K A;  3ZWH A;  2LV7 A;  2PAL A;  4DIR A;  1JC2 A;  2M49 B;  2K61 A;  4AOM A;  3AKA A;  1CM1 A;  1OMD A;  2M7L A;  5TNC A;  1EH2 A;  1OZO A;  1VRK A;  2G9B A;  2ZN8 A;  1F4O A;  4GGN A;  3D10 A;  2LAN A;  1M45 A; 
#chains in the Genus database with same CATH topology
 1XFR A;  1S5G Z;  1SRA A;  1WY9 A;  2FCE A;  3QRX A;  1CDP A;  2K60 A;  5DKQ A;  3O4X A;  1K8U A;  1MQ1 A;  5HKY A;  2KFF A;  1CLM A;  4N1G A;  2K7C A;  3JVT B;  1YX8 A;  1S1E A;  2KNE A;  3D78 A;  2MRD A;  3QME A;  1TUZ A;  2JPT A;  2KI6 C;  4PT1 A;  5I94 A;  3EKJ A;  2F8P A;  2BE4 A;  3BUO B;  3CR5 X;  3DF0 A;  4WQ3 A;  3O4Y A;  2MA2 A;  1F55 A;  1IIO A;  1S3P A;  1FI5 A;  1EG3 A;  3KEV A;  2KI6 D;  2I7A A;  1KWO C;  1BJF A;  1KFU S;  1SL8 A;  2EC6 C;  3PAL A;  1LKJ A;  4DRW A;  1CLB A;  2KI4 B;  2L4H A;  3FWC A;  3BXK A;  1IKU A;  2WND A;  5DIC A;  3SIB A;  1ZMZ A;  1CMF A;  1K9K A;  2O60 A;  1NCX A;  2KGR A;  2OTG C;  5DKN A;  1TNP A;  4GNK B;  1M39 A;  1NCY A;  4OV2 A;  2QDI A;  5HLO A;  3OX5 A;  3OX6 A;  3CZ1 A;  1UUR A;  3ZNI A;  2BEC A;  1WRL A;  3B87 A;  4OR9 B;  2EGD A;  3O78 A;  1B47 A;  1RWY A;  3EVV A;  3N7H A;  1IQ5 A;  4IL1 A;  4USL A;  4CFR A;  5I8N A;  1KWO B;  4OCI A;  2JUL A;  1OSA A;  1OOJ A;  2EC6 B;  2LNK A;  4INW A;  2M7N A;  1YTZ C;  2HET A;  1OOH A;  2LHL A;  1NPQ A;  1DJW A;  1PUL A;  1B9A A;  2KOT A;  4CID A;  5ER5 A;  2JWW A;  1WDC C;  2OTG B;  4M2P A;  3GK2 A;  5KU1 A;  1B8R A;  2AAO A;  4F0Z B;  2EHB A;  2KGB C;  2LLS A;  2LM5 A;  2V53 A;  4MN0 A;  5EL2 A;  3BYA A;  4GBA A;  2AMI A;  2M1K B;  4QJ3 B;  4YGA A;  1B1G A;  2KAY A;  4U8D A;  4A4C A;  2HPS A;  1C7V A;  4MZJ A;  1S6C A;  1JSA A;  1YVL A;  2CNP A;  1OW4 A;  1YR5 A;  2KAX A;  5HYD A;  1AJ4 A;  2KPH A;  3D77 A;  1E8A A;  3RLZ A;  1MHO A;  3NXA A;  4PE4 A;  3KHE A;  4YBH B;  2Y5I A;  5AXI A;  1G4Y R;  1C7W A;  3CLN A;  2QEO A;  5I2L A;  3DXL A;  1WDC B;  3JTD C;  1H4B A;  2WCL A;  1W9Z A;  2GGZ A;  3EVU A;  2PVB A;  4YGB B;  4TNC A;  4I5L B;  1NWD A;  1JBA A;  5FI2 A;  3SJS A;  1RTP 1;  2LMU A;  2FJU B;  3R72 A;  1A29 A;  3K21 A;  4KYN A;  3EK7 A;  3TUY C;  2F2P A;  4MRX A;  1H8B A;  3I5H C;  3FE8 A;  3HX4 A;  1CDM A;  1KQM C;  2L4I A;  2JOJ A;  3PLF B;  1J1E A;  4GFT A;  1XYD A;  1SCM C;  3NSL A;  3VRR A;  1EJ3 A;  4CLN A;  1W7I B;  1ZOT B;  1L2O C;  3CR2 A;  2CXJ A;  2OPO A;  1TN4 A;  2JQ6 A;  2BAP A;  1UHJ A;  2DOQ A;  5KSZ A;  2JT3 A;  2WCM A;  3JTD B;  2COL B;  1M46 A;  1OE9 B;  1FF1 A;  1S6J A;  2JTZ A;  1XA5 A;  1CFD A;  4ZCV A;  1K9P A;  1AJ5 A;  1QLK A;  3RM1 A;  5PAL A;  1TTX A;  2L51 A;  4MRY A;  1U5I B;  2HF5 A;  2RGI A;  2KSP A;  3LK1 A;  2BCX A;  2AUC A;  1Y0V H;  2M1U A;  2Y4Q A;  3B88 A;  4M2O A;  2KLE A;  1TOP A;  4PE7 A;  1F54 A;  1Z2C B;  3I5H B;  5AAN A;  3OHM B;  2F33 A;  1KQM B;  1PSB A;  2WC5 A;  2LMV A;  3DVM A;  3SS3 A;  1TNX A;  1DJI A;  4NDB A;  1JWD A;  2JU0 A;  2KHN A;  1IGV A;  3LL8 B;  1FBV A;  4GGF C;  4MLW A;  1TCO B;  4JKT A;  1F4Q A;  3VGO A;  1SYM A;  4YI9 A;  1PVA A;  2QEH A;  4PHM A;  3CAB A;  1GM0 A;  2JRF A;  3AKB A;  3IVT A;  3CR4 X;  1KFX L;  5CSI A;  1P28 A;  2BBM A;  2NZ0 A;  1LA0 A;  3L47 A;  1YRU B;  2MHH A;  3CYZ A;  1ZFS A;  4YRU A;  3CZ0 A;  3K1E A;  2CTN A;  1KK7 Y;  2PMY A;  3DF0 B;  1KK8 C;  1BR1 B;  1J7Q A;  1F8H A;  2Q91 A;  3AAJ A;  4N1F A;  1SNL A;  5CSJ A;  2HQW A;  4NQG A;  1K94 A;  1K96 A;  1K9U A;  1NX2 A;  1REC A;  1NSH A;  1G33 A;  3NSK A;  1QV1 A;  3PM8 A;  3BUX B;  2MLF C;  4GGF A;  1B4C A;  1SCV A;  1BOD A;  1QVI Z;  5HLV A;  4PHN A;  3WHT B;  3ICB A;  1BG1 A;  4XJK A;  2GTE A;  2K7B A;  3I5F C;  2K8M B;  3B86 A;  2GGM A;  3FWB A;  2CCM A;  1TWO A;  2M0R A;  2M9G A;  1J7O A;  2WCF A;  1WRZ A;  1RFJ A;  2LCP A;  4MVF A;  2L50 A;  3TZ1 A;  1IQ3 A;  2WOR A;  4I5J A;  3HCM A;  5HKW A;  3L4L A;  3BJH A;  3CS1 A;  1Z4H A;  4OKH A;  1TNW A;  1NX1 A;  1SR6 C;  1FW4 A;  2LAP A;  5AEQ A;  1QX5 B;  2LVJ A;  1DF0 B;  2LLT A;  1C3Z A;  3KPX A;  1F71 A;  2WC6 A;  3DVE A;  4P5O E;  5K89 A;  2Y1M A;  4HRG A;  4ETO A;  1IWQ A;  1OOI X;  3SG4 A;  1Y1X A;  3LLE A;  3I5F B;  2BCB A;  3PJI A;  2L5Y A;  4ORC B;  1F70 A;  1MF8 B;  1XFW O;  1DTL A;  2KQY A;  1UHI A;  4PE0 A;  1LA3 A;  1DF0 A;  3D75 A;  1UP5 A;  5CPV A;  2OS8 C;  3PSR A;  1KSM A;  2ZFD A;  3FS7 A;  1SBJ A;  4PDZ A;  2JZI A;  4MZK A;  1IH0 A;  1UHH A;  3SG5 A;  1R6P A;  1FPW A;  1L7Z A;  1DJG A;  1WLM A;  5BPJ A;  1SKT A;  4BY4 A;  2WCH A;  4C0L A;  2TN4 A;  1UWO A;  1YUU A;  2ZNE A;  2ERB A;  2L5X B;  1DGV A;  3CZT X;  4E68 A;  4FQO A;  1K95 A;  1N0Y A;  2KFH A;  1CFP A;  1YUT A;  1LIN A;  1TRF A;  3D74 A;  3B7A A;  2Y1N A;  3KO0 A;  1C3Y A;  1CDN A;  5HKZ A;  3IQO A;  2JC2 A;  1JUO A;  3F45 A;  1NIW A;  2BBN A;  3D0Y A;  1SL7 A;  2OS8 B;  1K2H A;  2JNF A;  4INX A;  1RK9 A;  4A4B A;  1OMV A;  2YGU A;  2M29 A;  4YGD B;  1QXP A;  4C0K A;  1EXR A;  4HRH A;  1IJ6 A;  1B8C A;  3CDN A;  1QTX A;  4IJ7 A;  3A4U B;  1R2U A;  1UHK A;  3V2L A;  5IBW A;  1QV0 A;  1YX7 A;  1Y1U A;  5CSF A;  1QX2 A;  5B8I B;  3SIA A;  3PN7 C;  4ZCU A;  5J3X A;  2BKH B;  3NHT A;  1AP4 A;  1S5G Y;  2PAS A;  4FTG A;  4HRE E;  2LVV A;  3D73 A;  1LXF C;  2JXL A;  3Q8I A;  3FE6 A;  4MSP A;  1CB1 A;  1BF5 A;  1IG5 A;  4UPG A;  2BCA A;  3VRN A;  1CM4 A;  1KQV A;  3CGA A;  1BT6 A;  1S26 D;  1A03 A;  1SL9 A;  1V1G A;  1Q80 A;  4Q04 A;  3EKH A;  4PHJ A;  4OZD A;  1K93 D;  1SK6 D;  3BUW B;  1Y1A A;  1PRW A;  3PN7 B;  3TUY B;  5JJG A;  2PRU A;  1SY9 A;  5CSN A;  2JTT A;  2KBM A;  3SG7 A;  3UO9 A;  1NUB A;  2LE9 B;  3TDI A;  2K7D A;  4QJ5 B;  1EG4 A;  1SCM B;  1B8L A;  2NCP A;  5HL1 A;  4N5X A;  1L2O B;  1J55 A;  3LCP C;  1ZAC A;  1MXL C;  1RRO A;  2PYQ A;  4PAL A;  5AFP A;  1DGU A;  3DD4 A;  4WQ2 A;  1BOC A;  3TDU A;  1KSO A;  1N65 A;  3WXA A;  2ZKM X;  4OVN F;  1DT7 B;  2QEV A;  5KTY A;  1B7T Y;  4ORA B;  1DEK A;  1D1O A;  1NCZ A;  2KDH A;  1CFF A;  2KFG A;  3L4A A;  3NHI A;  5D69 A;  1CMG A;  3CZ2 A;  1GGZ A;  2QPT A;  2LUX A;  2I94 A;  2QAC A;  2SAS A;  3WHU B;  1XO5 A;  2WCJ A;  3GK1 A;  3SG2 A;  1XFZ O;  1GGW A;  1G8I A;  4PCW A;  4XYN A;  1BMO A;  3TS5 C;  1DJX A;  5AER A;  2BKI B;  1OMR A;  1KFU L;  3O6B A;  4XJK B;  1CNP A;  4MZL A;  3PAT A;  4DS7 A;  3SS5 A;  1UHN A;  5FI6 A;  1XFU O;  4PHK A;  1DJY A;  1JF0 A;  1QAT A;  2LMT A;  1XVJ A;  3MSE B;  5FI7 A;  4NDC A;  3BQ3 A;  1NX3 A;  4YGC B;  2KI4 C;  2VRG A;  2LVI A;  1IRJ A;  1LS8 A;  1T14 A;  2R2I A;  1S6I A;  2MJW B;  5ER4 X;  3OB2 B;  1KFX S;  1ORG A;  1GQM A;  1KK8 B;  2QEB A;  2K0J A;  4D1E A;  1ALV A;  2K7O A;  3KF9 A;  1NX0 A;  1DC1 A;  4GUK A;  3OGN A;  3TS5 B;  5DKR A;  2PQL A;  1MR8 A;  2L0P A;  2Q4U A;  3BFA A;  1JFK A;  1M63 B;  3BOW B;  5I2Q A;  1WRK A;  2IS9 A;  5JOL A;  2PSR A;  2JXC A;  1TUJ A;  1NP8 A;  4JPZ B;  3PFV A;  2LUC A;  3GK4 X;  2HQ8 A;  2P6B B;  1CDL A;  1UUS A;  4R1E A;  1BR4 B;  4NDD A;  3BFH A;  2LP3 A;  3BOW A;  2F3Y A;  2L98 A;  3IF7 A;  3SS4 A;  1TCF A;  5GQQ C;  3VB1 A;  2K2F A;  4HSZ A;  3I5I C;  1OQP A;  4MBE A;  1AK8 A;  1A4P A;  5G08 A;  1J7P A;  1C07 A;  4YI8 A;  3S0G A;  1K90 D;  3AAK A;  1HQV A;  1DMO A;  2KLD A;  2ZN9 A;  3NSO A;  2JPO A;  2G2B A;  2KBI A;  1ODB A;  5D3O A;  1DQE A;  3S0B A;  2CT9 A;  2P71 A;  4WRI A;  2H61 C;  1CFC A;  2LLU A;  4DUQ A;  4P2Y B;  1SR6 B;  1MXE A;  1B7T Z;  3EK4 A;  2I2R E;  1YVH A;  2LHI A;  3LK0 A;  1OOF A;  1PSR A;  1WLZ A;  1TIZ A;  1J7R A;  2LVK A;  3D0Y B;  3OBV A;  1XFY O;  2BL0 C;  2MAZ A;  4C0J A;  2WC8 A;  3BUN B;  1XK4 C;  3CTN A;  1KK7 Z;  4QJ4 B;  3RZS A;  3IQQ A;  4JQ0 D;  1PAL A;  1QIW A;  4YGE B;  2WCK A;  3DVJ A;  3I5I B;  3SG6 A;  4ORB B;  1QS7 A;  1CLL A;  4GPL B;  3OB1 B;  1QIV A;  2ISD A;  4JWQ A;  1YUR A;  4BY5 A;  4F7F A;  3R1V A;  1QWV A;  1M31 A;  2O5G A;  4AQJ A;  2A4J A;  4I5N B;  3EG5 B;  1MUX A;  1Y6W A;  2F2O A;  1MWN A;  2ZND A;  2D8N A;  3EK8 A;  4DCK A;  1GJY A;  1DJZ A;  2BL0 B;  2FOT A;  2ZRS A;  1KCY A;  1YUS A;  3FE9 A;  1LVC D;  2KYF A;  1DVI A;  2H61 A;  1NYA A;  1QAS A;  3EVR A;  2WCB A;  3C1V A;  3S0D A;  2K2A A;  1A2X A;  3B6X A;  2FCD A;  1IJ5 A;  1A75 B;  2F3Z A;  3S0E A;  2LC5 A;  2H2K A;  2NLN A;  1ALW A;  1RJV A;  3VRO A;  1XK4 A;  2NXQ A;  2NCO A;  2KYC A;  2E6W A;  1PK0 D;  1AVS A;  2FJY A;  4ICB A;  4PE1 A;  3S0A A;  1AHR A;  3O2P A;  5D7F A;  2L2E A;  1W7J B;  2GV5 A;  1A75 A;  3D76 A;  1ZUZ A;  3M0W A;  3I5G C;  3UNW A;  3R1O A;  1CTR A;  1OOG A;  4MEW A;  3DY9 A;  3BFB A;  1CKK A;  2P70 A;  1QVI Y;  1YRT B;  3TDZ A;  1SSE B;  2CBL A;  2JT8 A;  1SW8 A;  1V1F A;  3A8R A;  1SPY A;  2MLE C;  2WOS A;  1DEL A;  2E30 A;  3DYE A;  3WNX B;  1EL4 A;  1X02 A;  3VRQ A;  1XFX O;  4CFQ A;  2WCE A;  4FQT A;  1JF2 A;  4AQI A;  4L9M A;  4CPV A;  2ZRT A;  1PVB A;  5F6T A;  3DVK A;  3R1P A;  2M97 A;  2MBX A;  3FIA A;  3VRP A;  5I2O A;  2KAV A;  2KQ6 A;  1J1D A;  1DJH A;  2LP2 A;  1SMG A;  1HT9 A;  2JT0 A;  4M2Q A;  2H8V A;  3I5G B;  2I18 A;  1QX7 A;  2SCP A;  3SG3 A;  2B1U A;  3H4S E;  2BE6 A;  3NGV A;  1N2D A;  3GOF A;  2L2C A;  3CWG A;  1XFV O;  2JNX A;  3E3R A;  3NSI A;  3BUM B;  1FI6 A;  1BLQ A;  2M8U A;  4GAO A;  5FYX A;  1OZS A;  1S36 A;  3JVT C;  1QLS A;  1U5I A;  1AUI B;  2BNX A;  1JFJ A;  1BU3 A;  2M3W A;  1QJT A;  3OP0 A;  1TNQ A;  4I5K A;  3ZWH A;  2LV7 A;  2PAL A;  4DIR A;  3S0F A;  2M49 B;  2K61 A;  4AOM A;  1JC2 A;  3AKA A;  1CM1 A;  4JD9 A;  1OMD A;  2M7L A;  5TNC A;  1EH2 A;  3DZT A;  1OZO A;  3PM2 A;  1VRK A;  2G9B A;  2ZN8 A;  1F4O A;  4GGN A;  3D10 A;  2LAN A;  1M45 A; 
#chains in the Genus database with same CATH homology
 2FCE A;  1S5G Z;  1SRA A;  1WY9 A;  3QRX A;  5DKQ A;  1CDP A;  1K8U A;  1MQ1 A;  5HKY A;  2KFF A;  1CLM A;  4N1G A;  2K7C A;  3JVT B;  1YX8 A;  1S1E A;  2KNE A;  2MRD A;  2KI6 C;  2JPT A;  3EKJ A;  2F8P A;  2BE4 A;  3BUO B;  3CR5 X;  3DF0 A;  4WQ3 A;  3O4Y A;  2MA2 A;  1F55 A;  1S3P A;  1FI5 A;  1EG3 A;  3KEV A;  2KI6 D;  2I7A A;  1KWO C;  1BJF A;  1KFU S;  1SL8 A;  2EC6 C;  3PAL A;  1LKJ A;  4DRW A;  1CLB A;  2KI4 B;  2L4H A;  3FWC A;  3BXK A;  1IKU A;  2WND A;  3SIB A;  1ZMZ A;  1CMF A;  1K9K A;  2O60 A;  1NCX A;  2KGR A;  2OTG C;  5DKN A;  1TNP A;  4GNK B;  1M39 A;  1NCY A;  4OV2 A;  5HLO A;  3OX5 A;  3OX6 A;  1UUR A;  3ZNI A;  2BEC A;  1WRL A;  4OR9 B;  2EGD A;  3O78 A;  1B47 A;  1RWY A;  3EVV A;  4IL1 A;  1IQ5 A;  4USL A;  4CFR A;  5I8N A;  1KWO B;  4OCI A;  2JUL A;  1OSA A;  1OOJ A;  2EC6 B;  2LNK A;  2M7N A;  1YTZ C;  2HET A;  2LHL A;  1NPQ A;  1DJW A;  1PUL A;  1B9A A;  2KOT A;  4CID A;  5ER5 A;  2JWW A;  1WDC C;  2OTG B;  4M2P A;  3GK2 A;  5KU1 A;  1B8R A;  2AAO A;  4F0Z B;  2EHB A;  2KGB C;  2LLS A;  2LM5 A;  2V53 A;  4MN0 A;  3BYA A;  4GBA A;  2AMI A;  2M1K B;  4QJ3 B;  4YGA A;  1B1G A;  2KAY A;  4U8D A;  4A4C A;  2HPS A;  1C7V A;  4MZJ A;  1S6C A;  1JSA A;  1YVL A;  2CNP A;  1YR5 A;  2KAX A;  5HYD A;  1AJ4 A;  1E8A A;  3RLZ A;  1MHO A;  3NXA A;  4PE4 A;  3KHE A;  4YBH B;  2Y5I A;  5AXI A;  1G4Y R;  1C7W A;  3CLN A;  5I2L A;  1WDC B;  3JTD C;  1H4B A;  2GGZ A;  3EVU A;  2PVB A;  4YGB B;  4TNC A;  4I5L B;  1NWD A;  1JBA A;  3SJS A;  1RTP 1;  2LMU A;  2FJU B;  1A29 A;  3K21 A;  3EK7 A;  3TUY C;  2F2P A;  4MRX A;  1H8B A;  3I5H C;  3HX4 A;  1CDM A;  1KQM C;  2L4I A;  2JOJ A;  3PLF B;  1J1E A;  4GFT A;  1XYD A;  1SCM C;  3NSL A;  3VRR A;  1EJ3 A;  4CLN A;  1W7I B;  1ZOT B;  1L2O C;  3CR2 A;  2CXJ A;  2OPO A;  1TN4 A;  2JQ6 A;  1UHJ A;  2DOQ A;  5KSZ A;  2JT3 A;  3JTD B;  2COL B;  1M46 A;  1OE9 B;  1FF1 A;  1S6J A;  2JTZ A;  1XA5 A;  1CFD A;  4ZCV A;  1K9P A;  1AJ5 A;  1QLK A;  3RM1 A;  5PAL A;  1TTX A;  2L51 A;  4MRY A;  1U5I B;  2HF5 A;  2RGI A;  2KSP A;  3LK1 A;  2BCX A;  2AUC A;  1Y0V H;  2M1U A;  2Y4Q A;  4M2O A;  4PE7 A;  1TOP A;  1F54 A;  3I5H B;  5AAN A;  3OHM B;  2F33 A;  1KQM B;  1PSB A;  2LMV A;  3DVM A;  1TNX A;  1DJI A;  4NDB A;  1JWD A;  2JU0 A;  2KHN A;  1IGV A;  3LL8 B;  1FBV A;  4GGF C;  4MLW A;  1TCO B;  1F4Q A;  3VGO A;  1SYM A;  4YI9 A;  1PVA A;  4PHM A;  2JRF A;  3AKB A;  3CR4 X;  1KFX L;  5CSI A;  2BBM A;  2NZ0 A;  1LA0 A;  1YRU B;  2MHH A;  1ZFS A;  4YRU A;  2CTN A;  1KK7 Y;  2PMY A;  3DF0 B;  1KK8 C;  1BR1 B;  1J7Q A;  1F8H A;  2Q91 A;  3AAJ A;  4N1F A;  1SNL A;  5CSJ A;  2HQW A;  4NQG A;  1K94 A;  1K96 A;  1K9U A;  1NX2 A;  1REC A;  1NSH A;  1G33 A;  3NSK A;  1QV1 A;  3PM8 A;  3BUX B;  2MLF C;  4GGF A;  1B4C A;  1SCV A;  1BOD A;  1QVI Z;  5HLV A;  4PHN A;  3WHT B;  3ICB A;  1BG1 A;  4XJK A;  2K7B A;  3I5F C;  2K8M B;  2GGM A;  3FWB A;  2CCM A;  2M0R A;  2M9G A;  1J7O A;  2WCF A;  1WRZ A;  1RFJ A;  2LCP A;  4MVF A;  2L50 A;  3TZ1 A;  1IQ3 A;  2WOR A;  4I5J A;  3HCM A;  5HKW A;  3CS1 A;  4OKH A;  1TNW A;  1NX1 A;  1SR6 C;  1FW4 A;  2LAP A;  5AEQ A;  1QX5 B;  2LVJ A;  1DF0 B;  2LLT A;  3KPX A;  1F71 A;  3DVE A;  4P5O E;  5K89 A;  2Y1M A;  4HRG A;  4ETO A;  1IWQ A;  3SG4 A;  1Y1X A;  3LLE A;  3I5F B;  2BCB A;  4ORC B;  1F70 A;  1MF8 B;  1XFW O;  1DTL A;  2KQY A;  1UHI A;  4PE0 A;  1LA3 A;  1DF0 A;  1UP5 A;  5CPV A;  2OS8 C;  3PSR A;  1KSM A;  2ZFD A;  3FS7 A;  1SBJ A;  4PDZ A;  2JZI A;  4MZK A;  1IH0 A;  1UHH A;  3SG5 A;  1R6P A;  1FPW A;  1L7Z A;  1DJG A;  1WLM A;  5BPJ A;  1SKT A;  4BY4 A;  4C0L A;  2TN4 A;  1UWO A;  1YUU A;  2ZNE A;  3CZT X;  2L5X B;  1DGV A;  4E68 A;  4FQO A;  1K95 A;  1N0Y A;  2KFH A;  1CFP A;  1YUT A;  1LIN A;  1TRF A;  2Y1N A;  3KO0 A;  1CDN A;  5HKZ A;  3IQO A;  2JC2 A;  1JUO A;  3F45 A;  1NIW A;  2BBN A;  3D0Y A;  1SL7 A;  2OS8 B;  1K2H A;  2JNF A;  1RK9 A;  4A4B A;  1OMV A;  2M29 A;  4YGD B;  1QXP A;  4C0K A;  1EXR A;  4HRH A;  1IJ6 A;  1B8C A;  5IBW A;  1QTX A;  3A4U B;  1R2U A;  1UHK A;  1QV0 A;  1YX7 A;  1Y1U A;  5CSF A;  1QX2 A;  5B8I B;  3SIA A;  3PN7 C;  4ZCU A;  5J3X A;  2BKH B;  1AP4 A;  1S5G Y;  2PAS A;  4FTG A;  4HRE E;  2LVV A;  1LXF C;  2JXL A;  4MSP A;  1CB1 A;  1BF5 A;  1IG5 A;  4UPG A;  2BCA A;  3VRN A;  1CM4 A;  1KQV A;  3CGA A;  1BT6 A;  1S26 D;  1A03 A;  1SL9 A;  1V1G A;  1Q80 A;  4Q04 A;  3EKH A;  4PHJ A;  1K93 D;  1SK6 D;  3BUW B;  1Y1A A;  1PRW A;  3PN7 B;  3TUY B;  5JJG A;  2PRU A;  1SY9 A;  5CSN A;  2JTT A;  2KBM A;  3SG7 A;  1NUB A;  2LE9 B;  3TDI A;  2K7D A;  4QJ5 B;  1EG4 A;  1SCM B;  1B8L A;  2NCP A;  4N5X A;  1L2O B;  1J55 A;  3LCP C;  1ZAC A;  1MXL C;  1RRO A;  4PAL A;  5AFP A;  1DGU A;  3DD4 A;  4WQ2 A;  1BOC A;  3TDU A;  1KSO A;  1N65 A;  3WXA A;  2ZKM X;  4OVN F;  1DT7 B;  5KTY A;  1B7T Y;  4ORA B;  1D1O A;  1NCZ A;  2KDH A;  1CFF A;  2KFG A;  5D69 A;  1CMG A;  1GGZ A;  2QPT A;  2LUX A;  2I94 A;  2QAC A;  2SAS A;  3WHU B;  1XO5 A;  3SG2 A;  3GK1 A;  1GGW A;  1XFZ O;  1G8I A;  4PCW A;  4XYN A;  1BMO A;  3TS5 C;  1DJX A;  5AER A;  2BKI B;  1OMR A;  1KFU L;  3O6B A;  4XJK B;  1CNP A;  4MZL A;  3PAT A;  4DS7 A;  1UHN A;  1XFU O;  4PHK A;  1DJY A;  1JF0 A;  1QAT A;  2LMT A;  1XVJ A;  3MSE B;  4NDC A;  3BQ3 A;  1NX3 A;  4YGC B;  2KI4 C;  2VRG A;  2LVI A;  1IRJ A;  2R2I A;  1S6I A;  2MJW B;  5ER4 X;  3OB2 B;  1KFX S;  1GQM A;  1KK8 B;  4D1E A;  2K0J A;  1ALV A;  2K7O A;  3KF9 A;  1NX0 A;  4GUK A;  3TS5 B;  5DKR A;  1MR8 A;  2L0P A;  2Q4U A;  1JFK A;  1M63 B;  3BOW B;  5I2Q A;  1WRK A;  2IS9 A;  5JOL A;  2PSR A;  2JXC A;  1NP8 A;  4JPZ B;  3PFV A;  2LUC A;  3GK4 X;  2HQ8 A;  2P6B B;  1CDL A;  1UUS A;  4R1E A;  1BR4 B;  4NDD A;  2LP3 A;  3BOW A;  2F3Y A;  2L98 A;  3IF7 A;  1TCF A;  5GQQ C;  2K2F A;  4HSZ A;  3I5I C;  1OQP A;  4MBE A;  1AK8 A;  1A4P A;  5G08 A;  1J7P A;  1C07 A;  4YI8 A;  1K90 D;  3AAK A;  1HQV A;  1DMO A;  2ZN9 A;  3NSO A;  2G2B A;  2KBI A;  1ODB A;  2CT9 A;  4WRI A;  1CFC A;  2H61 C;  2LLU A;  4DUQ A;  4P2Y B;  1SR6 B;  1MXE A;  1B7T Z;  3EK4 A;  2I2R E;  1YVH A;  2LHI A;  3LK0 A;  1PSR A;  1WLZ A;  1TIZ A;  1J7R A;  2LVK A;  3D0Y B;  1XFY O;  2BL0 C;  2MAZ A;  4C0J A;  2WC8 A;  3BUN B;  1XK4 C;  3CTN A;  1KK7 Z;  4QJ4 B;  3IQQ A;  4JQ0 D;  1PAL A;  1QIW A;  4YGE B;  3DVJ A;  3I5I B;  3SG6 A;  4ORB B;  1QS7 A;  1CLL A;  4GPL B;  3OB1 B;  1QIV A;  2ISD A;  4JWQ A;  1YUR A;  4BY5 A;  1M31 A;  2O5G A;  4AQJ A;  2A4J A;  4I5N B;  1MUX A;  1Y6W A;  2F2O A;  1MWN A;  2ZND A;  2D8N A;  3EK8 A;  4DCK A;  1GJY A;  1DJZ A;  2BL0 B;  2FOT A;  2ZRS A;  1KCY A;  1YUS A;  1LVC D;  2KYF A;  1DVI A;  2H61 A;  1NYA A;  1QAS A;  3EVR A;  2WCB A;  3C1V A;  2K2A A;  1A2X A;  2FCD A;  1IJ5 A;  1A75 B;  2F3Z A;  2LC5 A;  2H2K A;  2NLN A;  1ALW A;  1RJV A;  3VRO A;  1XK4 A;  2NXQ A;  2NCO A;  2KYC A;  2E6W A;  1PK0 D;  1AVS A;  4ICB A;  4PE1 A;  1AHR A;  3O2P A;  5D7F A;  2L2E A;  1W7J B;  2GV5 A;  1A75 A;  3M0W A;  1ZUZ A;  3I5G C;  1CTR A;  4MEW A;  1CKK A;  3TDZ A;  1QVI Y;  1YRT B;  2CBL A;  2JT8 A;  1SW8 A;  1V1F A;  3A8R A;  1SPY A;  2MLE C;  2WOS A;  2E30 A;  3WNX B;  1EL4 A;  1X02 A;  3VRQ A;  1XFX O;  4CFQ A;  2WCE A;  1JF2 A;  4AQI A;  4L9M A;  4CPV A;  2ZRT A;  1PVB A;  5F6T A;  3DVK A;  2MBX A;  2M97 A;  3FIA A;  3VRP A;  5I2O A;  2KAV A;  2KQ6 A;  1J1D A;  1DJH A;  2LP2 A;  1SMG A;  1HT9 A;  2JT0 A;  4M2Q A;  3I5G B;  2I18 A;  1QX7 A;  2SCP A;  3SG3 A;  2B1U A;  3H4S E;  2BE6 A;  1N2D A;  3GOF A;  3CWG A;  1XFV O;  2JNX A;  3E3R A;  3NSI A;  3BUM B;  1FI6 A;  1BLQ A;  2M8U A;  4GAO A;  5FYX A;  1OZS A;  1S36 A;  3JVT C;  1QLS A;  1U5I A;  1AUI B;  1JFJ A;  1BU3 A;  2M3W A;  1QJT A;  3OP0 A;  1TNQ A;  4I5K A;  3ZWH A;  2LV7 A;  2PAL A;  4DIR A;  1JC2 A;  2M49 B;  2K61 A;  4AOM A;  3AKA A;  1CM1 A;  1OMD A;  2M7L A;  5TNC A;  1EH2 A;  1OZO A;  1VRK A;  2G9B A;  2ZN8 A;  1F4O A;  4GGN A;  3D10 A;  2LAN A;  1M45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...