3PN7C

Visualizing new hinges and a potential major source of compliance in the lever arm of myosin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
152
Chain Sequence
KLSQDEIDDLKEVFELFDFWDGRDGAVDAFKIGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTYADYMEAFKTFDREGQGFISGAELRHVLSGLGERLSDEEVDEIINLTDLQEDLEGNVKYEEFVKKVMTGPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
publication title Visualizing key hinges and a potential major source of compliance in the lever arm of myosin.
pubmed doi rcsb
molecule tags Protein binding
total genus 45
structure length 152
sequence length 152
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pn7C01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pn7C02
1DMOA 1DT7B 5J3XA 1J7RA 1PVBA 2WNDA 3KHEA 3LL8B 4I5NB 1B1GA 5HKWA 4MEWA 1NCXA 3CS1A 2L0PA 1IG5A 1DJIA 1DTLA 4PHMA 3ZWHA 1CFPA 1K93D 4GAOA 1PK0D 2WOSA 1AJ5A 1QX5B 2LV7A 1DJWA 4QJ4B 2LAPA 1QVIZ 2MBXA 4MZLA 1CMGA 3FS7A 1YVLA 5I8NA 2Q4UA 2L5XB 2PALA 1TNWA 1DJYA 1IJ6A 3KF9A 3BUNB 3LLEA 1U5IA 4PE0A 1N2DA 1QASA 1DGVA 2Q91A 1Y1AA 2BBMA 3VRQA 1QVIY 2OPOA 3KEVA 1R2UA 1A4PA 1F4QA 3AKAA 1KFXL 2ZRSA 3KPXA 1NCZA 5D69A 1CFFA 2LP3A 2M7NA 3GK4X 1BODA 5AFPA 1F54A 2D8NA 3RM1A 2JTTA 1XFXO 1NX2A 3DF0A 1W7IB 4A4BA 2WCBA 4YRUA 3TS5C 4WRIA 3TS5B 3CWGA 1PULA 1OQPA 3BUWB 3ICBA 1FW4A 1CNPA 3BUXB 4N1GA 4DCKA 2LVIA 2PSRA 2NCPA 1OZSA 1K90D 2ZN9A 4NDBA 2ZRTA 4JQ0D 3BOWB 2F33A 4MZKA 2R2IA 4MZJA 1OSAA 3VROA 1QXPA 3RLZA 5I2LA 3FWCA 3HCMA 3VRPA 3D10A 1OE9B 3QRXA 1NCYA 1S5GY 2EGDA 1XFVO 5G08A 4M2QA 1GQMA 3BUMB 3F45A 3TZ1A 2MLFC 3MSEB 3WNXB 1PRWA 2O5GA 3DVEA 1QIVA 2CNPA 3WXAA 1QJTA 2KFHA 3NSIA 2LLTA 2P6BB 1CLMA 1UHJA 2KGRA 4P5OE 3WHUB 2FJUB 4CFQA 5HLVA 1K95A 1DVIA 1QLKA 1K9PA 1VRKA 1KQVA 4UPGA 1SPYA 1XK4A 1XYDA 4MRYA 4CPVA 5AANA 2CBLA 4N5XA 4YGBB 2AMIA 4USLA 1JF2A 1NPQA 3IF7A 1UURA 2Y4QA 1JSAA 4WQ2A 1YX8A 4BY4A 4GFTA 2JNFA 4GGFA 2HETA 2LVJA 1K2HA 1ZFSA 2F8PA 1CTRA 2LUCA 5AEQA 2KFFA 1S6IA 2H61A 3NSKA 5F6TA 1MXLC 4CFRA 2CTNA 4PE7A 1RTP1 4FTGA 4XYNA 1ODBA 1RWYA 3TDIA 1GJYA 1K9UA 1IGVA 2KSPA 1F55A 1EG3A 1TNXA 2G2BA 3M0WA 1C07A 4AQJA 1B8CA 4U8DA 3SG7A 4E68A 2LMTA 4FQOA 4JPZB 1SL7A 1TNPA 2JOJA 4TNCA 4WQ3A 1QLSA 4PE4A 4IL1A 2JT0A 2Y1MA 1NWDA 3A8RA 4YI9A 2VRGA 1G33A 3DVKA 2M7LA 4OVNF 3VRNA 2M0RA 3SIAA 3SG4A 4DRWA 1J55A 1PSBA 1ZACA 3BXKA 1XFYO 4C0KA 3H4SE 2KQYA 1FBVA 2JQ6A 1SRAA 1MUXA 1Y0VH 2BCAA 4HSZA 1QV0A 1KCYA 3E3RA 4YGAA 2ZNDA 1RK9A 2LANA 1A2XA 4XJKA 5ER4X 4PALA 2WC8A 1JC2A 1QV1A 1JFKA 3I5HC 3I5HB 1NX1A 3DD4A 2M97A 3CR2A 1DJHA 5HKZA 2RGIA 1SW8A 3HX4A 1WRKA 4ICBA 2V53A 1SCVA 4GUKA 2CT9A 4YBHB 2M8UA 4PDZA 1DF0B 1SBJA 2M3WA 4AOMA 4NDDA 1B8LA 4QJ3B 1AJ4A 2I18A 2K7OA 3I5FC 2K7BA 1F8HA 3I5FB 5K89A 1DGUA 1NX0A 3KO0A 4PHNA 3SG6A 3ZNIA 3PM8A 1LVCD 1CDMA 1YTZC 2BECA 3PALA 1CFDA 1J7QA 2LC5A 1IKUA 1BG1A 4PCWA 2MHHA 1UP5A 1SKTA 3NSOA 1AHRA 3LCPC 4OCIA 3BQ3A 3O4YA 5PALA 3CZTX 1WRZA 2DOQA 4MBEA 4ORCB 2KDHA 1YURA 5FYXA 4CIDA 1GGWA 3OB1B 1ALVA 5KU1A 2BL0C 2KAYA 2JT8A 3OX6A 2BL0B 2JNXA 2WCFA 2FCEA 1MXEA 1L2OC 4I5KA 4MRXA 1L2OB 1YRTB 3EK8A 2I2RE 2I94A 3JTDC 3JVTC 3JTDB 1M46A 1S5GZ 5CSIA 3JVTB 1LINA 1IRJA 1S3PA 2L4HA 3BOWA 1OZOA 4MLWA 1CMFA 1G8IA 2E30A 1KSOA 2SASA 3EVRA 1MHOA 1FI6A 2PRUA 5CSJA 2PVBA 2LE9B 1N65A 2ZN8A 3PLFB 4YGDB 1QATA 1FF1A 5JJGA 2KNEA 1A03A 2K2AA 1KFUL 1UHNA 4CLNA 2KBIA 1S6CA 1NP8A 2LLUA 1FPWA 4JWQA 1JWDA 2FCDA 1XVJA 2KI4C 1KWOC 4GNKB 1SY9A 4PHJA 2KI4B 1GGZA 1KWOB 1SL8A 1MQ1A 1NSHA 1JUOA 1EG4A 1XO5A 3EKHA 2NCOA 1KK7Y 1IQ3A 2BKHB 1QTXA 4YI8A 3TDUA 1YVHA 3FWBA 1KFXS 3CR5X 2KAXA 4DS7A 1XA5A 1BR1B 2K0JA 1B7TY 1DJZA 1Y6WA 1YUTA 4GBAA 1BLQA 2K61A 1JBAA 1V1GA 1CDPA 1F4OA 1SYMA 5CSFA 1CFCA 3BYAA 1K96A 1H4BA 1RFJA 4MN0A 5DKRA 1OMVA 4ZCUA 4C0LA 1JF0A 5HKYA 5I2OA 1AP4A 3OP0A 2M29A 3CGAA 1SL9A 3LK0A 2AUCA 2EC6C 2K8MB 3AAJA 1EJ3A 2EC6B 4YGEB 1XK4C 3GOFA 4OV2A 1CM1A 1A75B 5KTYA 3TUYC 1JFJA 4PHKA 5DKNA 3TUYB 4N1FA 2BE6A 3I5GC 2F3ZA 2HQ8A 1KK8C 2AAOA 3I5GB 1KK8B 3I5IC 1TNQA 1S26D 3I5IB 1YUSA 1B4CA 2JXCA 3AAKA 5BPJA 3NXAA 1RROA 2KHNA 1QIWA 3C1VA 2GGMA 2ISDA 3CTNA 2MRDA 2F2OA 3O78A 2KBMA 4M2OA 4DUQA 1Q80A 4ORBB 4M2PA 2LHLA 2M9GA 1K8UA 1KQMC 1NUBA 1ZMZA 2JWWA 2QACA 3PN7C 1KQMB 5IBWA 1Y1XA 1WLZA 5B8IB 2L50A 3A4UB 3OB2B 2MJWB 4GPLB 1J7OA 2LCPA 2JPTA 4OKHA 1BR4B 2K7DA 5KSZA 4MVFA 1TCFA 4QJ5B 2MA2A 1OOJA 1ALWA 3PATA 2KYFA 4PE1A 1J1EA 1LXFC 1BF5A 4R1EA 2KI6D 1Y1UA 1BJFA 1CDLA 1EL4A 3FIAA 2NLNA 2TN4A 1ZUZA 3PSRA 1H8BA 1AK8A 1C7VA 4D1EA 1J7PA 2M1KB 1E8AA 3D0YB 1S1EA 1DF0A 1AVSA 2L2EA 2L4IA 5CPVA 1D1OA 1YR5A 4DIRA 3AKBA 4HREE 1SNLA 2LVVA 3CLNA 4L9MA 3SG2A 5CSNA 1WY9A 1B47A 1PVAA 1W7JB 1CDNA 2LNKA 1SK6D 5TNCA 1S6JA 2NXQA 2JRFA 4Q04A 4MSPA 4HRGA 2E6WA 2BE4A 1IH0A 1QS7A 2BCBA 2JTZA 2ZFDA 3SG5A 1HT9A 5JOLA 1EH2A 1TCOB 1IQ5A 1U5IB 2HQWA 1RJVA 5HLOA 2KGBC 3EVVA 2WCEA 1SMGA 2L98A 3GK1A 1TN4A 1YX7A 1BT6A 2M49B 2CXJA 3O2PA 5AXIA 2FOTA 2OTGC 1LKJA 1LA3A 1NX3A 2OTGB 3DF0B 1A29A 5D7FA 1WLMA 3PFVA 1MF8B 3BUOB 2L51A 2PMYA 2MLEC 3O6BA 1K94A 2OS8C 4GGNA 1AUIB 4C0JA 1MWNA 2OS8B 3SJSA 3VRRA 1KK7Z 1XFZO 1YUUA 4I5LB 1UHKA 1CKKA 1DJXA 1B8RA 1X02A 2K7CA 1M45A 2LMVA 2JXLA 4NQGA 4ZCVA 1CLBA 1UHIA 3CR4X 1B7TZ 1R6PA 2LVKA 3DVJA 1SR6C 1UUSA 1XFUO 3LK1A 1L7ZA 1EXRA 1SR6B 1FI5A 1M31A 1CB1A 1CLLA 1RECA 2CCMA 2GGZA 2COLB 2KAVA 5GQQC 1UWOA 2Y5IA 2LLSA 3IQQA 1YRUB 2PASA 3SG3A 2HF5A 3EKJA 4NDCA 2KQ6A 1J1DA 2KYCA 2LUXA 2LM5A 1DJGA 2O60A 5DKQA 2SCPA 4YGCB 4AQIA 2F2PA 1HQVA 4ORAB 1IWQA 2BKIB 1F70A 2M1UA 1MR8A 1TOPA 1QX7A 2KI6C 4A4CA 1KSMA 1B9AA 1WDCC 5ER5A 2ZKMX 1WDCB 3VGOA 2JT3A 1A75A 3WHTB 1K9KA 5AERA 1CM4A 2LMUA 2MAZA 2K2FA 1ZOTB 2QPTA 4GGFC 3EK7A 2A4JA 1UHHA 1XFWO 3IQOA 1KFUS 3EK4A 4HRHA 1NIWA 2WORA 2ZNEA 1PALA 1M63B 2H61C 3NSLA 3SIBA 1SCMC 5I2QA 1SCMB 1BMOA 1NYAA 2G9BA 2JC2A 2Y1NA 1PSRA 2NZ0A 3PN7B 1OMRA 2BBNA 2HPSA 2KOTA 1G4YR 1M39A 4I5JA 1C7WA 1IJ5A 4F0ZB 2H2KA 2B1UA 2JU0A 2EHBA 3TDZA 1TIZA 1TRFA 3OX5A 1WRLA 2IS9A 2JULA 1BOCA 1F71A 3OHMB 3GK2A 3K21A 4BY5A 1TTXA 1LA0A 1QX2A 5HYDA 1BU3A 3DVMA 2LHIA 2LP2A 3EVUA 2GV5A 2I7AA 2JZIA 4OR9B 3D0YA 4P2YB 1OMDA 1V1FA 2KFGA 4ETOA 2F3YA 4XJKB 1N0YA 2BCXA 1S36A
chains in the Genus database with same CATH superfamily
1DMOA 1DT7B 5J3XA 1J7RA 1PVBA 2WNDA 2FJYA 3KHEA 3LL8B 4I5NB 5D3OA 1QWVA 4MEWA 1NCXA 2P70A 5HKWA 2GTEA 3CS1A 2L0PA 1IG5A 1TWOA 1DJIA 1DTLA 4PHMA 3ZWHA 3SS3A 1CFPA 1K93D 4GAOA 1PK0D 2WOSA 1AJ5A 1QX5B 3Q8IA 2LV7A 1DJWA 4QJ4B 2LAPA 1QVIZ 2MBXA 1SSEB 4MZLA 1CMGA 4PT1A 3S0DA 3FS7A 1YVLA 5I8NA 2Q4UA 2BAPA 2L5XB 2PALA 1TNWA 3CZ1A 1DJYA 1IJ6A 3KF9A 3BUNB 3LLEA 1U5IA 4PE0A 1N2DA 1QASA 1DGVA 2Q91A 1Y1AA 2BBMA 3B86A 3VRQA 3RZSA 1QVIY 2OPOA 3KEVA 1R2UA 1A4PA 1F4QA 3AKAA 3D75A 1KFXL 2ZRSA 3DXLA 1NCZA 3KPXA 5D69A 2LP3A 2M7NA 3FE8A 3GK4X 5AFPA 1BODA 1F54A 1C3ZA 2D8NA 3RM1A 2JTTA 1XFXO 1TUJA 1NX2A 3DF0A 1W7IB 4A4BA 2WCBA 5EL2A 4YRUA 3TS5C 4WRIA 1OOIX 3TS5B 3CWGA 1PULA 1OQPA 1P28A 3BUWB 3ICBA 1FW4A 1CNPA 3BUXB 4N1GA 4DCKA 2LVIA 2PSRA 2NCPA 1OZSA 1K90D 2ZN9A 4NDBA 2ZRTA 4JQ0D 3BOWB 2F33A 4INWA 4MZKA 2R2IA 4MZJA 1OSAA 3VROA 1QXPA 3BFBA 3RLZA 5I2LA 3FWCA 3HCMA 3VRPA 3D10A 1OE9B 3QRXA 1NCYA 2JPOA 1S5GY 2EGDA 1XFVO 5G08A 4M2QA 1GQMA 3BUMB 3F45A 3TZ1A 2MLFC 3MSEB 1DQEA 3WNXB 1PRWA 2O5GA 3DVEA 1QIVA 3D76A 2CNPA 3WXAA 1QJTA 2KFHA 2WCJA 2LLTA 2P6BB 1CLMA 1ORGA 3NSIA 1UHJA 2KGRA 4P5OE 3WHUB 2FJUB 4CFQA 5HLVA 1K95A 1DVIA 1QLKA 1K9PA 1VRKA 1KQVA 4UPGA 1SPYA 1XK4A 1XYDA 4MRYA 4CPVA 3L4AA 5AANA 2CBLA 4N5XA 4YGBB 2AMIA 4USLA 1JF2A 1NPQA 3IF7A 1UURA 2Y4QA 1JSAA 4WQ2A 1YX8A 4BY4A 5HL1A 4GFTA 2JNFA 4GGFA 2HETA 2LVJA 1K2HA 1ZFSA 2F8PA 1CTRA 2LUCA 5AEQA 2KFFA 1S6IA 2H61A 3NSKA 5F6TA 1MXLC 3S0GA 4CFRA 2CTNA 4PE7A 1RTP1 4FTGA 4XYNA 1C3YA 1ODBA 1RWYA 3QMEA 3TDIA 1GJYA 1K9UA 3DYEA 1IGVA 4F7FA 2KSPA 1F55A 3K1EA 1EG3A 1TNXA 2G2BA 3M0WA 3NHTA 1C07A 4AQJA 1B8CA 4U8DA 3SG7A 4E68A 2LMTA 4FQOA 4JPZB 1SL7A 1TNPA 2JOJA 2KLDA 2KPHA 4TNCA 4WQ3A 3UNWA 1QLSA 4PE4A 4IL1A 2JT0A 3VB1A 2Y1MA 3S0FA 1NWDA 3A8RA 4YI9A 2VRGA 1G33A 3DVKA 2M7LA 4OVNF 3B6XA 3VRNA 2M0RA 3SIAA 3SG4A 3OBVA 2PYQA 4DRWA 1J55A 1PSBA 1ZACA 3BXKA 2L2CA 1XFYO 4C0KA 3H4SE 2KQYA 1FBVA 2JQ6A 1SRAA 1MUXA 1Y0VH 2BCAA 4HSZA 1QV0A 1KCYA 3E3RA 4YGAA 2ZNDA 1RK9A 2LANA 1A2XA 4XJKA 3O4XA 3R1PA 5ER4X 4PALA 2WC8A 1JC2A 1QV1A 1JFKA 3I5HC 3I5HB 1NX1A 3DD4A 1JFJA 2BNXA 2M97A 3CR2A 1DJHA 2WCMA 5HKZA 2RGIA 1SW8A 3HX4A 1WRKA 4ICBA 2V53A 1SCVA 4GUKA 4KYNA 2CT9A 4YBHB 2M8UA 3NGVA 4PDZA 1DF0B 5FI2A 1SBJA 2M3WA 4AOMA 3CZ2A 4NDDA 1B8LA 4QJ3B 1AJ4A 2I18A 2K7OA 3I5FC 2K7BA 1F8HA 3I5FB 5K89A 1DGUA 1DEKA 1NX0A 3KO0A 4PHNA 3SG6A 3ZNIA 3PM8A 1LVCD 1CDMA 1YTZC 2BECA 3PALA 1CFDA 1J7QA 2LC5A 1IKUA 1BG1A 4PCWA 2MHHA 1UP5A 1SKTA 3NSOA 1AHRA 3LCPC 2P71A 1OOGA 3BQ3A 3O4YA 4OCIA 5PALA 3CZTX 1WRZA 2DOQA 4MBEA 4ORCB 2KDHA 1YURA 5FYXA 4CIDA 1GGWA 3OB1B 1ALVA 5KU1A 2BL0C 2KAYA 2JT8A 1OW4A 2BL0B 3OX6A 2JNXA 2WCFA 2FCEA 1MXEA 1L2OC 4I5KA 4MRXA 1L2OB 1YRTB 3EK8A 1T14A 2I2RE 2I94A 3JTDC 3PM2A 3JVTC 3JTDB 1M46A 1S5GZ 5CSIA 3JVTB 1LINA 1IRJA 1S3PA 2L4HA 3BOWA 1OZOA 4MLWA 1CMFA 1G8IA 2E30A 1KSOA 2SASA 5I94A 3EVRA 1MHOA 2QEOA 1FI6A 2PRUA 5CSJA 2PVBA 2QEVA 1XFRA 2LE9B 1N65A 2ZN8A 3PLFB 4YGDB 1QATA 3B87A 1FF1A 5JJGA 2KNEA 1A03A 2K2AA 1KFUL 1UHNA 4CLNA 3SS5A 2KBIA 1S6CA 1NP8A 2LLUA 1FPWA 4JWQA 1JWDA 2FCDA 1XVJA 2KI4C 1KWOC 4GNKB 1SY9A 4PHJA 2KI4B 1GGZA 1KWOB 1SL8A 2L5YA 1MQ1A 1NSHA 1JUOA 1EG4A 1XO5A 3EKHA 2NCOA 1KK7Y 1IQ3A 2BKHB 1QTXA 4YI8A 3TDUA 1YVHA 3FWBA 3R1OA 1KFXS 3CR5X 2KAXA 4DS7A 1XA5A 1BR1B 2K0JA 1B7TY 3L4LA 5FI7A 1DJZA 1Y6WA 1YUTA 3PJIA 4GBAA 1BLQA 1W9ZA 2K61A 3B88A 1JBAA 1V1GA 1CDPA 1F4OA 1SYMA 5CSFA 3N7HA 1CFCA 3BYAA 1K96A 1H4BA 1RFJA 4MN0A 5DKRA 1OMVA 4ZCUA 2QDIA 1JF0A 4C0LA 5HKYA 5I2OA 1AP4A 3OP0A 2M29A 3CGAA 1SL9A 3LK0A 2AUCA 2EC6C 2K8MB 3AAJA 1EJ3A 2EC6B 4YGEB 1XK4C 3GOFA 4OV2A 1CM1A 1A75B 5KTYA 3BFAA 3TUYC 4OZDA 2WCKA 3EG5B 4PHKA 5DKNA 3TUYB 4N1FA 2BE6A 3FE9A 3I5GC 2F3ZA 2HQ8A 1KK8C 2AAOA 3I5GB 3S0AA 1KK8B 3I5IC 1TNQA 1S26D 3I5IB 1YUSA 1B4CA 1Z2CB 2JXCA 3AAKA 3B7AA 5BPJA 3CABA 1B1GA 3NXAA 1RROA 2KHNA 1QIWA 3C1VA 2GGMA 2ISDA 3CTNA 2MRDA 2F2OA 3O78A 2KBMA 4M2OA 4DUQA 1Q80A 4ORBB 4M2PA 2LHLA 2M9GA 1K8UA 1KQMC 1NUBA 1ZMZA 2JWWA 2QACA 3PN7C 1KQMB 1TUZA 5IBWA 1Y1XA 1WLZA 1GM0A 3S0BA 4INXA 2L50A 3A4UB 3OB2B 2MJWB 4GPLB 5DICA 5B8IB 1LS8A 2LCPA 2JPTA 4OKHA 1J7OA 1BR4B 2K7DA 3D73A 5KSZA 4MVFA 1TCFA 4QJ5B 2MA2A 1OOJA 1ALWA 3PATA 2KYFA 4PE1A 1J1EA 1OOFA 1LXFC 1BF5A 4R1EA 2KI6D 1Y1UA 3IVTA 1BJFA 1CDLA 1EL4A 3FIAA 2NLNA 3R1VA 2TN4A 1ZUZA 2WC5A 2QEHA 3PSRA 3S0EA 1AK8A 1C7VA 4D1EA 1H8BA 1OOHA 1J7PA 2M1KB 1E8AA 3D0YB 2K60A 5FI6A 2WCLA 4JKTA 1S1EA 1DF0A 1AVSA 2WC6A 2L2EA 2L4IA 3D77A 5CPVA 1D1OA 1YR5A 4DIRA 3AKBA 2YGUA 4HREE 2QEBA 1SNLA 2LVVA 3CLNA 4L9MA 3SG2A 5CSNA 1WY9A 1B47A 1PVAA 1W7JB 1CDNA 3BJHA 2LNKA 1SK6D 5TNCA 1S6JA 2NXQA 2JRFA 4Q04A 1CFFA 4MSPA 4HRGA 2E6WA 2BE4A 1DC1A 1QS7A 2BCBA 2JTZA 2ZFDA 2KLEA 1IH0A 3SG5A 1HT9A 5JOLA 1EH2A 1TCOB 1IQ5A 1U5IB 2HQWA 1RJVA 5HLOA 2KGBC 3EVVA 2WCEA 2ERBA 1SMGA 2L98A 3GK1A 1TN4A 1YX7A 1BT6A 2M49B 2WCHA 2CXJA 3O2PA 5AXIA 2FOTA 2OTGC 3OGNA 1LKJA 1LA3A 1NX3A 2OTGB 3DF0B 1A29A 5D7FA 1WLMA 3PFVA 1MF8B 3BUOB 2L51A 2PMYA 3BFHA 2MLEC 3O6BA 1K94A 2OS8C 4GGNA 1AUIB 4C0JA 1MWNA 2OS8B 3DZTA 3SJSA 3VRRA 3CZ0A 1KK7Z 1XFZO 1YUUA 4I5LB 1UHKA 1CKKA 1DJXA 1B8RA 1X02A 2K7CA 1M45A 2LMVA 2JXLA 4NQGA 4ZCVA 3L47A 1CLBA 1UHIA 3CR4X 1B7TZ 1R6PA 2LVKA 3DVJA 1SR6C 1UUSA 1XFUO 3FE6A 3LK1A 1L7ZA 1EXRA 1SR6B 1FI5A 1M31A 1CB1A 4IJ7A 1CLLA 1RECA 2CCMA 2GGZA 2COLB 2H8VA 2KAVA 5GQQC 1UWOA 2Y5IA 2LLSA 3R72A 3IQQA 1YRUB 2PASA 3SG3A 2HF5A 3EKJA 4NDCA 2KQ6A 1J1DA 2KYCA 2LUXA 2LM5A 1DJGA 2O60A 5DKQA 2SCPA 4YGCB 4AQIA 2F2PA 1HQVA 4ORAB 1IWQA 1Z4HA 2BKIB 2M1UA 1MR8A 1F70A 1TOPA 1QX7A 2KI6C 4A4CA 1KSMA 1B9AA 1WDCC 5ER5A 2ZKMX 1WDCB 3VGOA 2JT3A 1A75A 3WHTB 1K9KA 5AERA 1CM4A 2LMUA 2MAZA 2K2FA 1ZOTB 2QPTA 4GGFC 3EK7A 2A4JA 1UHHA 1XFWO 3IQOA 3CYZA 1KFUS 3EK4A 4HRHA 1NIWA 2WORA 2ZNEA 3DY9A 1PALA 1M63B 2H61C 3NSLA 3SIBA 1SCMC 5I2QA 1SCMB 1BMOA 1NYAA 2G9BA 2JC2A 2Y1NA 1PSRA 2NZ0A 3PN7B 1DELA 1OMRA 2BBNA 3D74A 4JD9A 2HPSA 3SS4A 1IIOA 2KOTA 2PQLA 4FQTA 1G4YR 1M39A 4I5JA 3UO9A 1C7WA 1IJ5A 4F0ZB 2H2KA 2B1UA 2JU0A 2EHBA 3TDZA 1TIZA 1TRFA 3OX5A 1WRLA 2IS9A 2JULA 1BOCA 1F71A 3OHMB 3GK2A 3K21A 4BY5A 1TTXA 1LA0A 1QX2A 5HYDA 1BU3A 3DVMA 2LHIA 2LP2A 3V2LA 3EVUA 2GV5A 2I7AA 2JZIA 4OR9B 3D78A 3D0YA 3CDNA 4P2YB 1OMDA 1V1FA 2KFGA 4ETOA 2F3YA 4XJKB 1N0YA 2BCXA 3NHIA 1S36A
chains in the Genus database with same CATH topology
1DMOA 1DT7B 5J3XA 1J7RA 1PVBA 2WNDA 3KHEA 3LL8B 4I5NB 1B1GA 5HKWA 4MEWA 1NCXA 3CS1A 2L0PA 1IG5A 1DJIA 1DTLA 4PHMA 3ZWHA 1CFPA 1K93D 4GAOA 1PK0D 2WOSA 1AJ5A 1QX5B 2LV7A 1DJWA 4QJ4B 2LAPA 1QVIZ 2MBXA 4MZLA 1CMGA 3FS7A 1YVLA 5I8NA 2Q4UA 2L5XB 2PALA 1TNWA 1DJYA 1IJ6A 3KF9A 3BUNB 3LLEA 1U5IA 4PE0A 1N2DA 1QASA 1DGVA 2Q91A 1Y1AA 2BBMA 3VRQA 1QVIY 2OPOA 3KEVA 1R2UA 1A4PA 1F4QA 3AKAA 1KFXL 2ZRSA 3KPXA 1NCZA 5D69A 1CFFA 2LP3A 2M7NA 3GK4X 1BODA 5AFPA 1F54A 2D8NA 3RM1A 2JTTA 1XFXO 1NX2A 3DF0A 1W7IB 4A4BA 2WCBA 4YRUA 3TS5C 4WRIA 3TS5B 3CWGA 1PULA 1OQPA 3BUWB 3ICBA 1FW4A 1CNPA 3BUXB 4N1GA 4DCKA 2LVIA 2PSRA 2NCPA 1OZSA 1K90D 2ZN9A 4NDBA 2ZRTA 4JQ0D 3BOWB 2F33A 4MZKA 2R2IA 4MZJA 1OSAA 3VROA 1QXPA 3RLZA 5I2LA 3FWCA 3HCMA 3VRPA 3D10A 1OE9B 3QRXA 1NCYA 1S5GY 2EGDA 1XFVO 5G08A 4M2QA 1GQMA 3BUMB 3F45A 3TZ1A 2MLFC 3MSEB 3WNXB 1PRWA 2O5GA 3DVEA 1QIVA 2CNPA 3WXAA 1QJTA 2KFHA 3NSIA 2LLTA 2P6BB 1CLMA 1UHJA 2KGRA 4P5OE 3WHUB 2FJUB 4CFQA 5HLVA 1K95A 1DVIA 1QLKA 1K9PA 1VRKA 1KQVA 4UPGA 1SPYA 1XK4A 1XYDA 4MRYA 4CPVA 5AANA 2CBLA 4N5XA 4YGBB 2AMIA 4USLA 1JF2A 1NPQA 3IF7A 1UURA 2Y4QA 1JSAA 4WQ2A 1YX8A 4BY4A 4GFTA 2JNFA 4GGFA 2HETA 2LVJA 1K2HA 1ZFSA 2F8PA 1CTRA 2LUCA 5AEQA 2KFFA 1S6IA 2H61A 3NSKA 5F6TA 1MXLC 4CFRA 2CTNA 4PE7A 1RTP1 4FTGA 4XYNA 1ODBA 1RWYA 3TDIA 1GJYA 1K9UA 1IGVA 2KSPA 1F55A 1EG3A 1TNXA 2G2BA 3M0WA 1C07A 4AQJA 1B8CA 4U8DA 3SG7A 4E68A 2LMTA 4FQOA 4JPZB 1SL7A 1TNPA 2JOJA 4TNCA 4WQ3A 1QLSA 4PE4A 4IL1A 2JT0A 2Y1MA 1NWDA 3A8RA 4YI9A 2VRGA 1G33A 3DVKA 2M7LA 4OVNF 3VRNA 2M0RA 3SIAA 3SG4A 4DRWA 1J55A 1PSBA 1ZACA 3BXKA 1XFYO 4C0KA 3H4SE 2KQYA 1FBVA 2JQ6A 1SRAA 1MUXA 1Y0VH 2BCAA 4HSZA 1QV0A 1KCYA 3E3RA 4YGAA 2ZNDA 1RK9A 2LANA 1A2XA 4XJKA 5ER4X 4PALA 2WC8A 1JC2A 1QV1A 1JFKA 3I5HC 3I5HB 1NX1A 3DD4A 2M97A 3CR2A 1DJHA 5HKZA 2RGIA 1SW8A 3HX4A 1WRKA 4ICBA 2V53A 1SCVA 4GUKA 2CT9A 4YBHB 2M8UA 4PDZA 1DF0B 1SBJA 2M3WA 4AOMA 4NDDA 1B8LA 4QJ3B 1AJ4A 2I18A 2K7OA 3I5FC 2K7BA 1F8HA 3I5FB 5K89A 1DGUA 1NX0A 3KO0A 4PHNA 3SG6A 3ZNIA 3PM8A 1LVCD 1CDMA 1YTZC 2BECA 3PALA 1CFDA 1J7QA 2LC5A 1IKUA 1BG1A 4PCWA 2MHHA 1UP5A 1SKTA 3NSOA 1AHRA 3LCPC 4OCIA 3BQ3A 3O4YA 5PALA 3CZTX 1WRZA 2DOQA 4MBEA 4ORCB 2KDHA 1YURA 5FYXA 4CIDA 1GGWA 3OB1B 1ALVA 5KU1A 2BL0C 2KAYA 2JT8A 3OX6A 2BL0B 2JNXA 2WCFA 2FCEA 1MXEA 1L2OC 4I5KA 4MRXA 1L2OB 1YRTB 3EK8A 2I2RE 2I94A 3JTDC 3JVTC 3JTDB 1M46A 1S5GZ 5CSIA 3JVTB 1LINA 1IRJA 1S3PA 2L4HA 3BOWA 1OZOA 4MLWA 1CMFA 1G8IA 2E30A 1KSOA 2SASA 3EVRA 1MHOA 1FI6A 2PRUA 5CSJA 2PVBA 2LE9B 1N65A 2ZN8A 3PLFB 4YGDB 1QATA 1FF1A 5JJGA 2KNEA 1A03A 2K2AA 1KFUL 1UHNA 4CLNA 2KBIA 1S6CA 1NP8A 2LLUA 1FPWA 4JWQA 1JWDA 2FCDA 1XVJA 2KI4C 1KWOC 4GNKB 1SY9A 4PHJA 2KI4B 1GGZA 1KWOB 1SL8A 1MQ1A 1NSHA 1JUOA 1EG4A 1XO5A 3EKHA 2NCOA 1KK7Y 1IQ3A 2BKHB 1QTXA 4YI8A 3TDUA 1YVHA 3FWBA 1KFXS 3CR5X 2KAXA 4DS7A 1XA5A 1BR1B 2K0JA 1B7TY 1DJZA 1Y6WA 1YUTA 4GBAA 1BLQA 2K61A 1JBAA 1V1GA 1CDPA 1F4OA 1SYMA 5CSFA 1CFCA 3BYAA 1K96A 1H4BA 1RFJA 4MN0A 5DKRA 1OMVA 4ZCUA 4C0LA 1JF0A 5HKYA 5I2OA 1AP4A 3OP0A 2M29A 3CGAA 1SL9A 3LK0A 2AUCA 2EC6C 2K8MB 3AAJA 1EJ3A 2EC6B 4YGEB 1XK4C 3GOFA 4OV2A 1CM1A 1A75B 5KTYA 3TUYC 1JFJA 4PHKA 5DKNA 3TUYB 4N1FA 2BE6A 3I5GC 2F3ZA 2HQ8A 1KK8C 2AAOA 3I5GB 1KK8B 3I5IC 1TNQA 1S26D 3I5IB 1YUSA 1B4CA 2JXCA 3AAKA 5BPJA 3NXAA 1RROA 2KHNA 1QIWA 3C1VA 2GGMA 2ISDA 3CTNA 2MRDA 2F2OA 3O78A 2KBMA 4M2OA 4DUQA 1Q80A 4ORBB 4M2PA 2LHLA 2M9GA 1K8UA 1KQMC 1NUBA 1ZMZA 2JWWA 2QACA 3PN7C 1KQMB 5IBWA 1Y1XA 1WLZA 5B8IB 2L50A 3A4UB 3OB2B 2MJWB 4GPLB 1J7OA 2LCPA 2JPTA 4OKHA 1BR4B 2K7DA 5KSZA 4MVFA 1TCFA 4QJ5B 2MA2A 1OOJA 1ALWA 3PATA 2KYFA 4PE1A 1J1EA 1LXFC 1BF5A 4R1EA 2KI6D 1Y1UA 1BJFA 1CDLA 1EL4A 3FIAA 2NLNA 2TN4A 1ZUZA 3PSRA 1H8BA 1AK8A 1C7VA 4D1EA 1J7PA 2M1KB 1E8AA 3D0YB 1S1EA 1DF0A 1AVSA 2L2EA 2L4IA 5CPVA 1D1OA 1YR5A 4DIRA 3AKBA 4HREE 1SNLA 2LVVA 3CLNA 4L9MA 3SG2A 5CSNA 1WY9A 1B47A 1PVAA 1W7JB 1CDNA 2LNKA 1SK6D 5TNCA 1S6JA 2NXQA 2JRFA 4Q04A 4MSPA 4HRGA 2E6WA 2BE4A 1IH0A 1QS7A 2BCBA 2JTZA 2ZFDA 3SG5A 1HT9A 5JOLA 1EH2A 1TCOB 1IQ5A 1U5IB 2HQWA 1RJVA 5HLOA 2KGBC 3EVVA 2WCEA 1SMGA 2L98A 3GK1A 1TN4A 1YX7A 1BT6A 2M49B 2CXJA 3O2PA 5AXIA 2FOTA 2OTGC 1LKJA 1LA3A 1NX3A 2OTGB 3DF0B 1A29A 5D7FA 1WLMA 3PFVA 1MF8B 3BUOB 2L51A 2PMYA 2MLEC 3O6BA 1K94A 2OS8C 4GGNA 1AUIB 4C0JA 1MWNA 2OS8B 3SJSA 3VRRA 1KK7Z 1XFZO 1YUUA 4I5LB 1UHKA 1CKKA 1DJXA 1B8RA 1X02A 2K7CA 1M45A 2LMVA 2JXLA 4NQGA 4ZCVA 1CLBA 1UHIA 3CR4X 1B7TZ 1R6PA 2LVKA 3DVJA 1SR6C 1UUSA 1XFUO 3LK1A 1L7ZA 1EXRA 1SR6B 1FI5A 1M31A 1CB1A 1CLLA 1RECA 2CCMA 2GGZA 2COLB 2KAVA 5GQQC 1UWOA 2Y5IA 2LLSA 3IQQA 1YRUB 2PASA 3SG3A 2HF5A 3EKJA 4NDCA 2KQ6A 1J1DA 2KYCA 2LUXA 2LM5A 1DJGA 2O60A 5DKQA 2SCPA 4YGCB 4AQIA 2F2PA 1HQVA 4ORAB 1IWQA 2BKIB 1F70A 2M1UA 1MR8A 1TOPA 1QX7A 2KI6C 4A4CA 1KSMA 1B9AA 1WDCC 5ER5A 2ZKMX 1WDCB 3VGOA 2JT3A 1A75A 3WHTB 1K9KA 5AERA 1CM4A 2LMUA 2MAZA 2K2FA 1ZOTB 2QPTA 4GGFC 3EK7A 2A4JA 1UHHA 1XFWO 3IQOA 1KFUS 3EK4A 4HRHA 1NIWA 2WORA 2ZNEA 1PALA 1M63B 2H61C 3NSLA 3SIBA 1SCMC 5I2QA 1SCMB 1BMOA 1NYAA 2G9BA 2JC2A 2Y1NA 1PSRA 2NZ0A 3PN7B 1OMRA 2BBNA 2HPSA 2KOTA 1G4YR 1M39A 4I5JA 1C7WA 1IJ5A 4F0ZB 2H2KA 2B1UA 2JU0A 2EHBA 3TDZA 1TIZA 1TRFA 3OX5A 1WRLA 2IS9A 2JULA 1BOCA 1F71A 3OHMB 3GK2A 3K21A 4BY5A 1TTXA 1LA0A 1QX2A 5HYDA 1BU3A 3DVMA 2LHIA 2LP2A 3EVUA 2GV5A 2I7AA 2JZIA 4OR9B 3D0YA 4P2YB 1OMDA 1V1FA 2KFGA 4ETOA 2F3YA 4XJKB 1N0YA 2BCXA 1S36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DMO A;  1DT7 B;  5J3X A;  1J7R A;  1PVB A;  2WND A;  3KHE A;  3LL8 B;  4I5N B;  1B1G A;  5HKW A;  4MEW A;  1NCX A;  3CS1 A;  2L0P A;  1IG5 A;  1DJI A;  1DTL A;  4PHM A;  3ZWH A;  1CFP A;  1K93 D;  4GAO A;  1PK0 D;  2WOS A;  1AJ5 A;  1QX5 B;  2LV7 A;  1DJW A;  4QJ4 B;  2LAP A;  1QVI Z;  2MBX A;  4MZL A;  1CMG A;  3FS7 A;  1YVL A;  5I8N A;  2Q4U A;  2L5X B;  2PAL A;  1TNW A;  1DJY A;  1IJ6 A;  3KF9 A;  3BUN B;  3LLE A;  1U5I A;  4PE0 A;  1N2D A;  1QAS A;  1DGV A;  2Q91 A;  1Y1A A;  2BBM A;  3VRQ A;  1QVI Y;  2OPO A;  3KEV A;  1R2U A;  1A4P A;  1F4Q A;  3AKA A;  1KFX L;  2ZRS A;  3KPX A;  1NCZ A;  5D69 A;  1CFF A;  2LP3 A;  2M7N A;  3GK4 X;  1BOD A;  5AFP A;  1F54 A;  2D8N A;  3RM1 A;  2JTT A;  1XFX O;  1NX2 A;  3DF0 A;  1W7I B;  4A4B A;  2WCB A;  4YRU A;  3TS5 C;  4WRI A;  3TS5 B;  3CWG A;  1PUL A;  1OQP A;  3BUW B;  3ICB A;  1FW4 A;  1CNP A;  3BUX B;  4N1G A;  4DCK A;  2LVI A;  2PSR A;  2NCP A;  1OZS A;  1K90 D;  2ZN9 A;  4NDB A;  2ZRT A;  4JQ0 D;  3BOW B;  2F33 A;  4MZK A;  2R2I A;  4MZJ A;  1OSA A;  3VRO A;  1QXP A;  3RLZ A;  5I2L A;  3FWC A;  3HCM A;  3VRP A;  3D10 A;  1OE9 B;  3QRX A;  1NCY A;  1S5G Y;  2EGD A;  1XFV O;  5G08 A;  4M2Q A;  1GQM A;  3BUM B;  3F45 A;  3TZ1 A;  2MLF C;  3MSE B;  3WNX B;  1PRW A;  2O5G A;  3DVE A;  1QIV A;  2CNP A;  3WXA A;  1QJT A;  2KFH A;  3NSI A;  2LLT A;  2P6B B;  1CLM A;  1UHJ A;  2KGR A;  4P5O E;  3WHU B;  2FJU B;  4CFQ A;  5HLV A;  1K95 A;  1DVI A;  1QLK A;  1K9P A;  1VRK A;  1KQV A;  4UPG A;  1SPY A;  1XK4 A;  1XYD A;  4MRY A;  4CPV A;  5AAN A;  2CBL A;  4N5X A;  4YGB B;  2AMI A;  4USL A;  1JF2 A;  1NPQ A;  3IF7 A;  1UUR A;  2Y4Q A;  1JSA A;  4WQ2 A;  1YX8 A;  4BY4 A;  4GFT A;  2JNF A;  4GGF A;  2HET A;  2LVJ A;  1K2H A;  1ZFS A;  2F8P A;  1CTR A;  2LUC A;  5AEQ A;  2KFF A;  1S6I A;  2H61 A;  3NSK A;  5F6T A;  1MXL C;  4CFR A;  2CTN A;  4PE7 A;  1RTP 1;  4FTG A;  4XYN A;  1ODB A;  1RWY A;  3TDI A;  1GJY A;  1K9U A;  1IGV A;  2KSP A;  1F55 A;  1EG3 A;  1TNX A;  2G2B A;  3M0W A;  1C07 A;  4AQJ A;  1B8C A;  4U8D A;  3SG7 A;  4E68 A;  2LMT A;  4FQO A;  4JPZ B;  1SL7 A;  1TNP A;  2JOJ A;  4TNC A;  4WQ3 A;  1QLS A;  4PE4 A;  4IL1 A;  2JT0 A;  2Y1M A;  1NWD A;  3A8R A;  4YI9 A;  2VRG A;  1G33 A;  3DVK A;  2M7L A;  4OVN F;  3VRN A;  2M0R A;  3SIA A;  3SG4 A;  4DRW A;  1J55 A;  1PSB A;  1ZAC A;  3BXK A;  1XFY O;  4C0K A;  3H4S E;  2KQY A;  1FBV A;  2JQ6 A;  1SRA A;  1MUX A;  1Y0V H;  2BCA A;  4HSZ A;  1QV0 A;  1KCY A;  3E3R A;  4YGA A;  2ZND A;  1RK9 A;  2LAN A;  1A2X A;  4XJK A;  5ER4 X;  4PAL A;  2WC8 A;  1JC2 A;  1QV1 A;  1JFK A;  3I5H C;  3I5H B;  1NX1 A;  3DD4 A;  2M97 A;  3CR2 A;  1DJH A;  5HKZ A;  2RGI A;  1SW8 A;  3HX4 A;  1WRK A;  4ICB A;  2V53 A;  1SCV A;  4GUK A;  2CT9 A;  4YBH B;  2M8U A;  4PDZ A;  1DF0 B;  1SBJ A;  2M3W A;  4AOM A;  4NDD A;  1B8L A;  4QJ3 B;  1AJ4 A;  2I18 A;  2K7O A;  3I5F C;  2K7B A;  1F8H A;  3I5F B;  5K89 A;  1DGU A;  1NX0 A;  3KO0 A;  4PHN A;  3SG6 A;  3ZNI A;  3PM8 A;  1LVC D;  1CDM A;  1YTZ C;  2BEC A;  3PAL A;  1CFD A;  1J7Q A;  2LC5 A;  1IKU A;  1BG1 A;  4PCW A;  2MHH A;  1UP5 A;  1SKT A;  3NSO A;  1AHR A;  3LCP C;  4OCI A;  3BQ3 A;  3O4Y A;  5PAL A;  3CZT X;  1WRZ A;  2DOQ A;  4MBE A;  4ORC B;  2KDH A;  1YUR A;  5FYX A;  4CID A;  1GGW A;  3OB1 B;  1ALV A;  5KU1 A;  2BL0 C;  2KAY A;  2JT8 A;  3OX6 A;  2BL0 B;  2JNX A;  2WCF A;  2FCE A;  1MXE A;  1L2O C;  4I5K A;  4MRX A;  1L2O B;  1YRT B;  3EK8 A;  2I2R E;  2I94 A;  3JTD C;  3JVT C;  3JTD B;  1M46 A;  1S5G Z;  5CSI A;  3JVT B;  1LIN A;  1IRJ A;  1S3P A;  2L4H A;  3BOW A;  1OZO A;  4MLW A;  1CMF A;  1G8I A;  2E30 A;  1KSO A;  2SAS A;  3EVR A;  1MHO A;  1FI6 A;  2PRU A;  5CSJ A;  2PVB A;  2LE9 B;  1N65 A;  2ZN8 A;  3PLF B;  4YGD B;  1QAT A;  1FF1 A;  5JJG A;  2KNE A;  1A03 A;  2K2A A;  1KFU L;  1UHN A;  4CLN A;  2KBI A;  1S6C A;  1NP8 A;  2LLU A;  1FPW A;  4JWQ A;  1JWD A;  2FCD A;  1XVJ A;  2KI4 C;  1KWO C;  4GNK B;  1SY9 A;  4PHJ A;  2KI4 B;  1GGZ A;  1KWO B;  1SL8 A;  1MQ1 A;  1NSH A;  1JUO A;  1EG4 A;  1XO5 A;  3EKH A;  2NCO A;  1KK7 Y;  1IQ3 A;  2BKH B;  1QTX A;  4YI8 A;  3TDU A;  1YVH A;  3FWB A;  1KFX S;  3CR5 X;  2KAX A;  4DS7 A;  1XA5 A;  1BR1 B;  2K0J A;  1B7T Y;  1DJZ A;  1Y6W A;  1YUT A;  4GBA A;  1BLQ A;  2K61 A;  1JBA A;  1V1G A;  1CDP A;  1F4O A;  1SYM A;  5CSF A;  1CFC A;  3BYA A;  1K96 A;  1H4B A;  1RFJ A;  4MN0 A;  5DKR A;  1OMV A;  4ZCU A;  4C0L A;  1JF0 A;  5HKY A;  5I2O A;  1AP4 A;  3OP0 A;  2M29 A;  3CGA A;  1SL9 A;  3LK0 A;  2AUC A;  2EC6 C;  2K8M B;  3AAJ A;  1EJ3 A;  2EC6 B;  4YGE B;  1XK4 C;  3GOF A;  4OV2 A;  1CM1 A;  1A75 B;  5KTY A;  3TUY C;  1JFJ A;  4PHK A;  5DKN A;  3TUY B;  4N1F A;  2BE6 A;  3I5G C;  2F3Z A;  2HQ8 A;  1KK8 C;  2AAO A;  3I5G B;  1KK8 B;  3I5I C;  1TNQ A;  1S26 D;  3I5I B;  1YUS A;  1B4C A;  2JXC A;  3AAK A;  5BPJ A;  3NXA A;  1RRO A;  2KHN A;  1QIW A;  3C1V A;  2GGM A;  2ISD A;  3CTN A;  2MRD A;  2F2O A;  3O78 A;  2KBM A;  4M2O A;  4DUQ A;  1Q80 A;  4ORB B;  4M2P A;  2LHL A;  2M9G A;  1K8U A;  1KQM C;  1NUB A;  1ZMZ A;  2JWW A;  2QAC A;  3PN7 C;  1KQM B;  5IBW A;  1Y1X A;  1WLZ A;  5B8I B;  2L50 A;  3A4U B;  3OB2 B;  2MJW B;  4GPL B;  1J7O A;  2LCP A;  2JPT A;  4OKH A;  1BR4 B;  2K7D A;  5KSZ A;  4MVF A;  1TCF A;  4QJ5 B;  2MA2 A;  1OOJ A;  1ALW A;  3PAT A;  2KYF A;  4PE1 A;  1J1E A;  1LXF C;  1BF5 A;  4R1E A;  2KI6 D;  1Y1U A;  1BJF A;  1CDL A;  1EL4 A;  3FIA A;  2NLN A;  2TN4 A;  1ZUZ A;  3PSR A;  1H8B A;  1AK8 A;  1C7V A;  4D1E A;  1J7P A;  2M1K B;  1E8A A;  3D0Y B;  1S1E A;  1DF0 A;  1AVS A;  2L2E A;  2L4I A;  5CPV A;  1D1O A;  1YR5 A;  4DIR A;  3AKB A;  4HRE E;  1SNL A;  2LVV A;  3CLN A;  4L9M A;  3SG2 A;  5CSN A;  1WY9 A;  1B47 A;  1PVA A;  1W7J B;  1CDN A;  2LNK A;  1SK6 D;  5TNC A;  1S6J A;  2NXQ A;  2JRF A;  4Q04 A;  4MSP A;  4HRG A;  2E6W A;  2BE4 A;  1IH0 A;  1QS7 A;  2BCB A;  2JTZ A;  2ZFD A;  3SG5 A;  1HT9 A;  5JOL A;  1EH2 A;  1TCO B;  1IQ5 A;  1U5I B;  2HQW A;  1RJV A;  5HLO A;  2KGB C;  3EVV A;  2WCE A;  1SMG A;  2L98 A;  3GK1 A;  1TN4 A;  1YX7 A;  1BT6 A;  2M49 B;  2CXJ A;  3O2P A;  5AXI A;  2FOT A;  2OTG C;  1LKJ A;  1LA3 A;  1NX3 A;  2OTG B;  3DF0 B;  1A29 A;  5D7F A;  1WLM A;  3PFV A;  1MF8 B;  3BUO B;  2L51 A;  2PMY A;  2MLE C;  3O6B A;  1K94 A;  2OS8 C;  4GGN A;  1AUI B;  4C0J A;  1MWN A;  2OS8 B;  3SJS A;  3VRR A;  1KK7 Z;  1XFZ O;  1YUU A;  4I5L B;  1UHK A;  1CKK A;  1DJX A;  1B8R A;  1X02 A;  2K7C A;  1M45 A;  2LMV A;  2JXL A;  4NQG A;  4ZCV A;  1CLB A;  1UHI A;  3CR4 X;  1B7T Z;  1R6P A;  2LVK A;  3DVJ A;  1SR6 C;  1UUS A;  1XFU O;  3LK1 A;  1L7Z A;  1EXR A;  1SR6 B;  1FI5 A;  1M31 A;  1CB1 A;  1CLL A;  1REC A;  2CCM A;  2GGZ A;  2COL B;  2KAV A;  5GQQ C;  1UWO A;  2Y5I A;  2LLS A;  3IQQ A;  1YRU B;  2PAS A;  3SG3 A;  2HF5 A;  3EKJ A;  4NDC A;  2KQ6 A;  1J1D A;  2KYC A;  2LUX A;  2LM5 A;  1DJG A;  2O60 A;  5DKQ A;  2SCP A;  4YGC B;  4AQI A;  2F2P A;  1HQV A;  4ORA B;  1IWQ A;  2BKI B;  1F70 A;  2M1U A;  1MR8 A;  1TOP A;  1QX7 A;  2KI6 C;  4A4C A;  1KSM A;  1B9A A;  1WDC C;  5ER5 A;  2ZKM X;  1WDC B;  3VGO A;  2JT3 A;  1A75 A;  3WHT B;  1K9K A;  5AER A;  1CM4 A;  2LMU A;  2MAZ A;  2K2F A;  1ZOT B;  2QPT A;  4GGF C;  3EK7 A;  2A4J A;  1UHH A;  1XFW O;  3IQO A;  1KFU S;  3EK4 A;  4HRH A;  1NIW A;  2WOR A;  2ZNE A;  1PAL A;  1M63 B;  2H61 C;  3NSL A;  3SIB A;  1SCM C;  5I2Q A;  1SCM B;  1BMO A;  1NYA A;  2G9B A;  2JC2 A;  2Y1N A;  1PSR A;  2NZ0 A;  3PN7 B;  1OMR A;  2BBN A;  2HPS A;  2KOT A;  1G4Y R;  1M39 A;  4I5J A;  1C7W A;  1IJ5 A;  4F0Z B;  2H2K A;  2B1U A;  2JU0 A;  2EHB A;  3TDZ A;  1TIZ A;  1TRF A;  3OX5 A;  1WRL A;  2IS9 A;  2JUL A;  1BOC A;  1F71 A;  3OHM B;  3GK2 A;  3K21 A;  4BY5 A;  1TTX A;  1LA0 A;  1QX2 A;  5HYD A;  1BU3 A;  3DVM A;  2LHI A;  2LP2 A;  3EVU A;  2GV5 A;  2I7A A;  2JZI A;  4OR9 B;  3D0Y A;  4P2Y B;  1OMD A;  1V1F A;  2KFG A;  4ETO A;  2F3Y A;  4XJK B;  1N0Y A;  2BCX A;  1S36 A; 
#chains in the Genus database with same CATH topology
 1DMO A;  1DT7 B;  5J3X A;  1J7R A;  1PVB A;  2WND A;  2FJY A;  3KHE A;  3LL8 B;  4I5N B;  5D3O A;  1QWV A;  4MEW A;  1NCX A;  2P70 A;  5HKW A;  2GTE A;  3CS1 A;  2L0P A;  1IG5 A;  1TWO A;  1DJI A;  1DTL A;  4PHM A;  3ZWH A;  3SS3 A;  1CFP A;  1K93 D;  4GAO A;  1PK0 D;  2WOS A;  1AJ5 A;  1QX5 B;  3Q8I A;  2LV7 A;  1DJW A;  4QJ4 B;  2LAP A;  1QVI Z;  2MBX A;  1SSE B;  4MZL A;  1CMG A;  4PT1 A;  3S0D A;  3FS7 A;  1YVL A;  5I8N A;  2Q4U A;  2BAP A;  2L5X B;  2PAL A;  1TNW A;  3CZ1 A;  1DJY A;  1IJ6 A;  3KF9 A;  3BUN B;  3LLE A;  1U5I A;  4PE0 A;  1N2D A;  1QAS A;  1DGV A;  2Q91 A;  1Y1A A;  2BBM A;  3B86 A;  3VRQ A;  3RZS A;  1QVI Y;  2OPO A;  3KEV A;  1R2U A;  1A4P A;  1F4Q A;  3AKA A;  3D75 A;  1KFX L;  2ZRS A;  3DXL A;  1NCZ A;  3KPX A;  5D69 A;  2LP3 A;  2M7N A;  3FE8 A;  3GK4 X;  5AFP A;  1BOD A;  1F54 A;  1C3Z A;  2D8N A;  3RM1 A;  2JTT A;  1XFX O;  1TUJ A;  1NX2 A;  3DF0 A;  1W7I B;  4A4B A;  2WCB A;  5EL2 A;  4YRU A;  3TS5 C;  4WRI A;  1OOI X;  3TS5 B;  3CWG A;  1PUL A;  1OQP A;  1P28 A;  3BUW B;  3ICB A;  1FW4 A;  1CNP A;  3BUX B;  4N1G A;  4DCK A;  2LVI A;  2PSR A;  2NCP A;  1OZS A;  1K90 D;  2ZN9 A;  4NDB A;  2ZRT A;  4JQ0 D;  3BOW B;  2F33 A;  4INW A;  4MZK A;  2R2I A;  4MZJ A;  1OSA A;  3VRO A;  1QXP A;  3BFB A;  3RLZ A;  5I2L A;  3FWC A;  3HCM A;  3VRP A;  3D10 A;  1OE9 B;  3QRX A;  1NCY A;  2JPO A;  1S5G Y;  2EGD A;  1XFV O;  5G08 A;  4M2Q A;  1GQM A;  3BUM B;  3F45 A;  3TZ1 A;  2MLF C;  3MSE B;  1DQE A;  3WNX B;  1PRW A;  2O5G A;  3DVE A;  1QIV A;  3D76 A;  2CNP A;  3WXA A;  1QJT A;  2KFH A;  2WCJ A;  2LLT A;  2P6B B;  1CLM A;  1ORG A;  3NSI A;  1UHJ A;  2KGR A;  4P5O E;  3WHU B;  2FJU B;  4CFQ A;  5HLV A;  1K95 A;  1DVI A;  1QLK A;  1K9P A;  1VRK A;  1KQV A;  4UPG A;  1SPY A;  1XK4 A;  1XYD A;  4MRY A;  4CPV A;  3L4A A;  5AAN A;  2CBL A;  4N5X A;  4YGB B;  2AMI A;  4USL A;  1JF2 A;  1NPQ A;  3IF7 A;  1UUR A;  2Y4Q A;  1JSA A;  4WQ2 A;  1YX8 A;  4BY4 A;  5HL1 A;  4GFT A;  2JNF A;  4GGF A;  2HET A;  2LVJ A;  1K2H A;  1ZFS A;  2F8P A;  1CTR A;  2LUC A;  5AEQ A;  2KFF A;  1S6I A;  2H61 A;  3NSK A;  5F6T A;  1MXL C;  3S0G A;  4CFR A;  2CTN A;  4PE7 A;  1RTP 1;  4FTG A;  4XYN A;  1C3Y A;  1ODB A;  1RWY A;  3QME A;  3TDI A;  1GJY A;  1K9U A;  3DYE A;  1IGV A;  4F7F A;  2KSP A;  1F55 A;  3K1E A;  1EG3 A;  1TNX A;  2G2B A;  3M0W A;  3NHT A;  1C07 A;  4AQJ A;  1B8C A;  4U8D A;  3SG7 A;  4E68 A;  2LMT A;  4FQO A;  4JPZ B;  1SL7 A;  1TNP A;  2JOJ A;  2KLD A;  2KPH A;  4TNC A;  4WQ3 A;  3UNW A;  1QLS A;  4PE4 A;  4IL1 A;  2JT0 A;  3VB1 A;  2Y1M A;  3S0F A;  1NWD A;  3A8R A;  4YI9 A;  2VRG A;  1G33 A;  3DVK A;  2M7L A;  4OVN F;  3B6X A;  3VRN A;  2M0R A;  3SIA A;  3SG4 A;  3OBV A;  2PYQ A;  4DRW A;  1J55 A;  1PSB A;  1ZAC A;  3BXK A;  2L2C A;  1XFY O;  4C0K A;  3H4S E;  2KQY A;  1FBV A;  2JQ6 A;  1SRA A;  1MUX A;  1Y0V H;  2BCA A;  4HSZ A;  1QV0 A;  1KCY A;  3E3R A;  4YGA A;  2ZND A;  1RK9 A;  2LAN A;  1A2X A;  4XJK A;  3O4X A;  3R1P A;  5ER4 X;  4PAL A;  2WC8 A;  1JC2 A;  1QV1 A;  1JFK A;  3I5H C;  3I5H B;  1NX1 A;  3DD4 A;  1JFJ A;  2BNX A;  2M97 A;  3CR2 A;  1DJH A;  2WCM A;  5HKZ A;  2RGI A;  1SW8 A;  3HX4 A;  1WRK A;  4ICB A;  2V53 A;  1SCV A;  4GUK A;  4KYN A;  2CT9 A;  4YBH B;  2M8U A;  3NGV A;  4PDZ A;  1DF0 B;  5FI2 A;  1SBJ A;  2M3W A;  4AOM A;  3CZ2 A;  4NDD A;  1B8L A;  4QJ3 B;  1AJ4 A;  2I18 A;  2K7O A;  3I5F C;  2K7B A;  1F8H A;  3I5F B;  5K89 A;  1DGU A;  1DEK A;  1NX0 A;  3KO0 A;  4PHN A;  3SG6 A;  3ZNI A;  3PM8 A;  1LVC D;  1CDM A;  1YTZ C;  2BEC A;  3PAL A;  1CFD A;  1J7Q A;  2LC5 A;  1IKU A;  1BG1 A;  4PCW A;  2MHH A;  1UP5 A;  1SKT A;  3NSO A;  1AHR A;  3LCP C;  2P71 A;  1OOG A;  3BQ3 A;  3O4Y A;  4OCI A;  5PAL A;  3CZT X;  1WRZ A;  2DOQ A;  4MBE A;  4ORC B;  2KDH A;  1YUR A;  5FYX A;  4CID A;  1GGW A;  3OB1 B;  1ALV A;  5KU1 A;  2BL0 C;  2KAY A;  2JT8 A;  1OW4 A;  2BL0 B;  3OX6 A;  2JNX A;  2WCF A;  2FCE A;  1MXE A;  1L2O C;  4I5K A;  4MRX A;  1L2O B;  1YRT B;  3EK8 A;  1T14 A;  2I2R E;  2I94 A;  3JTD C;  3PM2 A;  3JVT C;  3JTD B;  1M46 A;  1S5G Z;  5CSI A;  3JVT B;  1LIN A;  1IRJ A;  1S3P A;  2L4H A;  3BOW A;  1OZO A;  4MLW A;  1CMF A;  1G8I A;  2E30 A;  1KSO A;  2SAS A;  5I94 A;  3EVR A;  1MHO A;  2QEO A;  1FI6 A;  2PRU A;  5CSJ A;  2PVB A;  2QEV A;  1XFR A;  2LE9 B;  1N65 A;  2ZN8 A;  3PLF B;  4YGD B;  1QAT A;  3B87 A;  1FF1 A;  5JJG A;  2KNE A;  1A03 A;  2K2A A;  1KFU L;  1UHN A;  4CLN A;  3SS5 A;  2KBI A;  1S6C A;  1NP8 A;  2LLU A;  1FPW A;  4JWQ A;  1JWD A;  2FCD A;  1XVJ A;  2KI4 C;  1KWO C;  4GNK B;  1SY9 A;  4PHJ A;  2KI4 B;  1GGZ A;  1KWO B;  1SL8 A;  2L5Y A;  1MQ1 A;  1NSH A;  1JUO A;  1EG4 A;  1XO5 A;  3EKH A;  2NCO A;  1KK7 Y;  1IQ3 A;  2BKH B;  1QTX A;  4YI8 A;  3TDU A;  1YVH A;  3FWB A;  3R1O A;  1KFX S;  3CR5 X;  2KAX A;  4DS7 A;  1XA5 A;  1BR1 B;  2K0J A;  1B7T Y;  3L4L A;  5FI7 A;  1DJZ A;  1Y6W A;  1YUT A;  3PJI A;  4GBA A;  1BLQ A;  1W9Z A;  2K61 A;  3B88 A;  1JBA A;  1V1G A;  1CDP A;  1F4O A;  1SYM A;  5CSF A;  3N7H A;  1CFC A;  3BYA A;  1K96 A;  1H4B A;  1RFJ A;  4MN0 A;  5DKR A;  1OMV A;  4ZCU A;  2QDI A;  1JF0 A;  4C0L A;  5HKY A;  5I2O A;  1AP4 A;  3OP0 A;  2M29 A;  3CGA A;  1SL9 A;  3LK0 A;  2AUC A;  2EC6 C;  2K8M B;  3AAJ A;  1EJ3 A;  2EC6 B;  4YGE B;  1XK4 C;  3GOF A;  4OV2 A;  1CM1 A;  1A75 B;  5KTY A;  3BFA A;  3TUY C;  4OZD A;  2WCK A;  3EG5 B;  4PHK A;  5DKN A;  3TUY B;  4N1F A;  2BE6 A;  3FE9 A;  3I5G C;  2F3Z A;  2HQ8 A;  1KK8 C;  2AAO A;  3I5G B;  3S0A A;  1KK8 B;  3I5I C;  1TNQ A;  1S26 D;  3I5I B;  1YUS A;  1B4C A;  1Z2C B;  2JXC A;  3AAK A;  3B7A A;  5BPJ A;  3CAB A;  1B1G A;  3NXA A;  1RRO A;  2KHN A;  1QIW A;  3C1V A;  2GGM A;  2ISD A;  3CTN A;  2MRD A;  2F2O A;  3O78 A;  2KBM A;  4M2O A;  4DUQ A;  1Q80 A;  4ORB B;  4M2P A;  2LHL A;  2M9G A;  1K8U A;  1KQM C;  1NUB A;  1ZMZ A;  2JWW A;  2QAC A;  3PN7 C;  1KQM B;  1TUZ A;  5IBW A;  1Y1X A;  1WLZ A;  1GM0 A;  3S0B A;  4INX A;  2L50 A;  3A4U B;  3OB2 B;  2MJW B;  4GPL B;  5DIC A;  5B8I B;  1LS8 A;  2LCP A;  2JPT A;  4OKH A;  1J7O A;  1BR4 B;  2K7D A;  3D73 A;  5KSZ A;  4MVF A;  1TCF A;  4QJ5 B;  2MA2 A;  1OOJ A;  1ALW A;  3PAT A;  2KYF A;  4PE1 A;  1J1E A;  1OOF A;  1LXF C;  1BF5 A;  4R1E A;  2KI6 D;  1Y1U A;  3IVT A;  1BJF A;  1CDL A;  1EL4 A;  3FIA A;  2NLN A;  3R1V A;  2TN4 A;  1ZUZ A;  2WC5 A;  2QEH A;  3PSR A;  3S0E A;  1AK8 A;  1C7V A;  4D1E A;  1H8B A;  1OOH A;  1J7P A;  2M1K B;  1E8A A;  3D0Y B;  2K60 A;  5FI6 A;  2WCL A;  4JKT A;  1S1E A;  1DF0 A;  1AVS A;  2WC6 A;  2L2E A;  2L4I A;  3D77 A;  5CPV A;  1D1O A;  1YR5 A;  4DIR A;  3AKB A;  2YGU A;  4HRE E;  2QEB A;  1SNL A;  2LVV A;  3CLN A;  4L9M A;  3SG2 A;  5CSN A;  1WY9 A;  1B47 A;  1PVA A;  1W7J B;  1CDN A;  3BJH A;  2LNK A;  1SK6 D;  5TNC A;  1S6J A;  2NXQ A;  2JRF A;  4Q04 A;  1CFF A;  4MSP A;  4HRG A;  2E6W A;  2BE4 A;  1DC1 A;  1QS7 A;  2BCB A;  2JTZ A;  2ZFD A;  2KLE A;  1IH0 A;  3SG5 A;  1HT9 A;  5JOL A;  1EH2 A;  1TCO B;  1IQ5 A;  1U5I B;  2HQW A;  1RJV A;  5HLO A;  2KGB C;  3EVV A;  2WCE A;  2ERB A;  1SMG A;  2L98 A;  3GK1 A;  1TN4 A;  1YX7 A;  1BT6 A;  2M49 B;  2WCH A;  2CXJ A;  3O2P A;  5AXI A;  2FOT A;  2OTG C;  3OGN A;  1LKJ A;  1LA3 A;  1NX3 A;  2OTG B;  3DF0 B;  1A29 A;  5D7F A;  1WLM A;  3PFV A;  1MF8 B;  3BUO B;  2L51 A;  2PMY A;  3BFH A;  2MLE C;  3O6B A;  1K94 A;  2OS8 C;  4GGN A;  1AUI B;  4C0J A;  1MWN A;  2OS8 B;  3DZT A;  3SJS A;  3VRR A;  3CZ0 A;  1KK7 Z;  1XFZ O;  1YUU A;  4I5L B;  1UHK A;  1CKK A;  1DJX A;  1B8R A;  1X02 A;  2K7C A;  1M45 A;  2LMV A;  2JXL A;  4NQG A;  4ZCV A;  3L47 A;  1CLB A;  1UHI A;  3CR4 X;  1B7T Z;  1R6P A;  2LVK A;  3DVJ A;  1SR6 C;  1UUS A;  1XFU O;  3FE6 A;  3LK1 A;  1L7Z A;  1EXR A;  1SR6 B;  1FI5 A;  1M31 A;  1CB1 A;  4IJ7 A;  1CLL A;  1REC A;  2CCM A;  2GGZ A;  2COL B;  2H8V A;  2KAV A;  5GQQ C;  1UWO A;  2Y5I A;  2LLS A;  3R72 A;  3IQQ A;  1YRU B;  2PAS A;  3SG3 A;  2HF5 A;  3EKJ A;  4NDC A;  2KQ6 A;  1J1D A;  2KYC A;  2LUX A;  2LM5 A;  1DJG A;  2O60 A;  5DKQ A;  2SCP A;  4YGC B;  4AQI A;  2F2P A;  1HQV A;  4ORA B;  1IWQ A;  1Z4H A;  2BKI B;  2M1U A;  1MR8 A;  1F70 A;  1TOP A;  1QX7 A;  2KI6 C;  4A4C A;  1KSM A;  1B9A A;  1WDC C;  5ER5 A;  2ZKM X;  1WDC B;  3VGO A;  2JT3 A;  1A75 A;  3WHT B;  1K9K A;  5AER A;  1CM4 A;  2LMU A;  2MAZ A;  2K2F A;  1ZOT B;  2QPT A;  4GGF C;  3EK7 A;  2A4J A;  1UHH A;  1XFW O;  3IQO A;  3CYZ A;  1KFU S;  3EK4 A;  4HRH A;  1NIW A;  2WOR A;  2ZNE A;  3DY9 A;  1PAL A;  1M63 B;  2H61 C;  3NSL A;  3SIB A;  1SCM C;  5I2Q A;  1SCM B;  1BMO A;  1NYA A;  2G9B A;  2JC2 A;  2Y1N A;  1PSR A;  2NZ0 A;  3PN7 B;  1DEL A;  1OMR A;  2BBN A;  3D74 A;  4JD9 A;  2HPS A;  3SS4 A;  1IIO A;  2KOT A;  2PQL A;  4FQT A;  1G4Y R;  1M39 A;  4I5J A;  3UO9 A;  1C7W A;  1IJ5 A;  4F0Z B;  2H2K A;  2B1U A;  2JU0 A;  2EHB A;  3TDZ A;  1TIZ A;  1TRF A;  3OX5 A;  1WRL A;  2IS9 A;  2JUL A;  1BOC A;  1F71 A;  3OHM B;  3GK2 A;  3K21 A;  4BY5 A;  1TTX A;  1LA0 A;  1QX2 A;  5HYD A;  1BU3 A;  3DVM A;  2LHI A;  2LP2 A;  3V2L A;  3EVU A;  2GV5 A;  2I7A A;  2JZI A;  4OR9 B;  3D78 A;  3D0Y A;  3CDN A;  4P2Y B;  1OMD A;  1V1F A;  2KFG A;  4ETO A;  2F3Y A;  4XJK B;  1N0Y A;  2BCX A;  3NHI A;  1S36 A; 
#chains in the Genus database with same CATH homology
 1DMO A;  1DT7 B;  5J3X A;  1J7R A;  1PVB A;  2WND A;  3KHE A;  3LL8 B;  4I5N B;  1B1G A;  5HKW A;  4MEW A;  1NCX A;  3CS1 A;  2L0P A;  1IG5 A;  1DJI A;  1DTL A;  4PHM A;  3ZWH A;  1CFP A;  1K93 D;  4GAO A;  1PK0 D;  2WOS A;  1AJ5 A;  1QX5 B;  2LV7 A;  1DJW A;  4QJ4 B;  2LAP A;  1QVI Z;  2MBX A;  4MZL A;  1CMG A;  3FS7 A;  1YVL A;  5I8N A;  2Q4U A;  2L5X B;  2PAL A;  1TNW A;  1DJY A;  1IJ6 A;  3KF9 A;  3BUN B;  3LLE A;  1U5I A;  4PE0 A;  1N2D A;  1QAS A;  1DGV A;  2Q91 A;  1Y1A A;  2BBM A;  3VRQ A;  1QVI Y;  2OPO A;  3KEV A;  1R2U A;  1A4P A;  1F4Q A;  3AKA A;  1KFX L;  2ZRS A;  3KPX A;  1NCZ A;  5D69 A;  1CFF A;  2LP3 A;  2M7N A;  3GK4 X;  1BOD A;  5AFP A;  1F54 A;  2D8N A;  3RM1 A;  2JTT A;  1XFX O;  1NX2 A;  3DF0 A;  1W7I B;  4A4B A;  2WCB A;  4YRU A;  3TS5 C;  4WRI A;  3TS5 B;  3CWG A;  1PUL A;  1OQP A;  3BUW B;  3ICB A;  1FW4 A;  1CNP A;  3BUX B;  4N1G A;  4DCK A;  2LVI A;  2PSR A;  2NCP A;  1OZS A;  1K90 D;  2ZN9 A;  4NDB A;  2ZRT A;  4JQ0 D;  3BOW B;  2F33 A;  4MZK A;  2R2I A;  4MZJ A;  1OSA A;  3VRO A;  1QXP A;  3RLZ A;  5I2L A;  3FWC A;  3HCM A;  3VRP A;  3D10 A;  1OE9 B;  3QRX A;  1NCY A;  1S5G Y;  2EGD A;  1XFV O;  5G08 A;  4M2Q A;  1GQM A;  3BUM B;  3F45 A;  3TZ1 A;  2MLF C;  3MSE B;  3WNX B;  1PRW A;  2O5G A;  3DVE A;  1QIV A;  2CNP A;  3WXA A;  1QJT A;  2KFH A;  3NSI A;  2LLT A;  2P6B B;  1CLM A;  1UHJ A;  2KGR A;  4P5O E;  3WHU B;  2FJU B;  4CFQ A;  5HLV A;  1K95 A;  1DVI A;  1QLK A;  1K9P A;  1VRK A;  1KQV A;  4UPG A;  1SPY A;  1XK4 A;  1XYD A;  4MRY A;  4CPV A;  5AAN A;  2CBL A;  4N5X A;  4YGB B;  2AMI A;  4USL A;  1JF2 A;  1NPQ A;  3IF7 A;  1UUR A;  2Y4Q A;  1JSA A;  4WQ2 A;  1YX8 A;  4BY4 A;  4GFT A;  2JNF A;  4GGF A;  2HET A;  2LVJ A;  1K2H A;  1ZFS A;  2F8P A;  1CTR A;  2LUC A;  5AEQ A;  2KFF A;  1S6I A;  2H61 A;  3NSK A;  5F6T A;  1MXL C;  4CFR A;  2CTN A;  4PE7 A;  1RTP 1;  4FTG A;  4XYN A;  1ODB A;  1RWY A;  3TDI A;  1GJY A;  1K9U A;  1IGV A;  2KSP A;  1F55 A;  1EG3 A;  1TNX A;  2G2B A;  3M0W A;  1C07 A;  4AQJ A;  1B8C A;  4U8D A;  3SG7 A;  4E68 A;  2LMT A;  4FQO A;  4JPZ B;  1SL7 A;  1TNP A;  2JOJ A;  4TNC A;  4WQ3 A;  1QLS A;  4PE4 A;  4IL1 A;  2JT0 A;  2Y1M A;  1NWD A;  3A8R A;  4YI9 A;  2VRG A;  1G33 A;  3DVK A;  2M7L A;  4OVN F;  3VRN A;  2M0R A;  3SIA A;  3SG4 A;  4DRW A;  1J55 A;  1PSB A;  1ZAC A;  3BXK A;  1XFY O;  4C0K A;  3H4S E;  2KQY A;  1FBV A;  2JQ6 A;  1SRA A;  1MUX A;  1Y0V H;  2BCA A;  4HSZ A;  1QV0 A;  1KCY A;  3E3R A;  4YGA A;  2ZND A;  1RK9 A;  2LAN A;  1A2X A;  4XJK A;  5ER4 X;  4PAL A;  2WC8 A;  1JC2 A;  1QV1 A;  1JFK A;  3I5H C;  3I5H B;  1NX1 A;  3DD4 A;  2M97 A;  3CR2 A;  1DJH A;  5HKZ A;  2RGI A;  1SW8 A;  3HX4 A;  1WRK A;  4ICB A;  2V53 A;  1SCV A;  4GUK A;  2CT9 A;  4YBH B;  2M8U A;  4PDZ A;  1DF0 B;  1SBJ A;  2M3W A;  4AOM A;  4NDD A;  1B8L A;  4QJ3 B;  1AJ4 A;  2I18 A;  2K7O A;  3I5F C;  2K7B A;  1F8H A;  3I5F B;  5K89 A;  1DGU A;  1NX0 A;  3KO0 A;  4PHN A;  3SG6 A;  3ZNI A;  3PM8 A;  1LVC D;  1CDM A;  1YTZ C;  2BEC A;  3PAL A;  1CFD A;  1J7Q A;  2LC5 A;  1IKU A;  1BG1 A;  4PCW A;  2MHH A;  1UP5 A;  1SKT A;  3NSO A;  1AHR A;  3LCP C;  4OCI A;  3BQ3 A;  3O4Y A;  5PAL A;  3CZT X;  1WRZ A;  2DOQ A;  4MBE A;  4ORC B;  2KDH A;  1YUR A;  5FYX A;  4CID A;  1GGW A;  3OB1 B;  1ALV A;  5KU1 A;  2BL0 C;  2KAY A;  2JT8 A;  3OX6 A;  2BL0 B;  2JNX A;  2WCF A;  2FCE A;  1MXE A;  1L2O C;  4I5K A;  4MRX A;  1L2O B;  1YRT B;  3EK8 A;  2I2R E;  2I94 A;  3JTD C;  3JVT C;  3JTD B;  1M46 A;  1S5G Z;  5CSI A;  3JVT B;  1LIN A;  1IRJ A;  1S3P A;  2L4H A;  3BOW A;  1OZO A;  4MLW A;  1CMF A;  1G8I A;  2E30 A;  1KSO A;  2SAS A;  3EVR A;  1MHO A;  1FI6 A;  2PRU A;  5CSJ A;  2PVB A;  2LE9 B;  1N65 A;  2ZN8 A;  3PLF B;  4YGD B;  1QAT A;  1FF1 A;  5JJG A;  2KNE A;  1A03 A;  2K2A A;  1KFU L;  1UHN A;  4CLN A;  2KBI A;  1S6C A;  1NP8 A;  2LLU A;  1FPW A;  4JWQ A;  1JWD A;  2FCD A;  1XVJ A;  2KI4 C;  1KWO C;  4GNK B;  1SY9 A;  4PHJ A;  2KI4 B;  1GGZ A;  1KWO B;  1SL8 A;  1MQ1 A;  1NSH A;  1JUO A;  1EG4 A;  1XO5 A;  3EKH A;  2NCO A;  1KK7 Y;  1IQ3 A;  2BKH B;  1QTX A;  4YI8 A;  3TDU A;  1YVH A;  3FWB A;  1KFX S;  3CR5 X;  2KAX A;  4DS7 A;  1XA5 A;  1BR1 B;  2K0J A;  1B7T Y;  1DJZ A;  1Y6W A;  1YUT A;  4GBA A;  1BLQ A;  2K61 A;  1JBA A;  1V1G A;  1CDP A;  1F4O A;  1SYM A;  5CSF A;  1CFC A;  3BYA A;  1K96 A;  1H4B A;  1RFJ A;  4MN0 A;  5DKR A;  1OMV A;  4ZCU A;  4C0L A;  1JF0 A;  5HKY A;  5I2O A;  1AP4 A;  3OP0 A;  2M29 A;  3CGA A;  1SL9 A;  3LK0 A;  2AUC A;  2EC6 C;  2K8M B;  3AAJ A;  1EJ3 A;  2EC6 B;  4YGE B;  1XK4 C;  3GOF A;  4OV2 A;  1CM1 A;  1A75 B;  5KTY A;  3TUY C;  1JFJ A;  4PHK A;  5DKN A;  3TUY B;  4N1F A;  2BE6 A;  3I5G C;  2F3Z A;  2HQ8 A;  1KK8 C;  2AAO A;  3I5G B;  1KK8 B;  3I5I C;  1TNQ A;  1S26 D;  3I5I B;  1YUS A;  1B4C A;  2JXC A;  3AAK A;  5BPJ A;  3NXA A;  1RRO A;  2KHN A;  1QIW A;  3C1V A;  2GGM A;  2ISD A;  3CTN A;  2MRD A;  2F2O A;  3O78 A;  2KBM A;  4M2O A;  4DUQ A;  1Q80 A;  4ORB B;  4M2P A;  2LHL A;  2M9G A;  1K8U A;  1KQM C;  1NUB A;  1ZMZ A;  2JWW A;  2QAC A;  3PN7 C;  1KQM B;  5IBW A;  1Y1X A;  1WLZ A;  5B8I B;  2L50 A;  3A4U B;  3OB2 B;  2MJW B;  4GPL B;  1J7O A;  2LCP A;  2JPT A;  4OKH A;  1BR4 B;  2K7D A;  5KSZ A;  4MVF A;  1TCF A;  4QJ5 B;  2MA2 A;  1OOJ A;  1ALW A;  3PAT A;  2KYF A;  4PE1 A;  1J1E A;  1LXF C;  1BF5 A;  4R1E A;  2KI6 D;  1Y1U A;  1BJF A;  1CDL A;  1EL4 A;  3FIA A;  2NLN A;  2TN4 A;  1ZUZ A;  3PSR A;  1H8B A;  1AK8 A;  1C7V A;  4D1E A;  1J7P A;  2M1K B;  1E8A A;  3D0Y B;  1S1E A;  1DF0 A;  1AVS A;  2L2E A;  2L4I A;  5CPV A;  1D1O A;  1YR5 A;  4DIR A;  3AKB A;  4HRE E;  1SNL A;  2LVV A;  3CLN A;  4L9M A;  3SG2 A;  5CSN A;  1WY9 A;  1B47 A;  1PVA A;  1W7J B;  1CDN A;  2LNK A;  1SK6 D;  5TNC A;  1S6J A;  2NXQ A;  2JRF A;  4Q04 A;  4MSP A;  4HRG A;  2E6W A;  2BE4 A;  1IH0 A;  1QS7 A;  2BCB A;  2JTZ A;  2ZFD A;  3SG5 A;  1HT9 A;  5JOL A;  1EH2 A;  1TCO B;  1IQ5 A;  1U5I B;  2HQW A;  1RJV A;  5HLO A;  2KGB C;  3EVV A;  2WCE A;  1SMG A;  2L98 A;  3GK1 A;  1TN4 A;  1YX7 A;  1BT6 A;  2M49 B;  2CXJ A;  3O2P A;  5AXI A;  2FOT A;  2OTG C;  1LKJ A;  1LA3 A;  1NX3 A;  2OTG B;  3DF0 B;  1A29 A;  5D7F A;  1WLM A;  3PFV A;  1MF8 B;  3BUO B;  2L51 A;  2PMY A;  2MLE C;  3O6B A;  1K94 A;  2OS8 C;  4GGN A;  1AUI B;  4C0J A;  1MWN A;  2OS8 B;  3SJS A;  3VRR A;  1KK7 Z;  1XFZ O;  1YUU A;  4I5L B;  1UHK A;  1CKK A;  1DJX A;  1B8R A;  1X02 A;  2K7C A;  1M45 A;  2LMV A;  2JXL A;  4NQG A;  4ZCV A;  1CLB A;  1UHI A;  3CR4 X;  1B7T Z;  1R6P A;  2LVK A;  3DVJ A;  1SR6 C;  1UUS A;  1XFU O;  3LK1 A;  1L7Z A;  1EXR A;  1SR6 B;  1FI5 A;  1M31 A;  1CB1 A;  1CLL A;  1REC A;  2CCM A;  2GGZ A;  2COL B;  2KAV A;  5GQQ C;  1UWO A;  2Y5I A;  2LLS A;  3IQQ A;  1YRU B;  2PAS A;  3SG3 A;  2HF5 A;  3EKJ A;  4NDC A;  2KQ6 A;  1J1D A;  2KYC A;  2LUX A;  2LM5 A;  1DJG A;  2O60 A;  5DKQ A;  2SCP A;  4YGC B;  4AQI A;  2F2P A;  1HQV A;  4ORA B;  1IWQ A;  2BKI B;  1F70 A;  2M1U A;  1MR8 A;  1TOP A;  1QX7 A;  2KI6 C;  4A4C A;  1KSM A;  1B9A A;  1WDC C;  5ER5 A;  2ZKM X;  1WDC B;  3VGO A;  2JT3 A;  1A75 A;  3WHT B;  1K9K A;  5AER A;  1CM4 A;  2LMU A;  2MAZ A;  2K2F A;  1ZOT B;  2QPT A;  4GGF C;  3EK7 A;  2A4J A;  1UHH A;  1XFW O;  3IQO A;  1KFU S;  3EK4 A;  4HRH A;  1NIW A;  2WOR A;  2ZNE A;  1PAL A;  1M63 B;  2H61 C;  3NSL A;  3SIB A;  1SCM C;  5I2Q A;  1SCM B;  1BMO A;  1NYA A;  2G9B A;  2JC2 A;  2Y1N A;  1PSR A;  2NZ0 A;  3PN7 B;  1OMR A;  2BBN A;  2HPS A;  2KOT A;  1G4Y R;  1M39 A;  4I5J A;  1C7W A;  1IJ5 A;  4F0Z B;  2H2K A;  2B1U A;  2JU0 A;  2EHB A;  3TDZ A;  1TIZ A;  1TRF A;  3OX5 A;  1WRL A;  2IS9 A;  2JUL A;  1BOC A;  1F71 A;  3OHM B;  3GK2 A;  3K21 A;  4BY5 A;  1TTX A;  1LA0 A;  1QX2 A;  5HYD A;  1BU3 A;  3DVM A;  2LHI A;  2LP2 A;  3EVU A;  2GV5 A;  2I7A A;  2JZI A;  4OR9 B;  3D0Y A;  4P2Y B;  1OMD A;  1V1F A;  2KFG A;  4ETO A;  2F3Y A;  4XJK B;  1N0Y A;  2BCX A;  1S36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...