1XFYO

Crystal structure of anthrax edema factor (ef) in complex with calmodulin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
146
structure length
146
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDQMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin-sensitive adenylate cyclase
publication title Calcium-independent calmodulin binding and two-metal-ion catalytic mechanism of anthrax edema factor.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Lyase/metal binding protein
total genus 34
structure length 146
sequence length 146
chains with identical sequence P, Q, R, S, T
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfyO02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfyO01
3SIAA 4GBAA 2VRGA 1YRTB 1JF2A 4MVFA 1S6IA 2MRDA 3SG2A 1KFUS 1SL9A 1RWYA 4GPLB 3TZ1A 4YGCB 2L4HA 1NCYA 3O2PA 5D7FA 1B8RA 2IS9A 1OSAA 3KEVA 2KFGA 4GUKA 3BUWB 2F3YA 3IF7A 2K8MB 3TS5C 1IJ5A 2KI4C 3F45A 1OMVA 2M0RA 1QASA 4HSZA 1S5GZ 4U8DA 1Y1AA 2F33A 3I5IC 1IGVA 1KK7Y 2MLFC 2LUCA 4F0ZB 1J7PA 3LK1A 1CDNA 1JWDA 3HCMA 2HF5A 3LL8B 1WY9A 3AKAA 1A03A 4MZKA 3KO0A 1XFZO 1ZUZA 1S26D 4CIDA 1QVIY 4ZCUA 1CFDA 4I5NB 1DF0A 3AAJA 1H8BA 2M1UA 3DVEA 2BBNA 5DKNA 4A4CA 3I5HC 2NLNA 4PALA 1AUIB 3SG3A 1LVCD 2HQWA 1LKJA 1NX0A 5CSNA 4AQJA 3NSOA 5K89A 3LLEA 1EH2A 1ODBA 2I7AA 1UP5A 2BCXA 1KWOB 1WLMA 5HKYA 3ICBA 3TDUA 1PSRA 2CCMA 1BOCA 2KBMA 2KYFA 5HLOA 1CDPA 2H61A 1SL8A 1OMRA 1MF8B 3EKJA 1V1FA 3O4YA 1BF5A 2AAOA 2K7BA 2CTNA 1JUOA 5IBWA 1K2HA 4I5LB 1FBVA 1AHRA 2BCBA 3FIAA 4JQ0D 2K0JA 1KQMC 1LA3A 3EK4A 5BPJA 2PALA 2JXLA 4XYNA 1OZSA 2DOQA 1SR6B 2L4IA 3SG4A 3TUYB 1RJVA 2K7DA 2KBIA 1A75A 2P6BB 3OP0A 4R1EA 1Y1XA 5AXIA 2M7NA 1BG1A 1SMGA 1ZFSA 1KK8B 2ZKMX 2Y1NA 5HYDA 5PALA 2LE9B 5AFPA 1F55A 2KFFA 4QJ3B 1UHIA 2F2PA 2M3WA 3BUXB 1MXLC 1B7TY 1ZMZA 3BOWA 1UURA 2LMVA 1YRUB 3I5FB 4DUQA 5I2OA 4PE1A 2JTZA 1JSAA 1XFYO 1BJFA 2L2EA 1QV1A 2LANA 1JC2A 2KOTA 1IQ5A 1G4YR 4I5JA 1DGVA 3BYAA 1NX3A 2EC6C 2LVIA 3FWBA 3WHUB 2WNDA 1YUSA 3KPXA 5AEQA 1B4CA 4MSPA 5I2LA 1J7OA 2GGMA 3EKHA 4AOMA 5AERA 3GK4X 5D69A 1AP4A 1NCXA 2E30A 2LLSA 4WQ2A 4HRHA 1W7IB 3D0YA 4AQIA 1DTLA 1CKKA 1DJYA 1RFJA 1YUUA 1K8UA 1QLKA 2BL0B 1LA0A 1TCFA 4L9MA 4JWQA 3BUMB 1DVIA 4IL1A 1DF0B 2TN4A 4MEWA 1PVBA 4PE0A 5JJGA 1J7QA 2E6WA 4PHKA 3SG6A 4CLNA 1XYDA 3CS1A 4HRGA 2JXCA 4OCIA 2L5XB 2JOJA 3HX4A 4YGEB 1XO5A 3A4UB 4N1FA 1TNWA 2KYCA 3I5GB 4Q04A 2PRUA 2QPTA 4ORCB 3K21A 1SW8A 4MRXA 3CTNA 1EL4A 1KK7Z 3CLNA 3DF0A 1LXFC 4CFRA 4DCKA 1YVHA 1K9PA 4C0JA 2K2FA 3VGOA 5HLVA 5J3XA 1IH0A 2LMTA 1KFXS 1QVIZ 2NZ0A 1ALWA 2KAYA 1CFFA 3VRRA 3EVUA 1L2OC 3RM1A 3DVJA 1A75B 1UHKA 4YI8A 4C0LA 1BT6A 2GV5A 3BQ3A 3DVKA 3MSEB 2LM5A 2PSRA 1D1OA 1J55A 1ZACA 4ORAB 1EG4A 4GGFC 1DT7B 5CSIA 2JT3A 1G33A 4N1GA 3VROA 5FYXA 3SG7A 2H2KA 4D1EA 1S1EA 2JNXA 1XA5A 1EG3A 2L50A 1HQVA 3BOWB 2KDHA 2OPOA 3CR5X 1MHOA 2LLTA 4I5KA 1H4BA 2EGDA 4N5XA 1A29A 2LC5A 2O60A 1G8IA 3TDZA 2JU0A 1OE9B 1B9AA 1S6JA 4XJKA 1KSOA 3PFVA 4NDBA 2AUCA 1XVJA 4FQOA 4WRIA 4MZLA 3TDIA 1IKUA 2OS8B 1WDCB 4NDCA 1FI5A 3D0YB 3GOFA 1SYMA 1DJHA 1QX5B 1FPWA 2BE4A 2FCDA 4MN0A 4UPGA 2RGIA 4CFQA 1PK0D 2CT9A 4MBEA 3EVVA 2KI6D 1BU3A 1Y1UA 4DRWA 1UHJA 1YX7A 1RECA 1A4PA 1HT9A 1TIZA 2F8PA 1EXRA 1B7TZ 2K7OA 4M2QA 2MHHA 2M29A 1IG5A 1XK4C 2V53A 2WORA 3AAKA 3DD4A 4YGBB 1ZOTB 1WRLA 2LUXA 1B47A 3OB2B 5G08A 3BXKA 1BLQA 1U5IA 5CSJA 3EK7A 1X02A 2JNFA 3JTDB 1QATA 2Q4UA 3WNXB 1S5GY 2MAZA 1KWOC 2LVJA 3PLFB 2WCEA 1K94A 1F8HA 1DGUA 2Y4QA 4JPZB 1OMDA 2BBMA 2KHNA 2NCPA 2LMUA 3LCPC 4PDZA 3DF0B 4P5OE 1L7ZA 1DJZA 1KFXL 4GGFA 1QIWA 2HQ8A 1F4OA 1NX2A 1MR8A 1CMFA 1AVSA 2LP2A 2MLEC 1JBAA 2ZNDA 3WHTB 2JULA 1YURA 3TUYC 4NDDA 5DKQA 1XFWO 1N65A 3PALA 1NPQA 4NQGA 3CZTX 1KK8C 1NYAA 2KI6C 2LCPA 1F70A 1FI6A 3BUOB 4BY4A 1PVAA 1C7WA 1PULA 3PSRA 2KFHA 2MBXA 4ICBA 2F3ZA 4HREE 2D8NA 1JF0A 2EHBA 1SL7A 3BUNB 1F54A 1YUTA 3AKBA 3I5FC 5I8NA 2COLB 2HPSA 3PN7B 3CR2A 1TNPA 1IQ3A 4GGNA 2K61A 1B8LA 3WXAA 4XJKB 3PATA 1CFCA 5AANA 1NIWA 2WC8A 1S36A 1WLZA 1TRFA 1MXEA 1CLLA 2JT8A 2LP3A 5CSFA 4ETOA 1XK4A 2ZFDA 1MQ1A 2PVBA 3SIBA 2KQ6A 1OZOA 3LK0A 1UHNA 1F71A 4BY5A 1PRWA 3QRXA 4ZCVA 1AJ5A 1NP8A 1DJIA 2BL0C 3O6BA 1M63B 1TNXA 1XFUO 1UHHA 4OR9B 4OVNF 4TNCA 2KAXA 2OTGB 1CFPA 2FOTA 1M31A 1V1GA 2MJWB 3VRQA 2Y1MA 1OOJA 1FW4A 1MWNA 1U5IB 2BECA 2O5GA 3JVTC 3FS7A 5JOLA 3A8RA 1J1DA 3M0WA 1SBJA 2ISDA 2L0PA 1SCVA 1A2XA 3EK8A 5ER5A 3H4SE 3I5GC 2LLUA 1SK6D 4YI9A 4PHNA 1CLBA 2ZRTA 1CTRA 1TTXA 2G9BA 2LV7A 2CXJA 3TS5B 2KI4B 2JC2A 2KGBC 4PE4A 1SCMC 3I5IB 1CLMA 3PM8A 2LVVA 2KGRA 2M49B 5KU1A 1QX2A 1YVLA 4PHMA 1QIVA 1M46A 1K95A 2GGZA 4GNKB 2M8UA 1AJ4A 1NWDA 1MUXA 3NSLA 2SASA 4YBHB 4OV2A 1QJTA 3IQOA 3CWGA 1XFVO 5ER4X 1CMGA 1YX8A 5F6TA 1BR4B 1W7JB 4DS7A 1QXPA 1NUBA 1YTZC 3I5HB 3SG5A 1Y6WA 1B8CA 1KQVA 1CM4A 4GFTA 4USLA 1SRAA 5KTYA 4QJ5B 1RTP1 2KSPA 3RLZA 1QV0A 2M97A 1Y0VH 3E3RA 2JPTA 1QS7A 2WCBA 2ZN9A 1GQMA 2CBLA 4M2OA 4MRYA 3OHMB 1IWQA 2I94A 4MLWA 4YGDB 3C1VA 1CNPA 5DKRA 1LINA 2FJUB 2OS8C 1WDCC 4MZJA 1KQMB 1WRZA 1C07A 1DJXA 2I18A 5HKWA 2MA2A 3OX6A 1GJYA 3IQQA 1AK8A 2BKHB 4GAOA 1GGWA 1VRKA 4E68A 1JFJA 4DIRA 1BR1B 2JWWA 2A4JA 1TN4A 2SCPA 3DVMA 1RROA 2PASA 4FTGA 1K96A 2K7CA 1SPYA 2LVKA 1FF1A 2I2RE 1PALA 3ZNIA 4WQ3A 3GK2A 1M39A 1UUSA 1SY9A 3JTDC 1K90D 2JZIA 1SKTA 1SR6C 1NX1A 1R6PA 2FCEA 1S3PA 1QLSA 1IRJA 1M45A 1DMOA 2EC6B 2G2BA 2AMIA 2NCOA 1J1EA 3VRNA 1C7VA 1CM1A 2PMYA 2JT0A 1KCYA 1R2UA 2NXQA 1Q80A 4YGAA 3NSKA 1KFUL 1OQPA 3FWCA 3GK1A 2M1KB 5CPVA 5TNCA 2ZN8A 3ZWHA 2B1UA 1DJWA 2Y5IA 4ORBB 4M2PA 3CGAA 1K9UA 1CDMA 4QJ4B 1EJ3A 4A4BA 1CB1A 3KF9A 2HETA 1GGZA 2K2AA 1S6CA 2M7LA 1F4QA 1YR5A 2CNPA 4CPVA 2WCFA 2BCAA 4C0KA 1BMOA 1WRKA 1B1GA 2JRFA 3OB1B 3D10A 2KNEA 5HKZA 2Q91A 3OX5A 1TCOB 2KQYA 1SNLA 1TNQA 3PN7C 1NSHA 4PCWA 3O78A 3SJSA 2LNKA 4PHJA 1BODA 1KSMA 1NCZA 2M9GA 1QTXA 2L98A 1JFKA 1N2DA 4YRUA 1K93D 2QACA 2JTTA 3KHEA 1DJGA 1ALVA 1J7RA 2BE6A 2LAPA 3NSIA 3CR4X 3JVTB 2LHLA 4P2YB 1CDLA 1L2OB 2ZNEA 1RK9A 1PSBA 2H61C 5B8IB 1IJ6A 1E8AA 5KSZA 2WOSA 3EVRA 1N0YA 4PE7A 4OKHA 2JQ6A 1UWOA 1K9KA 5I2QA 3VRPA 2OTGC 1TOPA 2KAVA 1QX7A 2BKIB 5GQQC 2L51A 3NXAA 1SCMB 2ZRSA 2R2IA 2F2OA 2LHIA 1XFXO
chains in the Genus database with same CATH superfamily
3SIAA 4GBAA 2VRGA 3BFBA 1YRTB 1JF2A 4MVFA 1S6IA 2MRDA 3SG2A 1KFUS 1OOHA 1SL9A 1RWYA 4GPLB 3TZ1A 4YGCB 2L4HA 1NCYA 3O2PA 5D7FA 1B8RA 2IS9A 1OSAA 3KEVA 2KFGA 4GUKA 3BUWB 2F3YA 1OOGA 3IF7A 2K8MB 3TS5C 1IJ5A 2KI4C 3F45A 1OMVA 2M0RA 1QASA 3DY9A 4HSZA 1S5GZ 4U8DA 1Y1AA 2F33A 3I5IC 1IGVA 1KK7Y 2MLFC 2LUCA 4F0ZB 1J7PA 3LK1A 1CDNA 1JWDA 3HCMA 2HF5A 3LL8B 1WY9A 3AKAA 1A03A 4MZKA 3KO0A 1XFZO 1ZUZA 3OGNA 1S26D 4CIDA 3BFAA 1QVIY 4ZCUA 1CFDA 4I5NB 1DF0A 3AAJA 1H8BA 2M1UA 3DVEA 2BBNA 4OZDA 5DKNA 4A4CA 3I5HC 2NLNA 2JPOA 4PALA 1AUIB 3SG3A 1LVCD 2HQWA 1LKJA 1NX0A 5CSNA 3S0GA 3NSOA 4AQJA 5K89A 1TWOA 3LLEA 1EH2A 1ODBA 2I7AA 1UP5A 3DZTA 2BCXA 1KWOB 1WLMA 1TUJA 3ICBA 3TDUA 5HKYA 1PSRA 2CCMA 1BOCA 2KBMA 2KYFA 2WCMA 3N7HA 4INWA 5HLOA 1CDPA 2H61A 1OOIX 1SL8A 3DYEA 1OMRA 1MF8B 3EKJA 1V1FA 3O4YA 1BF5A 2AAOA 2K7BA 2CTNA 1JUOA 5IBWA 1K2HA 4I5LB 1FBVA 1AHRA 2BCBA 3FIAA 1GM0A 4JQ0D 2K0JA 1KQMC 2P70A 1W9ZA 1LA3A 3EK4A 5BPJA 2PALA 2JXLA 4XYNA 4F7FA 2QEOA 1OZSA 2DOQA 1SR6B 3OBVA 3CDNA 2L4IA 3SG4A 3TUYB 1RJVA 2K7DA 2KBIA 1A75A 2P6BB 3OP0A 4R1EA 1Y1XA 5AXIA 2M7NA 1BG1A 1SMGA 1ZFSA 1KK8B 2ZKMX 3VB1A 2Y1NA 3CZ1A 5PALA 5HYDA 3DXLA 2LE9B 5AFPA 1F55A 2KFFA 4QJ3B 1UHIA 2F2PA 2M3WA 3BUXB 1MXLC 1B7TY 1ZMZA 3SS5A 3BJHA 3BOWA 1UURA 2LMVA 1YRUB 3I5FB 4DUQA 5I2OA 4PE1A 2FJYA 2JTZA 1JSAA 1XFYO 1BJFA 2L2EA 1QV1A 2LANA 1JC2A 2KOTA 1IQ5A 1G4YR 4I5JA 1DGVA 1TUZA 3BYAA 1NX3A 2EC6C 2LVIA 3FWBA 3WHUB 2WNDA 1YUSA 3KPXA 5AEQA 1B4CA 4MSPA 5I2LA 1J7OA 2GGMA 3EKHA 4AOMA 5AERA 3GK4X 3D74A 5D69A 1AP4A 1NCXA 2E30A 2LLSA 4WQ2A 4HRHA 1W7IB 3D0YA 4AQIA 1DTLA 1CKKA 1DJYA 1RFJA 1YUUA 1K8UA 1QLKA 2BL0B 1LA0A 1TCFA 2WCLA 4L9MA 4JWQA 1C3ZA 1C3YA 3BUMB 1DVIA 4IL1A 1DF0B 2TN4A 2WCJA 4MEWA 3D75A 1DC1A 1PVBA 4PE0A 5JJGA 1J7QA 2E6WA 4PHKA 3SG6A 4CLNA 3CYZA 1XYDA 3CS1A 4HRGA 2JXCA 4OCIA 2L5XB 2JOJA 3HX4A 4YGEB 1XO5A 3A4UB 4N1FA 1TNWA 2KYCA 3I5GB 4Q04A 2PRUA 2QPTA 4ORCB 3K21A 1SW8A 4MRXA 4JD9A 3CTNA 1EL4A 3SS4A 3V2LA 1KK7Z 3CLNA 3FE9A 3DF0A 1LXFC 3CABA 4CFRA 4DCKA 1YVHA 2ERBA 1K9PA 4C0JA 2K2FA 3VGOA 5HLVA 5J3XA 5D3OA 3L4AA 1IH0A 2LMTA 1KFXS 1QVIZ 2NZ0A 1ALWA 3CZ0A 2KAYA 3R72A 3VRRA 3EVUA 1CFFA 1L2OC 3RM1A 3DVJA 1A75B 1UHKA 4YI8A 4C0LA 1BT6A 2GV5A 3BQ3A 3DVKA 3MSEB 2LM5A 2PSRA 1D1OA 1J55A 1ZACA 4ORAB 1EG4A 4GGFC 1DT7B 5CSIA 2JT3A 1G33A 4N1GA 3VROA 5FYXA 3SG7A 2H2KA 4D1EA 1S1EA 2JNXA 1XA5A 2KLEA 1EG3A 2L50A 1OOFA 1HQVA 3BOWB 2KDHA 2OPOA 3CR5X 1MHOA 2LLTA 4I5KA 1H4BA 2EGDA 4PT1A 3D77A 4N5XA 1A29A 2L2CA 2LC5A 2O60A 1G8IA 3TDZA 2JU0A 1OE9B 1B9AA 1S6JA 4XJKA 3R1VA 3K1EA 1KSOA 3PFVA 4NDBA 2AUCA 1XVJA 2K60A 4FQOA 4MZLA 4WRIA 3TDIA 2OS8B 1IKUA 1WDCB 4NDCA 1FI5A 3D0YB 3GOFA 1SYMA 1DJHA 1QX5B 1FPWA 2BE4A 2FCDA 4MN0A 4UPGA 2RGIA 4CFQA 1PK0D 2CT9A 4MBEA 1DELA 3B6XA 3EVVA 2KI6D 1BU3A 1Y1UA 4DRWA 1UHJA 1YX7A 1RECA 1A4PA 1HT9A 1TIZA 2F8PA 1EXRA 1B7TZ 2K7OA 2QEHA 4M2QA 2MHHA 2M29A 1IG5A 1XK4C 2V53A 2WORA 3AAKA 3DD4A 4YGBB 1ZOTB 1WRLA 2LUXA 1B47A 3OB2B 5G08A 3BXKA 1BLQA 1U5IA 5CSJA 3D76A 3EK7A 1X02A 2JNFA 3JTDB 1QATA 2Q4UA 3B86A 3WNXB 1S5GY 2MAZA 1KWOC 2LVJA 3PLFB 2WCEA 2P71A 1K94A 1ORGA 1F8HA 1DGUA 2Y4QA 4JPZB 1OMDA 2BBMA 2KHNA 2NCPA 2LMUA 3LCPC 4PDZA 3DF0B 4P5OE 1L7ZA 1DJZA 1KFXL 4GGFA 3R1PA 1QIWA 2HQ8A 2WC5A 1F4OA 1NX2A 1MR8A 1CMFA 1AVSA 2LP2A 2MLEC 1JBAA 2ZNDA 5HL1A 3WHTB 3L4LA 3S0FA 2JULA 1YURA 3TUYC 4NDDA 5DKQA 1XFWO 1N65A 3PALA 1NPQA 4NQGA 3CZTX 1KK8C 1NYAA 2KI6C 2LCPA 1F70A 1FI6A 3BUOB 4BY4A 1PVAA 1C7WA 1PULA 3PSRA 2KFHA 2MBXA 4ICBA 2F3ZA 4HREE 4JKTA 2D8NA 1JF0A 2EHBA 1SL7A 3BUNB 1F54A 3UO9A 1YUTA 3AKBA 3I5FC 5I8NA 2COLB 3S0BA 2HPSA 3B87A 3PN7B 3CR2A 1TNPA 1IQ3A 4GGNA 2K61A 1B8LA 2WCHA 3WXAA 4XJKB 3PATA 1CFCA 5AANA 1NIWA 3FE6A 2YGUA 3SS3A 1SSEB 2WC8A 1S36A 1WLZA 1TRFA 1MXEA 1CLLA 2JT8A 2LP3A 3RZSA 5CSFA 4ETOA 1XK4A 2ZFDA 1MQ1A 2PVBA 3SIBA 2KQ6A 1OZOA 3LK0A 1UHNA 1F71A 1LS8A 4BY5A 1PRWA 3QRXA 4ZCVA 1AJ5A 1NP8A 1DJIA 2BL0C 3O6BA 1M63B 1TNXA 1XFUO 1Z2CB 1UHHA 3Q8IA 4OR9B 4OVNF 4TNCA 1XFRA 2KAXA 3QMEA 3D73A 2OTGB 1CFPA 2QEVA 3UNWA 2FOTA 1M31A 1V1GA 2MJWB 3VRQA 2Y1MA 1OOJA 1FW4A 1MWNA 1U5IB 2BECA 2O5GA 2WCKA 3JVTC 3FS7A 4INXA 3A8RA 1J1DA 3M0WA 1SBJA 5JOLA 2ISDA 2L0PA 1SCVA 1A2XA 3EK8A 5ER5A 3H4SE 3I5GC 5FI6A 2LLUA 1SK6D 2BNXA 4PHNA 4YI9A 1CLBA 2ZRTA 3R1OA 1CTRA 1TTXA 2G9BA 2LV7A 3S0DA 2CXJA 3TS5B 2KI4B 2JC2A 2KGBC 4PE4A 1SCMC 4IJ7A 3I5IB 1CLMA 3D78A 3PM8A 2LVVA 2KGRA 2M49B 5KU1A 1QX2A 1YVLA 4PHMA 1QIVA 1M46A 1K95A 2GGZA 4GNKB 2M8UA 1AJ4A 1NWDA 1MUXA 3NSLA 2SASA 4YBHB 4OV2A 1QJTA 3IQOA 3CWGA 1XFVO 5ER4X 1CMGA 1YX8A 5F6TA 3BFHA 1BR4B 3O4XA 1W7JB 2L5YA 4DS7A 1QXPA 1NUBA 1YTZC 3I5HB 3SG5A 1Y6WA 1B8CA 1KQVA 1CM4A 4GFTA 4USLA 1SRAA 5KTYA 4QJ5B 1RTP1 2WC6A 2KSPA 3RLZA 1QV0A 2M97A 1Y0VH 3E3RA 3CZ2A 2JPTA 3B7AA 1QS7A 2WCBA 3B88A 2ZN9A 1GQMA 2CBLA 4M2OA 4MRYA 3OHMB 5I94A 1IWQA 2I94A 4MLWA 4YGDB 3C1VA 1CNPA 5DKRA 1LINA 2FJUB 3EG5B 5EL2A 2OS8C 2H8VA 1WDCC 4MZJA 1KQMB 1IIOA 1WRZA 1C07A 1DJXA 2I18A 3PM2A 5HKWA 2MA2A 3OX6A 1GJYA 3IQQA 1AK8A 2BKHB 2GTEA 4GAOA 1VRKA 4E68A 1GGWA 1JFJA 4DIRA 1BR1B 2JWWA 3FE8A 5DICA 2A4JA 1TN4A 2SCPA 3DVMA 4FQTA 1RROA 2PASA 4FTGA 1K96A 2K7CA 1SPYA 2LVKA 1FF1A 2I2RE 1PALA 3S0EA 3ZNIA 4WQ3A 3GK2A 1M39A 1UUSA 1OW4A 1SY9A 3JTDC 1K90D 2JZIA 1SKTA 1SR6C 1NX1A 1R6PA 2FCEA 1S3PA 1QLSA 1IRJA 1M45A 1DMOA 2EC6B 2G2BA 2AMIA 2NCOA 1J1EA 3NGVA 3VRNA 1P28A 1C7VA 1CM1A 1Z4HA 2PMYA 2JT0A 1KCYA 1R2UA 2PYQA 2NXQA 1Q80A 4YGAA 3NSKA 3PJIA 1KFUL 1OQPA 3FWCA 3GK1A 2M1KB 3IVTA 5CPVA 5TNCA 4KYNA 2ZN8A 3ZWHA 2B1UA 1DJWA 2Y5IA 4ORBB 4M2PA 2QEBA 3CGAA 1K9UA 1CDMA 4QJ4B 1EJ3A 4A4BA 1CB1A 3KF9A 2HETA 1GGZA 2K2AA 5FI2A 1S6CA 2M7LA 1F4QA 1YR5A 2CNPA 4CPVA 2WCFA 2BCAA 4C0KA 1BMOA 2KPHA 1DEKA 1WRKA 1B1GA 2JRFA 3OB1B 3D10A 2KNEA 3L47A 5HKZA 2Q91A 3OX5A 1TCOB 2KQYA 3S0AA 1SNLA 1TNQA 3PN7C 1NSHA 4PCWA 3O78A 3SJSA 2LNKA 4PHJA 1BODA 2PQLA 1KSMA 1NCZA 2M9GA 1QTXA 2L98A 1JFKA 1N2DA 4YRUA 1K93D 2QACA 2JTTA 3KHEA 1QWVA 1DJGA 1ALVA 1J7RA 2BE6A 2LAPA 3NSIA 3CR4X 3JVTB 2LHLA 4P2YB 2BAPA 1CDLA 1L2OB 2ZNEA 1RK9A 1PSBA 2H61C 2KLDA 1IJ6A 5B8IB 1E8AA 3NHTA 5KSZA 2WOSA 3EVRA 1N0YA 4PE7A 4OKHA 2JQ6A 1UWOA 1K9KA 1T14A 3VRPA 2OTGC 5I2QA 1TOPA 5FI7A 2KAVA 3NHIA 1QX7A 2BKIB 2QDIA 5GQQC 2L51A 3NXAA 1SCMB 2ZRSA 2R2IA 2F2OA 2LHIA 1XFXO 1DQEA
chains in the Genus database with same CATH topology
3SIAA 4GBAA 2VRGA 1YRTB 1JF2A 4MVFA 1S6IA 2MRDA 3SG2A 1KFUS 1SL9A 1RWYA 4GPLB 3TZ1A 4YGCB 2L4HA 1NCYA 3O2PA 5D7FA 1B8RA 2IS9A 1OSAA 3KEVA 2KFGA 4GUKA 3BUWB 2F3YA 3IF7A 2K8MB 3TS5C 1IJ5A 2KI4C 3F45A 1OMVA 2M0RA 1QASA 4HSZA 1S5GZ 4U8DA 1Y1AA 2F33A 3I5IC 1IGVA 1KK7Y 2MLFC 2LUCA 4F0ZB 1J7PA 3LK1A 1CDNA 1JWDA 3HCMA 2HF5A 3LL8B 1WY9A 3AKAA 1A03A 4MZKA 3KO0A 1XFZO 1ZUZA 1S26D 4CIDA 1QVIY 4ZCUA 1CFDA 4I5NB 1DF0A 3AAJA 1H8BA 2M1UA 3DVEA 2BBNA 5DKNA 4A4CA 3I5HC 2NLNA 4PALA 1AUIB 3SG3A 1LVCD 2HQWA 1LKJA 1NX0A 5CSNA 4AQJA 3NSOA 5K89A 3LLEA 1EH2A 1ODBA 2I7AA 1UP5A 2BCXA 1KWOB 1WLMA 5HKYA 3ICBA 3TDUA 1PSRA 2CCMA 1BOCA 2KBMA 2KYFA 5HLOA 1CDPA 2H61A 1SL8A 1OMRA 1MF8B 3EKJA 1V1FA 3O4YA 1BF5A 2AAOA 2K7BA 2CTNA 1JUOA 5IBWA 1K2HA 4I5LB 1FBVA 1AHRA 2BCBA 3FIAA 4JQ0D 2K0JA 1KQMC 1LA3A 3EK4A 5BPJA 2PALA 2JXLA 4XYNA 1OZSA 2DOQA 1SR6B 2L4IA 3SG4A 3TUYB 1RJVA 2K7DA 2KBIA 1A75A 2P6BB 3OP0A 4R1EA 1Y1XA 5AXIA 2M7NA 1BG1A 1SMGA 1ZFSA 1KK8B 2ZKMX 2Y1NA 5HYDA 5PALA 2LE9B 5AFPA 1F55A 2KFFA 4QJ3B 1UHIA 2F2PA 2M3WA 3BUXB 1MXLC 1B7TY 1ZMZA 3BOWA 1UURA 2LMVA 1YRUB 3I5FB 4DUQA 5I2OA 4PE1A 2JTZA 1JSAA 1XFYO 1BJFA 2L2EA 1QV1A 2LANA 1JC2A 2KOTA 1IQ5A 1G4YR 4I5JA 1DGVA 3BYAA 1NX3A 2EC6C 2LVIA 3FWBA 3WHUB 2WNDA 1YUSA 3KPXA 5AEQA 1B4CA 4MSPA 5I2LA 1J7OA 2GGMA 3EKHA 4AOMA 5AERA 3GK4X 5D69A 1AP4A 1NCXA 2E30A 2LLSA 4WQ2A 4HRHA 1W7IB 3D0YA 4AQIA 1DTLA 1CKKA 1DJYA 1RFJA 1YUUA 1K8UA 1QLKA 2BL0B 1LA0A 1TCFA 4L9MA 4JWQA 3BUMB 1DVIA 4IL1A 1DF0B 2TN4A 4MEWA 1PVBA 4PE0A 5JJGA 1J7QA 2E6WA 4PHKA 3SG6A 4CLNA 1XYDA 3CS1A 4HRGA 2JXCA 4OCIA 2L5XB 2JOJA 3HX4A 4YGEB 1XO5A 3A4UB 4N1FA 1TNWA 2KYCA 3I5GB 4Q04A 2PRUA 2QPTA 4ORCB 3K21A 1SW8A 4MRXA 3CTNA 1EL4A 1KK7Z 3CLNA 3DF0A 1LXFC 4CFRA 4DCKA 1YVHA 1K9PA 4C0JA 2K2FA 3VGOA 5HLVA 5J3XA 1IH0A 2LMTA 1KFXS 1QVIZ 2NZ0A 1ALWA 2KAYA 1CFFA 3VRRA 3EVUA 1L2OC 3RM1A 3DVJA 1A75B 1UHKA 4YI8A 4C0LA 1BT6A 2GV5A 3BQ3A 3DVKA 3MSEB 2LM5A 2PSRA 1D1OA 1J55A 1ZACA 4ORAB 1EG4A 4GGFC 1DT7B 5CSIA 2JT3A 1G33A 4N1GA 3VROA 5FYXA 3SG7A 2H2KA 4D1EA 1S1EA 2JNXA 1XA5A 1EG3A 2L50A 1HQVA 3BOWB 2KDHA 2OPOA 3CR5X 1MHOA 2LLTA 4I5KA 1H4BA 2EGDA 4N5XA 1A29A 2LC5A 2O60A 1G8IA 3TDZA 2JU0A 1OE9B 1B9AA 1S6JA 4XJKA 1KSOA 3PFVA 4NDBA 2AUCA 1XVJA 4FQOA 4WRIA 4MZLA 3TDIA 1IKUA 2OS8B 1WDCB 4NDCA 1FI5A 3D0YB 3GOFA 1SYMA 1DJHA 1QX5B 1FPWA 2BE4A 2FCDA 4MN0A 4UPGA 2RGIA 4CFQA 1PK0D 2CT9A 4MBEA 3EVVA 2KI6D 1BU3A 1Y1UA 4DRWA 1UHJA 1YX7A 1RECA 1A4PA 1HT9A 1TIZA 2F8PA 1EXRA 1B7TZ 2K7OA 4M2QA 2MHHA 2M29A 1IG5A 1XK4C 2V53A 2WORA 3AAKA 3DD4A 4YGBB 1ZOTB 1WRLA 2LUXA 1B47A 3OB2B 5G08A 3BXKA 1BLQA 1U5IA 5CSJA 3EK7A 1X02A 2JNFA 3JTDB 1QATA 2Q4UA 3WNXB 1S5GY 2MAZA 1KWOC 2LVJA 3PLFB 2WCEA 1K94A 1F8HA 1DGUA 2Y4QA 4JPZB 1OMDA 2BBMA 2KHNA 2NCPA 2LMUA 3LCPC 4PDZA 3DF0B 4P5OE 1L7ZA 1DJZA 1KFXL 4GGFA 1QIWA 2HQ8A 1F4OA 1NX2A 1MR8A 1CMFA 1AVSA 2LP2A 2MLEC 1JBAA 2ZNDA 3WHTB 2JULA 1YURA 3TUYC 4NDDA 5DKQA 1XFWO 1N65A 3PALA 1NPQA 4NQGA 3CZTX 1KK8C 1NYAA 2KI6C 2LCPA 1F70A 1FI6A 3BUOB 4BY4A 1PVAA 1C7WA 1PULA 3PSRA 2KFHA 2MBXA 4ICBA 2F3ZA 4HREE 2D8NA 1JF0A 2EHBA 1SL7A 3BUNB 1F54A 1YUTA 3AKBA 3I5FC 5I8NA 2COLB 2HPSA 3PN7B 3CR2A 1TNPA 1IQ3A 4GGNA 2K61A 1B8LA 3WXAA 4XJKB 3PATA 1CFCA 5AANA 1NIWA 2WC8A 1S36A 1WLZA 1TRFA 1MXEA 1CLLA 2JT8A 2LP3A 5CSFA 4ETOA 1XK4A 2ZFDA 1MQ1A 2PVBA 3SIBA 2KQ6A 1OZOA 3LK0A 1UHNA 1F71A 4BY5A 1PRWA 3QRXA 4ZCVA 1AJ5A 1NP8A 1DJIA 2BL0C 3O6BA 1M63B 1TNXA 1XFUO 1UHHA 4OR9B 4OVNF 4TNCA 2KAXA 2OTGB 1CFPA 2FOTA 1M31A 1V1GA 2MJWB 3VRQA 2Y1MA 1OOJA 1FW4A 1MWNA 1U5IB 2BECA 2O5GA 3JVTC 3FS7A 5JOLA 3A8RA 1J1DA 3M0WA 1SBJA 2ISDA 2L0PA 1SCVA 1A2XA 3EK8A 5ER5A 3H4SE 3I5GC 2LLUA 1SK6D 4YI9A 4PHNA 1CLBA 2ZRTA 1CTRA 1TTXA 2G9BA 2LV7A 2CXJA 3TS5B 2KI4B 2JC2A 2KGBC 4PE4A 1SCMC 3I5IB 1CLMA 3PM8A 2LVVA 2KGRA 2M49B 5KU1A 1QX2A 1YVLA 4PHMA 1QIVA 1M46A 1K95A 2GGZA 4GNKB 2M8UA 1AJ4A 1NWDA 1MUXA 3NSLA 2SASA 4YBHB 4OV2A 1QJTA 3IQOA 3CWGA 1XFVO 5ER4X 1CMGA 1YX8A 5F6TA 1BR4B 1W7JB 4DS7A 1QXPA 1NUBA 1YTZC 3I5HB 3SG5A 1Y6WA 1B8CA 1KQVA 1CM4A 4GFTA 4USLA 1SRAA 5KTYA 4QJ5B 1RTP1 2KSPA 3RLZA 1QV0A 2M97A 1Y0VH 3E3RA 2JPTA 1QS7A 2WCBA 2ZN9A 1GQMA 2CBLA 4M2OA 4MRYA 3OHMB 1IWQA 2I94A 4MLWA 4YGDB 3C1VA 1CNPA 5DKRA 1LINA 2FJUB 2OS8C 1WDCC 4MZJA 1KQMB 1WRZA 1C07A 1DJXA 2I18A 5HKWA 2MA2A 3OX6A 1GJYA 3IQQA 1AK8A 2BKHB 4GAOA 1GGWA 1VRKA 4E68A 1JFJA 4DIRA 1BR1B 2JWWA 2A4JA 1TN4A 2SCPA 3DVMA 1RROA 2PASA 4FTGA 1K96A 2K7CA 1SPYA 2LVKA 1FF1A 2I2RE 1PALA 3ZNIA 4WQ3A 3GK2A 1M39A 1UUSA 1SY9A 3JTDC 1K90D 2JZIA 1SKTA 1SR6C 1NX1A 1R6PA 2FCEA 1S3PA 1QLSA 1IRJA 1M45A 1DMOA 2EC6B 2G2BA 2AMIA 2NCOA 1J1EA 3VRNA 1C7VA 1CM1A 2PMYA 2JT0A 1KCYA 1R2UA 2NXQA 1Q80A 4YGAA 3NSKA 1KFUL 1OQPA 3FWCA 3GK1A 2M1KB 5CPVA 5TNCA 2ZN8A 3ZWHA 2B1UA 1DJWA 2Y5IA 4ORBB 4M2PA 3CGAA 1K9UA 1CDMA 4QJ4B 1EJ3A 4A4BA 1CB1A 3KF9A 2HETA 1GGZA 2K2AA 1S6CA 2M7LA 1F4QA 1YR5A 2CNPA 4CPVA 2WCFA 2BCAA 4C0KA 1BMOA 1WRKA 1B1GA 2JRFA 3OB1B 3D10A 2KNEA 5HKZA 2Q91A 3OX5A 1TCOB 2KQYA 1SNLA 1TNQA 3PN7C 1NSHA 4PCWA 3O78A 3SJSA 2LNKA 4PHJA 1BODA 1KSMA 1NCZA 2M9GA 1QTXA 2L98A 1JFKA 1N2DA 4YRUA 1K93D 2QACA 2JTTA 3KHEA 1DJGA 1ALVA 1J7RA 2BE6A 2LAPA 3NSIA 3CR4X 3JVTB 2LHLA 4P2YB 1CDLA 1L2OB 2ZNEA 1RK9A 1PSBA 2H61C 5B8IB 1IJ6A 1E8AA 5KSZA 2WOSA 3EVRA 1N0YA 4PE7A 4OKHA 2JQ6A 1UWOA 1K9KA 5I2QA 3VRPA 2OTGC 1TOPA 2KAVA 1QX7A 2BKIB 5GQQC 2L51A 3NXAA 1SCMB 2ZRSA 2R2IA 2F2OA 2LHIA 1XFXO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SIA A;  4GBA A;  2VRG A;  1YRT B;  1JF2 A;  4MVF A;  1S6I A;  2MRD A;  3SG2 A;  1KFU S;  1SL9 A;  1RWY A;  4GPL B;  3TZ1 A;  4YGC B;  2L4H A;  1NCY A;  3O2P A;  5D7F A;  1B8R A;  2IS9 A;  1OSA A;  3KEV A;  2KFG A;  4GUK A;  3BUW B;  2F3Y A;  3IF7 A;  2K8M B;  3TS5 C;  1IJ5 A;  2KI4 C;  3F45 A;  1OMV A;  2M0R A;  1QAS A;  4HSZ A;  1S5G Z;  4U8D A;  1Y1A A;  2F33 A;  3I5I C;  1IGV A;  1KK7 Y;  2MLF C;  2LUC A;  4F0Z B;  1J7P A;  3LK1 A;  1CDN A;  1JWD A;  3HCM A;  2HF5 A;  3LL8 B;  1WY9 A;  3AKA A;  1A03 A;  4MZK A;  3KO0 A;  1XFZ O;  1ZUZ A;  1S26 D;  4CID A;  1QVI Y;  4ZCU A;  1CFD A;  4I5N B;  1DF0 A;  3AAJ A;  1H8B A;  2M1U A;  3DVE A;  2BBN A;  5DKN A;  4A4C A;  3I5H C;  2NLN A;  4PAL A;  1AUI B;  3SG3 A;  1LVC D;  2HQW A;  1LKJ A;  1NX0 A;  5CSN A;  4AQJ A;  3NSO A;  5K89 A;  3LLE A;  1EH2 A;  1ODB A;  2I7A A;  1UP5 A;  2BCX A;  1KWO B;  1WLM A;  5HKY A;  3ICB A;  3TDU A;  1PSR A;  2CCM A;  1BOC A;  2KBM A;  2KYF A;  5HLO A;  1CDP A;  2H61 A;  1SL8 A;  1OMR A;  1MF8 B;  3EKJ A;  1V1F A;  3O4Y A;  1BF5 A;  2AAO A;  2K7B A;  2CTN A;  1JUO A;  5IBW A;  1K2H A;  4I5L B;  1FBV A;  1AHR A;  2BCB A;  3FIA A;  4JQ0 D;  2K0J A;  1KQM C;  1LA3 A;  3EK4 A;  5BPJ A;  2PAL A;  2JXL A;  4XYN A;  1OZS A;  2DOQ A;  1SR6 B;  2L4I A;  3SG4 A;  3TUY B;  1RJV A;  2K7D A;  2KBI A;  1A75 A;  2P6B B;  3OP0 A;  4R1E A;  1Y1X A;  5AXI A;  2M7N A;  1BG1 A;  1SMG A;  1ZFS A;  1KK8 B;  2ZKM X;  2Y1N A;  5HYD A;  5PAL A;  2LE9 B;  5AFP A;  1F55 A;  2KFF A;  4QJ3 B;  1UHI A;  2F2P A;  2M3W A;  3BUX B;  1MXL C;  1B7T Y;  1ZMZ A;  3BOW A;  1UUR A;  2LMV A;  1YRU B;  3I5F B;  4DUQ A;  5I2O A;  4PE1 A;  2JTZ A;  1JSA A;  1XFY O;  1BJF A;  2L2E A;  1QV1 A;  2LAN A;  1JC2 A;  2KOT A;  1IQ5 A;  1G4Y R;  4I5J A;  1DGV A;  3BYA A;  1NX3 A;  2EC6 C;  2LVI A;  3FWB A;  3WHU B;  2WND A;  1YUS A;  3KPX A;  5AEQ A;  1B4C A;  4MSP A;  5I2L A;  1J7O A;  2GGM A;  3EKH A;  4AOM A;  5AER A;  3GK4 X;  5D69 A;  1AP4 A;  1NCX A;  2E30 A;  2LLS A;  4WQ2 A;  4HRH A;  1W7I B;  3D0Y A;  4AQI A;  1DTL A;  1CKK A;  1DJY A;  1RFJ A;  1YUU A;  1K8U A;  1QLK A;  2BL0 B;  1LA0 A;  1TCF A;  4L9M A;  4JWQ A;  3BUM B;  1DVI A;  4IL1 A;  1DF0 B;  2TN4 A;  4MEW A;  1PVB A;  4PE0 A;  5JJG A;  1J7Q A;  2E6W A;  4PHK A;  3SG6 A;  4CLN A;  1XYD A;  3CS1 A;  4HRG A;  2JXC A;  4OCI A;  2L5X B;  2JOJ A;  3HX4 A;  4YGE B;  1XO5 A;  3A4U B;  4N1F A;  1TNW A;  2KYC A;  3I5G B;  4Q04 A;  2PRU A;  2QPT A;  4ORC B;  3K21 A;  1SW8 A;  4MRX A;  3CTN A;  1EL4 A;  1KK7 Z;  3CLN A;  3DF0 A;  1LXF C;  4CFR A;  4DCK A;  1YVH A;  1K9P A;  4C0J A;  2K2F A;  3VGO A;  5HLV A;  5J3X A;  1IH0 A;  2LMT A;  1KFX S;  1QVI Z;  2NZ0 A;  1ALW A;  2KAY A;  1CFF A;  3VRR A;  3EVU A;  1L2O C;  3RM1 A;  3DVJ A;  1A75 B;  1UHK A;  4YI8 A;  4C0L A;  1BT6 A;  2GV5 A;  3BQ3 A;  3DVK A;  3MSE B;  2LM5 A;  2PSR A;  1D1O A;  1J55 A;  1ZAC A;  4ORA B;  1EG4 A;  4GGF C;  1DT7 B;  5CSI A;  2JT3 A;  1G33 A;  4N1G A;  3VRO A;  5FYX A;  3SG7 A;  2H2K A;  4D1E A;  1S1E A;  2JNX A;  1XA5 A;  1EG3 A;  2L50 A;  1HQV A;  3BOW B;  2KDH A;  2OPO A;  3CR5 X;  1MHO A;  2LLT A;  4I5K A;  1H4B A;  2EGD A;  4N5X A;  1A29 A;  2LC5 A;  2O60 A;  1G8I A;  3TDZ A;  2JU0 A;  1OE9 B;  1B9A A;  1S6J A;  4XJK A;  1KSO A;  3PFV A;  4NDB A;  2AUC A;  1XVJ A;  4FQO A;  4WRI A;  4MZL A;  3TDI A;  1IKU A;  2OS8 B;  1WDC B;  4NDC A;  1FI5 A;  3D0Y B;  3GOF A;  1SYM A;  1DJH A;  1QX5 B;  1FPW A;  2BE4 A;  2FCD A;  4MN0 A;  4UPG A;  2RGI A;  4CFQ A;  1PK0 D;  2CT9 A;  4MBE A;  3EVV A;  2KI6 D;  1BU3 A;  1Y1U A;  4DRW A;  1UHJ A;  1YX7 A;  1REC A;  1A4P A;  1HT9 A;  1TIZ A;  2F8P A;  1EXR A;  1B7T Z;  2K7O A;  4M2Q A;  2MHH A;  2M29 A;  1IG5 A;  1XK4 C;  2V53 A;  2WOR A;  3AAK A;  3DD4 A;  4YGB B;  1ZOT B;  1WRL A;  2LUX A;  1B47 A;  3OB2 B;  5G08 A;  3BXK A;  1BLQ A;  1U5I A;  5CSJ A;  3EK7 A;  1X02 A;  2JNF A;  3JTD B;  1QAT A;  2Q4U A;  3WNX B;  1S5G Y;  2MAZ A;  1KWO C;  2LVJ A;  3PLF B;  2WCE A;  1K94 A;  1F8H A;  1DGU A;  2Y4Q A;  4JPZ B;  1OMD A;  2BBM A;  2KHN A;  2NCP A;  2LMU A;  3LCP C;  4PDZ A;  3DF0 B;  4P5O E;  1L7Z A;  1DJZ A;  1KFX L;  4GGF A;  1QIW A;  2HQ8 A;  1F4O A;  1NX2 A;  1MR8 A;  1CMF A;  1AVS A;  2LP2 A;  2MLE C;  1JBA A;  2ZND A;  3WHT B;  2JUL A;  1YUR A;  3TUY C;  4NDD A;  5DKQ A;  1XFW O;  1N65 A;  3PAL A;  1NPQ A;  4NQG A;  3CZT X;  1KK8 C;  1NYA A;  2KI6 C;  2LCP A;  1F70 A;  1FI6 A;  3BUO B;  4BY4 A;  1PVA A;  1C7W A;  1PUL A;  3PSR A;  2KFH A;  2MBX A;  4ICB A;  2F3Z A;  4HRE E;  2D8N A;  1JF0 A;  2EHB A;  1SL7 A;  3BUN B;  1F54 A;  1YUT A;  3AKB A;  3I5F C;  5I8N A;  2COL B;  2HPS A;  3PN7 B;  3CR2 A;  1TNP A;  1IQ3 A;  4GGN A;  2K61 A;  1B8L A;  3WXA A;  4XJK B;  3PAT A;  1CFC A;  5AAN A;  1NIW A;  2WC8 A;  1S36 A;  1WLZ A;  1TRF A;  1MXE A;  1CLL A;  2JT8 A;  2LP3 A;  5CSF A;  4ETO A;  1XK4 A;  2ZFD A;  1MQ1 A;  2PVB A;  3SIB A;  2KQ6 A;  1OZO A;  3LK0 A;  1UHN A;  1F71 A;  4BY5 A;  1PRW A;  3QRX A;  4ZCV A;  1AJ5 A;  1NP8 A;  1DJI A;  2BL0 C;  3O6B A;  1M63 B;  1TNX A;  1XFU O;  1UHH A;  4OR9 B;  4OVN F;  4TNC A;  2KAX A;  2OTG B;  1CFP A;  2FOT A;  1M31 A;  1V1G A;  2MJW B;  3VRQ A;  2Y1M A;  1OOJ A;  1FW4 A;  1MWN A;  1U5I B;  2BEC A;  2O5G A;  3JVT C;  3FS7 A;  5JOL A;  3A8R A;  1J1D A;  3M0W A;  1SBJ A;  2ISD A;  2L0P A;  1SCV A;  1A2X A;  3EK8 A;  5ER5 A;  3H4S E;  3I5G C;  2LLU A;  1SK6 D;  4YI9 A;  4PHN A;  1CLB A;  2ZRT A;  1CTR A;  1TTX A;  2G9B A;  2LV7 A;  2CXJ A;  3TS5 B;  2KI4 B;  2JC2 A;  2KGB C;  4PE4 A;  1SCM C;  3I5I B;  1CLM A;  3PM8 A;  2LVV A;  2KGR A;  2M49 B;  5KU1 A;  1QX2 A;  1YVL A;  4PHM A;  1QIV A;  1M46 A;  1K95 A;  2GGZ A;  4GNK B;  2M8U A;  1AJ4 A;  1NWD A;  1MUX A;  3NSL A;  2SAS A;  4YBH B;  4OV2 A;  1QJT A;  3IQO A;  3CWG A;  1XFV O;  5ER4 X;  1CMG A;  1YX8 A;  5F6T A;  1BR4 B;  1W7J B;  4DS7 A;  1QXP A;  1NUB A;  1YTZ C;  3I5H B;  3SG5 A;  1Y6W A;  1B8C A;  1KQV A;  1CM4 A;  4GFT A;  4USL A;  1SRA A;  5KTY A;  4QJ5 B;  1RTP 1;  2KSP A;  3RLZ A;  1QV0 A;  2M97 A;  1Y0V H;  3E3R A;  2JPT A;  1QS7 A;  2WCB A;  2ZN9 A;  1GQM A;  2CBL A;  4M2O A;  4MRY A;  3OHM B;  1IWQ A;  2I94 A;  4MLW A;  4YGD B;  3C1V A;  1CNP A;  5DKR A;  1LIN A;  2FJU B;  2OS8 C;  1WDC C;  4MZJ A;  1KQM B;  1WRZ A;  1C07 A;  1DJX A;  2I18 A;  5HKW A;  2MA2 A;  3OX6 A;  1GJY A;  3IQQ A;  1AK8 A;  2BKH B;  4GAO A;  1GGW A;  1VRK A;  4E68 A;  1JFJ A;  4DIR A;  1BR1 B;  2JWW A;  2A4J A;  1TN4 A;  2SCP A;  3DVM A;  1RRO A;  2PAS A;  4FTG A;  1K96 A;  2K7C A;  1SPY A;  2LVK A;  1FF1 A;  2I2R E;  1PAL A;  3ZNI A;  4WQ3 A;  3GK2 A;  1M39 A;  1UUS A;  1SY9 A;  3JTD C;  1K90 D;  2JZI A;  1SKT A;  1SR6 C;  1NX1 A;  1R6P A;  2FCE A;  1S3P A;  1QLS A;  1IRJ A;  1M45 A;  1DMO A;  2EC6 B;  2G2B A;  2AMI A;  2NCO A;  1J1E A;  3VRN A;  1C7V A;  1CM1 A;  2PMY A;  2JT0 A;  1KCY A;  1R2U A;  2NXQ A;  1Q80 A;  4YGA A;  3NSK A;  1KFU L;  1OQP A;  3FWC A;  3GK1 A;  2M1K B;  5CPV A;  5TNC A;  2ZN8 A;  3ZWH A;  2B1U A;  1DJW A;  2Y5I A;  4ORB B;  4M2P A;  3CGA A;  1K9U A;  1CDM A;  4QJ4 B;  1EJ3 A;  4A4B A;  1CB1 A;  3KF9 A;  2HET A;  1GGZ A;  2K2A A;  1S6C A;  2M7L A;  1F4Q A;  1YR5 A;  2CNP A;  4CPV A;  2WCF A;  2BCA A;  4C0K A;  1BMO A;  1WRK A;  1B1G A;  2JRF A;  3OB1 B;  3D10 A;  2KNE A;  5HKZ A;  2Q91 A;  3OX5 A;  1TCO B;  2KQY A;  1SNL A;  1TNQ A;  3PN7 C;  1NSH A;  4PCW A;  3O78 A;  3SJS A;  2LNK A;  4PHJ A;  1BOD A;  1KSM A;  1NCZ A;  2M9G A;  1QTX A;  2L98 A;  1JFK A;  1N2D A;  4YRU A;  1K93 D;  2QAC A;  2JTT A;  3KHE A;  1DJG A;  1ALV A;  1J7R A;  2BE6 A;  2LAP A;  3NSI A;  3CR4 X;  3JVT B;  2LHL A;  4P2Y B;  1CDL A;  1L2O B;  2ZNE A;  1RK9 A;  1PSB A;  2H61 C;  5B8I B;  1IJ6 A;  1E8A A;  5KSZ A;  2WOS A;  3EVR A;  1N0Y A;  4PE7 A;  4OKH A;  2JQ6 A;  1UWO A;  1K9K A;  5I2Q A;  3VRP A;  2OTG C;  1TOP A;  2KAV A;  1QX7 A;  2BKI B;  5GQQ C;  2L51 A;  3NXA A;  1SCM B;  2ZRS A;  2R2I A;  2F2O A;  2LHI A;  1XFX O; 
#chains in the Genus database with same CATH topology
 3SIA A;  4GBA A;  2VRG A;  3BFB A;  1YRT B;  1JF2 A;  4MVF A;  1S6I A;  2MRD A;  3SG2 A;  1KFU S;  1OOH A;  1SL9 A;  1RWY A;  4GPL B;  3TZ1 A;  4YGC B;  2L4H A;  1NCY A;  3O2P A;  5D7F A;  1B8R A;  2IS9 A;  1OSA A;  3KEV A;  2KFG A;  4GUK A;  3BUW B;  2F3Y A;  1OOG A;  3IF7 A;  2K8M B;  3TS5 C;  1IJ5 A;  2KI4 C;  3F45 A;  1OMV A;  2M0R A;  1QAS A;  3DY9 A;  4HSZ A;  1S5G Z;  4U8D A;  1Y1A A;  2F33 A;  3I5I C;  1IGV A;  1KK7 Y;  2MLF C;  2LUC A;  4F0Z B;  1J7P A;  3LK1 A;  1CDN A;  1JWD A;  3HCM A;  2HF5 A;  3LL8 B;  1WY9 A;  3AKA A;  1A03 A;  4MZK A;  3KO0 A;  1XFZ O;  1ZUZ A;  3OGN A;  1S26 D;  4CID A;  3BFA A;  1QVI Y;  4ZCU A;  1CFD A;  4I5N B;  1DF0 A;  3AAJ A;  1H8B A;  2M1U A;  3DVE A;  2BBN A;  4OZD A;  5DKN A;  4A4C A;  3I5H C;  2NLN A;  2JPO A;  4PAL A;  1AUI B;  3SG3 A;  1LVC D;  2HQW A;  1LKJ A;  1NX0 A;  5CSN A;  3S0G A;  3NSO A;  4AQJ A;  5K89 A;  1TWO A;  3LLE A;  1EH2 A;  1ODB A;  2I7A A;  1UP5 A;  3DZT A;  2BCX A;  1KWO B;  1WLM A;  1TUJ A;  3ICB A;  3TDU A;  5HKY A;  1PSR A;  2CCM A;  1BOC A;  2KBM A;  2KYF A;  2WCM A;  3N7H A;  4INW A;  5HLO A;  1CDP A;  2H61 A;  1OOI X;  1SL8 A;  3DYE A;  1OMR A;  1MF8 B;  3EKJ A;  1V1F A;  3O4Y A;  1BF5 A;  2AAO A;  2K7B A;  2CTN A;  1JUO A;  5IBW A;  1K2H A;  4I5L B;  1FBV A;  1AHR A;  2BCB A;  3FIA A;  1GM0 A;  4JQ0 D;  2K0J A;  1KQM C;  2P70 A;  1W9Z A;  1LA3 A;  3EK4 A;  5BPJ A;  2PAL A;  2JXL A;  4XYN A;  4F7F A;  2QEO A;  1OZS A;  2DOQ A;  1SR6 B;  3OBV A;  3CDN A;  2L4I A;  3SG4 A;  3TUY B;  1RJV A;  2K7D A;  2KBI A;  1A75 A;  2P6B B;  3OP0 A;  4R1E A;  1Y1X A;  5AXI A;  2M7N A;  1BG1 A;  1SMG A;  1ZFS A;  1KK8 B;  2ZKM X;  3VB1 A;  2Y1N A;  3CZ1 A;  5PAL A;  5HYD A;  3DXL A;  2LE9 B;  5AFP A;  1F55 A;  2KFF A;  4QJ3 B;  1UHI A;  2F2P A;  2M3W A;  3BUX B;  1MXL C;  1B7T Y;  1ZMZ A;  3SS5 A;  3BJH A;  3BOW A;  1UUR A;  2LMV A;  1YRU B;  3I5F B;  4DUQ A;  5I2O A;  4PE1 A;  2FJY A;  2JTZ A;  1JSA A;  1XFY O;  1BJF A;  2L2E A;  1QV1 A;  2LAN A;  1JC2 A;  2KOT A;  1IQ5 A;  1G4Y R;  4I5J A;  1DGV A;  1TUZ A;  3BYA A;  1NX3 A;  2EC6 C;  2LVI A;  3FWB A;  3WHU B;  2WND A;  1YUS A;  3KPX A;  5AEQ A;  1B4C A;  4MSP A;  5I2L A;  1J7O A;  2GGM A;  3EKH A;  4AOM A;  5AER A;  3GK4 X;  3D74 A;  5D69 A;  1AP4 A;  1NCX A;  2E30 A;  2LLS A;  4WQ2 A;  4HRH A;  1W7I B;  3D0Y A;  4AQI A;  1DTL A;  1CKK A;  1DJY A;  1RFJ A;  1YUU A;  1K8U A;  1QLK A;  2BL0 B;  1LA0 A;  1TCF A;  2WCL A;  4L9M A;  4JWQ A;  1C3Z A;  1C3Y A;  3BUM B;  1DVI A;  4IL1 A;  1DF0 B;  2TN4 A;  2WCJ A;  4MEW A;  3D75 A;  1DC1 A;  1PVB A;  4PE0 A;  5JJG A;  1J7Q A;  2E6W A;  4PHK A;  3SG6 A;  4CLN A;  3CYZ A;  1XYD A;  3CS1 A;  4HRG A;  2JXC A;  4OCI A;  2L5X B;  2JOJ A;  3HX4 A;  4YGE B;  1XO5 A;  3A4U B;  4N1F A;  1TNW A;  2KYC A;  3I5G B;  4Q04 A;  2PRU A;  2QPT A;  4ORC B;  3K21 A;  1SW8 A;  4MRX A;  4JD9 A;  3CTN A;  1EL4 A;  3SS4 A;  3V2L A;  1KK7 Z;  3CLN A;  3FE9 A;  3DF0 A;  1LXF C;  3CAB A;  4CFR A;  4DCK A;  1YVH A;  2ERB A;  1K9P A;  4C0J A;  2K2F A;  3VGO A;  5HLV A;  5J3X A;  5D3O A;  3L4A A;  1IH0 A;  2LMT A;  1KFX S;  1QVI Z;  2NZ0 A;  1ALW A;  3CZ0 A;  2KAY A;  3R72 A;  3VRR A;  3EVU A;  1CFF A;  1L2O C;  3RM1 A;  3DVJ A;  1A75 B;  1UHK A;  4YI8 A;  4C0L A;  1BT6 A;  2GV5 A;  3BQ3 A;  3DVK A;  3MSE B;  2LM5 A;  2PSR A;  1D1O A;  1J55 A;  1ZAC A;  4ORA B;  1EG4 A;  4GGF C;  1DT7 B;  5CSI A;  2JT3 A;  1G33 A;  4N1G A;  3VRO A;  5FYX A;  3SG7 A;  2H2K A;  4D1E A;  1S1E A;  2JNX A;  1XA5 A;  2KLE A;  1EG3 A;  2L50 A;  1OOF A;  1HQV A;  3BOW B;  2KDH A;  2OPO A;  3CR5 X;  1MHO A;  2LLT A;  4I5K A;  1H4B A;  2EGD A;  4PT1 A;  3D77 A;  4N5X A;  1A29 A;  2L2C A;  2LC5 A;  2O60 A;  1G8I A;  3TDZ A;  2JU0 A;  1OE9 B;  1B9A A;  1S6J A;  4XJK A;  3R1V A;  3K1E A;  1KSO A;  3PFV A;  4NDB A;  2AUC A;  1XVJ A;  2K60 A;  4FQO A;  4MZL A;  4WRI A;  3TDI A;  2OS8 B;  1IKU A;  1WDC B;  4NDC A;  1FI5 A;  3D0Y B;  3GOF A;  1SYM A;  1DJH A;  1QX5 B;  1FPW A;  2BE4 A;  2FCD A;  4MN0 A;  4UPG A;  2RGI A;  4CFQ A;  1PK0 D;  2CT9 A;  4MBE A;  1DEL A;  3B6X A;  3EVV A;  2KI6 D;  1BU3 A;  1Y1U A;  4DRW A;  1UHJ A;  1YX7 A;  1REC A;  1A4P A;  1HT9 A;  1TIZ A;  2F8P A;  1EXR A;  1B7T Z;  2K7O A;  2QEH A;  4M2Q A;  2MHH A;  2M29 A;  1IG5 A;  1XK4 C;  2V53 A;  2WOR A;  3AAK A;  3DD4 A;  4YGB B;  1ZOT B;  1WRL A;  2LUX A;  1B47 A;  3OB2 B;  5G08 A;  3BXK A;  1BLQ A;  1U5I A;  5CSJ A;  3D76 A;  3EK7 A;  1X02 A;  2JNF A;  3JTD B;  1QAT A;  2Q4U A;  3B86 A;  3WNX B;  1S5G Y;  2MAZ A;  1KWO C;  2LVJ A;  3PLF B;  2WCE A;  2P71 A;  1K94 A;  1ORG A;  1F8H A;  1DGU A;  2Y4Q A;  4JPZ B;  1OMD A;  2BBM A;  2KHN A;  2NCP A;  2LMU A;  3LCP C;  4PDZ A;  3DF0 B;  4P5O E;  1L7Z A;  1DJZ A;  1KFX L;  4GGF A;  3R1P A;  1QIW A;  2HQ8 A;  2WC5 A;  1F4O A;  1NX2 A;  1MR8 A;  1CMF A;  1AVS A;  2LP2 A;  2MLE C;  1JBA A;  2ZND A;  5HL1 A;  3WHT B;  3L4L A;  3S0F A;  2JUL A;  1YUR A;  3TUY C;  4NDD A;  5DKQ A;  1XFW O;  1N65 A;  3PAL A;  1NPQ A;  4NQG A;  3CZT X;  1KK8 C;  1NYA A;  2KI6 C;  2LCP A;  1F70 A;  1FI6 A;  3BUO B;  4BY4 A;  1PVA A;  1C7W A;  1PUL A;  3PSR A;  2KFH A;  2MBX A;  4ICB A;  2F3Z A;  4HRE E;  4JKT A;  2D8N A;  1JF0 A;  2EHB A;  1SL7 A;  3BUN B;  1F54 A;  3UO9 A;  1YUT A;  3AKB A;  3I5F C;  5I8N A;  2COL B;  3S0B A;  2HPS A;  3B87 A;  3PN7 B;  3CR2 A;  1TNP A;  1IQ3 A;  4GGN A;  2K61 A;  1B8L A;  2WCH A;  3WXA A;  4XJK B;  3PAT A;  1CFC A;  5AAN A;  1NIW A;  3FE6 A;  2YGU A;  3SS3 A;  1SSE B;  2WC8 A;  1S36 A;  1WLZ A;  1TRF A;  1MXE A;  1CLL A;  2JT8 A;  2LP3 A;  3RZS A;  5CSF A;  4ETO A;  1XK4 A;  2ZFD A;  1MQ1 A;  2PVB A;  3SIB A;  2KQ6 A;  1OZO A;  3LK0 A;  1UHN A;  1F71 A;  1LS8 A;  4BY5 A;  1PRW A;  3QRX A;  4ZCV A;  1AJ5 A;  1NP8 A;  1DJI A;  2BL0 C;  3O6B A;  1M63 B;  1TNX A;  1XFU O;  1Z2C B;  1UHH A;  3Q8I A;  4OR9 B;  4OVN F;  4TNC A;  1XFR A;  2KAX A;  3QME A;  3D73 A;  2OTG B;  1CFP A;  2QEV A;  3UNW A;  2FOT A;  1M31 A;  1V1G A;  2MJW B;  3VRQ A;  2Y1M A;  1OOJ A;  1FW4 A;  1MWN A;  1U5I B;  2BEC A;  2O5G A;  2WCK A;  3JVT C;  3FS7 A;  4INX A;  3A8R A;  1J1D A;  3M0W A;  1SBJ A;  5JOL A;  2ISD A;  2L0P A;  1SCV A;  1A2X A;  3EK8 A;  5ER5 A;  3H4S E;  3I5G C;  5FI6 A;  2LLU A;  1SK6 D;  2BNX A;  4PHN A;  4YI9 A;  1CLB A;  2ZRT A;  3R1O A;  1CTR A;  1TTX A;  2G9B A;  2LV7 A;  3S0D A;  2CXJ A;  3TS5 B;  2KI4 B;  2JC2 A;  2KGB C;  4PE4 A;  1SCM C;  4IJ7 A;  3I5I B;  1CLM A;  3D78 A;  3PM8 A;  2LVV A;  2KGR A;  2M49 B;  5KU1 A;  1QX2 A;  1YVL A;  4PHM A;  1QIV A;  1M46 A;  1K95 A;  2GGZ A;  4GNK B;  2M8U A;  1AJ4 A;  1NWD A;  1MUX A;  3NSL A;  2SAS A;  4YBH B;  4OV2 A;  1QJT A;  3IQO A;  3CWG A;  1XFV O;  5ER4 X;  1CMG A;  1YX8 A;  5F6T A;  3BFH A;  1BR4 B;  3O4X A;  1W7J B;  2L5Y A;  4DS7 A;  1QXP A;  1NUB A;  1YTZ C;  3I5H B;  3SG5 A;  1Y6W A;  1B8C A;  1KQV A;  1CM4 A;  4GFT A;  4USL A;  1SRA A;  5KTY A;  4QJ5 B;  1RTP 1;  2WC6 A;  2KSP A;  3RLZ A;  1QV0 A;  2M97 A;  1Y0V H;  3E3R A;  3CZ2 A;  2JPT A;  3B7A A;  1QS7 A;  2WCB A;  3B88 A;  2ZN9 A;  1GQM A;  2CBL A;  4M2O A;  4MRY A;  3OHM B;  5I94 A;  1IWQ A;  2I94 A;  4MLW A;  4YGD B;  3C1V A;  1CNP A;  5DKR A;  1LIN A;  2FJU B;  3EG5 B;  5EL2 A;  2OS8 C;  2H8V A;  1WDC C;  4MZJ A;  1KQM B;  1IIO A;  1WRZ A;  1C07 A;  1DJX A;  2I18 A;  3PM2 A;  5HKW A;  2MA2 A;  3OX6 A;  1GJY A;  3IQQ A;  1AK8 A;  2BKH B;  2GTE A;  4GAO A;  1VRK A;  4E68 A;  1GGW A;  1JFJ A;  4DIR A;  1BR1 B;  2JWW A;  3FE8 A;  5DIC A;  2A4J A;  1TN4 A;  2SCP A;  3DVM A;  4FQT A;  1RRO A;  2PAS A;  4FTG A;  1K96 A;  2K7C A;  1SPY A;  2LVK A;  1FF1 A;  2I2R E;  1PAL A;  3S0E A;  3ZNI A;  4WQ3 A;  3GK2 A;  1M39 A;  1UUS A;  1OW4 A;  1SY9 A;  3JTD C;  1K90 D;  2JZI A;  1SKT A;  1SR6 C;  1NX1 A;  1R6P A;  2FCE A;  1S3P A;  1QLS A;  1IRJ A;  1M45 A;  1DMO A;  2EC6 B;  2G2B A;  2AMI A;  2NCO A;  1J1E A;  3NGV A;  3VRN A;  1P28 A;  1C7V A;  1CM1 A;  1Z4H A;  2PMY A;  2JT0 A;  1KCY A;  1R2U A;  2PYQ A;  2NXQ A;  1Q80 A;  4YGA A;  3NSK A;  3PJI A;  1KFU L;  1OQP A;  3FWC A;  3GK1 A;  2M1K B;  3IVT A;  5CPV A;  5TNC A;  4KYN A;  2ZN8 A;  3ZWH A;  2B1U A;  1DJW A;  2Y5I A;  4ORB B;  4M2P A;  2QEB A;  3CGA A;  1K9U A;  1CDM A;  4QJ4 B;  1EJ3 A;  4A4B A;  1CB1 A;  3KF9 A;  2HET A;  1GGZ A;  2K2A A;  5FI2 A;  1S6C A;  2M7L A;  1F4Q A;  1YR5 A;  2CNP A;  4CPV A;  2WCF A;  2BCA A;  4C0K A;  1BMO A;  2KPH A;  1DEK A;  1WRK A;  1B1G A;  2JRF A;  3OB1 B;  3D10 A;  2KNE A;  3L47 A;  5HKZ A;  2Q91 A;  3OX5 A;  1TCO B;  2KQY A;  3S0A A;  1SNL A;  1TNQ A;  3PN7 C;  1NSH A;  4PCW A;  3O78 A;  3SJS A;  2LNK A;  4PHJ A;  1BOD A;  2PQL A;  1KSM A;  1NCZ A;  2M9G A;  1QTX A;  2L98 A;  1JFK A;  1N2D A;  4YRU A;  1K93 D;  2QAC A;  2JTT A;  3KHE A;  1QWV A;  1DJG A;  1ALV A;  1J7R A;  2BE6 A;  2LAP A;  3NSI A;  3CR4 X;  3JVT B;  2LHL A;  4P2Y B;  2BAP A;  1CDL A;  1L2O B;  2ZNE A;  1RK9 A;  1PSB A;  2H61 C;  2KLD A;  1IJ6 A;  5B8I B;  1E8A A;  3NHT A;  5KSZ A;  2WOS A;  3EVR A;  1N0Y A;  4PE7 A;  4OKH A;  2JQ6 A;  1UWO A;  1K9K A;  1T14 A;  3VRP A;  2OTG C;  5I2Q A;  1TOP A;  5FI7 A;  2KAV A;  3NHI A;  1QX7 A;  2BKI B;  2QDI A;  5GQQ C;  2L51 A;  3NXA A;  1SCM B;  2ZRS A;  2R2I A;  2F2O A;  2LHI A;  1XFX O;  1DQE A; 
#chains in the Genus database with same CATH homology
 3SIA A;  4GBA A;  2VRG A;  1YRT B;  1JF2 A;  4MVF A;  1S6I A;  2MRD A;  3SG2 A;  1KFU S;  1SL9 A;  1RWY A;  4GPL B;  3TZ1 A;  4YGC B;  2L4H A;  1NCY A;  3O2P A;  5D7F A;  1B8R A;  2IS9 A;  1OSA A;  3KEV A;  2KFG A;  4GUK A;  3BUW B;  2F3Y A;  3IF7 A;  2K8M B;  3TS5 C;  1IJ5 A;  2KI4 C;  3F45 A;  1OMV A;  2M0R A;  1QAS A;  4HSZ A;  1S5G Z;  4U8D A;  1Y1A A;  2F33 A;  3I5I C;  1IGV A;  1KK7 Y;  2MLF C;  2LUC A;  4F0Z B;  1J7P A;  3LK1 A;  1CDN A;  1JWD A;  3HCM A;  2HF5 A;  3LL8 B;  1WY9 A;  3AKA A;  1A03 A;  4MZK A;  3KO0 A;  1XFZ O;  1ZUZ A;  1S26 D;  4CID A;  1QVI Y;  4ZCU A;  1CFD A;  4I5N B;  1DF0 A;  3AAJ A;  1H8B A;  2M1U A;  3DVE A;  2BBN A;  5DKN A;  4A4C A;  3I5H C;  2NLN A;  4PAL A;  1AUI B;  3SG3 A;  1LVC D;  2HQW A;  1LKJ A;  1NX0 A;  5CSN A;  4AQJ A;  3NSO A;  5K89 A;  3LLE A;  1EH2 A;  1ODB A;  2I7A A;  1UP5 A;  2BCX A;  1KWO B;  1WLM A;  5HKY A;  3ICB A;  3TDU A;  1PSR A;  2CCM A;  1BOC A;  2KBM A;  2KYF A;  5HLO A;  1CDP A;  2H61 A;  1SL8 A;  1OMR A;  1MF8 B;  3EKJ A;  1V1F A;  3O4Y A;  1BF5 A;  2AAO A;  2K7B A;  2CTN A;  1JUO A;  5IBW A;  1K2H A;  4I5L B;  1FBV A;  1AHR A;  2BCB A;  3FIA A;  4JQ0 D;  2K0J A;  1KQM C;  1LA3 A;  3EK4 A;  5BPJ A;  2PAL A;  2JXL A;  4XYN A;  1OZS A;  2DOQ A;  1SR6 B;  2L4I A;  3SG4 A;  3TUY B;  1RJV A;  2K7D A;  2KBI A;  1A75 A;  2P6B B;  3OP0 A;  4R1E A;  1Y1X A;  5AXI A;  2M7N A;  1BG1 A;  1SMG A;  1ZFS A;  1KK8 B;  2ZKM X;  2Y1N A;  5HYD A;  5PAL A;  2LE9 B;  5AFP A;  1F55 A;  2KFF A;  4QJ3 B;  1UHI A;  2F2P A;  2M3W A;  3BUX B;  1MXL C;  1B7T Y;  1ZMZ A;  3BOW A;  1UUR A;  2LMV A;  1YRU B;  3I5F B;  4DUQ A;  5I2O A;  4PE1 A;  2JTZ A;  1JSA A;  1XFY O;  1BJF A;  2L2E A;  1QV1 A;  2LAN A;  1JC2 A;  2KOT A;  1IQ5 A;  1G4Y R;  4I5J A;  1DGV A;  3BYA A;  1NX3 A;  2EC6 C;  2LVI A;  3FWB A;  3WHU B;  2WND A;  1YUS A;  3KPX A;  5AEQ A;  1B4C A;  4MSP A;  5I2L A;  1J7O A;  2GGM A;  3EKH A;  4AOM A;  5AER A;  3GK4 X;  5D69 A;  1AP4 A;  1NCX A;  2E30 A;  2LLS A;  4WQ2 A;  4HRH A;  1W7I B;  3D0Y A;  4AQI A;  1DTL A;  1CKK A;  1DJY A;  1RFJ A;  1YUU A;  1K8U A;  1QLK A;  2BL0 B;  1LA0 A;  1TCF A;  4L9M A;  4JWQ A;  3BUM B;  1DVI A;  4IL1 A;  1DF0 B;  2TN4 A;  4MEW A;  1PVB A;  4PE0 A;  5JJG A;  1J7Q A;  2E6W A;  4PHK A;  3SG6 A;  4CLN A;  1XYD A;  3CS1 A;  4HRG A;  2JXC A;  4OCI A;  2L5X B;  2JOJ A;  3HX4 A;  4YGE B;  1XO5 A;  3A4U B;  4N1F A;  1TNW A;  2KYC A;  3I5G B;  4Q04 A;  2PRU A;  2QPT A;  4ORC B;  3K21 A;  1SW8 A;  4MRX A;  3CTN A;  1EL4 A;  1KK7 Z;  3CLN A;  3DF0 A;  1LXF C;  4CFR A;  4DCK A;  1YVH A;  1K9P A;  4C0J A;  2K2F A;  3VGO A;  5HLV A;  5J3X A;  1IH0 A;  2LMT A;  1KFX S;  1QVI Z;  2NZ0 A;  1ALW A;  2KAY A;  1CFF A;  3VRR A;  3EVU A;  1L2O C;  3RM1 A;  3DVJ A;  1A75 B;  1UHK A;  4YI8 A;  4C0L A;  1BT6 A;  2GV5 A;  3BQ3 A;  3DVK A;  3MSE B;  2LM5 A;  2PSR A;  1D1O A;  1J55 A;  1ZAC A;  4ORA B;  1EG4 A;  4GGF C;  1DT7 B;  5CSI A;  2JT3 A;  1G33 A;  4N1G A;  3VRO A;  5FYX A;  3SG7 A;  2H2K A;  4D1E A;  1S1E A;  2JNX A;  1XA5 A;  1EG3 A;  2L50 A;  1HQV A;  3BOW B;  2KDH A;  2OPO A;  3CR5 X;  1MHO A;  2LLT A;  4I5K A;  1H4B A;  2EGD A;  4N5X A;  1A29 A;  2LC5 A;  2O60 A;  1G8I A;  3TDZ A;  2JU0 A;  1OE9 B;  1B9A A;  1S6J A;  4XJK A;  1KSO A;  3PFV A;  4NDB A;  2AUC A;  1XVJ A;  4FQO A;  4WRI A;  4MZL A;  3TDI A;  1IKU A;  2OS8 B;  1WDC B;  4NDC A;  1FI5 A;  3D0Y B;  3GOF A;  1SYM A;  1DJH A;  1QX5 B;  1FPW A;  2BE4 A;  2FCD A;  4MN0 A;  4UPG A;  2RGI A;  4CFQ A;  1PK0 D;  2CT9 A;  4MBE A;  3EVV A;  2KI6 D;  1BU3 A;  1Y1U A;  4DRW A;  1UHJ A;  1YX7 A;  1REC A;  1A4P A;  1HT9 A;  1TIZ A;  2F8P A;  1EXR A;  1B7T Z;  2K7O A;  4M2Q A;  2MHH A;  2M29 A;  1IG5 A;  1XK4 C;  2V53 A;  2WOR A;  3AAK A;  3DD4 A;  4YGB B;  1ZOT B;  1WRL A;  2LUX A;  1B47 A;  3OB2 B;  5G08 A;  3BXK A;  1BLQ A;  1U5I A;  5CSJ A;  3EK7 A;  1X02 A;  2JNF A;  3JTD B;  1QAT A;  2Q4U A;  3WNX B;  1S5G Y;  2MAZ A;  1KWO C;  2LVJ A;  3PLF B;  2WCE A;  1K94 A;  1F8H A;  1DGU A;  2Y4Q A;  4JPZ B;  1OMD A;  2BBM A;  2KHN A;  2NCP A;  2LMU A;  3LCP C;  4PDZ A;  3DF0 B;  4P5O E;  1L7Z A;  1DJZ A;  1KFX L;  4GGF A;  1QIW A;  2HQ8 A;  1F4O A;  1NX2 A;  1MR8 A;  1CMF A;  1AVS A;  2LP2 A;  2MLE C;  1JBA A;  2ZND A;  3WHT B;  2JUL A;  1YUR A;  3TUY C;  4NDD A;  5DKQ A;  1XFW O;  1N65 A;  3PAL A;  1NPQ A;  4NQG A;  3CZT X;  1KK8 C;  1NYA A;  2KI6 C;  2LCP A;  1F70 A;  1FI6 A;  3BUO B;  4BY4 A;  1PVA A;  1C7W A;  1PUL A;  3PSR A;  2KFH A;  2MBX A;  4ICB A;  2F3Z A;  4HRE E;  2D8N A;  1JF0 A;  2EHB A;  1SL7 A;  3BUN B;  1F54 A;  1YUT A;  3AKB A;  3I5F C;  5I8N A;  2COL B;  2HPS A;  3PN7 B;  3CR2 A;  1TNP A;  1IQ3 A;  4GGN A;  2K61 A;  1B8L A;  3WXA A;  4XJK B;  3PAT A;  1CFC A;  5AAN A;  1NIW A;  2WC8 A;  1S36 A;  1WLZ A;  1TRF A;  1MXE A;  1CLL A;  2JT8 A;  2LP3 A;  5CSF A;  4ETO A;  1XK4 A;  2ZFD A;  1MQ1 A;  2PVB A;  3SIB A;  2KQ6 A;  1OZO A;  3LK0 A;  1UHN A;  1F71 A;  4BY5 A;  1PRW A;  3QRX A;  4ZCV A;  1AJ5 A;  1NP8 A;  1DJI A;  2BL0 C;  3O6B A;  1M63 B;  1TNX A;  1XFU O;  1UHH A;  4OR9 B;  4OVN F;  4TNC A;  2KAX A;  2OTG B;  1CFP A;  2FOT A;  1M31 A;  1V1G A;  2MJW B;  3VRQ A;  2Y1M A;  1OOJ A;  1FW4 A;  1MWN A;  1U5I B;  2BEC A;  2O5G A;  3JVT C;  3FS7 A;  5JOL A;  3A8R A;  1J1D A;  3M0W A;  1SBJ A;  2ISD A;  2L0P A;  1SCV A;  1A2X A;  3EK8 A;  5ER5 A;  3H4S E;  3I5G C;  2LLU A;  1SK6 D;  4YI9 A;  4PHN A;  1CLB A;  2ZRT A;  1CTR A;  1TTX A;  2G9B A;  2LV7 A;  2CXJ A;  3TS5 B;  2KI4 B;  2JC2 A;  2KGB C;  4PE4 A;  1SCM C;  3I5I B;  1CLM A;  3PM8 A;  2LVV A;  2KGR A;  2M49 B;  5KU1 A;  1QX2 A;  1YVL A;  4PHM A;  1QIV A;  1M46 A;  1K95 A;  2GGZ A;  4GNK B;  2M8U A;  1AJ4 A;  1NWD A;  1MUX A;  3NSL A;  2SAS A;  4YBH B;  4OV2 A;  1QJT A;  3IQO A;  3CWG A;  1XFV O;  5ER4 X;  1CMG A;  1YX8 A;  5F6T A;  1BR4 B;  1W7J B;  4DS7 A;  1QXP A;  1NUB A;  1YTZ C;  3I5H B;  3SG5 A;  1Y6W A;  1B8C A;  1KQV A;  1CM4 A;  4GFT A;  4USL A;  1SRA A;  5KTY A;  4QJ5 B;  1RTP 1;  2KSP A;  3RLZ A;  1QV0 A;  2M97 A;  1Y0V H;  3E3R A;  2JPT A;  1QS7 A;  2WCB A;  2ZN9 A;  1GQM A;  2CBL A;  4M2O A;  4MRY A;  3OHM B;  1IWQ A;  2I94 A;  4MLW A;  4YGD B;  3C1V A;  1CNP A;  5DKR A;  1LIN A;  2FJU B;  2OS8 C;  1WDC C;  4MZJ A;  1KQM B;  1WRZ A;  1C07 A;  1DJX A;  2I18 A;  5HKW A;  2MA2 A;  3OX6 A;  1GJY A;  3IQQ A;  1AK8 A;  2BKH B;  4GAO A;  1GGW A;  1VRK A;  4E68 A;  1JFJ A;  4DIR A;  1BR1 B;  2JWW A;  2A4J A;  1TN4 A;  2SCP A;  3DVM A;  1RRO A;  2PAS A;  4FTG A;  1K96 A;  2K7C A;  1SPY A;  2LVK A;  1FF1 A;  2I2R E;  1PAL A;  3ZNI A;  4WQ3 A;  3GK2 A;  1M39 A;  1UUS A;  1SY9 A;  3JTD C;  1K90 D;  2JZI A;  1SKT A;  1SR6 C;  1NX1 A;  1R6P A;  2FCE A;  1S3P A;  1QLS A;  1IRJ A;  1M45 A;  1DMO A;  2EC6 B;  2G2B A;  2AMI A;  2NCO A;  1J1E A;  3VRN A;  1C7V A;  1CM1 A;  2PMY A;  2JT0 A;  1KCY A;  1R2U A;  2NXQ A;  1Q80 A;  4YGA A;  3NSK A;  1KFU L;  1OQP A;  3FWC A;  3GK1 A;  2M1K B;  5CPV A;  5TNC A;  2ZN8 A;  3ZWH A;  2B1U A;  1DJW A;  2Y5I A;  4ORB B;  4M2P A;  3CGA A;  1K9U A;  1CDM A;  4QJ4 B;  1EJ3 A;  4A4B A;  1CB1 A;  3KF9 A;  2HET A;  1GGZ A;  2K2A A;  1S6C A;  2M7L A;  1F4Q A;  1YR5 A;  2CNP A;  4CPV A;  2WCF A;  2BCA A;  4C0K A;  1BMO A;  1WRK A;  1B1G A;  2JRF A;  3OB1 B;  3D10 A;  2KNE A;  5HKZ A;  2Q91 A;  3OX5 A;  1TCO B;  2KQY A;  1SNL A;  1TNQ A;  3PN7 C;  1NSH A;  4PCW A;  3O78 A;  3SJS A;  2LNK A;  4PHJ A;  1BOD A;  1KSM A;  1NCZ A;  2M9G A;  1QTX A;  2L98 A;  1JFK A;  1N2D A;  4YRU A;  1K93 D;  2QAC A;  2JTT A;  3KHE A;  1DJG A;  1ALV A;  1J7R A;  2BE6 A;  2LAP A;  3NSI A;  3CR4 X;  3JVT B;  2LHL A;  4P2Y B;  1CDL A;  1L2O B;  2ZNE A;  1RK9 A;  1PSB A;  2H61 C;  5B8I B;  1IJ6 A;  1E8A A;  5KSZ A;  2WOS A;  3EVR A;  1N0Y A;  4PE7 A;  4OKH A;  2JQ6 A;  1UWO A;  1K9K A;  5I2Q A;  3VRP A;  2OTG C;  1TOP A;  2KAV A;  1QX7 A;  2BKI B;  5GQQ C;  2L51 A;  3NXA A;  1SCM B;  2ZRS A;  2R2I A;  2F2O A;  2LHI A;  1XFX O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...