3PN7C

Visualizing new hinges and a potential major source of compliance in the lever arm of myosin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
152
Chain Sequence
KLSQDEIDDLKEVFELFDFWDGRDGAVDAFKIGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTYADYMEAFKTFDREGQGFISGAELRHVLSGLGERLSDEEVDEIINLTDLQEDLEGNVKYEEFVKKVMTGPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Myosin heavy chain
publication title Visualizing key hinges and a potential major source of compliance in the lever arm of myosin.
pubmed doi rcsb
total genus 45
structure length 152
sequence length 152
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pn7C01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pn7C02
1SY9A 5D69A 2JT8A 4OVNF 1NWDA 4P5OE 3MSEB 1XO5A 1EG3A 3EVRA 4MEWA 4UPGA 1A4PA 1R6PA 1KFUL 1KQMC 4OV2A 1PSBA 1EL4A 1K9KA 2JXLA 2ZN8A 5BPJA 1KWOB 3SG4A 2JZIA 1B8CA 1G4YR 1RECA 2LE9B 3O78A 2O5GA 3D10A 3QRXA 3NSOA 1NSHA 4AOMA 2F33A 4A4CA 1A2XA 1NP8A 3O6BA 1QXPA 1CFPA 3OX6A 5D7FA 5B8IB 1N2DA 1BJFA 3AAJA 4NDBA 4NQGA 1CFFA 1Y1XA 2CXJA 3PLFB 2K7OA 3EK8A 1LA0A 1TOPA 1QATA 2L2EA 2MHHA 4DIRA 5HYDA 1OZOA 1JWDA 1R2UA 4DCKA 3SIBA 1FF1A 2FJUB 5JOLA 1M39A 1XFUO 1TNXA 1B7TY 2HQ8A 2BE4A 2PVBA 3D0YA 5ER4X 1G33A 5KU1A 1AP4A 1KQVA 3PATA 4FQOA 3RM1A 1QS7A 1CFDA 1K94A 1XFZO 1A75A 2LANA 1SYMA 1IQ3A 5AXIA 3EVVA 5GQQC 2SASA 1AHRA 3FIAA 1F4QA 2KAYA 1SR6B 2WCEA 4A4BA 3GOFA 4MZKA 4USLA 4U8DA 2G2BA 1DJYA 1VRKA 1UHNA 3TDUA 4P2YB 1DVIA 3FWBA 4JQ0D 2CCMA 5IBWA 1RK9A 1UP5A 3DVKA 1JBAA 4M2QA 2K0JA 1SRAA 2KNEA 1QIVA 2LHIA 2QPTA 4PDZA 1B9AA 1UWOA 2K7DA 3D0YB 3DVJA 3GK1A 4WQ2A 3BUMB 3O4YA 3BUOB 1OMVA 1A75B 4GPLB 5AFPA 2QACA 2WCBA 1RTP1 1OE9B 2PSRA 5CSIA 4C0KA 3I5FB 4GGFA 4I5NB 1F55A 1DJWA 3CLNA 2BBMA 1J7OA 3CTNA 2LAPA 1EG4A 4MBEA 1TIZA 1ALWA 3OHMB 1V1FA 1SL8A 2KYFA 3DVMA 1SW8A 4XYNA 1HQVA 2LC5A 1KCYA 1PVBA 2HF5A 2OPOA 2JTZA 2LV7A 1BODA 3CZTX 1SR6C 2Y1NA 1SCVA 2BCAA 1K90D 2K7BA 3LCPC 1L2OC 2FCDA 2I94A 2Y1MA 4GAOA 4HRHA 1CDMA 1CMGA 3KHEA 1NCYA 1QVIZ 4WQ3A 3CR4X 1WLMA 3PSRA 4ZCUA 5AEQA 3LK1A 1KQMB 4YGBB 1M46A 1K95A 5K89A 2LLSA 1J55A 1RFJA 4YGAA 1GQMA 1QLKA 3VRQA 2L0PA 2CNPA 1CDPA 2L5XB 1BMOA 1W7IB 4L9MA 2JT3A 2LP2A 3TDIA 3I5FC 2E6WA 2M97A 1DJIA 3CGAA 4GUKA 1CM1A 2L50A 3FS7A 4C0LA 4QJ5B 2F3ZA 2ZRSA 1H4BA 1WRLA 3LK0A 4OKHA 1NX0A 2NXQA 1JSAA 1DGVA 4XJKA 4PHKA 4ORCB 1UURA 2JNXA 3PALA 1PVAA 3SG2A 1CM4A 4GFTA 1YUUA 3E3RA 3FWCA 1CNPA 2WNDA 2KI6C 1KK8C 2LUXA 2M1UA 1ZFSA 1YUTA 1XFVO 2K61A 2LM5A 1W7JB 2MLEC 4PE0A 1V1GA 2M3WA 4OCIA 1OSAA 4QJ4B 2FCEA 1SK6D 1GJYA 2BE6A 3KF9A 3A4UB 1JFJA 4GGFC 2M0RA 2MBXA 1K2HA 3PM8A 1SBJA 1RJVA 2M7NA 1IJ5A 3SG7A 3SG6A 1S3PA 1YRUB 2MRDA 2LLTA 1DMOA 1N0YA 3KO0A 2Y4QA 4XJKB 1NX2A 5G08A 2BKHB 2BKIB 5ER5A 1B47A 4MSPA 2M1KB 4AQJA 1Y0VH 2M7LA 2HPSA 2JXCA 2JRFA 1MXLC 4PHJA 3BOWA 1F4OA 1TCOB 3OP0A 2KBMA 1IRJA 1DF0A 1HT9A 2M29A 4ZCVA 4OR9B 1XFXO 1XFYO 1IKUA 4CLNA 2MJWB 1CLBA 1CFCA 3SG3A 2BCBA 3C1VA 2IS9A 1C7VA 2ISDA 2ZRTA 1WY9A 1AUIB 1WLZA 5HKWA 1EJ3A 1IGVA 1Y1AA 4F0ZB 3GK4X 1BLQA 3BUWB 4PE4A 2WC8A 2F2OA 1LXFC 1DJXA 5TNCA 3VRNA 3VRRA 2JT0A 3EKJA 2A4JA 1B7TZ 1UUSA 4HRGA 5HKZA 2L4IA 2I2RE 5PALA 1S6IA 3BOWB 4I5JA 1GGZA 1DF0B 1XYDA 2PASA 2KBIA 2ZNEA 1JF2A 1NX1A 1QASA 2CT9A 1RROA 1L2OB 2I18A 2GGMA 2KYCA 5I8NA 4MN0A 1J7RA 1B8RA 1F70A 1XVJA 1AJ4A 4MZLA 2H61A 2M8UA 3NSKA 2B1UA 3TS5B 3ZNIA 1FI6A 4ETOA 3NXAA 1NX3A 1K93D 1BR4B 2CTNA 4HSZA 4N5XA 1CB1A 1JC2A 1KSMA 1MF8B 3ZWHA 1NUBA 1K9PA 3EK4A 1MHOA 4FTGA 2KGRA 4DUQA 1IQ5A 1JUOA 3KEVA 2DOQA 1AVSA 1F54A 4MRXA 1K9UA 1QJTA 1XA5A 5DKNA 3SJSA 3I5IB 3IQQA 3LLEA 2LCPA 1D1OA 2L4HA 3WHTB 1IH0A 2JC2A 1ZUZA 1S6JA 3BUNB 1XK4A 1BT6A 1KK8B 1PALA 2R2IA 3VGOA 5DKRA 1MQ1A 3JTDC 1G8IA 4ORAB 4C0JA 1F8HA 2HQWA 1UHKA 2JTTA 2EGDA 1M45A 5F6TA 1TRFA 3HCMA 1UHJA 1WDCB 2H2KA 1LINA 2MA2A 1CDNA 4CPVA 4CIDA 2BECA 2NCOA 4YGDB 1NCXA 2KFFA 1S5GZ 2D8NA 3TS5C 1ZMZA 3DD4A 4R1EA 4M2PA 2AMIA 1K96A 1ZOTB 2NZ0A 1KFXL 4YRUA 1BU3A 4ORBB 1C07A 2WCFA 2L98A 5I2QA 1N65A 1X02A 2ZKMX 4YBHB 1PRWA 4I5KA 1U5IA 1OMDA 3OB2B 5FYXA 2LMVA 3I5IC 5CSFA 3JVTB 4CFRA 1QX2A 4CFQA 1LVCD 3H4SE 3DF0A 4AQIA 3TZ1A 2KGBC 1FI5A 1J7PA 2H61C 1KK7Z 1CLLA 1DTLA 3KPXA 4WRIA 3OX5A 1C7WA 1NPQA 2KI4B 1WDCC 2LMTA 1NCZA 3NSLA 1QV0A 1ZACA 3DVEA 1SMGA 1SL7A 1BOCA 1PK0D 1PSRA 1YVLA 1U5IB 1NIWA 2LHLA 3LL8B 1EH2A 3PN7C 2TN4A 3I5GB 3BXKA 3NSIA 1SKTA 2BCXA 2JQ6A 1J7QA 1XK4C 3BYAA 2K7CA 2M49B 1CDLA 2LVJA 3DF0B 3RLZA 2KQYA 3VROA 3VRPA 1FW4A 1SNLA 1SPYA 2SCPA 1FPWA 1OQPA 1KFXS 2WOSA 3CR2A 3JVTC 4M2OA 2WORA 5AANA 1QIWA 1TNQA 1YUSA 4MLWA 1AK8A 1OOJA 5I2OA 3K21A 1DJHA 2ZN9A 2AAOA 1IJ6A 5KSZA 2JNFA 2NLNA 5DKQA 4JWQA 4GNKB 4ICBA 1QLSA 2KI4C 1TNWA 2KFHA 1YURA 2KAXA 4PE1A 2Q91A 4MZJA 1YRTB 1QX5B 1IG5A 2LLUA 2EC6B 4TNCA 1QV1A 4NDDA 3I5GC 4I5LB 2OTGC 1CLMA 2FOTA 1YR5A 1B8LA 1MUXA 2K2AA 2PRUA 3JTDB 5KTYA 4PHNA 1PULA 2BBNA 3SIAA 2KSPA 1CKKA 5CSJA 1YX7A 4D1EA 1H8BA 2MLFC 3BUXB 3WXAA 1TCFA 2EHBA 1K8UA 5CSNA 2F3YA 2F8PA 2GV5A 1M63B 3EK7A 4DRWA 1KWOC 1E8AA 5HLOA 4DS7A 4BY5A 1YVHA 2KAVA 1KFUS 4HREE 4MRYA 1MXEA 2F2PA 2JU0A 3WHUB 1IWQA 4N1FA 1B4CA 3O2PA 2KFGA 2CBLA 1ALVA 2HETA 2KHNA 3AAKA 1A29A 2K8MB 1ODBA 4QJ3B 1M31A 2JOJA 2L51A 2EC6C 1MWNA 1DJZA 1S6CA 3OB1B 2G9BA 3I5HB 4E68A 1SCMB 2BL0B 2V53A 1J1EA 1UHIA 4Q04A 3TDZA 3AKAA 5I2LA 1CTRA 1OZSA 2KOTA 1DT7B 3IF7A 4YGEB 1JFKA 4YGCB 1BG1A 1QTXA 4PALA 3SG5A 1JF0A 2O60A 1FBVA 1DGUA 1TTXA 2LVIA 1Q80A 5HLVA 2PALA 2LUCA 1RWYA 3TUYB 4PCWA 2K2FA 3WNXB 2ZFDA 1LKJA 3PFVA 4BY4A 1S1EA 1SL9A 1UHHA 2KQ6A 2LNKA 2E30A 3AKBA 4MVFA 1WRKA 1BR1B 1TNPA 3CS1A 2LVVA 1B1GA 2LP3A 1WRZA 2AUCA 2Y5IA 2JULA 1NYAA 3PN7B 5J3XA 1Y1UA 1GGWA 3ICBA 4IL1A 2KDHA 2OS8B 1L7ZA 3BQ3A 3GK2A 5AERA 4PE7A 1LA3A 1QVIY 3EVUA 5JJGA 4NDCA 1DJGA 2PMYA 1TN4A 1S36A 4N1GA 2KI6D 2JPTA 3CWGA 5CPVA 3I5HC 1Y6WA 1BF5A 1SCMC 1S5GY 3HX4A 2BL0C 1F71A 2LVKA 5HKYA 2M9GA 1A03A 1S26D 2GGZA 3CR5X 2NCPA 3M0WA 2ZNDA 1YX8A 2Q4UA 2COLB 1AJ5A 1MR8A 3EKHA 4JPZB 1CMFA 3TUYC 3IQOA 3F45A 2RGIA 4YI8A 4PHMA 2P6BB 1EXRA 2MAZA 2I7AA 4GGNA 1YTZC 1KSOA 1QX7A 2JWWA 2LMUA 1J1DA 1OMRA 2OTGB 1KK7Y 4GBAA 4YI9A 2OS8C 3A8RA 1XFWO 2VRGA
chains in the Genus database with same CATH superfamily
1SY9A 5D69A 2JT8A 4OVNF 1NWDA 1Z4HA 3MSEB 1XO5A 1EG3A 3D78A 3EVRA 4MEWA 4P5OE 3V2LA 1TUZA 4UPGA 1XFRA 1A4PA 1R6PA 1KFUL 1KQMC 4OV2A 1PSBA 5DICA 1EL4A 1K9KA 1P28A 2JXLA 2ZN8A 5BPJA 1KWOB 3SG4A 2JZIA 1B8CA 1G4YR 1RECA 2LE9B 3O78A 2O5GA 4KYNA 3D10A 3QRXA 3NSOA 3IVTA 5D3OA 1NSHA 4AOMA 2F33A 4A4CA 1A2XA 1NP8A 3O6BA 1QXPA 1CFPA 3OX6A 5D7FA 5B8IB 1TWOA 1GM0A 3S0GA 1N2DA 1BJFA 3AAJA 4NDBA 4NQGA 3SS5A 1CFFA 1Y1XA 2CXJA 3PLFB 3O4XA 2K7OA 3EK8A 1LA0A 1TOPA 1QATA 2L2EA 2MHHA 4DIRA 5HYDA 1OZOA 1JWDA 1R2UA 2PQLA 4DCKA 2QEBA 3SIBA 1FF1A 2FJUB 5JOLA 1M39A 1XFUO 1TNXA 1B7TY 2HQ8A 2BE4A 2PVBA 3D0YA 5ER4X 1G33A 5KU1A 1AP4A 1KQVA 3PATA 4FQOA 3RM1A 1QS7A 1CFDA 1K94A 1XFZO 1A75A 2LANA 1SYMA 1IQ3A 5AXIA 3EVVA 5GQQC 3VB1A 2SASA 1AHRA 3FIAA 1F4QA 2KAYA 1SR6B 2WCEA 4A4BA 3GOFA 4MZKA 4USLA 4U8DA 2G2BA 1DJYA 1VRKA 2KPHA 1UHNA 3TDUA 4P2YB 1DVIA 3FWBA 4JQ0D 2CCMA 5IBWA 1RK9A 1UP5A 2WC6A 3DVKA 1JBAA 4M2QA 2K0JA 1SRAA 2KNEA 1QIVA 2LHIA 2QPTA 4PDZA 1B9AA 1UWOA 2K7DA 3D0YB 3DVJA 3GK1A 3NHIA 4WQ2A 3BUMB 3O4YA 2H8VA 3BUOB 1OMVA 1A75B 4GPLB 4INWA 5AFPA 2QACA 2WCBA 1OW4A 1RTP1 1OE9B 2PSRA 5CSIA 3R72A 4C0KA 3I5FB 3S0AA 4GGFA 4I5NB 1F55A 1DJWA 2BNXA 3CLNA 2BBMA 1J7OA 3CTNA 2LAPA 1EG4A 5HL1A 4MBEA 3L4LA 1TIZA 1ALWA 2WCJA 3OGNA 3OHMB 1V1FA 1SL8A 2KYFA 3DVMA 1SW8A 4XYNA 1HQVA 2LC5A 3D77A 1KCYA 1PVBA 2HF5A 2OPOA 2JTZA 2LV7A 1BODA 3CZTX 1SR6C 2Y1NA 1SCVA 2BCAA 1K90D 2K7BA 3LCPC 1L2OC 2FCDA 2I94A 2Y1MA 4GAOA 4HRHA 1CDMA 1CMGA 3KHEA 1NCYA 1QVIZ 4WQ3A 3CR4X 1WLMA 3PSRA 4ZCUA 5AEQA 3LK1A 1KQMB 4YGBB 1M46A 1K95A 5K89A 2JPOA 3PJIA 2LLSA 1J55A 3B88A 1RFJA 4YGAA 1GQMA 1QLKA 3VRQA 2L0PA 2CNPA 1CDPA 2L5XB 3SS4A 1BMOA 1W7IB 4L9MA 2JT3A 2LP2A 3TDIA 3I5FC 2E6WA 3S0FA 2M97A 3B6XA 1DJIA 2P71A 3CGAA 4GUKA 1CM1A 2L50A 3FS7A 4C0LA 4QJ5B 2F3ZA 2ZRSA 1H4BA 1WRLA 2L2CA 3LK0A 4OKHA 1NX0A 2NXQA 1JSAA 1DGVA 3B87A 4XJKA 3DYEA 4ORCB 1UURA 2BAPA 2JNXA 1PVAA 3PALA 4PHKA 3SG2A 1CM4A 4GFTA 1YUUA 4JD9A 3E3RA 3FWCA 1CNPA 1TUJA 2WNDA 2KI6C 1KK8C 2LUXA 2M1UA 1ZFSA 1YUTA 1XFVO 2K61A 2LM5A 1W7JB 2MLEC 2QEHA 4PE0A 1V1GA 2M3WA 4OCIA 1OSAA 4QJ4B 2FCEA 1SK6D 1GJYA 2BE6A 3KF9A 1OOFA 3A4UB 1JFJA 4GGFC 2M0RA 2MBXA 1K2HA 3PM8A 1SBJA 1OOHA 1RJVA 2M7NA 1IJ5A 5EL2A 3SG6A 3SG7A 1S3PA 1YRUB 2MRDA 2LLTA 1DMOA 1N0YA 3KO0A 2Y4QA 4XJKB 1NX2A 5G08A 2BKHB 2BKIB 5ER5A 1B47A 4MSPA 2M1KB 4AQJA 1Y0VH 2M7LA 2HPSA 4INXA 2JXCA 2QDIA 2JRFA 1MXLC 4PHJA 3BOWA 3FE8A 1F4OA 1TCOB 3OP0A 2KBMA 1IRJA 1DF0A 1HT9A 2M29A 4ZCVA 4OR9B 1XFXO 1XFYO 1IKUA 4CLNA 2MJWB 1CLBA 1CFCA 3SG3A 2BCBA 3C1VA 2IS9A 1C7VA 3EG5B 2ZRTA 2ISDA 1WY9A 1AUIB 1WLZA 5HKWA 1EJ3A 1IGVA 1Y1AA 4F0ZB 3GK4X 1BLQA 3BUWB 4PE4A 2WC8A 2F2OA 1LXFC 1DJXA 5TNCA 3VRNA 3VRRA 4OZDA 2JT0A 3EKJA 2A4JA 1B7TZ 1UUSA 3DXLA 4HRGA 5HKZA 2L4IA 3BJHA 2I2RE 5PALA 1S6IA 3BOWB 4I5JA 1GGZA 3D74A 1DF0B 1DC1A 3D73A 1XYDA 2KLEA 3D76A 2PASA 2KBIA 2ZNEA 1JF2A 1NX1A 1QASA 2CT9A 1RROA 1L2OB 3CZ1A 2I18A 2GGMA 2KYCA 5I8NA 4MN0A 3N7HA 3CZ2A 1J7RA 1B8RA 1F70A 1XVJA 1AJ4A 4MZLA 3RZSA 2H61A 2M8UA 3NSKA 2B1UA 3TS5B 3ZNIA 1FI6A 4ETOA 3NXAA 1NX3A 2PYQA 1K93D 1BR4B 2CTNA 3PM2A 4HSZA 4N5XA 1CB1A 1JC2A 1KSMA 1MF8B 3ZWHA 1NUBA 1K9PA 2FJYA 1MHOA 3EK4A 4FTGA 2KGRA 4DUQA 1IQ5A 1JUOA 3KEVA 2DOQA 1AVSA 1F54A 4MRXA 1K9UA 1QJTA 3OBVA 1XA5A 5DKNA 3SJSA 3I5IB 3IQQA 3LLEA 2LCPA 4JKTA 1D1OA 2L4HA 3WHTB 3R1OA 2JC2A 1IH0A 1ZUZA 1S6JA 3BUNB 1XK4A 1BT6A 1KK8B 1PALA 2QEOA 2R2IA 5DKRA 3VGOA 1MQ1A 3JTDC 1G8IA 4ORAB 4C0JA 1F8HA 2HQWA 1UHKA 2JTTA 2EGDA 1M45A 5F6TA 3CYZA 1TRFA 3HCMA 1UHJA 1WDCB 2H2KA 1LINA 2MA2A 1CDNA 4CPVA 4CIDA 2BECA 2NCOA 4YGDB 1NCXA 2KFFA 1S5GZ 2D8NA 3TS5C 1ZMZA 3DD4A 1Z2CB 2WCMA 4R1EA 4M2PA 2AMIA 1K96A 3K1EA 3R1PA 1ZOTB 5FI2A 4F7FA 2NZ0A 1KFXL 4YRUA 1BU3A 4ORBB 1C07A 2WCFA 2L98A 5I2QA 1N65A 1X02A 2WCLA 2ZKMX 1PRWA 4I5KA 4YBHB 1U5IA 1OMDA 3OB2B 5FYXA 2LMVA 3I5IC 5CSFA 3JVTB 4CFRA 1QX2A 4CFQA 1LVCD 3H4SE 1ORGA 3D75A 3DF0A 1OOIX 4AQIA 3TZ1A 2KGBC 1FI5A 1J7PA 2H61C 1KK7Z 1CLLA 3NGVA 1DTLA 3KPXA 4WRIA 3OX5A 1C7WA 1NPQA 2KI4B 1WDCC 2LMTA 1NCZA 3NSLA 1QV0A 1ZACA 3DVEA 1SMGA 1SL7A 1BOCA 1PK0D 1PSRA 1YVLA 3UNWA 3B7AA 4FQTA 1U5IB 3S0DA 1NIWA 2LHLA 3FE6A 3LL8B 1DQEA 1EH2A 3PN7C 2TN4A 3I5GB 3BXKA 3NSIA 1LS8A 1SKTA 2BCXA 2JQ6A 1J7QA 1XK4C 3BYAA 2K7CA 2M49B 1CDLA 2LVJA 3DF0B 3RLZA 2KQYA 3VROA 3VRPA 1FW4A 1SNLA 1SPYA 2SCPA 1FPWA 3Q8IA 1OQPA 1KFXS 2WOSA 3CR2A 3JVTC 4M2OA 1C3YA 5I94A 1QWVA 2WORA 5AANA 1QIWA 1TNQA 1YUSA 4MLWA 1AK8A 1OOJA 5I2OA 3K21A 1DJHA 3CZ0A 2ZN9A 2AAOA 1IJ6A 5KSZA 2JNFA 2NLNA 5DKQA 4JWQA 2KLDA 4GNKB 4ICBA 1QLSA 2KI4C 3S0EA 1TNWA 2KFHA 1YURA 2KAXA 4PE1A 2Q91A 4MZJA 1YRTB 3FE9A 1QX5B 1IG5A 3DY9A 2LLUA 1OOGA 2EC6B 4TNCA 1QV1A 3BFAA 4NDDA 3I5GC 4I5LB 2OTGC 2K60A 1W9ZA 1CLMA 3S0BA 2FOTA 1YR5A 1B8LA 1MUXA 2K2AA 2PRUA 3JTDB 5KTYA 4PHNA 1PULA 2BBNA 3SIAA 2KSPA 1CKKA 5CSJA 1YX7A 4D1EA 1H8BA 2MLFC 3BUXB 3WXAA 1C3ZA 1TCFA 2EHBA 1K8UA 5CSNA 1IIOA 3CDNA 2F3YA 2F8PA 2GV5A 1M63B 3EK7A 4DRWA 1KWOC 1T14A 1E8AA 2WCKA 5HLOA 2GTEA 4DS7A 3L4AA 4BY5A 1YVHA 2KAVA 1DELA 1KFUS 2QEVA 4HREE 4MRYA 1MXEA 2F2PA 2JU0A 3R1VA 1IWQA 4N1FA 3WHUB 1B4CA 3O2PA 3BFBA 2KFGA 5FI7A 2CBLA 1ALVA 2HETA 2KHNA 3AAKA 3SS3A 1A29A 2K8MB 1ODBA 4QJ3B 1M31A 2JOJA 2L51A 2EC6C 1MWNA 1DJZA 1S6CA 3OB1B 2G9BA 3I5HB 4E68A 1SCMB 2BL0B 2V53A 1J1EA 1UHIA 4Q04A 3TDZA 1SSEB 3AKAA 5I2LA 1CTRA 1OZSA 2KOTA 1DT7B 3IF7A 4YGEB 1JFKA 4YGCB 1BG1A 1QTXA 4PALA 3SG5A 1JF0A 2O60A 1FBVA 1DGUA 1TTXA 2LVIA 1Q80A 5HLVA 2PALA 2LUCA 2WCHA 1RWYA 3TUYB 4PCWA 2K2FA 3WNXB 2ZFDA 1LKJA 3PFVA 3UO9A 1S1EA 1SL9A 1UHHA 2KQ6A 2LNKA 2E30A 3AKBA 4MVFA 1WRKA 1BR1B 1TNPA 3CS1A 2LVVA 1B1GA 2LP3A 1WRZA 4IJ7A 4BY4A 2AUCA 2Y5IA 2JULA 1NYAA 3PN7B 5J3XA 1Y1UA 1GGWA 3ICBA 4IL1A 2KDHA 2OS8B 2YGUA 1L7ZA 3BQ3A 3GK2A 5AERA 4PE7A 1LA3A 3BFHA 1QVIY 3EVUA 5JJGA 4NDCA 1DJGA 2PMYA 1TN4A 1S36A 4N1GA 2KI6D 2JPTA 3CWGA 5CPVA 3I5HC 1Y6WA 1BF5A 1SCMC 2WC5A 1S5GY 3HX4A 2BL0C 1F71A 2LVKA 3QMEA 5HKYA 3DZTA 2M9GA 3CABA 1A03A 1S26D 2GGZA 3CR5X 2NCPA 3M0WA 2ZNDA 5FI6A 1YX8A 2Q4UA 2COLB 1AJ5A 1MR8A 3EKHA 4JPZB 3B86A 3L47A 1CMFA 2ERBA 3TUYC 1DEKA 3IQOA 2P70A 3F45A 2RGIA 4YI8A 4PHMA 2L5YA 2P6BB 1EXRA 2MAZA 2I7AA 4GGNA 1YTZC 1KSOA 1QX7A 2JWWA 2LMUA 1J1DA 1OMRA 2OTGB 1KK7Y 4GBAA 4YI9A 2OS8C 3NHTA 3A8RA 1XFWO 4PT1A 2VRGA
chains in the Genus database with same CATH topology
1SY9A 5D69A 2JT8A 4OVNF 1NWDA 4P5OE 3MSEB 1XO5A 1EG3A 3EVRA 4MEWA 4UPGA 1A4PA 1R6PA 1KFUL 1KQMC 4OV2A 1PSBA 1EL4A 1K9KA 2JXLA 2ZN8A 5BPJA 1KWOB 3SG4A 2JZIA 1B8CA 1G4YR 1RECA 2LE9B 3O78A 2O5GA 3D10A 3QRXA 3NSOA 1NSHA 4AOMA 2F33A 4A4CA 1A2XA 1NP8A 3O6BA 1QXPA 1CFPA 3OX6A 5D7FA 5B8IB 1N2DA 1BJFA 3AAJA 4NDBA 4NQGA 1CFFA 1Y1XA 2CXJA 3PLFB 2K7OA 3EK8A 1LA0A 1TOPA 1QATA 2L2EA 2MHHA 4DIRA 5HYDA 1OZOA 1JWDA 1R2UA 4DCKA 3SIBA 1FF1A 2FJUB 5JOLA 1M39A 1XFUO 1TNXA 1B7TY 2HQ8A 2BE4A 2PVBA 3D0YA 5ER4X 1G33A 5KU1A 1AP4A 1KQVA 3PATA 4FQOA 3RM1A 1QS7A 1CFDA 1K94A 1XFZO 1A75A 2LANA 1SYMA 1IQ3A 5AXIA 3EVVA 5GQQC 2SASA 1AHRA 3FIAA 1F4QA 2KAYA 1SR6B 2WCEA 4A4BA 3GOFA 4MZKA 4USLA 4U8DA 2G2BA 1DJYA 1VRKA 1UHNA 3TDUA 4P2YB 1DVIA 3FWBA 4JQ0D 2CCMA 5IBWA 1RK9A 1UP5A 3DVKA 1JBAA 4M2QA 2K0JA 1SRAA 2KNEA 1QIVA 2LHIA 2QPTA 4PDZA 1B9AA 1UWOA 2K7DA 3D0YB 3DVJA 3GK1A 4WQ2A 3BUMB 3O4YA 3BUOB 1OMVA 1A75B 4GPLB 5AFPA 2QACA 2WCBA 1RTP1 1OE9B 2PSRA 5CSIA 4C0KA 3I5FB 4GGFA 4I5NB 1F55A 1DJWA 3CLNA 2BBMA 1J7OA 3CTNA 2LAPA 1EG4A 4MBEA 1TIZA 1ALWA 3OHMB 1V1FA 1SL8A 2KYFA 3DVMA 1SW8A 4XYNA 1HQVA 2LC5A 1KCYA 1PVBA 2HF5A 2OPOA 2JTZA 2LV7A 1BODA 3CZTX 1SR6C 2Y1NA 1SCVA 2BCAA 1K90D 2K7BA 3LCPC 1L2OC 2FCDA 2I94A 2Y1MA 4GAOA 4HRHA 1CDMA 1CMGA 3KHEA 1NCYA 1QVIZ 4WQ3A 3CR4X 1WLMA 3PSRA 4ZCUA 5AEQA 3LK1A 1KQMB 4YGBB 1M46A 1K95A 5K89A 2LLSA 1J55A 1RFJA 4YGAA 1GQMA 1QLKA 3VRQA 2L0PA 2CNPA 1CDPA 2L5XB 1BMOA 1W7IB 4L9MA 2JT3A 2LP2A 3TDIA 3I5FC 2E6WA 2M97A 1DJIA 3CGAA 4GUKA 1CM1A 2L50A 3FS7A 4C0LA 4QJ5B 2F3ZA 2ZRSA 1H4BA 1WRLA 3LK0A 4OKHA 1NX0A 2NXQA 1JSAA 1DGVA 4XJKA 4PHKA 4ORCB 1UURA 2JNXA 3PALA 1PVAA 3SG2A 1CM4A 4GFTA 1YUUA 3E3RA 3FWCA 1CNPA 2WNDA 2KI6C 1KK8C 2LUXA 2M1UA 1ZFSA 1YUTA 1XFVO 2K61A 2LM5A 1W7JB 2MLEC 4PE0A 1V1GA 2M3WA 4OCIA 1OSAA 4QJ4B 2FCEA 1SK6D 1GJYA 2BE6A 3KF9A 3A4UB 1JFJA 4GGFC 2M0RA 2MBXA 1K2HA 3PM8A 1SBJA 1RJVA 2M7NA 1IJ5A 3SG7A 3SG6A 1S3PA 1YRUB 2MRDA 2LLTA 1DMOA 1N0YA 3KO0A 2Y4QA 4XJKB 1NX2A 5G08A 2BKHB 2BKIB 5ER5A 1B47A 4MSPA 2M1KB 4AQJA 1Y0VH 2M7LA 2HPSA 2JXCA 2JRFA 1MXLC 4PHJA 3BOWA 1F4OA 1TCOB 3OP0A 2KBMA 1IRJA 1DF0A 1HT9A 2M29A 4ZCVA 4OR9B 1XFXO 1XFYO 1IKUA 4CLNA 2MJWB 1CLBA 1CFCA 3SG3A 2BCBA 3C1VA 2IS9A 1C7VA 2ISDA 2ZRTA 1WY9A 1AUIB 1WLZA 5HKWA 1EJ3A 1IGVA 1Y1AA 4F0ZB 3GK4X 1BLQA 3BUWB 4PE4A 2WC8A 2F2OA 1LXFC 1DJXA 5TNCA 3VRNA 3VRRA 2JT0A 3EKJA 2A4JA 1B7TZ 1UUSA 4HRGA 5HKZA 2L4IA 2I2RE 5PALA 1S6IA 3BOWB 4I5JA 1GGZA 1DF0B 1XYDA 2PASA 2KBIA 2ZNEA 1JF2A 1NX1A 1QASA 2CT9A 1RROA 1L2OB 2I18A 2GGMA 2KYCA 5I8NA 4MN0A 1J7RA 1B8RA 1F70A 1XVJA 1AJ4A 4MZLA 2H61A 2M8UA 3NSKA 2B1UA 3TS5B 3ZNIA 1FI6A 4ETOA 3NXAA 1NX3A 1K93D 1BR4B 2CTNA 4HSZA 4N5XA 1CB1A 1JC2A 1KSMA 1MF8B 3ZWHA 1NUBA 1K9PA 3EK4A 1MHOA 4FTGA 2KGRA 4DUQA 1IQ5A 1JUOA 3KEVA 2DOQA 1AVSA 1F54A 4MRXA 1K9UA 1QJTA 1XA5A 5DKNA 3SJSA 3I5IB 3IQQA 3LLEA 2LCPA 1D1OA 2L4HA 3WHTB 1IH0A 2JC2A 1ZUZA 1S6JA 3BUNB 1XK4A 1BT6A 1KK8B 1PALA 2R2IA 3VGOA 5DKRA 1MQ1A 3JTDC 1G8IA 4ORAB 4C0JA 1F8HA 2HQWA 1UHKA 2JTTA 2EGDA 1M45A 5F6TA 1TRFA 3HCMA 1UHJA 1WDCB 2H2KA 1LINA 2MA2A 1CDNA 4CPVA 4CIDA 2BECA 2NCOA 4YGDB 1NCXA 2KFFA 1S5GZ 2D8NA 3TS5C 1ZMZA 3DD4A 4R1EA 4M2PA 2AMIA 1K96A 1ZOTB 2NZ0A 1KFXL 4YRUA 1BU3A 4ORBB 1C07A 2WCFA 2L98A 5I2QA 1N65A 1X02A 2ZKMX 4YBHB 1PRWA 4I5KA 1U5IA 1OMDA 3OB2B 5FYXA 2LMVA 3I5IC 5CSFA 3JVTB 4CFRA 1QX2A 4CFQA 1LVCD 3H4SE 3DF0A 4AQIA 3TZ1A 2KGBC 1FI5A 1J7PA 2H61C 1KK7Z 1CLLA 1DTLA 3KPXA 4WRIA 3OX5A 1C7WA 1NPQA 2KI4B 1WDCC 2LMTA 1NCZA 3NSLA 1QV0A 1ZACA 3DVEA 1SMGA 1SL7A 1BOCA 1PK0D 1PSRA 1YVLA 1U5IB 1NIWA 2LHLA 3LL8B 1EH2A 3PN7C 2TN4A 3I5GB 3BXKA 3NSIA 1SKTA 2BCXA 2JQ6A 1J7QA 1XK4C 3BYAA 2K7CA 2M49B 1CDLA 2LVJA 3DF0B 3RLZA 2KQYA 3VROA 3VRPA 1FW4A 1SNLA 1SPYA 2SCPA 1FPWA 1OQPA 1KFXS 2WOSA 3CR2A 3JVTC 4M2OA 2WORA 5AANA 1QIWA 1TNQA 1YUSA 4MLWA 1AK8A 1OOJA 5I2OA 3K21A 1DJHA 2ZN9A 2AAOA 1IJ6A 5KSZA 2JNFA 2NLNA 5DKQA 4JWQA 4GNKB 4ICBA 1QLSA 2KI4C 1TNWA 2KFHA 1YURA 2KAXA 4PE1A 2Q91A 4MZJA 1YRTB 1QX5B 1IG5A 2LLUA 2EC6B 4TNCA 1QV1A 4NDDA 3I5GC 4I5LB 2OTGC 1CLMA 2FOTA 1YR5A 1B8LA 1MUXA 2K2AA 2PRUA 3JTDB 5KTYA 4PHNA 1PULA 2BBNA 3SIAA 2KSPA 1CKKA 5CSJA 1YX7A 4D1EA 1H8BA 2MLFC 3BUXB 3WXAA 1TCFA 2EHBA 1K8UA 5CSNA 2F3YA 2F8PA 2GV5A 1M63B 3EK7A 4DRWA 1KWOC 1E8AA 5HLOA 4DS7A 4BY5A 1YVHA 2KAVA 1KFUS 4HREE 4MRYA 1MXEA 2F2PA 2JU0A 3WHUB 1IWQA 4N1FA 1B4CA 3O2PA 2KFGA 2CBLA 1ALVA 2HETA 2KHNA 3AAKA 1A29A 2K8MB 1ODBA 4QJ3B 1M31A 2JOJA 2L51A 2EC6C 1MWNA 1DJZA 1S6CA 3OB1B 2G9BA 3I5HB 4E68A 1SCMB 2BL0B 2V53A 1J1EA 1UHIA 4Q04A 3TDZA 3AKAA 5I2LA 1CTRA 1OZSA 2KOTA 1DT7B 3IF7A 4YGEB 1JFKA 4YGCB 1BG1A 1QTXA 4PALA 3SG5A 1JF0A 2O60A 1FBVA 1DGUA 1TTXA 2LVIA 1Q80A 5HLVA 2PALA 2LUCA 1RWYA 3TUYB 4PCWA 2K2FA 3WNXB 2ZFDA 1LKJA 3PFVA 4BY4A 1S1EA 1SL9A 1UHHA 2KQ6A 2LNKA 2E30A 3AKBA 4MVFA 1WRKA 1BR1B 1TNPA 3CS1A 2LVVA 1B1GA 2LP3A 1WRZA 2AUCA 2Y5IA 2JULA 1NYAA 3PN7B 5J3XA 1Y1UA 1GGWA 3ICBA 4IL1A 2KDHA 2OS8B 1L7ZA 3BQ3A 3GK2A 5AERA 4PE7A 1LA3A 1QVIY 3EVUA 5JJGA 4NDCA 1DJGA 2PMYA 1TN4A 1S36A 4N1GA 2KI6D 2JPTA 3CWGA 5CPVA 3I5HC 1Y6WA 1BF5A 1SCMC 1S5GY 3HX4A 2BL0C 1F71A 2LVKA 5HKYA 2M9GA 1A03A 1S26D 2GGZA 3CR5X 2NCPA 3M0WA 2ZNDA 1YX8A 2Q4UA 2COLB 1AJ5A 1MR8A 3EKHA 4JPZB 1CMFA 3TUYC 3IQOA 3F45A 2RGIA 4YI8A 4PHMA 2P6BB 1EXRA 2MAZA 2I7AA 4GGNA 1YTZC 1KSOA 1QX7A 2JWWA 2LMUA 1J1DA 1OMRA 2OTGB 1KK7Y 4GBAA 4YI9A 2OS8C 3A8RA 1XFWO 2VRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SY9 A;  5D69 A;  2JT8 A;  4OVN F;  1NWD A;  4P5O E;  3MSE B;  1XO5 A;  1EG3 A;  3EVR A;  4MEW A;  4UPG A;  1A4P A;  1R6P A;  1KFU L;  1KQM C;  4OV2 A;  1PSB A;  1EL4 A;  1K9K A;  2JXL A;  2ZN8 A;  5BPJ A;  1KWO B;  3SG4 A;  2JZI A;  1B8C A;  1G4Y R;  1REC A;  2LE9 B;  3O78 A;  2O5G A;  3D10 A;  3QRX A;  3NSO A;  1NSH A;  4AOM A;  2F33 A;  4A4C A;  1A2X A;  1NP8 A;  3O6B A;  1QXP A;  1CFP A;  3OX6 A;  5D7F A;  5B8I B;  1N2D A;  1BJF A;  3AAJ A;  4NDB A;  4NQG A;  1CFF A;  1Y1X A;  2CXJ A;  3PLF B;  2K7O A;  3EK8 A;  1LA0 A;  1TOP A;  1QAT A;  2L2E A;  2MHH A;  4DIR A;  5HYD A;  1OZO A;  1JWD A;  1R2U A;  4DCK A;  3SIB A;  1FF1 A;  2FJU B;  5JOL A;  1M39 A;  1XFU O;  1TNX A;  1B7T Y;  2HQ8 A;  2BE4 A;  2PVB A;  3D0Y A;  5ER4 X;  1G33 A;  5KU1 A;  1AP4 A;  1KQV A;  3PAT A;  4FQO A;  3RM1 A;  1QS7 A;  1CFD A;  1K94 A;  1XFZ O;  1A75 A;  2LAN A;  1SYM A;  1IQ3 A;  5AXI A;  3EVV A;  5GQQ C;  2SAS A;  1AHR A;  3FIA A;  1F4Q A;  2KAY A;  1SR6 B;  2WCE A;  4A4B A;  3GOF A;  4MZK A;  4USL A;  4U8D A;  2G2B A;  1DJY A;  1VRK A;  1UHN A;  3TDU A;  4P2Y B;  1DVI A;  3FWB A;  4JQ0 D;  2CCM A;  5IBW A;  1RK9 A;  1UP5 A;  3DVK A;  1JBA A;  4M2Q A;  2K0J A;  1SRA A;  2KNE A;  1QIV A;  2LHI A;  2QPT A;  4PDZ A;  1B9A A;  1UWO A;  2K7D A;  3D0Y B;  3DVJ A;  3GK1 A;  4WQ2 A;  3BUM B;  3O4Y A;  3BUO B;  1OMV A;  1A75 B;  4GPL B;  5AFP A;  2QAC A;  2WCB A;  1RTP 1;  1OE9 B;  2PSR A;  5CSI A;  4C0K A;  3I5F B;  4GGF A;  4I5N B;  1F55 A;  1DJW A;  3CLN A;  2BBM A;  1J7O A;  3CTN A;  2LAP A;  1EG4 A;  4MBE A;  1TIZ A;  1ALW A;  3OHM B;  1V1F A;  1SL8 A;  2KYF A;  3DVM A;  1SW8 A;  4XYN A;  1HQV A;  2LC5 A;  1KCY A;  1PVB A;  2HF5 A;  2OPO A;  2JTZ A;  2LV7 A;  1BOD A;  3CZT X;  1SR6 C;  2Y1N A;  1SCV A;  2BCA A;  1K90 D;  2K7B A;  3LCP C;  1L2O C;  2FCD A;  2I94 A;  2Y1M A;  4GAO A;  4HRH A;  1CDM A;  1CMG A;  3KHE A;  1NCY A;  1QVI Z;  4WQ3 A;  3CR4 X;  1WLM A;  3PSR A;  4ZCU A;  5AEQ A;  3LK1 A;  1KQM B;  4YGB B;  1M46 A;  1K95 A;  5K89 A;  2LLS A;  1J55 A;  1RFJ A;  4YGA A;  1GQM A;  1QLK A;  3VRQ A;  2L0P A;  2CNP A;  1CDP A;  2L5X B;  1BMO A;  1W7I B;  4L9M A;  2JT3 A;  2LP2 A;  3TDI A;  3I5F C;  2E6W A;  2M97 A;  1DJI A;  3CGA A;  4GUK A;  1CM1 A;  2L50 A;  3FS7 A;  4C0L A;  4QJ5 B;  2F3Z A;  2ZRS A;  1H4B A;  1WRL A;  3LK0 A;  4OKH A;  1NX0 A;  2NXQ A;  1JSA A;  1DGV A;  4XJK A;  4PHK A;  4ORC B;  1UUR A;  2JNX A;  3PAL A;  1PVA A;  3SG2 A;  1CM4 A;  4GFT A;  1YUU A;  3E3R A;  3FWC A;  1CNP A;  2WND A;  2KI6 C;  1KK8 C;  2LUX A;  2M1U A;  1ZFS A;  1YUT A;  1XFV O;  2K61 A;  2LM5 A;  1W7J B;  2MLE C;  4PE0 A;  1V1G A;  2M3W A;  4OCI A;  1OSA A;  4QJ4 B;  2FCE A;  1SK6 D;  1GJY A;  2BE6 A;  3KF9 A;  3A4U B;  1JFJ A;  4GGF C;  2M0R A;  2MBX A;  1K2H A;  3PM8 A;  1SBJ A;  1RJV A;  2M7N A;  1IJ5 A;  3SG7 A;  3SG6 A;  1S3P A;  1YRU B;  2MRD A;  2LLT A;  1DMO A;  1N0Y A;  3KO0 A;  2Y4Q A;  4XJK B;  1NX2 A;  5G08 A;  2BKH B;  2BKI B;  5ER5 A;  1B47 A;  4MSP A;  2M1K B;  4AQJ A;  1Y0V H;  2M7L A;  2HPS A;  2JXC A;  2JRF A;  1MXL C;  4PHJ A;  3BOW A;  1F4O A;  1TCO B;  3OP0 A;  2KBM A;  1IRJ A;  1DF0 A;  1HT9 A;  2M29 A;  4ZCV A;  4OR9 B;  1XFX O;  1XFY O;  1IKU A;  4CLN A;  2MJW B;  1CLB A;  1CFC A;  3SG3 A;  2BCB A;  3C1V A;  2IS9 A;  1C7V A;  2ISD A;  2ZRT A;  1WY9 A;  1AUI B;  1WLZ A;  5HKW A;  1EJ3 A;  1IGV A;  1Y1A A;  4F0Z B;  3GK4 X;  1BLQ A;  3BUW B;  4PE4 A;  2WC8 A;  2F2O A;  1LXF C;  1DJX A;  5TNC A;  3VRN A;  3VRR A;  2JT0 A;  3EKJ A;  2A4J A;  1B7T Z;  1UUS A;  4HRG A;  5HKZ A;  2L4I A;  2I2R E;  5PAL A;  1S6I A;  3BOW B;  4I5J A;  1GGZ A;  1DF0 B;  1XYD A;  2PAS A;  2KBI A;  2ZNE A;  1JF2 A;  1NX1 A;  1QAS A;  2CT9 A;  1RRO A;  1L2O B;  2I18 A;  2GGM A;  2KYC A;  5I8N A;  4MN0 A;  1J7R A;  1B8R A;  1F70 A;  1XVJ A;  1AJ4 A;  4MZL A;  2H61 A;  2M8U A;  3NSK A;  2B1U A;  3TS5 B;  3ZNI A;  1FI6 A;  4ETO A;  3NXA A;  1NX3 A;  1K93 D;  1BR4 B;  2CTN A;  4HSZ A;  4N5X A;  1CB1 A;  1JC2 A;  1KSM A;  1MF8 B;  3ZWH A;  1NUB A;  1K9P A;  3EK4 A;  1MHO A;  4FTG A;  2KGR A;  4DUQ A;  1IQ5 A;  1JUO A;  3KEV A;  2DOQ A;  1AVS A;  1F54 A;  4MRX A;  1K9U A;  1QJT A;  1XA5 A;  5DKN A;  3SJS A;  3I5I B;  3IQQ A;  3LLE A;  2LCP A;  1D1O A;  2L4H A;  3WHT B;  1IH0 A;  2JC2 A;  1ZUZ A;  1S6J A;  3BUN B;  1XK4 A;  1BT6 A;  1KK8 B;  1PAL A;  2R2I A;  3VGO A;  5DKR A;  1MQ1 A;  3JTD C;  1G8I A;  4ORA B;  4C0J A;  1F8H A;  2HQW A;  1UHK A;  2JTT A;  2EGD A;  1M45 A;  5F6T A;  1TRF A;  3HCM A;  1UHJ A;  1WDC B;  2H2K A;  1LIN A;  2MA2 A;  1CDN A;  4CPV A;  4CID A;  2BEC A;  2NCO A;  4YGD B;  1NCX A;  2KFF A;  1S5G Z;  2D8N A;  3TS5 C;  1ZMZ A;  3DD4 A;  4R1E A;  4M2P A;  2AMI A;  1K96 A;  1ZOT B;  2NZ0 A;  1KFX L;  4YRU A;  1BU3 A;  4ORB B;  1C07 A;  2WCF A;  2L98 A;  5I2Q A;  1N65 A;  1X02 A;  2ZKM X;  4YBH B;  1PRW A;  4I5K A;  1U5I A;  1OMD A;  3OB2 B;  5FYX A;  2LMV A;  3I5I C;  5CSF A;  3JVT B;  4CFR A;  1QX2 A;  4CFQ A;  1LVC D;  3H4S E;  3DF0 A;  4AQI A;  3TZ1 A;  2KGB C;  1FI5 A;  1J7P A;  2H61 C;  1KK7 Z;  1CLL A;  1DTL A;  3KPX A;  4WRI A;  3OX5 A;  1C7W A;  1NPQ A;  2KI4 B;  1WDC C;  2LMT A;  1NCZ A;  3NSL A;  1QV0 A;  1ZAC A;  3DVE A;  1SMG A;  1SL7 A;  1BOC A;  1PK0 D;  1PSR A;  1YVL A;  1U5I B;  1NIW A;  2LHL A;  3LL8 B;  1EH2 A;  3PN7 C;  2TN4 A;  3I5G B;  3BXK A;  3NSI A;  1SKT A;  2BCX A;  2JQ6 A;  1J7Q A;  1XK4 C;  3BYA A;  2K7C A;  2M49 B;  1CDL A;  2LVJ A;  3DF0 B;  3RLZ A;  2KQY A;  3VRO A;  3VRP A;  1FW4 A;  1SNL A;  1SPY A;  2SCP A;  1FPW A;  1OQP A;  1KFX S;  2WOS A;  3CR2 A;  3JVT C;  4M2O A;  2WOR A;  5AAN A;  1QIW A;  1TNQ A;  1YUS A;  4MLW A;  1AK8 A;  1OOJ A;  5I2O A;  3K21 A;  1DJH A;  2ZN9 A;  2AAO A;  1IJ6 A;  5KSZ A;  2JNF A;  2NLN A;  5DKQ A;  4JWQ A;  4GNK B;  4ICB A;  1QLS A;  2KI4 C;  1TNW A;  2KFH A;  1YUR A;  2KAX A;  4PE1 A;  2Q91 A;  4MZJ A;  1YRT B;  1QX5 B;  1IG5 A;  2LLU A;  2EC6 B;  4TNC A;  1QV1 A;  4NDD A;  3I5G C;  4I5L B;  2OTG C;  1CLM A;  2FOT A;  1YR5 A;  1B8L A;  1MUX A;  2K2A A;  2PRU A;  3JTD B;  5KTY A;  4PHN A;  1PUL A;  2BBN A;  3SIA A;  2KSP A;  1CKK A;  5CSJ A;  1YX7 A;  4D1E A;  1H8B A;  2MLF C;  3BUX B;  3WXA A;  1TCF A;  2EHB A;  1K8U A;  5CSN A;  2F3Y A;  2F8P A;  2GV5 A;  1M63 B;  3EK7 A;  4DRW A;  1KWO C;  1E8A A;  5HLO A;  4DS7 A;  4BY5 A;  1YVH A;  2KAV A;  1KFU S;  4HRE E;  4MRY A;  1MXE A;  2F2P A;  2JU0 A;  3WHU B;  1IWQ A;  4N1F A;  1B4C A;  3O2P A;  2KFG A;  2CBL A;  1ALV A;  2HET A;  2KHN A;  3AAK A;  1A29 A;  2K8M B;  1ODB A;  4QJ3 B;  1M31 A;  2JOJ A;  2L51 A;  2EC6 C;  1MWN A;  1DJZ A;  1S6C A;  3OB1 B;  2G9B A;  3I5H B;  4E68 A;  1SCM B;  2BL0 B;  2V53 A;  1J1E A;  1UHI A;  4Q04 A;  3TDZ A;  3AKA A;  5I2L A;  1CTR A;  1OZS A;  2KOT A;  1DT7 B;  3IF7 A;  4YGE B;  1JFK A;  4YGC B;  1BG1 A;  1QTX A;  4PAL A;  3SG5 A;  1JF0 A;  2O60 A;  1FBV A;  1DGU A;  1TTX A;  2LVI A;  1Q80 A;  5HLV A;  2PAL A;  2LUC A;  1RWY A;  3TUY B;  4PCW A;  2K2F A;  3WNX B;  2ZFD A;  1LKJ A;  3PFV A;  4BY4 A;  1S1E A;  1SL9 A;  1UHH A;  2KQ6 A;  2LNK A;  2E30 A;  3AKB A;  4MVF A;  1WRK A;  1BR1 B;  1TNP A;  3CS1 A;  2LVV A;  1B1G A;  2LP3 A;  1WRZ A;  2AUC A;  2Y5I A;  2JUL A;  1NYA A;  3PN7 B;  5J3X A;  1Y1U A;  1GGW A;  3ICB A;  4IL1 A;  2KDH A;  2OS8 B;  1L7Z A;  3BQ3 A;  3GK2 A;  5AER A;  4PE7 A;  1LA3 A;  1QVI Y;  3EVU A;  5JJG A;  4NDC A;  1DJG A;  2PMY A;  1TN4 A;  1S36 A;  4N1G A;  2KI6 D;  2JPT A;  3CWG A;  5CPV A;  3I5H C;  1Y6W A;  1BF5 A;  1SCM C;  1S5G Y;  3HX4 A;  2BL0 C;  1F71 A;  2LVK A;  5HKY A;  2M9G A;  1A03 A;  1S26 D;  2GGZ A;  3CR5 X;  2NCP A;  3M0W A;  2ZND A;  1YX8 A;  2Q4U A;  2COL B;  1AJ5 A;  1MR8 A;  3EKH A;  4JPZ B;  1CMF A;  3TUY C;  3IQO A;  3F45 A;  2RGI A;  4YI8 A;  4PHM A;  2P6B B;  1EXR A;  2MAZ A;  2I7A A;  4GGN A;  1YTZ C;  1KSO A;  1QX7 A;  2JWW A;  2LMU A;  1J1D A;  1OMR A;  2OTG B;  1KK7 Y;  4GBA A;  4YI9 A;  2OS8 C;  3A8R A;  1XFW O;  2VRG A; 
#chains in the Genus database with same CATH topology
 1SY9 A;  5D69 A;  2JT8 A;  4OVN F;  1NWD A;  1Z4H A;  3MSE B;  1XO5 A;  1EG3 A;  3D78 A;  3EVR A;  4MEW A;  4P5O E;  3V2L A;  1TUZ A;  4UPG A;  1XFR A;  1A4P A;  1R6P A;  1KFU L;  1KQM C;  4OV2 A;  1PSB A;  5DIC A;  1EL4 A;  1K9K A;  1P28 A;  2JXL A;  2ZN8 A;  5BPJ A;  1KWO B;  3SG4 A;  2JZI A;  1B8C A;  1G4Y R;  1REC A;  2LE9 B;  3O78 A;  2O5G A;  4KYN A;  3D10 A;  3QRX A;  3NSO A;  3IVT A;  5D3O A;  1NSH A;  4AOM A;  2F33 A;  4A4C A;  1A2X A;  1NP8 A;  3O6B A;  1QXP A;  1CFP A;  3OX6 A;  5D7F A;  5B8I B;  1TWO A;  1GM0 A;  3S0G A;  1N2D A;  1BJF A;  3AAJ A;  4NDB A;  4NQG A;  3SS5 A;  1CFF A;  1Y1X A;  2CXJ A;  3PLF B;  3O4X A;  2K7O A;  3EK8 A;  1LA0 A;  1TOP A;  1QAT A;  2L2E A;  2MHH A;  4DIR A;  5HYD A;  1OZO A;  1JWD A;  1R2U A;  2PQL A;  4DCK A;  2QEB A;  3SIB A;  1FF1 A;  2FJU B;  5JOL A;  1M39 A;  1XFU O;  1TNX A;  1B7T Y;  2HQ8 A;  2BE4 A;  2PVB A;  3D0Y A;  5ER4 X;  1G33 A;  5KU1 A;  1AP4 A;  1KQV A;  3PAT A;  4FQO A;  3RM1 A;  1QS7 A;  1CFD A;  1K94 A;  1XFZ O;  1A75 A;  2LAN A;  1SYM A;  1IQ3 A;  5AXI A;  3EVV A;  5GQQ C;  3VB1 A;  2SAS A;  1AHR A;  3FIA A;  1F4Q A;  2KAY A;  1SR6 B;  2WCE A;  4A4B A;  3GOF A;  4MZK A;  4USL A;  4U8D A;  2G2B A;  1DJY A;  1VRK A;  2KPH A;  1UHN A;  3TDU A;  4P2Y B;  1DVI A;  3FWB A;  4JQ0 D;  2CCM A;  5IBW A;  1RK9 A;  1UP5 A;  2WC6 A;  3DVK A;  1JBA A;  4M2Q A;  2K0J A;  1SRA A;  2KNE A;  1QIV A;  2LHI A;  2QPT A;  4PDZ A;  1B9A A;  1UWO A;  2K7D A;  3D0Y B;  3DVJ A;  3GK1 A;  3NHI A;  4WQ2 A;  3BUM B;  3O4Y A;  2H8V A;  3BUO B;  1OMV A;  1A75 B;  4GPL B;  4INW A;  5AFP A;  2QAC A;  2WCB A;  1OW4 A;  1RTP 1;  1OE9 B;  2PSR A;  5CSI A;  3R72 A;  4C0K A;  3I5F B;  3S0A A;  4GGF A;  4I5N B;  1F55 A;  1DJW A;  2BNX A;  3CLN A;  2BBM A;  1J7O A;  3CTN A;  2LAP A;  1EG4 A;  5HL1 A;  4MBE A;  3L4L A;  1TIZ A;  1ALW A;  2WCJ A;  3OGN A;  3OHM B;  1V1F A;  1SL8 A;  2KYF A;  3DVM A;  1SW8 A;  4XYN A;  1HQV A;  2LC5 A;  3D77 A;  1KCY A;  1PVB A;  2HF5 A;  2OPO A;  2JTZ A;  2LV7 A;  1BOD A;  3CZT X;  1SR6 C;  2Y1N A;  1SCV A;  2BCA A;  1K90 D;  2K7B A;  3LCP C;  1L2O C;  2FCD A;  2I94 A;  2Y1M A;  4GAO A;  4HRH A;  1CDM A;  1CMG A;  3KHE A;  1NCY A;  1QVI Z;  4WQ3 A;  3CR4 X;  1WLM A;  3PSR A;  4ZCU A;  5AEQ A;  3LK1 A;  1KQM B;  4YGB B;  1M46 A;  1K95 A;  5K89 A;  2JPO A;  3PJI A;  2LLS A;  1J55 A;  3B88 A;  1RFJ A;  4YGA A;  1GQM A;  1QLK A;  3VRQ A;  2L0P A;  2CNP A;  1CDP A;  2L5X B;  3SS4 A;  1BMO A;  1W7I B;  4L9M A;  2JT3 A;  2LP2 A;  3TDI A;  3I5F C;  2E6W A;  3S0F A;  2M97 A;  3B6X A;  1DJI A;  2P71 A;  3CGA A;  4GUK A;  1CM1 A;  2L50 A;  3FS7 A;  4C0L A;  4QJ5 B;  2F3Z A;  2ZRS A;  1H4B A;  1WRL A;  2L2C A;  3LK0 A;  4OKH A;  1NX0 A;  2NXQ A;  1JSA A;  1DGV A;  3B87 A;  4XJK A;  3DYE A;  4ORC B;  1UUR A;  2BAP A;  2JNX A;  1PVA A;  3PAL A;  4PHK A;  3SG2 A;  1CM4 A;  4GFT A;  1YUU A;  4JD9 A;  3E3R A;  3FWC A;  1CNP A;  1TUJ A;  2WND A;  2KI6 C;  1KK8 C;  2LUX A;  2M1U A;  1ZFS A;  1YUT A;  1XFV O;  2K61 A;  2LM5 A;  1W7J B;  2MLE C;  2QEH A;  4PE0 A;  1V1G A;  2M3W A;  4OCI A;  1OSA A;  4QJ4 B;  2FCE A;  1SK6 D;  1GJY A;  2BE6 A;  3KF9 A;  1OOF A;  3A4U B;  1JFJ A;  4GGF C;  2M0R A;  2MBX A;  1K2H A;  3PM8 A;  1SBJ A;  1OOH A;  1RJV A;  2M7N A;  1IJ5 A;  5EL2 A;  3SG6 A;  3SG7 A;  1S3P A;  1YRU B;  2MRD A;  2LLT A;  1DMO A;  1N0Y A;  3KO0 A;  2Y4Q A;  4XJK B;  1NX2 A;  5G08 A;  2BKH B;  2BKI B;  5ER5 A;  1B47 A;  4MSP A;  2M1K B;  4AQJ A;  1Y0V H;  2M7L A;  2HPS A;  4INX A;  2JXC A;  2QDI A;  2JRF A;  1MXL C;  4PHJ A;  3BOW A;  3FE8 A;  1F4O A;  1TCO B;  3OP0 A;  2KBM A;  1IRJ A;  1DF0 A;  1HT9 A;  2M29 A;  4ZCV A;  4OR9 B;  1XFX O;  1XFY O;  1IKU A;  4CLN A;  2MJW B;  1CLB A;  1CFC A;  3SG3 A;  2BCB A;  3C1V A;  2IS9 A;  1C7V A;  3EG5 B;  2ZRT A;  2ISD A;  1WY9 A;  1AUI B;  1WLZ A;  5HKW A;  1EJ3 A;  1IGV A;  1Y1A A;  4F0Z B;  3GK4 X;  1BLQ A;  3BUW B;  4PE4 A;  2WC8 A;  2F2O A;  1LXF C;  1DJX A;  5TNC A;  3VRN A;  3VRR A;  4OZD A;  2JT0 A;  3EKJ A;  2A4J A;  1B7T Z;  1UUS A;  3DXL A;  4HRG A;  5HKZ A;  2L4I A;  3BJH A;  2I2R E;  5PAL A;  1S6I A;  3BOW B;  4I5J A;  1GGZ A;  3D74 A;  1DF0 B;  1DC1 A;  3D73 A;  1XYD A;  2KLE A;  3D76 A;  2PAS A;  2KBI A;  2ZNE A;  1JF2 A;  1NX1 A;  1QAS A;  2CT9 A;  1RRO A;  1L2O B;  3CZ1 A;  2I18 A;  2GGM A;  2KYC A;  5I8N A;  4MN0 A;  3N7H A;  3CZ2 A;  1J7R A;  1B8R A;  1F70 A;  1XVJ A;  1AJ4 A;  4MZL A;  3RZS A;  2H61 A;  2M8U A;  3NSK A;  2B1U A;  3TS5 B;  3ZNI A;  1FI6 A;  4ETO A;  3NXA A;  1NX3 A;  2PYQ A;  1K93 D;  1BR4 B;  2CTN A;  3PM2 A;  4HSZ A;  4N5X A;  1CB1 A;  1JC2 A;  1KSM A;  1MF8 B;  3ZWH A;  1NUB A;  1K9P A;  2FJY A;  1MHO A;  3EK4 A;  4FTG A;  2KGR A;  4DUQ A;  1IQ5 A;  1JUO A;  3KEV A;  2DOQ A;  1AVS A;  1F54 A;  4MRX A;  1K9U A;  1QJT A;  3OBV A;  1XA5 A;  5DKN A;  3SJS A;  3I5I B;  3IQQ A;  3LLE A;  2LCP A;  4JKT A;  1D1O A;  2L4H A;  3WHT B;  3R1O A;  2JC2 A;  1IH0 A;  1ZUZ A;  1S6J A;  3BUN B;  1XK4 A;  1BT6 A;  1KK8 B;  1PAL A;  2QEO A;  2R2I A;  5DKR A;  3VGO A;  1MQ1 A;  3JTD C;  1G8I A;  4ORA B;  4C0J A;  1F8H A;  2HQW A;  1UHK A;  2JTT A;  2EGD A;  1M45 A;  5F6T A;  3CYZ A;  1TRF A;  3HCM A;  1UHJ A;  1WDC B;  2H2K A;  1LIN A;  2MA2 A;  1CDN A;  4CPV A;  4CID A;  2BEC A;  2NCO A;  4YGD B;  1NCX A;  2KFF A;  1S5G Z;  2D8N A;  3TS5 C;  1ZMZ A;  3DD4 A;  1Z2C B;  2WCM A;  4R1E A;  4M2P A;  2AMI A;  1K96 A;  3K1E A;  3R1P A;  1ZOT B;  5FI2 A;  4F7F A;  2NZ0 A;  1KFX L;  4YRU A;  1BU3 A;  4ORB B;  1C07 A;  2WCF A;  2L98 A;  5I2Q A;  1N65 A;  1X02 A;  2WCL A;  2ZKM X;  1PRW A;  4I5K A;  4YBH B;  1U5I A;  1OMD A;  3OB2 B;  5FYX A;  2LMV A;  3I5I C;  5CSF A;  3JVT B;  4CFR A;  1QX2 A;  4CFQ A;  1LVC D;  3H4S E;  1ORG A;  3D75 A;  3DF0 A;  1OOI X;  4AQI A;  3TZ1 A;  2KGB C;  1FI5 A;  1J7P A;  2H61 C;  1KK7 Z;  1CLL A;  3NGV A;  1DTL A;  3KPX A;  4WRI A;  3OX5 A;  1C7W A;  1NPQ A;  2KI4 B;  1WDC C;  2LMT A;  1NCZ A;  3NSL A;  1QV0 A;  1ZAC A;  3DVE A;  1SMG A;  1SL7 A;  1BOC A;  1PK0 D;  1PSR A;  1YVL A;  3UNW A;  3B7A A;  4FQT A;  1U5I B;  3S0D A;  1NIW A;  2LHL A;  3FE6 A;  3LL8 B;  1DQE A;  1EH2 A;  3PN7 C;  2TN4 A;  3I5G B;  3BXK A;  3NSI A;  1LS8 A;  1SKT A;  2BCX A;  2JQ6 A;  1J7Q A;  1XK4 C;  3BYA A;  2K7C A;  2M49 B;  1CDL A;  2LVJ A;  3DF0 B;  3RLZ A;  2KQY A;  3VRO A;  3VRP A;  1FW4 A;  1SNL A;  1SPY A;  2SCP A;  1FPW A;  3Q8I A;  1OQP A;  1KFX S;  2WOS A;  3CR2 A;  3JVT C;  4M2O A;  1C3Y A;  5I94 A;  1QWV A;  2WOR A;  5AAN A;  1QIW A;  1TNQ A;  1YUS A;  4MLW A;  1AK8 A;  1OOJ A;  5I2O A;  3K21 A;  1DJH A;  3CZ0 A;  2ZN9 A;  2AAO A;  1IJ6 A;  5KSZ A;  2JNF A;  2NLN A;  5DKQ A;  4JWQ A;  2KLD A;  4GNK B;  4ICB A;  1QLS A;  2KI4 C;  3S0E A;  1TNW A;  2KFH A;  1YUR A;  2KAX A;  4PE1 A;  2Q91 A;  4MZJ A;  1YRT B;  3FE9 A;  1QX5 B;  1IG5 A;  3DY9 A;  2LLU A;  1OOG A;  2EC6 B;  4TNC A;  1QV1 A;  3BFA A;  4NDD A;  3I5G C;  4I5L B;  2OTG C;  2K60 A;  1W9Z A;  1CLM A;  3S0B A;  2FOT A;  1YR5 A;  1B8L A;  1MUX A;  2K2A A;  2PRU A;  3JTD B;  5KTY A;  4PHN A;  1PUL A;  2BBN A;  3SIA A;  2KSP A;  1CKK A;  5CSJ A;  1YX7 A;  4D1E A;  1H8B A;  2MLF C;  3BUX B;  3WXA A;  1C3Z A;  1TCF A;  2EHB A;  1K8U A;  5CSN A;  1IIO A;  3CDN A;  2F3Y A;  2F8P A;  2GV5 A;  1M63 B;  3EK7 A;  4DRW A;  1KWO C;  1T14 A;  1E8A A;  2WCK A;  5HLO A;  2GTE A;  4DS7 A;  3L4A A;  4BY5 A;  1YVH A;  2KAV A;  1DEL A;  1KFU S;  2QEV A;  4HRE E;  4MRY A;  1MXE A;  2F2P A;  2JU0 A;  3R1V A;  1IWQ A;  4N1F A;  3WHU B;  1B4C A;  3O2P A;  3BFB A;  2KFG A;  5FI7 A;  2CBL A;  1ALV A;  2HET A;  2KHN A;  3AAK A;  3SS3 A;  1A29 A;  2K8M B;  1ODB A;  4QJ3 B;  1M31 A;  2JOJ A;  2L51 A;  2EC6 C;  1MWN A;  1DJZ A;  1S6C A;  3OB1 B;  2G9B A;  3I5H B;  4E68 A;  1SCM B;  2BL0 B;  2V53 A;  1J1E A;  1UHI A;  4Q04 A;  3TDZ A;  1SSE B;  3AKA A;  5I2L A;  1CTR A;  1OZS A;  2KOT A;  1DT7 B;  3IF7 A;  4YGE B;  1JFK A;  4YGC B;  1BG1 A;  1QTX A;  4PAL A;  3SG5 A;  1JF0 A;  2O60 A;  1FBV A;  1DGU A;  1TTX A;  2LVI A;  1Q80 A;  5HLV A;  2PAL A;  2LUC A;  2WCH A;  1RWY A;  3TUY B;  4PCW A;  2K2F A;  3WNX B;  2ZFD A;  1LKJ A;  3PFV A;  3UO9 A;  1S1E A;  1SL9 A;  1UHH A;  2KQ6 A;  2LNK A;  2E30 A;  3AKB A;  4MVF A;  1WRK A;  1BR1 B;  1TNP A;  3CS1 A;  2LVV A;  1B1G A;  2LP3 A;  1WRZ A;  4IJ7 A;  4BY4 A;  2AUC A;  2Y5I A;  2JUL A;  1NYA A;  3PN7 B;  5J3X A;  1Y1U A;  1GGW A;  3ICB A;  4IL1 A;  2KDH A;  2OS8 B;  2YGU A;  1L7Z A;  3BQ3 A;  3GK2 A;  5AER A;  4PE7 A;  1LA3 A;  3BFH A;  1QVI Y;  3EVU A;  5JJG A;  4NDC A;  1DJG A;  2PMY A;  1TN4 A;  1S36 A;  4N1G A;  2KI6 D;  2JPT A;  3CWG A;  5CPV A;  3I5H C;  1Y6W A;  1BF5 A;  1SCM C;  2WC5 A;  1S5G Y;  3HX4 A;  2BL0 C;  1F71 A;  2LVK A;  3QME A;  5HKY A;  3DZT A;  2M9G A;  3CAB A;  1A03 A;  1S26 D;  2GGZ A;  3CR5 X;  2NCP A;  3M0W A;  2ZND A;  5FI6 A;  1YX8 A;  2Q4U A;  2COL B;  1AJ5 A;  1MR8 A;  3EKH A;  4JPZ B;  3B86 A;  3L47 A;  1CMF A;  2ERB A;  3TUY C;  1DEK A;  3IQO A;  2P70 A;  3F45 A;  2RGI A;  4YI8 A;  4PHM A;  2L5Y A;  2P6B B;  1EXR A;  2MAZ A;  2I7A A;  4GGN A;  1YTZ C;  1KSO A;  1QX7 A;  2JWW A;  2LMU A;  1J1D A;  1OMR A;  2OTG B;  1KK7 Y;  4GBA A;  4YI9 A;  2OS8 C;  3NHT A;  3A8R A;  1XFW O;  4PT1 A;  2VRG A; 
#chains in the Genus database with same CATH homology
 1SY9 A;  5D69 A;  2JT8 A;  4OVN F;  1NWD A;  4P5O E;  3MSE B;  1XO5 A;  1EG3 A;  3EVR A;  4MEW A;  4UPG A;  1A4P A;  1R6P A;  1KFU L;  1KQM C;  4OV2 A;  1PSB A;  1EL4 A;  1K9K A;  2JXL A;  2ZN8 A;  5BPJ A;  1KWO B;  3SG4 A;  2JZI A;  1B8C A;  1G4Y R;  1REC A;  2LE9 B;  3O78 A;  2O5G A;  3D10 A;  3QRX A;  3NSO A;  1NSH A;  4AOM A;  2F33 A;  4A4C A;  1A2X A;  1NP8 A;  3O6B A;  1QXP A;  1CFP A;  3OX6 A;  5D7F A;  5B8I B;  1N2D A;  1BJF A;  3AAJ A;  4NDB A;  4NQG A;  1CFF A;  1Y1X A;  2CXJ A;  3PLF B;  2K7O A;  3EK8 A;  1LA0 A;  1TOP A;  1QAT A;  2L2E A;  2MHH A;  4DIR A;  5HYD A;  1OZO A;  1JWD A;  1R2U A;  4DCK A;  3SIB A;  1FF1 A;  2FJU B;  5JOL A;  1M39 A;  1XFU O;  1TNX A;  1B7T Y;  2HQ8 A;  2BE4 A;  2PVB A;  3D0Y A;  5ER4 X;  1G33 A;  5KU1 A;  1AP4 A;  1KQV A;  3PAT A;  4FQO A;  3RM1 A;  1QS7 A;  1CFD A;  1K94 A;  1XFZ O;  1A75 A;  2LAN A;  1SYM A;  1IQ3 A;  5AXI A;  3EVV A;  5GQQ C;  2SAS A;  1AHR A;  3FIA A;  1F4Q A;  2KAY A;  1SR6 B;  2WCE A;  4A4B A;  3GOF A;  4MZK A;  4USL A;  4U8D A;  2G2B A;  1DJY A;  1VRK A;  1UHN A;  3TDU A;  4P2Y B;  1DVI A;  3FWB A;  4JQ0 D;  2CCM A;  5IBW A;  1RK9 A;  1UP5 A;  3DVK A;  1JBA A;  4M2Q A;  2K0J A;  1SRA A;  2KNE A;  1QIV A;  2LHI A;  2QPT A;  4PDZ A;  1B9A A;  1UWO A;  2K7D A;  3D0Y B;  3DVJ A;  3GK1 A;  4WQ2 A;  3BUM B;  3O4Y A;  3BUO B;  1OMV A;  1A75 B;  4GPL B;  5AFP A;  2QAC A;  2WCB A;  1RTP 1;  1OE9 B;  2PSR A;  5CSI A;  4C0K A;  3I5F B;  4GGF A;  4I5N B;  1F55 A;  1DJW A;  3CLN A;  2BBM A;  1J7O A;  3CTN A;  2LAP A;  1EG4 A;  4MBE A;  1TIZ A;  1ALW A;  3OHM B;  1V1F A;  1SL8 A;  2KYF A;  3DVM A;  1SW8 A;  4XYN A;  1HQV A;  2LC5 A;  1KCY A;  1PVB A;  2HF5 A;  2OPO A;  2JTZ A;  2LV7 A;  1BOD A;  3CZT X;  1SR6 C;  2Y1N A;  1SCV A;  2BCA A;  1K90 D;  2K7B A;  3LCP C;  1L2O C;  2FCD A;  2I94 A;  2Y1M A;  4GAO A;  4HRH A;  1CDM A;  1CMG A;  3KHE A;  1NCY A;  1QVI Z;  4WQ3 A;  3CR4 X;  1WLM A;  3PSR A;  4ZCU A;  5AEQ A;  3LK1 A;  1KQM B;  4YGB B;  1M46 A;  1K95 A;  5K89 A;  2LLS A;  1J55 A;  1RFJ A;  4YGA A;  1GQM A;  1QLK A;  3VRQ A;  2L0P A;  2CNP A;  1CDP A;  2L5X B;  1BMO A;  1W7I B;  4L9M A;  2JT3 A;  2LP2 A;  3TDI A;  3I5F C;  2E6W A;  2M97 A;  1DJI A;  3CGA A;  4GUK A;  1CM1 A;  2L50 A;  3FS7 A;  4C0L A;  4QJ5 B;  2F3Z A;  2ZRS A;  1H4B A;  1WRL A;  3LK0 A;  4OKH A;  1NX0 A;  2NXQ A;  1JSA A;  1DGV A;  4XJK A;  4PHK A;  4ORC B;  1UUR A;  2JNX A;  3PAL A;  1PVA A;  3SG2 A;  1CM4 A;  4GFT A;  1YUU A;  3E3R A;  3FWC A;  1CNP A;  2WND A;  2KI6 C;  1KK8 C;  2LUX A;  2M1U A;  1ZFS A;  1YUT A;  1XFV O;  2K61 A;  2LM5 A;  1W7J B;  2MLE C;  4PE0 A;  1V1G A;  2M3W A;  4OCI A;  1OSA A;  4QJ4 B;  2FCE A;  1SK6 D;  1GJY A;  2BE6 A;  3KF9 A;  3A4U B;  1JFJ A;  4GGF C;  2M0R A;  2MBX A;  1K2H A;  3PM8 A;  1SBJ A;  1RJV A;  2M7N A;  1IJ5 A;  3SG7 A;  3SG6 A;  1S3P A;  1YRU B;  2MRD A;  2LLT A;  1DMO A;  1N0Y A;  3KO0 A;  2Y4Q A;  4XJK B;  1NX2 A;  5G08 A;  2BKH B;  2BKI B;  5ER5 A;  1B47 A;  4MSP A;  2M1K B;  4AQJ A;  1Y0V H;  2M7L A;  2HPS A;  2JXC A;  2JRF A;  1MXL C;  4PHJ A;  3BOW A;  1F4O A;  1TCO B;  3OP0 A;  2KBM A;  1IRJ A;  1DF0 A;  1HT9 A;  2M29 A;  4ZCV A;  4OR9 B;  1XFX O;  1XFY O;  1IKU A;  4CLN A;  2MJW B;  1CLB A;  1CFC A;  3SG3 A;  2BCB A;  3C1V A;  2IS9 A;  1C7V A;  2ISD A;  2ZRT A;  1WY9 A;  1AUI B;  1WLZ A;  5HKW A;  1EJ3 A;  1IGV A;  1Y1A A;  4F0Z B;  3GK4 X;  1BLQ A;  3BUW B;  4PE4 A;  2WC8 A;  2F2O A;  1LXF C;  1DJX A;  5TNC A;  3VRN A;  3VRR A;  2JT0 A;  3EKJ A;  2A4J A;  1B7T Z;  1UUS A;  4HRG A;  5HKZ A;  2L4I A;  2I2R E;  5PAL A;  1S6I A;  3BOW B;  4I5J A;  1GGZ A;  1DF0 B;  1XYD A;  2PAS A;  2KBI A;  2ZNE A;  1JF2 A;  1NX1 A;  1QAS A;  2CT9 A;  1RRO A;  1L2O B;  2I18 A;  2GGM A;  2KYC A;  5I8N A;  4MN0 A;  1J7R A;  1B8R A;  1F70 A;  1XVJ A;  1AJ4 A;  4MZL A;  2H61 A;  2M8U A;  3NSK A;  2B1U A;  3TS5 B;  3ZNI A;  1FI6 A;  4ETO A;  3NXA A;  1NX3 A;  1K93 D;  1BR4 B;  2CTN A;  4HSZ A;  4N5X A;  1CB1 A;  1JC2 A;  1KSM A;  1MF8 B;  3ZWH A;  1NUB A;  1K9P A;  3EK4 A;  1MHO A;  4FTG A;  2KGR A;  4DUQ A;  1IQ5 A;  1JUO A;  3KEV A;  2DOQ A;  1AVS A;  1F54 A;  4MRX A;  1K9U A;  1QJT A;  1XA5 A;  5DKN A;  3SJS A;  3I5I B;  3IQQ A;  3LLE A;  2LCP A;  1D1O A;  2L4H A;  3WHT B;  1IH0 A;  2JC2 A;  1ZUZ A;  1S6J A;  3BUN B;  1XK4 A;  1BT6 A;  1KK8 B;  1PAL A;  2R2I A;  3VGO A;  5DKR A;  1MQ1 A;  3JTD C;  1G8I A;  4ORA B;  4C0J A;  1F8H A;  2HQW A;  1UHK A;  2JTT A;  2EGD A;  1M45 A;  5F6T A;  1TRF A;  3HCM A;  1UHJ A;  1WDC B;  2H2K A;  1LIN A;  2MA2 A;  1CDN A;  4CPV A;  4CID A;  2BEC A;  2NCO A;  4YGD B;  1NCX A;  2KFF A;  1S5G Z;  2D8N A;  3TS5 C;  1ZMZ A;  3DD4 A;  4R1E A;  4M2P A;  2AMI A;  1K96 A;  1ZOT B;  2NZ0 A;  1KFX L;  4YRU A;  1BU3 A;  4ORB B;  1C07 A;  2WCF A;  2L98 A;  5I2Q A;  1N65 A;  1X02 A;  2ZKM X;  4YBH B;  1PRW A;  4I5K A;  1U5I A;  1OMD A;  3OB2 B;  5FYX A;  2LMV A;  3I5I C;  5CSF A;  3JVT B;  4CFR A;  1QX2 A;  4CFQ A;  1LVC D;  3H4S E;  3DF0 A;  4AQI A;  3TZ1 A;  2KGB C;  1FI5 A;  1J7P A;  2H61 C;  1KK7 Z;  1CLL A;  1DTL A;  3KPX A;  4WRI A;  3OX5 A;  1C7W A;  1NPQ A;  2KI4 B;  1WDC C;  2LMT A;  1NCZ A;  3NSL A;  1QV0 A;  1ZAC A;  3DVE A;  1SMG A;  1SL7 A;  1BOC A;  1PK0 D;  1PSR A;  1YVL A;  1U5I B;  1NIW A;  2LHL A;  3LL8 B;  1EH2 A;  3PN7 C;  2TN4 A;  3I5G B;  3BXK A;  3NSI A;  1SKT A;  2BCX A;  2JQ6 A;  1J7Q A;  1XK4 C;  3BYA A;  2K7C A;  2M49 B;  1CDL A;  2LVJ A;  3DF0 B;  3RLZ A;  2KQY A;  3VRO A;  3VRP A;  1FW4 A;  1SNL A;  1SPY A;  2SCP A;  1FPW A;  1OQP A;  1KFX S;  2WOS A;  3CR2 A;  3JVT C;  4M2O A;  2WOR A;  5AAN A;  1QIW A;  1TNQ A;  1YUS A;  4MLW A;  1AK8 A;  1OOJ A;  5I2O A;  3K21 A;  1DJH A;  2ZN9 A;  2AAO A;  1IJ6 A;  5KSZ A;  2JNF A;  2NLN A;  5DKQ A;  4JWQ A;  4GNK B;  4ICB A;  1QLS A;  2KI4 C;  1TNW A;  2KFH A;  1YUR A;  2KAX A;  4PE1 A;  2Q91 A;  4MZJ A;  1YRT B;  1QX5 B;  1IG5 A;  2LLU A;  2EC6 B;  4TNC A;  1QV1 A;  4NDD A;  3I5G C;  4I5L B;  2OTG C;  1CLM A;  2FOT A;  1YR5 A;  1B8L A;  1MUX A;  2K2A A;  2PRU A;  3JTD B;  5KTY A;  4PHN A;  1PUL A;  2BBN A;  3SIA A;  2KSP A;  1CKK A;  5CSJ A;  1YX7 A;  4D1E A;  1H8B A;  2MLF C;  3BUX B;  3WXA A;  1TCF A;  2EHB A;  1K8U A;  5CSN A;  2F3Y A;  2F8P A;  2GV5 A;  1M63 B;  3EK7 A;  4DRW A;  1KWO C;  1E8A A;  5HLO A;  4DS7 A;  4BY5 A;  1YVH A;  2KAV A;  1KFU S;  4HRE E;  4MRY A;  1MXE A;  2F2P A;  2JU0 A;  3WHU B;  1IWQ A;  4N1F A;  1B4C A;  3O2P A;  2KFG A;  2CBL A;  1ALV A;  2HET A;  2KHN A;  3AAK A;  1A29 A;  2K8M B;  1ODB A;  4QJ3 B;  1M31 A;  2JOJ A;  2L51 A;  2EC6 C;  1MWN A;  1DJZ A;  1S6C A;  3OB1 B;  2G9B A;  3I5H B;  4E68 A;  1SCM B;  2BL0 B;  2V53 A;  1J1E A;  1UHI A;  4Q04 A;  3TDZ A;  3AKA A;  5I2L A;  1CTR A;  1OZS A;  2KOT A;  1DT7 B;  3IF7 A;  4YGE B;  1JFK A;  4YGC B;  1BG1 A;  1QTX A;  4PAL A;  3SG5 A;  1JF0 A;  2O60 A;  1FBV A;  1DGU A;  1TTX A;  2LVI A;  1Q80 A;  5HLV A;  2PAL A;  2LUC A;  1RWY A;  3TUY B;  4PCW A;  2K2F A;  3WNX B;  2ZFD A;  1LKJ A;  3PFV A;  4BY4 A;  1S1E A;  1SL9 A;  1UHH A;  2KQ6 A;  2LNK A;  2E30 A;  3AKB A;  4MVF A;  1WRK A;  1BR1 B;  1TNP A;  3CS1 A;  2LVV A;  1B1G A;  2LP3 A;  1WRZ A;  2AUC A;  2Y5I A;  2JUL A;  1NYA A;  3PN7 B;  5J3X A;  1Y1U A;  1GGW A;  3ICB A;  4IL1 A;  2KDH A;  2OS8 B;  1L7Z A;  3BQ3 A;  3GK2 A;  5AER A;  4PE7 A;  1LA3 A;  1QVI Y;  3EVU A;  5JJG A;  4NDC A;  1DJG A;  2PMY A;  1TN4 A;  1S36 A;  4N1G A;  2KI6 D;  2JPT A;  3CWG A;  5CPV A;  3I5H C;  1Y6W A;  1BF5 A;  1SCM C;  1S5G Y;  3HX4 A;  2BL0 C;  1F71 A;  2LVK A;  5HKY A;  2M9G A;  1A03 A;  1S26 D;  2GGZ A;  3CR5 X;  2NCP A;  3M0W A;  2ZND A;  1YX8 A;  2Q4U A;  2COL B;  1AJ5 A;  1MR8 A;  3EKH A;  4JPZ B;  1CMF A;  3TUY C;  3IQO A;  3F45 A;  2RGI A;  4YI8 A;  4PHM A;  2P6B B;  1EXR A;  2MAZ A;  2I7A A;  4GGN A;  1YTZ C;  1KSO A;  1QX7 A;  2JWW A;  2LMU A;  1J1D A;  1OMR A;  2OTG B;  1KK7 Y;  4GBA A;  4YI9 A;  2OS8 C;  3A8R A;  1XFW O;  2VRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...