4DCKA

Crystal structure of the c-terminus of voltage-gated sodium channel in complex with fgf13 and cam
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
153
Chain Sequence
SVATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Ternary Complex of a NaV C-Terminal Domain, a Fibroblast Growth Factor Homologous Factor, and Calmodulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/signaling protein
molecule keywords Sodium channel protein type 5 subunit alpha
total genus 51
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2012-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4dckA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4dckA02
2K7DA 4HREE 2NCPA 1KK7Y 1HQVA 1RFJA 4DRWA 4FTGA 2E6WA 1TNXA 1RROA 1CKKA 2KSPA 3JTDC 1DJWA 2M9GA 4MRXA 2JQ6A 2LNKA 1MXLC 3BOWB 2AAOA 1S5GZ 3AAKA 1KK8B 1KSOA 4MN0A 5F6TA 2LUXA 1IGVA 5HLVA 5KSZA 1YUSA 4GFTA 5GQQC 1EH2A 1K9KA 2EGDA 3EKJA 2BBNA 4AOMA 3CWGA 2WORA 3ZNIA 3VRNA 1ODBA 2M1KB 2LVJA 2ZRSA 5ER4X 2K0JA 1S6IA 4BY4A 4WRIA 3ICBA 3O2PA 2KBIA 1CLLA 1B4CA 1IKUA 1JWDA 1K8UA 2BECA 2ZNDA 1TNPA 2JU0A 5D7FA 2M8UA 1SL7A 1NCYA 3BYAA 1YUTA 2VRGA 1G4YR 3JVTB 1OMDA 3OP0A 1WDCC 1CFCA 2JWWA 4IL1A 1QIWA 2I7AA 2KHNA 3SIAA 3FWBA 1A29A 3I5FB 1F8HA 1EXRA 2GGZA 2QPTA 4ORCB 4C0LA 3TDIA 1FPWA 1RTP1 3CS1A 1AP4A 4PHNA 4N1FA 4USLA 3O78A 3SG6A 1TCOB 2K7CA 1L2OB 2L4IA 3NSIA 4GAOA 1CFFA 2L51A 1K95A 1DJGA 1S1EA 1BF5A 1LA0A 4L9MA 3EK4A 2KAVA 2RGIA 2KQ6A 5BPJA 2K2FA 4CIDA 4PE0A 3E3RA 1GJYA 1NX3A 3CR2A 4NDDA 3OX5A 1SCMC 3WNXB 1FI5A 2F2PA 5AFPA 3WXAA 1TIZA 1SNLA 1KK7Z 5KU1A 3SJSA 3AAJA 1J55A 3SG4A 3TDZA 4D1EA 1YX8A 1SR6C 1ZACA 1TRFA 5TNCA 2MJWB 1YURA 2COLB 4YI8A 1F55A 1SCVA 2KNEA 1C7WA 1J1EA 2LLUA 4PE4A 1WDCB 3SG2A 3LLEA 2JT0A 5AXIA 2D8NA 2KAXA 3OHMB 1MF8B 2K7BA 4UPGA 1UHIA 2CXJA 1QASA 1IRJA 1MR8A 2LP3A 2JULA 1F4OA 1XA5A 3RLZA 1CDMA 1X02A 4AQJA 2WOSA 3EK8A 1B1GA 1DVIA 1BU3A 2LCPA 5HLOA 4A4BA 3D0YA 1YVHA 4M2OA 1W7JB 4MZKA 3CLNA 2LHLA 1MQ1A 3EVRA 1UUSA 1KFXL 1DJIA 1UHNA 2FJUB 1L7ZA 1XYDA 1M31A 1KWOC 1CFPA 2Y1MA 1CMFA 1RK9A 1CFDA 2F3YA 4GGFC 5HKZA 1JFJA 4NQGA 2M29A 1PK0D 1S3PA 1OZOA 4TNCA 1XFUO 3PLFB 2JOJA 1NUBA 4YGBB 5JOLA 1MXEA 1DJHA 2WCBA 1QXPA 2LMTA 4M2PA 5JJGA 1K9UA 4XYNA 2NZ0A 2PASA 4CFRA 1NX1A 4GGNA 1L2OC 2LP2A 1CNPA 2JTTA 1G8IA 3ZWHA 3RM1A 1V1FA 2KFHA 4ZCUA 1OSAA 4HSZA 2Y1NA 3IF7A 1D1OA 5I2LA 1E8AA 4C0KA 2F33A 3KPXA 3I5HB 5I2OA 1WRLA 2JNXA 3LCPC 1JF2A 1NCZA 3NSLA 3EVUA 2A4JA 4HRGA 1NX2A 2KGBC 3CTNA 1AHRA 1Q80A 2LHIA 1QV0A 1J7OA 1KFXS 3JTDB 1DJZA 2LLSA 1CLMA 4OVNF 1MHOA 2KAYA 1QS7A 1UHJA 2V53A 3OB1B 3FWCA 3SIBA 4JWQA 2KI4C 3AKBA 1K94A 3LL8B 1JFKA 2LMUA 3TUYB 3WHTB 1F4QA 2K8MB 4Q04A 1YRUB 1BLQA 1XFXO 1CDNA 1R2UA 2FCDA 4CPVA 1IG5A 1WRKA 3NSKA 2GV5A 2KFFA 3I5GB 4I5LB 2PALA 1NWDA 4N1GA 2H61A 1FI6A 1UHHA 1TNQA 2ISDA 1NSHA 3FIAA 3O4YA 2Q91A 2LC5A 1LA3A 1PSBA 4MSPA 4MVFA 1S26D 2B1UA 2ZRTA 2K2AA 2R2IA 2BL0C 1NX0A 3KHEA 3CR4X 1YVLA 2HPSA 2BCXA 1CM4A 1EJ3A 1IWQA 1PULA 1C07A 3KF9A 3PSRA 1A2XA 2I18A 2M0RA 5B8IB 2E30A 1S6CA 1M63B 3SG5A 3KEVA 2KOTA 5AEQA 4JPZB 2JPTA 3MSEB 5DKRA 2JRFA 4MZJA 4PALA 1BOCA 1Y1XA 2MHHA 1OE9B 1S5GY 3OB2B 1BR4B 1DJXA 2JT3A 1SL8A 5HKYA 1SBJA 1ZFSA 1J1DA 1K93D 3IQOA 2F3ZA 3PN7B 2HQWA 1TN4A 1KQVA 3I5IC 1N65A 1J7RA 1GQMA 2HETA 1XFYO 1B47A 1PVBA 3KO0A 4MEWA 3F45A 1R6PA 1XFWO 1FW4A 2DOQA 5I8NA 1QV1A 1YR5A 2MLEC 1OQPA 3I5HC 3TS5B 1FBVA 2CCMA 1EG4A 2EHBA 2Y4QA 4YRUA 2JC2A 2M7NA 5G08A 5AERA 3D0YB 1CLBA 1OZSA 5HYDA 3EK7A 1K90D 2H61C 1WRZA 3JVTC 3PATA 1J7PA 1SL9A 4WQ3A 1XFZO 3HCMA 3M0WA 1CMGA 1QX7A 1IJ6A 5CSFA 2O60A 2HQ8A 2WNDA 4P2YB 1FF1A 2H2KA 2EC6C 2BCAA 3BQ3A 2LVIA 1OMVA 3EKHA 4QJ5B 3GOFA 2ZFDA 1A75B 1MWNA 2NCOA 1S36A 1PALA 1WLMA 1K96A 2OS8B 2BE4A 4NDCA 1XVJA 1CB1A 1OOJA 1HT9A 4ETOA 1CM1A 2LM5A 1IJ5A 1DF0B 1A75A 3BUMB 3DVMA 2JT8A 4JQ0D 3CGAA 4PHKA 2BCBA 2KFGA 2LVVA 2Q4UA 3DVEA 3VRPA 2KQYA 3A8RA 1SMGA 3BUWB 1SK6D 1BMOA 2ZKMX 5CSIA 2PMYA 4U8DA 1F71A 1DF0A 2JXLA 2L5XB 2M97A 1BT6A 4PCWA 1BG1A 4XJKB 1QATA 3GK4X 4I5KA 5I2QA 2BE6A 1DGVA 4ZCVA 4YBHB 2CNPA 2L0PA 2L2EA 4ORBB 2O5GA 4M2QA 1SW8A 1H8BA 1BODA 1RECA 1SYMA 5J3XA 2AMIA 1TTXA 2OS8C 4R1EA 3TS5C 1WY9A 1TOPA 4YGAA 4OV2A 1NYAA 1ZMZA 3QRXA 2KYFA 1LINA 1DMOA 2ZNEA 2KI6D 2EC6B 4GGFA 1IQ5A 1LVCD 1QVIY 1UP5A 4FQOA 1SCMB 3DVKA 2L50A 3PN7C 3O6BA 4YGCB 5DKQA 1Y1AA 3DF0A 2MBXA 1DTLA 4HRHA 2MRDA 4GNKB 1QIVA 4DS7A 2Y9ZA 5DKNA 3LK1A 2I2RE 3DF0B 4GBAA 2KBMA 1K2HA 4C0JA 2HF5A 2PSRA 4OCIA 4YI9A 2TN4A 1JUOA 2SCPA 1YTZC 1XK4A 2M3WA 1GGZA 1KWOB 3A4UB 1Y0VH 3K21A 3PM8A 2WCFA 4A4CA 4XJKA 2GGMA 2BBMA 4YGDB 1OFCX 1SKTA 1QLSA 1SR6B 1QJTA 1CDLA 1BJFA 2PVBA 3H4SE 3WHUB 2LAPA 1Y6WA 3VRQA 1XO5A 2QACA 2OPOA 4DUQA 2JTZA 1N0YA 1KFUS 2L98A 1B7TY 2LMVA 1H4BA 4F0ZB 2G9BA 1B8RA 3NXAA 5CSJA 1LXFC 3BUXB 1OMRA 2LLTA 2JZIA 2ZN8A 2IS9A 4ICBA 1IH0A 3SG7A 1KQMC 2JNFA 2MLFC 2BL0B 1ZOTB 3FS7A 2CBLA 1XK4C 1PRWA 3IQQA 1JBAA 4GPLB 5FYXA 2LUCA 2M49B 1LKJA 3NSOA 1BR1B 1M39A 4DCKA 1NPQA 4GUKA 1DJYA 3TZ1A 3PFVA 5KTYA 3I5GC 1WLZA 2LV7A 3EVVA 3I5FC 2OTGC 5CPVA 4CFQA 2KDHA 1JSAA 1KCYA 1QX2A 4E68A 2I94A 5D69A 1RJVA 2G2BA 1KQMB 1J7QA 1W7IB 1QLKA 1RWYA 3PALA 1NP8A 2K7OA 1QTXA 4BY5A 1ALVA 1NCXA 3LK0A 4NDBA 1AK8A 1GGWA 1U5IB 2JXCA 4PDZA 4QJ3B 2BKHB 2FOTA 1YRTB 4PE7A 1UWOA 4P5OE 4QJ4B 1IQ3A 2Y5IA 4PHMA 1M46A 3D10A 2M7LA 1UHKA 2NLNA 4WQ2A 2Y9YA 4DIRA 5K89A 1U5IA 1QX5B 2PRUA 1AUIB 1SRAA 1AJ5A 2KGRA 3HX4A 3VROA 4AQIA 1C7VA 1XFVO 3TDUA 4MBEA 1CTRA 1ALWA 5CSNA 1YX7A 3DD4A 3DVJA 1UURA 1QVIZ 1F70A 2LE9B 3GK1A 1EL4A 3BOWA 1B8CA 1KFUL 1TCFA 3BXKA 1SY9A 1V1GA 4PE1A 1K9PA 1M45A 1N2DA 1PSRA 2MA2A 1S6JA 4I5JA 3TUYC 2CT9A 1A03A 1KSMA 1AVSA 2LVKA 1A4PA 3BUOB 1B8LA 1NIWA 3CZTX 3VGOA 3VRRA 5AANA 1CDPA 5IBWA 4ORAB 2F8PA 2NXQA 2K61A 1ZUZA 4YGEB 3OX6A 4PHJA 2AUCA 5ER5A 1VRKA 2P6BB 2CTNA 1YUUA 1PVAA 1DT7B 1EG3A 1G33A 1DGUA 2M1UA 3GK2A 2L4HA 2MAZA 1TNWA 2KYCA 4CLNA 4MRYA 1JF0A 2OTGB 4OKHA 4I5NB 2ZN9A 5PALA 2BKIB 2LANA 1B7TZ 1MUXA 2WC8A 3AKAA 3C1VA 4OR9B 3SG3A 1AJ4A 1KK8C 1JC2A 2SASA 3I5IB 5HKWA 1F54A 3CR5X 4N5XA 1B9AA 4MLWA 4MZLA 3BUNB 2KI4B 1SPYA 2KI6C 2WCEA 2F2OA 2FCEA 1Y1UA
chains in the Genus database with same CATH superfamily
2ZYAA 2PYQA 1HTLC 2E6WA 3S4RA 1CKKA 3HD7C 3JTDC 1DJWA 3KQGA 4XE5B 3Q1MA 2P58A 3GHGB 2H43A 1YBKA 2E76C 1KSOA 3ABVC 2KNCA 2LUXA 5GQQC 3DYEA 3EKJA 2Z5HA 2BBNA 3SS4A 1FDMA 3BCCD 4OWFA 2WORA 3CXHI 2N9YB 2M1KB 3JCUE 1XFRA 2K0JA 2N1TA 4BY4A 1S9KD 3VP8A 2FKWB 1BGYJ 2XNDH 1BGYD 1JWDA 1K8UA 1FU1A 3MHVA 2ZNDA 3L70E 2JU0A 5D7FA 5AW4B 2M8UA 1SL7A 2VRGA 1G4YR 3OP0A 1NTKK 2KUBA 1WDCC 2FXPA 1CFCA 4H44C 2I7AA 2WMMA 1RE4C 1A29A 2GTEA 4UB8E 3B5NB 5AW2B 2POHA 1NYHA 2GGZA 2QPTA 2A45H 2JPOA 4C0LA 3TDIA 1RF1A 3PJSK 1N7SA 4D6TE 3SG6A 3WU2E 1HF9A 3NSIA 2JKVA 1TWOA 3RK3C 1T3UA 2KAVA 2RGIA 2KQ6A 1JY2P 1IC2A 2K2FA 3E3RA 1GJYA 2K37A 1KQGB 3H1JE 3CR2A 1FI5A 2F2PA 3WXAA 1SNLA 3FE6A 1J1EB 1KK7Z 5KU1A 3AAJA 1J55A 3SG4A 4D1EA 2FY8A 4U3FD 5TISE 1NTKG 1NU1K 1ZP0C 1WDCB 2HR3A 2JT0A 5AXIA 2D8NA 2KAXA 1Q90D 2JDIH 1IRJA 1BE3G 1EZVE 2JULA 1F4OA 2BAPA 3RLZA 1MV8A 1SFCC 3L37A 1LT9A 3B87A 1BCCJ 2ZXEB 2OTLP 1MKMA 1NAYA 3AE4C 1EDJA 2R5DA 1NOHA 1UUSA 1UHNA 1K05A 1XYDA 1RHZB 2F3YA 3AE5C 3CX5E 1W2EA 1IFDA 2E74D 3UO9A 5AVSB 3AE9C 1OZOA 1TUZA 4L76A 1SQPK 4JYCA 5KLVJ 3EFFK 4XYNA 5KKZC 4CFRA 2I1KA 1FDOA 1G8IA 2N1TB 1V1FA 1Z4HA 2BCCG 1LWUC 4C0KA 2BEZF 3KPXA 1OVRA 2ZXXA 1NU1J 2H88C 1WRLA 2JNXA 3OGNA 3PH0A 2A45G 3BCCJ 5KLVD 2KGBC 3CTNA 1QV0A 2YMYA 1JMMA 1CZQA 4DZOA 1KFXS 2LLSA 1CLMA 1L0LJ 2KLDA 4OVNF 2KK7A 2KAYA 1UHJA 1QVFO 3FWCA 2B89A 1SFCB 3K1EA 3WHTB 2M0BA 1PP9E 1YRUB 1BLQA 1CDNA 1J1DC 1FE6A 3G71P 3MUDA 3S0GA 1IG5A 2GV5A 3B6XA 2H61A 3L71D 2K1AA 3MGNA 1TNQA 1FS0E 3B5NC 1NSHA 2Q91A 3HUSA 4I2LC 1LA3A 3DXLA 3JSVC 1NJIQ 4M3LA 3TGUJ 2OQQA 4B86A 3H1HD 5DJUB 2HPSA 1VF5C 5TJHA 1IWQA 2IBZI 1A2XA 1J1DB 5CJ4A 1T6AA 1N73C 1M63B 3G4SP 3MTUE 3CCMP 3MSEB 2ZVNB 1Y1XA 1OE9B 3OB2B 2QJKB 1J1DA 1K93D 1PPJG 4GOFA 3MUDC 2HQWA 2G3AA 1TN4A 1KQVA 1GQMA 2YKOA 1USDA 5AW9B 3F5HA 2FXMA 3CCUP 2Q3EA 4GT1A 5KLIB 3CC7P 2DOQA 2QM8A 1QV1A 3M9QA 1OW6A 1FZAA 5CCGC 3TS5B 1LTSC 2Y4QA 4KT0J 2E74C 4C7RA 5AERA 2N9BA 2KI7B 1K90D 2HLOA 3UNWA 1LP1B 1NTKJ 3QWOC 1VPCA 3D73A 1J7PA 3BRTB 2ZFCA 5AW1B 3R1VA 2KLVA 2FYUJ 1IJ6A 1JEKA 1LS8A 2R3SA 2R44A 1G1JA 5CHXA 3CX5H 1BDDA 3EKHA 2ZFDA 2M3EA 2IX7C 1S2EA 3NXSA 3VMAA 1S36A 3NMDA 1M90Q 2BE4A 2Y0EA 1FOSE 1BSNA 2LM5A 1SQPG 2NPSB 1J1EC 1Q2NA 3VTPC 3NGVA 3DVMA 3V2RA 3AE7C 2AXCA 2LVVA 1BMOA 2JEEA 3M91A 3TNUA 1M57D 2IPPA 4XJKB 3GK4X 3PJIA 4I5KA 5I2QA 2RKLA 2L0PA 2AXTE 1JUNA 5BU5A 4NPDA 2QEOA 3AECC 1RF0C 1H8BA 4YXWH 2W83C 3B5ND 1SYMA 3TS5C 1VDFA 1VQ7P 3FE9A 4OV2A 4YPCA 1OZHA 3IFMA 2WSFH 2RN0A 2J58A 2YXRB 3S0AA 4GGFA 1DH3A 1QVIY 1SCMB 2L50A 3PN7C 4GODA 3H32A 4HRHA 2MRDA 3EFGA 1QIVA 1QL2A 1Q7YQ 4W7ZA 1NTMK 2FYNB 1K2HA 3L70G 2PSRA 2GUVA 2XZRA 1L0NK 1L4AD 2SCPA 4PD4I 1GGZA 1VQ6P 2IYPA 3S0EA 1SKTA 1IFNA 1CDLA 4I7ZB 2PVBA 3MD0A 2JWDA 3VRQA 1KILC 1JY3N 4DUQA 2H8PD 5DJTB 1SQXG 4WY4B 1KFUS 2SPZA 4LLHA 3V4WA 1QLED 5KAFH 2QA4P 1AV1A 2JP3A 1KORA 2QE7H 3SG7A 1S5LE 1BCCD 2CBLA 1GL2C 2VRSA 1SQQK 2QEBA 4NPFX 5AW6B 1SQXK 3NSOA 1BR1B 3IF4A 4DCKA 3EQ2A 2LV7A 3I5FC 4CFQA 1JSAA 3PHLA 1QX2A 5EL2A 3TK1A 1HH0A 1QEXA 1QLKA 1RWYA 5CCHA 2D2CC 3L35A 1BCCE 1AK8A 1GGWA 3Q5RA 1T8ZA 4QJ3B 1M1JB 1YRTB 4PE7A 1P84D 4U3FG 1UHKA 3M9HA 4WQ2A 3E1RA 2PRUA 1AUIB 3HX4A 4H0LC 1C7VA 1SQVJ 3TDUA 4MBEA 1GK6A 2IFNA 1YX7A 4H44B 1JMBA 1EL4A 2JO1A 3VP9A 4ASWA 3BVHA 2K3RA 1SY9A 1V1GA 4I5JA 3U1CA 1AVSA 2HFED 3AEEC 3VRRA 4IFMA 4DJGA 5AANA 5AW3B 1U7JA 4HKZH 1ZUZA 1UIXA 1NTME 4PHJA 3CDNA 3D77A 1LTGC 3JCUH 4C7NA 2OYIB 1YUUA 2QSIA 3M0AA 3H1KE 2FFDC 3N4XA 1NAFA 2MAZA 4CLNA 4MRYA 5PALA 2Y0CA 2YO2A 3KZIE 1MUXA 3SG3A 1GW4A 1JC2A 1KILD 3V2QA 1GL2B 1B9AA 4MLWA 4Y99C 3AE2C 3BUNB 2KI4B 2KI6C 1Y1UA 2ZJSE 5I94A 1HQVA 1ZR2A 2HG5D 4K35A 1RROA 2CPBA 4MRXA 1DEEG 1N7SB 4WVZA 5H2FE 1GD2E 3BFBA 1MXLC 2AAOA 4U7JA 1S5GZ 3WU2H 1LTTC 1IGVA 1TU3F 1YUSA 4GFTA 1K9KA 5KLVG 5CCHD 3VRNA 1ODBA 2V7QJ 1W5CE 1X79B 2ZRSA 5ER4X 1S6IA 2OYIC 1MZ9A 4WRIA 2WC6A 1N73A 1WMKA 3L74D 1KQSO 3B4SA 3CPWO 4WBAA 3JVTB 1OMDA 2R5BA 2WPVB 3U1AA 2OARA 3OAKA 2JWWA 4IL1A 3II6A 4H13B 2YNYA 4N78E 2L5YA 3C1LA 2OYHC 3I5FB 2OYHB 2NPSD 1F8HA 3H1HJ 4ORCB 1X9VA 1FPWA 1RTP1 3CS1A 1AP4A 1NU1E 3O78A 1TCOB 1FZBA 1BF5A 3PTZA 1LA0A 2BEQD 3EK4A 2K9YA 4JD9A 1SQBD 2A06E 5BPJA 1VQKP 3SS5A 4IOIH 2ZT9C 1NX3A 1KFNA 4NDDA 3Q2YA 1SCMC 3WNXB 1TIZA 3TDZA 4I7ZC 2G8YA 1TRFA 1YURA 1JY3P 2O1KA 1F55A 5GTHH 1C7WA 2LLUA 4PE4A 3USSA 2KZJA 2ZT9B 2QJKC 2YIUC 2K7BA 1UHIA 2LP3A 3CCRP 1CDMA 4AQJA 3HE5A 4L75A 1VF5B 1BU3A 5HLOA 1TUJA 3ZDMA 1KYOH 3D70A 2B88A 3D0YA 4M2OA 2WSEJ 4EI2A 1W7JB 1M1KQ 2E74B 2LHLA 1MQ1A 2FJUB 1RQUA 1M31A 5E79H 1CMFA 1AQ5A 4R4MA 1RK9A 1JFJA 2IBZD 2M29A 3VYIA 4RO0A 1PK0D 3GMAA 3RL0B 1EC5A 1S3PA 2JOJA 1NUBA 2FYUE 3L4AA 1QXPA 5E79E 1K9UA 2PASA 1NTKE 2LP2A 4DT0A 1FJPA 3ZWHA 3QMEA 3A0HE 4HSZA 2Y1NA 1D1OA 1DELA 2NPSC 4IL6E 2KSJA 3I5HB 3H1JG 3OBVA 1DIPA 3LCPC 2K9JB 3NSLA 3EVUA 1YI2P 1SVFA 1Q80A 2LHIA 1J7OA 2KS1A 2O1JA 3G6EP 3O4XA 3IR9A 3A7OA 4K3AA 3CCSP 4UB8H 3SIBA 5B5EE 3V2LA 2KI4C 1OXZA 1GU4A 3VB1A 4WWIA 1F4QA 4Q04A 1L4AC 3V2PA 2FCDA 4CPVA 1WRKA 3NSKA 3B8EB 1FI6A 5APQA 4N1GA 4NPEA 1UHHA 3K5BA 3O4YA 4H44D 1PSBA 4MVFA 2R2IA 2MKVA 1LWUB 3L71E 2BCXA 2WC5A 3SWYA 4OGQB 5CJ0A 1CM4A 2W6AA 3GW6A 3SFEC 1NTZE 2P10A 3PSRA 2E30A 3TDKA 4D6TD 2GA1A 3I55P 1YIJP 4IFFA 4JPZB 4U3FJ 1BOCA 3RK2B 1S5GY 1RQVA 2JT3A 3W68A 1ZFSA 1DEBA 1RH5B 3H6PA 2CPSA 3PN7B 3P8CD 1VQ4P 2P71A 3KO0A 5AVQB 4IFDK 4MEWA 4OGQC 1KD1Q 3SFDC 1KMIZ 1YR5A 5AVYB 2B87B 3WMM0 1SQBE 1URQD 2KB7P 4YRUA 3GLMA 2IFMA 1JOCA 5BVZA 3BCCG 2WITA 1AVYA 2YGUA 3KYQA 4ASVA 5HYDA 3PATA 2B87A 2W6BA 1SL9A 4WQ3A 4LC1A 3D76A 1XFZO 3HCMA 3M0WA 1RE3A 2GUSA 2IDBA 5CSFA 4P2YB 1S1CX 1R5SA 3V4QA 1ZOYC 1RF0A 5FI6A 2NCOA 3CL3D 4NDCA 1XVJA 4QMAA 1CB1A 3TNUB 4ETOA 3V5BA 1S9KE 1CM1A 1T14A 1A75A 3BUMB 2PFXA 3H1HG 4PHKA 3CGAA 1FJKA 2KFGA 2Q4UA 3DVEA 4AUWA 3CLQA 2KQYA 1GTWA 3HE5B 3BUWB 1SK6D 1Q86Q 2ZKMX 3WUTA 1FAVA 5AVUB 2M97A 4PCWA 1SQVG 2BCCE 4XA4A 1DGVA 1PP9D 5APUA 4ZCVA 3V2NA 2CNPA 1J2JB 1SS1A 1JTHA 2L2EA 1Y8AA 4M2QA 1BODA 3L73G 5J3XA 4PJ0E 4AYCA 1TTXA 2QG4A 2W8ZA 1MFTA 2Q5UA 1NYAA 1HJ0A 1R8EA 1DMOA 3C9IA 3H1LD 4TLFA 4LGDE 4FQOA 3DVKA 3BFAA 4RESB 1Y1AA 2MBXA 4PT1A 1KILA 3H1JJ 3KHUA 3C8VA 4GNKB 1Q82Q 3TGUD 2RMZA 3DF0B 4GBAA 1OW7A 3IAOA 4GKGA 1ZRTE 2HF5A 4OCIA 2PQLA 2WVRA 5AVTB 5CCHC 2W90A 1YTZC 1LTJB 1C3ZA 1Y0VH 4F7FA 4XJKA 3AEAC 3MP7B 4YGDB 2YKPA 3FWNA 3CXHD 1QLSA 1CI6B 1MUUA 3UIAA 1XO5A 2QACA 4HB1A 3BJHA 5APTA 3R4YA 2L98A 3GG2A 1VF5D 1SQPE 4WB4A 3TGUG 1B8RA 3L72J 3L75G 3NXAA 1H88A 5CSJA 1JO5A 1LXFC 1OMRA 4ICBA 1OIPA 2C9NY 1N8RQ 3D75A 3IQQA 5FYXA 1OVVA 4PD4D 1AQTA 2Q1KA 2M49B 1LKJA 1M39A 1EDIA 3BATA 4GUKA 1WLZA 2K60A 2OTGC 2QRXA 3D6YA 2KDHA 3VMZA 1P84H 1RJVA 2G2BA 1KQMB 5KKZB 1W7IB 3R72A 1Q81Q 2LXBA 1NP8A 2K7OA 2QM7A 1QTXA 4BY5A 2WT7A 5KJ7C 1NCXA 1WT6A 1U5IB 4PDZA 2BKHB 1UWOA 4QJ4B 1M46A 3L70J 4EOTA 1YJNP 2Y9YA 1R5LA 5K89A 5BU8B 1U5IA 1QX5B 1HBWA 1M56D 1AJ5A 3VROA 3T97B 1XFVO 3HD7A 3CCEP 3B86A 5CSNA 3AEDC 3DVJA 1GU5A 2LE9B 1KYOE 2KPHA 1OWAA 3GK1A 1BE3E 1HJBA 2WPQA 4MN4C 1KFUL 1NTZG 5KLVE 3L73E 2MA2A 3O6QB 3L73J 1KSMA 3RGUA 2JR8A 1SQXD 2FYUK 4PD4E 1CDPA 5IBWA 2F8PA 2P70A 2NXQA 2DW3A 4YGEB 1FZGA 2WCJA 3OX6A 1VQ9P 3RZSA 1VQOP 2CTNA 3CZ2A 1PVAA 1MFZA 3EWKA 1SQVK 3GK2A 2L4HA 3H32B 2RH0A 3H1HE 2ZN9A 3CC2P 5KAIH 4A7PA 3CCLP 3HE4A 4TT3H 1AJ4A 3CWBJ 3CWBD 2H89C 1SLQA 4ZNCA 4NQGA 2PGDA 3RK2D 5DICA 3CC4P 4HREE 4FTGA 1TNXA 2FXOA 2KSPA 3R1OA 1JB0J 1FBMA 1AA0A 3PP5A 3BOWB 2WSCH 1KK8B 3HRNA 3H25A 1FZFA 1PGOA 2AEMA 1EH2A 2EGDA 2Z5IA 5KAFE 1JY2N 3CWGA 3Q5PA 1EZVD 3NTNA 3ZNIA 4YTPC 2LVJA 1GZLA 1L0ND 3CZ0A 3N7NA 2KOGA 1SQPJ 1SQPD 1B4CA 1CLLA 1IKUA 5HL1A 5CCGA 1TNPA 3L36A 1NTMD 1BCCG 1X8YA 2FBWC 2WSFJ 3TYYA 2FYUD 1NCYA 3BYAA 2Q7CA 2L2CA 4JF7A 5APSA 1PPJE 1ZN5A 2B9BA 2YKQA 5GTHE 3RBXA 1QIWA 2BCCD 3L4FA 3KZIH 3SIAA 3FWBA 4DOJA 3MIWA 1EXRA 2AEJA 3M06A 4JYBA 1NHLA 1ZRTD 4N3YB 4WY4A 1Y47A 4PHNA 3H1KJ 4USLA 2KP8A 3GHGA 1L2OB 4GAOA 1CFFA 1LJ2A 1VQNP 4L9MA 1HUCA 4W80A 2ZAEB 1K9MQ 1SQVD 4PE0A 4GDOA 1P84E 1IK7A 2A06G 1GDTA 5AFPA 1LT1A 4HH2A 3L70D 2QVAA 5AW8B 1L0LD 1YX8A 2MJWB 2COLB 4YI8A 3GHGC 1J1EA 1G2CB 3HTKB 5CBOA 1URQA 2R32A 3AE3C 3IN6A 2WT7B 1OOFA 2CXJA 1IZNB 3CWBE 1QASA 3A0HH 2E43A 1EDKA 1XA5A 1OOGA 3L74G 3BASA 5FI7A 2YIUB 2WOSA 2WSEH 1B1GA 3VN0A 1LGHB 5KAIE 3KXDA 3E1IA 1YVHA 4MZKA 5AVXB 1IIOA 1KQFB 2GM4A 1KFXL 1N7LA 1DJIA 1YJ9P 1Y9BA 1CFPA 2Y1MA 2E5TA 3CMEP 1JCDA 3FWLA 4GGFC 5HKZA 1KYOI 4PJ0H 4TNCA 1XFUO 3PLFB 3HUSB 4YGBB 3AE6C 1MXEA 1DJHA 2WCBA 5KTBA 2MJZA 5JJGA 3L75D 1ZLLA 2NZ0A 1NX1A 4GGNA 1L2OC 1CNPA 1G2CA 1LTAC 3RM1A 4ZCUA 3IF7A 5I2LA 1E8AA 5I2OA 2P67A 5GTIH 1NCZA 2FFDB 3L72G 3L75J 2O01N 4HRGA 1NX2A 2YXQB 1AHRA 2OTKE 3BFHA 2KXPB 1MHOA 2UWJE 1NTZK 3SS3A 2V53A 3OB1B 1S72P 2IYOA 4JWQA 3LL8B 1JFKA 2LMUA 3TUYB 1LTIC 2LXCB 4INWA 3G3ZA 1YTZT 4PV1C 5AW7B 2K8MB 1DC1A 2HPCB 1P28A 3I5GB 4I5LB 1NWDA 1PV3A 5FI2A 2ISDA 2KLUA 1L0NE 3M0DA 2NZ2A 1BDCA 2ZRTA 2K2AA 2BL0C 1E79H 3KHEA 1EZVI 3L72E 3CR4X 2IBZE 2Z4EA 1IO4A 3S0BA 1PULA 1C07A 5B8IB 2I18A 1S6CA 3SG5A 3N7HA 3PLNA 1LWUA 2OGUA 1DQEA 5DKRA 2JRFA 4PALA 1YHQP 1E5WA 3LIEA 2MHHA 3NHIA 1KZUB 4I1LA 3CCJP 1G1IA 5HKYA 1SBJA 5L8RJ 2Q9IA 3IQOA 2F3ZA 1K8AQ 1N65A 1L2PA 1J7RA 1FDIA 2HETA 1B47A 2WTYA 1PVBA 3M0DC 3F45A 2QEHA 1SQQG 3QH9A 3F89A 1OQPA 1ORGA 1FBVA 2CCMA 1RF1C 1EG4A 2EHBA 1YQ4C 1N7SC 1M1JC 5G08A 1CLBA 3AEFC 2R3CA 2H61C 3JVTC 3VMYA 5KJ7D 1VQ5P 1KB9H 1GM0A 1CMGA 4GIFA 3O6QA 3P32A 2O60A 2WNDA 1YJWP 2H2KA 2QDIA 2EC6C 2BCAA 3OA7A 4N78D 1P84I 1OMVA 1Z56A 4L74A 4ZKUA 1A75B 1GL2D 4H0LB 3WUVA 3BRVB 2OS8B 1X0TA 1JY2O 1OW8A 1HT9A 2WCMA 1ZXGA 1BGYG 1IJ5A 4OZDA 4AQRD 1NTZD 1OVUA 2PAJA 4RKUJ 1SMGA 1EXIA 1JTHB 5CSIA 2PMYA 4U8DA 1F71A 1DF0A 1GK4A 2JXLA 2L5XB 4D6TG 1JY3O 2BE6A 2D2CD 3P8CE 1SQBG 4ORBB 3V6IA 2FYUG 4O9BA 3FX0A 3U59A 3OW2O 2AMIA 5B66E 4RJTA 4YGAA 3I5CA 2QJPC 2QJPB 3QRXA 1HVVA 4H0LD 2KYFA 1LINA 1SFCA 2E75D 2ZNEA 1W9ZA 2EC6B 3DY9A 3H1LJ 3MZWB 1LVCD 1UP5A 2HPCA 2OYIA 3O6BA 5APWA 1KYOD 1RY3A 4BXLA 3HD7D 2XNXA 2WSSH 5DKNA 4XFJA 2H8VA 1ZR4A 1GMJA 1KILB 2KBMA 4C0JA 1NTKD 4YI9A 2TN4A 1JUOA 1CI6A 1SP4A 1Z2CB 1XK4A 4A4CA 3PM8A 3LW5J 1OFCX 2WCFA 2BBMA 2O01J 1SR6B 1BJFA 3H4SE 1N7SD 2AXTH 1Y6WA 1NKZB 3CX5D 2OPOA 1EXJA 3CI9A 5APYA 1H4BA 1K04A 5EFWB 2G9BA 3B71A 2XU6A 1PP9G 2JZIA 1H0TB 2IS9A 1IH0A 1UIIA 1KQMC 1IJDB 2JNFA 1OX3A 1ZOTB 3RL0g 1XK4C 1PRWA 1OMIA 1OOHA 3OJAB 5AW5B 3H1LE 2C0WA 2C9LY 1DJYA 3GF3A 5CPVA 4E68A 4H13D 2I94A 5D69A 1URQC 1PIXA 4KYNA 3L47A 2YO3A 3PALA 3B5NA 3LIDA 4IL6X 4C46A 1KB9I 1KILE 2K88A 3Q5SA 2FOTA 1D7MA 5D3OA 1IK9A 1M8OB 4P5OE 1IQ3A 1DD3A 1C3YA 2Y5IA 1KB9E 1LT9B 1SQQE 2M7LA 1U57A 4DIRA 4ZKPA 1SRAA 3CYZA 2E75B 3AE8C 2OYOA 2E75C 5AVVB 1VQ8P 2FJYA 5AVWB 1CTRA 2I1JA 2PP6A 1LP1A 3DD4A 1LNQA 3PM2A 1UURA 1QVIZ 1S5LX 1TCFA 1M45A 1PSRA 4N6JA 1S6JA 2CT9A 3Q3DA 1A03A 2M8RA 1A02F 2H7HA 1OOIX 2LVKA 3AE1C 1B8LA 2QEXP 1NIWA 3CZTX 1ZW0A 5TISH 1BE3D 4ORAB 2K61A 2ZT9D 3HTKA 1SQVE 5AW0B 1VRKA 3RK3B 2WWWA 2P6BB 3GF7A 2KYVA 4D6TJ 3HE4B 1TNWA 1QWVA 3NFQA 1S4XA 2L91A 5K5GB 1WRGA 3CABA 1B7TZ 2WC8A 2W27A 5KLVK 4UB6H 1KB9D 2QEVA 1F54A 3CX5I 4N5XA 1N2DC 4MZLA 1SPYA 2FCEA 2I2RE 2K7DA 2NCPA 3BCCE 1KK7Y 1RFJA 4DRWA 1NU1G 2M9GA 2JQ6A 3S9OA 4UB6E 2LNKA 1L4AA 2Y0DA 3AAKA 3VOPA 3D78A 5APXA 4MN0A 3M9BA 5F6TA 1H89A 5HLVA 5KSZA 5AVZB 1OW4A 4OH8B 1SQQD 4AOMA 3L72D 3E7KA 2M5AB 4BRYB 4W7YA 4H13C 3JC22 1L0NJ 5CMZA 1YITP 3ICBA 3O2PA 2KBIA 2BECA 4PV1D 1FC2C 3CMAP 3W67A 1NU1D 1SQQJ 1YUTA 1KTMA 3AEGC 1URQB 2J5UA 2BCCJ 3O8ZA 1JCCA 3L71G 1JNMA 2M3BA 2FYZA 2ZYGA 2KLEA 2N1TC 1T2KD 5KLIC 4N1FA 2ERBA 1M1JA 1AVOA 1NTZJ 2K7CA 5H2FH 2L4IA 2L51A 1K95A 1DJGA 1S1EA 2I8DA 3CWBG 3H1LG 3L71J 3CD6P 1H0TA 4FQTA 1HGZA 3R1PA 3CZ1A 1IFPA 3AEBC 2XKMA 4CIDA 3FE8A 2E42A 3G9RA 1YQ3C 2WCKA 3OX5A 1RE4A 1SQXE 2XV5A 3DZTA 2KSEA 5CCGD 3D74A 2KZIA 2P2UA 1QL1A 1GW3A 3SJSA 2Q6QA 1SR6C 4PD4H 2V7QH 1ZACA 5TNCA 1BE3J 3FXEA 1SCVA 2KNEA 3KDPB 5CBNA 1VQLP 1AFOA 3SG2A 3LLEA 2O01H 2WQYC 2YMKA 3OHMB 4C7NB 1MF8B 3H1KG 4UPGA 2NPSA 1MR8A 1S3JA 2OYHA 5M1BA 1X02A 3EK8A 2HODB 1KQLA 4BWNA 1DVIA 2LCPA 2XDJA 4A4BA 4ZMDA 3RBZA 3CLNA 3EVRA 1NTMJ 1L7ZA 1LTJC 2C0XA 1KWOC 1CFDA 3B88A 2P1JA 2HYNA 3CCVP 5APVA 5JOLA 3SWKA 1PL5A 3RK2C 4M2PA 2LMTA 2BNXA 3P7KA 3A5TA 4HJGH 2CK3H 2JTTA 1XTGB 4CPGA 2KFHA 1YTZI 1OSAA 2F33A 2WCHA 2JWAA 2E76D 3VMXA 2O3JA 3H1IG 1EDLA 1LT9C 1JF2A 2N1TD 1T2KC 2A4JA 2PRRA 1PZQA 3FGAD 3JTDB 1FZCC 1DJZA 2P7JA 2FFDA 1QS7A 2KS1B 3AKBA 1K94A 3TGUE 1XFXO 1R2UA 2V4HA 2KFFA 2PALA 3FIAA 2LC5A 1FOSF 1SQXJ 4MSPA 1S26D 2B1UA 1NH4A 4KHXA 1KV4A 2IZ1A 3B7AA 3A0BE 1NX0A 2E76B 1YVLA 2OTJP 1FZCA 1EJ3A 3KF9A 2M0RA 1IFMA 1M7LA 3KEVA 2KOTA 5AEQA 2BASA 2JPTA 2D2CB 4MZJA 4IL6H 1BR4B 1DJXA 3A2AA 1SL8A 1NKNA 3A0BH 2E5YA 3I5IC 2NRGA 3RL0C 1QGKB 1XFYO 3EG5B 1PGQA 1R6PA 3S1KA 1RF1B 1W2BO 1XFWO 1FW4A 5I8NA 2MLEC 3I5HC 3L74E 5B5EH 1XTCC 1FZEA 3P8MC 2IBZG 1S5LH 2JC2A 2M7NA 3D0YB 3S0DA 3HD7B 1HWTC 1OZSA 4L73A 3EK7A 3TF5A 1NGMB 1WRZA 1L0NG 3CXHE 3TSIA 1H8AA 1QX7A 4Y99B 5AVRB 2HQ8A 1SFCD 1FF1A 3BQ3A 2LVIA 1ZV8A 1BSHA 4QJ5B 3GOFA 3FXDA 3L74J 1DX7A 1MWNA 1WLMA 1PALA 5C39A 1K96A 2WCLA 1OOJA 1A02J 1DF0B 4YXDC 3L75E 2JT8A 4JQ0D 2BCBA 3VRPA 1EQ7A 3A8RA 4KJMA 2FYNC 1VQPP 1IFIA 1IFJA 1BT6A 1BG1A 1QATA 5GTIE 3T97A 4YBHB 3H1IJ 3SWFA 2O5GA 3SSUA 3D71A 1SW8A 1RECA 4U3FE 2OS8C 4R1EA 1WY9A 2QIWA 3WUUA 1TOPA 2QJYC 1ZMZA 1RE3C 2KNCB 2KI6D 1IQ5A 1X22A 1K73Q 2M5AA 4BRYA 4YGCB 5DKQA 2J59M 3D6ZA 3DF0A 1DTLA 3A3YB 4DS7A 2Y9ZA 4WY4C 1NVOA 3LK1A 1NWQA 1N73B 4R4LA 1PGJA 3RL0D 1N86A 2KIKA 1FZCB 1KFMA 4OGQD 2M3WA 3K21A 1KWOB 3A4UB 2GGMA 3L73D 5KJ7A 1QJTA 2LR2A 1U7MA 3WHUB 2LAPA 1L4AB 1KN7A 2WPRA 2JTZA 1N0YA 1LTBC 1B7TY 2LMVA 1DD4A 1BGYE 4EYYQ 4F0ZB 4JKTA 3BUXB 2LLTA 2JJLA 2ZN8A 1QVGO 2MLFC 3NHTA 2BL0B 3FS7A 2A45I 1JBAA 3ITKA 4GPLB 1VL2A 2LUCA 2W6JH 1PP9J 3L4LA 3RK3E 1NPQA 3TZ1A 1SQBK 3PFVA 5KTYA 3I5GC 3EVVA 3IVTA 1CSBA 1KCYA 4EIJA 3H1IE 1L0LE 3LW5H 1J7QA 1LTJA 3HUSC 1NO4A 4JBZA 1ALVA 1DEKA 3Q8IA 1VQMP 1NTMG 3LK0A 4NDBA 2JXCA 1PGPA 1GL2A 3I56P 1ZMEC 4HYTB 3H1JD 4I6MC 3CXHH 4IJ7A 4PHMA 3D10A 2HODA 2NLNA 2WPSA 1KC8Q 2KGRA 4AQIA 3PRJA 2LKMA 1ALWA 1AJYA 3H1ID 1F70A 1L0LK 3H1KD 2L5GB 1CW5A 3BOWA 1B8CA 1T3JA 2ITAA 3BXKA 4PE1A 3TUYC 1K9PA 1N2DA 4PV1B 5B66H 3RK3D 1SSEB 1A4PA 3BUOB 3CCQP 3VGOA 4WY4D 2Q3IA 1PPJD 4Y28J 1YYCA 3KPEA 2AUCA 4INXA 5ER5A 4Z1MH 2A06D 1DT7B 1USEA 1HGVA 1EG3A 1G33A 1DGUA 2M1UA 1JM0A 1EZVG 2KYCA 3R2PA 1QX8A 1JF0A 2OTGB 4OKHA 1L0LG 4I5NB 4GOEA 2IZ0A 3S0FA 2BKIB 2LANA 1SQBJ 2QJYB 4EDFA 2AEFA 3C1VA 3AKAA 2WSCJ 4OR9B 1KK8C 2WZ7A 2SASA 3I5IB 5HKWA 3CR5X 2ZYDA 1PFIA 2K9JA 2WCEA 2F2OA 2KHNA 2ZVOB
chains in the Genus database with same CATH topology
2K7DA 4HREE 2NCPA 1KK7Y 1HQVA 1RFJA 4DRWA 4FTGA 2E6WA 1TNXA 1RROA 1CKKA 2KSPA 3JTDC 1DJWA 2M9GA 4MRXA 2JQ6A 2LNKA 1MXLC 3BOWB 2AAOA 1S5GZ 3AAKA 1KK8B 1KSOA 4MN0A 5F6TA 2LUXA 1IGVA 5HLVA 5KSZA 1YUSA 4GFTA 5GQQC 1EH2A 1K9KA 2EGDA 3EKJA 2BBNA 4AOMA 3CWGA 2WORA 3ZNIA 3VRNA 1ODBA 2M1KB 2LVJA 2ZRSA 5ER4X 2K0JA 1S6IA 4BY4A 4WRIA 3ICBA 3O2PA 2KBIA 1CLLA 1B4CA 1IKUA 1JWDA 1K8UA 2BECA 2ZNDA 1TNPA 2JU0A 5D7FA 2M8UA 1SL7A 1NCYA 3BYAA 1YUTA 2VRGA 1G4YR 3JVTB 1OMDA 3OP0A 1WDCC 1CFCA 2JWWA 4IL1A 1QIWA 2I7AA 2KHNA 3SIAA 3FWBA 1A29A 3I5FB 1F8HA 1EXRA 2GGZA 2QPTA 4ORCB 4C0LA 3TDIA 1FPWA 1RTP1 3CS1A 1AP4A 4PHNA 4N1FA 4USLA 3O78A 3SG6A 1TCOB 2K7CA 1L2OB 2L4IA 3NSIA 4GAOA 1CFFA 2L51A 1K95A 1DJGA 1S1EA 1BF5A 1LA0A 4L9MA 3EK4A 2KAVA 2RGIA 2KQ6A 5BPJA 2K2FA 4CIDA 4PE0A 3E3RA 1GJYA 1NX3A 3CR2A 4NDDA 3OX5A 1SCMC 3WNXB 1FI5A 2F2PA 5AFPA 3WXAA 1TIZA 1SNLA 1KK7Z 5KU1A 3SJSA 3AAJA 1J55A 3SG4A 3TDZA 4D1EA 1YX8A 1SR6C 1ZACA 1TRFA 5TNCA 2MJWB 1YURA 2COLB 4YI8A 1F55A 1SCVA 2KNEA 1C7WA 1J1EA 2LLUA 4PE4A 1WDCB 3SG2A 3LLEA 2JT0A 5AXIA 2D8NA 2KAXA 3OHMB 1MF8B 2K7BA 4UPGA 1UHIA 2CXJA 1QASA 1IRJA 1MR8A 2LP3A 2JULA 1F4OA 1XA5A 3RLZA 1CDMA 1X02A 4AQJA 2WOSA 3EK8A 1B1GA 1DVIA 1BU3A 2LCPA 5HLOA 4A4BA 3D0YA 1YVHA 4M2OA 1W7JB 4MZKA 3CLNA 2LHLA 1MQ1A 3EVRA 1UUSA 1KFXL 1DJIA 1UHNA 2FJUB 1L7ZA 1XYDA 1M31A 1KWOC 1CFPA 2Y1MA 1CMFA 1RK9A 1CFDA 2F3YA 4GGFC 5HKZA 1JFJA 4NQGA 2M29A 1PK0D 1S3PA 1OZOA 4TNCA 1XFUO 3PLFB 2JOJA 1NUBA 4YGBB 5JOLA 1MXEA 1DJHA 2WCBA 1QXPA 2LMTA 4M2PA 5JJGA 1K9UA 4XYNA 2NZ0A 2PASA 4CFRA 1NX1A 4GGNA 1L2OC 2LP2A 1CNPA 2JTTA 1G8IA 3ZWHA 3RM1A 1V1FA 2KFHA 4ZCUA 1OSAA 4HSZA 2Y1NA 3IF7A 1D1OA 5I2LA 1E8AA 4C0KA 2F33A 3KPXA 3I5HB 5I2OA 1WRLA 2JNXA 3LCPC 1JF2A 1NCZA 3NSLA 3EVUA 2A4JA 4HRGA 1NX2A 2KGBC 3CTNA 1AHRA 1Q80A 2LHIA 1QV0A 1J7OA 1KFXS 3JTDB 1DJZA 2LLSA 1CLMA 4OVNF 1MHOA 2KAYA 1QS7A 1UHJA 2V53A 3OB1B 3FWCA 3SIBA 4JWQA 2KI4C 3AKBA 1K94A 3LL8B 1JFKA 2LMUA 3TUYB 3WHTB 1F4QA 2K8MB 4Q04A 1YRUB 1BLQA 1XFXO 1CDNA 1R2UA 2FCDA 4CPVA 1IG5A 1WRKA 3NSKA 2GV5A 2KFFA 3I5GB 4I5LB 2PALA 1NWDA 4N1GA 2H61A 1FI6A 1UHHA 1TNQA 2ISDA 1NSHA 3FIAA 3O4YA 2Q91A 2LC5A 1LA3A 1PSBA 4MSPA 4MVFA 1S26D 2B1UA 2ZRTA 2K2AA 2R2IA 2BL0C 1NX0A 3KHEA 3CR4X 1YVLA 2HPSA 2BCXA 1CM4A 1EJ3A 1IWQA 1PULA 1C07A 3KF9A 3PSRA 1A2XA 2I18A 2M0RA 5B8IB 2E30A 1S6CA 1M63B 3SG5A 3KEVA 2KOTA 5AEQA 4JPZB 2JPTA 3MSEB 5DKRA 2JRFA 4MZJA 4PALA 1BOCA 1Y1XA 2MHHA 1OE9B 1S5GY 3OB2B 1BR4B 1DJXA 2JT3A 1SL8A 5HKYA 1SBJA 1ZFSA 1J1DA 1K93D 3IQOA 2F3ZA 3PN7B 2HQWA 1TN4A 1KQVA 3I5IC 1N65A 1J7RA 1GQMA 2HETA 1XFYO 1B47A 1PVBA 3KO0A 4MEWA 3F45A 1R6PA 1XFWO 1FW4A 2DOQA 5I8NA 1QV1A 1YR5A 2MLEC 1OQPA 3I5HC 3TS5B 1FBVA 2CCMA 1EG4A 2EHBA 2Y4QA 4YRUA 2JC2A 2M7NA 5G08A 5AERA 3D0YB 1CLBA 1OZSA 5HYDA 3EK7A 1K90D 2H61C 1WRZA 3JVTC 3PATA 1J7PA 1SL9A 4WQ3A 1XFZO 3HCMA 3M0WA 1CMGA 1QX7A 1IJ6A 5CSFA 2O60A 2HQ8A 2WNDA 4P2YB 1FF1A 2H2KA 2EC6C 2BCAA 3BQ3A 2LVIA 1OMVA 3EKHA 4QJ5B 3GOFA 2ZFDA 1A75B 1MWNA 2NCOA 1S36A 1PALA 1WLMA 1K96A 2OS8B 2BE4A 4NDCA 1XVJA 1CB1A 1OOJA 1HT9A 4ETOA 1CM1A 2LM5A 1IJ5A 1DF0B 1A75A 3BUMB 3DVMA 2JT8A 4JQ0D 3CGAA 4PHKA 2BCBA 2KFGA 2LVVA 2Q4UA 3DVEA 3VRPA 2KQYA 3A8RA 1SMGA 3BUWB 1SK6D 1BMOA 2ZKMX 5CSIA 2PMYA 4U8DA 1F71A 1DF0A 2JXLA 2L5XB 2M97A 1BT6A 4PCWA 1BG1A 4XJKB 1QATA 3GK4X 4I5KA 5I2QA 2BE6A 1DGVA 4ZCVA 4YBHB 2CNPA 2L0PA 2L2EA 4ORBB 2O5GA 4M2QA 1SW8A 1H8BA 1BODA 1RECA 1SYMA 5J3XA 2AMIA 1TTXA 2OS8C 4R1EA 3TS5C 1WY9A 1TOPA 4YGAA 4OV2A 1NYAA 1ZMZA 3QRXA 2KYFA 1LINA 1DMOA 2ZNEA 2KI6D 2EC6B 4GGFA 1IQ5A 1LVCD 1QVIY 1UP5A 4FQOA 1SCMB 3DVKA 2L50A 3PN7C 3O6BA 4YGCB 5DKQA 1Y1AA 3DF0A 2MBXA 1DTLA 4HRHA 2MRDA 4GNKB 1QIVA 4DS7A 2Y9ZA 5DKNA 3LK1A 2I2RE 3DF0B 4GBAA 2KBMA 1K2HA 4C0JA 2HF5A 2PSRA 4OCIA 4YI9A 2TN4A 1JUOA 2SCPA 1YTZC 1XK4A 2M3WA 1GGZA 1KWOB 3A4UB 1Y0VH 3K21A 3PM8A 2WCFA 4A4CA 4XJKA 2GGMA 2BBMA 4YGDB 1OFCX 1SKTA 1QLSA 1SR6B 1QJTA 1CDLA 1BJFA 2PVBA 3H4SE 3WHUB 2LAPA 1Y6WA 3VRQA 1XO5A 2QACA 2OPOA 4DUQA 2JTZA 1N0YA 1KFUS 2L98A 1B7TY 2LMVA 1H4BA 4F0ZB 2G9BA 1B8RA 3NXAA 5CSJA 1LXFC 3BUXB 1OMRA 2LLTA 2JZIA 2ZN8A 2IS9A 4ICBA 1IH0A 3SG7A 1KQMC 2JNFA 2MLFC 2BL0B 1ZOTB 3FS7A 2CBLA 1XK4C 1PRWA 3IQQA 1JBAA 4GPLB 5FYXA 2LUCA 2M49B 1LKJA 3NSOA 1BR1B 1M39A 4DCKA 1NPQA 4GUKA 1DJYA 3TZ1A 3PFVA 5KTYA 3I5GC 1WLZA 2LV7A 3EVVA 3I5FC 2OTGC 5CPVA 4CFQA 2KDHA 1JSAA 1KCYA 1QX2A 4E68A 2I94A 5D69A 1RJVA 2G2BA 1KQMB 1J7QA 1W7IB 1QLKA 1RWYA 3PALA 1NP8A 2K7OA 1QTXA 4BY5A 1ALVA 1NCXA 3LK0A 4NDBA 1AK8A 1GGWA 1U5IB 2JXCA 4PDZA 4QJ3B 2BKHB 2FOTA 1YRTB 4PE7A 1UWOA 4P5OE 4QJ4B 1IQ3A 2Y5IA 4PHMA 1M46A 3D10A 2M7LA 1UHKA 2NLNA 4WQ2A 2Y9YA 4DIRA 5K89A 1U5IA 1QX5B 2PRUA 1AUIB 1SRAA 1AJ5A 2KGRA 3HX4A 3VROA 4AQIA 1C7VA 1XFVO 3TDUA 4MBEA 1CTRA 1ALWA 5CSNA 1YX7A 3DD4A 3DVJA 1UURA 1QVIZ 1F70A 2LE9B 3GK1A 1EL4A 3BOWA 1B8CA 1KFUL 1TCFA 3BXKA 1SY9A 1V1GA 4PE1A 1K9PA 1M45A 1N2DA 1PSRA 2MA2A 1S6JA 4I5JA 3TUYC 2CT9A 1A03A 1KSMA 1AVSA 2LVKA 1A4PA 3BUOB 1B8LA 1NIWA 3CZTX 3VGOA 3VRRA 5AANA 1CDPA 5IBWA 4ORAB 2F8PA 2NXQA 2K61A 1ZUZA 4YGEB 3OX6A 4PHJA 2AUCA 5ER5A 1VRKA 2P6BB 2CTNA 1YUUA 1PVAA 1DT7B 1EG3A 1G33A 1DGUA 2M1UA 3GK2A 2L4HA 2MAZA 1TNWA 2KYCA 4CLNA 4MRYA 1JF0A 2OTGB 4OKHA 4I5NB 2ZN9A 5PALA 2BKIB 2LANA 1B7TZ 1MUXA 2WC8A 3AKAA 3C1VA 4OR9B 3SG3A 1AJ4A 1KK8C 1JC2A 2SASA 3I5IB 5HKWA 1F54A 3CR5X 4N5XA 1B9AA 4MLWA 4MZLA 3BUNB 2KI4B 1SPYA 2KI6C 2WCEA 2F2OA 2FCEA 1Y1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7D A;  4HRE E;  2NCP A;  1KK7 Y;  1HQV A;  1RFJ A;  4DRW A;  4FTG A;  2E6W A;  1TNX A;  1RRO A;  1CKK A;  2KSP A;  3JTD C;  1DJW A;  2M9G A;  4MRX A;  2JQ6 A;  2LNK A;  1MXL C;  3BOW B;  2AAO A;  1S5G Z;  3AAK A;  1KK8 B;  1KSO A;  4MN0 A;  5F6T A;  2LUX A;  1IGV A;  5HLV A;  5KSZ A;  1YUS A;  4GFT A;  5GQQ C;  1EH2 A;  1K9K A;  2EGD A;  3EKJ A;  2BBN A;  4AOM A;  3CWG A;  2WOR A;  3ZNI A;  3VRN A;  1ODB A;  2M1K B;  2LVJ A;  2ZRS A;  5ER4 X;  2K0J A;  1S6I A;  4BY4 A;  4WRI A;  3ICB A;  3O2P A;  2KBI A;  1CLL A;  1B4C A;  1IKU A;  1JWD A;  1K8U A;  2BEC A;  2ZND A;  1TNP A;  2JU0 A;  5D7F A;  2M8U A;  1SL7 A;  1NCY A;  3BYA A;  1YUT A;  2VRG A;  1G4Y R;  3JVT B;  1OMD A;  3OP0 A;  1WDC C;  1CFC A;  2JWW A;  4IL1 A;  1QIW A;  2I7A A;  2KHN A;  3SIA A;  3FWB A;  1A29 A;  3I5F B;  1F8H A;  1EXR A;  2GGZ A;  2QPT A;  4ORC B;  4C0L A;  3TDI A;  1FPW A;  1RTP 1;  3CS1 A;  1AP4 A;  4PHN A;  4N1F A;  4USL A;  3O78 A;  3SG6 A;  1TCO B;  2K7C A;  1L2O B;  2L4I A;  3NSI A;  4GAO A;  1CFF A;  2L51 A;  1K95 A;  1DJG A;  1S1E A;  1BF5 A;  1LA0 A;  4L9M A;  3EK4 A;  2KAV A;  2RGI A;  2KQ6 A;  5BPJ A;  2K2F A;  4CID A;  4PE0 A;  3E3R A;  1GJY A;  1NX3 A;  3CR2 A;  4NDD A;  3OX5 A;  1SCM C;  3WNX B;  1FI5 A;  2F2P A;  5AFP A;  3WXA A;  1TIZ A;  1SNL A;  1KK7 Z;  5KU1 A;  3SJS A;  3AAJ A;  1J55 A;  3SG4 A;  3TDZ A;  4D1E A;  1YX8 A;  1SR6 C;  1ZAC A;  1TRF A;  5TNC A;  2MJW B;  1YUR A;  2COL B;  4YI8 A;  1F55 A;  1SCV A;  2KNE A;  1C7W A;  1J1E A;  2LLU A;  4PE4 A;  1WDC B;  3SG2 A;  3LLE A;  2JT0 A;  5AXI A;  2D8N A;  2KAX A;  3OHM B;  1MF8 B;  2K7B A;  4UPG A;  1UHI A;  2CXJ A;  1QAS A;  1IRJ A;  1MR8 A;  2LP3 A;  2JUL A;  1F4O A;  1XA5 A;  3RLZ A;  1CDM A;  1X02 A;  4AQJ A;  2WOS A;  3EK8 A;  1B1G A;  1DVI A;  1BU3 A;  2LCP A;  5HLO A;  4A4B A;  3D0Y A;  1YVH A;  4M2O A;  1W7J B;  4MZK A;  3CLN A;  2LHL A;  1MQ1 A;  3EVR A;  1UUS A;  1KFX L;  1DJI A;  1UHN A;  2FJU B;  1L7Z A;  1XYD A;  1M31 A;  1KWO C;  1CFP A;  2Y1M A;  1CMF A;  1RK9 A;  1CFD A;  2F3Y A;  4GGF C;  5HKZ A;  1JFJ A;  4NQG A;  2M29 A;  1PK0 D;  1S3P A;  1OZO A;  4TNC A;  1XFU O;  3PLF B;  2JOJ A;  1NUB A;  4YGB B;  5JOL A;  1MXE A;  1DJH A;  2WCB A;  1QXP A;  2LMT A;  4M2P A;  5JJG A;  1K9U A;  4XYN A;  2NZ0 A;  2PAS A;  4CFR A;  1NX1 A;  4GGN A;  1L2O C;  2LP2 A;  1CNP A;  2JTT A;  1G8I A;  3ZWH A;  3RM1 A;  1V1F A;  2KFH A;  4ZCU A;  1OSA A;  4HSZ A;  2Y1N A;  3IF7 A;  1D1O A;  5I2L A;  1E8A A;  4C0K A;  2F33 A;  3KPX A;  3I5H B;  5I2O A;  1WRL A;  2JNX A;  3LCP C;  1JF2 A;  1NCZ A;  3NSL A;  3EVU A;  2A4J A;  4HRG A;  1NX2 A;  2KGB C;  3CTN A;  1AHR A;  1Q80 A;  2LHI A;  1QV0 A;  1J7O A;  1KFX S;  3JTD B;  1DJZ A;  2LLS A;  1CLM A;  4OVN F;  1MHO A;  2KAY A;  1QS7 A;  1UHJ A;  2V53 A;  3OB1 B;  3FWC A;  3SIB A;  4JWQ A;  2KI4 C;  3AKB A;  1K94 A;  3LL8 B;  1JFK A;  2LMU A;  3TUY B;  3WHT B;  1F4Q A;  2K8M B;  4Q04 A;  1YRU B;  1BLQ A;  1XFX O;  1CDN A;  1R2U A;  2FCD A;  4CPV A;  1IG5 A;  1WRK A;  3NSK A;  2GV5 A;  2KFF A;  3I5G B;  4I5L B;  2PAL A;  1NWD A;  4N1G A;  2H61 A;  1FI6 A;  1UHH A;  1TNQ A;  2ISD A;  1NSH A;  3FIA A;  3O4Y A;  2Q91 A;  2LC5 A;  1LA3 A;  1PSB A;  4MSP A;  4MVF A;  1S26 D;  2B1U A;  2ZRT A;  2K2A A;  2R2I A;  2BL0 C;  1NX0 A;  3KHE A;  3CR4 X;  1YVL A;  2HPS A;  2BCX A;  1CM4 A;  1EJ3 A;  1IWQ A;  1PUL A;  1C07 A;  3KF9 A;  3PSR A;  1A2X A;  2I18 A;  2M0R A;  5B8I B;  2E30 A;  1S6C A;  1M63 B;  3SG5 A;  3KEV A;  2KOT A;  5AEQ A;  4JPZ B;  2JPT A;  3MSE B;  5DKR A;  2JRF A;  4MZJ A;  4PAL A;  1BOC A;  1Y1X A;  2MHH A;  1OE9 B;  1S5G Y;  3OB2 B;  1BR4 B;  1DJX A;  2JT3 A;  1SL8 A;  5HKY A;  1SBJ A;  1ZFS A;  1J1D A;  1K93 D;  3IQO A;  2F3Z A;  3PN7 B;  2HQW A;  1TN4 A;  1KQV A;  3I5I C;  1N65 A;  1J7R A;  1GQM A;  2HET A;  1XFY O;  1B47 A;  1PVB A;  3KO0 A;  4MEW A;  3F45 A;  1R6P A;  1XFW O;  1FW4 A;  2DOQ A;  5I8N A;  1QV1 A;  1YR5 A;  2MLE C;  1OQP A;  3I5H C;  3TS5 B;  1FBV A;  2CCM A;  1EG4 A;  2EHB A;  2Y4Q A;  4YRU A;  2JC2 A;  2M7N A;  5G08 A;  5AER A;  3D0Y B;  1CLB A;  1OZS A;  5HYD A;  3EK7 A;  1K90 D;  2H61 C;  1WRZ A;  3JVT C;  3PAT A;  1J7P A;  1SL9 A;  4WQ3 A;  1XFZ O;  3HCM A;  3M0W A;  1CMG A;  1QX7 A;  1IJ6 A;  5CSF A;  2O60 A;  2HQ8 A;  2WND A;  4P2Y B;  1FF1 A;  2H2K A;  2EC6 C;  2BCA A;  3BQ3 A;  2LVI A;  1OMV A;  3EKH A;  4QJ5 B;  3GOF A;  2ZFD A;  1A75 B;  1MWN A;  2NCO A;  1S36 A;  1PAL A;  1WLM A;  1K96 A;  2OS8 B;  2BE4 A;  4NDC A;  1XVJ A;  1CB1 A;  1OOJ A;  1HT9 A;  4ETO A;  1CM1 A;  2LM5 A;  1IJ5 A;  1DF0 B;  1A75 A;  3BUM B;  3DVM A;  2JT8 A;  4JQ0 D;  3CGA A;  4PHK A;  2BCB A;  2KFG A;  2LVV A;  2Q4U A;  3DVE A;  3VRP A;  2KQY A;  3A8R A;  1SMG A;  3BUW B;  1SK6 D;  1BMO A;  2ZKM X;  5CSI A;  2PMY A;  4U8D A;  1F71 A;  1DF0 A;  2JXL A;  2L5X B;  2M97 A;  1BT6 A;  4PCW A;  1BG1 A;  4XJK B;  1QAT A;  3GK4 X;  4I5K A;  5I2Q A;  2BE6 A;  1DGV A;  4ZCV A;  4YBH B;  2CNP A;  2L0P A;  2L2E A;  4ORB B;  2O5G A;  4M2Q A;  1SW8 A;  1H8B A;  1BOD A;  1REC A;  1SYM A;  5J3X A;  2AMI A;  1TTX A;  2OS8 C;  4R1E A;  3TS5 C;  1WY9 A;  1TOP A;  4YGA A;  4OV2 A;  1NYA A;  1ZMZ A;  3QRX A;  2KYF A;  1LIN A;  1DMO A;  2ZNE A;  2KI6 D;  2EC6 B;  4GGF A;  1IQ5 A;  1LVC D;  1QVI Y;  1UP5 A;  4FQO A;  1SCM B;  3DVK A;  2L50 A;  3PN7 C;  3O6B A;  4YGC B;  5DKQ A;  1Y1A A;  3DF0 A;  2MBX A;  1DTL A;  4HRH A;  2MRD A;  4GNK B;  1QIV A;  4DS7 A;  2Y9Z A;  5DKN A;  3LK1 A;  2I2R E;  3DF0 B;  4GBA A;  2KBM A;  1K2H A;  4C0J A;  2HF5 A;  2PSR A;  4OCI A;  4YI9 A;  2TN4 A;  1JUO A;  2SCP A;  1YTZ C;  1XK4 A;  2M3W A;  1GGZ A;  1KWO B;  3A4U B;  1Y0V H;  3K21 A;  3PM8 A;  2WCF A;  4A4C A;  4XJK A;  2GGM A;  2BBM A;  4YGD B;  1OFC X;  1SKT A;  1QLS A;  1SR6 B;  1QJT A;  1CDL A;  1BJF A;  2PVB A;  3H4S E;  3WHU B;  2LAP A;  1Y6W A;  3VRQ A;  1XO5 A;  2QAC A;  2OPO A;  4DUQ A;  2JTZ A;  1N0Y A;  1KFU S;  2L98 A;  1B7T Y;  2LMV A;  1H4B A;  4F0Z B;  2G9B A;  1B8R A;  3NXA A;  5CSJ A;  1LXF C;  3BUX B;  1OMR A;  2LLT A;  2JZI A;  2ZN8 A;  2IS9 A;  4ICB A;  1IH0 A;  3SG7 A;  1KQM C;  2JNF A;  2MLF C;  2BL0 B;  1ZOT B;  3FS7 A;  2CBL A;  1XK4 C;  1PRW A;  3IQQ A;  1JBA A;  4GPL B;  5FYX A;  2LUC A;  2M49 B;  1LKJ A;  3NSO A;  1BR1 B;  1M39 A;  4DCK A;  1NPQ A;  4GUK A;  1DJY A;  3TZ1 A;  3PFV A;  5KTY A;  3I5G C;  1WLZ A;  2LV7 A;  3EVV A;  3I5F C;  2OTG C;  5CPV A;  4CFQ A;  2KDH A;  1JSA A;  1KCY A;  1QX2 A;  4E68 A;  2I94 A;  5D69 A;  1RJV A;  2G2B A;  1KQM B;  1J7Q A;  1W7I B;  1QLK A;  1RWY A;  3PAL A;  1NP8 A;  2K7O A;  1QTX A;  4BY5 A;  1ALV A;  1NCX A;  3LK0 A;  4NDB A;  1AK8 A;  1GGW A;  1U5I B;  2JXC A;  4PDZ A;  4QJ3 B;  2BKH B;  2FOT A;  1YRT B;  4PE7 A;  1UWO A;  4P5O E;  4QJ4 B;  1IQ3 A;  2Y5I A;  4PHM A;  1M46 A;  3D10 A;  2M7L A;  1UHK A;  2NLN A;  4WQ2 A;  2Y9Y A;  4DIR A;  5K89 A;  1U5I A;  1QX5 B;  2PRU A;  1AUI B;  1SRA A;  1AJ5 A;  2KGR A;  3HX4 A;  3VRO A;  4AQI A;  1C7V A;  1XFV O;  3TDU A;  4MBE A;  1CTR A;  1ALW A;  5CSN A;  1YX7 A;  3DD4 A;  3DVJ A;  1UUR A;  1QVI Z;  1F70 A;  2LE9 B;  3GK1 A;  1EL4 A;  3BOW A;  1B8C A;  1KFU L;  1TCF A;  3BXK A;  1SY9 A;  1V1G A;  4PE1 A;  1K9P A;  1M45 A;  1N2D A;  1PSR A;  2MA2 A;  1S6J A;  4I5J A;  3TUY C;  2CT9 A;  1A03 A;  1KSM A;  1AVS A;  2LVK A;  1A4P A;  3BUO B;  1B8L A;  1NIW A;  3CZT X;  3VGO A;  3VRR A;  5AAN A;  1CDP A;  5IBW A;  4ORA B;  2F8P A;  2NXQ A;  2K61 A;  1ZUZ A;  4YGE B;  3OX6 A;  4PHJ A;  2AUC A;  5ER5 A;  1VRK A;  2P6B B;  2CTN A;  1YUU A;  1PVA A;  1DT7 B;  1EG3 A;  1G33 A;  1DGU A;  2M1U A;  3GK2 A;  2L4H A;  2MAZ A;  1TNW A;  2KYC A;  4CLN A;  4MRY A;  1JF0 A;  2OTG B;  4OKH A;  4I5N B;  2ZN9 A;  5PAL A;  2BKI B;  2LAN A;  1B7T Z;  1MUX A;  2WC8 A;  3AKA A;  3C1V A;  4OR9 B;  3SG3 A;  1AJ4 A;  1KK8 C;  1JC2 A;  2SAS A;  3I5I B;  5HKW A;  1F54 A;  3CR5 X;  4N5X A;  1B9A A;  4MLW A;  4MZL A;  3BUN B;  2KI4 B;  1SPY A;  2KI6 C;  2WCE A;  2F2O A;  2FCE A;  1Y1U A; 
#chains in the Genus database with same CATH topology
 2ZYA A;  2PYQ A;  1HTL C;  2E6W A;  3S4R A;  1CKK A;  3HD7 C;  3JTD C;  1DJW A;  3KQG A;  4XE5 B;  3Q1M A;  2P58 A;  3GHG B;  2H43 A;  1YBK A;  2E76 C;  1KSO A;  3ABV C;  2KNC A;  2LUX A;  5GQQ C;  3DYE A;  3EKJ A;  2Z5H A;  2BBN A;  3SS4 A;  1FDM A;  3BCC D;  4OWF A;  2WOR A;  3CXH I;  2N9Y B;  2M1K B;  3JCU E;  1XFR A;  2K0J A;  2N1T A;  4BY4 A;  1S9K D;  3VP8 A;  2FKW B;  1BGY J;  2XND H;  1BGY D;  1JWD A;  1K8U A;  1FU1 A;  3MHV A;  2ZND A;  3L70 E;  2JU0 A;  5D7F A;  5AW4 B;  2M8U A;  1SL7 A;  2VRG A;  1G4Y R;  3OP0 A;  1NTK K;  2KUB A;  1WDC C;  2FXP A;  1CFC A;  4H44 C;  2I7A A;  2WMM A;  1RE4 C;  1A29 A;  2GTE A;  4UB8 E;  3B5N B;  5AW2 B;  2POH A;  1NYH A;  2GGZ A;  2QPT A;  2A45 H;  2JPO A;  4C0L A;  3TDI A;  1RF1 A;  3PJS K;  1N7S A;  4D6T E;  3SG6 A;  3WU2 E;  1HF9 A;  3NSI A;  2JKV A;  1TWO A;  3RK3 C;  1T3U A;  2KAV A;  2RGI A;  2KQ6 A;  1JY2 P;  1IC2 A;  2K2F A;  3E3R A;  1GJY A;  2K37 A;  1KQG B;  3H1J E;  3CR2 A;  1FI5 A;  2F2P A;  3WXA A;  1SNL A;  3FE6 A;  1J1E B;  1KK7 Z;  5KU1 A;  3AAJ A;  1J55 A;  3SG4 A;  4D1E A;  2FY8 A;  4U3F D;  5TIS E;  1NTK G;  1NU1 K;  1ZP0 C;  1WDC B;  2HR3 A;  2JT0 A;  5AXI A;  2D8N A;  2KAX A;  1Q90 D;  2JDI H;  1IRJ A;  1BE3 G;  1EZV E;  2JUL A;  1F4O A;  2BAP A;  3RLZ A;  1MV8 A;  1SFC C;  3L37 A;  1LT9 A;  3B87 A;  1BCC J;  2ZXE B;  2OTL P;  1MKM A;  1NAY A;  3AE4 C;  1EDJ A;  2R5D A;  1NOH A;  1UUS A;  1UHN A;  1K05 A;  1XYD A;  1RHZ B;  2F3Y A;  3AE5 C;  3CX5 E;  1W2E A;  1IFD A;  2E74 D;  3UO9 A;  5AVS B;  3AE9 C;  1OZO A;  1TUZ A;  4L76 A;  1SQP K;  4JYC A;  5KLV J;  3EFF K;  4XYN A;  5KKZ C;  4CFR A;  2I1K A;  1FDO A;  1G8I A;  2N1T B;  1V1F A;  1Z4H A;  2BCC G;  1LWU C;  4C0K A;  2BEZ F;  3KPX A;  1OVR A;  2ZXX A;  1NU1 J;  2H88 C;  1WRL A;  2JNX A;  3OGN A;  3PH0 A;  2A45 G;  3BCC J;  5KLV D;  2KGB C;  3CTN A;  1QV0 A;  2YMY A;  1JMM A;  1CZQ A;  4DZO A;  1KFX S;  2LLS A;  1CLM A;  1L0L J;  2KLD A;  4OVN F;  2KK7 A;  2KAY A;  1UHJ A;  1QVF O;  3FWC A;  2B89 A;  1SFC B;  3K1E A;  3WHT B;  2M0B A;  1PP9 E;  1YRU B;  1BLQ A;  1CDN A;  1J1D C;  1FE6 A;  3G71 P;  3MUD A;  3S0G A;  1IG5 A;  2GV5 A;  3B6X A;  2H61 A;  3L71 D;  2K1A A;  3MGN A;  1TNQ A;  1FS0 E;  3B5N C;  1NSH A;  2Q91 A;  3HUS A;  4I2L C;  1LA3 A;  3DXL A;  3JSV C;  1NJI Q;  4M3L A;  3TGU J;  2OQQ A;  4B86 A;  3H1H D;  5DJU B;  2HPS A;  1VF5 C;  5TJH A;  1IWQ A;  2IBZ I;  1A2X A;  1J1D B;  5CJ4 A;  1T6A A;  1N73 C;  1M63 B;  3G4S P;  3MTU E;  3CCM P;  3MSE B;  2ZVN B;  1Y1X A;  1OE9 B;  3OB2 B;  2QJK B;  1J1D A;  1K93 D;  1PPJ G;  4GOF A;  3MUD C;  2HQW A;  2G3A A;  1TN4 A;  1KQV A;  1GQM A;  2YKO A;  1USD A;  5AW9 B;  3F5H A;  2FXM A;  3CCU P;  2Q3E A;  4GT1 A;  5KLI B;  3CC7 P;  2DOQ A;  2QM8 A;  1QV1 A;  3M9Q A;  1OW6 A;  1FZA A;  5CCG C;  3TS5 B;  1LTS C;  2Y4Q A;  4KT0 J;  2E74 C;  4C7R A;  5AER A;  2N9B A;  2KI7 B;  1K90 D;  2HLO A;  3UNW A;  1LP1 B;  1NTK J;  3QWO C;  1VPC A;  3D73 A;  1J7P A;  3BRT B;  2ZFC A;  5AW1 B;  3R1V A;  2KLV A;  2FYU J;  1IJ6 A;  1JEK A;  1LS8 A;  2R3S A;  2R44 A;  1G1J A;  5CHX A;  3CX5 H;  1BDD A;  3EKH A;  2ZFD A;  2M3E A;  2IX7 C;  1S2E A;  3NXS A;  3VMA A;  1S36 A;  3NMD A;  1M90 Q;  2BE4 A;  2Y0E A;  1FOS E;  1BSN A;  2LM5 A;  1SQP G;  2NPS B;  1J1E C;  1Q2N A;  3VTP C;  3NGV A;  3DVM A;  3V2R A;  3AE7 C;  2AXC A;  2LVV A;  1BMO A;  2JEE A;  3M91 A;  3TNU A;  1M57 D;  2IPP A;  4XJK B;  3GK4 X;  3PJI A;  4I5K A;  5I2Q A;  2RKL A;  2L0P A;  2AXT E;  1JUN A;  5BU5 A;  4NPD A;  2QEO A;  3AEC C;  1RF0 C;  1H8B A;  4YXW H;  2W83 C;  3B5N D;  1SYM A;  3TS5 C;  1VDF A;  1VQ7 P;  3FE9 A;  4OV2 A;  4YPC A;  1OZH A;  3IFM A;  2WSF H;  2RN0 A;  2J58 A;  2YXR B;  3S0A A;  4GGF A;  1DH3 A;  1QVI Y;  1SCM B;  2L50 A;  3PN7 C;  4GOD A;  3H32 A;  4HRH A;  2MRD A;  3EFG A;  1QIV A;  1QL2 A;  1Q7Y Q;  4W7Z A;  1NTM K;  2FYN B;  1K2H A;  3L70 G;  2PSR A;  2GUV A;  2XZR A;  1L0N K;  1L4A D;  2SCP A;  4PD4 I;  1GGZ A;  1VQ6 P;  2IYP A;  3S0E A;  1SKT A;  1IFN A;  1CDL A;  4I7Z B;  2PVB A;  3MD0 A;  2JWD A;  3VRQ A;  1KIL C;  1JY3 N;  4DUQ A;  2H8P D;  5DJT B;  1SQX G;  4WY4 B;  1KFU S;  2SPZ A;  4LLH A;  3V4W A;  1QLE D;  5KAF H;  2QA4 P;  1AV1 A;  2JP3 A;  1KOR A;  2QE7 H;  3SG7 A;  1S5L E;  1BCC D;  2CBL A;  1GL2 C;  2VRS A;  1SQQ K;  2QEB A;  4NPF X;  5AW6 B;  1SQX K;  3NSO A;  1BR1 B;  3IF4 A;  4DCK A;  3EQ2 A;  2LV7 A;  3I5F C;  4CFQ A;  1JSA A;  3PHL A;  1QX2 A;  5EL2 A;  3TK1 A;  1HH0 A;  1QEX A;  1QLK A;  1RWY A;  5CCH A;  2D2C C;  3L35 A;  1BCC E;  1AK8 A;  1GGW A;  3Q5R A;  1T8Z A;  4QJ3 B;  1M1J B;  1YRT B;  4PE7 A;  1P84 D;  4U3F G;  1UHK A;  3M9H A;  4WQ2 A;  3E1R A;  2PRU A;  1AUI B;  3HX4 A;  4H0L C;  1C7V A;  1SQV J;  3TDU A;  4MBE A;  1GK6 A;  2IFN A;  1YX7 A;  4H44 B;  1JMB A;  1EL4 A;  2JO1 A;  3VP9 A;  4ASW A;  3BVH A;  2K3R A;  1SY9 A;  1V1G A;  4I5J A;  3U1C A;  1AVS A;  2HFE D;  3AEE C;  3VRR A;  4IFM A;  4DJG A;  5AAN A;  5AW3 B;  1U7J A;  4HKZ H;  1ZUZ A;  1UIX A;  1NTM E;  4PHJ A;  3CDN A;  3D77 A;  1LTG C;  3JCU H;  4C7N A;  2OYI B;  1YUU A;  2QSI A;  3M0A A;  3H1K E;  2FFD C;  3N4X A;  1NAF A;  2MAZ A;  4CLN A;  4MRY A;  5PAL A;  2Y0C A;  2YO2 A;  3KZI E;  1MUX A;  3SG3 A;  1GW4 A;  1JC2 A;  1KIL D;  3V2Q A;  1GL2 B;  1B9A A;  4MLW A;  4Y99 C;  3AE2 C;  3BUN B;  2KI4 B;  2KI6 C;  1Y1U A;  2ZJS E;  5I94 A;  1HQV A;  1ZR2 A;  2HG5 D;  4K35 A;  1RRO A;  2CPB A;  4MRX A;  1DEE G;  1N7S B;  4WVZ A;  5H2F E;  1GD2 E;  3BFB A;  1MXL C;  2AAO A;  4U7J A;  1S5G Z;  3WU2 H;  1LTT C;  1IGV A;  1TU3 F;  1YUS A;  4GFT A;  1K9K A;  5KLV G;  5CCH D;  3VRN A;  1ODB A;  2V7Q J;  1W5C E;  1X79 B;  2ZRS A;  5ER4 X;  1S6I A;  2OYI C;  1MZ9 A;  4WRI A;  2WC6 A;  1N73 A;  1WMK A;  3L74 D;  1KQS O;  3B4S A;  3CPW O;  4WBA A;  3JVT B;  1OMD A;  2R5B A;  2WPV B;  3U1A A;  2OAR A;  3OAK A;  2JWW A;  4IL1 A;  3II6 A;  4H13 B;  2YNY A;  4N78 E;  2L5Y A;  3C1L A;  2OYH C;  3I5F B;  2OYH B;  2NPS D;  1F8H A;  3H1H J;  4ORC B;  1X9V A;  1FPW A;  1RTP 1;  3CS1 A;  1AP4 A;  1NU1 E;  3O78 A;  1TCO B;  1FZB A;  1BF5 A;  3PTZ A;  1LA0 A;  2BEQ D;  3EK4 A;  2K9Y A;  4JD9 A;  1SQB D;  2A06 E;  5BPJ A;  1VQK P;  3SS5 A;  4IOI H;  2ZT9 C;  1NX3 A;  1KFN A;  4NDD A;  3Q2Y A;  1SCM C;  3WNX B;  1TIZ A;  3TDZ A;  4I7Z C;  2G8Y A;  1TRF A;  1YUR A;  1JY3 P;  2O1K A;  1F55 A;  5GTH H;  1C7W A;  2LLU A;  4PE4 A;  3USS A;  2KZJ A;  2ZT9 B;  2QJK C;  2YIU C;  2K7B A;  1UHI A;  2LP3 A;  3CCR P;  1CDM A;  4AQJ A;  3HE5 A;  4L75 A;  1VF5 B;  1BU3 A;  5HLO A;  1TUJ A;  3ZDM A;  1KYO H;  3D70 A;  2B88 A;  3D0Y A;  4M2O A;  2WSE J;  4EI2 A;  1W7J B;  1M1K Q;  2E74 B;  2LHL A;  1MQ1 A;  2FJU B;  1RQU A;  1M31 A;  5E79 H;  1CMF A;  1AQ5 A;  4R4M A;  1RK9 A;  1JFJ A;  2IBZ D;  2M29 A;  3VYI A;  4RO0 A;  1PK0 D;  3GMA A;  3RL0 B;  1EC5 A;  1S3P A;  2JOJ A;  1NUB A;  2FYU E;  3L4A A;  1QXP A;  5E79 E;  1K9U A;  2PAS A;  1NTK E;  2LP2 A;  4DT0 A;  1FJP A;  3ZWH A;  3QME A;  3A0H E;  4HSZ A;  2Y1N A;  1D1O A;  1DEL A;  2NPS C;  4IL6 E;  2KSJ A;  3I5H B;  3H1J G;  3OBV A;  1DIP A;  3LCP C;  2K9J B;  3NSL A;  3EVU A;  1YI2 P;  1SVF A;  1Q80 A;  2LHI A;  1J7O A;  2KS1 A;  2O1J A;  3G6E P;  3O4X A;  3IR9 A;  3A7O A;  4K3A A;  3CCS P;  4UB8 H;  3SIB A;  5B5E E;  3V2L A;  2KI4 C;  1OXZ A;  1GU4 A;  3VB1 A;  4WWI A;  1F4Q A;  4Q04 A;  1L4A C;  3V2P A;  2FCD A;  4CPV A;  1WRK A;  3NSK A;  3B8E B;  1FI6 A;  5APQ A;  4N1G A;  4NPE A;  1UHH A;  3K5B A;  3O4Y A;  4H44 D;  1PSB A;  4MVF A;  2R2I A;  2MKV A;  1LWU B;  3L71 E;  2BCX A;  2WC5 A;  3SWY A;  4OGQ B;  5CJ0 A;  1CM4 A;  2W6A A;  3GW6 A;  3SFE C;  1NTZ E;  2P10 A;  3PSR A;  2E30 A;  3TDK A;  4D6T D;  2GA1 A;  3I55 P;  1YIJ P;  4IFF A;  4JPZ B;  4U3F J;  1BOC A;  3RK2 B;  1S5G Y;  1RQV A;  2JT3 A;  3W68 A;  1ZFS A;  1DEB A;  1RH5 B;  3H6P A;  2CPS A;  3PN7 B;  3P8C D;  1VQ4 P;  2P71 A;  3KO0 A;  5AVQ B;  4IFD K;  4MEW A;  4OGQ C;  1KD1 Q;  3SFD C;  1KMI Z;  1YR5 A;  5AVY B;  2B87 B;  3WMM 0;  1SQB E;  1URQ D;  2KB7 P;  4YRU A;  3GLM A;  2IFM A;  1JOC A;  5BVZ A;  3BCC G;  2WIT A;  1AVY A;  2YGU A;  3KYQ A;  4ASV A;  5HYD A;  3PAT A;  2B87 A;  2W6B A;  1SL9 A;  4WQ3 A;  4LC1 A;  3D76 A;  1XFZ O;  3HCM A;  3M0W A;  1RE3 A;  2GUS A;  2IDB A;  5CSF A;  4P2Y B;  1S1C X;  1R5S A;  3V4Q A;  1ZOY C;  1RF0 A;  5FI6 A;  2NCO A;  3CL3 D;  4NDC A;  1XVJ A;  4QMA A;  1CB1 A;  3TNU B;  4ETO A;  3V5B A;  1S9K E;  1CM1 A;  1T14 A;  1A75 A;  3BUM B;  2PFX A;  3H1H G;  4PHK A;  3CGA A;  1FJK A;  2KFG A;  2Q4U A;  3DVE A;  4AUW A;  3CLQ A;  2KQY A;  1GTW A;  3HE5 B;  3BUW B;  1SK6 D;  1Q86 Q;  2ZKM X;  3WUT A;  1FAV A;  5AVU B;  2M97 A;  4PCW A;  1SQV G;  2BCC E;  4XA4 A;  1DGV A;  1PP9 D;  5APU A;  4ZCV A;  3V2N A;  2CNP A;  1J2J B;  1SS1 A;  1JTH A;  2L2E A;  1Y8A A;  4M2Q A;  1BOD A;  3L73 G;  5J3X A;  4PJ0 E;  4AYC A;  1TTX A;  2QG4 A;  2W8Z A;  1MFT A;  2Q5U A;  1NYA A;  1HJ0 A;  1R8E A;  1DMO A;  3C9I A;  3H1L D;  4TLF A;  4LGD E;  4FQO A;  3DVK A;  3BFA A;  4RES B;  1Y1A A;  2MBX A;  4PT1 A;  1KIL A;  3H1J J;  3KHU A;  3C8V A;  4GNK B;  1Q82 Q;  3TGU D;  2RMZ A;  3DF0 B;  4GBA A;  1OW7 A;  3IAO A;  4GKG A;  1ZRT E;  2HF5 A;  4OCI A;  2PQL A;  2WVR A;  5AVT B;  5CCH C;  2W90 A;  1YTZ C;  1LTJ B;  1C3Z A;  1Y0V H;  4F7F A;  4XJK A;  3AEA C;  3MP7 B;  4YGD B;  2YKP A;  3FWN A;  3CXH D;  1QLS A;  1CI6 B;  1MUU A;  3UIA A;  1XO5 A;  2QAC A;  4HB1 A;  3BJH A;  5APT A;  3R4Y A;  2L98 A;  3GG2 A;  1VF5 D;  1SQP E;  4WB4 A;  3TGU G;  1B8R A;  3L72 J;  3L75 G;  3NXA A;  1H88 A;  5CSJ A;  1JO5 A;  1LXF C;  1OMR A;  4ICB A;  1OIP A;  2C9N Y;  1N8R Q;  3D75 A;  3IQQ A;  5FYX A;  1OVV A;  4PD4 D;  1AQT A;  2Q1K A;  2M49 B;  1LKJ A;  1M39 A;  1EDI A;  3BAT A;  4GUK A;  1WLZ A;  2K60 A;  2OTG C;  2QRX A;  3D6Y A;  2KDH A;  3VMZ A;  1P84 H;  1RJV A;  2G2B A;  1KQM B;  5KKZ B;  1W7I B;  3R72 A;  1Q81 Q;  2LXB A;  1NP8 A;  2K7O A;  2QM7 A;  1QTX A;  4BY5 A;  2WT7 A;  5KJ7 C;  1NCX A;  1WT6 A;  1U5I B;  4PDZ A;  2BKH B;  1UWO A;  4QJ4 B;  1M46 A;  3L70 J;  4EOT A;  1YJN P;  2Y9Y A;  1R5L A;  5K89 A;  5BU8 B;  1U5I A;  1QX5 B;  1HBW A;  1M56 D;  1AJ5 A;  3VRO A;  3T97 B;  1XFV O;  3HD7 A;  3CCE P;  3B86 A;  5CSN A;  3AED C;  3DVJ A;  1GU5 A;  2LE9 B;  1KYO E;  2KPH A;  1OWA A;  3GK1 A;  1BE3 E;  1HJB A;  2WPQ A;  4MN4 C;  1KFU L;  1NTZ G;  5KLV E;  3L73 E;  2MA2 A;  3O6Q B;  3L73 J;  1KSM A;  3RGU A;  2JR8 A;  1SQX D;  2FYU K;  4PD4 E;  1CDP A;  5IBW A;  2F8P A;  2P70 A;  2NXQ A;  2DW3 A;  4YGE B;  1FZG A;  2WCJ A;  3OX6 A;  1VQ9 P;  3RZS A;  1VQO P;  2CTN A;  3CZ2 A;  1PVA A;  1MFZ A;  3EWK A;  1SQV K;  3GK2 A;  2L4H A;  3H32 B;  2RH0 A;  3H1H E;  2ZN9 A;  3CC2 P;  5KAI H;  4A7P A;  3CCL P;  3HE4 A;  4TT3 H;  1AJ4 A;  3CWB J;  3CWB D;  2H89 C;  1SLQ A;  4ZNC A;  4NQG A;  2PGD A;  3RK2 D;  5DIC A;  3CC4 P;  4HRE E;  4FTG A;  1TNX A;  2FXO A;  2KSP A;  3R1O A;  1JB0 J;  1FBM A;  1AA0 A;  3PP5 A;  3BOW B;  2WSC H;  1KK8 B;  3HRN A;  3H25 A;  1FZF A;  1PGO A;  2AEM A;  1EH2 A;  2EGD A;  2Z5I A;  5KAF E;  1JY2 N;  3CWG A;  3Q5P A;  1EZV D;  3NTN A;  3ZNI A;  4YTP C;  2LVJ A;  1GZL A;  1L0N D;  3CZ0 A;  3N7N A;  2KOG A;  1SQP J;  1SQP D;  1B4C A;  1CLL A;  1IKU A;  5HL1 A;  5CCG A;  1TNP A;  3L36 A;  1NTM D;  1BCC G;  1X8Y A;  2FBW C;  2WSF J;  3TYY A;  2FYU D;  1NCY A;  3BYA A;  2Q7C A;  2L2C A;  4JF7 A;  5APS A;  1PPJ E;  1ZN5 A;  2B9B A;  2YKQ A;  5GTH E;  3RBX A;  1QIW A;  2BCC D;  3L4F A;  3KZI H;  3SIA A;  3FWB A;  4DOJ A;  3MIW A;  1EXR A;  2AEJ A;  3M06 A;  4JYB A;  1NHL A;  1ZRT D;  4N3Y B;  4WY4 A;  1Y47 A;  4PHN A;  3H1K J;  4USL A;  2KP8 A;  3GHG A;  1L2O B;  4GAO A;  1CFF A;  1LJ2 A;  1VQN P;  4L9M A;  1HUC A;  4W80 A;  2ZAE B;  1K9M Q;  1SQV D;  4PE0 A;  4GDO A;  1P84 E;  1IK7 A;  2A06 G;  1GDT A;  5AFP A;  1LT1 A;  4HH2 A;  3L70 D;  2QVA A;  5AW8 B;  1L0L D;  1YX8 A;  2MJW B;  2COL B;  4YI8 A;  3GHG C;  1J1E A;  1G2C B;  3HTK B;  5CBO A;  1URQ A;  2R32 A;  3AE3 C;  3IN6 A;  2WT7 B;  1OOF A;  2CXJ A;  1IZN B;  3CWB E;  1QAS A;  3A0H H;  2E43 A;  1EDK A;  1XA5 A;  1OOG A;  3L74 G;  3BAS A;  5FI7 A;  2YIU B;  2WOS A;  2WSE H;  1B1G A;  3VN0 A;  1LGH B;  5KAI E;  3KXD A;  3E1I A;  1YVH A;  4MZK A;  5AVX B;  1IIO A;  1KQF B;  2GM4 A;  1KFX L;  1N7L A;  1DJI A;  1YJ9 P;  1Y9B A;  1CFP A;  2Y1M A;  2E5T A;  3CME P;  1JCD A;  3FWL A;  4GGF C;  5HKZ A;  1KYO I;  4PJ0 H;  4TNC A;  1XFU O;  3PLF B;  3HUS B;  4YGB B;  3AE6 C;  1MXE A;  1DJH A;  2WCB A;  5KTB A;  2MJZ A;  5JJG A;  3L75 D;  1ZLL A;  2NZ0 A;  1NX1 A;  4GGN A;  1L2O C;  1CNP A;  1G2C A;  1LTA C;  3RM1 A;  4ZCU A;  3IF7 A;  5I2L A;  1E8A A;  5I2O A;  2P67 A;  5GTI H;  1NCZ A;  2FFD B;  3L72 G;  3L75 J;  2O01 N;  4HRG A;  1NX2 A;  2YXQ B;  1AHR A;  2OTK E;  3BFH A;  2KXP B;  1MHO A;  2UWJ E;  1NTZ K;  3SS3 A;  2V53 A;  3OB1 B;  1S72 P;  2IYO A;  4JWQ A;  3LL8 B;  1JFK A;  2LMU A;  3TUY B;  1LTI C;  2LXC B;  4INW A;  3G3Z A;  1YTZ T;  4PV1 C;  5AW7 B;  2K8M B;  1DC1 A;  2HPC B;  1P28 A;  3I5G B;  4I5L B;  1NWD A;  1PV3 A;  5FI2 A;  2ISD A;  2KLU A;  1L0N E;  3M0D A;  2NZ2 A;  1BDC A;  2ZRT A;  2K2A A;  2BL0 C;  1E79 H;  3KHE A;  1EZV I;  3L72 E;  3CR4 X;  2IBZ E;  2Z4E A;  1IO4 A;  3S0B A;  1PUL A;  1C07 A;  5B8I B;  2I18 A;  1S6C A;  3SG5 A;  3N7H A;  3PLN A;  1LWU A;  2OGU A;  1DQE A;  5DKR A;  2JRF A;  4PAL A;  1YHQ P;  1E5W A;  3LIE A;  2MHH A;  3NHI A;  1KZU B;  4I1L A;  3CCJ P;  1G1I A;  5HKY A;  1SBJ A;  5L8R J;  2Q9I A;  3IQO A;  2F3Z A;  1K8A Q;  1N65 A;  1L2P A;  1J7R A;  1FDI A;  2HET A;  1B47 A;  2WTY A;  1PVB A;  3M0D C;  3F45 A;  2QEH A;  1SQQ G;  3QH9 A;  3F89 A;  1OQP A;  1ORG A;  1FBV A;  2CCM A;  1RF1 C;  1EG4 A;  2EHB A;  1YQ4 C;  1N7S C;  1M1J C;  5G08 A;  1CLB A;  3AEF C;  2R3C A;  2H61 C;  3JVT C;  3VMY A;  5KJ7 D;  1VQ5 P;  1KB9 H;  1GM0 A;  1CMG A;  4GIF A;  3O6Q A;  3P32 A;  2O60 A;  2WND A;  1YJW P;  2H2K A;  2QDI A;  2EC6 C;  2BCA A;  3OA7 A;  4N78 D;  1P84 I;  1OMV A;  1Z56 A;  4L74 A;  4ZKU A;  1A75 B;  1GL2 D;  4H0L B;  3WUV A;  3BRV B;  2OS8 B;  1X0T A;  1JY2 O;  1OW8 A;  1HT9 A;  2WCM A;  1ZXG A;  1BGY G;  1IJ5 A;  4OZD A;  4AQR D;  1NTZ D;  1OVU A;  2PAJ A;  4RKU J;  1SMG A;  1EXI A;  1JTH B;  5CSI A;  2PMY A;  4U8D A;  1F71 A;  1DF0 A;  1GK4 A;  2JXL A;  2L5X B;  4D6T G;  1JY3 O;  2BE6 A;  2D2C D;  3P8C E;  1SQB G;  4ORB B;  3V6I A;  2FYU G;  4O9B A;  3FX0 A;  3U59 A;  3OW2 O;  2AMI A;  5B66 E;  4RJT A;  4YGA A;  3I5C A;  2QJP C;  2QJP B;  3QRX A;  1HVV A;  4H0L D;  2KYF A;  1LIN A;  1SFC A;  2E75 D;  2ZNE A;  1W9Z A;  2EC6 B;  3DY9 A;  3H1L J;  3MZW B;  1LVC D;  1UP5 A;  2HPC A;  2OYI A;  3O6B A;  5APW A;  1KYO D;  1RY3 A;  4BXL A;  3HD7 D;  2XNX A;  2WSS H;  5DKN A;  4XFJ A;  2H8V A;  1ZR4 A;  1GMJ A;  1KIL B;  2KBM A;  4C0J A;  1NTK D;  4YI9 A;  2TN4 A;  1JUO A;  1CI6 A;  1SP4 A;  1Z2C B;  1XK4 A;  4A4C A;  3PM8 A;  3LW5 J;  1OFC X;  2WCF A;  2BBM A;  2O01 J;  1SR6 B;  1BJF A;  3H4S E;  1N7S D;  2AXT H;  1Y6W A;  1NKZ B;  3CX5 D;  2OPO A;  1EXJ A;  3CI9 A;  5APY A;  1H4B A;  1K04 A;  5EFW B;  2G9B A;  3B71 A;  2XU6 A;  1PP9 G;  2JZI A;  1H0T B;  2IS9 A;  1IH0 A;  1UII A;  1KQM C;  1IJD B;  2JNF A;  1OX3 A;  1ZOT B;  3RL0 g;  1XK4 C;  1PRW A;  1OMI A;  1OOH A;  3OJA B;  5AW5 B;  3H1L E;  2C0W A;  2C9L Y;  1DJY A;  3GF3 A;  5CPV A;  4E68 A;  4H13 D;  2I94 A;  5D69 A;  1URQ C;  1PIX A;  4KYN A;  3L47 A;  2YO3 A;  3PAL A;  3B5N A;  3LID A;  4IL6 X;  4C46 A;  1KB9 I;  1KIL E;  2K88 A;  3Q5S A;  2FOT A;  1D7M A;  5D3O A;  1IK9 A;  1M8O B;  4P5O E;  1IQ3 A;  1DD3 A;  1C3Y A;  2Y5I A;  1KB9 E;  1LT9 B;  1SQQ E;  2M7L A;  1U57 A;  4DIR A;  4ZKP A;  1SRA A;  3CYZ A;  2E75 B;  3AE8 C;  2OYO A;  2E75 C;  5AVV B;  1VQ8 P;  2FJY A;  5AVW B;  1CTR A;  2I1J A;  2PP6 A;  1LP1 A;  3DD4 A;  1LNQ A;  3PM2 A;  1UUR A;  1QVI Z;  1S5L X;  1TCF A;  1M45 A;  1PSR A;  4N6J A;  1S6J A;  2CT9 A;  3Q3D A;  1A03 A;  2M8R A;  1A02 F;  2H7H A;  1OOI X;  2LVK A;  3AE1 C;  1B8L A;  2QEX P;  1NIW A;  3CZT X;  1ZW0 A;  5TIS H;  1BE3 D;  4ORA B;  2K61 A;  2ZT9 D;  3HTK A;  1SQV E;  5AW0 B;  1VRK A;  3RK3 B;  2WWW A;  2P6B B;  3GF7 A;  2KYV A;  4D6T J;  3HE4 B;  1TNW A;  1QWV A;  3NFQ A;  1S4X A;  2L91 A;  5K5G B;  1WRG A;  3CAB A;  1B7T Z;  2WC8 A;  2W27 A;  5KLV K;  4UB6 H;  1KB9 D;  2QEV A;  1F54 A;  3CX5 I;  4N5X A;  1N2D C;  4MZL A;  1SPY A;  2FCE A;  2I2R E;  2K7D A;  2NCP A;  3BCC E;  1KK7 Y;  1RFJ A;  4DRW A;  1NU1 G;  2M9G A;  2JQ6 A;  3S9O A;  4UB6 E;  2LNK A;  1L4A A;  2Y0D A;  3AAK A;  3VOP A;  3D78 A;  5APX A;  4MN0 A;  3M9B A;  5F6T A;  1H89 A;  5HLV A;  5KSZ A;  5AVZ B;  1OW4 A;  4OH8 B;  1SQQ D;  4AOM A;  3L72 D;  3E7K A;  2M5A B;  4BRY B;  4W7Y A;  4H13 C;  3JC2 2;  1L0N J;  5CMZ A;  1YIT P;  3ICB A;  3O2P A;  2KBI A;  2BEC A;  4PV1 D;  1FC2 C;  3CMA P;  3W67 A;  1NU1 D;  1SQQ J;  1YUT A;  1KTM A;  3AEG C;  1URQ B;  2J5U A;  2BCC J;  3O8Z A;  1JCC A;  3L71 G;  1JNM A;  2M3B A;  2FYZ A;  2ZYG A;  2KLE A;  2N1T C;  1T2K D;  5KLI C;  4N1F A;  2ERB A;  1M1J A;  1AVO A;  1NTZ J;  2K7C A;  5H2F H;  2L4I A;  2L51 A;  1K95 A;  1DJG A;  1S1E A;  2I8D A;  3CWB G;  3H1L G;  3L71 J;  3CD6 P;  1H0T A;  4FQT A;  1HGZ A;  3R1P A;  3CZ1 A;  1IFP A;  3AEB C;  2XKM A;  4CID A;  3FE8 A;  2E42 A;  3G9R A;  1YQ3 C;  2WCK A;  3OX5 A;  1RE4 A;  1SQX E;  2XV5 A;  3DZT A;  2KSE A;  5CCG D;  3D74 A;  2KZI A;  2P2U A;  1QL1 A;  1GW3 A;  3SJS A;  2Q6Q A;  1SR6 C;  4PD4 H;  2V7Q H;  1ZAC A;  5TNC A;  1BE3 J;  3FXE A;  1SCV A;  2KNE A;  3KDP B;  5CBN A;  1VQL P;  1AFO A;  3SG2 A;  3LLE A;  2O01 H;  2WQY C;  2YMK A;  3OHM B;  4C7N B;  1MF8 B;  3H1K G;  4UPG A;  2NPS A;  1MR8 A;  1S3J A;  2OYH A;  5M1B A;  1X02 A;  3EK8 A;  2HOD B;  1KQL A;  4BWN A;  1DVI A;  2LCP A;  2XDJ A;  4A4B A;  4ZMD A;  3RBZ A;  3CLN A;  3EVR A;  1NTM J;  1L7Z A;  1LTJ C;  2C0X A;  1KWO C;  1CFD A;  3B88 A;  2P1J A;  2HYN A;  3CCV P;  5APV A;  5JOL A;  3SWK A;  1PL5 A;  3RK2 C;  4M2P A;  2LMT A;  2BNX A;  3P7K A;  3A5T A;  4HJG H;  2CK3 H;  2JTT A;  1XTG B;  4CPG A;  2KFH A;  1YTZ I;  1OSA A;  2F33 A;  2WCH A;  2JWA A;  2E76 D;  3VMX A;  2O3J A;  3H1I G;  1EDL A;  1LT9 C;  1JF2 A;  2N1T D;  1T2K C;  2A4J A;  2PRR A;  1PZQ A;  3FGA D;  3JTD B;  1FZC C;  1DJZ A;  2P7J A;  2FFD A;  1QS7 A;  2KS1 B;  3AKB A;  1K94 A;  3TGU E;  1XFX O;  1R2U A;  2V4H A;  2KFF A;  2PAL A;  3FIA A;  2LC5 A;  1FOS F;  1SQX J;  4MSP A;  1S26 D;  2B1U A;  1NH4 A;  4KHX A;  1KV4 A;  2IZ1 A;  3B7A A;  3A0B E;  1NX0 A;  2E76 B;  1YVL A;  2OTJ P;  1FZC A;  1EJ3 A;  3KF9 A;  2M0R A;  1IFM A;  1M7L A;  3KEV A;  2KOT A;  5AEQ A;  2BAS A;  2JPT A;  2D2C B;  4MZJ A;  4IL6 H;  1BR4 B;  1DJX A;  3A2A A;  1SL8 A;  1NKN A;  3A0B H;  2E5Y A;  3I5I C;  2NRG A;  3RL0 C;  1QGK B;  1XFY O;  3EG5 B;  1PGQ A;  1R6P A;  3S1K A;  1RF1 B;  1W2B O;  1XFW O;  1FW4 A;  5I8N A;  2MLE C;  3I5H C;  3L74 E;  5B5E H;  1XTC C;  1FZE A;  3P8M C;  2IBZ G;  1S5L H;  2JC2 A;  2M7N A;  3D0Y B;  3S0D A;  3HD7 B;  1HWT C;  1OZS A;  4L73 A;  3EK7 A;  3TF5 A;  1NGM B;  1WRZ A;  1L0N G;  3CXH E;  3TSI A;  1H8A A;  1QX7 A;  4Y99 B;  5AVR B;  2HQ8 A;  1SFC D;  1FF1 A;  3BQ3 A;  2LVI A;  1ZV8 A;  1BSH A;  4QJ5 B;  3GOF A;  3FXD A;  3L74 J;  1DX7 A;  1MWN A;  1WLM A;  1PAL A;  5C39 A;  1K96 A;  2WCL A;  1OOJ A;  1A02 J;  1DF0 B;  4YXD C;  3L75 E;  2JT8 A;  4JQ0 D;  2BCB A;  3VRP A;  1EQ7 A;  3A8R A;  4KJM A;  2FYN C;  1VQP P;  1IFI A;  1IFJ A;  1BT6 A;  1BG1 A;  1QAT A;  5GTI E;  3T97 A;  4YBH B;  3H1I J;  3SWF A;  2O5G A;  3SSU A;  3D71 A;  1SW8 A;  1REC A;  4U3F E;  2OS8 C;  4R1E A;  1WY9 A;  2QIW A;  3WUU A;  1TOP A;  2QJY C;  1ZMZ A;  1RE3 C;  2KNC B;  2KI6 D;  1IQ5 A;  1X22 A;  1K73 Q;  2M5A A;  4BRY A;  4YGC B;  5DKQ A;  2J59 M;  3D6Z A;  3DF0 A;  1DTL A;  3A3Y B;  4DS7 A;  2Y9Z A;  4WY4 C;  1NVO A;  3LK1 A;  1NWQ A;  1N73 B;  4R4L A;  1PGJ A;  3RL0 D;  1N86 A;  2KIK A;  1FZC B;  1KFM A;  4OGQ D;  2M3W A;  3K21 A;  1KWO B;  3A4U B;  2GGM A;  3L73 D;  5KJ7 A;  1QJT A;  2LR2 A;  1U7M A;  3WHU B;  2LAP A;  1L4A B;  1KN7 A;  2WPR A;  2JTZ A;  1N0Y A;  1LTB C;  1B7T Y;  2LMV A;  1DD4 A;  1BGY E;  4EYY Q;  4F0Z B;  4JKT A;  3BUX B;  2LLT A;  2JJL A;  2ZN8 A;  1QVG O;  2MLF C;  3NHT A;  2BL0 B;  3FS7 A;  2A45 I;  1JBA A;  3ITK A;  4GPL B;  1VL2 A;  2LUC A;  2W6J H;  1PP9 J;  3L4L A;  3RK3 E;  1NPQ A;  3TZ1 A;  1SQB K;  3PFV A;  5KTY A;  3I5G C;  3EVV A;  3IVT A;  1CSB A;  1KCY A;  4EIJ A;  3H1I E;  1L0L E;  3LW5 H;  1J7Q A;  1LTJ A;  3HUS C;  1NO4 A;  4JBZ A;  1ALV A;  1DEK A;  3Q8I A;  1VQM P;  1NTM G;  3LK0 A;  4NDB A;  2JXC A;  1PGP A;  1GL2 A;  3I56 P;  1ZME C;  4HYT B;  3H1J D;  4I6M C;  3CXH H;  4IJ7 A;  4PHM A;  3D10 A;  2HOD A;  2NLN A;  2WPS A;  1KC8 Q;  2KGR A;  4AQI A;  3PRJ A;  2LKM A;  1ALW A;  1AJY A;  3H1I D;  1F70 A;  1L0L K;  3H1K D;  2L5G B;  1CW5 A;  3BOW A;  1B8C A;  1T3J A;  2ITA A;  3BXK A;  4PE1 A;  3TUY C;  1K9P A;  1N2D A;  4PV1 B;  5B66 H;  3RK3 D;  1SSE B;  1A4P A;  3BUO B;  3CCQ P;  3VGO A;  4WY4 D;  2Q3I A;  1PPJ D;  4Y28 J;  1YYC A;  3KPE A;  2AUC A;  4INX A;  5ER5 A;  4Z1M H;  2A06 D;  1DT7 B;  1USE A;  1HGV A;  1EG3 A;  1G33 A;  1DGU A;  2M1U A;  1JM0 A;  1EZV G;  2KYC A;  3R2P A;  1QX8 A;  1JF0 A;  2OTG B;  4OKH A;  1L0L G;  4I5N B;  4GOE A;  2IZ0 A;  3S0F A;  2BKI B;  2LAN A;  1SQB J;  2QJY B;  4EDF A;  2AEF A;  3C1V A;  3AKA A;  2WSC J;  4OR9 B;  1KK8 C;  2WZ7 A;  2SAS A;  3I5I B;  5HKW A;  3CR5 X;  2ZYD A;  1PFI A;  2K9J A;  2WCE A;  2F2O A;  2KHN A;  2ZVO B; 
#chains in the Genus database with same CATH homology
 2K7D A;  4HRE E;  2NCP A;  1KK7 Y;  1HQV A;  1RFJ A;  4DRW A;  4FTG A;  2E6W A;  1TNX A;  1RRO A;  1CKK A;  2KSP A;  3JTD C;  1DJW A;  2M9G A;  4MRX A;  2JQ6 A;  2LNK A;  1MXL C;  3BOW B;  2AAO A;  1S5G Z;  3AAK A;  1KK8 B;  1KSO A;  4MN0 A;  5F6T A;  2LUX A;  1IGV A;  5HLV A;  5KSZ A;  1YUS A;  4GFT A;  5GQQ C;  1EH2 A;  1K9K A;  2EGD A;  3EKJ A;  2BBN A;  4AOM A;  3CWG A;  2WOR A;  3ZNI A;  3VRN A;  1ODB A;  2M1K B;  2LVJ A;  2ZRS A;  5ER4 X;  2K0J A;  1S6I A;  4BY4 A;  4WRI A;  3ICB A;  3O2P A;  2KBI A;  1CLL A;  1B4C A;  1IKU A;  1JWD A;  1K8U A;  2BEC A;  2ZND A;  1TNP A;  2JU0 A;  5D7F A;  2M8U A;  1SL7 A;  1NCY A;  3BYA A;  1YUT A;  2VRG A;  1G4Y R;  3JVT B;  1OMD A;  3OP0 A;  1WDC C;  1CFC A;  2JWW A;  4IL1 A;  1QIW A;  2I7A A;  2KHN A;  3SIA A;  3FWB A;  1A29 A;  3I5F B;  1F8H A;  1EXR A;  2GGZ A;  2QPT A;  4ORC B;  4C0L A;  3TDI A;  1FPW A;  1RTP 1;  3CS1 A;  1AP4 A;  4PHN A;  4N1F A;  4USL A;  3O78 A;  3SG6 A;  1TCO B;  2K7C A;  1L2O B;  2L4I A;  3NSI A;  4GAO A;  1CFF A;  2L51 A;  1K95 A;  1DJG A;  1S1E A;  1BF5 A;  1LA0 A;  4L9M A;  3EK4 A;  2KAV A;  2RGI A;  2KQ6 A;  5BPJ A;  2K2F A;  4CID A;  4PE0 A;  3E3R A;  1GJY A;  1NX3 A;  3CR2 A;  4NDD A;  3OX5 A;  1SCM C;  3WNX B;  1FI5 A;  2F2P A;  5AFP A;  3WXA A;  1TIZ A;  1SNL A;  1KK7 Z;  5KU1 A;  3SJS A;  3AAJ A;  1J55 A;  3SG4 A;  3TDZ A;  4D1E A;  1YX8 A;  1SR6 C;  1ZAC A;  1TRF A;  5TNC A;  2MJW B;  1YUR A;  2COL B;  4YI8 A;  1F55 A;  1SCV A;  2KNE A;  1C7W A;  1J1E A;  2LLU A;  4PE4 A;  1WDC B;  3SG2 A;  3LLE A;  2JT0 A;  5AXI A;  2D8N A;  2KAX A;  3OHM B;  1MF8 B;  2K7B A;  4UPG A;  1UHI A;  2CXJ A;  1QAS A;  1IRJ A;  1MR8 A;  2LP3 A;  2JUL A;  1F4O A;  1XA5 A;  3RLZ A;  1CDM A;  1X02 A;  4AQJ A;  2WOS A;  3EK8 A;  1B1G A;  1DVI A;  1BU3 A;  2LCP A;  5HLO A;  4A4B A;  3D0Y A;  1YVH A;  4M2O A;  1W7J B;  4MZK A;  3CLN A;  2LHL A;  1MQ1 A;  3EVR A;  1UUS A;  1KFX L;  1DJI A;  1UHN A;  2FJU B;  1L7Z A;  1XYD A;  1M31 A;  1KWO C;  1CFP A;  2Y1M A;  1CMF A;  1RK9 A;  1CFD A;  2F3Y A;  4GGF C;  5HKZ A;  1JFJ A;  4NQG A;  2M29 A;  1PK0 D;  1S3P A;  1OZO A;  4TNC A;  1XFU O;  3PLF B;  2JOJ A;  1NUB A;  4YGB B;  5JOL A;  1MXE A;  1DJH A;  2WCB A;  1QXP A;  2LMT A;  4M2P A;  5JJG A;  1K9U A;  4XYN A;  2NZ0 A;  2PAS A;  4CFR A;  1NX1 A;  4GGN A;  1L2O C;  2LP2 A;  1CNP A;  2JTT A;  1G8I A;  3ZWH A;  3RM1 A;  1V1F A;  2KFH A;  4ZCU A;  1OSA A;  4HSZ A;  2Y1N A;  3IF7 A;  1D1O A;  5I2L A;  1E8A A;  4C0K A;  2F33 A;  3KPX A;  3I5H B;  5I2O A;  1WRL A;  2JNX A;  3LCP C;  1JF2 A;  1NCZ A;  3NSL A;  3EVU A;  2A4J A;  4HRG A;  1NX2 A;  2KGB C;  3CTN A;  1AHR A;  1Q80 A;  2LHI A;  1QV0 A;  1J7O A;  1KFX S;  3JTD B;  1DJZ A;  2LLS A;  1CLM A;  4OVN F;  1MHO A;  2KAY A;  1QS7 A;  1UHJ A;  2V53 A;  3OB1 B;  3FWC A;  3SIB A;  4JWQ A;  2KI4 C;  3AKB A;  1K94 A;  3LL8 B;  1JFK A;  2LMU A;  3TUY B;  3WHT B;  1F4Q A;  2K8M B;  4Q04 A;  1YRU B;  1BLQ A;  1XFX O;  1CDN A;  1R2U A;  2FCD A;  4CPV A;  1IG5 A;  1WRK A;  3NSK A;  2GV5 A;  2KFF A;  3I5G B;  4I5L B;  2PAL A;  1NWD A;  4N1G A;  2H61 A;  1FI6 A;  1UHH A;  1TNQ A;  2ISD A;  1NSH A;  3FIA A;  3O4Y A;  2Q91 A;  2LC5 A;  1LA3 A;  1PSB A;  4MSP A;  4MVF A;  1S26 D;  2B1U A;  2ZRT A;  2K2A A;  2R2I A;  2BL0 C;  1NX0 A;  3KHE A;  3CR4 X;  1YVL A;  2HPS A;  2BCX A;  1CM4 A;  1EJ3 A;  1IWQ A;  1PUL A;  1C07 A;  3KF9 A;  3PSR A;  1A2X A;  2I18 A;  2M0R A;  5B8I B;  2E30 A;  1S6C A;  1M63 B;  3SG5 A;  3KEV A;  2KOT A;  5AEQ A;  4JPZ B;  2JPT A;  3MSE B;  5DKR A;  2JRF A;  4MZJ A;  4PAL A;  1BOC A;  1Y1X A;  2MHH A;  1OE9 B;  1S5G Y;  3OB2 B;  1BR4 B;  1DJX A;  2JT3 A;  1SL8 A;  5HKY A;  1SBJ A;  1ZFS A;  1J1D A;  1K93 D;  3IQO A;  2F3Z A;  3PN7 B;  2HQW A;  1TN4 A;  1KQV A;  3I5I C;  1N65 A;  1J7R A;  1GQM A;  2HET A;  1XFY O;  1B47 A;  1PVB A;  3KO0 A;  4MEW A;  3F45 A;  1R6P A;  1XFW O;  1FW4 A;  2DOQ A;  5I8N A;  1QV1 A;  1YR5 A;  2MLE C;  1OQP A;  3I5H C;  3TS5 B;  1FBV A;  2CCM A;  1EG4 A;  2EHB A;  2Y4Q A;  4YRU A;  2JC2 A;  2M7N A;  5G08 A;  5AER A;  3D0Y B;  1CLB A;  1OZS A;  5HYD A;  3EK7 A;  1K90 D;  2H61 C;  1WRZ A;  3JVT C;  3PAT A;  1J7P A;  1SL9 A;  4WQ3 A;  1XFZ O;  3HCM A;  3M0W A;  1CMG A;  1QX7 A;  1IJ6 A;  5CSF A;  2O60 A;  2HQ8 A;  2WND A;  4P2Y B;  1FF1 A;  2H2K A;  2EC6 C;  2BCA A;  3BQ3 A;  2LVI A;  1OMV A;  3EKH A;  4QJ5 B;  3GOF A;  2ZFD A;  1A75 B;  1MWN A;  2NCO A;  1S36 A;  1PAL A;  1WLM A;  1K96 A;  2OS8 B;  2BE4 A;  4NDC A;  1XVJ A;  1CB1 A;  1OOJ A;  1HT9 A;  4ETO A;  1CM1 A;  2LM5 A;  1IJ5 A;  1DF0 B;  1A75 A;  3BUM B;  3DVM A;  2JT8 A;  4JQ0 D;  3CGA A;  4PHK A;  2BCB A;  2KFG A;  2LVV A;  2Q4U A;  3DVE A;  3VRP A;  2KQY A;  3A8R A;  1SMG A;  3BUW B;  1SK6 D;  1BMO A;  2ZKM X;  5CSI A;  2PMY A;  4U8D A;  1F71 A;  1DF0 A;  2JXL A;  2L5X B;  2M97 A;  1BT6 A;  4PCW A;  1BG1 A;  4XJK B;  1QAT A;  3GK4 X;  4I5K A;  5I2Q A;  2BE6 A;  1DGV A;  4ZCV A;  4YBH B;  2CNP A;  2L0P A;  2L2E A;  4ORB B;  2O5G A;  4M2Q A;  1SW8 A;  1H8B A;  1BOD A;  1REC A;  1SYM A;  5J3X A;  2AMI A;  1TTX A;  2OS8 C;  4R1E A;  3TS5 C;  1WY9 A;  1TOP A;  4YGA A;  4OV2 A;  1NYA A;  1ZMZ A;  3QRX A;  2KYF A;  1LIN A;  1DMO A;  2ZNE A;  2KI6 D;  2EC6 B;  4GGF A;  1IQ5 A;  1LVC D;  1QVI Y;  1UP5 A;  4FQO A;  1SCM B;  3DVK A;  2L50 A;  3PN7 C;  3O6B A;  4YGC B;  5DKQ A;  1Y1A A;  3DF0 A;  2MBX A;  1DTL A;  4HRH A;  2MRD A;  4GNK B;  1QIV A;  4DS7 A;  2Y9Z A;  5DKN A;  3LK1 A;  2I2R E;  3DF0 B;  4GBA A;  2KBM A;  1K2H A;  4C0J A;  2HF5 A;  2PSR A;  4OCI A;  4YI9 A;  2TN4 A;  1JUO A;  2SCP A;  1YTZ C;  1XK4 A;  2M3W A;  1GGZ A;  1KWO B;  3A4U B;  1Y0V H;  3K21 A;  3PM8 A;  2WCF A;  4A4C A;  4XJK A;  2GGM A;  2BBM A;  4YGD B;  1OFC X;  1SKT A;  1QLS A;  1SR6 B;  1QJT A;  1CDL A;  1BJF A;  2PVB A;  3H4S E;  3WHU B;  2LAP A;  1Y6W A;  3VRQ A;  1XO5 A;  2QAC A;  2OPO A;  4DUQ A;  2JTZ A;  1N0Y A;  1KFU S;  2L98 A;  1B7T Y;  2LMV A;  1H4B A;  4F0Z B;  2G9B A;  1B8R A;  3NXA A;  5CSJ A;  1LXF C;  3BUX B;  1OMR A;  2LLT A;  2JZI A;  2ZN8 A;  2IS9 A;  4ICB A;  1IH0 A;  3SG7 A;  1KQM C;  2JNF A;  2MLF C;  2BL0 B;  1ZOT B;  3FS7 A;  2CBL A;  1XK4 C;  1PRW A;  3IQQ A;  1JBA A;  4GPL B;  5FYX A;  2LUC A;  2M49 B;  1LKJ A;  3NSO A;  1BR1 B;  1M39 A;  4DCK A;  1NPQ A;  4GUK A;  1DJY A;  3TZ1 A;  3PFV A;  5KTY A;  3I5G C;  1WLZ A;  2LV7 A;  3EVV A;  3I5F C;  2OTG C;  5CPV A;  4CFQ A;  2KDH A;  1JSA A;  1KCY A;  1QX2 A;  4E68 A;  2I94 A;  5D69 A;  1RJV A;  2G2B A;  1KQM B;  1J7Q A;  1W7I B;  1QLK A;  1RWY A;  3PAL A;  1NP8 A;  2K7O A;  1QTX A;  4BY5 A;  1ALV A;  1NCX A;  3LK0 A;  4NDB A;  1AK8 A;  1GGW A;  1U5I B;  2JXC A;  4PDZ A;  4QJ3 B;  2BKH B;  2FOT A;  1YRT B;  4PE7 A;  1UWO A;  4P5O E;  4QJ4 B;  1IQ3 A;  2Y5I A;  4PHM A;  1M46 A;  3D10 A;  2M7L A;  1UHK A;  2NLN A;  4WQ2 A;  2Y9Y A;  4DIR A;  5K89 A;  1U5I A;  1QX5 B;  2PRU A;  1AUI B;  1SRA A;  1AJ5 A;  2KGR A;  3HX4 A;  3VRO A;  4AQI A;  1C7V A;  1XFV O;  3TDU A;  4MBE A;  1CTR A;  1ALW A;  5CSN A;  1YX7 A;  3DD4 A;  3DVJ A;  1UUR A;  1QVI Z;  1F70 A;  2LE9 B;  3GK1 A;  1EL4 A;  3BOW A;  1B8C A;  1KFU L;  1TCF A;  3BXK A;  1SY9 A;  1V1G A;  4PE1 A;  1K9P A;  1M45 A;  1N2D A;  1PSR A;  2MA2 A;  1S6J A;  4I5J A;  3TUY C;  2CT9 A;  1A03 A;  1KSM A;  1AVS A;  2LVK A;  1A4P A;  3BUO B;  1B8L A;  1NIW A;  3CZT X;  3VGO A;  3VRR A;  5AAN A;  1CDP A;  5IBW A;  4ORA B;  2F8P A;  2NXQ A;  2K61 A;  1ZUZ A;  4YGE B;  3OX6 A;  4PHJ A;  2AUC A;  5ER5 A;  1VRK A;  2P6B B;  2CTN A;  1YUU A;  1PVA A;  1DT7 B;  1EG3 A;  1G33 A;  1DGU A;  2M1U A;  3GK2 A;  2L4H A;  2MAZ A;  1TNW A;  2KYC A;  4CLN A;  4MRY A;  1JF0 A;  2OTG B;  4OKH A;  4I5N B;  2ZN9 A;  5PAL A;  2BKI B;  2LAN A;  1B7T Z;  1MUX A;  2WC8 A;  3AKA A;  3C1V A;  4OR9 B;  3SG3 A;  1AJ4 A;  1KK8 C;  1JC2 A;  2SAS A;  3I5I B;  5HKW A;  1F54 A;  3CR5 X;  4N5X A;  1B9A A;  4MLW A;  4MZL A;  3BUN B;  2KI4 B;  1SPY A;  2KI6 C;  2WCE A;  2F2O A;  2FCE A;  1Y1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...