4DCKA

Crystal structure of the c-terminus of voltage-gated sodium channel in complex with fgf13 and cam
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
153
Chain Sequence
b'SVATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sodium channel protein type 5 subunit alpha
molecule tags Transport protein/signaling protein
source organism Homo sapiens
publication title Crystal Structure of the Ternary Complex of a NaV C-Terminal Domain, a Fibroblast Growth Factor Homologous Factor, and Calmodulin.
pubmed doi rcsb
total genus 51
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2012-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4dckA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4dckA02
2BBNA 1SL8A 3D0YB 4NQGA 1YR5A 4DRWA 1PRWA 2LANA 3FIAA 3TUYB 1CDLA 1MR8A 1KQMB 2K7DA 2Y9ZA 1S6JA 1S5GZ 1XYDA 4YGBB 1CM4A 1MF8B 1QX7A 3EK4A 1KFXL 1EJ3A 1TRFA 2KYFA 4MBEA 3SG4A 2CBLA 4D1EA 5KU1A 3BUWB 3A4UB 2NCPA 1BR1B 1QX2A 1DTLA 1LA0A 2H61C 4HREE 1DJWA 1MWNA 2M1KB 1PVBA 1N2DA 2LHIA 2Q91A 3EVVA 3IQQA 5CSIA 1BJFA 1KQMC 1CTRA 4FTGA 5JOLA 1F4QA 3O4YA 3WNXB 1GGZA 3SIBA 1QATA 4MZJA 3LK1A 1A75A 2PASA 4CLNA 1M45A 1F8HA 3GK4X 2RGIA 4ZCVA 5HLOA 1XK4A 2LVKA 2EC6B 3AKAA 1IRJA 1HT9A 1QASA 4A4CA 1SMGA 1TOPA 1DJZA 4I5LB 5AANA 4HSZA 1LINA 3WHUB 1JSAA 5G08A 1L7ZA 2ISDA 2P6BB 1DGUA 1LKJA 2QACA 1QV1A 1IJ6A 5D7FA 2L50A 2FCEA 2V53A 4NDBA 2Y1NA 4QJ3B 4ORCB 1UURA 5PALA 1TCOB 1TIZA 1XFVO 3CR5X 4YBHB 5HLVA 3TZ1A 1HQVA 2B1UA 3D0YA 2PALA 4YGAA 1S36A 1OFCX 1NUBA 2LLTA 1ALVA 2M8UA 3AKBA 3I5FB 2K2AA 1S3PA 3JVTB 1A2XA 2CXJA 1TNQA 3JVTC 4XJKA 2MLEC 5ER4X 3PFVA 3TS5B 1CLMA 4R1EA 1ZMZA 2LHLA 1MUXA 1F55A 1FPWA 4NDDA 2M1UA 4PCWA 5AXIA 2KAVA 1JBAA 1YUSA 1KK8C 1UHKA 1Y1AA 2KAXA 3F45A 1YUUA 3OB1B 3PM8A 4M2QA 1LXFC 3PLFB 1OE9B 4I5NB 5KSZA 3CR4X 2LMUA 1LVCD 3TDIA 5DKQA 4NDCA 2Q4UA 4GGFC 3HX4A 2IS9A 1B4CA 1S6CA 2JULA 2JOJA 4OR9B 1CMGA 2KGRA 1NCZA 1B7TY 1SKTA 3PN7B 3RLZA 1XFZO 2JT3A 1CNPA 1SRAA 1JUOA 3CR2A 1W7JB 2LP2A 1OSAA 3MSEB 2F3YA 1SNLA 1CDNA 1YVHA 2E6WA 2LC5A 3SG3A 3SIAA 1DJIA 1B47A 1XA5A 2JNXA 1PK0D 2LVVA 1DJGA 3I5HC 3KF9A 1DJHA 3BQ3A 2BBMA 3NSIA 4GBAA 2A4JA 4GGNA 3WHTB 2JZIA 1IH0A 2ZRTA 4DUQA 2JNFA 1BLQA 1OZOA 4DIRA 2CNPA 1OQPA 2M7NA 2JXCA 2F3ZA 3I5GC 2MJWB 1A4PA 1UUSA 3SG5A 3O6BA 5AERA 4MRXA 1SK6D 1OZSA 2O5GA 2AAOA 3I5HB 4MEWA 3CTNA 1G8IA 4DCKA 1FI6A 1DJYA 5IBWA 1M31A 1BODA 1RWYA 3M0WA 3NSKA 1QS7A 1A29A 2LUXA 1KSOA 1YVLA 1Y1UA 1CFFA 2F2PA 4CIDA 3CS1A 1XK4C 1EG4A 3LCPC 4AQJA 1F54A 1C7WA 2M7LA 1R2UA 3EK7A 1WY9A 3OX5A 1N65A 2ZRSA 3DF0A 4ETOA 4YI8A 2KHNA 2JC2A 5I2OA 1B8CA 1S1EA 2OPOA 1SCMC 1UWOA 3I5GB 2M49B 3VRPA 4PHMA 3WXAA 1KFXS 2VRGA 1RTP1 3ZWHA 2WOSA 1NX0A 2Y4QA 1DF0A 1M63B 1S26D 3HCMA 1AJ4A 3BOWA 4BY4A 1KFUS 4MZLA 4TNCA 1EXRA 1EH2A 1PVAA 1XFWO 3FWCA 4Q04A 2BCBA 1K8UA 1UHHA 2L5XB 1EG3A 3PSRA 5D69A 4ZCUA 1NX2A 2G2BA 3GK2A 3NSLA 1IQ3A 4YGDB 2MHHA 3BUMB 2LM5A 1WDCB 1J1EA 2EHBA 1UHNA 3QRXA 2L4HA 2ZKMX 5HKWA 4PHNA 5FYXA 2FJUB 2ZN8A 2D8NA 1K2HA 2M3WA 2WNDA 2BE6A 2LUCA 4JQ0D 1SPYA 2BCXA 1BMOA 2LLSA 1LA3A 3DVEA 4I5JA 4PHKA 1PSRA 3DVJA 4MZKA 5BPJA 4N1GA 1FI5A 3EKJA 3TDZA 2OS8C 3GK1A 3IQOA 2K7OA 1U5IB 4PE7A 2COLB 2KSPA 1J7QA 1B1GA 2KGBC 5CSNA 2BKHB 4ICBA 1IKUA 5CSJA 1K94A 1KWOC 1NIWA 1F71A 2M97A 5CPVA 1DJXA 1QV0A 2JQ6A 1F4OA 4OCIA 1SYMA 2R2IA 1SCMB 1XFYO 1BG1A 2HQ8A 1QVIY 2BL0C 2KQ6A 3VRRA 1YRTB 1XO5A 1S6IA 4GFTA 1D1OA 2BKIB 5KTYA 3E3RA 1CFPA 3SJSA 3KPXA 1BT6A 2AUCA 2M0RA 2WC8A 5J3XA 1QJTA 4AOMA 4XYNA 3DVMA 1V1GA 3O2PA 1NPQA 3TUYC 3OX6A 2PMYA 2OTGB 4WQ2A 5B8IB 3CGAA 4DS7A 1Y1XA 1L2OC 2WCEA 3PALA 3I5IB 4M2PA 1MXLC 4QJ4B 1YX7A 4PALA 1UHJA 2KI6C 1Y6WA 2K0JA 2JT0A 5GQQC 1QLSA 2I7AA 1GGWA 2HF5A 2F8PA 2L98A 1SY9A 1NX1A 1RROA 1B8LA 3RM1A 2JTZA 1B7TZ 2JPTA 1WRZA 3CWGA 1CLBA 1AUIB 1K93D 3TDUA 2LLUA 1N0YA 2BCAA 2ZNDA 1IQ5A 3KEVA 1RECA 4YI9A 1KQVA 2Y5IA 4HRHA 1M39A 1PALA 2GV5A 4C0JA 1H8BA 5HKZA 1K9KA 1M46A 1KWOB 1DMOA 2KI4C 4MSPA 2SASA 1K90D 1R6PA 2WCFA 1SBJA 3LL8B 1ZUZA 1QIVA 4OVNF 1W7IB 1ZOTB 2OS8B 1TN4A 5DKRA 5K89A 1NCYA 5I8NA 2HQWA 2K7CA 4CFQA 3NXAA 2FOTA 4CPVA 5JJGA 1CDPA 3A8RA 1GJYA 1K95A 4PDZA 1MQ1A 4L9MA 1Q80A 2PRUA 4AQIA 3JTDC 1GQMA 1DT7B 1NSHA 1H4BA 1C7VA 4PE1A 2I94A 1XVJA 1CFDA 3ICBA 3SG7A 4F0ZB 1X02A 4MVFA 2KI4B 1VRKA 3AAKA 5TNCA 3BOWB 1WDCC 1RJVA 2KDHA 5DKNA 2KBMA 1F70A 1CMFA 3K21A 1SL9A 1NYAA 1YX8A 2ZNEA 4CFRA 1KSMA 3TS5C 1WLMA 3ZNIA 2JRFA 1KCYA 2ZN9A 1U5IA 2Y1MA 2O60A 2L4IA 4ORBB 4ORAB 2ZFDA 1K96A 1UP5A 1AK8A 1YURA 1WLZA 3EK8A 3EVUA 3VRNA 1G4YR 4GPLB 1JFKA 1ZFSA 1IJ5A 1OMVA 1BF5A 1OMDA 1V1FA 2FCDA 1K9PA 1QLKA 2I18A 4UPGA 1J7OA 2LMVA 3JTDB 4YGEB 2EGDA 1SL7A 1G33A 1J7PA 4GUKA 2BECA 1J55A 3I5IC 2CT9A 3OP0A 1S5GY 2EC6C 4PHJA 4C0KA 1IGVA 2MLFC 1J1DA 2JWWA 1J7RA 3OB2B 3LK0A 1WRLA 1YRUB 2PVBA 2I2RE 1FF1A 1NCXA 4N1FA 3D10A 1Y0VH 2F33A 3KO0A 1JC2A 4IL1A 4C0LA 1KK7Y 2NLNA 4WRIA 1QXPA 3PN7C 2LE9B 2GGMA 4MRYA 3CLNA 4P5OE 3C1VA 1C07A 2LAPA 1RK9A 2F2OA 1BR4B 1DVIA 1ALWA 3DF0B 2KFHA 3DD4A 3FWBA 5I2QA 5HYDA 2BL0B 2LMTA 1CB1A 3IF7A 1QX5B 1SR6B 1NWDA 1PULA 3BYAA 1TCFA 2H61A 1SCVA 2K2FA 3DVKA 1EL4A 1CM1A 3EVRA 2K7BA 2LCPA 4MLWA 1IWQA 4P2YB 2KQYA 4A4BA 1KK8B 3BUNB 2MBXA 2H2KA 2SCPA 2L0PA 1SR6C 2K8MB 1TTXA 1UHIA 1YTZC 1MXEA 2WORA 1K9UA 1QTXA 3NSOA 3VRQA 1TNPA 3LLEA 4BY5A 2KNEA 2OTGC 2LV7A 2Y9YA 2MA2A 2LNKA 2M9GA 2PSRA 3SG2A 4WQ3A 3SG6A 1JWDA 1E8AA 1DF0B 1QVIZ 3BXKA 2WCBA 1OMRA 1NX3A 1CDMA 2QPTA 4USLA 4HRGA 4GNKB 1MHOA 3VGOA 4I5KA 1B8RA 4YRUA 4QJ5B 2L51A 1BOCA 4GGFA 2CTNA 1AP4A 2HPSA 4PE4A 2JXLA 2K61A 2BE4A 5ER5A 2HETA 2MAZA 3FS7A 4YGCB 1NP8A 2G9BA 4U8DA 2JT8A 1YUTA 1B9AA 1TNWA 2JTTA 1JF0A 1KK7Z 2MRDA 1ODBA 1IG5A 2NZ0A 1RFJA 2KAYA 4PE0A 4GAOA 1OOJA 1SW8A 3EKHA 1A03A 1WRKA 5AFPA 2NXQA 1BU3A 2L2EA 4MN0A 2LVIA 2M29A 1JF2A 3CZTX 3OHMB 2KYCA 1ZACA 2KI6D 3H4SE 1TNXA 5I2LA 2LP3A 3PATA 1KFUL 1FW4A 4M2OA 1JFJA 3BUXB 2KFGA 3I5FC 2GGZA 2E30A 2TN4A 3GOFA 2AMIA 5AEQA 1XFUO 3AAJA 1AVSA 1DGVA 1CKKA 2KFFA 1QIWA 1CLLA 2JU0A 2CCMA 5F6TA 4OKHA 1A75B 5CSFA 4E68A 1CFCA 4FQOA 2LVJA 1PSBA 3KHEA 4N5XA 5HKYA 2NCOA 2KBIA 4XJKB 2KOTA 3O78A 4JWQA 3VROA 1L2OB 1AHRA 1XFXO 1FBVA 2DOQA 3BUOB 1AJ5A 4JPZB 4OV2A
chains in the Genus database with same CATH superfamily
1SL8A 1HGVA 1YR5A 4DRWA 4GT1A 2LANA 3TUYB 1LT9A 3L74J 3L70E 1TU3F 1OVUA 2Y9ZA 2QEOA 1FDOA 2FYNC 1KFXL 2ZJSE 5TISH 1S72P 2K9JA 1BR1B 1LA0A 4HREE 5DJTB 1DJWA 1KQMC 1U7MA 3ABVC 1F4QA 3O4YA 3SIBA 4MZJA 1ZN5A 1HVVA 5AW9B 1UIIA 1R5SA 1F8HA 1H89A 2RN0A 2HYNA 3CXHD 5AVXB 2WSFH 5KAFE 4XE5B 5HLOA 2ZT9C 1IRJA 1DJZA 3WHUB 1M7LA 1L7ZA 2ISDA 2IBZD 1LKJA 2W27A 2QACA 2CPSA 3IR9A 1IJ6A 5D7FA 3USSA 4NDBA 4QJ3B 3HE4A 3FWNA 3H1JG 1TCOB 4YBHB 3CR5X 1IFNA 3HD7D 1AVOA 2YMKA 2WVRA 3BFBA 1S36A 1SS1A 2M8UA 1ALVA 2L5YA 1S3PA 2VRSA 3L73D 3CYZA 1GL2A 3BCCJ 3TS5B 1CLMA 1GZLA 4NDDA 1AQ5A 2M1UA 3O4XA 4PCWA 2KAVA 1H88A 1NTME 5CJ4A 3FE9A 2GA1A 4IL6E 3OB1B 2WCMA 1VQ6P 4C7NB 1JY2O 1LVCD 3TDIA 2XKMA 2JULA 4BXLA 3CC4P 1CMGA 3PN7B 1SKTA 3CWBJ 1KYOD 1XFZO 1AVYA 5GTHE 2I8DA 2LP2A 1NTKJ 3RBZA 2G3AA 1QLED 3C1LA 3D74A 4H44C 2E5YA 2Q1KA 2LC5A 1W2BO 3SIAA 1DJIA 3HD7B 1PGJA 1L0NK 2JNXA 4WY4B 3NSIA 1JCDA 3BQ3A 2BBMA 1DD3A 2FYNB 4GBAA 3WHTB 3W67A 5KLVK 1IH0A 2ZRTA 4DUQA 1BE3E 2JNFA 4UB8H 1BLQA 1ZMEC 2JXCA 1RQUA 1A4PA 4IFMA 1EDLA 1EZVE 2P58A 2AAOA 1N7SC 4MEWA 4F7FA 2QEXP 3HE5B 1PIXA 1QVFO 1M31A 1BODA 1FDMA 5AW6B 4OGQC 1A29A 2LUXA 1E79H 1YVLA 1Y1UA 3B6XA 1OMIA 4IL6X 2R32A 3T97A 1A02J 2K3RA 3M0AA 1JY3N 1VQ5P 4ETOA 3C8VA 2BAPA 3TGUE 2FYUD 1S1EA 2KP8A 1SCMC 1OOHA 5EFWB 1KFXS 3ZWHA 2WOSA 3R1VA 3HCMA 3TK1A 4BY4A 4PV1C 1KFUS 3H1IE 4TNCA 1EH2A 1RE3C 5D69A 2L5XB 3PSRA 4ZCUA 3S0DA 2A45H 1NX2A 2G2BA 3D73A 2MHHA 4ASWA 1MZ9A 3D70A 3CMEP 3AEBC 2LM5A 1J1EA 1OW4A 3L4AA 2KLEA 3QRXA 1SQQJ 2FJUB 3L70D 1RH5B 1BMOA 2LLSA 3L37A 2OARA 4I7ZC 2N9BA 1PSRA 1C3YA 4W80A 3L71D 5E79H 4N1GA 4GDOA 3MZWB 3TDZA 1SQXJ 1YJNP 2K7OA 4PE7A 2MJZA 4XA4A 4L74A 1YYCA 3AECC 2BKHB 4ICBA 3G6EP 2M97A 1BDDA 1DJXA 2B88A 1JY2P 1JMBA 2IPPA 3KZIH 1JY2N 3GF7A 1XFYO 1M90Q 2AEMA 1SFCD 2KOGA 2BL0C 2KQ6A 1YRTB 4GFTA 4IFFA 3SJSA 3D6YA 2KS1A 1BT6A 2OYHC 1DD4A 1QJTA 1NKZB 2JKVA 2A45G 3Q2YA 4ZMDA 5CCGA 5APWA 1SSEB 2K88A 3OX6A 3B88A 5KLVJ 1LTGC 3CXHI 2J5UA 3FGAD 3CGAA 1G1IA 2KI7B 5APTA 1P84H 3V5BA 3R4YA 2AEJA 1YX7A 1Y6WA 2JT0A 2WT7A 1OW6A 1T3JA 1GGWA 1SY9A 4DJGA 2OYHB 1B8LA 1B7TZ 3CWGA 2C0XA 1HTLC 3CC2P 2LLUA 2ZAEB 1IQ5A 4HRHA 3WU2E 1M39A 5KKZB 4HJGH 1ZR4A 5HKZA 1CI6A 1URQC 3PTZA 1M46A 1CI6B 1HGZA 1DMOA 2KI4C 1KILE 4INWA 4OVNF 1ZOTB 5DKRA 4EDFA 1URQD 1CDPA 1GJYA 1K95A 3V2RA 3B5ND 1MQ1A 1LTJA 4PD4I 1USDA 2PRUA 5FI2A 1PP9E 4N78D 1S3JA 2KK7A 4C46A 1UIXA 1NTMG 2I94A 4F0ZB 2WT7B 2KDHA 1SL9A 3AE6C 2BNXA 3NTNA 3A7OA 1SQQK 3L71G 3PHLA 4ORBB 3I56P 1NKNA 1U7JA 3OA7A 1YURA 3EVUA 1M1JB 1YHQP 3VRNA 1IJDB 1JFKA 3NHTA 1IJ5A 2QM8A 3GG2A 1BF5A 1KMIZ 1NHLA 2QVAA 3CZ1A 1J7OA 1GK6A 2EGDA 2Q7CA 3RK3E 1J7PA 1PPJG 2CT9A 2IYPA 2EC6C 4PHJA 5CMZA 1J7RA 3DYEA 3SFEC 1BE3G 1NTZE 1WRLA 2OTKE 1FF1A 1NCXA 4ZKUA 1Y0VH 2FYUE 3RL0C 4R4LA 3CDNA 4IL1A 1EZVG 2NLNA 1HWTC 2BEZF 1QXPA 3S0AA 2LE9B 2GGMA 3CLNA 3C1VA 1RK9A 3EFFK 1DELA 1ALWA 3DF0B 2WSCJ 2KFHA 1FZFA 1SR6B 3L75E 1TCFA 2K2FA 1KZUB 2OQQA 1FZGA 2H8VA 3L71E 1CM1A 5DICA 1N2DC 3H1HG 4MLWA 3D77A 3GHGB 4P2YB 1KK8B 5GTIE 2MKVA 4DZOA 2QA4P 3PRJA 2K8MB 3TYYA 2BASA 2WORA 1K9UA 4BY5A 2SPZA 2NPSC 2Y9YA 2MA2A 1KYOH 3LW5J 1T2KD 2LNKA 2M9GA 3SG6A 3SG2A 3S0GA 1KYOI 3BXKA 1NU1K 1OMRA 1CDMA 4OWFA 2O3JA 4EOTA 4I5KA 1S9KE 2O1JA 3CLQA 4PD4E 4XFJA 1GL2B 2WQYC 1RF1B 4YGCB 1NP8A 1QWVA 2G9BA 3FX0A 1PGOA 1B9AA 2JTTA 1NAYA 4PV1D 1A03A 3EKHA 1WRKA 2NXQA 5TISE 1LT1A 3L47A 3N7NA 1ZACA 2GUVA 3H1HE 1RF1C 2OYIA 2LP3A 1HJ0A 2KLUA 1FW4A 4M2OA 2HODA 3BUXB 4U3FG 2KFGA 2WPVB 3AE4C 2P2UA 2N9YB 1SQPD 2E30A 2TN4A 1XFUO 1CKKA 1QIWA 1EDJA 5CSFA 1JNMA 4FQOA 4GOFA 3CCRP 1RHZB 1OOIX 3H1KE 4XJKB 3RK2B 4JWQA 3CC7P 2CPBA 1AHRA 2BBNA 4NQGA 4HH2A 1OOFA 1KQMB 1EZVI 2K7DA 2G8YA 2XNDH 1S5GZ 1IFIA 1CM4A 1BGYD 1EXIA 1EJ3A 3VB1A 3SG4A 5KU1A 2H43A 4GIFA 2NCPA 1DTLA 2H61C 1PP9D 1EC5A 3CI9A 5AVWB 1BJFA 4FTGA 5JOLA 2E42A 2C9LY 2E76D 1WMKA 2WC5A 1GGZA 3RL0B 2PASA 1LP1A 3JSVC 3FXEA 2BCCD 2LVKA 2EC6B 3KYQA 1NTZJ 1QASA 1TOPA 4HSZA 5G08A 1NTKK 2IBZG 3SS5A 2L50A 2V53A 2JP3A 2Y1NA 4ORCB 1XFVO 1TIZA 1XFRA 3S1KA 5K5GB 2B1UA 3D0YA 2PALA 2W83C 3CX5D 1XTGB 1NUBA 2W90A 1NU1J 3NXSA 3I5FB 1K04A 3HUSB 1KN7A 2CK3H 1LTJC 1KB9E 1TNQA 1SQXD 1GW4A 1PP9G 3L71J 3PJIA 1BCCE 1F55A 1FPWA 2M3BA 1KK8C 1RF0A 1UHKA 1NOHA 5KAIH 3PLFB 1GMJA 1OE9B 2IZ0A 1NTKD 2QJKC 2QJYB 2E76B 2E75B 2IFMA 1DQEA 1G2CB 4GGFC 2ZYAA 3HX4A 1B4CA 1DEBA 1ORGA 1N7LA 4OR9B 3I5CA 1NCZA 1B7TY 1S4XA 1AFOA 1YQ3C 2QEVA 4H13D 1CNPA 3OGNA 1SRAA 1JUOA 3CR2A 3F89A 3SS4A 5B5EE 3PJSK 1PPJE 3CX5I 1CDNA 1W5CE 2E6WA 5B66E 1RF1A 2WSFJ 1XA5A 3VN0A 1PK0D 1NTZG 2LVVA 5APYA 3I5HC 4PD4H 2FYUG 1OZOA 3SFDC 2M7NA 1NAFA 3EFGA 3MUDA 2F3ZA 1BCCG 2MJWB 3O6BA 2QM7A 1NJIQ 5AW2B 1M1JC 1BGYG 1G8IA 5APQA 5IBWA 1J1DB 3L75G 2P67A 1JOCA 1YTZI 1J2JB 1NTMD 3O6QA 3RGUA 2I1KA 4CIDA 2Z4EA 3CWBE 3H1ID 2XU6A 3H1KJ 3M9HA 1EG4A 4L76A 3OJAB 2OYOA 3I55P 3EK7A 1WY9A 3OX5A 4KHXA 3B87A 3DF0A 1IFMA 2JC2A 2ZYGA 1EQ7A 1MKMA 2IBZI 1SQQD 1UWOA 3VRPA 5KAIE 3G9RA 2WTYA 2VRGA 2KIKA 5AVTB 1M63B 1S26D 1JY3P 2RKLA 1Q90D 3A5TA 4JBZA 1QL1A 1XFWO 2K9YA 1K8UA 1EG3A 3B71A 3CCUP 3NSLA 1LJ2A 4I7ZB 2M8RA 1BGYE 1JUNA 1UHNA 1FS0E 3EWKA 4PHNA 1EDIA 2WWWA 1EZVD 1SPYA 3QMEA 1LA3A 3DVEA 4U3FE 3CXHH 1YI2P 1FI5A 2M0BA 3EKJA 3IQOA 2AEFA 3L75D 2KSPA 1B1GA 5CSNA 2PRRA 2R5DA 3B5NC 5CSJA 1DEKA 3C9IA 4OCIA 1SYMA 2R2IA 1SCMB 1FE6A 2XZRA 3H1KG 5KLVE 1SQPE 1LTJB 1JM0A 2QRXA 1S6IA 2BKIB 5KTYA 3VMAA 1YIJP 3KPXA 1NTMJ 3H1HD 3IVTA 1DIPA 3H1JJ 3RK3C 1Q2NA 1TWOA 4M3LA 4RJTA 3O2PA 4AYCA 5KLIB 1RY3A 1NYHA 2PMYA 4W7YA 2P71A 4WQ2A 5B8IB 1Y1XA 1K73Q 1L2OC 3MD0A 1FZAA 1N7SB 1IFPA 1NGMB 1LS8A 1MXLC 3EG5B 2KI6C 2L5GB 2QJKB 1URQA 4EIJA 3CWBD 2F8PA 2L98A 1WRZA 3D76A 1AUIB 3TDUA 3HD7C 1N0YA 2ZNDA 1RECA 3AE9C 2IBZE 3HUSC 1KQVA 1P84E 3PLNA 1SQPG 3ZDMA 1PALA 1K9KA 3WU2H 1KWOB 4MSPA 1OIPA 2YNYA 5APXA 3AE5C 2WCFA 3PH0A 3LL8B 1ZUZA 2WITA 1T2KC 1TN4A 5K89A 2B87A 5AW4B 3R72A 4CFQA 3A8RA 3E7KA 3B4SA 1VQ9P 2YXRB 1DT7B 1D7MA 1LTSC 4YTPC 1C7VA 4PE1A 3RZSA 4K35A 1XVJA 1CFDA 3ICBA 1X02A 4MVFA 3AAKA 1CMFA 2ZNEA 4OGQB 3TS5C 1KCYA 1OXZA 4L75A 1GD2E 1U5IA 1NH4A 1L4AC 4WWIA 1TUZA 4ORAB 2QEHA 3IAOA 1Y8AA 1Q82Q 3IN6A 1OMVA 5AVUB 1KD1Q 1FZBA 4UPGA 4HKZH 2I18A 2IDBA 1SL7A 1G33A 2BECA 1J55A 3I5IC 4C0KA 1JTHA 3OB2B 2Q3IA 3RK3D 1BE3J 1MUUA 1YRUB 2PAJA 4N1FA 3L74D 3AE7C 1GU5A 4I6MC 3KO0A 1JC2A 2UWJE 3VYIA 1KK7Y 4WRIA 3PN7C 4D6TD 4MRYA 1C07A 2LAPA 1VF5D 3FWBA 4GODA 5HYDA 2O1KA 3IF7A 1NWDA 3BYAA 4Y99B 2XV5A 4AUWA 3G71P 1H0TA 1HF9A 3DVKA 3GHGC 3EVRA 1ZOYC 1IWQA 3CWBG 3EQ2A 2KQYA 3AEGC 3NFQA 2H2KA 2SCPA 2L0PA 1SR6C 2FXOA 2R44A 4R4MA 1C3ZA 1SQXG 1KTMA 1AA0A 1PGQA 3VRQA 3LLEA 3Q5SA 1L4AB 2W6AA 1FZCA 2YO2A 1G2CA 2PSRA 1VQMP 1E8AA 1DF0B 2DW3A 2P7JA 1L0LG 3G4SP 2QJPC 2QPTA 4USLA 4HRGA 4GNKB 3UNWA 1MHOA 4PJ0H 2GM4A 5EL2A 2LXBA 3IF4A 2OYIC 2L51A 3B8EB 1BOCA 4OZDA 3H1IJ 1AP4A 2NPSB 2HPSA 4PE4A 2BE4A 5ER5A 5AW0B 2HETA 2JPOA 3HRNA 3W68A 1KK7Z 5B66H 2KAYA 4PE0A 1YBKA 3V4QA 4GAOA 1OOJA 2N1TA 1J1EC 1BU3A 2L2EA 1LTIC 2LVIA 2M29A 3CZTX 3OW2O 1T14A 3OHMB 2KYCA 2JEEA 1TNXA 2K60A 3S0EA 1BSHA 2PQLA 2KSEA 2GGZA 1T8ZA 1N73B 3RL0g 1AJYA 4Y28J 1HBWA 3AAJA 1BCCD 2LXCB 1L0NG 4INXA 2HR3A 1NTZK 4E68A 3VTPC 2LVJA 5KLVG 3KHEA 4N5XA 5HKYA 4DOJA 3T97B 3BFAA 3O78A 4L73A 4PD4D 1L2OB 1VQOP 4U3FD 1XTCC 1JEKA 2NPSD 3L74G 3H32B 1PRWA 5KLIC 1RE4A 5KKZC 4YGBB 1S5LH 1MF8B 1QX7A 3EK4A 1CSBA 5BVZA 1TRFA 2KYFA 1KFMA 1CW5A 3CZ2A 1OOGA 3BUWB 4H13C 1KQFB 4N78E 2A06E 1N2DA 1ZRTD 1OVVA 1CTRA 3WNXB 3LK1A 1A75A 4WBAA 5TJHA 1IK9A 1M45A 1VQKP 4ZCVA 3HD7A 1XK4A 3AKAA 5BU5A 5AW5B 4A4CA 3HUSA 1SMGA 4I5LB 5AANA 1Z2CB 1LINA 2ZXEB 2N1TD 1RF0C 2IYOA 2WMMA 2FCEA 1TUJA 1UURA 5PALA 1T3UA 5HLVA 2IX7C 4C7RA 1HQVA 4H0LC 3L70J 3L74E 2LLTA 3JVTB 2CXJA 3JVTC 4C7NA 3P8CD 1R8EA 5GTIH 5ER4X 1KILB 4R1EA 2Z5HA 2LHLA 1MUXA 4H0LB 1FBMA 1SLQA 2V4HA 2AXCA 1YUSA 4N3YB 1Y1AA 2KAXA 3FE6A 5D3OA 2A06G 3CX5H 1LXFC 3CR4X 2IZ1A 4D6TJ 2OTJP 5DKQA 2LKMA 3QWOC 2E76C 1N7SD 1SVFA 2JOJA 1P28A 2ZVNB 1KB9H 1FJKA 2KGRA 3GF3A 2AXTH 5KJ7C 2JT3A 3MUDC 1IO4A 1QL2A 3AE8C 1GK4A 1OSAA 3MSEB 1FC2C 3D71A 2F3YA 3L72J 1S9KD 3M06A 3OBVA 4WB4A 1DX7A 4H13B 1B47A 4U7JA 3KF9A 4A7PA 4PV1B 2JZIA 3CCEP 5FI6A 2XDJA 3M9QA 2CNPA 3H1HJ 4AQRD 1UUSA 2W6JH 3CABA 1OZSA 2O5GA 1S5LX 2Z5IA 3I5HB 3LIDA 2QSIA 4DCKA 1X9VA 1GM0A 1PZQA 4BRYA 1IIOA 3KQGA 1SFCA 1QS7A 3L4FA 3IFMA 3H32A 5KAFH 1CFFA 2Y0CA 2WSCH 3CS1A 5APUA 3Q5RA 1SQXE 3LCPC 1C7WA 4JKTA 4DT0A 1M1JA 4IJ7A 3MIWA 2H8PD 2QIWA 2E75C 2H7HA 3S0BA 5I2OA 1IZNB 1B8CA 2M49B 1L0LE 3WXAA 3ITKA 1RTP1 3CCVP 2OGUA 2Y4QA 1KFNA 1AJ4A 3BOWA 1N73A 2AXTE 3P32A 4NPDA 1EXRA 2HLOA 1NTMK 2D2CC 3A3YB 4RO0A 1JTHB 2HPCA 3CXHE 4H44B 3GK2A 5AW8B 1KORA 1IQ3A 4YGDB 3N7HA 1BE3D 2FFDA 3BUMB 2W6BA 1WDCB 2EHBA 1SQQG 2ZT9D 2ZN8A 2D8NA 1K2HA 1T6AA 3A0HE 3KPEA 2WNDA 2BE6A 3NHIA 4JQ0D 1ZV8A 2BCXA 3CMAP 2K1AA 3DVJA 1SQVK 2OS8C 3GK1A 1U5IB 2COLB 4JYBA 1HH0A 1L0NE 1VQPP 1K94A 1F71A 1L0ND 3BASA 1BSNA 1FZCB 2WPSA 3QH9A 2HQ8A 3CD6P 1QVIY 1U57A 5CCHA 1KYOE 2FJYA 1XO5A 1NTZD 3MTUE 3E3RA 1CFPA 1NVOA 2AUCA 2M0RA 5J3XA 3CCJP 4AOMA 4XYNA 2WCJA 3DVMA 1P84D 2P10A 3B5NA 3WMM0 2GUSA 1VPCA 3OAKA 3K1EA 1SQBD 1SQQE 1PP9J 2KS1B 3RK2C 2ZT9B 3V6IA 4ZNCA 2WCEA 3I5IB 4QJ4B 2KXPB 4PALA 4U3FJ 1OW8A 1UHJA 3SWYA 5GQQC 1QLSA 4UB8E 3H6PA 1RROA 5CBNA 3RM1A 2JPTA 1CLBA 3V4WA 3LIEA 1K93D 1WT6A 4LLHA 1LWUA 1IK7A 3AE3C 1N8RQ 4C0JA 2FY8A 2FBWC 1W9ZA 2SASA 1K90D 1R6PA 1IFJA 3GW6A 1QIVA 2RH0A 1W7IB 1X22A 2OS8B 2YO3A 2GTEA 1NO4A 5I8NA 3WUTA 2K7CA 5JJGA 3NXAA 2FOTA 2JWAA 2ZYDA 2FYUJ 4PDZA 5CCGD 4L9MA 1Q80A 2HPCB 1GQMA 1NSHA 2L91A 3O8ZA 2YGUA 1BCCJ 3SG7A 3VOPA 5AW1B 3BOWB 1WDCC 1RJVA 2KBMA 1YJ9P 2KYVA 1NYAA 2JR8A 4CFRA 1KSMA 3ZNIA 2JRFA 2ZN9A 2B87B 2BCCJ 2Y1MA 2O60A 2L4IA 4RESB 2ZFDA 1K96A 1UP5A 2D2CB 3WUVA 1WLZA 1IC2A 5AW7B 1G4YR 4GPLB 5L8RJ 1NTKE 3U59A 4EYYQ 2WPRA 1QLKA 4ZKPA 2FXPA 3L4LA 3AEFC 5H2FH 4GUKA 2E43A 3OP0A 3V2LA 1BGYJ 4LGDE 1S5GY 1IGVA 2MLFC 2JWWA 3L73E 3M0DC 5GTHH 5BU8B 2PVBA 2M3EA 3M91A 2A45I 1A02F 1URQB 2KLDA 4O9BA 1K8AQ 3PM2A 2P1JA 2QEBA 4C0LA 2ERBA 3MGNA 3RK3B 1N7SA 3SWFA 4P5OE 5AVRB 1SQBG 2E74B 3L73J 4JD9A 2V7QH 2WPQA 3LW5H 5I2QA 1SFCC 5CCHC 2LMTA 1CB1A 2HG5D 1PULA 1PGPA 2PYQA 1EL4A 4IFDK 2K7BA 3R2PA 2LCPA 3DY9A 2YIUB 2ZXXA 2KZJA 3BUNB 2FFDB 3FE8A 2MBXA 1NTKG 1YTZC 2YKQA 3U1AA 2Y0DA 2JDIH 2KNEA 4UB6H 1X8YA 1P84I 2N1TC 3D75A 3TGUJ 1MV8A 2BEQD 1NX3A 3DXLA 1H8AA 3VGOA 1JB0J 5AVZB 4GGFA 2CTNA 1PPJD 2Y0EA 2MAZA 1GU4A 1SP4A 2FYZA 2JT8A 4B86A 1YUTA 2NZ0A 1JF0A 4JYCA 1SQBE 1ODBA 1IG5A 1SW8A 3VMZA 1ZXGA 5AFPA 1DEEG 4MN0A 1JF2A 3HE4B 2KI6D 1FOSE 4BRYB 5I2LA 4IOIH 2E75D 1X79B 1KFUL 1JFJA 3GMAA 3RL0D 3HTKB 2D2CD 3TF5A 3GOFA 4GKGA 3SSUA 2AMIA 5AEQA 1ZLLA 2WZ7A 2E5TA 1DGVA 1RE4C 2KFFA 1CLLA 2CCMA 1A75B 1GW3A 4YXDC 3L72D 3CX5E 2NCOA 4HB1A 1J1DC 1VQNP 1JO5A 2R3CA 2W8ZA 3VP9A 2YKOA 3BUOB 5DJUB 4JPZB 3D0YB 2V7QJ 3FIAA 1Y9BA 1GL2D 1NU1E 1CDLA 1OVRA 1MR8A 1S6JA 3TNUB 1HJBA 1XYDA 1LT9B 4D6TG 2C0WA 5AVSB 3JC22 4I2LC 4MBEA 1Y47A 2E74D 2CBLA 4D1EA 3D6ZA 5KJ7D 3A4UB 2E74C 3A2AA 1MFZA 1QX2A 3V2QA 1NWQA 4TLFA 1MWNA 2M1KB 1PVBA 2Q91A 2LHIA 3IQQA 3EVVA 5CSIA 2OTLP 2KNCA 3NMDA 1IFDA 3KXDA 1CZQA 2H89C 1QATA 1EXJA 4CLNA 2KNCB 4KT0J 2FXMA 1Q86Q 3E1IA 3L35A 1KILA 3GK4X 2RGIA 3AEDC 4N6JA 3P8MC 4W7ZA 1HT9A 1ZP0C 1JSAA 3B7AA 2QJYC 3U1CA 2KPHA 2P6BB 1KB9D 1DGUA 1QV1A 3TNUA 3H1JD 3TZ1A 3KHUA 2N1TB 4YGAA 4WY4C 1OFCX 1VQ7P 3AKBA 1NU1G 2K2AA 3II6A 2KUBA 1A2XA 1KQLA 1Q7YQ 1PV3A 4XJKA 2MLEC 3PFVA 2KZIA 4D6TE 2Q9IA 1ZMZA 5KJ7A 5AXIA 1VDFA 1JBAA 2FFDC 1SQVG 3F45A 4UB6E 1YUUA 3PM8A 4M2QA 3CPWO 4I5NB 4TT3H 5KSZA 4IL6H 3AEAC 2LMUA 2XNXA 2IFNA 2O01H 1M56D 2K9JB 5B5EH 4NDCA 2Q4UA 2IS9A 1L4AA 1S6CA 2RMZA 2OYIB 3V2NA 3RLZA 1L2PA 2QJPB 1JMMA 1W7JB 1Z4HA 1LTAC 1S2EA 3R1OA 3L72G 1NU1D 1SNLA 3CZ0A 2POHA 1YVHA 3BVHA 1M57D 2QE7H 3SG3A 1SQBJ 1HUCA 3L73G 3BATA 3A0BH 2B89A 1DJGA 1DJHA 2A4JA 3BJHA 4GGNA 2PFXA 3Q1MA 2JWDA 3FWLA 4DIRA 1OQPA 1JY3O 3I5GC 3CCMP 2Q5UA 3SG5A 4WY4D 5AERA 4Y99C 4MRXA 1SK6D 1FOSF 2C9NY 2PP6A 4PJ0E 1SQVE 1ZW0A 3CTNA 5H2FE 1FI6A 5I94A 3L75J 3P8CE 1DJYA 1RWYA 5CHXA 3M0WA 3NSKA 1PL5A 2PGDA 1L0LD 1MFTA 1OW7A 1KSOA 2O01J 3AE2C 3F5HA 2F2PA 3K5BA 3GHGA 1L0LJ 1SQVJ 1XK4C 1GTWA 4AQJA 1F54A 1SQPK 5AW3B 1RE3A 2M7LA 1R2UA 2NPSA 4KJMA 1N65A 2ZRSA 1EDKA 5AVYB 4YI8A 2KHNA 2QDIA 2P70A 3A0BE 2OPOA 1FZCC 2ITAA 3I5GB 1LTBC 1FAVA 3TDKA 4PHMA 3A0HH 5APSA 1S5LE 1Z56A 1NX0A 2FKWB 1DF0A 1E5WA 1N86A 3HTKA 4MZLA 1QVGO 2HODB 2KB7P 1PVAA 3VP8A 3FWCA 4Q04A 2BCBA 3AEEC 1UHHA 1GL2C 2JJLA 4RKUJ 1KQSO 2L4HA 2ZKMX 5HKWA 1SQVD 5FYXA 4H44D 2M3WA 1H0TB 1GDTA 2LUCA 4OGQD 3BFHA 1X0TA 2B9BA 4I5JA 4PHKA 2WSSH 1VQ8P 4MZKA 5BPJA 1JCCA 3BCCD 3H1LD 3H1LE 3S9OA 1YJWP 1J7QA 2KGBC 1IKUA 5CCGC 1KWOC 1NIWA 2KSJA 5CPVA 1KQGB 2JQ6A 1QV0A 2Q6QA 1F4OA 3TSIA 1BG1A 2M5AB 1M1KQ 1VQ4P 3NGVA 3FXDA 3H1LJ 1ZR2A 3MP7B 4K3AA 3VRRA 1D1OA 2WCLA 1KILD 2WSEJ 2WC8A 3M0DA 3VMYA 2R5BA 1SQBK 1KB9I 1V1GA 1OZHA 1NPQA 4CPGA 4Z1MH 3TUYC 1VL2A 3L70G 1LGHB 2QG4A 2L2CA 2OTGB 2FYUK 4JF7A 3G3ZA 4DS7A 3CCSP 1LWUB 4OH8B 4PT1A 1FZEA 5FI7A 3PALA 4ASVA 1BDCA 5M1BA 4M2PA 3B86A 2K0JA 2OYHA 2M5AA 3CL3D 2ZVOB 3SWKA 1SQXK 3VMXA 2I7AA 2NZ2A 2HF5A 3UO9A 1NX1A 2JTZA 2I1JA 1L0LK 1LTTC 3DZTA 2BCAA 3KEVA 4YI9A 1SQPJ 2Y5IA 4I1LA 2GV5A 1ZRTE 1H8BA 2WCHA 3AE1C 2A06D 3S4RA 3P7KA 3B5NB 3Q3DA 4WVZA 2WC6A 1SBJA 5KLVD 2NRGA 1NCYA 5CBOA 2HQWA 3L36A 4CPVA 4AQIA 2J58A 3JTDC 3KDPB 1H4BA 3JCUH 2KI4B 1VRKA 3WUUA 5TNCA 2YMYA 5DKNA 1F70A 1VF5B 3H1KD 3K21A 1YX8A 5APVA 1QX8A 2BCCG 1WLMA 3BCCG 4QMAA 4GOEA 1AK8A 1YITP 1M8OB 3D78A 3EK8A 5AVVB 4EI2A 2Q3EA 1LT9C 1ZFSA 5CCHD 3Q8IA 1OMDA 1V1FA 2FCDA 1K9PA 3L72E 2HFED 2LMVA 3JTDB 4YGEB 3O6QB 3CCQP 4HYTB 2WCKA 3SS3A 2YKPA 1WRGA 1J1DA 3LK0A 2I2RE 3MHVA 4YPCA 3D10A 2F33A 3TGUD 2H88C 2WSEH 2F2OA 2O01N 1BR4B 2YXQB 1DVIA 3N4XA 1FDIA 1S1CX 3DD4A 4MN4C 2BL0B 1QX5B 2BCCE 3UIAA 3CCLP 2H61A 1SCVA 1PFIA 3BCCE 1YQ4C 2LR2A 2YIUC 3RBXA 4A4BA 1QEXA 3BRVB 5AVQB 1AQTA 1TTXA 1SFCB 1UHIA 1MXEA 2J59M 1KILC 1QTXA 2K37A 3NSOA 1TNPA 1LWUC 1RQVA 3HE5A 1USEA 2OTGC 2ZFCA 2LV7A 4WQ3A 1LNQA 1JWDA 3TGUG 4BWNA 1VF5C 1K9MQ 1QVIZ 3BRTB 3GLMA 2WCBA 1AV1A 1YTZT 3KZIE 1KC8Q 1FU1A 4LC1A 1B8RA 1DH3A 1W2EA 4YRUA 4QJ5B 1N73C 3H1IG 2R3SA 4WY4A 2JXLA 2K61A 4NPEA 3FS7A 2KLVA 4U8DA 1TNWA 2MRDA 4H0LD 1RFJA 5E79E 1R5LA 3E1RA 1J1EB 1OX3A 3Q5PA 1Q81Q 3M9BA 1FJPA 3H4SE 5CJ0A 1KV4A 3JCUE 3PP5A 3PATA 1VQLP 3H1LG 3I5FC 1G1JA 3H25A 2JO1A 1AVSA 5KTBA 3S0FA 2JU0A 1L4AD 4NPFX 3RK2D 1LP1B 3V2PA 5F6TA 4OKHA 1K05A 1L0NJ 5C39A 1CFCA 4YXWH 1PSBA 4KYNA 2KBIA 1OWAA 1DC1A 3R1PA 2KOTA 3VROA 3H1JE 1XFXO 1FBVA 2DOQA 5HL1A 4FQTA 1QGKB 1AJ5A 4OV2A
chains in the Genus database with same CATH topology
2BBNA 1SL8A 3D0YB 4NQGA 1YR5A 4DRWA 1PRWA 2LANA 3FIAA 3TUYB 1CDLA 1MR8A 1KQMB 2K7DA 2Y9ZA 1S6JA 1S5GZ 1XYDA 4YGBB 1CM4A 1MF8B 1QX7A 3EK4A 1KFXL 1EJ3A 1TRFA 2KYFA 4MBEA 3SG4A 2CBLA 4D1EA 5KU1A 3BUWB 3A4UB 2NCPA 1BR1B 1QX2A 1DTLA 1LA0A 2H61C 4HREE 1DJWA 1MWNA 2M1KB 1PVBA 1N2DA 2LHIA 2Q91A 3EVVA 3IQQA 5CSIA 1BJFA 1KQMC 1CTRA 4FTGA 5JOLA 1F4QA 3O4YA 3WNXB 1GGZA 3SIBA 1QATA 4MZJA 3LK1A 1A75A 2PASA 4CLNA 1M45A 1F8HA 3GK4X 2RGIA 4ZCVA 5HLOA 1XK4A 2LVKA 2EC6B 3AKAA 1IRJA 1HT9A 1QASA 4A4CA 1SMGA 1TOPA 1DJZA 4I5LB 5AANA 4HSZA 1LINA 3WHUB 1JSAA 5G08A 1L7ZA 2ISDA 2P6BB 1DGUA 1LKJA 2QACA 1QV1A 1IJ6A 5D7FA 2L50A 2FCEA 2V53A 4NDBA 2Y1NA 4QJ3B 4ORCB 1UURA 5PALA 1TCOB 1TIZA 1XFVO 3CR5X 4YBHB 5HLVA 3TZ1A 1HQVA 2B1UA 3D0YA 2PALA 4YGAA 1S36A 1OFCX 1NUBA 2LLTA 1ALVA 2M8UA 3AKBA 3I5FB 2K2AA 1S3PA 3JVTB 1A2XA 2CXJA 1TNQA 3JVTC 4XJKA 2MLEC 5ER4X 3PFVA 3TS5B 1CLMA 4R1EA 1ZMZA 2LHLA 1MUXA 1F55A 1FPWA 4NDDA 2M1UA 4PCWA 5AXIA 2KAVA 1JBAA 1YUSA 1KK8C 1UHKA 1Y1AA 2KAXA 3F45A 1YUUA 3OB1B 3PM8A 4M2QA 1LXFC 3PLFB 1OE9B 4I5NB 5KSZA 3CR4X 2LMUA 1LVCD 3TDIA 5DKQA 4NDCA 2Q4UA 4GGFC 3HX4A 2IS9A 1B4CA 1S6CA 2JULA 2JOJA 4OR9B 1CMGA 2KGRA 1NCZA 1B7TY 1SKTA 3PN7B 3RLZA 1XFZO 2JT3A 1CNPA 1SRAA 1JUOA 3CR2A 1W7JB 2LP2A 1OSAA 3MSEB 2F3YA 1SNLA 1CDNA 1YVHA 2E6WA 2LC5A 3SG3A 3SIAA 1DJIA 1B47A 1XA5A 2JNXA 1PK0D 2LVVA 1DJGA 3I5HC 3KF9A 1DJHA 3BQ3A 2BBMA 3NSIA 4GBAA 2A4JA 4GGNA 3WHTB 2JZIA 1IH0A 2ZRTA 4DUQA 2JNFA 1BLQA 1OZOA 4DIRA 2CNPA 1OQPA 2M7NA 2JXCA 2F3ZA 3I5GC 2MJWB 1A4PA 1UUSA 3SG5A 3O6BA 5AERA 4MRXA 1SK6D 1OZSA 2O5GA 2AAOA 3I5HB 4MEWA 3CTNA 1G8IA 4DCKA 1FI6A 1DJYA 5IBWA 1M31A 1BODA 1RWYA 3M0WA 3NSKA 1QS7A 1A29A 2LUXA 1KSOA 1YVLA 1Y1UA 1CFFA 2F2PA 4CIDA 3CS1A 1XK4C 1EG4A 3LCPC 4AQJA 1F54A 1C7WA 2M7LA 1R2UA 3EK7A 1WY9A 3OX5A 1N65A 2ZRSA 3DF0A 4ETOA 4YI8A 2KHNA 2JC2A 5I2OA 1B8CA 1S1EA 2OPOA 1SCMC 1UWOA 3I5GB 2M49B 3VRPA 4PHMA 3WXAA 1KFXS 2VRGA 1RTP1 3ZWHA 2WOSA 1NX0A 2Y4QA 1DF0A 1M63B 1S26D 3HCMA 1AJ4A 3BOWA 4BY4A 1KFUS 4MZLA 4TNCA 1EXRA 1EH2A 1PVAA 1XFWO 3FWCA 4Q04A 2BCBA 1K8UA 1UHHA 2L5XB 1EG3A 3PSRA 5D69A 4ZCUA 1NX2A 2G2BA 3GK2A 3NSLA 1IQ3A 4YGDB 2MHHA 3BUMB 2LM5A 1WDCB 1J1EA 2EHBA 1UHNA 3QRXA 2L4HA 2ZKMX 5HKWA 4PHNA 5FYXA 2FJUB 2ZN8A 2D8NA 1K2HA 2M3WA 2WNDA 2BE6A 2LUCA 4JQ0D 1SPYA 2BCXA 1BMOA 2LLSA 1LA3A 3DVEA 4I5JA 4PHKA 1PSRA 3DVJA 4MZKA 5BPJA 4N1GA 1FI5A 3EKJA 3TDZA 2OS8C 3GK1A 3IQOA 2K7OA 1U5IB 4PE7A 2COLB 2KSPA 1J7QA 1B1GA 2KGBC 5CSNA 2BKHB 4ICBA 1IKUA 5CSJA 1K94A 1KWOC 1NIWA 1F71A 2M97A 5CPVA 1DJXA 1QV0A 2JQ6A 1F4OA 4OCIA 1SYMA 2R2IA 1SCMB 1XFYO 1BG1A 2HQ8A 1QVIY 2BL0C 2KQ6A 3VRRA 1YRTB 1XO5A 1S6IA 4GFTA 1D1OA 2BKIB 5KTYA 3E3RA 1CFPA 3SJSA 3KPXA 1BT6A 2AUCA 2M0RA 2WC8A 5J3XA 1QJTA 4AOMA 4XYNA 3DVMA 1V1GA 3O2PA 1NPQA 3TUYC 3OX6A 2PMYA 2OTGB 4WQ2A 5B8IB 3CGAA 4DS7A 1Y1XA 1L2OC 2WCEA 3PALA 3I5IB 4M2PA 1MXLC 4QJ4B 1YX7A 4PALA 1UHJA 2KI6C 1Y6WA 2K0JA 2JT0A 5GQQC 1QLSA 2I7AA 1GGWA 2HF5A 2F8PA 2L98A 1SY9A 1NX1A 1RROA 1B8LA 3RM1A 2JTZA 1B7TZ 2JPTA 1WRZA 3CWGA 1CLBA 1AUIB 1K93D 3TDUA 2LLUA 1N0YA 2BCAA 2ZNDA 1IQ5A 3KEVA 1RECA 4YI9A 1KQVA 2Y5IA 4HRHA 1M39A 1PALA 2GV5A 4C0JA 1H8BA 5HKZA 1K9KA 1M46A 1KWOB 1DMOA 2KI4C 4MSPA 2SASA 1K90D 1R6PA 2WCFA 1SBJA 3LL8B 1ZUZA 1QIVA 4OVNF 1W7IB 1ZOTB 2OS8B 1TN4A 5DKRA 5K89A 1NCYA 5I8NA 2HQWA 2K7CA 4CFQA 3NXAA 2FOTA 4CPVA 5JJGA 1CDPA 3A8RA 1GJYA 1K95A 4PDZA 1MQ1A 4L9MA 1Q80A 2PRUA 4AQIA 3JTDC 1GQMA 1DT7B 1NSHA 1H4BA 1C7VA 4PE1A 2I94A 1XVJA 1CFDA 3ICBA 3SG7A 4F0ZB 1X02A 4MVFA 2KI4B 1VRKA 3AAKA 5TNCA 3BOWB 1WDCC 1RJVA 2KDHA 5DKNA 2KBMA 1F70A 1CMFA 3K21A 1SL9A 1NYAA 1YX8A 2ZNEA 4CFRA 1KSMA 3TS5C 1WLMA 3ZNIA 2JRFA 1KCYA 2ZN9A 1U5IA 2Y1MA 2O60A 2L4IA 4ORBB 4ORAB 2ZFDA 1K96A 1UP5A 1AK8A 1YURA 1WLZA 3EK8A 3EVUA 3VRNA 1G4YR 4GPLB 1JFKA 1ZFSA 1IJ5A 1OMVA 1BF5A 1OMDA 1V1FA 2FCDA 1K9PA 1QLKA 2I18A 4UPGA 1J7OA 2LMVA 3JTDB 4YGEB 2EGDA 1SL7A 1G33A 1J7PA 4GUKA 2BECA 1J55A 3I5IC 2CT9A 3OP0A 1S5GY 2EC6C 4PHJA 4C0KA 1IGVA 2MLFC 1J1DA 2JWWA 1J7RA 3OB2B 3LK0A 1WRLA 1YRUB 2PVBA 2I2RE 1FF1A 1NCXA 4N1FA 3D10A 1Y0VH 2F33A 3KO0A 1JC2A 4IL1A 4C0LA 1KK7Y 2NLNA 4WRIA 1QXPA 3PN7C 2LE9B 2GGMA 4MRYA 3CLNA 4P5OE 3C1VA 1C07A 2LAPA 1RK9A 2F2OA 1BR4B 1DVIA 1ALWA 3DF0B 2KFHA 3DD4A 3FWBA 5I2QA 5HYDA 2BL0B 2LMTA 1CB1A 3IF7A 1QX5B 1SR6B 1NWDA 1PULA 3BYAA 1TCFA 2H61A 1SCVA 2K2FA 3DVKA 1EL4A 1CM1A 3EVRA 2K7BA 2LCPA 4MLWA 1IWQA 4P2YB 2KQYA 4A4BA 1KK8B 3BUNB 2MBXA 2H2KA 2SCPA 2L0PA 1SR6C 2K8MB 1TTXA 1UHIA 1YTZC 1MXEA 2WORA 1K9UA 1QTXA 3NSOA 3VRQA 1TNPA 3LLEA 4BY5A 2KNEA 2OTGC 2LV7A 2Y9YA 2MA2A 2LNKA 2M9GA 2PSRA 3SG2A 4WQ3A 3SG6A 1JWDA 1E8AA 1DF0B 1QVIZ 3BXKA 2WCBA 1OMRA 1NX3A 1CDMA 2QPTA 4USLA 4HRGA 4GNKB 1MHOA 3VGOA 4I5KA 1B8RA 4YRUA 4QJ5B 2L51A 1BOCA 4GGFA 2CTNA 1AP4A 2HPSA 4PE4A 2JXLA 2K61A 2BE4A 5ER5A 2HETA 2MAZA 3FS7A 4YGCB 1NP8A 2G9BA 4U8DA 2JT8A 1YUTA 1B9AA 1TNWA 2JTTA 1JF0A 1KK7Z 2MRDA 1ODBA 1IG5A 2NZ0A 1RFJA 2KAYA 4PE0A 4GAOA 1OOJA 1SW8A 3EKHA 1A03A 1WRKA 5AFPA 2NXQA 1BU3A 2L2EA 4MN0A 2LVIA 2M29A 1JF2A 3CZTX 3OHMB 2KYCA 1ZACA 2KI6D 3H4SE 1TNXA 5I2LA 2LP3A 3PATA 1KFUL 1FW4A 4M2OA 1JFJA 3BUXB 2KFGA 3I5FC 2GGZA 2E30A 2TN4A 3GOFA 2AMIA 5AEQA 1XFUO 3AAJA 1AVSA 1DGVA 1CKKA 2KFFA 1QIWA 1CLLA 2JU0A 2CCMA 5F6TA 4OKHA 1A75B 5CSFA 4E68A 1CFCA 4FQOA 2LVJA 1PSBA 3KHEA 4N5XA 5HKYA 2NCOA 2KBIA 4XJKB 2KOTA 3O78A 4JWQA 3VROA 1L2OB 1AHRA 1XFXO 1FBVA 2DOQA 3BUOB 1AJ5A 4JPZB 4OV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBN A;  1SL8 A;  3D0Y B;  4NQG A;  1YR5 A;  4DRW A;  1PRW A;  2LAN A;  3FIA A;  3TUY B;  1CDL A;  1MR8 A;  1KQM B;  2K7D A;  2Y9Z A;  1S6J A;  1S5G Z;  1XYD A;  4YGB B;  1CM4 A;  1MF8 B;  1QX7 A;  3EK4 A;  1KFX L;  1EJ3 A;  1TRF A;  2KYF A;  4MBE A;  3SG4 A;  2CBL A;  4D1E A;  5KU1 A;  3BUW B;  3A4U B;  2NCP A;  1BR1 B;  1QX2 A;  1DTL A;  1LA0 A;  2H61 C;  4HRE E;  1DJW A;  1MWN A;  2M1K B;  1PVB A;  1N2D A;  2LHI A;  2Q91 A;  3EVV A;  3IQQ A;  5CSI A;  1BJF A;  1KQM C;  1CTR A;  4FTG A;  5JOL A;  1F4Q A;  3O4Y A;  3WNX B;  1GGZ A;  3SIB A;  1QAT A;  4MZJ A;  3LK1 A;  1A75 A;  2PAS A;  4CLN A;  1M45 A;  1F8H A;  3GK4 X;  2RGI A;  4ZCV A;  5HLO A;  1XK4 A;  2LVK A;  2EC6 B;  3AKA A;  1IRJ A;  1HT9 A;  1QAS A;  4A4C A;  1SMG A;  1TOP A;  1DJZ A;  4I5L B;  5AAN A;  4HSZ A;  1LIN A;  3WHU B;  1JSA A;  5G08 A;  1L7Z A;  2ISD A;  2P6B B;  1DGU A;  1LKJ A;  2QAC A;  1QV1 A;  1IJ6 A;  5D7F A;  2L50 A;  2FCE A;  2V53 A;  4NDB A;  2Y1N A;  4QJ3 B;  4ORC B;  1UUR A;  5PAL A;  1TCO B;  1TIZ A;  1XFV O;  3CR5 X;  4YBH B;  5HLV A;  3TZ1 A;  1HQV A;  2B1U A;  3D0Y A;  2PAL A;  4YGA A;  1S36 A;  1OFC X;  1NUB A;  2LLT A;  1ALV A;  2M8U A;  3AKB A;  3I5F B;  2K2A A;  1S3P A;  3JVT B;  1A2X A;  2CXJ A;  1TNQ A;  3JVT C;  4XJK A;  2MLE C;  5ER4 X;  3PFV A;  3TS5 B;  1CLM A;  4R1E A;  1ZMZ A;  2LHL A;  1MUX A;  1F55 A;  1FPW A;  4NDD A;  2M1U A;  4PCW A;  5AXI A;  2KAV A;  1JBA A;  1YUS A;  1KK8 C;  1UHK A;  1Y1A A;  2KAX A;  3F45 A;  1YUU A;  3OB1 B;  3PM8 A;  4M2Q A;  1LXF C;  3PLF B;  1OE9 B;  4I5N B;  5KSZ A;  3CR4 X;  2LMU A;  1LVC D;  3TDI A;  5DKQ A;  4NDC A;  2Q4U A;  4GGF C;  3HX4 A;  2IS9 A;  1B4C A;  1S6C A;  2JUL A;  2JOJ A;  4OR9 B;  1CMG A;  2KGR A;  1NCZ A;  1B7T Y;  1SKT A;  3PN7 B;  3RLZ A;  1XFZ O;  2JT3 A;  1CNP A;  1SRA A;  1JUO A;  3CR2 A;  1W7J B;  2LP2 A;  1OSA A;  3MSE B;  2F3Y A;  1SNL A;  1CDN A;  1YVH A;  2E6W A;  2LC5 A;  3SG3 A;  3SIA A;  1DJI A;  1B47 A;  1XA5 A;  2JNX A;  1PK0 D;  2LVV A;  1DJG A;  3I5H C;  3KF9 A;  1DJH A;  3BQ3 A;  2BBM A;  3NSI A;  4GBA A;  2A4J A;  4GGN A;  3WHT B;  2JZI A;  1IH0 A;  2ZRT A;  4DUQ A;  2JNF A;  1BLQ A;  1OZO A;  4DIR A;  2CNP A;  1OQP A;  2M7N A;  2JXC A;  2F3Z A;  3I5G C;  2MJW B;  1A4P A;  1UUS A;  3SG5 A;  3O6B A;  5AER A;  4MRX A;  1SK6 D;  1OZS A;  2O5G A;  2AAO A;  3I5H B;  4MEW A;  3CTN A;  1G8I A;  4DCK A;  1FI6 A;  1DJY A;  5IBW A;  1M31 A;  1BOD A;  1RWY A;  3M0W A;  3NSK A;  1QS7 A;  1A29 A;  2LUX A;  1KSO A;  1YVL A;  1Y1U A;  1CFF A;  2F2P A;  4CID A;  3CS1 A;  1XK4 C;  1EG4 A;  3LCP C;  4AQJ A;  1F54 A;  1C7W A;  2M7L A;  1R2U A;  3EK7 A;  1WY9 A;  3OX5 A;  1N65 A;  2ZRS A;  3DF0 A;  4ETO A;  4YI8 A;  2KHN A;  2JC2 A;  5I2O A;  1B8C A;  1S1E A;  2OPO A;  1SCM C;  1UWO A;  3I5G B;  2M49 B;  3VRP A;  4PHM A;  3WXA A;  1KFX S;  2VRG A;  1RTP 1;  3ZWH A;  2WOS A;  1NX0 A;  2Y4Q A;  1DF0 A;  1M63 B;  1S26 D;  3HCM A;  1AJ4 A;  3BOW A;  4BY4 A;  1KFU S;  4MZL A;  4TNC A;  1EXR A;  1EH2 A;  1PVA A;  1XFW O;  3FWC A;  4Q04 A;  2BCB A;  1K8U A;  1UHH A;  2L5X B;  1EG3 A;  3PSR A;  5D69 A;  4ZCU A;  1NX2 A;  2G2B A;  3GK2 A;  3NSL A;  1IQ3 A;  4YGD B;  2MHH A;  3BUM B;  2LM5 A;  1WDC B;  1J1E A;  2EHB A;  1UHN A;  3QRX A;  2L4H A;  2ZKM X;  5HKW A;  4PHN A;  5FYX A;  2FJU B;  2ZN8 A;  2D8N A;  1K2H A;  2M3W A;  2WND A;  2BE6 A;  2LUC A;  4JQ0 D;  1SPY A;  2BCX A;  1BMO A;  2LLS A;  1LA3 A;  3DVE A;  4I5J A;  4PHK A;  1PSR A;  3DVJ A;  4MZK A;  5BPJ A;  4N1G A;  1FI5 A;  3EKJ A;  3TDZ A;  2OS8 C;  3GK1 A;  3IQO A;  2K7O A;  1U5I B;  4PE7 A;  2COL B;  2KSP A;  1J7Q A;  1B1G A;  2KGB C;  5CSN A;  2BKH B;  4ICB A;  1IKU A;  5CSJ A;  1K94 A;  1KWO C;  1NIW A;  1F71 A;  2M97 A;  5CPV A;  1DJX A;  1QV0 A;  2JQ6 A;  1F4O A;  4OCI A;  1SYM A;  2R2I A;  1SCM B;  1XFY O;  1BG1 A;  2HQ8 A;  1QVI Y;  2BL0 C;  2KQ6 A;  3VRR A;  1YRT B;  1XO5 A;  1S6I A;  4GFT A;  1D1O A;  2BKI B;  5KTY A;  3E3R A;  1CFP A;  3SJS A;  3KPX A;  1BT6 A;  2AUC A;  2M0R A;  2WC8 A;  5J3X A;  1QJT A;  4AOM A;  4XYN A;  3DVM A;  1V1G A;  3O2P A;  1NPQ A;  3TUY C;  3OX6 A;  2PMY A;  2OTG B;  4WQ2 A;  5B8I B;  3CGA A;  4DS7 A;  1Y1X A;  1L2O C;  2WCE A;  3PAL A;  3I5I B;  4M2P A;  1MXL C;  4QJ4 B;  1YX7 A;  4PAL A;  1UHJ A;  2KI6 C;  1Y6W A;  2K0J A;  2JT0 A;  5GQQ C;  1QLS A;  2I7A A;  1GGW A;  2HF5 A;  2F8P A;  2L98 A;  1SY9 A;  1NX1 A;  1RRO A;  1B8L A;  3RM1 A;  2JTZ A;  1B7T Z;  2JPT A;  1WRZ A;  3CWG A;  1CLB A;  1AUI B;  1K93 D;  3TDU A;  2LLU A;  1N0Y A;  2BCA A;  2ZND A;  1IQ5 A;  3KEV A;  1REC A;  4YI9 A;  1KQV A;  2Y5I A;  4HRH A;  1M39 A;  1PAL A;  2GV5 A;  4C0J A;  1H8B A;  5HKZ A;  1K9K A;  1M46 A;  1KWO B;  1DMO A;  2KI4 C;  4MSP A;  2SAS A;  1K90 D;  1R6P A;  2WCF A;  1SBJ A;  3LL8 B;  1ZUZ A;  1QIV A;  4OVN F;  1W7I B;  1ZOT B;  2OS8 B;  1TN4 A;  5DKR A;  5K89 A;  1NCY A;  5I8N A;  2HQW A;  2K7C A;  4CFQ A;  3NXA A;  2FOT A;  4CPV A;  5JJG A;  1CDP A;  3A8R A;  1GJY A;  1K95 A;  4PDZ A;  1MQ1 A;  4L9M A;  1Q80 A;  2PRU A;  4AQI A;  3JTD C;  1GQM A;  1DT7 B;  1NSH A;  1H4B A;  1C7V A;  4PE1 A;  2I94 A;  1XVJ A;  1CFD A;  3ICB A;  3SG7 A;  4F0Z B;  1X02 A;  4MVF A;  2KI4 B;  1VRK A;  3AAK A;  5TNC A;  3BOW B;  1WDC C;  1RJV A;  2KDH A;  5DKN A;  2KBM A;  1F70 A;  1CMF A;  3K21 A;  1SL9 A;  1NYA A;  1YX8 A;  2ZNE A;  4CFR A;  1KSM A;  3TS5 C;  1WLM A;  3ZNI A;  2JRF A;  1KCY A;  2ZN9 A;  1U5I A;  2Y1M A;  2O60 A;  2L4I A;  4ORB B;  4ORA B;  2ZFD A;  1K96 A;  1UP5 A;  1AK8 A;  1YUR A;  1WLZ A;  3EK8 A;  3EVU A;  3VRN A;  1G4Y R;  4GPL B;  1JFK A;  1ZFS A;  1IJ5 A;  1OMV A;  1BF5 A;  1OMD A;  1V1F A;  2FCD A;  1K9P A;  1QLK A;  2I18 A;  4UPG A;  1J7O A;  2LMV A;  3JTD B;  4YGE B;  2EGD A;  1SL7 A;  1G33 A;  1J7P A;  4GUK A;  2BEC A;  1J55 A;  3I5I C;  2CT9 A;  3OP0 A;  1S5G Y;  2EC6 C;  4PHJ A;  4C0K A;  1IGV A;  2MLF C;  1J1D A;  2JWW A;  1J7R A;  3OB2 B;  3LK0 A;  1WRL A;  1YRU B;  2PVB A;  2I2R E;  1FF1 A;  1NCX A;  4N1F A;  3D10 A;  1Y0V H;  2F33 A;  3KO0 A;  1JC2 A;  4IL1 A;  4C0L A;  1KK7 Y;  2NLN A;  4WRI A;  1QXP A;  3PN7 C;  2LE9 B;  2GGM A;  4MRY A;  3CLN A;  4P5O E;  3C1V A;  1C07 A;  2LAP A;  1RK9 A;  2F2O A;  1BR4 B;  1DVI A;  1ALW A;  3DF0 B;  2KFH A;  3DD4 A;  3FWB A;  5I2Q A;  5HYD A;  2BL0 B;  2LMT A;  1CB1 A;  3IF7 A;  1QX5 B;  1SR6 B;  1NWD A;  1PUL A;  3BYA A;  1TCF A;  2H61 A;  1SCV A;  2K2F A;  3DVK A;  1EL4 A;  1CM1 A;  3EVR A;  2K7B A;  2LCP A;  4MLW A;  1IWQ A;  4P2Y B;  2KQY A;  4A4B A;  1KK8 B;  3BUN B;  2MBX A;  2H2K A;  2SCP A;  2L0P A;  1SR6 C;  2K8M B;  1TTX A;  1UHI A;  1YTZ C;  1MXE A;  2WOR A;  1K9U A;  1QTX A;  3NSO A;  3VRQ A;  1TNP A;  3LLE A;  4BY5 A;  2KNE A;  2OTG C;  2LV7 A;  2Y9Y A;  2MA2 A;  2LNK A;  2M9G A;  2PSR A;  3SG2 A;  4WQ3 A;  3SG6 A;  1JWD A;  1E8A A;  1DF0 B;  1QVI Z;  3BXK A;  2WCB A;  1OMR A;  1NX3 A;  1CDM A;  2QPT A;  4USL A;  4HRG A;  4GNK B;  1MHO A;  3VGO A;  4I5K A;  1B8R A;  4YRU A;  4QJ5 B;  2L51 A;  1BOC A;  4GGF A;  2CTN A;  1AP4 A;  2HPS A;  4PE4 A;  2JXL A;  2K61 A;  2BE4 A;  5ER5 A;  2HET A;  2MAZ A;  3FS7 A;  4YGC B;  1NP8 A;  2G9B A;  4U8D A;  2JT8 A;  1YUT A;  1B9A A;  1TNW A;  2JTT A;  1JF0 A;  1KK7 Z;  2MRD A;  1ODB A;  1IG5 A;  2NZ0 A;  1RFJ A;  2KAY A;  4PE0 A;  4GAO A;  1OOJ A;  1SW8 A;  3EKH A;  1A03 A;  1WRK A;  5AFP A;  2NXQ A;  1BU3 A;  2L2E A;  4MN0 A;  2LVI A;  2M29 A;  1JF2 A;  3CZT X;  3OHM B;  2KYC A;  1ZAC A;  2KI6 D;  3H4S E;  1TNX A;  5I2L A;  2LP3 A;  3PAT A;  1KFU L;  1FW4 A;  4M2O A;  1JFJ A;  3BUX B;  2KFG A;  3I5F C;  2GGZ A;  2E30 A;  2TN4 A;  3GOF A;  2AMI A;  5AEQ A;  1XFU O;  3AAJ A;  1AVS A;  1DGV A;  1CKK A;  2KFF A;  1QIW A;  1CLL A;  2JU0 A;  2CCM A;  5F6T A;  4OKH A;  1A75 B;  5CSF A;  4E68 A;  1CFC A;  4FQO A;  2LVJ A;  1PSB A;  3KHE A;  4N5X A;  5HKY A;  2NCO A;  2KBI A;  4XJK B;  2KOT A;  3O78 A;  4JWQ A;  3VRO A;  1L2O B;  1AHR A;  1XFX O;  1FBV A;  2DOQ A;  3BUO B;  1AJ5 A;  4JPZ B;  4OV2 A; 
#chains in the Genus database with same CATH topology
 1SL8 A;  1HGV A;  1YR5 A;  4DRW A;  4GT1 A;  2LAN A;  3TUY B;  1LT9 A;  3L74 J;  3L70 E;  1TU3 F;  1OVU A;  2Y9Z A;  2QEO A;  1FDO A;  2FYN C;  1KFX L;  2ZJS E;  5TIS H;  1S72 P;  2K9J A;  1BR1 B;  1LA0 A;  4HRE E;  5DJT B;  1DJW A;  1KQM C;  1U7M A;  3ABV C;  1F4Q A;  3O4Y A;  3SIB A;  4MZJ A;  1ZN5 A;  1HVV A;  5AW9 B;  1UII A;  1R5S A;  1F8H A;  1H89 A;  2RN0 A;  2HYN A;  3CXH D;  5AVX B;  2WSF H;  5KAF E;  4XE5 B;  5HLO A;  2ZT9 C;  1IRJ A;  1DJZ A;  3WHU B;  1M7L A;  1L7Z A;  2ISD A;  2IBZ D;  1LKJ A;  2W27 A;  2QAC A;  2CPS A;  3IR9 A;  1IJ6 A;  5D7F A;  3USS A;  4NDB A;  4QJ3 B;  3HE4 A;  3FWN A;  3H1J G;  1TCO B;  4YBH B;  3CR5 X;  1IFN A;  3HD7 D;  1AVO A;  2YMK A;  2WVR A;  3BFB A;  1S36 A;  1SS1 A;  2M8U A;  1ALV A;  2L5Y A;  1S3P A;  2VRS A;  3L73 D;  3CYZ A;  1GL2 A;  3BCC J;  3TS5 B;  1CLM A;  1GZL A;  4NDD A;  1AQ5 A;  2M1U A;  3O4X A;  4PCW A;  2KAV A;  1H88 A;  1NTM E;  5CJ4 A;  3FE9 A;  2GA1 A;  4IL6 E;  3OB1 B;  2WCM A;  1VQ6 P;  4C7N B;  1JY2 O;  1LVC D;  3TDI A;  2XKM A;  2JUL A;  4BXL A;  3CC4 P;  1CMG A;  3PN7 B;  1SKT A;  3CWB J;  1KYO D;  1XFZ O;  1AVY A;  5GTH E;  2I8D A;  2LP2 A;  1NTK J;  3RBZ A;  2G3A A;  1QLE D;  3C1L A;  3D74 A;  4H44 C;  2E5Y A;  2Q1K A;  2LC5 A;  1W2B O;  3SIA A;  1DJI A;  3HD7 B;  1PGJ A;  1L0N K;  2JNX A;  4WY4 B;  3NSI A;  1JCD A;  3BQ3 A;  2BBM A;  1DD3 A;  2FYN B;  4GBA A;  3WHT B;  3W67 A;  5KLV K;  1IH0 A;  2ZRT A;  4DUQ A;  1BE3 E;  2JNF A;  4UB8 H;  1BLQ A;  1ZME C;  2JXC A;  1RQU A;  1A4P A;  4IFM A;  1EDL A;  1EZV E;  2P58 A;  2AAO A;  1N7S C;  4MEW A;  4F7F A;  2QEX P;  3HE5 B;  1PIX A;  1QVF O;  1M31 A;  1BOD A;  1FDM A;  5AW6 B;  4OGQ C;  1A29 A;  2LUX A;  1E79 H;  1YVL A;  1Y1U A;  3B6X A;  1OMI A;  4IL6 X;  2R32 A;  3T97 A;  1A02 J;  2K3R A;  3M0A A;  1JY3 N;  1VQ5 P;  4ETO A;  3C8V A;  2BAP A;  3TGU E;  2FYU D;  1S1E A;  2KP8 A;  1SCM C;  1OOH A;  5EFW B;  1KFX S;  3ZWH A;  2WOS A;  3R1V A;  3HCM A;  3TK1 A;  4BY4 A;  4PV1 C;  1KFU S;  3H1I E;  4TNC A;  1EH2 A;  1RE3 C;  5D69 A;  2L5X B;  3PSR A;  4ZCU A;  3S0D A;  2A45 H;  1NX2 A;  2G2B A;  3D73 A;  2MHH A;  4ASW A;  1MZ9 A;  3D70 A;  3CME P;  3AEB C;  2LM5 A;  1J1E A;  1OW4 A;  3L4A A;  2KLE A;  3QRX A;  1SQQ J;  2FJU B;  3L70 D;  1RH5 B;  1BMO A;  2LLS A;  3L37 A;  2OAR A;  4I7Z C;  2N9B A;  1PSR A;  1C3Y A;  4W80 A;  3L71 D;  5E79 H;  4N1G A;  4GDO A;  3MZW B;  3TDZ A;  1SQX J;  1YJN P;  2K7O A;  4PE7 A;  2MJZ A;  4XA4 A;  4L74 A;  1YYC A;  3AEC C;  2BKH B;  4ICB A;  3G6E P;  2M97 A;  1BDD A;  1DJX A;  2B88 A;  1JY2 P;  1JMB A;  2IPP A;  3KZI H;  1JY2 N;  3GF7 A;  1XFY O;  1M90 Q;  2AEM A;  1SFC D;  2KOG A;  2BL0 C;  2KQ6 A;  1YRT B;  4GFT A;  4IFF A;  3SJS A;  3D6Y A;  2KS1 A;  1BT6 A;  2OYH C;  1DD4 A;  1QJT A;  1NKZ B;  2JKV A;  2A45 G;  3Q2Y A;  4ZMD A;  5CCG A;  5APW A;  1SSE B;  2K88 A;  3OX6 A;  3B88 A;  5KLV J;  1LTG C;  3CXH I;  2J5U A;  3FGA D;  3CGA A;  1G1I A;  2KI7 B;  5APT A;  1P84 H;  3V5B A;  3R4Y A;  2AEJ A;  1YX7 A;  1Y6W A;  2JT0 A;  2WT7 A;  1OW6 A;  1T3J A;  1GGW A;  1SY9 A;  4DJG A;  2OYH B;  1B8L A;  1B7T Z;  3CWG A;  2C0X A;  1HTL C;  3CC2 P;  2LLU A;  2ZAE B;  1IQ5 A;  4HRH A;  3WU2 E;  1M39 A;  5KKZ B;  4HJG H;  1ZR4 A;  5HKZ A;  1CI6 A;  1URQ C;  3PTZ A;  1M46 A;  1CI6 B;  1HGZ A;  1DMO A;  2KI4 C;  1KIL E;  4INW A;  4OVN F;  1ZOT B;  5DKR A;  4EDF A;  1URQ D;  1CDP A;  1GJY A;  1K95 A;  3V2R A;  3B5N D;  1MQ1 A;  1LTJ A;  4PD4 I;  1USD A;  2PRU A;  5FI2 A;  1PP9 E;  4N78 D;  1S3J A;  2KK7 A;  4C46 A;  1UIX A;  1NTM G;  2I94 A;  4F0Z B;  2WT7 B;  2KDH A;  1SL9 A;  3AE6 C;  2BNX A;  3NTN A;  3A7O A;  1SQQ K;  3L71 G;  3PHL A;  4ORB B;  3I56 P;  1NKN A;  1U7J A;  3OA7 A;  1YUR A;  3EVU A;  1M1J B;  1YHQ P;  3VRN A;  1IJD B;  1JFK A;  3NHT A;  1IJ5 A;  2QM8 A;  3GG2 A;  1BF5 A;  1KMI Z;  1NHL A;  2QVA A;  3CZ1 A;  1J7O A;  1GK6 A;  2EGD A;  2Q7C A;  3RK3 E;  1J7P A;  1PPJ G;  2CT9 A;  2IYP A;  2EC6 C;  4PHJ A;  5CMZ A;  1J7R A;  3DYE A;  3SFE C;  1BE3 G;  1NTZ E;  1WRL A;  2OTK E;  1FF1 A;  1NCX A;  4ZKU A;  1Y0V H;  2FYU E;  3RL0 C;  4R4L A;  3CDN A;  4IL1 A;  1EZV G;  2NLN A;  1HWT C;  2BEZ F;  1QXP A;  3S0A A;  2LE9 B;  2GGM A;  3CLN A;  3C1V A;  1RK9 A;  3EFF K;  1DEL A;  1ALW A;  3DF0 B;  2WSC J;  2KFH A;  1FZF A;  1SR6 B;  3L75 E;  1TCF A;  2K2F A;  1KZU B;  2OQQ A;  1FZG A;  2H8V A;  3L71 E;  1CM1 A;  5DIC A;  1N2D C;  3H1H G;  4MLW A;  3D77 A;  3GHG B;  4P2Y B;  1KK8 B;  5GTI E;  2MKV A;  4DZO A;  2QA4 P;  3PRJ A;  2K8M B;  3TYY A;  2BAS A;  2WOR A;  1K9U A;  4BY5 A;  2SPZ A;  2NPS C;  2Y9Y A;  2MA2 A;  1KYO H;  3LW5 J;  1T2K D;  2LNK A;  2M9G A;  3SG6 A;  3SG2 A;  3S0G A;  1KYO I;  3BXK A;  1NU1 K;  1OMR A;  1CDM A;  4OWF A;  2O3J A;  4EOT A;  4I5K A;  1S9K E;  2O1J A;  3CLQ A;  4PD4 E;  4XFJ A;  1GL2 B;  2WQY C;  1RF1 B;  4YGC B;  1NP8 A;  1QWV A;  2G9B A;  3FX0 A;  1PGO A;  1B9A A;  2JTT A;  1NAY A;  4PV1 D;  1A03 A;  3EKH A;  1WRK A;  2NXQ A;  5TIS E;  1LT1 A;  3L47 A;  3N7N A;  1ZAC A;  2GUV A;  3H1H E;  1RF1 C;  2OYI A;  2LP3 A;  1HJ0 A;  2KLU A;  1FW4 A;  4M2O A;  2HOD A;  3BUX B;  4U3F G;  2KFG A;  2WPV B;  3AE4 C;  2P2U A;  2N9Y B;  1SQP D;  2E30 A;  2TN4 A;  1XFU O;  1CKK A;  1QIW A;  1EDJ A;  5CSF A;  1JNM A;  4FQO A;  4GOF A;  3CCR P;  1RHZ B;  1OOI X;  3H1K E;  4XJK B;  3RK2 B;  4JWQ A;  3CC7 P;  2CPB A;  1AHR A;  2BBN A;  4NQG A;  4HH2 A;  1OOF A;  1KQM B;  1EZV I;  2K7D A;  2G8Y A;  2XND H;  1S5G Z;  1IFI A;  1CM4 A;  1BGY D;  1EXI A;  1EJ3 A;  3VB1 A;  3SG4 A;  5KU1 A;  2H43 A;  4GIF A;  2NCP A;  1DTL A;  2H61 C;  1PP9 D;  1EC5 A;  3CI9 A;  5AVW B;  1BJF A;  4FTG A;  5JOL A;  2E42 A;  2C9L Y;  2E76 D;  1WMK A;  2WC5 A;  1GGZ A;  3RL0 B;  2PAS A;  1LP1 A;  3JSV C;  3FXE A;  2BCC D;  2LVK A;  2EC6 B;  3KYQ A;  1NTZ J;  1QAS A;  1TOP A;  4HSZ A;  5G08 A;  1NTK K;  2IBZ G;  3SS5 A;  2L50 A;  2V53 A;  2JP3 A;  2Y1N A;  4ORC B;  1XFV O;  1TIZ A;  1XFR A;  3S1K A;  5K5G B;  2B1U A;  3D0Y A;  2PAL A;  2W83 C;  3CX5 D;  1XTG B;  1NUB A;  2W90 A;  1NU1 J;  3NXS A;  3I5F B;  1K04 A;  3HUS B;  1KN7 A;  2CK3 H;  1LTJ C;  1KB9 E;  1TNQ A;  1SQX D;  1GW4 A;  1PP9 G;  3L71 J;  3PJI A;  1BCC E;  1F55 A;  1FPW A;  2M3B A;  1KK8 C;  1RF0 A;  1UHK A;  1NOH A;  5KAI H;  3PLF B;  1GMJ A;  1OE9 B;  2IZ0 A;  1NTK D;  2QJK C;  2QJY B;  2E76 B;  2E75 B;  2IFM A;  1DQE A;  1G2C B;  4GGF C;  2ZYA A;  3HX4 A;  1B4C A;  1DEB A;  1ORG A;  1N7L A;  4OR9 B;  3I5C A;  1NCZ A;  1B7T Y;  1S4X A;  1AFO A;  1YQ3 C;  2QEV A;  4H13 D;  1CNP A;  3OGN A;  1SRA A;  1JUO A;  3CR2 A;  3F89 A;  3SS4 A;  5B5E E;  3PJS K;  1PPJ E;  3CX5 I;  1CDN A;  1W5C E;  2E6W A;  5B66 E;  1RF1 A;  2WSF J;  1XA5 A;  3VN0 A;  1PK0 D;  1NTZ G;  2LVV A;  5APY A;  3I5H C;  4PD4 H;  2FYU G;  1OZO A;  3SFD C;  2M7N A;  1NAF A;  3EFG A;  3MUD A;  2F3Z A;  1BCC G;  2MJW B;  3O6B A;  2QM7 A;  1NJI Q;  5AW2 B;  1M1J C;  1BGY G;  1G8I A;  5APQ A;  5IBW A;  1J1D B;  3L75 G;  2P67 A;  1JOC A;  1YTZ I;  1J2J B;  1NTM D;  3O6Q A;  3RGU A;  2I1K A;  4CID A;  2Z4E A;  3CWB E;  3H1I D;  2XU6 A;  3H1K J;  3M9H A;  1EG4 A;  4L76 A;  3OJA B;  2OYO A;  3I55 P;  3EK7 A;  1WY9 A;  3OX5 A;  4KHX A;  3B87 A;  3DF0 A;  1IFM A;  2JC2 A;  2ZYG A;  1EQ7 A;  1MKM A;  2IBZ I;  1SQQ D;  1UWO A;  3VRP A;  5KAI E;  3G9R A;  2WTY A;  2VRG A;  2KIK A;  5AVT B;  1M63 B;  1S26 D;  1JY3 P;  2RKL A;  1Q90 D;  3A5T A;  4JBZ A;  1QL1 A;  1XFW O;  2K9Y A;  1K8U A;  1EG3 A;  3B71 A;  3CCU P;  3NSL A;  1LJ2 A;  4I7Z B;  2M8R A;  1BGY E;  1JUN A;  1UHN A;  1FS0 E;  3EWK A;  4PHN A;  1EDI A;  2WWW A;  1EZV D;  1SPY A;  3QME A;  1LA3 A;  3DVE A;  4U3F E;  3CXH H;  1YI2 P;  1FI5 A;  2M0B A;  3EKJ A;  3IQO A;  2AEF A;  3L75 D;  2KSP A;  1B1G A;  5CSN A;  2PRR A;  2R5D A;  3B5N C;  5CSJ A;  1DEK A;  3C9I A;  4OCI A;  1SYM A;  2R2I A;  1SCM B;  1FE6 A;  2XZR A;  3H1K G;  5KLV E;  1SQP E;  1LTJ B;  1JM0 A;  2QRX A;  1S6I A;  2BKI B;  5KTY A;  3VMA A;  1YIJ P;  3KPX A;  1NTM J;  3H1H D;  3IVT A;  1DIP A;  3H1J J;  3RK3 C;  1Q2N A;  1TWO A;  4M3L A;  4RJT A;  3O2P A;  4AYC A;  5KLI B;  1RY3 A;  1NYH A;  2PMY A;  4W7Y A;  2P71 A;  4WQ2 A;  5B8I B;  1Y1X A;  1K73 Q;  1L2O C;  3MD0 A;  1FZA A;  1N7S B;  1IFP A;  1NGM B;  1LS8 A;  1MXL C;  3EG5 B;  2KI6 C;  2L5G B;  2QJK B;  1URQ A;  4EIJ A;  3CWB D;  2F8P A;  2L98 A;  1WRZ A;  3D76 A;  1AUI B;  3TDU A;  3HD7 C;  1N0Y A;  2ZND A;  1REC A;  3AE9 C;  2IBZ E;  3HUS C;  1KQV A;  1P84 E;  3PLN A;  1SQP G;  3ZDM A;  1PAL A;  1K9K A;  3WU2 H;  1KWO B;  4MSP A;  1OIP A;  2YNY A;  5APX A;  3AE5 C;  2WCF A;  3PH0 A;  3LL8 B;  1ZUZ A;  2WIT A;  1T2K C;  1TN4 A;  5K89 A;  2B87 A;  5AW4 B;  3R72 A;  4CFQ A;  3A8R A;  3E7K A;  3B4S A;  1VQ9 P;  2YXR B;  1DT7 B;  1D7M A;  1LTS C;  4YTP C;  1C7V A;  4PE1 A;  3RZS A;  4K35 A;  1XVJ A;  1CFD A;  3ICB A;  1X02 A;  4MVF A;  3AAK A;  1CMF A;  2ZNE A;  4OGQ B;  3TS5 C;  1KCY A;  1OXZ A;  4L75 A;  1GD2 E;  1U5I A;  1NH4 A;  1L4A C;  4WWI A;  1TUZ A;  4ORA B;  2QEH A;  3IAO A;  1Y8A A;  1Q82 Q;  3IN6 A;  1OMV A;  5AVU B;  1KD1 Q;  1FZB A;  4UPG A;  4HKZ H;  2I18 A;  2IDB A;  1SL7 A;  1G33 A;  2BEC A;  1J55 A;  3I5I C;  4C0K A;  1JTH A;  3OB2 B;  2Q3I A;  3RK3 D;  1BE3 J;  1MUU A;  1YRU B;  2PAJ A;  4N1F A;  3L74 D;  3AE7 C;  1GU5 A;  4I6M C;  3KO0 A;  1JC2 A;  2UWJ E;  3VYI A;  1KK7 Y;  4WRI A;  3PN7 C;  4D6T D;  4MRY A;  1C07 A;  2LAP A;  1VF5 D;  3FWB A;  4GOD A;  5HYD A;  2O1K A;  3IF7 A;  1NWD A;  3BYA A;  4Y99 B;  2XV5 A;  4AUW A;  3G71 P;  1H0T A;  1HF9 A;  3DVK A;  3GHG C;  3EVR A;  1ZOY C;  1IWQ A;  3CWB G;  3EQ2 A;  2KQY A;  3AEG C;  3NFQ A;  2H2K A;  2SCP A;  2L0P A;  1SR6 C;  2FXO A;  2R44 A;  4R4M A;  1C3Z A;  1SQX G;  1KTM A;  1AA0 A;  1PGQ A;  3VRQ A;  3LLE A;  3Q5S A;  1L4A B;  2W6A A;  1FZC A;  2YO2 A;  1G2C A;  2PSR A;  1VQM P;  1E8A A;  1DF0 B;  2DW3 A;  2P7J A;  1L0L G;  3G4S P;  2QJP C;  2QPT A;  4USL A;  4HRG A;  4GNK B;  3UNW A;  1MHO A;  4PJ0 H;  2GM4 A;  5EL2 A;  2LXB A;  3IF4 A;  2OYI C;  2L51 A;  3B8E B;  1BOC A;  4OZD A;  3H1I J;  1AP4 A;  2NPS B;  2HPS A;  4PE4 A;  2BE4 A;  5ER5 A;  5AW0 B;  2HET A;  2JPO A;  3HRN A;  3W68 A;  1KK7 Z;  5B66 H;  2KAY A;  4PE0 A;  1YBK A;  3V4Q A;  4GAO A;  1OOJ A;  2N1T A;  1J1E C;  1BU3 A;  2L2E A;  1LTI C;  2LVI A;  2M29 A;  3CZT X;  3OW2 O;  1T14 A;  3OHM B;  2KYC A;  2JEE A;  1TNX A;  2K60 A;  3S0E A;  1BSH A;  2PQL A;  2KSE A;  2GGZ A;  1T8Z A;  1N73 B;  3RL0 g;  1AJY A;  4Y28 J;  1HBW A;  3AAJ A;  1BCC D;  2LXC B;  1L0N G;  4INX A;  2HR3 A;  1NTZ K;  4E68 A;  3VTP C;  2LVJ A;  5KLV G;  3KHE A;  4N5X A;  5HKY A;  4DOJ A;  3T97 B;  3BFA A;  3O78 A;  4L73 A;  4PD4 D;  1L2O B;  1VQO P;  4U3F D;  1XTC C;  1JEK A;  2NPS D;  3L74 G;  3H32 B;  1PRW A;  5KLI C;  1RE4 A;  5KKZ C;  4YGB B;  1S5L H;  1MF8 B;  1QX7 A;  3EK4 A;  1CSB A;  5BVZ A;  1TRF A;  2KYF A;  1KFM A;  1CW5 A;  3CZ2 A;  1OOG A;  3BUW B;  4H13 C;  1KQF B;  4N78 E;  2A06 E;  1N2D A;  1ZRT D;  1OVV A;  1CTR A;  3WNX B;  3LK1 A;  1A75 A;  4WBA A;  5TJH A;  1IK9 A;  1M45 A;  1VQK P;  4ZCV A;  3HD7 A;  1XK4 A;  3AKA A;  5BU5 A;  5AW5 B;  4A4C A;  3HUS A;  1SMG A;  4I5L B;  5AAN A;  1Z2C B;  1LIN A;  2ZXE B;  2N1T D;  1RF0 C;  2IYO A;  2WMM A;  2FCE A;  1TUJ A;  1UUR A;  5PAL A;  1T3U A;  5HLV A;  2IX7 C;  4C7R A;  1HQV A;  4H0L C;  3L70 J;  3L74 E;  2LLT A;  3JVT B;  2CXJ A;  3JVT C;  4C7N A;  3P8C D;  1R8E A;  5GTI H;  5ER4 X;  1KIL B;  4R1E A;  2Z5H A;  2LHL A;  1MUX A;  4H0L B;  1FBM A;  1SLQ A;  2V4H A;  2AXC A;  1YUS A;  4N3Y B;  1Y1A A;  2KAX A;  3FE6 A;  5D3O A;  2A06 G;  3CX5 H;  1LXF C;  3CR4 X;  2IZ1 A;  4D6T J;  2OTJ P;  5DKQ A;  2LKM A;  3QWO C;  2E76 C;  1N7S D;  1SVF A;  2JOJ A;  1P28 A;  2ZVN B;  1KB9 H;  1FJK A;  2KGR A;  3GF3 A;  2AXT H;  5KJ7 C;  2JT3 A;  3MUD C;  1IO4 A;  1QL2 A;  3AE8 C;  1GK4 A;  1OSA A;  3MSE B;  1FC2 C;  3D71 A;  2F3Y A;  3L72 J;  1S9K D;  3M06 A;  3OBV A;  4WB4 A;  1DX7 A;  4H13 B;  1B47 A;  4U7J A;  3KF9 A;  4A7P A;  4PV1 B;  2JZI A;  3CCE P;  5FI6 A;  2XDJ A;  3M9Q A;  2CNP A;  3H1H J;  4AQR D;  1UUS A;  2W6J H;  3CAB A;  1OZS A;  2O5G A;  1S5L X;  2Z5I A;  3I5H B;  3LID A;  2QSI A;  4DCK A;  1X9V A;  1GM0 A;  1PZQ A;  4BRY A;  1IIO A;  3KQG A;  1SFC A;  1QS7 A;  3L4F A;  3IFM A;  3H32 A;  5KAF H;  1CFF A;  2Y0C A;  2WSC H;  3CS1 A;  5APU A;  3Q5R A;  1SQX E;  3LCP C;  1C7W A;  4JKT A;  4DT0 A;  1M1J A;  4IJ7 A;  3MIW A;  2H8P D;  2QIW A;  2E75 C;  2H7H A;  3S0B A;  5I2O A;  1IZN B;  1B8C A;  2M49 B;  1L0L E;  3WXA A;  3ITK A;  1RTP 1;  3CCV P;  2OGU A;  2Y4Q A;  1KFN A;  1AJ4 A;  3BOW A;  1N73 A;  2AXT E;  3P32 A;  4NPD A;  1EXR A;  2HLO A;  1NTM K;  2D2C C;  3A3Y B;  4RO0 A;  1JTH B;  2HPC A;  3CXH E;  4H44 B;  3GK2 A;  5AW8 B;  1KOR A;  1IQ3 A;  4YGD B;  3N7H A;  1BE3 D;  2FFD A;  3BUM B;  2W6B A;  1WDC B;  2EHB A;  1SQQ G;  2ZT9 D;  2ZN8 A;  2D8N A;  1K2H A;  1T6A A;  3A0H E;  3KPE A;  2WND A;  2BE6 A;  3NHI A;  4JQ0 D;  1ZV8 A;  2BCX A;  3CMA P;  2K1A A;  3DVJ A;  1SQV K;  2OS8 C;  3GK1 A;  1U5I B;  2COL B;  4JYB A;  1HH0 A;  1L0N E;  1VQP P;  1K94 A;  1F71 A;  1L0N D;  3BAS A;  1BSN A;  1FZC B;  2WPS A;  3QH9 A;  2HQ8 A;  3CD6 P;  1QVI Y;  1U57 A;  5CCH A;  1KYO E;  2FJY A;  1XO5 A;  1NTZ D;  3MTU E;  3E3R A;  1CFP A;  1NVO A;  2AUC A;  2M0R A;  5J3X A;  3CCJ P;  4AOM A;  4XYN A;  2WCJ A;  3DVM A;  1P84 D;  2P10 A;  3B5N A;  3WMM 0;  2GUS A;  1VPC A;  3OAK A;  3K1E A;  1SQB D;  1SQQ E;  1PP9 J;  2KS1 B;  3RK2 C;  2ZT9 B;  3V6I A;  4ZNC A;  2WCE A;  3I5I B;  4QJ4 B;  2KXP B;  4PAL A;  4U3F J;  1OW8 A;  1UHJ A;  3SWY A;  5GQQ C;  1QLS A;  4UB8 E;  3H6P A;  1RRO A;  5CBN A;  3RM1 A;  2JPT A;  1CLB A;  3V4W A;  3LIE A;  1K93 D;  1WT6 A;  4LLH A;  1LWU A;  1IK7 A;  3AE3 C;  1N8R Q;  4C0J A;  2FY8 A;  2FBW C;  1W9Z A;  2SAS A;  1K90 D;  1R6P A;  1IFJ A;  3GW6 A;  1QIV A;  2RH0 A;  1W7I B;  1X22 A;  2OS8 B;  2YO3 A;  2GTE A;  1NO4 A;  5I8N A;  3WUT A;  2K7C A;  5JJG A;  3NXA A;  2FOT A;  2JWA A;  2ZYD A;  2FYU J;  4PDZ A;  5CCG D;  4L9M A;  1Q80 A;  2HPC B;  1GQM A;  1NSH A;  2L91 A;  3O8Z A;  2YGU A;  1BCC J;  3SG7 A;  3VOP A;  5AW1 B;  3BOW B;  1WDC C;  1RJV A;  2KBM A;  1YJ9 P;  2KYV A;  1NYA A;  2JR8 A;  4CFR A;  1KSM A;  3ZNI A;  2JRF A;  2ZN9 A;  2B87 B;  2BCC J;  2Y1M A;  2O60 A;  2L4I A;  4RES B;  2ZFD A;  1K96 A;  1UP5 A;  2D2C B;  3WUV A;  1WLZ A;  1IC2 A;  5AW7 B;  1G4Y R;  4GPL B;  5L8R J;  1NTK E;  3U59 A;  4EYY Q;  2WPR A;  1QLK A;  4ZKP A;  2FXP A;  3L4L A;  3AEF C;  5H2F H;  4GUK A;  2E43 A;  3OP0 A;  3V2L A;  1BGY J;  4LGD E;  1S5G Y;  1IGV A;  2MLF C;  2JWW A;  3L73 E;  3M0D C;  5GTH H;  5BU8 B;  2PVB A;  2M3E A;  3M91 A;  2A45 I;  1A02 F;  1URQ B;  2KLD A;  4O9B A;  1K8A Q;  3PM2 A;  2P1J A;  2QEB A;  4C0L A;  2ERB A;  3MGN A;  3RK3 B;  1N7S A;  3SWF A;  4P5O E;  5AVR B;  1SQB G;  2E74 B;  3L73 J;  4JD9 A;  2V7Q H;  2WPQ A;  3LW5 H;  5I2Q A;  1SFC C;  5CCH C;  2LMT A;  1CB1 A;  2HG5 D;  1PUL A;  1PGP A;  2PYQ A;  1EL4 A;  4IFD K;  2K7B A;  3R2P A;  2LCP A;  3DY9 A;  2YIU B;  2ZXX A;  2KZJ A;  3BUN B;  2FFD B;  3FE8 A;  2MBX A;  1NTK G;  1YTZ C;  2YKQ A;  3U1A A;  2Y0D A;  2JDI H;  2KNE A;  4UB6 H;  1X8Y A;  1P84 I;  2N1T C;  3D75 A;  3TGU J;  1MV8 A;  2BEQ D;  1NX3 A;  3DXL A;  1H8A A;  3VGO A;  1JB0 J;  5AVZ B;  4GGF A;  2CTN A;  1PPJ D;  2Y0E A;  2MAZ A;  1GU4 A;  1SP4 A;  2FYZ A;  2JT8 A;  4B86 A;  1YUT A;  2NZ0 A;  1JF0 A;  4JYC A;  1SQB E;  1ODB A;  1IG5 A;  1SW8 A;  3VMZ A;  1ZXG A;  5AFP A;  1DEE G;  4MN0 A;  1JF2 A;  3HE4 B;  2KI6 D;  1FOS E;  4BRY B;  5I2L A;  4IOI H;  2E75 D;  1X79 B;  1KFU L;  1JFJ A;  3GMA A;  3RL0 D;  3HTK B;  2D2C D;  3TF5 A;  3GOF A;  4GKG A;  3SSU A;  2AMI A;  5AEQ A;  1ZLL A;  2WZ7 A;  2E5T A;  1DGV A;  1RE4 C;  2KFF A;  1CLL A;  2CCM A;  1A75 B;  1GW3 A;  4YXD C;  3L72 D;  3CX5 E;  2NCO A;  4HB1 A;  1J1D C;  1VQN P;  1JO5 A;  2R3C A;  2W8Z A;  3VP9 A;  2YKO A;  3BUO B;  5DJU B;  4JPZ B;  3D0Y B;  2V7Q J;  3FIA A;  1Y9B A;  1GL2 D;  1NU1 E;  1CDL A;  1OVR A;  1MR8 A;  1S6J A;  3TNU B;  1HJB A;  1XYD A;  1LT9 B;  4D6T G;  2C0W A;  5AVS B;  3JC2 2;  4I2L C;  4MBE A;  1Y47 A;  2E74 D;  2CBL A;  4D1E A;  3D6Z A;  5KJ7 D;  3A4U B;  2E74 C;  3A2A A;  1MFZ A;  1QX2 A;  3V2Q A;  1NWQ A;  4TLF A;  1MWN A;  2M1K B;  1PVB A;  2Q91 A;  2LHI A;  3IQQ A;  3EVV A;  5CSI A;  2OTL P;  2KNC A;  3NMD A;  1IFD A;  3KXD A;  1CZQ A;  2H89 C;  1QAT A;  1EXJ A;  4CLN A;  2KNC B;  4KT0 J;  2FXM A;  1Q86 Q;  3E1I A;  3L35 A;  1KIL A;  3GK4 X;  2RGI A;  3AED C;  4N6J A;  3P8M C;  4W7Z A;  1HT9 A;  1ZP0 C;  1JSA A;  3B7A A;  2QJY C;  3U1C A;  2KPH A;  2P6B B;  1KB9 D;  1DGU A;  1QV1 A;  3TNU A;  3H1J D;  3TZ1 A;  3KHU A;  2N1T B;  4YGA A;  4WY4 C;  1OFC X;  1VQ7 P;  3AKB A;  1NU1 G;  2K2A A;  3II6 A;  2KUB A;  1A2X A;  1KQL A;  1Q7Y Q;  1PV3 A;  4XJK A;  2MLE C;  3PFV A;  2KZI A;  4D6T E;  2Q9I A;  1ZMZ A;  5KJ7 A;  5AXI A;  1VDF A;  1JBA A;  2FFD C;  1SQV G;  3F45 A;  4UB6 E;  1YUU A;  3PM8 A;  4M2Q A;  3CPW O;  4I5N B;  4TT3 H;  5KSZ A;  4IL6 H;  3AEA C;  2LMU A;  2XNX A;  2IFN A;  2O01 H;  1M56 D;  2K9J B;  5B5E H;  4NDC A;  2Q4U A;  2IS9 A;  1L4A A;  1S6C A;  2RMZ A;  2OYI B;  3V2N A;  3RLZ A;  1L2P A;  2QJP B;  1JMM A;  1W7J B;  1Z4H A;  1LTA C;  1S2E A;  3R1O A;  3L72 G;  1NU1 D;  1SNL A;  3CZ0 A;  2POH A;  1YVH A;  3BVH A;  1M57 D;  2QE7 H;  3SG3 A;  1SQB J;  1HUC A;  3L73 G;  3BAT A;  3A0B H;  2B89 A;  1DJG A;  1DJH A;  2A4J A;  3BJH A;  4GGN A;  2PFX A;  3Q1M A;  2JWD A;  3FWL A;  4DIR A;  1OQP A;  1JY3 O;  3I5G C;  3CCM P;  2Q5U A;  3SG5 A;  4WY4 D;  5AER A;  4Y99 C;  4MRX A;  1SK6 D;  1FOS F;  2C9N Y;  2PP6 A;  4PJ0 E;  1SQV E;  1ZW0 A;  3CTN A;  5H2F E;  1FI6 A;  5I94 A;  3L75 J;  3P8C E;  1DJY A;  1RWY A;  5CHX A;  3M0W A;  3NSK A;  1PL5 A;  2PGD A;  1L0L D;  1MFT A;  1OW7 A;  1KSO A;  2O01 J;  3AE2 C;  3F5H A;  2F2P A;  3K5B A;  3GHG A;  1L0L J;  1SQV J;  1XK4 C;  1GTW A;  4AQJ A;  1F54 A;  1SQP K;  5AW3 B;  1RE3 A;  2M7L A;  1R2U A;  2NPS A;  4KJM A;  1N65 A;  2ZRS A;  1EDK A;  5AVY B;  4YI8 A;  2KHN A;  2QDI A;  2P70 A;  3A0B E;  2OPO A;  1FZC C;  2ITA A;  3I5G B;  1LTB C;  1FAV A;  3TDK A;  4PHM A;  3A0H H;  5APS A;  1S5L E;  1Z56 A;  1NX0 A;  2FKW B;  1DF0 A;  1E5W A;  1N86 A;  3HTK A;  4MZL A;  1QVG O;  2HOD B;  2KB7 P;  1PVA A;  3VP8 A;  3FWC A;  4Q04 A;  2BCB A;  3AEE C;  1UHH A;  1GL2 C;  2JJL A;  4RKU J;  1KQS O;  2L4H A;  2ZKM X;  5HKW A;  1SQV D;  5FYX A;  4H44 D;  2M3W A;  1H0T B;  1GDT A;  2LUC A;  4OGQ D;  3BFH A;  1X0T A;  2B9B A;  4I5J A;  4PHK A;  2WSS H;  1VQ8 P;  4MZK A;  5BPJ A;  1JCC A;  3BCC D;  3H1L D;  3H1L E;  3S9O A;  1YJW P;  1J7Q A;  2KGB C;  1IKU A;  5CCG C;  1KWO C;  1NIW A;  2KSJ A;  5CPV A;  1KQG B;  2JQ6 A;  1QV0 A;  2Q6Q A;  1F4O A;  3TSI A;  1BG1 A;  2M5A B;  1M1K Q;  1VQ4 P;  3NGV A;  3FXD A;  3H1L J;  1ZR2 A;  3MP7 B;  4K3A A;  3VRR A;  1D1O A;  2WCL A;  1KIL D;  2WSE J;  2WC8 A;  3M0D A;  3VMY A;  2R5B A;  1SQB K;  1KB9 I;  1V1G A;  1OZH A;  1NPQ A;  4CPG A;  4Z1M H;  3TUY C;  1VL2 A;  3L70 G;  1LGH B;  2QG4 A;  2L2C A;  2OTG B;  2FYU K;  4JF7 A;  3G3Z A;  4DS7 A;  3CCS P;  1LWU B;  4OH8 B;  4PT1 A;  1FZE A;  5FI7 A;  3PAL A;  4ASV A;  1BDC A;  5M1B A;  4M2P A;  3B86 A;  2K0J A;  2OYH A;  2M5A A;  3CL3 D;  2ZVO B;  3SWK A;  1SQX K;  3VMX A;  2I7A A;  2NZ2 A;  2HF5 A;  3UO9 A;  1NX1 A;  2JTZ A;  2I1J A;  1L0L K;  1LTT C;  3DZT A;  2BCA A;  3KEV A;  4YI9 A;  1SQP J;  2Y5I A;  4I1L A;  2GV5 A;  1ZRT E;  1H8B A;  2WCH A;  3AE1 C;  2A06 D;  3S4R A;  3P7K A;  3B5N B;  3Q3D A;  4WVZ A;  2WC6 A;  1SBJ A;  5KLV D;  2NRG A;  1NCY A;  5CBO A;  2HQW A;  3L36 A;  4CPV A;  4AQI A;  2J58 A;  3JTD C;  3KDP B;  1H4B A;  3JCU H;  2KI4 B;  1VRK A;  3WUU A;  5TNC A;  2YMY A;  5DKN A;  1F70 A;  1VF5 B;  3H1K D;  3K21 A;  1YX8 A;  5APV A;  1QX8 A;  2BCC G;  1WLM A;  3BCC G;  4QMA A;  4GOE A;  1AK8 A;  1YIT P;  1M8O B;  3D78 A;  3EK8 A;  5AVV B;  4EI2 A;  2Q3E A;  1LT9 C;  1ZFS A;  5CCH D;  3Q8I A;  1OMD A;  1V1F A;  2FCD A;  1K9P A;  3L72 E;  2HFE D;  2LMV A;  3JTD B;  4YGE B;  3O6Q B;  3CCQ P;  4HYT B;  2WCK A;  3SS3 A;  2YKP A;  1WRG A;  1J1D A;  3LK0 A;  2I2R E;  3MHV A;  4YPC A;  3D10 A;  2F33 A;  3TGU D;  2H88 C;  2WSE H;  2F2O A;  2O01 N;  1BR4 B;  2YXQ B;  1DVI A;  3N4X A;  1FDI A;  1S1C X;  3DD4 A;  4MN4 C;  2BL0 B;  1QX5 B;  2BCC E;  3UIA A;  3CCL P;  2H61 A;  1SCV A;  1PFI A;  3BCC E;  1YQ4 C;  2LR2 A;  2YIU C;  3RBX A;  4A4B A;  1QEX A;  3BRV B;  5AVQ B;  1AQT A;  1TTX A;  1SFC B;  1UHI A;  1MXE A;  2J59 M;  1KIL C;  1QTX A;  2K37 A;  3NSO A;  1TNP A;  1LWU C;  1RQV A;  3HE5 A;  1USE A;  2OTG C;  2ZFC A;  2LV7 A;  4WQ3 A;  1LNQ A;  1JWD A;  3TGU G;  4BWN A;  1VF5 C;  1K9M Q;  1QVI Z;  3BRT B;  3GLM A;  2WCB A;  1AV1 A;  1YTZ T;  3KZI E;  1KC8 Q;  1FU1 A;  4LC1 A;  1B8R A;  1DH3 A;  1W2E A;  4YRU A;  4QJ5 B;  1N73 C;  3H1I G;  2R3S A;  4WY4 A;  2JXL A;  2K61 A;  4NPE A;  3FS7 A;  2KLV A;  4U8D A;  1TNW A;  2MRD A;  4H0L D;  1RFJ A;  5E79 E;  1R5L A;  3E1R A;  1J1E B;  1OX3 A;  3Q5P A;  1Q81 Q;  3M9B A;  1FJP A;  3H4S E;  5CJ0 A;  1KV4 A;  3JCU E;  3PP5 A;  3PAT A;  1VQL P;  3H1L G;  3I5F C;  1G1J A;  3H25 A;  2JO1 A;  1AVS A;  5KTB A;  3S0F A;  2JU0 A;  1L4A D;  4NPF X;  3RK2 D;  1LP1 B;  3V2P A;  5F6T A;  4OKH A;  1K05 A;  1L0N J;  5C39 A;  1CFC A;  4YXW H;  1PSB A;  4KYN A;  2KBI A;  1OWA A;  1DC1 A;  3R1P A;  2KOT A;  3VRO A;  3H1J E;  1XFX O;  1FBV A;  2DOQ A;  5HL1 A;  4FQT A;  1QGK B;  1AJ5 A;  4OV2 A; 
#chains in the Genus database with same CATH homology
 2BBN A;  1SL8 A;  3D0Y B;  4NQG A;  1YR5 A;  4DRW A;  1PRW A;  2LAN A;  3FIA A;  3TUY B;  1CDL A;  1MR8 A;  1KQM B;  2K7D A;  2Y9Z A;  1S6J A;  1S5G Z;  1XYD A;  4YGB B;  1CM4 A;  1MF8 B;  1QX7 A;  3EK4 A;  1KFX L;  1EJ3 A;  1TRF A;  2KYF A;  4MBE A;  3SG4 A;  2CBL A;  4D1E A;  5KU1 A;  3BUW B;  3A4U B;  2NCP A;  1BR1 B;  1QX2 A;  1DTL A;  1LA0 A;  2H61 C;  4HRE E;  1DJW A;  1MWN A;  2M1K B;  1PVB A;  1N2D A;  2LHI A;  2Q91 A;  3EVV A;  3IQQ A;  5CSI A;  1BJF A;  1KQM C;  1CTR A;  4FTG A;  5JOL A;  1F4Q A;  3O4Y A;  3WNX B;  1GGZ A;  3SIB A;  1QAT A;  4MZJ A;  3LK1 A;  1A75 A;  2PAS A;  4CLN A;  1M45 A;  1F8H A;  3GK4 X;  2RGI A;  4ZCV A;  5HLO A;  1XK4 A;  2LVK A;  2EC6 B;  3AKA A;  1IRJ A;  1HT9 A;  1QAS A;  4A4C A;  1SMG A;  1TOP A;  1DJZ A;  4I5L B;  5AAN A;  4HSZ A;  1LIN A;  3WHU B;  1JSA A;  5G08 A;  1L7Z A;  2ISD A;  2P6B B;  1DGU A;  1LKJ A;  2QAC A;  1QV1 A;  1IJ6 A;  5D7F A;  2L50 A;  2FCE A;  2V53 A;  4NDB A;  2Y1N A;  4QJ3 B;  4ORC B;  1UUR A;  5PAL A;  1TCO B;  1TIZ A;  1XFV O;  3CR5 X;  4YBH B;  5HLV A;  3TZ1 A;  1HQV A;  2B1U A;  3D0Y A;  2PAL A;  4YGA A;  1S36 A;  1OFC X;  1NUB A;  2LLT A;  1ALV A;  2M8U A;  3AKB A;  3I5F B;  2K2A A;  1S3P A;  3JVT B;  1A2X A;  2CXJ A;  1TNQ A;  3JVT C;  4XJK A;  2MLE C;  5ER4 X;  3PFV A;  3TS5 B;  1CLM A;  4R1E A;  1ZMZ A;  2LHL A;  1MUX A;  1F55 A;  1FPW A;  4NDD A;  2M1U A;  4PCW A;  5AXI A;  2KAV A;  1JBA A;  1YUS A;  1KK8 C;  1UHK A;  1Y1A A;  2KAX A;  3F45 A;  1YUU A;  3OB1 B;  3PM8 A;  4M2Q A;  1LXF C;  3PLF B;  1OE9 B;  4I5N B;  5KSZ A;  3CR4 X;  2LMU A;  1LVC D;  3TDI A;  5DKQ A;  4NDC A;  2Q4U A;  4GGF C;  3HX4 A;  2IS9 A;  1B4C A;  1S6C A;  2JUL A;  2JOJ A;  4OR9 B;  1CMG A;  2KGR A;  1NCZ A;  1B7T Y;  1SKT A;  3PN7 B;  3RLZ A;  1XFZ O;  2JT3 A;  1CNP A;  1SRA A;  1JUO A;  3CR2 A;  1W7J B;  2LP2 A;  1OSA A;  3MSE B;  2F3Y A;  1SNL A;  1CDN A;  1YVH A;  2E6W A;  2LC5 A;  3SG3 A;  3SIA A;  1DJI A;  1B47 A;  1XA5 A;  2JNX A;  1PK0 D;  2LVV A;  1DJG A;  3I5H C;  3KF9 A;  1DJH A;  3BQ3 A;  2BBM A;  3NSI A;  4GBA A;  2A4J A;  4GGN A;  3WHT B;  2JZI A;  1IH0 A;  2ZRT A;  4DUQ A;  2JNF A;  1BLQ A;  1OZO A;  4DIR A;  2CNP A;  1OQP A;  2M7N A;  2JXC A;  2F3Z A;  3I5G C;  2MJW B;  1A4P A;  1UUS A;  3SG5 A;  3O6B A;  5AER A;  4MRX A;  1SK6 D;  1OZS A;  2O5G A;  2AAO A;  3I5H B;  4MEW A;  3CTN A;  1G8I A;  4DCK A;  1FI6 A;  1DJY A;  5IBW A;  1M31 A;  1BOD A;  1RWY A;  3M0W A;  3NSK A;  1QS7 A;  1A29 A;  2LUX A;  1KSO A;  1YVL A;  1Y1U A;  1CFF A;  2F2P A;  4CID A;  3CS1 A;  1XK4 C;  1EG4 A;  3LCP C;  4AQJ A;  1F54 A;  1C7W A;  2M7L A;  1R2U A;  3EK7 A;  1WY9 A;  3OX5 A;  1N65 A;  2ZRS A;  3DF0 A;  4ETO A;  4YI8 A;  2KHN A;  2JC2 A;  5I2O A;  1B8C A;  1S1E A;  2OPO A;  1SCM C;  1UWO A;  3I5G B;  2M49 B;  3VRP A;  4PHM A;  3WXA A;  1KFX S;  2VRG A;  1RTP 1;  3ZWH A;  2WOS A;  1NX0 A;  2Y4Q A;  1DF0 A;  1M63 B;  1S26 D;  3HCM A;  1AJ4 A;  3BOW A;  4BY4 A;  1KFU S;  4MZL A;  4TNC A;  1EXR A;  1EH2 A;  1PVA A;  1XFW O;  3FWC A;  4Q04 A;  2BCB A;  1K8U A;  1UHH A;  2L5X B;  1EG3 A;  3PSR A;  5D69 A;  4ZCU A;  1NX2 A;  2G2B A;  3GK2 A;  3NSL A;  1IQ3 A;  4YGD B;  2MHH A;  3BUM B;  2LM5 A;  1WDC B;  1J1E A;  2EHB A;  1UHN A;  3QRX A;  2L4H A;  2ZKM X;  5HKW A;  4PHN A;  5FYX A;  2FJU B;  2ZN8 A;  2D8N A;  1K2H A;  2M3W A;  2WND A;  2BE6 A;  2LUC A;  4JQ0 D;  1SPY A;  2BCX A;  1BMO A;  2LLS A;  1LA3 A;  3DVE A;  4I5J A;  4PHK A;  1PSR A;  3DVJ A;  4MZK A;  5BPJ A;  4N1G A;  1FI5 A;  3EKJ A;  3TDZ A;  2OS8 C;  3GK1 A;  3IQO A;  2K7O A;  1U5I B;  4PE7 A;  2COL B;  2KSP A;  1J7Q A;  1B1G A;  2KGB C;  5CSN A;  2BKH B;  4ICB A;  1IKU A;  5CSJ A;  1K94 A;  1KWO C;  1NIW A;  1F71 A;  2M97 A;  5CPV A;  1DJX A;  1QV0 A;  2JQ6 A;  1F4O A;  4OCI A;  1SYM A;  2R2I A;  1SCM B;  1XFY O;  1BG1 A;  2HQ8 A;  1QVI Y;  2BL0 C;  2KQ6 A;  3VRR A;  1YRT B;  1XO5 A;  1S6I A;  4GFT A;  1D1O A;  2BKI B;  5KTY A;  3E3R A;  1CFP A;  3SJS A;  3KPX A;  1BT6 A;  2AUC A;  2M0R A;  2WC8 A;  5J3X A;  1QJT A;  4AOM A;  4XYN A;  3DVM A;  1V1G A;  3O2P A;  1NPQ A;  3TUY C;  3OX6 A;  2PMY A;  2OTG B;  4WQ2 A;  5B8I B;  3CGA A;  4DS7 A;  1Y1X A;  1L2O C;  2WCE A;  3PAL A;  3I5I B;  4M2P A;  1MXL C;  4QJ4 B;  1YX7 A;  4PAL A;  1UHJ A;  2KI6 C;  1Y6W A;  2K0J A;  2JT0 A;  5GQQ C;  1QLS A;  2I7A A;  1GGW A;  2HF5 A;  2F8P A;  2L98 A;  1SY9 A;  1NX1 A;  1RRO A;  1B8L A;  3RM1 A;  2JTZ A;  1B7T Z;  2JPT A;  1WRZ A;  3CWG A;  1CLB A;  1AUI B;  1K93 D;  3TDU A;  2LLU A;  1N0Y A;  2BCA A;  2ZND A;  1IQ5 A;  3KEV A;  1REC A;  4YI9 A;  1KQV A;  2Y5I A;  4HRH A;  1M39 A;  1PAL A;  2GV5 A;  4C0J A;  1H8B A;  5HKZ A;  1K9K A;  1M46 A;  1KWO B;  1DMO A;  2KI4 C;  4MSP A;  2SAS A;  1K90 D;  1R6P A;  2WCF A;  1SBJ A;  3LL8 B;  1ZUZ A;  1QIV A;  4OVN F;  1W7I B;  1ZOT B;  2OS8 B;  1TN4 A;  5DKR A;  5K89 A;  1NCY A;  5I8N A;  2HQW A;  2K7C A;  4CFQ A;  3NXA A;  2FOT A;  4CPV A;  5JJG A;  1CDP A;  3A8R A;  1GJY A;  1K95 A;  4PDZ A;  1MQ1 A;  4L9M A;  1Q80 A;  2PRU A;  4AQI A;  3JTD C;  1GQM A;  1DT7 B;  1NSH A;  1H4B A;  1C7V A;  4PE1 A;  2I94 A;  1XVJ A;  1CFD A;  3ICB A;  3SG7 A;  4F0Z B;  1X02 A;  4MVF A;  2KI4 B;  1VRK A;  3AAK A;  5TNC A;  3BOW B;  1WDC C;  1RJV A;  2KDH A;  5DKN A;  2KBM A;  1F70 A;  1CMF A;  3K21 A;  1SL9 A;  1NYA A;  1YX8 A;  2ZNE A;  4CFR A;  1KSM A;  3TS5 C;  1WLM A;  3ZNI A;  2JRF A;  1KCY A;  2ZN9 A;  1U5I A;  2Y1M A;  2O60 A;  2L4I A;  4ORB B;  4ORA B;  2ZFD A;  1K96 A;  1UP5 A;  1AK8 A;  1YUR A;  1WLZ A;  3EK8 A;  3EVU A;  3VRN A;  1G4Y R;  4GPL B;  1JFK A;  1ZFS A;  1IJ5 A;  1OMV A;  1BF5 A;  1OMD A;  1V1F A;  2FCD A;  1K9P A;  1QLK A;  2I18 A;  4UPG A;  1J7O A;  2LMV A;  3JTD B;  4YGE B;  2EGD A;  1SL7 A;  1G33 A;  1J7P A;  4GUK A;  2BEC A;  1J55 A;  3I5I C;  2CT9 A;  3OP0 A;  1S5G Y;  2EC6 C;  4PHJ A;  4C0K A;  1IGV A;  2MLF C;  1J1D A;  2JWW A;  1J7R A;  3OB2 B;  3LK0 A;  1WRL A;  1YRU B;  2PVB A;  2I2R E;  1FF1 A;  1NCX A;  4N1F A;  3D10 A;  1Y0V H;  2F33 A;  3KO0 A;  1JC2 A;  4IL1 A;  4C0L A;  1KK7 Y;  2NLN A;  4WRI A;  1QXP A;  3PN7 C;  2LE9 B;  2GGM A;  4MRY A;  3CLN A;  4P5O E;  3C1V A;  1C07 A;  2LAP A;  1RK9 A;  2F2O A;  1BR4 B;  1DVI A;  1ALW A;  3DF0 B;  2KFH A;  3DD4 A;  3FWB A;  5I2Q A;  5HYD A;  2BL0 B;  2LMT A;  1CB1 A;  3IF7 A;  1QX5 B;  1SR6 B;  1NWD A;  1PUL A;  3BYA A;  1TCF A;  2H61 A;  1SCV A;  2K2F A;  3DVK A;  1EL4 A;  1CM1 A;  3EVR A;  2K7B A;  2LCP A;  4MLW A;  1IWQ A;  4P2Y B;  2KQY A;  4A4B A;  1KK8 B;  3BUN B;  2MBX A;  2H2K A;  2SCP A;  2L0P A;  1SR6 C;  2K8M B;  1TTX A;  1UHI A;  1YTZ C;  1MXE A;  2WOR A;  1K9U A;  1QTX A;  3NSO A;  3VRQ A;  1TNP A;  3LLE A;  4BY5 A;  2KNE A;  2OTG C;  2LV7 A;  2Y9Y A;  2MA2 A;  2LNK A;  2M9G A;  2PSR A;  3SG2 A;  4WQ3 A;  3SG6 A;  1JWD A;  1E8A A;  1DF0 B;  1QVI Z;  3BXK A;  2WCB A;  1OMR A;  1NX3 A;  1CDM A;  2QPT A;  4USL A;  4HRG A;  4GNK B;  1MHO A;  3VGO A;  4I5K A;  1B8R A;  4YRU A;  4QJ5 B;  2L51 A;  1BOC A;  4GGF A;  2CTN A;  1AP4 A;  2HPS A;  4PE4 A;  2JXL A;  2K61 A;  2BE4 A;  5ER5 A;  2HET A;  2MAZ A;  3FS7 A;  4YGC B;  1NP8 A;  2G9B A;  4U8D A;  2JT8 A;  1YUT A;  1B9A A;  1TNW A;  2JTT A;  1JF0 A;  1KK7 Z;  2MRD A;  1ODB A;  1IG5 A;  2NZ0 A;  1RFJ A;  2KAY A;  4PE0 A;  4GAO A;  1OOJ A;  1SW8 A;  3EKH A;  1A03 A;  1WRK A;  5AFP A;  2NXQ A;  1BU3 A;  2L2E A;  4MN0 A;  2LVI A;  2M29 A;  1JF2 A;  3CZT X;  3OHM B;  2KYC A;  1ZAC A;  2KI6 D;  3H4S E;  1TNX A;  5I2L A;  2LP3 A;  3PAT A;  1KFU L;  1FW4 A;  4M2O A;  1JFJ A;  3BUX B;  2KFG A;  3I5F C;  2GGZ A;  2E30 A;  2TN4 A;  3GOF A;  2AMI A;  5AEQ A;  1XFU O;  3AAJ A;  1AVS A;  1DGV A;  1CKK A;  2KFF A;  1QIW A;  1CLL A;  2JU0 A;  2CCM A;  5F6T A;  4OKH A;  1A75 B;  5CSF A;  4E68 A;  1CFC A;  4FQO A;  2LVJ A;  1PSB A;  3KHE A;  4N5X A;  5HKY A;  2NCO A;  2KBI A;  4XJK B;  2KOT A;  3O78 A;  4JWQ A;  3VRO A;  1L2O B;  1AHR A;  1XFX O;  1FBV A;  2DOQ A;  3BUO B;  1AJ5 A;  4JPZ B;  4OV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...