1XFYO

Crystal structure of anthrax edema factor (ef) in complex with calmodulin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
146
structure length
146
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDQMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/metal binding protein
molecule keywords Calmodulin-sensitive adenylate cyclase
publication title Calcium-independent calmodulin binding and two-metal-ion catalytic mechanism of anthrax edema factor.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 34
structure length 146
sequence length 146
chains with identical sequence P, Q, R, S, T
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfyO02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfyO01
4PHMA 1UUSA 5CSJA 1QIVA 1B8LA 3RM1A 1SPYA 2PALA 1J7QA 1OQPA 1N2DA 3I5GB 1K94A 1EL4A 1QLKA 2F2OA 1IJ5A 2LUCA 3OX6A 2K7BA 3BYAA 4MRXA 2BBMA 1F71A 1WLMA 4QJ3B 5KSZA 2MHHA 2BECA 3DVEA 5AEQA 3EVUA 1WRLA 2Y1MA 2M97A 3CWGA 2H61C 1WY9A 1YRTB 3PFVA 4L9MA 3OP0A 2ZN9A 1UURA 4QJ5B 1KQVA 2HETA 1KWOC 1BF5A 5AANA 3TS5C 3DVKA 1RFJA 4N5XA 1F70A 1KSOA 2LNKA 2HF5A 4OVNF 1IG5A 5I2QA 1SKTA 3PALA 4DUQA 2KI6C 4NDDA 1BODA 3SG2A 1QASA 1BR1B 1UWOA 1IKUA 1LA0A 1RTP1 1J7RA 1K9KA 1NX3A 1U5IB 2K8MB 2LMTA 2LUXA 2LLUA 1IQ3A 2LAPA 1YTZC 1UHJA 4MLWA 2COLB 2FJUB 1J7PA 2M7NA 4N1GA 1H4BA 2MJWB 3IQOA 3FIAA 3VRNA 5J3XA 3GK1A 4PDZA 2ZRTA 1YRUB 5AFPA 1PULA 2Q91A 2AUCA 2TN4A 1OZOA 2NCOA 5K89A 3BUXB 4ICBA 4ORCB 3LL8B 2KFFA 1AJ5A 4GBAA 1KQMB 1TRFA 1QX5B 4DCKA 2WORA 1DGUA 2ZFDA 1IGVA 4M2QA 1KWOB 4HREE 3JVTC 4YI8A 5B8IB 4PE4A 5HLOA 1KK8B 1CDNA 2I7AA 4FTGA 2M9GA 3VGOA 2FOTA 1RWYA 2KFHA 2KGBC 4M2PA 4XJKA 4WRIA 1FI5A 1QX7A 2KQ6A 2BCBA 1DJIA 1A2XA 1NYAA 1B7TY 3O2PA 3BQ3A 2OPOA 2L4IA 2NXQA 2KAVA 3JTDC 4JPZB 3BXKA 2KHNA 2RGIA 1B1GA 2JOJA 1CDLA 5AXIA 4I5LB 5HLVA 1DTLA 3PSRA 2PRUA 4HRGA 4YBHB 2JU0A 3TDIA 3GK2A 1SL7A 2L2EA 1MHOA 1QV1A 2L51A 3KEVA 1YUSA 4YGCB 3SG4A 2JC2A 1SL9A 1DJZA 2CT9A 4GAOA 4MN0A 3VROA 2F3ZA 1CTRA 2EGDA 1CLBA 1PRWA 2LHIA 4WQ2A 3DF0B 1A75A 1BMOA 1Q80A 3FS7A 4WQ3A 4ZCVA 2I2RE 2JXCA 5DKNA 5DKQA 5AERA 1AK8A 1F55A 4DS7A 1DMOA 1IH0A 1ZUZA 3JVTB 3IQQA 1BJFA 2ZNEA 1TNWA 1SRAA 1R6PA 3NSOA 1RROA 3AAKA 1NCYA 4R1EA 1DF0B 2PASA 1FW4A 3O6BA 2Q4UA 1SCMC 3OB1B 2L50A 1ALWA 1LXFC 1M46A 1DJXA 2LLSA 1LA3A 2PMYA 1S26D 4YGEB 5IBWA 3OB2B 1RJVA 3PLFB 2GGMA 4OKHA 2AAOA 3GOFA 3I5HC 4OV2A 5CSNA 2JPTA 3OX5A 2NZ0A 3I5FC 1Y1UA 3JTDB 1CKKA 2BE4A 3TZ1A 2KSPA 2E30A 1M45A 3KHEA 3GK4X 4IL1A 1IJ6A 2FCDA 2PVBA 3DVMA 4OR9B 1NX2A 2LV7A 4GFTA 1M63B 1K9UA 2NLNA 2KQYA 1WDCC 1WRZA 1JF2A 1B7TZ 1NCZA 2R2IA 5JOLA 4MRYA 2BCXA 1K90D 1Y6WA 2KNEA 3KF9A 3ZNIA 3PN7C 3A4UB 1GGWA 4CPVA 3EKJA 1LKJA 3K21A 1XFWO 2KGRA 4CLNA 4TNCA 1J7OA 4USLA 4YGDB 2KBIA 2KDHA 1S36A 1NX1A 1QJTA 2BL0C 3EK8A 2KI4B 4HSZA 2MAZA 4AOMA 2DOQA 2HPSA 4MZJA 2JZIA 1ZFSA 4ORBB 4CIDA 2ZNDA 5HKZA 1KCYA 2EC6B 1XK4A 1L7ZA 3I5HB 4BY4A 4PE1A 1YR5A 5HKYA 5HYDA 2QACA 2VRGA 3DD4A 5G08A 1L2OB 1QS7A 4NQGA 2LCPA 2K61A 2OTGC 1B9AA 2M49B 1NCXA 2E6WA 1V1GA 1XFXO 2KYCA 2OS8B 4GGNA 1K93D 1N0YA 4ETOA 1BR4B 3EK7A 1Y0VH 3BUMB 1BOCA 4CFRA 3WHTB 1C07A 4DIRA 3PN7B 3A8RA 3AKAA 3DVJA 1WLZA 5I8NA 2JWWA 1LVCD 4I5NB 1U5IA 2L5XB 1DVIA 1DJHA 1YX7A 3I5IC 5I2LA 4GGFC 1MR8A 3EVVA 1MWNA 1JF0A 3BOWB 2QPTA 2BL0B 2PSRA 1S6IA 2BKHB 2Y4QA 1B47A 1KK7Y 3D0YB 2MA2A 2G9BA 2KOTA 3EKHA 1S1EA 2IS9A 1PALA 2F8PA 2M1UA 4C0LA 1BU3A 3HCMA 1F4OA 1QTXA 3TS5B 1SNLA 2M3WA 2H61A 4PALA 3TUYC 1S6CA 3EK4A 1F4QA 2WCEA 4GPLB 2AMIA 4MEWA 1JC2A 2OTGB 1QV0A 3WNXB 2LM5A 2MRDA 3QRXA 1IWQA 3AKBA 1EJ3A 1SY9A 4I5KA 3AAJA 1MXLC 1DT7B 3BUNB 2K2AA 3KPXA 2CBLA 1QIWA 4NDCA 1MXEA 1XA5A 2ZN8A 2WC8A 4YI9A 1XYDA 1F54A 3FWBA 2KI6D 1N65A 1W7IB 2O5GA 4U8DA 3WXAA 3I5IB 1CDPA 4PHNA 3SIAA 4GUKA 1XO5A 3CS1A 3ICBA 1PSRA 2LLTA 3D10A 1XFYO 2JT0A 4YGAA 3PM8A 1C7WA 3BUOB 2K7DA 1CM4A 2WNDA 5GQQC 4PE0A 4YRUA 2WOSA 3SG7A 1Y1AA 3WHUB 1EXRA 1YUTA 2LP3A 1CFFA 1IRJA 2M0RA 3LLEA 2LANA 4E68A 1ZOTB 3DF0A 3FWCA 1SCVA 5I2OA 1KK7Z 1NSHA 1XFVO 1CNPA 1CB1A 2LVJA 3HX4A 2P6BB 4FQOA 1DF0A 4N1FA 2BE6A 1BT6A 2JTZA 4MZLA 4MVFA 1W7JB 4P5OE 2BBNA 2D8NA 1CFDA 1CDMA 5TNCA 5KTYA 2JTTA 3I5GC 1CLMA 2K2FA 1K2HA 1RK9A 1QVIY 1UHKA 1DJWA 1MQ1A 1JSAA 2A4JA 5KU1A 1YUUA 1JFJA 1CMFA 3CR2A 4CFQA 1S5GY 1H8BA 1V1FA 1Y1XA 4XYNA 1DGVA 2GGZA 3SG3A 2JULA 2LP2A 2SCPA 4D1EA 3H4SE 3EVRA 2WCFA 2L0PA 1KFXL 1RECA 1J1EA 3O4YA 3NSLA 3LCPC 2O60A 4BY5A 5DKRA 4HRHA 1X02A 2MLFC 1YVLA 4PCWA 4C0KA 1AHRA 1SCMB 1XFZO 5CSIA 3MSEB 1K96A 1NPQA 3CR5X 2CNPA 2Y5IA 4DRWA 3CTNA 1KSMA 2K0JA 2M7LA 1TTXA 4GNKB 1NUBA 2JT3A 1KFXS 3PATA 3LK1A 3I5FB 5HKWA 2GV5A 1JFKA 4UPGA 1UHIA 3ZWHA 2LE9B 1YVHA 1SK6D 3KO0A 2CXJA 5JJGA 2LMUA 1SYMA 1A4PA 1HT9A 1ZACA 2NCPA 4ZCUA 4A4CA 1G33A 1WDCB 1C7VA 1B8RA 1TIZA 2G2BA 1M39A 2M1KB 2MLEC 5FYXA 3M0WA 1A03A 2LHLA 1TNXA 1KQMC 1QXPA 1QVIZ 1R2UA 2KBMA 1TCFA 3CR4X 3O78A 2K7OA 1MUXA 1VRKA 1YURA 5ER4X 1S5GZ 1B4CA 1K95A 1J55A 1QLSA 1G4YR 1G8IA 1HQVA 1KK8C 1MF8B 3IF7A 4MBEA 4ORAB 1J1DA 3NSKA 2H2KA 2KFGA 3LK0A 1S6JA 1SR6C 1OZSA 1SL8A 1DJYA 1LINA 2L98A 1GGZA 2JNFA 1PK0D 3CGAA 2JRFA 1FBVA 2V53A 1BLQA 2JQ6A 3BOWA 1D1OA 1UHNA 3BUWB 3VRPA 1JUOA 1JWDA 2LMVA 3D0YA 1K9PA 2ISDA 3CZTX 2I94A 4YGBB 1OOJA 2L4HA 2KAYA 2HQWA 3RLZA 1AP4A 1NP8A 1XVJA 4MZKA 1QATA 1SMGA 2M8UA 1CLLA 1AUIB 1PVBA 1F8HA 3SG6A 1KFUL 1FI6A 2F3YA 5ER5A 3SIBA 1CMGA 1QX2A 4OCIA 1NIWA 4XJKB 3OHMB 3TDUA 1OMRA 1OMDA 2FCEA 2F2PA 1EG4A 1S3PA 1GJYA 2LVVA 3VRRA 5D7FA 1SR6B 1KFUS 4C0JA 5PALA 4QJ4B 2JT8A 1TNPA 2HQ8A 4GGFA 1TOPA 3VRQA 3F45A 1AJ4A 4PHKA 1FPWA 2EHBA 3TDZA 1NX0A 2CCMA 1A29A 2I18A 2M29A 1AVSA 2K7CA 3TUYB 1CM1A 2JNXA 2ZRSA 2JXLA 2CTNA 2LC5A 2LVIA 1A75B 1OE9B 4PHJA 3E3RA 1DJGA 1ODBA 1EG3A 1ALVA 2ZKMX 2LVKA 4A4BA 2BKIB 4Q04A 2Y1NA 4I5JA 3CLNA 4NDBA 4JWQA 2WCBA 4AQJA 1PVAA 2MBXA 1FF1A 2B1UA 4F0ZB 1XFUO 4PE7A 1XK4C 2KI4C 1TN4A 3C1VA 2KYFA 1ZMZA 1SW8A 1OMVA 1TCOB 2F33A 5BPJA 4AQIA 1SBJA 1CFPA 2EC6C 2SASA 1IQ5A 1TNQA 4P2YB 5CPVA 5CSFA 1OSAA 1WRKA 1NWDA 2BCAA 3NXAA 5D69A 5F6TA 1YX8A 3SJSA 1GQMA 3NSIA 1L2OC 3SG5A 1BG1A 4M2OA 1EH2A 1B8CA 1M31A 1UP5A 1PSBA 1E8AA 1K8UA 1UHHA 2OS8C 2KAXA 4MSPA 1CFCA 4JQ0D 1JBAA
chains in the Genus database with same CATH superfamily
4PHMA 1UUSA 5CSJA 1QIVA 1B8LA 3RM1A 1SPYA 2PALA 1J7QA 1OQPA 1N2DA 3I5GB 1K94A 3SS5A 1EL4A 1QLKA 2F2OA 3QMEA 1IJ5A 2LUCA 3OX6A 2K7BA 3BYAA 4MRXA 2BBMA 1F71A 1WLMA 4QJ3B 5KSZA 2MHHA 2BECA 3DVEA 5AEQA 3EVUA 1WRLA 2Y1MA 2M97A 3CWGA 2H61C 1WY9A 1YRTB 3PFVA 4L9MA 1OOGA 3OP0A 2ZN9A 1UURA 3FE8A 4QJ5B 1KQVA 2HETA 3B7AA 1KWOC 1BF5A 3S0DA 5AANA 3D75A 5HL1A 3TS5C 3DVKA 1RFJA 4N5XA 1F70A 1KSOA 2LNKA 2HF5A 4OVNF 1IG5A 1C3YA 5I2QA 1SKTA 3PALA 4DUQA 2KI6C 4NDDA 1BODA 3SG2A 1QASA 1BR1B 1UWOA 1IKUA 1LA0A 1RTP1 1J7RA 1K9KA 2QEBA 1NX3A 1U5IB 2K8MB 2LMTA 2LUXA 2LLUA 1IQ3A 2LAPA 1YTZC 1UHJA 4MLWA 2COLB 2FJUB 1J7PA 2M7NA 4N1GA 1H4BA 3SS3A 2MJWB 3IQOA 3FIAA 3VRNA 5J3XA 3GK1A 3VB1A 4PDZA 3DXLA 2ZRTA 3SS4A 1YRUB 3O4XA 5AFPA 1PULA 2Q91A 2AUCA 4FQTA 2TN4A 1OZOA 2NCOA 5K89A 3BUXB 4ICBA 4ORCB 3LL8B 2KFFA 3EG5B 1AJ5A 4GBAA 1KQMB 1TRFA 1QX5B 4DCKA 2WORA 1DGUA 2ZFDA 1IGVA 4M2QA 3S0EA 1KWOB 4HREE 5FI2A 3FE6A 3JVTC 4YI8A 5B8IB 4PE4A 5HLOA 1KK8B 1CDNA 2I7AA 4FTGA 2M9GA 3VGOA 2FOTA 1RWYA 1TUJA 2KFHA 2KGBC 4M2PA 4XJKA 4WRIA 2WC6A 2QEHA 1FI5A 1QX7A 2KQ6A 5FI7A 3S0BA 2BCBA 1DJIA 1A2XA 3CDNA 1NYAA 1B7TY 1IIOA 3O2PA 3BQ3A 2OPOA 2L4IA 2NXQA 2KAVA 3JTDC 4JPZB 3BXKA 2KHNA 5DICA 2RGIA 1B1GA 2JOJA 1CDLA 2QDIA 4I5LB 5AXIA 5HLVA 1DTLA 3PSRA 2PRUA 4HRGA 4YBHB 2JU0A 3TDIA 3GK2A 1SL7A 2K60A 2L2EA 1MHOA 1QV1A 2L51A 3KEVA 1YUSA 1QWVA 4YGCB 3SG4A 2JC2A 1SL9A 1DJZA 2CT9A 4GAOA 4MN0A 3VROA 2F3ZA 1CTRA 2EGDA 1CLBA 1PRWA 2LHIA 4WQ2A 3DF0B 1A75A 1BMOA 1Q80A 3FS7A 4WQ3A 4ZCVA 2I2RE 2JXCA 5DKNA 5DKQA 5AERA 1AK8A 1F55A 4DS7A 1DMOA 1IH0A 1ORGA 1ZUZA 3NGVA 3JVTB 3IQQA 1BJFA 2ZNEA 1TNWA 1SRAA 1R6PA 3NSOA 1RROA 3AAKA 1NCYA 4R1EA 1DF0B 2PASA 1T14A 1FW4A 3O6BA 2Q4UA 1SCMC 3OB1B 2L50A 1ALWA 1LXFC 1M46A 1DJXA 2LLSA 1LA3A 2PMYA 1S26D 4YGEB 5IBWA 3OB2B 1RJVA 3PLFB 2GGMA 4OKHA 2AAOA 3GOFA 3I5HC 4OV2A 4JKTA 5CSNA 2JPTA 3OX5A 2NZ0A 3I5FC 1Y1UA 3JTDB 1CKKA 2BE4A 3TZ1A 2KSPA 2E30A 1M45A 3KHEA 3GK4X 4IL1A 1IJ6A 2FCDA 2PVBA 3DVMA 4OR9B 1NX2A 1C3ZA 2LV7A 4GFTA 1M63B 3NHIA 1K9UA 2NLNA 5EL2A 2KQYA 1WDCC 1WRZA 1JF2A 1B7TZ 1NCZA 2R2IA 5JOLA 4MRYA 2BCXA 1K90D 1Y6WA 2KNEA 3KF9A 3ZNIA 2WCMA 3PN7C 3A4UB 1GGWA 4CPVA 1OOHA 3EKJA 1LKJA 3K21A 3FE9A 1XFWO 3IVTA 2KGRA 4CLNA 4TNCA 1J7OA 3DZTA 4USLA 4YGDB 2KBIA 2KDHA 1S36A 2L2CA 1NX1A 1QJTA 2BL0C 3EK8A 2KI4B 4HSZA 3L4LA 2MAZA 4AOMA 2DOQA 2HPSA 1TUZA 4MZJA 2JZIA 1ZFSA 4ORBB 4CIDA 2ZNDA 3CZ1A 2YGUA 5HKZA 1KCYA 2EC6B 2QEVA 1XK4A 1L7ZA 3I5HB 4BY4A 4PE1A 1YR5A 5HKYA 5HYDA 2QACA 2VRGA 3B87A 3DD4A 3S0FA 5G08A 1L2OB 2WCJA 1QS7A 4NQGA 2LCPA 2K61A 2OTGC 1B9AA 2BAPA 2M49B 1NCXA 1Z2CB 1V1GA 1XFXO 2E6WA 2KYCA 2OS8B 3OGNA 1K93D 1N0YA 2WC5A 1BR4B 4GGNA 4ETOA 1DC1A 3EK7A 1Y0VH 3BUMB 1BOCA 4CFRA 3WHTB 1C07A 4DIRA 3PN7B 3A8RA 3BJHA 3AKAA 3DVJA 1WLZA 5I8NA 2JWWA 1LVCD 4I5NB 3D78A 1U5IA 2L5XB 1DVIA 1DJHA 1YX7A 2KLEA 3I5IC 5I2LA 4GGFC 1MR8A 3EVVA 1MWNA 1JF0A 3BOWB 2QPTA 2BL0B 5I94A 2PSRA 1S6IA 2BKHB 2Y4QA 1B47A 1KK7Y 3D0YB 2MA2A 2G9BA 2KOTA 4F7FA 3EKHA 1S1EA 2IS9A 1PALA 2F8PA 2M1UA 4C0LA 1BU3A 3HCMA 3CYZA 1F4OA 1QTXA 2P71A 2BNXA 3D76A 3TS5B 2KPHA 3BFAA 1SNLA 2M3WA 2H61A 4PALA 3TUYC 1S6CA 3EK4A 1F4QA 2WCEA 4GPLB 2AMIA 4MEWA 1JC2A 2OTGB 1QV0A 3WNXB 2LM5A 2MRDA 3QRXA 1IWQA 3AKBA 1EJ3A 1DEKA 1SY9A 4I5KA 3AAJA 1MXLC 1DT7B 3BUNB 2K2AA 3KPXA 2CBLA 1QIWA 4NDCA 1MXEA 1XA5A 2ZN8A 2WC8A 4YI9A 1XYDA 1F54A 3FWBA 2KI6D 1N65A 1W7IB 2O5GA 4U8DA 3WXAA 3I5IB 1CDPA 4PHNA 3SIAA 3BFBA 4GUKA 1XO5A 3CS1A 3ICBA 1PSRA 2LLTA 3B6XA 1LS8A 1XFYO 3D10A 3R1OA 2JT0A 3S0GA 4YGAA 3PM8A 1C7WA 3BUOB 2K7DA 1CM4A 2WNDA 5GQQC 1SSEB 4PE0A 4YRUA 2WOSA 3SG7A 1Y1AA 1GM0A 3WHUB 1EXRA 1YUTA 2LP3A 1CFFA 1IRJA 1DQEA 2M0RA 3LLEA 2PYQA 2LANA 4E68A 1ZOTB 3DF0A 3FWCA 1SCVA 5I2OA 1KK7Z 1NSHA 1XFVO 3CZ2A 1CNPA 1CB1A 2LVJA 3HX4A 2P6BB 4FQOA 1DF0A 4N1FA 2BE6A 3DYEA 1BT6A 2JTZA 4MZLA 4MVFA 1W7JB 3UNWA 4P5OE 2BBNA 2D8NA 1CFDA 1CDMA 5TNCA 5KTYA 2JTTA 3I5GC 3RZSA 1CLMA 2K2FA 1K2HA 1RK9A 1QVIY 1UHKA 1DJWA 1MQ1A 1JSAA 2A4JA 5KU1A 1YUUA 1JFJA 1CMFA 3CR2A 4CFQA 1S5GY 1H8BA 2H8VA 1V1FA 1Y1XA 3S0AA 4XYNA 1DGVA 2GGZA 3SG3A 2JULA 2LP2A 2SCPA 4D1EA 3H4SE 3EVRA 2WCFA 2WCKA 3K1EA 3R1VA 2L0PA 2FJYA 1KFXL 2PQLA 1RECA 1J1EA 3O4YA 3NSLA 3LCPC 3R1PA 2O60A 4BY5A 5DKRA 4HRHA 1X02A 2MLFC 1YVLA 4PCWA 4C0KA 1AHRA 1SCMB 1XFZO 5CSIA 3MSEB 1K96A 1NPQA 3CR5X 3OBVA 2CNPA 2Y5IA 2GTEA 4DRWA 3CTNA 1KSMA 2K0JA 4OZDA 2M7LA 1TTXA 4GNKB 1NUBA 2JT3A 1KFXS 3PATA 3LK1A 3I5FB 1OW4A 5HKWA 2GV5A 3D77A 1JFKA 3Q8IA 1UHIA 4UPGA 3ZWHA 2LE9B 1YVHA 1SK6D 3KO0A 2CXJA 5JJGA 2LMUA 3B88A 1SYMA 1A4PA 1HT9A 1ZACA 2NCPA 4ZCUA 4A4CA 1G33A 1WDCB 1C7VA 1B8RA 1TIZA 2G2BA 1M39A 2M1KB 2MLEC 5FYXA 3M0WA 1A03A 2LHLA 1TNXA 1KQMC 1QXPA 1QVIZ 1R2UA 2KBMA 1TCFA 3CR4X 3CZ0A 3O78A 2K7OA 1MUXA 1VRKA 1YURA 5ER4X 1S5GZ 1B4CA 1K95A 1J55A 1QLSA 1G4YR 1G8IA 1HQVA 1KK8C 4INXA 1MF8B 3IF7A 4MBEA 1DELA 3CABA 4ORAB 1J1DA 3NSKA 2H2KA 2KFGA 1XFRA 3LK0A 1S6JA 1SR6C 1OZSA 1SL8A 1DJYA 1LINA 2L98A 1GGZA 2QEOA 2JNFA 2KLDA 4JD9A 1PK0D 3CGAA 2JRFA 1FBVA 2V53A 1BLQA 2JQ6A 3BOWA 1D1OA 5D3OA 1UHNA 3BUWB 3L47A 3VRPA 1JUOA 1JWDA 2LMVA 3D0YA 1K9PA 2ISDA 3CZTX 2I94A 4YGBB 1OOJA 2L4HA 2KAYA 2HQWA 3RLZA 1AP4A 1TWOA 1NP8A 1XVJA 4MZKA 1QATA 4INWA 1SMGA 5FI6A 2M8UA 1CLLA 1AUIB 1PVBA 1F8HA 3SG6A 1KFUL 1OOFA 1FI6A 2F3YA 5ER5A 3SIBA 3NHTA 1CMGA 1QX2A 4OCIA 1NIWA 4XJKB 3OHMB 3TDUA 1OMRA 3D73A 1OMDA 2FCEA 3N7HA 3BFHA 2F2PA 1EG4A 1S3PA 2P70A 1GJYA 2LVVA 4PT1A 3VRRA 5D7FA 1SR6B 1KFUS 4C0JA 5PALA 4QJ4B 3R72A 2JT8A 1TNPA 1W9ZA 2HQ8A 4GGFA 1TOPA 3VRQA 3F45A 1AJ4A 4PHKA 1FPWA 2EHBA 3TDZA 2ERBA 1NX0A 2CCMA 1A29A 2I18A 2M29A 1AVSA 2K7CA 2WCLA 3TUYB 1CM1A 3L4AA 2JNXA 3V2LA 2ZRSA 2JXLA 2CTNA 2LC5A 2LVIA 3PJIA 1A75B 1OE9B 4PHJA 3D74A 3E3RA 1DJGA 1Z4HA 2L5YA 1ODBA 1EG3A 1ALVA 2ZKMX 2LVKA 4A4BA 1P28A 2BKIB 4Q04A 2Y1NA 4I5JA 2JPOA 3CLNA 4JWQA 4NDBA 2WCBA 4AQJA 4KYNA 1PVAA 3DY9A 2MBXA 1FF1A 1OOIX 2B1UA 2WCHA 4F0ZB 1XFUO 4PE7A 3UO9A 1XK4C 2KI4C 1TN4A 3C1VA 2KYFA 1ZMZA 1SW8A 1OMVA 1TCOB 2F33A 4IJ7A 5BPJA 4AQIA 1SBJA 1CFPA 2EC6C 2SASA 1IQ5A 1TNQA 4P2YB 5CPVA 5CSFA 3PM2A 1OSAA 1WRKA 1NWDA 2BCAA 3NXAA 5D69A 5F6TA 1YX8A 3SJSA 1GQMA 3NSIA 1L2OC 3SG5A 1BG1A 4M2OA 1EH2A 3B86A 1B8CA 1M31A 1UP5A 1PSBA 1E8AA 1K8UA 1UHHA 2OS8C 2KAXA 4MSPA 1CFCA 4JQ0D 1JBAA
chains in the Genus database with same CATH topology
4PHMA 1UUSA 5CSJA 1QIVA 1B8LA 3RM1A 1SPYA 2PALA 1J7QA 1OQPA 1N2DA 3I5GB 1K94A 1EL4A 1QLKA 2F2OA 1IJ5A 2LUCA 3OX6A 2K7BA 3BYAA 4MRXA 2BBMA 1F71A 1WLMA 4QJ3B 5KSZA 2MHHA 2BECA 3DVEA 5AEQA 3EVUA 1WRLA 2Y1MA 2M97A 3CWGA 2H61C 1WY9A 1YRTB 3PFVA 4L9MA 3OP0A 2ZN9A 1UURA 4QJ5B 1KQVA 2HETA 1KWOC 1BF5A 5AANA 3TS5C 3DVKA 1RFJA 4N5XA 1F70A 1KSOA 2LNKA 2HF5A 4OVNF 1IG5A 5I2QA 1SKTA 3PALA 4DUQA 2KI6C 4NDDA 1BODA 3SG2A 1QASA 1BR1B 1UWOA 1IKUA 1LA0A 1RTP1 1J7RA 1K9KA 1NX3A 1U5IB 2K8MB 2LMTA 2LUXA 2LLUA 1IQ3A 2LAPA 1YTZC 1UHJA 4MLWA 2COLB 2FJUB 1J7PA 2M7NA 4N1GA 1H4BA 2MJWB 3IQOA 3FIAA 3VRNA 5J3XA 3GK1A 4PDZA 2ZRTA 1YRUB 5AFPA 1PULA 2Q91A 2AUCA 2TN4A 1OZOA 2NCOA 5K89A 3BUXB 4ICBA 4ORCB 3LL8B 2KFFA 1AJ5A 4GBAA 1KQMB 1TRFA 1QX5B 4DCKA 2WORA 1DGUA 2ZFDA 1IGVA 4M2QA 1KWOB 4HREE 3JVTC 4YI8A 5B8IB 4PE4A 5HLOA 1KK8B 1CDNA 2I7AA 4FTGA 2M9GA 3VGOA 2FOTA 1RWYA 2KFHA 2KGBC 4M2PA 4XJKA 4WRIA 1FI5A 1QX7A 2KQ6A 2BCBA 1DJIA 1A2XA 1NYAA 1B7TY 3O2PA 3BQ3A 2OPOA 2L4IA 2NXQA 2KAVA 3JTDC 4JPZB 3BXKA 2KHNA 2RGIA 1B1GA 2JOJA 1CDLA 5AXIA 4I5LB 5HLVA 1DTLA 3PSRA 2PRUA 4HRGA 4YBHB 2JU0A 3TDIA 3GK2A 1SL7A 2L2EA 1MHOA 1QV1A 2L51A 3KEVA 1YUSA 4YGCB 3SG4A 2JC2A 1SL9A 1DJZA 2CT9A 4GAOA 4MN0A 3VROA 2F3ZA 1CTRA 2EGDA 1CLBA 1PRWA 2LHIA 4WQ2A 3DF0B 1A75A 1BMOA 1Q80A 3FS7A 4WQ3A 4ZCVA 2I2RE 2JXCA 5DKNA 5DKQA 5AERA 1AK8A 1F55A 4DS7A 1DMOA 1IH0A 1ZUZA 3JVTB 3IQQA 1BJFA 2ZNEA 1TNWA 1SRAA 1R6PA 3NSOA 1RROA 3AAKA 1NCYA 4R1EA 1DF0B 2PASA 1FW4A 3O6BA 2Q4UA 1SCMC 3OB1B 2L50A 1ALWA 1LXFC 1M46A 1DJXA 2LLSA 1LA3A 2PMYA 1S26D 4YGEB 5IBWA 3OB2B 1RJVA 3PLFB 2GGMA 4OKHA 2AAOA 3GOFA 3I5HC 4OV2A 5CSNA 2JPTA 3OX5A 2NZ0A 3I5FC 1Y1UA 3JTDB 1CKKA 2BE4A 3TZ1A 2KSPA 2E30A 1M45A 3KHEA 3GK4X 4IL1A 1IJ6A 2FCDA 2PVBA 3DVMA 4OR9B 1NX2A 2LV7A 4GFTA 1M63B 1K9UA 2NLNA 2KQYA 1WDCC 1WRZA 1JF2A 1B7TZ 1NCZA 2R2IA 5JOLA 4MRYA 2BCXA 1K90D 1Y6WA 2KNEA 3KF9A 3ZNIA 3PN7C 3A4UB 1GGWA 4CPVA 3EKJA 1LKJA 3K21A 1XFWO 2KGRA 4CLNA 4TNCA 1J7OA 4USLA 4YGDB 2KBIA 2KDHA 1S36A 1NX1A 1QJTA 2BL0C 3EK8A 2KI4B 4HSZA 2MAZA 4AOMA 2DOQA 2HPSA 4MZJA 2JZIA 1ZFSA 4ORBB 4CIDA 2ZNDA 5HKZA 1KCYA 2EC6B 1XK4A 1L7ZA 3I5HB 4BY4A 4PE1A 1YR5A 5HKYA 5HYDA 2QACA 2VRGA 3DD4A 5G08A 1L2OB 1QS7A 4NQGA 2LCPA 2K61A 2OTGC 1B9AA 2M49B 1NCXA 2E6WA 1V1GA 1XFXO 2KYCA 2OS8B 4GGNA 1K93D 1N0YA 4ETOA 1BR4B 3EK7A 1Y0VH 3BUMB 1BOCA 4CFRA 3WHTB 1C07A 4DIRA 3PN7B 3A8RA 3AKAA 3DVJA 1WLZA 5I8NA 2JWWA 1LVCD 4I5NB 1U5IA 2L5XB 1DVIA 1DJHA 1YX7A 3I5IC 5I2LA 4GGFC 1MR8A 3EVVA 1MWNA 1JF0A 3BOWB 2QPTA 2BL0B 2PSRA 1S6IA 2BKHB 2Y4QA 1B47A 1KK7Y 3D0YB 2MA2A 2G9BA 2KOTA 3EKHA 1S1EA 2IS9A 1PALA 2F8PA 2M1UA 4C0LA 1BU3A 3HCMA 1F4OA 1QTXA 3TS5B 1SNLA 2M3WA 2H61A 4PALA 3TUYC 1S6CA 3EK4A 1F4QA 2WCEA 4GPLB 2AMIA 4MEWA 1JC2A 2OTGB 1QV0A 3WNXB 2LM5A 2MRDA 3QRXA 1IWQA 3AKBA 1EJ3A 1SY9A 4I5KA 3AAJA 1MXLC 1DT7B 3BUNB 2K2AA 3KPXA 2CBLA 1QIWA 4NDCA 1MXEA 1XA5A 2ZN8A 2WC8A 4YI9A 1XYDA 1F54A 3FWBA 2KI6D 1N65A 1W7IB 2O5GA 4U8DA 3WXAA 3I5IB 1CDPA 4PHNA 3SIAA 4GUKA 1XO5A 3CS1A 3ICBA 1PSRA 2LLTA 3D10A 1XFYO 2JT0A 4YGAA 3PM8A 1C7WA 3BUOB 2K7DA 1CM4A 2WNDA 5GQQC 4PE0A 4YRUA 2WOSA 3SG7A 1Y1AA 3WHUB 1EXRA 1YUTA 2LP3A 1CFFA 1IRJA 2M0RA 3LLEA 2LANA 4E68A 1ZOTB 3DF0A 3FWCA 1SCVA 5I2OA 1KK7Z 1NSHA 1XFVO 1CNPA 1CB1A 2LVJA 3HX4A 2P6BB 4FQOA 1DF0A 4N1FA 2BE6A 1BT6A 2JTZA 4MZLA 4MVFA 1W7JB 4P5OE 2BBNA 2D8NA 1CFDA 1CDMA 5TNCA 5KTYA 2JTTA 3I5GC 1CLMA 2K2FA 1K2HA 1RK9A 1QVIY 1UHKA 1DJWA 1MQ1A 1JSAA 2A4JA 5KU1A 1YUUA 1JFJA 1CMFA 3CR2A 4CFQA 1S5GY 1H8BA 1V1FA 1Y1XA 4XYNA 1DGVA 2GGZA 3SG3A 2JULA 2LP2A 2SCPA 4D1EA 3H4SE 3EVRA 2WCFA 2L0PA 1KFXL 1RECA 1J1EA 3O4YA 3NSLA 3LCPC 2O60A 4BY5A 5DKRA 4HRHA 1X02A 2MLFC 1YVLA 4PCWA 4C0KA 1AHRA 1SCMB 1XFZO 5CSIA 3MSEB 1K96A 1NPQA 3CR5X 2CNPA 2Y5IA 4DRWA 3CTNA 1KSMA 2K0JA 2M7LA 1TTXA 4GNKB 1NUBA 2JT3A 1KFXS 3PATA 3LK1A 3I5FB 5HKWA 2GV5A 1JFKA 4UPGA 1UHIA 3ZWHA 2LE9B 1YVHA 1SK6D 3KO0A 2CXJA 5JJGA 2LMUA 1SYMA 1A4PA 1HT9A 1ZACA 2NCPA 4ZCUA 4A4CA 1G33A 1WDCB 1C7VA 1B8RA 1TIZA 2G2BA 1M39A 2M1KB 2MLEC 5FYXA 3M0WA 1A03A 2LHLA 1TNXA 1KQMC 1QXPA 1QVIZ 1R2UA 2KBMA 1TCFA 3CR4X 3O78A 2K7OA 1MUXA 1VRKA 1YURA 5ER4X 1S5GZ 1B4CA 1K95A 1J55A 1QLSA 1G4YR 1G8IA 1HQVA 1KK8C 1MF8B 3IF7A 4MBEA 4ORAB 1J1DA 3NSKA 2H2KA 2KFGA 3LK0A 1S6JA 1SR6C 1OZSA 1SL8A 1DJYA 1LINA 2L98A 1GGZA 2JNFA 1PK0D 3CGAA 2JRFA 1FBVA 2V53A 1BLQA 2JQ6A 3BOWA 1D1OA 1UHNA 3BUWB 3VRPA 1JUOA 1JWDA 2LMVA 3D0YA 1K9PA 2ISDA 3CZTX 2I94A 4YGBB 1OOJA 2L4HA 2KAYA 2HQWA 3RLZA 1AP4A 1NP8A 1XVJA 4MZKA 1QATA 1SMGA 2M8UA 1CLLA 1AUIB 1PVBA 1F8HA 3SG6A 1KFUL 1FI6A 2F3YA 5ER5A 3SIBA 1CMGA 1QX2A 4OCIA 1NIWA 4XJKB 3OHMB 3TDUA 1OMRA 1OMDA 2FCEA 2F2PA 1EG4A 1S3PA 1GJYA 2LVVA 3VRRA 5D7FA 1SR6B 1KFUS 4C0JA 5PALA 4QJ4B 2JT8A 1TNPA 2HQ8A 4GGFA 1TOPA 3VRQA 3F45A 1AJ4A 4PHKA 1FPWA 2EHBA 3TDZA 1NX0A 2CCMA 1A29A 2I18A 2M29A 1AVSA 2K7CA 3TUYB 1CM1A 2JNXA 2ZRSA 2JXLA 2CTNA 2LC5A 2LVIA 1A75B 1OE9B 4PHJA 3E3RA 1DJGA 1ODBA 1EG3A 1ALVA 2ZKMX 2LVKA 4A4BA 2BKIB 4Q04A 2Y1NA 4I5JA 3CLNA 4NDBA 4JWQA 2WCBA 4AQJA 1PVAA 2MBXA 1FF1A 2B1UA 4F0ZB 1XFUO 4PE7A 1XK4C 2KI4C 1TN4A 3C1VA 2KYFA 1ZMZA 1SW8A 1OMVA 1TCOB 2F33A 5BPJA 4AQIA 1SBJA 1CFPA 2EC6C 2SASA 1IQ5A 1TNQA 4P2YB 5CPVA 5CSFA 1OSAA 1WRKA 1NWDA 2BCAA 3NXAA 5D69A 5F6TA 1YX8A 3SJSA 1GQMA 3NSIA 1L2OC 3SG5A 1BG1A 4M2OA 1EH2A 1B8CA 1M31A 1UP5A 1PSBA 1E8AA 1K8UA 1UHHA 2OS8C 2KAXA 4MSPA 1CFCA 4JQ0D 1JBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHM A;  1UUS A;  5CSJ A;  1QIV A;  1B8L A;  3RM1 A;  1SPY A;  2PAL A;  1J7Q A;  1OQP A;  1N2D A;  3I5G B;  1K94 A;  1EL4 A;  1QLK A;  2F2O A;  1IJ5 A;  2LUC A;  3OX6 A;  2K7B A;  3BYA A;  4MRX A;  2BBM A;  1F71 A;  1WLM A;  4QJ3 B;  5KSZ A;  2MHH A;  2BEC A;  3DVE A;  5AEQ A;  3EVU A;  1WRL A;  2Y1M A;  2M97 A;  3CWG A;  2H61 C;  1WY9 A;  1YRT B;  3PFV A;  4L9M A;  3OP0 A;  2ZN9 A;  1UUR A;  4QJ5 B;  1KQV A;  2HET A;  1KWO C;  1BF5 A;  5AAN A;  3TS5 C;  3DVK A;  1RFJ A;  4N5X A;  1F70 A;  1KSO A;  2LNK A;  2HF5 A;  4OVN F;  1IG5 A;  5I2Q A;  1SKT A;  3PAL A;  4DUQ A;  2KI6 C;  4NDD A;  1BOD A;  3SG2 A;  1QAS A;  1BR1 B;  1UWO A;  1IKU A;  1LA0 A;  1RTP 1;  1J7R A;  1K9K A;  1NX3 A;  1U5I B;  2K8M B;  2LMT A;  2LUX A;  2LLU A;  1IQ3 A;  2LAP A;  1YTZ C;  1UHJ A;  4MLW A;  2COL B;  2FJU B;  1J7P A;  2M7N A;  4N1G A;  1H4B A;  2MJW B;  3IQO A;  3FIA A;  3VRN A;  5J3X A;  3GK1 A;  4PDZ A;  2ZRT A;  1YRU B;  5AFP A;  1PUL A;  2Q91 A;  2AUC A;  2TN4 A;  1OZO A;  2NCO A;  5K89 A;  3BUX B;  4ICB A;  4ORC B;  3LL8 B;  2KFF A;  1AJ5 A;  4GBA A;  1KQM B;  1TRF A;  1QX5 B;  4DCK A;  2WOR A;  1DGU A;  2ZFD A;  1IGV A;  4M2Q A;  1KWO B;  4HRE E;  3JVT C;  4YI8 A;  5B8I B;  4PE4 A;  5HLO A;  1KK8 B;  1CDN A;  2I7A A;  4FTG A;  2M9G A;  3VGO A;  2FOT A;  1RWY A;  2KFH A;  2KGB C;  4M2P A;  4XJK A;  4WRI A;  1FI5 A;  1QX7 A;  2KQ6 A;  2BCB A;  1DJI A;  1A2X A;  1NYA A;  1B7T Y;  3O2P A;  3BQ3 A;  2OPO A;  2L4I A;  2NXQ A;  2KAV A;  3JTD C;  4JPZ B;  3BXK A;  2KHN A;  2RGI A;  1B1G A;  2JOJ A;  1CDL A;  5AXI A;  4I5L B;  5HLV A;  1DTL A;  3PSR A;  2PRU A;  4HRG A;  4YBH B;  2JU0 A;  3TDI A;  3GK2 A;  1SL7 A;  2L2E A;  1MHO A;  1QV1 A;  2L51 A;  3KEV A;  1YUS A;  4YGC B;  3SG4 A;  2JC2 A;  1SL9 A;  1DJZ A;  2CT9 A;  4GAO A;  4MN0 A;  3VRO A;  2F3Z A;  1CTR A;  2EGD A;  1CLB A;  1PRW A;  2LHI A;  4WQ2 A;  3DF0 B;  1A75 A;  1BMO A;  1Q80 A;  3FS7 A;  4WQ3 A;  4ZCV A;  2I2R E;  2JXC A;  5DKN A;  5DKQ A;  5AER A;  1AK8 A;  1F55 A;  4DS7 A;  1DMO A;  1IH0 A;  1ZUZ A;  3JVT B;  3IQQ A;  1BJF A;  2ZNE A;  1TNW A;  1SRA A;  1R6P A;  3NSO A;  1RRO A;  3AAK A;  1NCY A;  4R1E A;  1DF0 B;  2PAS A;  1FW4 A;  3O6B A;  2Q4U A;  1SCM C;  3OB1 B;  2L50 A;  1ALW A;  1LXF C;  1M46 A;  1DJX A;  2LLS A;  1LA3 A;  2PMY A;  1S26 D;  4YGE B;  5IBW A;  3OB2 B;  1RJV A;  3PLF B;  2GGM A;  4OKH A;  2AAO A;  3GOF A;  3I5H C;  4OV2 A;  5CSN A;  2JPT A;  3OX5 A;  2NZ0 A;  3I5F C;  1Y1U A;  3JTD B;  1CKK A;  2BE4 A;  3TZ1 A;  2KSP A;  2E30 A;  1M45 A;  3KHE A;  3GK4 X;  4IL1 A;  1IJ6 A;  2FCD A;  2PVB A;  3DVM A;  4OR9 B;  1NX2 A;  2LV7 A;  4GFT A;  1M63 B;  1K9U A;  2NLN A;  2KQY A;  1WDC C;  1WRZ A;  1JF2 A;  1B7T Z;  1NCZ A;  2R2I A;  5JOL A;  4MRY A;  2BCX A;  1K90 D;  1Y6W A;  2KNE A;  3KF9 A;  3ZNI A;  3PN7 C;  3A4U B;  1GGW A;  4CPV A;  3EKJ A;  1LKJ A;  3K21 A;  1XFW O;  2KGR A;  4CLN A;  4TNC A;  1J7O A;  4USL A;  4YGD B;  2KBI A;  2KDH A;  1S36 A;  1NX1 A;  1QJT A;  2BL0 C;  3EK8 A;  2KI4 B;  4HSZ A;  2MAZ A;  4AOM A;  2DOQ A;  2HPS A;  4MZJ A;  2JZI A;  1ZFS A;  4ORB B;  4CID A;  2ZND A;  5HKZ A;  1KCY A;  2EC6 B;  1XK4 A;  1L7Z A;  3I5H B;  4BY4 A;  4PE1 A;  1YR5 A;  5HKY A;  5HYD A;  2QAC A;  2VRG A;  3DD4 A;  5G08 A;  1L2O B;  1QS7 A;  4NQG A;  2LCP A;  2K61 A;  2OTG C;  1B9A A;  2M49 B;  1NCX A;  2E6W A;  1V1G A;  1XFX O;  2KYC A;  2OS8 B;  4GGN A;  1K93 D;  1N0Y A;  4ETO A;  1BR4 B;  3EK7 A;  1Y0V H;  3BUM B;  1BOC A;  4CFR A;  3WHT B;  1C07 A;  4DIR A;  3PN7 B;  3A8R A;  3AKA A;  3DVJ A;  1WLZ A;  5I8N A;  2JWW A;  1LVC D;  4I5N B;  1U5I A;  2L5X B;  1DVI A;  1DJH A;  1YX7 A;  3I5I C;  5I2L A;  4GGF C;  1MR8 A;  3EVV A;  1MWN A;  1JF0 A;  3BOW B;  2QPT A;  2BL0 B;  2PSR A;  1S6I A;  2BKH B;  2Y4Q A;  1B47 A;  1KK7 Y;  3D0Y B;  2MA2 A;  2G9B A;  2KOT A;  3EKH A;  1S1E A;  2IS9 A;  1PAL A;  2F8P A;  2M1U A;  4C0L A;  1BU3 A;  3HCM A;  1F4O A;  1QTX A;  3TS5 B;  1SNL A;  2M3W A;  2H61 A;  4PAL A;  3TUY C;  1S6C A;  3EK4 A;  1F4Q A;  2WCE A;  4GPL B;  2AMI A;  4MEW A;  1JC2 A;  2OTG B;  1QV0 A;  3WNX B;  2LM5 A;  2MRD A;  3QRX A;  1IWQ A;  3AKB A;  1EJ3 A;  1SY9 A;  4I5K A;  3AAJ A;  1MXL C;  1DT7 B;  3BUN B;  2K2A A;  3KPX A;  2CBL A;  1QIW A;  4NDC A;  1MXE A;  1XA5 A;  2ZN8 A;  2WC8 A;  4YI9 A;  1XYD A;  1F54 A;  3FWB A;  2KI6 D;  1N65 A;  1W7I B;  2O5G A;  4U8D A;  3WXA A;  3I5I B;  1CDP A;  4PHN A;  3SIA A;  4GUK A;  1XO5 A;  3CS1 A;  3ICB A;  1PSR A;  2LLT A;  3D10 A;  1XFY O;  2JT0 A;  4YGA A;  3PM8 A;  1C7W A;  3BUO B;  2K7D A;  1CM4 A;  2WND A;  5GQQ C;  4PE0 A;  4YRU A;  2WOS A;  3SG7 A;  1Y1A A;  3WHU B;  1EXR A;  1YUT A;  2LP3 A;  1CFF A;  1IRJ A;  2M0R A;  3LLE A;  2LAN A;  4E68 A;  1ZOT B;  3DF0 A;  3FWC A;  1SCV A;  5I2O A;  1KK7 Z;  1NSH A;  1XFV O;  1CNP A;  1CB1 A;  2LVJ A;  3HX4 A;  2P6B B;  4FQO A;  1DF0 A;  4N1F A;  2BE6 A;  1BT6 A;  2JTZ A;  4MZL A;  4MVF A;  1W7J B;  4P5O E;  2BBN A;  2D8N A;  1CFD A;  1CDM A;  5TNC A;  5KTY A;  2JTT A;  3I5G C;  1CLM A;  2K2F A;  1K2H A;  1RK9 A;  1QVI Y;  1UHK A;  1DJW A;  1MQ1 A;  1JSA A;  2A4J A;  5KU1 A;  1YUU A;  1JFJ A;  1CMF A;  3CR2 A;  4CFQ A;  1S5G Y;  1H8B A;  1V1F A;  1Y1X A;  4XYN A;  1DGV A;  2GGZ A;  3SG3 A;  2JUL A;  2LP2 A;  2SCP A;  4D1E A;  3H4S E;  3EVR A;  2WCF A;  2L0P A;  1KFX L;  1REC A;  1J1E A;  3O4Y A;  3NSL A;  3LCP C;  2O60 A;  4BY5 A;  5DKR A;  4HRH A;  1X02 A;  2MLF C;  1YVL A;  4PCW A;  4C0K A;  1AHR A;  1SCM B;  1XFZ O;  5CSI A;  3MSE B;  1K96 A;  1NPQ A;  3CR5 X;  2CNP A;  2Y5I A;  4DRW A;  3CTN A;  1KSM A;  2K0J A;  2M7L A;  1TTX A;  4GNK B;  1NUB A;  2JT3 A;  1KFX S;  3PAT A;  3LK1 A;  3I5F B;  5HKW A;  2GV5 A;  1JFK A;  4UPG A;  1UHI A;  3ZWH A;  2LE9 B;  1YVH A;  1SK6 D;  3KO0 A;  2CXJ A;  5JJG A;  2LMU A;  1SYM A;  1A4P A;  1HT9 A;  1ZAC A;  2NCP A;  4ZCU A;  4A4C A;  1G33 A;  1WDC B;  1C7V A;  1B8R A;  1TIZ A;  2G2B A;  1M39 A;  2M1K B;  2MLE C;  5FYX A;  3M0W A;  1A03 A;  2LHL A;  1TNX A;  1KQM C;  1QXP A;  1QVI Z;  1R2U A;  2KBM A;  1TCF A;  3CR4 X;  3O78 A;  2K7O A;  1MUX A;  1VRK A;  1YUR A;  5ER4 X;  1S5G Z;  1B4C A;  1K95 A;  1J55 A;  1QLS A;  1G4Y R;  1G8I A;  1HQV A;  1KK8 C;  1MF8 B;  3IF7 A;  4MBE A;  4ORA B;  1J1D A;  3NSK A;  2H2K A;  2KFG A;  3LK0 A;  1S6J A;  1SR6 C;  1OZS A;  1SL8 A;  1DJY A;  1LIN A;  2L98 A;  1GGZ A;  2JNF A;  1PK0 D;  3CGA A;  2JRF A;  1FBV A;  2V53 A;  1BLQ A;  2JQ6 A;  3BOW A;  1D1O A;  1UHN A;  3BUW B;  3VRP A;  1JUO A;  1JWD A;  2LMV A;  3D0Y A;  1K9P A;  2ISD A;  3CZT X;  2I94 A;  4YGB B;  1OOJ A;  2L4H A;  2KAY A;  2HQW A;  3RLZ A;  1AP4 A;  1NP8 A;  1XVJ A;  4MZK A;  1QAT A;  1SMG A;  2M8U A;  1CLL A;  1AUI B;  1PVB A;  1F8H A;  3SG6 A;  1KFU L;  1FI6 A;  2F3Y A;  5ER5 A;  3SIB A;  1CMG A;  1QX2 A;  4OCI A;  1NIW A;  4XJK B;  3OHM B;  3TDU A;  1OMR A;  1OMD A;  2FCE A;  2F2P A;  1EG4 A;  1S3P A;  1GJY A;  2LVV A;  3VRR A;  5D7F A;  1SR6 B;  1KFU S;  4C0J A;  5PAL A;  4QJ4 B;  2JT8 A;  1TNP A;  2HQ8 A;  4GGF A;  1TOP A;  3VRQ A;  3F45 A;  1AJ4 A;  4PHK A;  1FPW A;  2EHB A;  3TDZ A;  1NX0 A;  2CCM A;  1A29 A;  2I18 A;  2M29 A;  1AVS A;  2K7C A;  3TUY B;  1CM1 A;  2JNX A;  2ZRS A;  2JXL A;  2CTN A;  2LC5 A;  2LVI A;  1A75 B;  1OE9 B;  4PHJ A;  3E3R A;  1DJG A;  1ODB A;  1EG3 A;  1ALV A;  2ZKM X;  2LVK A;  4A4B A;  2BKI B;  4Q04 A;  2Y1N A;  4I5J A;  3CLN A;  4NDB A;  4JWQ A;  2WCB A;  4AQJ A;  1PVA A;  2MBX A;  1FF1 A;  2B1U A;  4F0Z B;  1XFU O;  4PE7 A;  1XK4 C;  2KI4 C;  1TN4 A;  3C1V A;  2KYF A;  1ZMZ A;  1SW8 A;  1OMV A;  1TCO B;  2F33 A;  5BPJ A;  4AQI A;  1SBJ A;  1CFP A;  2EC6 C;  2SAS A;  1IQ5 A;  1TNQ A;  4P2Y B;  5CPV A;  5CSF A;  1OSA A;  1WRK A;  1NWD A;  2BCA A;  3NXA A;  5D69 A;  5F6T A;  1YX8 A;  3SJS A;  1GQM A;  3NSI A;  1L2O C;  3SG5 A;  1BG1 A;  4M2O A;  1EH2 A;  1B8C A;  1M31 A;  1UP5 A;  1PSB A;  1E8A A;  1K8U A;  1UHH A;  2OS8 C;  2KAX A;  4MSP A;  1CFC A;  4JQ0 D;  1JBA A; 
#chains in the Genus database with same CATH topology
 4PHM A;  1UUS A;  5CSJ A;  1QIV A;  1B8L A;  3RM1 A;  1SPY A;  2PAL A;  1J7Q A;  1OQP A;  1N2D A;  3I5G B;  1K94 A;  3SS5 A;  1EL4 A;  1QLK A;  2F2O A;  3QME A;  1IJ5 A;  2LUC A;  3OX6 A;  2K7B A;  3BYA A;  4MRX A;  2BBM A;  1F71 A;  1WLM A;  4QJ3 B;  5KSZ A;  2MHH A;  2BEC A;  3DVE A;  5AEQ A;  3EVU A;  1WRL A;  2Y1M A;  2M97 A;  3CWG A;  2H61 C;  1WY9 A;  1YRT B;  3PFV A;  4L9M A;  1OOG A;  3OP0 A;  2ZN9 A;  1UUR A;  3FE8 A;  4QJ5 B;  1KQV A;  2HET A;  3B7A A;  1KWO C;  1BF5 A;  3S0D A;  5AAN A;  3D75 A;  5HL1 A;  3TS5 C;  3DVK A;  1RFJ A;  4N5X A;  1F70 A;  1KSO A;  2LNK A;  2HF5 A;  4OVN F;  1IG5 A;  1C3Y A;  5I2Q A;  1SKT A;  3PAL A;  4DUQ A;  2KI6 C;  4NDD A;  1BOD A;  3SG2 A;  1QAS A;  1BR1 B;  1UWO A;  1IKU A;  1LA0 A;  1RTP 1;  1J7R A;  1K9K A;  2QEB A;  1NX3 A;  1U5I B;  2K8M B;  2LMT A;  2LUX A;  2LLU A;  1IQ3 A;  2LAP A;  1YTZ C;  1UHJ A;  4MLW A;  2COL B;  2FJU B;  1J7P A;  2M7N A;  4N1G A;  1H4B A;  3SS3 A;  2MJW B;  3IQO A;  3FIA A;  3VRN A;  5J3X A;  3GK1 A;  3VB1 A;  4PDZ A;  3DXL A;  2ZRT A;  3SS4 A;  1YRU B;  3O4X A;  5AFP A;  1PUL A;  2Q91 A;  2AUC A;  4FQT A;  2TN4 A;  1OZO A;  2NCO A;  5K89 A;  3BUX B;  4ICB A;  4ORC B;  3LL8 B;  2KFF A;  3EG5 B;  1AJ5 A;  4GBA A;  1KQM B;  1TRF A;  1QX5 B;  4DCK A;  2WOR A;  1DGU A;  2ZFD A;  1IGV A;  4M2Q A;  3S0E A;  1KWO B;  4HRE E;  5FI2 A;  3FE6 A;  3JVT C;  4YI8 A;  5B8I B;  4PE4 A;  5HLO A;  1KK8 B;  1CDN A;  2I7A A;  4FTG A;  2M9G A;  3VGO A;  2FOT A;  1RWY A;  1TUJ A;  2KFH A;  2KGB C;  4M2P A;  4XJK A;  4WRI A;  2WC6 A;  2QEH A;  1FI5 A;  1QX7 A;  2KQ6 A;  5FI7 A;  3S0B A;  2BCB A;  1DJI A;  1A2X A;  3CDN A;  1NYA A;  1B7T Y;  1IIO A;  3O2P A;  3BQ3 A;  2OPO A;  2L4I A;  2NXQ A;  2KAV A;  3JTD C;  4JPZ B;  3BXK A;  2KHN A;  5DIC A;  2RGI A;  1B1G A;  2JOJ A;  1CDL A;  2QDI A;  4I5L B;  5AXI A;  5HLV A;  1DTL A;  3PSR A;  2PRU A;  4HRG A;  4YBH B;  2JU0 A;  3TDI A;  3GK2 A;  1SL7 A;  2K60 A;  2L2E A;  1MHO A;  1QV1 A;  2L51 A;  3KEV A;  1YUS A;  1QWV A;  4YGC B;  3SG4 A;  2JC2 A;  1SL9 A;  1DJZ A;  2CT9 A;  4GAO A;  4MN0 A;  3VRO A;  2F3Z A;  1CTR A;  2EGD A;  1CLB A;  1PRW A;  2LHI A;  4WQ2 A;  3DF0 B;  1A75 A;  1BMO A;  1Q80 A;  3FS7 A;  4WQ3 A;  4ZCV A;  2I2R E;  2JXC A;  5DKN A;  5DKQ A;  5AER A;  1AK8 A;  1F55 A;  4DS7 A;  1DMO A;  1IH0 A;  1ORG A;  1ZUZ A;  3NGV A;  3JVT B;  3IQQ A;  1BJF A;  2ZNE A;  1TNW A;  1SRA A;  1R6P A;  3NSO A;  1RRO A;  3AAK A;  1NCY A;  4R1E A;  1DF0 B;  2PAS A;  1T14 A;  1FW4 A;  3O6B A;  2Q4U A;  1SCM C;  3OB1 B;  2L50 A;  1ALW A;  1LXF C;  1M46 A;  1DJX A;  2LLS A;  1LA3 A;  2PMY A;  1S26 D;  4YGE B;  5IBW A;  3OB2 B;  1RJV A;  3PLF B;  2GGM A;  4OKH A;  2AAO A;  3GOF A;  3I5H C;  4OV2 A;  4JKT A;  5CSN A;  2JPT A;  3OX5 A;  2NZ0 A;  3I5F C;  1Y1U A;  3JTD B;  1CKK A;  2BE4 A;  3TZ1 A;  2KSP A;  2E30 A;  1M45 A;  3KHE A;  3GK4 X;  4IL1 A;  1IJ6 A;  2FCD A;  2PVB A;  3DVM A;  4OR9 B;  1NX2 A;  1C3Z A;  2LV7 A;  4GFT A;  1M63 B;  3NHI A;  1K9U A;  2NLN A;  5EL2 A;  2KQY A;  1WDC C;  1WRZ A;  1JF2 A;  1B7T Z;  1NCZ A;  2R2I A;  5JOL A;  4MRY A;  2BCX A;  1K90 D;  1Y6W A;  2KNE A;  3KF9 A;  3ZNI A;  2WCM A;  3PN7 C;  3A4U B;  1GGW A;  4CPV A;  1OOH A;  3EKJ A;  1LKJ A;  3K21 A;  3FE9 A;  1XFW O;  3IVT A;  2KGR A;  4CLN A;  4TNC A;  1J7O A;  3DZT A;  4USL A;  4YGD B;  2KBI A;  2KDH A;  1S36 A;  2L2C A;  1NX1 A;  1QJT A;  2BL0 C;  3EK8 A;  2KI4 B;  4HSZ A;  3L4L A;  2MAZ A;  4AOM A;  2DOQ A;  2HPS A;  1TUZ A;  4MZJ A;  2JZI A;  1ZFS A;  4ORB B;  4CID A;  2ZND A;  3CZ1 A;  2YGU A;  5HKZ A;  1KCY A;  2EC6 B;  2QEV A;  1XK4 A;  1L7Z A;  3I5H B;  4BY4 A;  4PE1 A;  1YR5 A;  5HKY A;  5HYD A;  2QAC A;  2VRG A;  3B87 A;  3DD4 A;  3S0F A;  5G08 A;  1L2O B;  2WCJ A;  1QS7 A;  4NQG A;  2LCP A;  2K61 A;  2OTG C;  1B9A A;  2BAP A;  2M49 B;  1NCX A;  1Z2C B;  1V1G A;  1XFX O;  2E6W A;  2KYC A;  2OS8 B;  3OGN A;  1K93 D;  1N0Y A;  2WC5 A;  1BR4 B;  4GGN A;  4ETO A;  1DC1 A;  3EK7 A;  1Y0V H;  3BUM B;  1BOC A;  4CFR A;  3WHT B;  1C07 A;  4DIR A;  3PN7 B;  3A8R A;  3BJH A;  3AKA A;  3DVJ A;  1WLZ A;  5I8N A;  2JWW A;  1LVC D;  4I5N B;  3D78 A;  1U5I A;  2L5X B;  1DVI A;  1DJH A;  1YX7 A;  2KLE A;  3I5I C;  5I2L A;  4GGF C;  1MR8 A;  3EVV A;  1MWN A;  1JF0 A;  3BOW B;  2QPT A;  2BL0 B;  5I94 A;  2PSR A;  1S6I A;  2BKH B;  2Y4Q A;  1B47 A;  1KK7 Y;  3D0Y B;  2MA2 A;  2G9B A;  2KOT A;  4F7F A;  3EKH A;  1S1E A;  2IS9 A;  1PAL A;  2F8P A;  2M1U A;  4C0L A;  1BU3 A;  3HCM A;  3CYZ A;  1F4O A;  1QTX A;  2P71 A;  2BNX A;  3D76 A;  3TS5 B;  2KPH A;  3BFA A;  1SNL A;  2M3W A;  2H61 A;  4PAL A;  3TUY C;  1S6C A;  3EK4 A;  1F4Q A;  2WCE A;  4GPL B;  2AMI A;  4MEW A;  1JC2 A;  2OTG B;  1QV0 A;  3WNX B;  2LM5 A;  2MRD A;  3QRX A;  1IWQ A;  3AKB A;  1EJ3 A;  1DEK A;  1SY9 A;  4I5K A;  3AAJ A;  1MXL C;  1DT7 B;  3BUN B;  2K2A A;  3KPX A;  2CBL A;  1QIW A;  4NDC A;  1MXE A;  1XA5 A;  2ZN8 A;  2WC8 A;  4YI9 A;  1XYD A;  1F54 A;  3FWB A;  2KI6 D;  1N65 A;  1W7I B;  2O5G A;  4U8D A;  3WXA A;  3I5I B;  1CDP A;  4PHN A;  3SIA A;  3BFB A;  4GUK A;  1XO5 A;  3CS1 A;  3ICB A;  1PSR A;  2LLT A;  3B6X A;  1LS8 A;  1XFY O;  3D10 A;  3R1O A;  2JT0 A;  3S0G A;  4YGA A;  3PM8 A;  1C7W A;  3BUO B;  2K7D A;  1CM4 A;  2WND A;  5GQQ C;  1SSE B;  4PE0 A;  4YRU A;  2WOS A;  3SG7 A;  1Y1A A;  1GM0 A;  3WHU B;  1EXR A;  1YUT A;  2LP3 A;  1CFF A;  1IRJ A;  1DQE A;  2M0R A;  3LLE A;  2PYQ A;  2LAN A;  4E68 A;  1ZOT B;  3DF0 A;  3FWC A;  1SCV A;  5I2O A;  1KK7 Z;  1NSH A;  1XFV O;  3CZ2 A;  1CNP A;  1CB1 A;  2LVJ A;  3HX4 A;  2P6B B;  4FQO A;  1DF0 A;  4N1F A;  2BE6 A;  3DYE A;  1BT6 A;  2JTZ A;  4MZL A;  4MVF A;  1W7J B;  3UNW A;  4P5O E;  2BBN A;  2D8N A;  1CFD A;  1CDM A;  5TNC A;  5KTY A;  2JTT A;  3I5G C;  3RZS A;  1CLM A;  2K2F A;  1K2H A;  1RK9 A;  1QVI Y;  1UHK A;  1DJW A;  1MQ1 A;  1JSA A;  2A4J A;  5KU1 A;  1YUU A;  1JFJ A;  1CMF A;  3CR2 A;  4CFQ A;  1S5G Y;  1H8B A;  2H8V A;  1V1F A;  1Y1X A;  3S0A A;  4XYN A;  1DGV A;  2GGZ A;  3SG3 A;  2JUL A;  2LP2 A;  2SCP A;  4D1E A;  3H4S E;  3EVR A;  2WCF A;  2WCK A;  3K1E A;  3R1V A;  2L0P A;  2FJY A;  1KFX L;  2PQL A;  1REC A;  1J1E A;  3O4Y A;  3NSL A;  3LCP C;  3R1P A;  2O60 A;  4BY5 A;  5DKR A;  4HRH A;  1X02 A;  2MLF C;  1YVL A;  4PCW A;  4C0K A;  1AHR A;  1SCM B;  1XFZ O;  5CSI A;  3MSE B;  1K96 A;  1NPQ A;  3CR5 X;  3OBV A;  2CNP A;  2Y5I A;  2GTE A;  4DRW A;  3CTN A;  1KSM A;  2K0J A;  4OZD A;  2M7L A;  1TTX A;  4GNK B;  1NUB A;  2JT3 A;  1KFX S;  3PAT A;  3LK1 A;  3I5F B;  1OW4 A;  5HKW A;  2GV5 A;  3D77 A;  1JFK A;  3Q8I A;  1UHI A;  4UPG A;  3ZWH A;  2LE9 B;  1YVH A;  1SK6 D;  3KO0 A;  2CXJ A;  5JJG A;  2LMU A;  3B88 A;  1SYM A;  1A4P A;  1HT9 A;  1ZAC A;  2NCP A;  4ZCU A;  4A4C A;  1G33 A;  1WDC B;  1C7V A;  1B8R A;  1TIZ A;  2G2B A;  1M39 A;  2M1K B;  2MLE C;  5FYX A;  3M0W A;  1A03 A;  2LHL A;  1TNX A;  1KQM C;  1QXP A;  1QVI Z;  1R2U A;  2KBM A;  1TCF A;  3CR4 X;  3CZ0 A;  3O78 A;  2K7O A;  1MUX A;  1VRK A;  1YUR A;  5ER4 X;  1S5G Z;  1B4C A;  1K95 A;  1J55 A;  1QLS A;  1G4Y R;  1G8I A;  1HQV A;  1KK8 C;  4INX A;  1MF8 B;  3IF7 A;  4MBE A;  1DEL A;  3CAB A;  4ORA B;  1J1D A;  3NSK A;  2H2K A;  2KFG A;  1XFR A;  3LK0 A;  1S6J A;  1SR6 C;  1OZS A;  1SL8 A;  1DJY A;  1LIN A;  2L98 A;  1GGZ A;  2QEO A;  2JNF A;  2KLD A;  4JD9 A;  1PK0 D;  3CGA A;  2JRF A;  1FBV A;  2V53 A;  1BLQ A;  2JQ6 A;  3BOW A;  1D1O A;  5D3O A;  1UHN A;  3BUW B;  3L47 A;  3VRP A;  1JUO A;  1JWD A;  2LMV A;  3D0Y A;  1K9P A;  2ISD A;  3CZT X;  2I94 A;  4YGB B;  1OOJ A;  2L4H A;  2KAY A;  2HQW A;  3RLZ A;  1AP4 A;  1TWO A;  1NP8 A;  1XVJ A;  4MZK A;  1QAT A;  4INW A;  1SMG A;  5FI6 A;  2M8U A;  1CLL A;  1AUI B;  1PVB A;  1F8H A;  3SG6 A;  1KFU L;  1OOF A;  1FI6 A;  2F3Y A;  5ER5 A;  3SIB A;  3NHT A;  1CMG A;  1QX2 A;  4OCI A;  1NIW A;  4XJK B;  3OHM B;  3TDU A;  1OMR A;  3D73 A;  1OMD A;  2FCE A;  3N7H A;  3BFH A;  2F2P A;  1EG4 A;  1S3P A;  2P70 A;  1GJY A;  2LVV A;  4PT1 A;  3VRR A;  5D7F A;  1SR6 B;  1KFU S;  4C0J A;  5PAL A;  4QJ4 B;  3R72 A;  2JT8 A;  1TNP A;  1W9Z A;  2HQ8 A;  4GGF A;  1TOP A;  3VRQ A;  3F45 A;  1AJ4 A;  4PHK A;  1FPW A;  2EHB A;  3TDZ A;  2ERB A;  1NX0 A;  2CCM A;  1A29 A;  2I18 A;  2M29 A;  1AVS A;  2K7C A;  2WCL A;  3TUY B;  1CM1 A;  3L4A A;  2JNX A;  3V2L A;  2ZRS A;  2JXL A;  2CTN A;  2LC5 A;  2LVI A;  3PJI A;  1A75 B;  1OE9 B;  4PHJ A;  3D74 A;  3E3R A;  1DJG A;  1Z4H A;  2L5Y A;  1ODB A;  1EG3 A;  1ALV A;  2ZKM X;  2LVK A;  4A4B A;  1P28 A;  2BKI B;  4Q04 A;  2Y1N A;  4I5J A;  2JPO A;  3CLN A;  4JWQ A;  4NDB A;  2WCB A;  4AQJ A;  4KYN A;  1PVA A;  3DY9 A;  2MBX A;  1FF1 A;  1OOI X;  2B1U A;  2WCH A;  4F0Z B;  1XFU O;  4PE7 A;  3UO9 A;  1XK4 C;  2KI4 C;  1TN4 A;  3C1V A;  2KYF A;  1ZMZ A;  1SW8 A;  1OMV A;  1TCO B;  2F33 A;  4IJ7 A;  5BPJ A;  4AQI A;  1SBJ A;  1CFP A;  2EC6 C;  2SAS A;  1IQ5 A;  1TNQ A;  4P2Y B;  5CPV A;  5CSF A;  3PM2 A;  1OSA A;  1WRK A;  1NWD A;  2BCA A;  3NXA A;  5D69 A;  5F6T A;  1YX8 A;  3SJS A;  1GQM A;  3NSI A;  1L2O C;  3SG5 A;  1BG1 A;  4M2O A;  1EH2 A;  3B86 A;  1B8C A;  1M31 A;  1UP5 A;  1PSB A;  1E8A A;  1K8U A;  1UHH A;  2OS8 C;  2KAX A;  4MSP A;  1CFC A;  4JQ0 D;  1JBA A; 
#chains in the Genus database with same CATH homology
 4PHM A;  1UUS A;  5CSJ A;  1QIV A;  1B8L A;  3RM1 A;  1SPY A;  2PAL A;  1J7Q A;  1OQP A;  1N2D A;  3I5G B;  1K94 A;  1EL4 A;  1QLK A;  2F2O A;  1IJ5 A;  2LUC A;  3OX6 A;  2K7B A;  3BYA A;  4MRX A;  2BBM A;  1F71 A;  1WLM A;  4QJ3 B;  5KSZ A;  2MHH A;  2BEC A;  3DVE A;  5AEQ A;  3EVU A;  1WRL A;  2Y1M A;  2M97 A;  3CWG A;  2H61 C;  1WY9 A;  1YRT B;  3PFV A;  4L9M A;  3OP0 A;  2ZN9 A;  1UUR A;  4QJ5 B;  1KQV A;  2HET A;  1KWO C;  1BF5 A;  5AAN A;  3TS5 C;  3DVK A;  1RFJ A;  4N5X A;  1F70 A;  1KSO A;  2LNK A;  2HF5 A;  4OVN F;  1IG5 A;  5I2Q A;  1SKT A;  3PAL A;  4DUQ A;  2KI6 C;  4NDD A;  1BOD A;  3SG2 A;  1QAS A;  1BR1 B;  1UWO A;  1IKU A;  1LA0 A;  1RTP 1;  1J7R A;  1K9K A;  1NX3 A;  1U5I B;  2K8M B;  2LMT A;  2LUX A;  2LLU A;  1IQ3 A;  2LAP A;  1YTZ C;  1UHJ A;  4MLW A;  2COL B;  2FJU B;  1J7P A;  2M7N A;  4N1G A;  1H4B A;  2MJW B;  3IQO A;  3FIA A;  3VRN A;  5J3X A;  3GK1 A;  4PDZ A;  2ZRT A;  1YRU B;  5AFP A;  1PUL A;  2Q91 A;  2AUC A;  2TN4 A;  1OZO A;  2NCO A;  5K89 A;  3BUX B;  4ICB A;  4ORC B;  3LL8 B;  2KFF A;  1AJ5 A;  4GBA A;  1KQM B;  1TRF A;  1QX5 B;  4DCK A;  2WOR A;  1DGU A;  2ZFD A;  1IGV A;  4M2Q A;  1KWO B;  4HRE E;  3JVT C;  4YI8 A;  5B8I B;  4PE4 A;  5HLO A;  1KK8 B;  1CDN A;  2I7A A;  4FTG A;  2M9G A;  3VGO A;  2FOT A;  1RWY A;  2KFH A;  2KGB C;  4M2P A;  4XJK A;  4WRI A;  1FI5 A;  1QX7 A;  2KQ6 A;  2BCB A;  1DJI A;  1A2X A;  1NYA A;  1B7T Y;  3O2P A;  3BQ3 A;  2OPO A;  2L4I A;  2NXQ A;  2KAV A;  3JTD C;  4JPZ B;  3BXK A;  2KHN A;  2RGI A;  1B1G A;  2JOJ A;  1CDL A;  5AXI A;  4I5L B;  5HLV A;  1DTL A;  3PSR A;  2PRU A;  4HRG A;  4YBH B;  2JU0 A;  3TDI A;  3GK2 A;  1SL7 A;  2L2E A;  1MHO A;  1QV1 A;  2L51 A;  3KEV A;  1YUS A;  4YGC B;  3SG4 A;  2JC2 A;  1SL9 A;  1DJZ A;  2CT9 A;  4GAO A;  4MN0 A;  3VRO A;  2F3Z A;  1CTR A;  2EGD A;  1CLB A;  1PRW A;  2LHI A;  4WQ2 A;  3DF0 B;  1A75 A;  1BMO A;  1Q80 A;  3FS7 A;  4WQ3 A;  4ZCV A;  2I2R E;  2JXC A;  5DKN A;  5DKQ A;  5AER A;  1AK8 A;  1F55 A;  4DS7 A;  1DMO A;  1IH0 A;  1ZUZ A;  3JVT B;  3IQQ A;  1BJF A;  2ZNE A;  1TNW A;  1SRA A;  1R6P A;  3NSO A;  1RRO A;  3AAK A;  1NCY A;  4R1E A;  1DF0 B;  2PAS A;  1FW4 A;  3O6B A;  2Q4U A;  1SCM C;  3OB1 B;  2L50 A;  1ALW A;  1LXF C;  1M46 A;  1DJX A;  2LLS A;  1LA3 A;  2PMY A;  1S26 D;  4YGE B;  5IBW A;  3OB2 B;  1RJV A;  3PLF B;  2GGM A;  4OKH A;  2AAO A;  3GOF A;  3I5H C;  4OV2 A;  5CSN A;  2JPT A;  3OX5 A;  2NZ0 A;  3I5F C;  1Y1U A;  3JTD B;  1CKK A;  2BE4 A;  3TZ1 A;  2KSP A;  2E30 A;  1M45 A;  3KHE A;  3GK4 X;  4IL1 A;  1IJ6 A;  2FCD A;  2PVB A;  3DVM A;  4OR9 B;  1NX2 A;  2LV7 A;  4GFT A;  1M63 B;  1K9U A;  2NLN A;  2KQY A;  1WDC C;  1WRZ A;  1JF2 A;  1B7T Z;  1NCZ A;  2R2I A;  5JOL A;  4MRY A;  2BCX A;  1K90 D;  1Y6W A;  2KNE A;  3KF9 A;  3ZNI A;  3PN7 C;  3A4U B;  1GGW A;  4CPV A;  3EKJ A;  1LKJ A;  3K21 A;  1XFW O;  2KGR A;  4CLN A;  4TNC A;  1J7O A;  4USL A;  4YGD B;  2KBI A;  2KDH A;  1S36 A;  1NX1 A;  1QJT A;  2BL0 C;  3EK8 A;  2KI4 B;  4HSZ A;  2MAZ A;  4AOM A;  2DOQ A;  2HPS A;  4MZJ A;  2JZI A;  1ZFS A;  4ORB B;  4CID A;  2ZND A;  5HKZ A;  1KCY A;  2EC6 B;  1XK4 A;  1L7Z A;  3I5H B;  4BY4 A;  4PE1 A;  1YR5 A;  5HKY A;  5HYD A;  2QAC A;  2VRG A;  3DD4 A;  5G08 A;  1L2O B;  1QS7 A;  4NQG A;  2LCP A;  2K61 A;  2OTG C;  1B9A A;  2M49 B;  1NCX A;  2E6W A;  1V1G A;  1XFX O;  2KYC A;  2OS8 B;  4GGN A;  1K93 D;  1N0Y A;  4ETO A;  1BR4 B;  3EK7 A;  1Y0V H;  3BUM B;  1BOC A;  4CFR A;  3WHT B;  1C07 A;  4DIR A;  3PN7 B;  3A8R A;  3AKA A;  3DVJ A;  1WLZ A;  5I8N A;  2JWW A;  1LVC D;  4I5N B;  1U5I A;  2L5X B;  1DVI A;  1DJH A;  1YX7 A;  3I5I C;  5I2L A;  4GGF C;  1MR8 A;  3EVV A;  1MWN A;  1JF0 A;  3BOW B;  2QPT A;  2BL0 B;  2PSR A;  1S6I A;  2BKH B;  2Y4Q A;  1B47 A;  1KK7 Y;  3D0Y B;  2MA2 A;  2G9B A;  2KOT A;  3EKH A;  1S1E A;  2IS9 A;  1PAL A;  2F8P A;  2M1U A;  4C0L A;  1BU3 A;  3HCM A;  1F4O A;  1QTX A;  3TS5 B;  1SNL A;  2M3W A;  2H61 A;  4PAL A;  3TUY C;  1S6C A;  3EK4 A;  1F4Q A;  2WCE A;  4GPL B;  2AMI A;  4MEW A;  1JC2 A;  2OTG B;  1QV0 A;  3WNX B;  2LM5 A;  2MRD A;  3QRX A;  1IWQ A;  3AKB A;  1EJ3 A;  1SY9 A;  4I5K A;  3AAJ A;  1MXL C;  1DT7 B;  3BUN B;  2K2A A;  3KPX A;  2CBL A;  1QIW A;  4NDC A;  1MXE A;  1XA5 A;  2ZN8 A;  2WC8 A;  4YI9 A;  1XYD A;  1F54 A;  3FWB A;  2KI6 D;  1N65 A;  1W7I B;  2O5G A;  4U8D A;  3WXA A;  3I5I B;  1CDP A;  4PHN A;  3SIA A;  4GUK A;  1XO5 A;  3CS1 A;  3ICB A;  1PSR A;  2LLT A;  3D10 A;  1XFY O;  2JT0 A;  4YGA A;  3PM8 A;  1C7W A;  3BUO B;  2K7D A;  1CM4 A;  2WND A;  5GQQ C;  4PE0 A;  4YRU A;  2WOS A;  3SG7 A;  1Y1A A;  3WHU B;  1EXR A;  1YUT A;  2LP3 A;  1CFF A;  1IRJ A;  2M0R A;  3LLE A;  2LAN A;  4E68 A;  1ZOT B;  3DF0 A;  3FWC A;  1SCV A;  5I2O A;  1KK7 Z;  1NSH A;  1XFV O;  1CNP A;  1CB1 A;  2LVJ A;  3HX4 A;  2P6B B;  4FQO A;  1DF0 A;  4N1F A;  2BE6 A;  1BT6 A;  2JTZ A;  4MZL A;  4MVF A;  1W7J B;  4P5O E;  2BBN A;  2D8N A;  1CFD A;  1CDM A;  5TNC A;  5KTY A;  2JTT A;  3I5G C;  1CLM A;  2K2F A;  1K2H A;  1RK9 A;  1QVI Y;  1UHK A;  1DJW A;  1MQ1 A;  1JSA A;  2A4J A;  5KU1 A;  1YUU A;  1JFJ A;  1CMF A;  3CR2 A;  4CFQ A;  1S5G Y;  1H8B A;  1V1F A;  1Y1X A;  4XYN A;  1DGV A;  2GGZ A;  3SG3 A;  2JUL A;  2LP2 A;  2SCP A;  4D1E A;  3H4S E;  3EVR A;  2WCF A;  2L0P A;  1KFX L;  1REC A;  1J1E A;  3O4Y A;  3NSL A;  3LCP C;  2O60 A;  4BY5 A;  5DKR A;  4HRH A;  1X02 A;  2MLF C;  1YVL A;  4PCW A;  4C0K A;  1AHR A;  1SCM B;  1XFZ O;  5CSI A;  3MSE B;  1K96 A;  1NPQ A;  3CR5 X;  2CNP A;  2Y5I A;  4DRW A;  3CTN A;  1KSM A;  2K0J A;  2M7L A;  1TTX A;  4GNK B;  1NUB A;  2JT3 A;  1KFX S;  3PAT A;  3LK1 A;  3I5F B;  5HKW A;  2GV5 A;  1JFK A;  4UPG A;  1UHI A;  3ZWH A;  2LE9 B;  1YVH A;  1SK6 D;  3KO0 A;  2CXJ A;  5JJG A;  2LMU A;  1SYM A;  1A4P A;  1HT9 A;  1ZAC A;  2NCP A;  4ZCU A;  4A4C A;  1G33 A;  1WDC B;  1C7V A;  1B8R A;  1TIZ A;  2G2B A;  1M39 A;  2M1K B;  2MLE C;  5FYX A;  3M0W A;  1A03 A;  2LHL A;  1TNX A;  1KQM C;  1QXP A;  1QVI Z;  1R2U A;  2KBM A;  1TCF A;  3CR4 X;  3O78 A;  2K7O A;  1MUX A;  1VRK A;  1YUR A;  5ER4 X;  1S5G Z;  1B4C A;  1K95 A;  1J55 A;  1QLS A;  1G4Y R;  1G8I A;  1HQV A;  1KK8 C;  1MF8 B;  3IF7 A;  4MBE A;  4ORA B;  1J1D A;  3NSK A;  2H2K A;  2KFG A;  3LK0 A;  1S6J A;  1SR6 C;  1OZS A;  1SL8 A;  1DJY A;  1LIN A;  2L98 A;  1GGZ A;  2JNF A;  1PK0 D;  3CGA A;  2JRF A;  1FBV A;  2V53 A;  1BLQ A;  2JQ6 A;  3BOW A;  1D1O A;  1UHN A;  3BUW B;  3VRP A;  1JUO A;  1JWD A;  2LMV A;  3D0Y A;  1K9P A;  2ISD A;  3CZT X;  2I94 A;  4YGB B;  1OOJ A;  2L4H A;  2KAY A;  2HQW A;  3RLZ A;  1AP4 A;  1NP8 A;  1XVJ A;  4MZK A;  1QAT A;  1SMG A;  2M8U A;  1CLL A;  1AUI B;  1PVB A;  1F8H A;  3SG6 A;  1KFU L;  1FI6 A;  2F3Y A;  5ER5 A;  3SIB A;  1CMG A;  1QX2 A;  4OCI A;  1NIW A;  4XJK B;  3OHM B;  3TDU A;  1OMR A;  1OMD A;  2FCE A;  2F2P A;  1EG4 A;  1S3P A;  1GJY A;  2LVV A;  3VRR A;  5D7F A;  1SR6 B;  1KFU S;  4C0J A;  5PAL A;  4QJ4 B;  2JT8 A;  1TNP A;  2HQ8 A;  4GGF A;  1TOP A;  3VRQ A;  3F45 A;  1AJ4 A;  4PHK A;  1FPW A;  2EHB A;  3TDZ A;  1NX0 A;  2CCM A;  1A29 A;  2I18 A;  2M29 A;  1AVS A;  2K7C A;  3TUY B;  1CM1 A;  2JNX A;  2ZRS A;  2JXL A;  2CTN A;  2LC5 A;  2LVI A;  1A75 B;  1OE9 B;  4PHJ A;  3E3R A;  1DJG A;  1ODB A;  1EG3 A;  1ALV A;  2ZKM X;  2LVK A;  4A4B A;  2BKI B;  4Q04 A;  2Y1N A;  4I5J A;  3CLN A;  4NDB A;  4JWQ A;  2WCB A;  4AQJ A;  1PVA A;  2MBX A;  1FF1 A;  2B1U A;  4F0Z B;  1XFU O;  4PE7 A;  1XK4 C;  2KI4 C;  1TN4 A;  3C1V A;  2KYF A;  1ZMZ A;  1SW8 A;  1OMV A;  1TCO B;  2F33 A;  5BPJ A;  4AQI A;  1SBJ A;  1CFP A;  2EC6 C;  2SAS A;  1IQ5 A;  1TNQ A;  4P2Y B;  5CPV A;  5CSF A;  1OSA A;  1WRK A;  1NWD A;  2BCA A;  3NXA A;  5D69 A;  5F6T A;  1YX8 A;  3SJS A;  1GQM A;  3NSI A;  1L2O C;  3SG5 A;  1BG1 A;  4M2O A;  1EH2 A;  1B8C A;  1M31 A;  1UP5 A;  1PSB A;  1E8A A;  1K8U A;  1UHH A;  2OS8 C;  2KAX A;  4MSP A;  1CFC A;  4JQ0 D;  1JBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...