1XFYO

Crystal structure of anthrax edema factor (ef) in complex with calmodulin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
146
structure length
146
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDQMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin-sensitive adenylate cyclase
publication title Calcium-independent calmodulin binding and two-metal-ion catalytic mechanism of anthrax edema factor.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Lyase/metal binding protein
total genus 34
structure length 146
sequence length 146
chains with identical sequence P, Q, R, S, T
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfyO02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfyO01
1IJ5A 3EVVA 2LVKA 1QXPA 2LHIA 3SJSA 4YRUA 1BG1A 1XYDA 3PN7C 1LA0A 1BLQA 1MXEA 1Y1AA 2CNPA 2K2FA 1J7OA 3KF9A 3TDUA 5I2OA 4JQ0D 4AQJA 1EJ3A 3JTDB 2LP2A 1WY9A 1YX7A 4PE7A 2F8PA 4R1EA 2SASA 1UWOA 1WRKA 4P2YB 4PE1A 2KI4B 3BUNB 2NCOA 1F4QA 2JOJA 2LV7A 3BQ3A 4PE4A 5JOLA 4HRHA 5G08A 4XJKA 5HLOA 3SG3A 1L7ZA 4C0JA 3EVRA 4PE0A 3AAJA 4GAOA 1QASA 2WCBA 1XK4C 1CLMA 3AKBA 2LAPA 1EL4A 1SL8A 2LANA 2L4HA 2Q91A 4C0KA 2KAYA 1KK7Z 2L5XB 4PHKA 2EGDA 2RGIA 4ICBA 1NCXA 4P5OE 1A29A 3PATA 1UHKA 2HETA 3JVTC 5CPVA 1K90D 3SG2A 3GK1A 2G2BA 1SBJA 2ZRTA 1CMFA 2KGRA 1JFKA 1PALA 2I18A 2KNEA 1C07A 1JWDA 2LC5A 3I5GC 1CFDA 1B1GA 1CNPA 1NX0A 3E3RA 1DJYA 2BECA 2L2EA 1ODBA 2O60A 1FPWA 2P6BB 1PRWA 1YVHA 1YR5A 5KTYA 1OSAA 4A4BA 2PMYA 4PALA 2GV5A 2PSRA 1BU3A 1J7PA 1AJ5A 3TDZA 1CFPA 1ZOTB 1QVIY 1AP4A 1KSMA 1C7VA 2KHNA 2F2OA 2ZRSA 3JVTB 1MUXA 4JWQA 1BOCA 1XK4A 1TNXA 1YRUB 2JT0A 2K7DA 1K96A 1BR4B 4ZCUA 2Y5IA 3CR4X 4N1FA 3GOFA 1IJ6A 1G8IA 1M39A 2EHBA 3HX4A 1QJTA 3OB2B 2M8UA 1KQVA 1MXLC 1BT6A 2KFHA 2FJUB 4PHNA 4MRXA 1CDMA 1DJIA 1SCMC 4NDCA 1B4CA 3VROA 1U5IA 3LLEA 2E30A 2KOTA 1R2UA 1AK8A 1CB1A 1KWOC 1B9AA 1NYAA 1ALVA 2JNFA 2QACA 3A8RA 1ZUZA 3VRNA 1AVSA 2M0RA 1OMDA 4OCIA 1JUOA 1CKKA 4OKHA 1PSBA 5AEQA 2BE4A 1F54A 3EK7A 3EKJA 4CLNA 3IF7A 2KYFA 2WCFA 2K7BA 5D7FA 2L0PA 1IH0A 2LP3A 2PASA 2EC6C 2I7AA 4I5KA 2NZ0A 1KFUS 2BCAA 2JQ6A 1HQVA 4ZCVA 1S36A 2K8MB 3DVEA 3OHMB 1K9UA 1DTLA 2M1KB 3F45A 1LKJA 1FI6A 1TCOB 4USLA 1TCFA 1UHJA 1KWOB 1MQ1A 4AOMA 4GPLB 2BCBA 2CTNA 5CSJA 4QJ4B 3O78A 1OQPA 1AJ4A 1Y1XA 4PCWA 2JNXA 1A03A 1RK9A 4MVFA 2AAOA 3I5IC 1GGZA 1CDPA 1TNWA 4I5JA 4MZLA 1S3PA 2KI6D 1OMVA 2MA2A 4GFTA 1SRAA 2ZN8A 1M45A 1DF0B 2KAXA 1MWNA 2EC6B 1AUIB 2H61A 3DF0A 3NSKA 1JFJA 2H2KA 1SL7A 1NP8A 2SCPA 1MHOA 3RM1A 2KQ6A 2LUXA 5HKYA 3VRRA 1A75A 1KCYA 1SYMA 2I94A 5TNCA 1OMRA 1DJZA 1CFCA 1H4BA 2CBLA 4DUQA 3LK1A 2ZFDA 2MRDA 1DJWA 1K9KA 5B8IB 4AQIA 2O5GA 3PALA 1EXRA 1DMOA 3CWGA 3O4YA 3NSOA 1BF5A 1W7JB 2LLUA 1XVJA 1CM1A 2WCEA 3GK2A 3I5IB 1TIZA 4MBEA 3TUYB 1B8CA 2LNKA 1NX2A 4XYNA 1IGVA 1JSAA 2G9BA 1F4OA 2MLEC 4M2OA 1F8HA 1SPYA 1B47A 2TN4A 1CDLA 2LLTA 4JPZB 4XJKB 2JTZA 2KGBC 2M97A 2NCPA 4YGDB 3NSLA 1YUUA 1PVBA 1ALWA 1KQMC 1EH2A 3TS5C 1N65A 2HQWA 2LMUA 4GUKA 1FF1A 1SNLA 4DS7A 3LCPC 1ZFSA 1B7TY 2BBNA 2F3ZA 3CLNA 3PN7B 1SW8A 5I2QA 1TN4A 1LVCD 1J1EA 1YRTB 4DIRA 2K7OA 1NUBA 5HKZA 4FQOA 3VGOA 3SG7A 3WHUB 4NQGA 1CFFA 1IG5A 1S6JA 4BY4A 1JF2A 1NPQA 3PSRA 1UUSA 1SCVA 3DVMA 3RLZA 4MEWA 3DVJA 1JC2A 3SG4A 1QS7A 1B8RA 1QATA 1SR6C 1KQMB 3AKAA 3WHTB 3TS5B 5I8NA 1QLKA 1KFXS 1BJFA 4OR9B 1G4YR 1S5GY 4HSZA 1GGWA 2MAZA 5KSZA 4OVNF 4QJ3B 1A4PA 1K95A 2KYCA 4C0LA 4ETOA 4GGNA 2JT8A 1J1DA 2JPTA 1L2OC 1TRFA 4M2PA 1Q80A 1ZMZA 5CSIA 1EG3A 4NDDA 3DVKA 4TNCA 3A4UB 1XFYO 1QX7A 1QLSA 4GGFA 4WQ2A 1SR6B 1Y0VH 1S6CA 1Y1UA 1AHRA 2LMVA 3PM8A 1U5IB 3MSEB 3TZ1A 1R6PA 1CDNA 3I5GB 2F2PA 1GJYA 3BUWB 4YBHB 4YGAA 2AUCA 5HLVA 1N0YA 2E6WA 1DJGA 5JJGA 4IL1A 3H4SE 3CR2A 2BKIB 3ZNIA 1M46A 1BR1B 1PK0D 5AXIA 1V1FA 1J55A 2M1UA 3EK4A 4PHJA 2BL0C 2H61C 1RECA 3OB1B 5AANA 1KK7Y 2MLFC 5AERA 2WORA 3WNXB 1TTXA 1YTZC 4CPVA 3D0YA 2NLNA 3NSIA 3LL8B 1WRZA 2B1UA 3CGAA 4BY5A 2Y1MA 1NIWA 3M0WA 2L4IA 1SCMB 3AAKA 1DGUA 1DVIA 1M31A 4WQ3A 5GQQC 1NWDA 5HKWA 5FYXA 2BL0B 3DF0B 2IS9A 1IWQA 2BE6A 5ER5A 3VRQA 1V1GA 2FCDA 1JBAA 1LXFC 3BXKA 2OS8C 1A75B 2ISDA 4DRWA 1SKTA 2HPSA 3BUMB 2WOSA 1NCYA 3DD4A 2JU0A 2F33A 1F71A 1B8LA 2M7LA 2JULA 3NXAA 5AFPA 2KI6C 2LMTA 1QIVA 1WDCC 2JWWA 1TOPA 1W7IB 2JTTA 1NX3A 3SG5A 1PSRA 1YUSA 4DCKA 1YUTA 4MSPA 2OS8B 4N1GA 3ICBA 1JF0A 1XFVO 1OZSA 2MJWB 1OOJA 5F6TA 1S1EA 3LK0A 5BPJA 1DT7B 1RJVA 2KFGA 1TNQA 1CLBA 1E8AA 2DOQA 1A2XA 3CS1A 2PALA 3TDIA 1F70A 2JC2A 1YX8A 4E68A 5DKQA 1WDCB 3OX6A 1XFXO 1D1OA 1SL9A 4ORAB 4ORCB 3C1VA 2GGZA 5D69A 4MZKA 2K0JA 1WLMA 4F0ZB 2LCPA 5KU1A 1X02A 2R2IA 3BUXB 1IRJA 2V53A 1K93D 2QPTA 4GGFC 2KBIA 1S26D 1KSOA 1YURA 1K2HA 1QVIZ 1K9PA 4I5LB 2L51A 2MBXA 3BOWA 1YVLA 4PHMA 1CM4A 2FOTA 4QJ5B 3CR5X 2OPOA 3KHEA 4CFRA 4PDZA 4A4CA 3CTNA 1G33A 2D8NA 4GBAA 1RTP1 2JZIA 2LE9B 5J3XA 2JT3A 4U8DA 2Y4QA 5K89A 4N5XA 1OZOA 4UPGA 4ORBB 3BYAA 4I5NB 3PLFB 1KFUL 1QX2A 1M63B 1CTRA 1DJXA 2ZNEA 2A4JA 2Q4UA 1IQ5A 3ZWHA 1FBVA 2KDHA 1QV0A 4MRYA 1NX1A 1NSHA 2ZNDA 1Y6WA 3K21A 4YGCB 2I2RE 3FS7A 2AMIA 3HCMA 2LUCA 2CT9A 4MLWA 4L9MA 3O6BA 2KSPA 3WXAA 2M9GA 2VRGA 4CIDA 2LM5A 4YI8A 2KQYA 1PULA 2BKHB 1N2DA 1S6IA 2CXJA 2LHLA 3I5FC 1CMGA 4M2QA 3I5HC 1FI5A 1RWYA 3D0YB 4HREE 3QRXA 1UHHA 1XA5A 2KBMA 1L2OB 3EK8A 1UHNA 2M49B 2COLB 1KK8C 3IQOA 2L98A 1IQ3A 5ER4X 2ZKMX 3SIBA 2K2AA 2LLSA 2K7CA 4NDBA 2MHHA 5DKNA 2FCEA 4WRIA 1HT9A 2F3YA 2BBMA 4D1EA 1QTXA 4CFQA 1J7QA 3I5FB 1IKUA 1UHIA 4YGEB 3D10A 3KO0A 3I5HB 1J7RA 5CSFA 1DGVA 1SK6D 3KPXA 4Q04A 3OX5A 2GGMA 1NCZA 2JRFA 3FWCA 1MF8B 1KK8B 1BODA 1ZACA 1XFWO 2WC8A 3SIAA 4MN0A 1FW4A 1XFZO 2PVBA 1K8UA 5HYDA 1LINA 1XFUO 2JXCA 2LVIA 2L50A 1QX5B 4HRGA 4OV2A 2WNDA 1XO5A 1EG4A 2HF5A 1F55A 1VRKA 1OE9B 3FIAA 2Y1NA 5I2LA 2JXLA 1BMOA 1MR8A 1C7WA 1UP5A 1SY9A 3PFVA 3VRPA 1QV1A 4FTGA 2OTGC 2M29A 2M7NA 2K61A 3EVUA 3GK4X 1RROA 1KFXL 3FWBA 1B7TZ 5PALA 3TUYC 2HQ8A 2M3WA 1DJHA 4YI9A 2ZN9A 2BCXA 3CZTX 3OP0A 3EKHA 2LVJA 2PRUA 3IQQA 1WLZA 4YGBB 3BUOB 2KFFA 1SMGA 5DKRA 1CLLA 1UURA 2CCMA 2LVVA 1TNPA 1GQMA 1K94A 1LA3A 3KEVA 5IBWA 1DF0A 1RFJA 3JTDC 1QIWA 2OTGB 3O2PA 4GNKB 3SG6A 1WRLA 2NXQA 4MZJA 1PVAA 1S5GZ 2KAVA 5CSNA 1H8BA 2KI4C 3BOWB
chains in the Genus database with same CATH superfamily
1IJ5A 3EVVA 2LVKA 1QXPA 2LHIA 3SJSA 4YRUA 1BG1A 1XYDA 2PQLA 3PN7C 1LA0A 4PT1A 2P70A 3L47A 1BLQA 1MXEA 1Y1AA 2CNPA 2K2FA 1J7OA 3L4LA 3B88A 3KF9A 3TDUA 2ERBA 5I2OA 4JQ0D 4AQJA 1EJ3A 3JTDB 2LP2A 1WY9A 1YX7A 4PE7A 2F8PA 4R1EA 2SASA 1UWOA 1WRKA 4P2YB 4PE1A 2KI4B 3BUNB 2NCOA 1F4QA 2JOJA 2LV7A 3BQ3A 4PE4A 5JOLA 4HRHA 5G08A 4XJKA 5HLOA 3SG3A 1L7ZA 4C0JA 3EVRA 4PE0A 3AAJA 3D73A 4GAOA 1QASA 2WCBA 1XK4C 1CLMA 3AKBA 2LAPA 1EL4A 3DZTA 1OOGA 1SL8A 2LANA 2L4HA 2Q91A 4C0KA 2KAYA 1KK7Z 1DC1A 2L5XB 4PHKA 2EGDA 2RGIA 4ICBA 1NCXA 4P5OE 1A29A 3PATA 1UHKA 2HETA 3JVTC 5CPVA 1K90D 3SG2A 3GK1A 2G2BA 1SBJA 2ZRTA 1CMFA 2KGRA 1JFKA 1PALA 2I18A 2KNEA 3PM2A 1C07A 3CYZA 1JWDA 1OOFA 2LC5A 3I5GC 1CFDA 1B1GA 1CNPA 1NX0A 3E3RA 1DJYA 2BECA 2L2EA 1ODBA 1OW4A 2O60A 1FPWA 2P6BB 1PRWA 1YVHA 1YR5A 5KTYA 3NGVA 1OSAA 4A4BA 2PMYA 4PALA 2GV5A 2PSRA 1BU3A 1J7PA 1AJ5A 3TDZA 2QEVA 1CFPA 1ZOTB 1QVIY 1AP4A 1KSMA 1C7VA 2KHNA 2F2OA 2ZRSA 3JVTB 1MUXA 3CZ0A 2WC6A 3N7HA 1XK4A 1TNXA 1YRUB 2JT0A 2K7DA 1K96A 1BR4B 3K1EA 4ZCUA 2Y5IA 3CR4X 4N1FA 3GOFA 3D74A 3S0AA 1IJ6A 1G8IA 1M39A 2EHBA 3HX4A 1QJTA 3OB2B 2M8UA 1KQVA 1MXLC 1BT6A 2KFHA 2FJUB 4PHNA 4MRXA 1CDMA 1DJIA 1SCMC 4NDCA 3OBVA 4F7FA 1B4CA 3VROA 1U5IA 3LLEA 2E30A 2KLDA 2KOTA 1R2UA 3D78A 1AK8A 1CB1A 1KWOC 1B9AA 2KPHA 1NYAA 1ALVA 2JNFA 2QACA 3A8RA 1ZUZA 3VRNA 1AVSA 2M0RA 1OMDA 4OCIA 5FI6A 1JUOA 1CKKA 4OKHA 1PSBA 5AEQA 2BE4A 1F54A 3EK7A 3EKJA 3PJIA 4CLNA 3IF7A 2KYFA 2WCFA 2K7BA 5D7FA 2L0PA 1IH0A 3L4AA 2LP3A 2PASA 2EC6C 2I7AA 4I5KA 2NZ0A 1KFUS 2BCAA 2JQ6A 1HQVA 3BJHA 4ZCVA 1S36A 2K8MB 3DVEA 5I94A 3OHMB 3VB1A 1K9UA 2BAPA 1DTLA 2M1KB 3F45A 1LKJA 1FI6A 1Z2CB 1TCOB 4USLA 1TCFA 1UHJA 1KWOB 1MQ1A 4AOMA 1TWOA 4GPLB 2BCBA 2CTNA 3CZ2A 5CSJA 3O78A 1OQPA 1AJ4A 1Y1XA 4PCWA 4QJ4B 2JNXA 1A03A 1RK9A 4MVFA 2AAOA 3I5IC 1GGZA 1CDPA 1TNWA 2QEHA 4I5JA 1S3PA 2KI6D 4MZLA 1OMVA 2MA2A 4GFTA 3RZSA 1SRAA 2ZN8A 1M45A 1DF0B 2KAXA 1MWNA 2EC6B 1AUIB 2H61A 3DF0A 3NSKA 1JFJA 2H2KA 1SL7A 1NP8A 2SCPA 2QEBA 1MHOA 3RM1A 2KQ6A 2LUXA 5HKYA 3VRRA 1A75A 1OOHA 1SYMA 2I94A 5TNCA 1OMRA 1KCYA 1DJZA 1CFCA 2FJYA 3D77A 1H4BA 2CBLA 4DUQA 3LK1A 2ZFDA 4JWQA 2MRDA 1DJWA 1K9KA 5B8IB 4AQIA 2O5GA 3PALA 1EXRA 1DMOA 3CWGA 3O4YA 3NSOA 1BF5A 1W7JB 2LLUA 1XVJA 1CM1A 2WCEA 3GK2A 3I5IB 1TIZA 4MBEA 3TUYB 1B8CA 2LNKA 1NX2A 2K60A 4XYNA 3DYEA 1IGVA 1JSAA 2G9BA 1F4OA 2MLEC 3DXLA 4M2OA 1F8HA 1SPYA 1GM0A 1B47A 2TN4A 1CDLA 2LLTA 4JPZB 4XJKB 2JTZA 2KGBC 2M97A 2NCPA 4YGDB 1C3YA 3NSLA 1YUUA 1PVBA 1ALWA 1KQMC 1EH2A 3TS5C 1N65A 2HQWA 2LMUA 4GUKA 1FF1A 1SNLA 4DS7A 3B7AA 3LCPC 1ZFSA 1B7TY 2BBNA 2F3ZA 3CLNA 3PN7B 4IJ7A 1SW8A 3Q8IA 5I2QA 1TN4A 1LVCD 1SSEB 1J1EA 3R1VA 1YRTB 4DIRA 3D76A 2K7OA 1NUBA 5HKZA 4FQOA 3VGOA 3SG7A 3WHUB 4NQGA 1CFFA 1IG5A 1S6JA 4BY4A 1JF2A 1NPQA 3PSRA 1UUSA 1SCVA 3DVMA 3DY9A 3RLZA 4MEWA 3DVJA 1JC2A 3B87A 3SG4A 1QS7A 1B8RA 1QATA 1SR6C 1KQMB 3AKAA 3WHTB 3TS5B 5I8NA 1QLKA 4INWA 1KFXS 1BJFA 1C3ZA 4OR9B 1G4YR 1S5GY 4HSZA 1GGWA 2H8VA 2MAZA 5KSZA 4OVNF 4QJ3B 3OGNA 1A4PA 1K95A 2KYCA 4C0LA 4ETOA 4GGNA 2JT8A 1J1DA 2JPTA 1L2OC 1TRFA 2KLEA 1Q80A 1ZMZA 4M2PA 5CSIA 1EG3A 4NDDA 3DVKA 4TNCA 2YGUA 3A4UB 1XFYO 1QX7A 1QLSA 3CABA 4GGFA 1SR6B 4WQ2A 1Y0VH 1S6CA 1Y1UA 1AHRA 1P28A 2LMVA 3PM8A 3R1OA 1BOCA 1U5IB 3MSEB 3TZ1A 1R6PA 5HL1A 3I5GB 1CDNA 2F2PA 1GJYA 3BUWB 4YBHB 4YGAA 2AUCA 5HLVA 1N0YA 2E6WA 1IIOA 1DJGA 5JJGA 4FQTA 4IL1A 3H4SE 3CR2A 2BKIB 3ZNIA 1M46A 1BR1B 1PK0D 5AXIA 1V1FA 1J55A 2M1UA 3EK4A 4PHJA 3SS5A 2BL0C 1DELA 2H61C 1RECA 3OB1B 5AANA 1KK7Y 3SS3A 2MLFC 5AERA 2WORA 3WNXB 1TTXA 1YTZC 4CPVA 3D0YA 2NLNA 2WCHA 3NSIA 3LL8B 1W9ZA 4INXA 1WRZA 2B1UA 3CGAA 4BY5A 2Y1MA 1NIWA 3M0WA 2L4IA 1SCMB 3AAKA 1DGUA 1DVIA 1M31A 4WQ3A 5GQQC 1NWDA 5HKWA 5FYXA 2BL0B 3DF0B 2IS9A 1IWQA 2BE6A 5ER5A 3VRQA 1V1GA 3O4XA 4OZDA 2FCDA 3BFHA 1JBAA 1LXFC 3S0FA 3BXKA 2OS8C 1A75B 2ISDA 3IVTA 4DRWA 1SKTA 2HPSA 5FI2A 3BUMB 2WOSA 1NCYA 3DD4A 2JU0A 2F33A 1F71A 1B8LA 1XFRA 2M7LA 2JULA 3NXAA 5AFPA 2KI6C 2LMTA 1QIVA 1ORGA 1WDCC 2JWWA 1TOPA 1W7IB 2JTTA 1NX3A 2WC5A 3SG5A 1PSRA 1YUSA 4DCKA 1YUTA 2WCMA 4MSPA 2OS8B 4N1GA 3S0EA 3ICBA 1JF0A 1XFVO 1OZSA 2MJWB 1OOJA 5F6TA 4JKTA 1S1EA 3LK0A 5BPJA 1DT7B 1RJVA 2KFGA 1TNQA 1CLBA 1E8AA 2GTEA 2DOQA 1A2XA 3CS1A 2PALA 3B6XA 3BFBA 2JC2A 1YX8A 3D75A 3TDIA 5DKQA 4E68A 2P71A 1F70A 3NHTA 1WDCB 3OX6A 1XFXO 1D1OA 3BFAA 1SL9A 4ORAB 4ORCB 3C1VA 2GGZA 5D69A 4MZKA 2K0JA 1WLMA 4F0ZB 2L2CA 2LCPA 5KU1A 1X02A 2R2IA 3BUXB 1IRJA 2V53A 4JD9A 1K93D 2QPTA 4GGFC 3CDNA 2KBIA 1S26D 1KSOA 1YURA 1K2HA 1QVIZ 1K9PA 4I5LB 2L51A 2MBXA 3BOWA 1YVLA 4PHMA 4KYNA 1CM4A 3QMEA 2FOTA 4QJ5B 3CR5X 2OPOA 1DQEA 3KHEA 4PDZA 4A4CA 3CTNA 4CFRA 1G33A 2D8NA 3R72A 4GBAA 1RTP1 2JZIA 2LE9B 5J3XA 2JT3A 4U8DA 2Y4QA 5K89A 4N5XA 1OZOA 4UPGA 4ORBB 3BYAA 4I5NB 5DICA 3PLFB 3B86A 2PYQA 1TUZA 1KFUL 3SS4A 1QX2A 1M63B 2BNXA 1CTRA 1DJXA 3S0DA 3FE8A 2ZNEA 2A4JA 2Q4UA 1IQ5A 3ZWHA 1FBVA 2KDHA 1T14A 1QV0A 4MRYA 1NX1A 1NSHA 2ZNDA 1Y6WA 3K21A 4YGCB 2I2RE 5FI7A 3FS7A 2AMIA 3HCMA 2LUCA 2CT9A 4MLWA 2WCKA 3O6BA 2KSPA 4L9MA 3S0GA 3NHIA 3WXAA 2M9GA 2VRGA 4CIDA 2LM5A 4YI8A 2KQYA 1PULA 2BKHB 1N2DA 1S6IA 2CXJA 2LHLA 3I5FC 3R1PA 1CMGA 4M2QA 3I5HC 2WCJA 1FI5A 1RWYA 3D0YB 4HREE 3QRXA 2L5YA 1UHHA 1Z4HA 1XA5A 2KBMA 1L2OB 3EK8A 1UHNA 2M49B 2COLB 1KK8C 3IQOA 2L98A 1IQ3A 2JPOA 5ER4X 2ZKMX 3SIBA 5D3OA 1DEKA 2K2AA 2K7CA 2LLSA 2MHHA 4NDBA 5DKNA 2FCEA 4WRIA 1HT9A 2F3YA 2BBMA 4D1EA 1QTXA 4CFQA 1J7QA 3I5FB 1IKUA 1UHIA 4YGEB 3D10A 3KO0A 3I5HB 1J7RA 5CSFA 1DGVA 1SK6D 3KPXA 4Q04A 3OX5A 2GGMA 1NCZA 2JRFA 3FWCA 5EL2A 1MF8B 1KK8B 1BODA 1ZACA 1XFWO 2WC8A 3SIAA 4MN0A 1FW4A 1XFZO 2PVBA 1K8UA 5HYDA 1LINA 1XFUO 2JXCA 2LVIA 2L50A 1QX5B 3EG5B 4HRGA 1OOIX 2WNDA 4OV2A 3FE9A 1XO5A 1EG4A 2HF5A 1F55A 1VRKA 1OE9B 1TUJA 3FIAA 2Y1NA 5I2LA 2JXLA 1BMOA 1MR8A 1C7WA 1UP5A 1SY9A 3PFVA 2QDIA 1QV1A 4FTGA 2OTGC 2M29A 3VRPA 2M7NA 2K61A 3EVUA 3GK4X 1RROA 2WCLA 1KFXL 3FWBA 1B7TZ 2QEOA 5PALA 3TUYC 2HQ8A 2M3WA 1DJHA 4YI9A 2ZN9A 2BCXA 3CZTX 3OP0A 3EKHA 3CZ1A 2LVJA 3FE6A 2PRUA 1LS8A 3IQQA 3S0BA 3UO9A 1WLZA 4YGBB 1QWVA 3BUOB 2KFFA 1SMGA 3UNWA 5DKRA 1CLLA 1UURA 2CCMA 2LVVA 1TNPA 1GQMA 1K94A 1LA3A 3KEVA 5IBWA 1DF0A 1RFJA 3JTDC 1QIWA 2OTGB 3O2PA 4GNKB 3SG6A 1WRLA 3V2LA 2NXQA 4MZJA 1PVAA 1S5GZ 2KAVA 5CSNA 1H8BA 2KI4C 3BOWB
chains in the Genus database with same CATH topology
1IJ5A 3EVVA 2LVKA 1QXPA 2LHIA 3SJSA 4YRUA 1BG1A 1XYDA 3PN7C 1LA0A 1BLQA 1MXEA 1Y1AA 2CNPA 2K2FA 1J7OA 3KF9A 3TDUA 5I2OA 4JQ0D 4AQJA 1EJ3A 3JTDB 2LP2A 1WY9A 1YX7A 4PE7A 2F8PA 4R1EA 2SASA 1UWOA 1WRKA 4P2YB 4PE1A 2KI4B 3BUNB 2NCOA 1F4QA 2JOJA 2LV7A 3BQ3A 4PE4A 5JOLA 4HRHA 5G08A 4XJKA 5HLOA 3SG3A 1L7ZA 4C0JA 3EVRA 4PE0A 3AAJA 4GAOA 1QASA 2WCBA 1XK4C 1CLMA 3AKBA 2LAPA 1EL4A 1SL8A 2LANA 2L4HA 2Q91A 4C0KA 2KAYA 1KK7Z 2L5XB 4PHKA 2EGDA 2RGIA 4ICBA 1NCXA 4P5OE 1A29A 3PATA 1UHKA 2HETA 3JVTC 5CPVA 1K90D 3SG2A 3GK1A 2G2BA 1SBJA 2ZRTA 1CMFA 2KGRA 1JFKA 1PALA 2I18A 2KNEA 1C07A 1JWDA 2LC5A 3I5GC 1CFDA 1B1GA 1CNPA 1NX0A 3E3RA 1DJYA 2BECA 2L2EA 1ODBA 2O60A 1FPWA 2P6BB 1PRWA 1YVHA 1YR5A 5KTYA 1OSAA 4A4BA 2PMYA 4PALA 2GV5A 2PSRA 1BU3A 1J7PA 1AJ5A 3TDZA 1CFPA 1ZOTB 1QVIY 1AP4A 1KSMA 1C7VA 2KHNA 2F2OA 2ZRSA 3JVTB 1MUXA 4JWQA 1BOCA 1XK4A 1TNXA 1YRUB 2JT0A 2K7DA 1K96A 1BR4B 4ZCUA 2Y5IA 3CR4X 4N1FA 3GOFA 1IJ6A 1G8IA 1M39A 2EHBA 3HX4A 1QJTA 3OB2B 2M8UA 1KQVA 1MXLC 1BT6A 2KFHA 2FJUB 4PHNA 4MRXA 1CDMA 1DJIA 1SCMC 4NDCA 1B4CA 3VROA 1U5IA 3LLEA 2E30A 2KOTA 1R2UA 1AK8A 1CB1A 1KWOC 1B9AA 1NYAA 1ALVA 2JNFA 2QACA 3A8RA 1ZUZA 3VRNA 1AVSA 2M0RA 1OMDA 4OCIA 1JUOA 1CKKA 4OKHA 1PSBA 5AEQA 2BE4A 1F54A 3EK7A 3EKJA 4CLNA 3IF7A 2KYFA 2WCFA 2K7BA 5D7FA 2L0PA 1IH0A 2LP3A 2PASA 2EC6C 2I7AA 4I5KA 2NZ0A 1KFUS 2BCAA 2JQ6A 1HQVA 4ZCVA 1S36A 2K8MB 3DVEA 3OHMB 1K9UA 1DTLA 2M1KB 3F45A 1LKJA 1FI6A 1TCOB 4USLA 1TCFA 1UHJA 1KWOB 1MQ1A 4AOMA 4GPLB 2BCBA 2CTNA 5CSJA 4QJ4B 3O78A 1OQPA 1AJ4A 1Y1XA 4PCWA 2JNXA 1A03A 1RK9A 4MVFA 2AAOA 3I5IC 1GGZA 1CDPA 1TNWA 4I5JA 4MZLA 1S3PA 2KI6D 1OMVA 2MA2A 4GFTA 1SRAA 2ZN8A 1M45A 1DF0B 2KAXA 1MWNA 2EC6B 1AUIB 2H61A 3DF0A 3NSKA 1JFJA 2H2KA 1SL7A 1NP8A 2SCPA 1MHOA 3RM1A 2KQ6A 2LUXA 5HKYA 3VRRA 1A75A 1KCYA 1SYMA 2I94A 5TNCA 1OMRA 1DJZA 1CFCA 1H4BA 2CBLA 4DUQA 3LK1A 2ZFDA 2MRDA 1DJWA 1K9KA 5B8IB 4AQIA 2O5GA 3PALA 1EXRA 1DMOA 3CWGA 3O4YA 3NSOA 1BF5A 1W7JB 2LLUA 1XVJA 1CM1A 2WCEA 3GK2A 3I5IB 1TIZA 4MBEA 3TUYB 1B8CA 2LNKA 1NX2A 4XYNA 1IGVA 1JSAA 2G9BA 1F4OA 2MLEC 4M2OA 1F8HA 1SPYA 1B47A 2TN4A 1CDLA 2LLTA 4JPZB 4XJKB 2JTZA 2KGBC 2M97A 2NCPA 4YGDB 3NSLA 1YUUA 1PVBA 1ALWA 1KQMC 1EH2A 3TS5C 1N65A 2HQWA 2LMUA 4GUKA 1FF1A 1SNLA 4DS7A 3LCPC 1ZFSA 1B7TY 2BBNA 2F3ZA 3CLNA 3PN7B 1SW8A 5I2QA 1TN4A 1LVCD 1J1EA 1YRTB 4DIRA 2K7OA 1NUBA 5HKZA 4FQOA 3VGOA 3SG7A 3WHUB 4NQGA 1CFFA 1IG5A 1S6JA 4BY4A 1JF2A 1NPQA 3PSRA 1UUSA 1SCVA 3DVMA 3RLZA 4MEWA 3DVJA 1JC2A 3SG4A 1QS7A 1B8RA 1QATA 1SR6C 1KQMB 3AKAA 3WHTB 3TS5B 5I8NA 1QLKA 1KFXS 1BJFA 4OR9B 1G4YR 1S5GY 4HSZA 1GGWA 2MAZA 5KSZA 4OVNF 4QJ3B 1A4PA 1K95A 2KYCA 4C0LA 4ETOA 4GGNA 2JT8A 1J1DA 2JPTA 1L2OC 1TRFA 4M2PA 1Q80A 1ZMZA 5CSIA 1EG3A 4NDDA 3DVKA 4TNCA 3A4UB 1XFYO 1QX7A 1QLSA 4GGFA 4WQ2A 1SR6B 1Y0VH 1S6CA 1Y1UA 1AHRA 2LMVA 3PM8A 1U5IB 3MSEB 3TZ1A 1R6PA 1CDNA 3I5GB 2F2PA 1GJYA 3BUWB 4YBHB 4YGAA 2AUCA 5HLVA 1N0YA 2E6WA 1DJGA 5JJGA 4IL1A 3H4SE 3CR2A 2BKIB 3ZNIA 1M46A 1BR1B 1PK0D 5AXIA 1V1FA 1J55A 2M1UA 3EK4A 4PHJA 2BL0C 2H61C 1RECA 3OB1B 5AANA 1KK7Y 2MLFC 5AERA 2WORA 3WNXB 1TTXA 1YTZC 4CPVA 3D0YA 2NLNA 3NSIA 3LL8B 1WRZA 2B1UA 3CGAA 4BY5A 2Y1MA 1NIWA 3M0WA 2L4IA 1SCMB 3AAKA 1DGUA 1DVIA 1M31A 4WQ3A 5GQQC 1NWDA 5HKWA 5FYXA 2BL0B 3DF0B 2IS9A 1IWQA 2BE6A 5ER5A 3VRQA 1V1GA 2FCDA 1JBAA 1LXFC 3BXKA 2OS8C 1A75B 2ISDA 4DRWA 1SKTA 2HPSA 3BUMB 2WOSA 1NCYA 3DD4A 2JU0A 2F33A 1F71A 1B8LA 2M7LA 2JULA 3NXAA 5AFPA 2KI6C 2LMTA 1QIVA 1WDCC 2JWWA 1TOPA 1W7IB 2JTTA 1NX3A 3SG5A 1PSRA 1YUSA 4DCKA 1YUTA 4MSPA 2OS8B 4N1GA 3ICBA 1JF0A 1XFVO 1OZSA 2MJWB 1OOJA 5F6TA 1S1EA 3LK0A 5BPJA 1DT7B 1RJVA 2KFGA 1TNQA 1CLBA 1E8AA 2DOQA 1A2XA 3CS1A 2PALA 3TDIA 1F70A 2JC2A 1YX8A 4E68A 5DKQA 1WDCB 3OX6A 1XFXO 1D1OA 1SL9A 4ORAB 4ORCB 3C1VA 2GGZA 5D69A 4MZKA 2K0JA 1WLMA 4F0ZB 2LCPA 5KU1A 1X02A 2R2IA 3BUXB 1IRJA 2V53A 1K93D 2QPTA 4GGFC 2KBIA 1S26D 1KSOA 1YURA 1K2HA 1QVIZ 1K9PA 4I5LB 2L51A 2MBXA 3BOWA 1YVLA 4PHMA 1CM4A 2FOTA 4QJ5B 3CR5X 2OPOA 3KHEA 4CFRA 4PDZA 4A4CA 3CTNA 1G33A 2D8NA 4GBAA 1RTP1 2JZIA 2LE9B 5J3XA 2JT3A 4U8DA 2Y4QA 5K89A 4N5XA 1OZOA 4UPGA 4ORBB 3BYAA 4I5NB 3PLFB 1KFUL 1QX2A 1M63B 1CTRA 1DJXA 2ZNEA 2A4JA 2Q4UA 1IQ5A 3ZWHA 1FBVA 2KDHA 1QV0A 4MRYA 1NX1A 1NSHA 2ZNDA 1Y6WA 3K21A 4YGCB 2I2RE 3FS7A 2AMIA 3HCMA 2LUCA 2CT9A 4MLWA 4L9MA 3O6BA 2KSPA 3WXAA 2M9GA 2VRGA 4CIDA 2LM5A 4YI8A 2KQYA 1PULA 2BKHB 1N2DA 1S6IA 2CXJA 2LHLA 3I5FC 1CMGA 4M2QA 3I5HC 1FI5A 1RWYA 3D0YB 4HREE 3QRXA 1UHHA 1XA5A 2KBMA 1L2OB 3EK8A 1UHNA 2M49B 2COLB 1KK8C 3IQOA 2L98A 1IQ3A 5ER4X 2ZKMX 3SIBA 2K2AA 2LLSA 2K7CA 4NDBA 2MHHA 5DKNA 2FCEA 4WRIA 1HT9A 2F3YA 2BBMA 4D1EA 1QTXA 4CFQA 1J7QA 3I5FB 1IKUA 1UHIA 4YGEB 3D10A 3KO0A 3I5HB 1J7RA 5CSFA 1DGVA 1SK6D 3KPXA 4Q04A 3OX5A 2GGMA 1NCZA 2JRFA 3FWCA 1MF8B 1KK8B 1BODA 1ZACA 1XFWO 2WC8A 3SIAA 4MN0A 1FW4A 1XFZO 2PVBA 1K8UA 5HYDA 1LINA 1XFUO 2JXCA 2LVIA 2L50A 1QX5B 4HRGA 4OV2A 2WNDA 1XO5A 1EG4A 2HF5A 1F55A 1VRKA 1OE9B 3FIAA 2Y1NA 5I2LA 2JXLA 1BMOA 1MR8A 1C7WA 1UP5A 1SY9A 3PFVA 3VRPA 1QV1A 4FTGA 2OTGC 2M29A 2M7NA 2K61A 3EVUA 3GK4X 1RROA 1KFXL 3FWBA 1B7TZ 5PALA 3TUYC 2HQ8A 2M3WA 1DJHA 4YI9A 2ZN9A 2BCXA 3CZTX 3OP0A 3EKHA 2LVJA 2PRUA 3IQQA 1WLZA 4YGBB 3BUOB 2KFFA 1SMGA 5DKRA 1CLLA 1UURA 2CCMA 2LVVA 1TNPA 1GQMA 1K94A 1LA3A 3KEVA 5IBWA 1DF0A 1RFJA 3JTDC 1QIWA 2OTGB 3O2PA 4GNKB 3SG6A 1WRLA 2NXQA 4MZJA 1PVAA 1S5GZ 2KAVA 5CSNA 1H8BA 2KI4C 3BOWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJ5 A;  3EVV A;  2LVK A;  1QXP A;  2LHI A;  3SJS A;  4YRU A;  1BG1 A;  1XYD A;  3PN7 C;  1LA0 A;  1BLQ A;  1MXE A;  1Y1A A;  2CNP A;  2K2F A;  1J7O A;  3KF9 A;  3TDU A;  5I2O A;  4JQ0 D;  4AQJ A;  1EJ3 A;  3JTD B;  2LP2 A;  1WY9 A;  1YX7 A;  4PE7 A;  2F8P A;  4R1E A;  2SAS A;  1UWO A;  1WRK A;  4P2Y B;  4PE1 A;  2KI4 B;  3BUN B;  2NCO A;  1F4Q A;  2JOJ A;  2LV7 A;  3BQ3 A;  4PE4 A;  5JOL A;  4HRH A;  5G08 A;  4XJK A;  5HLO A;  3SG3 A;  1L7Z A;  4C0J A;  3EVR A;  4PE0 A;  3AAJ A;  4GAO A;  1QAS A;  2WCB A;  1XK4 C;  1CLM A;  3AKB A;  2LAP A;  1EL4 A;  1SL8 A;  2LAN A;  2L4H A;  2Q91 A;  4C0K A;  2KAY A;  1KK7 Z;  2L5X B;  4PHK A;  2EGD A;  2RGI A;  4ICB A;  1NCX A;  4P5O E;  1A29 A;  3PAT A;  1UHK A;  2HET A;  3JVT C;  5CPV A;  1K90 D;  3SG2 A;  3GK1 A;  2G2B A;  1SBJ A;  2ZRT A;  1CMF A;  2KGR A;  1JFK A;  1PAL A;  2I18 A;  2KNE A;  1C07 A;  1JWD A;  2LC5 A;  3I5G C;  1CFD A;  1B1G A;  1CNP A;  1NX0 A;  3E3R A;  1DJY A;  2BEC A;  2L2E A;  1ODB A;  2O60 A;  1FPW A;  2P6B B;  1PRW A;  1YVH A;  1YR5 A;  5KTY A;  1OSA A;  4A4B A;  2PMY A;  4PAL A;  2GV5 A;  2PSR A;  1BU3 A;  1J7P A;  1AJ5 A;  3TDZ A;  1CFP A;  1ZOT B;  1QVI Y;  1AP4 A;  1KSM A;  1C7V A;  2KHN A;  2F2O A;  2ZRS A;  3JVT B;  1MUX A;  4JWQ A;  1BOC A;  1XK4 A;  1TNX A;  1YRU B;  2JT0 A;  2K7D A;  1K96 A;  1BR4 B;  4ZCU A;  2Y5I A;  3CR4 X;  4N1F A;  3GOF A;  1IJ6 A;  1G8I A;  1M39 A;  2EHB A;  3HX4 A;  1QJT A;  3OB2 B;  2M8U A;  1KQV A;  1MXL C;  1BT6 A;  2KFH A;  2FJU B;  4PHN A;  4MRX A;  1CDM A;  1DJI A;  1SCM C;  4NDC A;  1B4C A;  3VRO A;  1U5I A;  3LLE A;  2E30 A;  2KOT A;  1R2U A;  1AK8 A;  1CB1 A;  1KWO C;  1B9A A;  1NYA A;  1ALV A;  2JNF A;  2QAC A;  3A8R A;  1ZUZ A;  3VRN A;  1AVS A;  2M0R A;  1OMD A;  4OCI A;  1JUO A;  1CKK A;  4OKH A;  1PSB A;  5AEQ A;  2BE4 A;  1F54 A;  3EK7 A;  3EKJ A;  4CLN A;  3IF7 A;  2KYF A;  2WCF A;  2K7B A;  5D7F A;  2L0P A;  1IH0 A;  2LP3 A;  2PAS A;  2EC6 C;  2I7A A;  4I5K A;  2NZ0 A;  1KFU S;  2BCA A;  2JQ6 A;  1HQV A;  4ZCV A;  1S36 A;  2K8M B;  3DVE A;  3OHM B;  1K9U A;  1DTL A;  2M1K B;  3F45 A;  1LKJ A;  1FI6 A;  1TCO B;  4USL A;  1TCF A;  1UHJ A;  1KWO B;  1MQ1 A;  4AOM A;  4GPL B;  2BCB A;  2CTN A;  5CSJ A;  4QJ4 B;  3O78 A;  1OQP A;  1AJ4 A;  1Y1X A;  4PCW A;  2JNX A;  1A03 A;  1RK9 A;  4MVF A;  2AAO A;  3I5I C;  1GGZ A;  1CDP A;  1TNW A;  4I5J A;  4MZL A;  1S3P A;  2KI6 D;  1OMV A;  2MA2 A;  4GFT A;  1SRA A;  2ZN8 A;  1M45 A;  1DF0 B;  2KAX A;  1MWN A;  2EC6 B;  1AUI B;  2H61 A;  3DF0 A;  3NSK A;  1JFJ A;  2H2K A;  1SL7 A;  1NP8 A;  2SCP A;  1MHO A;  3RM1 A;  2KQ6 A;  2LUX A;  5HKY A;  3VRR A;  1A75 A;  1KCY A;  1SYM A;  2I94 A;  5TNC A;  1OMR A;  1DJZ A;  1CFC A;  1H4B A;  2CBL A;  4DUQ A;  3LK1 A;  2ZFD A;  2MRD A;  1DJW A;  1K9K A;  5B8I B;  4AQI A;  2O5G A;  3PAL A;  1EXR A;  1DMO A;  3CWG A;  3O4Y A;  3NSO A;  1BF5 A;  1W7J B;  2LLU A;  1XVJ A;  1CM1 A;  2WCE A;  3GK2 A;  3I5I B;  1TIZ A;  4MBE A;  3TUY B;  1B8C A;  2LNK A;  1NX2 A;  4XYN A;  1IGV A;  1JSA A;  2G9B A;  1F4O A;  2MLE C;  4M2O A;  1F8H A;  1SPY A;  1B47 A;  2TN4 A;  1CDL A;  2LLT A;  4JPZ B;  4XJK B;  2JTZ A;  2KGB C;  2M97 A;  2NCP A;  4YGD B;  3NSL A;  1YUU A;  1PVB A;  1ALW A;  1KQM C;  1EH2 A;  3TS5 C;  1N65 A;  2HQW A;  2LMU A;  4GUK A;  1FF1 A;  1SNL A;  4DS7 A;  3LCP C;  1ZFS A;  1B7T Y;  2BBN A;  2F3Z A;  3CLN A;  3PN7 B;  1SW8 A;  5I2Q A;  1TN4 A;  1LVC D;  1J1E A;  1YRT B;  4DIR A;  2K7O A;  1NUB A;  5HKZ A;  4FQO A;  3VGO A;  3SG7 A;  3WHU B;  4NQG A;  1CFF A;  1IG5 A;  1S6J A;  4BY4 A;  1JF2 A;  1NPQ A;  3PSR A;  1UUS A;  1SCV A;  3DVM A;  3RLZ A;  4MEW A;  3DVJ A;  1JC2 A;  3SG4 A;  1QS7 A;  1B8R A;  1QAT A;  1SR6 C;  1KQM B;  3AKA A;  3WHT B;  3TS5 B;  5I8N A;  1QLK A;  1KFX S;  1BJF A;  4OR9 B;  1G4Y R;  1S5G Y;  4HSZ A;  1GGW A;  2MAZ A;  5KSZ A;  4OVN F;  4QJ3 B;  1A4P A;  1K95 A;  2KYC A;  4C0L A;  4ETO A;  4GGN A;  2JT8 A;  1J1D A;  2JPT A;  1L2O C;  1TRF A;  4M2P A;  1Q80 A;  1ZMZ A;  5CSI A;  1EG3 A;  4NDD A;  3DVK A;  4TNC A;  3A4U B;  1XFY O;  1QX7 A;  1QLS A;  4GGF A;  4WQ2 A;  1SR6 B;  1Y0V H;  1S6C A;  1Y1U A;  1AHR A;  2LMV A;  3PM8 A;  1U5I B;  3MSE B;  3TZ1 A;  1R6P A;  1CDN A;  3I5G B;  2F2P A;  1GJY A;  3BUW B;  4YBH B;  4YGA A;  2AUC A;  5HLV A;  1N0Y A;  2E6W A;  1DJG A;  5JJG A;  4IL1 A;  3H4S E;  3CR2 A;  2BKI B;  3ZNI A;  1M46 A;  1BR1 B;  1PK0 D;  5AXI A;  1V1F A;  1J55 A;  2M1U A;  3EK4 A;  4PHJ A;  2BL0 C;  2H61 C;  1REC A;  3OB1 B;  5AAN A;  1KK7 Y;  2MLF C;  5AER A;  2WOR A;  3WNX B;  1TTX A;  1YTZ C;  4CPV A;  3D0Y A;  2NLN A;  3NSI A;  3LL8 B;  1WRZ A;  2B1U A;  3CGA A;  4BY5 A;  2Y1M A;  1NIW A;  3M0W A;  2L4I A;  1SCM B;  3AAK A;  1DGU A;  1DVI A;  1M31 A;  4WQ3 A;  5GQQ C;  1NWD A;  5HKW A;  5FYX A;  2BL0 B;  3DF0 B;  2IS9 A;  1IWQ A;  2BE6 A;  5ER5 A;  3VRQ A;  1V1G A;  2FCD A;  1JBA A;  1LXF C;  3BXK A;  2OS8 C;  1A75 B;  2ISD A;  4DRW A;  1SKT A;  2HPS A;  3BUM B;  2WOS A;  1NCY A;  3DD4 A;  2JU0 A;  2F33 A;  1F71 A;  1B8L A;  2M7L A;  2JUL A;  3NXA A;  5AFP A;  2KI6 C;  2LMT A;  1QIV A;  1WDC C;  2JWW A;  1TOP A;  1W7I B;  2JTT A;  1NX3 A;  3SG5 A;  1PSR A;  1YUS A;  4DCK A;  1YUT A;  4MSP A;  2OS8 B;  4N1G A;  3ICB A;  1JF0 A;  1XFV O;  1OZS A;  2MJW B;  1OOJ A;  5F6T A;  1S1E A;  3LK0 A;  5BPJ A;  1DT7 B;  1RJV A;  2KFG A;  1TNQ A;  1CLB A;  1E8A A;  2DOQ A;  1A2X A;  3CS1 A;  2PAL A;  3TDI A;  1F70 A;  2JC2 A;  1YX8 A;  4E68 A;  5DKQ A;  1WDC B;  3OX6 A;  1XFX O;  1D1O A;  1SL9 A;  4ORA B;  4ORC B;  3C1V A;  2GGZ A;  5D69 A;  4MZK A;  2K0J A;  1WLM A;  4F0Z B;  2LCP A;  5KU1 A;  1X02 A;  2R2I A;  3BUX B;  1IRJ A;  2V53 A;  1K93 D;  2QPT A;  4GGF C;  2KBI A;  1S26 D;  1KSO A;  1YUR A;  1K2H A;  1QVI Z;  1K9P A;  4I5L B;  2L51 A;  2MBX A;  3BOW A;  1YVL A;  4PHM A;  1CM4 A;  2FOT A;  4QJ5 B;  3CR5 X;  2OPO A;  3KHE A;  4CFR A;  4PDZ A;  4A4C A;  3CTN A;  1G33 A;  2D8N A;  4GBA A;  1RTP 1;  2JZI A;  2LE9 B;  5J3X A;  2JT3 A;  4U8D A;  2Y4Q A;  5K89 A;  4N5X A;  1OZO A;  4UPG A;  4ORB B;  3BYA A;  4I5N B;  3PLF B;  1KFU L;  1QX2 A;  1M63 B;  1CTR A;  1DJX A;  2ZNE A;  2A4J A;  2Q4U A;  1IQ5 A;  3ZWH A;  1FBV A;  2KDH A;  1QV0 A;  4MRY A;  1NX1 A;  1NSH A;  2ZND A;  1Y6W A;  3K21 A;  4YGC B;  2I2R E;  3FS7 A;  2AMI A;  3HCM A;  2LUC A;  2CT9 A;  4MLW A;  4L9M A;  3O6B A;  2KSP A;  3WXA A;  2M9G A;  2VRG A;  4CID A;  2LM5 A;  4YI8 A;  2KQY A;  1PUL A;  2BKH B;  1N2D A;  1S6I A;  2CXJ A;  2LHL A;  3I5F C;  1CMG A;  4M2Q A;  3I5H C;  1FI5 A;  1RWY A;  3D0Y B;  4HRE E;  3QRX A;  1UHH A;  1XA5 A;  2KBM A;  1L2O B;  3EK8 A;  1UHN A;  2M49 B;  2COL B;  1KK8 C;  3IQO A;  2L98 A;  1IQ3 A;  5ER4 X;  2ZKM X;  3SIB A;  2K2A A;  2LLS A;  2K7C A;  4NDB A;  2MHH A;  5DKN A;  2FCE A;  4WRI A;  1HT9 A;  2F3Y A;  2BBM A;  4D1E A;  1QTX A;  4CFQ A;  1J7Q A;  3I5F B;  1IKU A;  1UHI A;  4YGE B;  3D10 A;  3KO0 A;  3I5H B;  1J7R A;  5CSF A;  1DGV A;  1SK6 D;  3KPX A;  4Q04 A;  3OX5 A;  2GGM A;  1NCZ A;  2JRF A;  3FWC A;  1MF8 B;  1KK8 B;  1BOD A;  1ZAC A;  1XFW O;  2WC8 A;  3SIA A;  4MN0 A;  1FW4 A;  1XFZ O;  2PVB A;  1K8U A;  5HYD A;  1LIN A;  1XFU O;  2JXC A;  2LVI A;  2L50 A;  1QX5 B;  4HRG A;  4OV2 A;  2WND A;  1XO5 A;  1EG4 A;  2HF5 A;  1F55 A;  1VRK A;  1OE9 B;  3FIA A;  2Y1N A;  5I2L A;  2JXL A;  1BMO A;  1MR8 A;  1C7W A;  1UP5 A;  1SY9 A;  3PFV A;  3VRP A;  1QV1 A;  4FTG A;  2OTG C;  2M29 A;  2M7N A;  2K61 A;  3EVU A;  3GK4 X;  1RRO A;  1KFX L;  3FWB A;  1B7T Z;  5PAL A;  3TUY C;  2HQ8 A;  2M3W A;  1DJH A;  4YI9 A;  2ZN9 A;  2BCX A;  3CZT X;  3OP0 A;  3EKH A;  2LVJ A;  2PRU A;  3IQQ A;  1WLZ A;  4YGB B;  3BUO B;  2KFF A;  1SMG A;  5DKR A;  1CLL A;  1UUR A;  2CCM A;  2LVV A;  1TNP A;  1GQM A;  1K94 A;  1LA3 A;  3KEV A;  5IBW A;  1DF0 A;  1RFJ A;  3JTD C;  1QIW A;  2OTG B;  3O2P A;  4GNK B;  3SG6 A;  1WRL A;  2NXQ A;  4MZJ A;  1PVA A;  1S5G Z;  2KAV A;  5CSN A;  1H8B A;  2KI4 C;  3BOW B; 
#chains in the Genus database with same CATH topology
 1IJ5 A;  3EVV A;  2LVK A;  1QXP A;  2LHI A;  3SJS A;  4YRU A;  1BG1 A;  1XYD A;  2PQL A;  3PN7 C;  1LA0 A;  4PT1 A;  2P70 A;  3L47 A;  1BLQ A;  1MXE A;  1Y1A A;  2CNP A;  2K2F A;  1J7O A;  3L4L A;  3B88 A;  3KF9 A;  3TDU A;  2ERB A;  5I2O A;  4JQ0 D;  4AQJ A;  1EJ3 A;  3JTD B;  2LP2 A;  1WY9 A;  1YX7 A;  4PE7 A;  2F8P A;  4R1E A;  2SAS A;  1UWO A;  1WRK A;  4P2Y B;  4PE1 A;  2KI4 B;  3BUN B;  2NCO A;  1F4Q A;  2JOJ A;  2LV7 A;  3BQ3 A;  4PE4 A;  5JOL A;  4HRH A;  5G08 A;  4XJK A;  5HLO A;  3SG3 A;  1L7Z A;  4C0J A;  3EVR A;  4PE0 A;  3AAJ A;  3D73 A;  4GAO A;  1QAS A;  2WCB A;  1XK4 C;  1CLM A;  3AKB A;  2LAP A;  1EL4 A;  3DZT A;  1OOG A;  1SL8 A;  2LAN A;  2L4H A;  2Q91 A;  4C0K A;  2KAY A;  1KK7 Z;  1DC1 A;  2L5X B;  4PHK A;  2EGD A;  2RGI A;  4ICB A;  1NCX A;  4P5O E;  1A29 A;  3PAT A;  1UHK A;  2HET A;  3JVT C;  5CPV A;  1K90 D;  3SG2 A;  3GK1 A;  2G2B A;  1SBJ A;  2ZRT A;  1CMF A;  2KGR A;  1JFK A;  1PAL A;  2I18 A;  2KNE A;  3PM2 A;  1C07 A;  3CYZ A;  1JWD A;  1OOF A;  2LC5 A;  3I5G C;  1CFD A;  1B1G A;  1CNP A;  1NX0 A;  3E3R A;  1DJY A;  2BEC A;  2L2E A;  1ODB A;  1OW4 A;  2O60 A;  1FPW A;  2P6B B;  1PRW A;  1YVH A;  1YR5 A;  5KTY A;  3NGV A;  1OSA A;  4A4B A;  2PMY A;  4PAL A;  2GV5 A;  2PSR A;  1BU3 A;  1J7P A;  1AJ5 A;  3TDZ A;  2QEV A;  1CFP A;  1ZOT B;  1QVI Y;  1AP4 A;  1KSM A;  1C7V A;  2KHN A;  2F2O A;  2ZRS A;  3JVT B;  1MUX A;  3CZ0 A;  2WC6 A;  3N7H A;  1XK4 A;  1TNX A;  1YRU B;  2JT0 A;  2K7D A;  1K96 A;  1BR4 B;  3K1E A;  4ZCU A;  2Y5I A;  3CR4 X;  4N1F A;  3GOF A;  3D74 A;  3S0A A;  1IJ6 A;  1G8I A;  1M39 A;  2EHB A;  3HX4 A;  1QJT A;  3OB2 B;  2M8U A;  1KQV A;  1MXL C;  1BT6 A;  2KFH A;  2FJU B;  4PHN A;  4MRX A;  1CDM A;  1DJI A;  1SCM C;  4NDC A;  3OBV A;  4F7F A;  1B4C A;  3VRO A;  1U5I A;  3LLE A;  2E30 A;  2KLD A;  2KOT A;  1R2U A;  3D78 A;  1AK8 A;  1CB1 A;  1KWO C;  1B9A A;  2KPH A;  1NYA A;  1ALV A;  2JNF A;  2QAC A;  3A8R A;  1ZUZ A;  3VRN A;  1AVS A;  2M0R A;  1OMD A;  4OCI A;  5FI6 A;  1JUO A;  1CKK A;  4OKH A;  1PSB A;  5AEQ A;  2BE4 A;  1F54 A;  3EK7 A;  3EKJ A;  3PJI A;  4CLN A;  3IF7 A;  2KYF A;  2WCF A;  2K7B A;  5D7F A;  2L0P A;  1IH0 A;  3L4A A;  2LP3 A;  2PAS A;  2EC6 C;  2I7A A;  4I5K A;  2NZ0 A;  1KFU S;  2BCA A;  2JQ6 A;  1HQV A;  3BJH A;  4ZCV A;  1S36 A;  2K8M B;  3DVE A;  5I94 A;  3OHM B;  3VB1 A;  1K9U A;  2BAP A;  1DTL A;  2M1K B;  3F45 A;  1LKJ A;  1FI6 A;  1Z2C B;  1TCO B;  4USL A;  1TCF A;  1UHJ A;  1KWO B;  1MQ1 A;  4AOM A;  1TWO A;  4GPL B;  2BCB A;  2CTN A;  3CZ2 A;  5CSJ A;  3O78 A;  1OQP A;  1AJ4 A;  1Y1X A;  4PCW A;  4QJ4 B;  2JNX A;  1A03 A;  1RK9 A;  4MVF A;  2AAO A;  3I5I C;  1GGZ A;  1CDP A;  1TNW A;  2QEH A;  4I5J A;  1S3P A;  2KI6 D;  4MZL A;  1OMV A;  2MA2 A;  4GFT A;  3RZS A;  1SRA A;  2ZN8 A;  1M45 A;  1DF0 B;  2KAX A;  1MWN A;  2EC6 B;  1AUI B;  2H61 A;  3DF0 A;  3NSK A;  1JFJ A;  2H2K A;  1SL7 A;  1NP8 A;  2SCP A;  2QEB A;  1MHO A;  3RM1 A;  2KQ6 A;  2LUX A;  5HKY A;  3VRR A;  1A75 A;  1OOH A;  1SYM A;  2I94 A;  5TNC A;  1OMR A;  1KCY A;  1DJZ A;  1CFC A;  2FJY A;  3D77 A;  1H4B A;  2CBL A;  4DUQ A;  3LK1 A;  2ZFD A;  4JWQ A;  2MRD A;  1DJW A;  1K9K A;  5B8I B;  4AQI A;  2O5G A;  3PAL A;  1EXR A;  1DMO A;  3CWG A;  3O4Y A;  3NSO A;  1BF5 A;  1W7J B;  2LLU A;  1XVJ A;  1CM1 A;  2WCE A;  3GK2 A;  3I5I B;  1TIZ A;  4MBE A;  3TUY B;  1B8C A;  2LNK A;  1NX2 A;  2K60 A;  4XYN A;  3DYE A;  1IGV A;  1JSA A;  2G9B A;  1F4O A;  2MLE C;  3DXL A;  4M2O A;  1F8H A;  1SPY A;  1GM0 A;  1B47 A;  2TN4 A;  1CDL A;  2LLT A;  4JPZ B;  4XJK B;  2JTZ A;  2KGB C;  2M97 A;  2NCP A;  4YGD B;  1C3Y A;  3NSL A;  1YUU A;  1PVB A;  1ALW A;  1KQM C;  1EH2 A;  3TS5 C;  1N65 A;  2HQW A;  2LMU A;  4GUK A;  1FF1 A;  1SNL A;  4DS7 A;  3B7A A;  3LCP C;  1ZFS A;  1B7T Y;  2BBN A;  2F3Z A;  3CLN A;  3PN7 B;  4IJ7 A;  1SW8 A;  3Q8I A;  5I2Q A;  1TN4 A;  1LVC D;  1SSE B;  1J1E A;  3R1V A;  1YRT B;  4DIR A;  3D76 A;  2K7O A;  1NUB A;  5HKZ A;  4FQO A;  3VGO A;  3SG7 A;  3WHU B;  4NQG A;  1CFF A;  1IG5 A;  1S6J A;  4BY4 A;  1JF2 A;  1NPQ A;  3PSR A;  1UUS A;  1SCV A;  3DVM A;  3DY9 A;  3RLZ A;  4MEW A;  3DVJ A;  1JC2 A;  3B87 A;  3SG4 A;  1QS7 A;  1B8R A;  1QAT A;  1SR6 C;  1KQM B;  3AKA A;  3WHT B;  3TS5 B;  5I8N A;  1QLK A;  4INW A;  1KFX S;  1BJF A;  1C3Z A;  4OR9 B;  1G4Y R;  1S5G Y;  4HSZ A;  1GGW A;  2H8V A;  2MAZ A;  5KSZ A;  4OVN F;  4QJ3 B;  3OGN A;  1A4P A;  1K95 A;  2KYC A;  4C0L A;  4ETO A;  4GGN A;  2JT8 A;  1J1D A;  2JPT A;  1L2O C;  1TRF A;  2KLE A;  1Q80 A;  1ZMZ A;  4M2P A;  5CSI A;  1EG3 A;  4NDD A;  3DVK A;  4TNC A;  2YGU A;  3A4U B;  1XFY O;  1QX7 A;  1QLS A;  3CAB A;  4GGF A;  1SR6 B;  4WQ2 A;  1Y0V H;  1S6C A;  1Y1U A;  1AHR A;  1P28 A;  2LMV A;  3PM8 A;  3R1O A;  1BOC A;  1U5I B;  3MSE B;  3TZ1 A;  1R6P A;  5HL1 A;  3I5G B;  1CDN A;  2F2P A;  1GJY A;  3BUW B;  4YBH B;  4YGA A;  2AUC A;  5HLV A;  1N0Y A;  2E6W A;  1IIO A;  1DJG A;  5JJG A;  4FQT A;  4IL1 A;  3H4S E;  3CR2 A;  2BKI B;  3ZNI A;  1M46 A;  1BR1 B;  1PK0 D;  5AXI A;  1V1F A;  1J55 A;  2M1U A;  3EK4 A;  4PHJ A;  3SS5 A;  2BL0 C;  1DEL A;  2H61 C;  1REC A;  3OB1 B;  5AAN A;  1KK7 Y;  3SS3 A;  2MLF C;  5AER A;  2WOR A;  3WNX B;  1TTX A;  1YTZ C;  4CPV A;  3D0Y A;  2NLN A;  2WCH A;  3NSI A;  3LL8 B;  1W9Z A;  4INX A;  1WRZ A;  2B1U A;  3CGA A;  4BY5 A;  2Y1M A;  1NIW A;  3M0W A;  2L4I A;  1SCM B;  3AAK A;  1DGU A;  1DVI A;  1M31 A;  4WQ3 A;  5GQQ C;  1NWD A;  5HKW A;  5FYX A;  2BL0 B;  3DF0 B;  2IS9 A;  1IWQ A;  2BE6 A;  5ER5 A;  3VRQ A;  1V1G A;  3O4X A;  4OZD A;  2FCD A;  3BFH A;  1JBA A;  1LXF C;  3S0F A;  3BXK A;  2OS8 C;  1A75 B;  2ISD A;  3IVT A;  4DRW A;  1SKT A;  2HPS A;  5FI2 A;  3BUM B;  2WOS A;  1NCY A;  3DD4 A;  2JU0 A;  2F33 A;  1F71 A;  1B8L A;  1XFR A;  2M7L A;  2JUL A;  3NXA A;  5AFP A;  2KI6 C;  2LMT A;  1QIV A;  1ORG A;  1WDC C;  2JWW A;  1TOP A;  1W7I B;  2JTT A;  1NX3 A;  2WC5 A;  3SG5 A;  1PSR A;  1YUS A;  4DCK A;  1YUT A;  2WCM A;  4MSP A;  2OS8 B;  4N1G A;  3S0E A;  3ICB A;  1JF0 A;  1XFV O;  1OZS A;  2MJW B;  1OOJ A;  5F6T A;  4JKT A;  1S1E A;  3LK0 A;  5BPJ A;  1DT7 B;  1RJV A;  2KFG A;  1TNQ A;  1CLB A;  1E8A A;  2GTE A;  2DOQ A;  1A2X A;  3CS1 A;  2PAL A;  3B6X A;  3BFB A;  2JC2 A;  1YX8 A;  3D75 A;  3TDI A;  5DKQ A;  4E68 A;  2P71 A;  1F70 A;  3NHT A;  1WDC B;  3OX6 A;  1XFX O;  1D1O A;  3BFA A;  1SL9 A;  4ORA B;  4ORC B;  3C1V A;  2GGZ A;  5D69 A;  4MZK A;  2K0J A;  1WLM A;  4F0Z B;  2L2C A;  2LCP A;  5KU1 A;  1X02 A;  2R2I A;  3BUX B;  1IRJ A;  2V53 A;  4JD9 A;  1K93 D;  2QPT A;  4GGF C;  3CDN A;  2KBI A;  1S26 D;  1KSO A;  1YUR A;  1K2H A;  1QVI Z;  1K9P A;  4I5L B;  2L51 A;  2MBX A;  3BOW A;  1YVL A;  4PHM A;  4KYN A;  1CM4 A;  3QME A;  2FOT A;  4QJ5 B;  3CR5 X;  2OPO A;  1DQE A;  3KHE A;  4PDZ A;  4A4C A;  3CTN A;  4CFR A;  1G33 A;  2D8N A;  3R72 A;  4GBA A;  1RTP 1;  2JZI A;  2LE9 B;  5J3X A;  2JT3 A;  4U8D A;  2Y4Q A;  5K89 A;  4N5X A;  1OZO A;  4UPG A;  4ORB B;  3BYA A;  4I5N B;  5DIC A;  3PLF B;  3B86 A;  2PYQ A;  1TUZ A;  1KFU L;  3SS4 A;  1QX2 A;  1M63 B;  2BNX A;  1CTR A;  1DJX A;  3S0D A;  3FE8 A;  2ZNE A;  2A4J A;  2Q4U A;  1IQ5 A;  3ZWH A;  1FBV A;  2KDH A;  1T14 A;  1QV0 A;  4MRY A;  1NX1 A;  1NSH A;  2ZND A;  1Y6W A;  3K21 A;  4YGC B;  2I2R E;  5FI7 A;  3FS7 A;  2AMI A;  3HCM A;  2LUC A;  2CT9 A;  4MLW A;  2WCK A;  3O6B A;  2KSP A;  4L9M A;  3S0G A;  3NHI A;  3WXA A;  2M9G A;  2VRG A;  4CID A;  2LM5 A;  4YI8 A;  2KQY A;  1PUL A;  2BKH B;  1N2D A;  1S6I A;  2CXJ A;  2LHL A;  3I5F C;  3R1P A;  1CMG A;  4M2Q A;  3I5H C;  2WCJ A;  1FI5 A;  1RWY A;  3D0Y B;  4HRE E;  3QRX A;  2L5Y A;  1UHH A;  1Z4H A;  1XA5 A;  2KBM A;  1L2O B;  3EK8 A;  1UHN A;  2M49 B;  2COL B;  1KK8 C;  3IQO A;  2L98 A;  1IQ3 A;  2JPO A;  5ER4 X;  2ZKM X;  3SIB A;  5D3O A;  1DEK A;  2K2A A;  2K7C A;  2LLS A;  2MHH A;  4NDB A;  5DKN A;  2FCE A;  4WRI A;  1HT9 A;  2F3Y A;  2BBM A;  4D1E A;  1QTX A;  4CFQ A;  1J7Q A;  3I5F B;  1IKU A;  1UHI A;  4YGE B;  3D10 A;  3KO0 A;  3I5H B;  1J7R A;  5CSF A;  1DGV A;  1SK6 D;  3KPX A;  4Q04 A;  3OX5 A;  2GGM A;  1NCZ A;  2JRF A;  3FWC A;  5EL2 A;  1MF8 B;  1KK8 B;  1BOD A;  1ZAC A;  1XFW O;  2WC8 A;  3SIA A;  4MN0 A;  1FW4 A;  1XFZ O;  2PVB A;  1K8U A;  5HYD A;  1LIN A;  1XFU O;  2JXC A;  2LVI A;  2L50 A;  1QX5 B;  3EG5 B;  4HRG A;  1OOI X;  2WND A;  4OV2 A;  3FE9 A;  1XO5 A;  1EG4 A;  2HF5 A;  1F55 A;  1VRK A;  1OE9 B;  1TUJ A;  3FIA A;  2Y1N A;  5I2L A;  2JXL A;  1BMO A;  1MR8 A;  1C7W A;  1UP5 A;  1SY9 A;  3PFV A;  2QDI A;  1QV1 A;  4FTG A;  2OTG C;  2M29 A;  3VRP A;  2M7N A;  2K61 A;  3EVU A;  3GK4 X;  1RRO A;  2WCL A;  1KFX L;  3FWB A;  1B7T Z;  2QEO A;  5PAL A;  3TUY C;  2HQ8 A;  2M3W A;  1DJH A;  4YI9 A;  2ZN9 A;  2BCX A;  3CZT X;  3OP0 A;  3EKH A;  3CZ1 A;  2LVJ A;  3FE6 A;  2PRU A;  1LS8 A;  3IQQ A;  3S0B A;  3UO9 A;  1WLZ A;  4YGB B;  1QWV A;  3BUO B;  2KFF A;  1SMG A;  3UNW A;  5DKR A;  1CLL A;  1UUR A;  2CCM A;  2LVV A;  1TNP A;  1GQM A;  1K94 A;  1LA3 A;  3KEV A;  5IBW A;  1DF0 A;  1RFJ A;  3JTD C;  1QIW A;  2OTG B;  3O2P A;  4GNK B;  3SG6 A;  1WRL A;  3V2L A;  2NXQ A;  4MZJ A;  1PVA A;  1S5G Z;  2KAV A;  5CSN A;  1H8B A;  2KI4 C;  3BOW B; 
#chains in the Genus database with same CATH homology
 1IJ5 A;  3EVV A;  2LVK A;  1QXP A;  2LHI A;  3SJS A;  4YRU A;  1BG1 A;  1XYD A;  3PN7 C;  1LA0 A;  1BLQ A;  1MXE A;  1Y1A A;  2CNP A;  2K2F A;  1J7O A;  3KF9 A;  3TDU A;  5I2O A;  4JQ0 D;  4AQJ A;  1EJ3 A;  3JTD B;  2LP2 A;  1WY9 A;  1YX7 A;  4PE7 A;  2F8P A;  4R1E A;  2SAS A;  1UWO A;  1WRK A;  4P2Y B;  4PE1 A;  2KI4 B;  3BUN B;  2NCO A;  1F4Q A;  2JOJ A;  2LV7 A;  3BQ3 A;  4PE4 A;  5JOL A;  4HRH A;  5G08 A;  4XJK A;  5HLO A;  3SG3 A;  1L7Z A;  4C0J A;  3EVR A;  4PE0 A;  3AAJ A;  4GAO A;  1QAS A;  2WCB A;  1XK4 C;  1CLM A;  3AKB A;  2LAP A;  1EL4 A;  1SL8 A;  2LAN A;  2L4H A;  2Q91 A;  4C0K A;  2KAY A;  1KK7 Z;  2L5X B;  4PHK A;  2EGD A;  2RGI A;  4ICB A;  1NCX A;  4P5O E;  1A29 A;  3PAT A;  1UHK A;  2HET A;  3JVT C;  5CPV A;  1K90 D;  3SG2 A;  3GK1 A;  2G2B A;  1SBJ A;  2ZRT A;  1CMF A;  2KGR A;  1JFK A;  1PAL A;  2I18 A;  2KNE A;  1C07 A;  1JWD A;  2LC5 A;  3I5G C;  1CFD A;  1B1G A;  1CNP A;  1NX0 A;  3E3R A;  1DJY A;  2BEC A;  2L2E A;  1ODB A;  2O60 A;  1FPW A;  2P6B B;  1PRW A;  1YVH A;  1YR5 A;  5KTY A;  1OSA A;  4A4B A;  2PMY A;  4PAL A;  2GV5 A;  2PSR A;  1BU3 A;  1J7P A;  1AJ5 A;  3TDZ A;  1CFP A;  1ZOT B;  1QVI Y;  1AP4 A;  1KSM A;  1C7V A;  2KHN A;  2F2O A;  2ZRS A;  3JVT B;  1MUX A;  4JWQ A;  1BOC A;  1XK4 A;  1TNX A;  1YRU B;  2JT0 A;  2K7D A;  1K96 A;  1BR4 B;  4ZCU A;  2Y5I A;  3CR4 X;  4N1F A;  3GOF A;  1IJ6 A;  1G8I A;  1M39 A;  2EHB A;  3HX4 A;  1QJT A;  3OB2 B;  2M8U A;  1KQV A;  1MXL C;  1BT6 A;  2KFH A;  2FJU B;  4PHN A;  4MRX A;  1CDM A;  1DJI A;  1SCM C;  4NDC A;  1B4C A;  3VRO A;  1U5I A;  3LLE A;  2E30 A;  2KOT A;  1R2U A;  1AK8 A;  1CB1 A;  1KWO C;  1B9A A;  1NYA A;  1ALV A;  2JNF A;  2QAC A;  3A8R A;  1ZUZ A;  3VRN A;  1AVS A;  2M0R A;  1OMD A;  4OCI A;  1JUO A;  1CKK A;  4OKH A;  1PSB A;  5AEQ A;  2BE4 A;  1F54 A;  3EK7 A;  3EKJ A;  4CLN A;  3IF7 A;  2KYF A;  2WCF A;  2K7B A;  5D7F A;  2L0P A;  1IH0 A;  2LP3 A;  2PAS A;  2EC6 C;  2I7A A;  4I5K A;  2NZ0 A;  1KFU S;  2BCA A;  2JQ6 A;  1HQV A;  4ZCV A;  1S36 A;  2K8M B;  3DVE A;  3OHM B;  1K9U A;  1DTL A;  2M1K B;  3F45 A;  1LKJ A;  1FI6 A;  1TCO B;  4USL A;  1TCF A;  1UHJ A;  1KWO B;  1MQ1 A;  4AOM A;  4GPL B;  2BCB A;  2CTN A;  5CSJ A;  4QJ4 B;  3O78 A;  1OQP A;  1AJ4 A;  1Y1X A;  4PCW A;  2JNX A;  1A03 A;  1RK9 A;  4MVF A;  2AAO A;  3I5I C;  1GGZ A;  1CDP A;  1TNW A;  4I5J A;  4MZL A;  1S3P A;  2KI6 D;  1OMV A;  2MA2 A;  4GFT A;  1SRA A;  2ZN8 A;  1M45 A;  1DF0 B;  2KAX A;  1MWN A;  2EC6 B;  1AUI B;  2H61 A;  3DF0 A;  3NSK A;  1JFJ A;  2H2K A;  1SL7 A;  1NP8 A;  2SCP A;  1MHO A;  3RM1 A;  2KQ6 A;  2LUX A;  5HKY A;  3VRR A;  1A75 A;  1KCY A;  1SYM A;  2I94 A;  5TNC A;  1OMR A;  1DJZ A;  1CFC A;  1H4B A;  2CBL A;  4DUQ A;  3LK1 A;  2ZFD A;  2MRD A;  1DJW A;  1K9K A;  5B8I B;  4AQI A;  2O5G A;  3PAL A;  1EXR A;  1DMO A;  3CWG A;  3O4Y A;  3NSO A;  1BF5 A;  1W7J B;  2LLU A;  1XVJ A;  1CM1 A;  2WCE A;  3GK2 A;  3I5I B;  1TIZ A;  4MBE A;  3TUY B;  1B8C A;  2LNK A;  1NX2 A;  4XYN A;  1IGV A;  1JSA A;  2G9B A;  1F4O A;  2MLE C;  4M2O A;  1F8H A;  1SPY A;  1B47 A;  2TN4 A;  1CDL A;  2LLT A;  4JPZ B;  4XJK B;  2JTZ A;  2KGB C;  2M97 A;  2NCP A;  4YGD B;  3NSL A;  1YUU A;  1PVB A;  1ALW A;  1KQM C;  1EH2 A;  3TS5 C;  1N65 A;  2HQW A;  2LMU A;  4GUK A;  1FF1 A;  1SNL A;  4DS7 A;  3LCP C;  1ZFS A;  1B7T Y;  2BBN A;  2F3Z A;  3CLN A;  3PN7 B;  1SW8 A;  5I2Q A;  1TN4 A;  1LVC D;  1J1E A;  1YRT B;  4DIR A;  2K7O A;  1NUB A;  5HKZ A;  4FQO A;  3VGO A;  3SG7 A;  3WHU B;  4NQG A;  1CFF A;  1IG5 A;  1S6J A;  4BY4 A;  1JF2 A;  1NPQ A;  3PSR A;  1UUS A;  1SCV A;  3DVM A;  3RLZ A;  4MEW A;  3DVJ A;  1JC2 A;  3SG4 A;  1QS7 A;  1B8R A;  1QAT A;  1SR6 C;  1KQM B;  3AKA A;  3WHT B;  3TS5 B;  5I8N A;  1QLK A;  1KFX S;  1BJF A;  4OR9 B;  1G4Y R;  1S5G Y;  4HSZ A;  1GGW A;  2MAZ A;  5KSZ A;  4OVN F;  4QJ3 B;  1A4P A;  1K95 A;  2KYC A;  4C0L A;  4ETO A;  4GGN A;  2JT8 A;  1J1D A;  2JPT A;  1L2O C;  1TRF A;  4M2P A;  1Q80 A;  1ZMZ A;  5CSI A;  1EG3 A;  4NDD A;  3DVK A;  4TNC A;  3A4U B;  1XFY O;  1QX7 A;  1QLS A;  4GGF A;  4WQ2 A;  1SR6 B;  1Y0V H;  1S6C A;  1Y1U A;  1AHR A;  2LMV A;  3PM8 A;  1U5I B;  3MSE B;  3TZ1 A;  1R6P A;  1CDN A;  3I5G B;  2F2P A;  1GJY A;  3BUW B;  4YBH B;  4YGA A;  2AUC A;  5HLV A;  1N0Y A;  2E6W A;  1DJG A;  5JJG A;  4IL1 A;  3H4S E;  3CR2 A;  2BKI B;  3ZNI A;  1M46 A;  1BR1 B;  1PK0 D;  5AXI A;  1V1F A;  1J55 A;  2M1U A;  3EK4 A;  4PHJ A;  2BL0 C;  2H61 C;  1REC A;  3OB1 B;  5AAN A;  1KK7 Y;  2MLF C;  5AER A;  2WOR A;  3WNX B;  1TTX A;  1YTZ C;  4CPV A;  3D0Y A;  2NLN A;  3NSI A;  3LL8 B;  1WRZ A;  2B1U A;  3CGA A;  4BY5 A;  2Y1M A;  1NIW A;  3M0W A;  2L4I A;  1SCM B;  3AAK A;  1DGU A;  1DVI A;  1M31 A;  4WQ3 A;  5GQQ C;  1NWD A;  5HKW A;  5FYX A;  2BL0 B;  3DF0 B;  2IS9 A;  1IWQ A;  2BE6 A;  5ER5 A;  3VRQ A;  1V1G A;  2FCD A;  1JBA A;  1LXF C;  3BXK A;  2OS8 C;  1A75 B;  2ISD A;  4DRW A;  1SKT A;  2HPS A;  3BUM B;  2WOS A;  1NCY A;  3DD4 A;  2JU0 A;  2F33 A;  1F71 A;  1B8L A;  2M7L A;  2JUL A;  3NXA A;  5AFP A;  2KI6 C;  2LMT A;  1QIV A;  1WDC C;  2JWW A;  1TOP A;  1W7I B;  2JTT A;  1NX3 A;  3SG5 A;  1PSR A;  1YUS A;  4DCK A;  1YUT A;  4MSP A;  2OS8 B;  4N1G A;  3ICB A;  1JF0 A;  1XFV O;  1OZS A;  2MJW B;  1OOJ A;  5F6T A;  1S1E A;  3LK0 A;  5BPJ A;  1DT7 B;  1RJV A;  2KFG A;  1TNQ A;  1CLB A;  1E8A A;  2DOQ A;  1A2X A;  3CS1 A;  2PAL A;  3TDI A;  1F70 A;  2JC2 A;  1YX8 A;  4E68 A;  5DKQ A;  1WDC B;  3OX6 A;  1XFX O;  1D1O A;  1SL9 A;  4ORA B;  4ORC B;  3C1V A;  2GGZ A;  5D69 A;  4MZK A;  2K0J A;  1WLM A;  4F0Z B;  2LCP A;  5KU1 A;  1X02 A;  2R2I A;  3BUX B;  1IRJ A;  2V53 A;  1K93 D;  2QPT A;  4GGF C;  2KBI A;  1S26 D;  1KSO A;  1YUR A;  1K2H A;  1QVI Z;  1K9P A;  4I5L B;  2L51 A;  2MBX A;  3BOW A;  1YVL A;  4PHM A;  1CM4 A;  2FOT A;  4QJ5 B;  3CR5 X;  2OPO A;  3KHE A;  4CFR A;  4PDZ A;  4A4C A;  3CTN A;  1G33 A;  2D8N A;  4GBA A;  1RTP 1;  2JZI A;  2LE9 B;  5J3X A;  2JT3 A;  4U8D A;  2Y4Q A;  5K89 A;  4N5X A;  1OZO A;  4UPG A;  4ORB B;  3BYA A;  4I5N B;  3PLF B;  1KFU L;  1QX2 A;  1M63 B;  1CTR A;  1DJX A;  2ZNE A;  2A4J A;  2Q4U A;  1IQ5 A;  3ZWH A;  1FBV A;  2KDH A;  1QV0 A;  4MRY A;  1NX1 A;  1NSH A;  2ZND A;  1Y6W A;  3K21 A;  4YGC B;  2I2R E;  3FS7 A;  2AMI A;  3HCM A;  2LUC A;  2CT9 A;  4MLW A;  4L9M A;  3O6B A;  2KSP A;  3WXA A;  2M9G A;  2VRG A;  4CID A;  2LM5 A;  4YI8 A;  2KQY A;  1PUL A;  2BKH B;  1N2D A;  1S6I A;  2CXJ A;  2LHL A;  3I5F C;  1CMG A;  4M2Q A;  3I5H C;  1FI5 A;  1RWY A;  3D0Y B;  4HRE E;  3QRX A;  1UHH A;  1XA5 A;  2KBM A;  1L2O B;  3EK8 A;  1UHN A;  2M49 B;  2COL B;  1KK8 C;  3IQO A;  2L98 A;  1IQ3 A;  5ER4 X;  2ZKM X;  3SIB A;  2K2A A;  2LLS A;  2K7C A;  4NDB A;  2MHH A;  5DKN A;  2FCE A;  4WRI A;  1HT9 A;  2F3Y A;  2BBM A;  4D1E A;  1QTX A;  4CFQ A;  1J7Q A;  3I5F B;  1IKU A;  1UHI A;  4YGE B;  3D10 A;  3KO0 A;  3I5H B;  1J7R A;  5CSF A;  1DGV A;  1SK6 D;  3KPX A;  4Q04 A;  3OX5 A;  2GGM A;  1NCZ A;  2JRF A;  3FWC A;  1MF8 B;  1KK8 B;  1BOD A;  1ZAC A;  1XFW O;  2WC8 A;  3SIA A;  4MN0 A;  1FW4 A;  1XFZ O;  2PVB A;  1K8U A;  5HYD A;  1LIN A;  1XFU O;  2JXC A;  2LVI A;  2L50 A;  1QX5 B;  4HRG A;  4OV2 A;  2WND A;  1XO5 A;  1EG4 A;  2HF5 A;  1F55 A;  1VRK A;  1OE9 B;  3FIA A;  2Y1N A;  5I2L A;  2JXL A;  1BMO A;  1MR8 A;  1C7W A;  1UP5 A;  1SY9 A;  3PFV A;  3VRP A;  1QV1 A;  4FTG A;  2OTG C;  2M29 A;  2M7N A;  2K61 A;  3EVU A;  3GK4 X;  1RRO A;  1KFX L;  3FWB A;  1B7T Z;  5PAL A;  3TUY C;  2HQ8 A;  2M3W A;  1DJH A;  4YI9 A;  2ZN9 A;  2BCX A;  3CZT X;  3OP0 A;  3EKH A;  2LVJ A;  2PRU A;  3IQQ A;  1WLZ A;  4YGB B;  3BUO B;  2KFF A;  1SMG A;  5DKR A;  1CLL A;  1UUR A;  2CCM A;  2LVV A;  1TNP A;  1GQM A;  1K94 A;  1LA3 A;  3KEV A;  5IBW A;  1DF0 A;  1RFJ A;  3JTD C;  1QIW A;  2OTG B;  3O2P A;  4GNK B;  3SG6 A;  1WRL A;  2NXQ A;  4MZJ A;  1PVA A;  1S5G Z;  2KAV A;  5CSN A;  1H8B A;  2KI4 C;  3BOW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...