4DCKA

Crystal structure of the c-terminus of voltage-gated sodium channel in complex with fgf13 and cam
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
153
Chain Sequence
SVATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein/signaling protein
molecule keywords Sodium channel protein type 5 subunit alpha
publication title Crystal Structure of the Ternary Complex of a NaV C-Terminal Domain, a Fibroblast Growth Factor Homologous Factor, and Calmodulin.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2012-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4dckA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4dckA02
1TOPA 2KQ6A 2MHHA 2AAOA 2F33A 1WDCB 2IS9A 2I94A 2WCFA 1WLZA 1CFPA 2FCDA 2ZKMX 2COLB 3I5HB 2K61A 2BE4A 4JPZB 4YGCB 5FYXA 3O4YA 4ORBB 1SYMA 4N5XA 2KFHA 1YVLA 1YR5A 2BECA 4AQIA 1BODA 2BKIB 1Y0VH 2ZN9A 1JFKA 1SR6C 2CBLA 3SG2A 1UURA 3IQOA 2GGZA 1UHKA 2M3WA 1BF5A 2M9GA 1ZFSA 1NX2A 1FI5A 3VRNA 1NWDA 1RFJA 5HLVA 1A29A 3SIBA 1XFXO 1XVJA 2KAXA 1QIVA 1BLQA 3OX5A 4ZCVA 1DJHA 1EG3A 1TIZA 3TS5B 3MSEB 3D0YB 1NX3A 2KYCA 1IWQA 2LCPA 2KHNA 2L51A 1V1GA 2LE9B 2Q91A 3E3RA 2MLEC 3SG7A 2I2RE 2KI6D 3BQ3A 1F4QA 2OTGC 1F55A 5CSFA 3I5IC 1EG4A 3O78A 1TN4A 5CSIA 1EH2A 4N1GA 4NDDA 1KWOB 4ORAB 5F6TA 5BPJA 3SJSA 1S36A 1YRTB 1OMRA 1WRZA 1IQ3A 1G4YR 1TCOB 4R1EA 1SPYA 1K9PA 4HREE 1TNQA 4PE0A 3GK1A 4MLWA 4M2OA 1QVIY 1CDPA 1NSHA 1NPQA 1U5IB 3PALA 3FWBA 2ZFDA 5AEQA 2NZ0A 1XK4C 4XJKB 4ETOA 2PALA 1SW8A 1XFZO 1QLSA 3LK1A 4YI8A 1DT7B 4YI9A 3AKBA 2AUCA 1A2XA 2LLSA 1R6PA 4A4CA 1QX7A 1Y1UA 2G2BA 3EK7A 4UPGA 3H4SE 3NSOA 2BL0C 1A03A 2JRFA 2JZIA 3TUYB 2BBMA 2BBNA 2LLTA 3LK0A 1KSMA 2EC6B 1DJXA 1S26D 2WORA 5J3XA 1YUSA 2KFFA 4OKHA 3BUMB 2EGDA 3NSIA 2JXCA 2L2EA 4I5JA 5CSJA 3VRQA 2EHBA 3CLNA 3KF9A 3SG4A 3SG5A 1M31A 4PCWA 5PALA 1FF1A 2LC5A 1F8HA 2BCXA 1UUSA 1K8UA 3NSKA 2BCBA 3CR2A 1FBVA 1FPWA 1AJ4A 1MHOA 1BT6A 1QTXA 1NP8A 2G9BA 3SG6A 5KSZA 2H2KA 3FWCA 1CKKA 1SNLA 1X02A 1B7TY 3HX4A 4MZKA 2KSPA 1B1GA 1JFJA 1SCVA 1XFWO 2K8MB 1KK8B 3EK4A 1TRFA 1EXRA 2L5XB 5DKQA 4MSPA 3PSRA 1DGVA 5G08A 1SK6D 3GK4X 2WCEA 1KFUL 1PVAA 1CB1A 1ZUZA 1UHJA 1QJTA 4DIRA 2L4HA 2HPSA 3GK2A 3HCMA 2F8PA 2JU0A 1OZOA 4YGDB 2PVBA 1NCZA 3JVTB 3VRRA 3D10A 4DCKA 4WQ2A 3BYAA 1L7ZA 4MZJA 1IJ6A 1C7VA 1JBAA 1PK0D 1J7OA 1MXLC 1L2OC 4Q04A 2KAVA 2JT0A 3TDUA 2QPTA 5GQQC 1B4CA 1A75B 4OCIA 1Y1XA 1LKJA 1HT9A 1CMGA 4WRIA 2Q4UA 5AANA 1C07A 1DJGA 1JUOA 2JULA 1K2HA 3LL8B 1H8BA 2AMIA 4I5LB 4AOMA 2KBIA 3BXKA 1WRLA 1OZSA 1S6CA 1IKUA 4DS7A 2LM5A 1B8LA 1CLMA 4F0ZB 1UHIA 1BMOA 2M97A 1ALVA 2JQ6A 1J7RA 2LV7A 1QATA 1QS7A 4D1EA 2VRGA 3AKAA 3GOFA 1DTLA 1G8IA 2KI4C 4CLNA 3VGOA 1YURA 1C7WA 2GV5A 1ODBA 2JOJA 3FS7A 1QASA 1K96A 2KAYA 1IH0A 1NX1A 3BUNB 4YRUA 3PATA 1BJFA 1U5IA 3EKJA 3I5GC 1CFFA 1B8CA 1DMOA 2F2OA 4PALA 5I2LA 2LUXA 4C0KA 4XJKA 4DRWA 3O6BA 2LMVA 4HRGA 1OOJA 2SCPA 2HF5A 2CTNA 4YGEB 4U8DA 1E8AA 2F3ZA 4N1FA 5DKNA 1JWDA 4MVFA 4CFRA 1KQVA 4PE7A 5I2QA 4PHJA 3DVKA 2K7DA 3K21A 4GPLB 4QJ4B 2M1UA 2MJWB 2P6BB 3JTDB 3RM1A 3I5FC 3C1VA 2Y5IA 3A8RA 2F2PA 3DF0A 4TNCA 1CDMA 2M7NA 4FQOA 1NIWA 1CFCA 2JXLA 4GBAA 3M0WA 5IBWA 2CXJA 1SBJA 4DUQA 1B8RA 4ICBA 1CTRA 2OS8B 3NXAA 1YUTA 1IRJA 2PMYA 2WOSA 2CT9A 1PALA 3DVMA 1KQMC 1RK9A 4M2QA 2ZN8A 3LLEA 4NDCA 3WHUB 2FCEA 2M8UA 1MR8A 2MA2A 4YGAA 1JSAA 5JOLA 1IG5A 1Q80A 1YX8A 4QJ5B 2KQYA 3EVRA 4I5NB 1MUXA 2HQWA 4CIDA 1SR6B 3NSLA 1CLBA 1DJIA 1JF2A 1B9AA 4GUKA 5CSNA 1YTZC 1FW4A 1J7PA 2I7AA 1BOCA 1DF0B 2PSRA 1SMGA 3AAKA 1TNWA 4GNKB 2MLFC 2O5GA 1BR4B 3CR5X 3I5GB 4AQJA 4PHMA 4CPVA 1HQVA 2B1UA 2JPTA 3I5HC 2ZRSA 3EK8A 1NX0A 2LANA 1PSBA 1Y6WA 2MAZA 2L50A 1SY9A 3BOWB 4YBHB 1XYDA 1OMVA 1KFXL 1WLMA 2OTGB 1Y1AA 3CWGA 1QX5B 3LCPC 1OSAA 4CFQA 3I5IB 1K94A 2D8NA 2LVJA 2Y4QA 3BUOB 3SG3A 4XYNA 1NYAA 1G33A 4USLA 1PVBA 1PULA 1SCMC 5HKYA 4NDBA 1CDNA 2WCBA 4ORCB 3OX6A 1EJ3A 1VRKA 2R2IA 4C0JA 4MRXA 3IQQA 3TS5C 2JWWA 2NCOA 3WHTB 1AVSA 3PM8A 4NQGA 4P2YB 1YX7A 1XA5A 3ZNIA 1QX2A 2BCAA 4C0LA 1FI6A 2BKHB 1JF0A 3TDZA 2LHIA 2E6WA 5D69A 3VROA 2LVKA 2TN4A 2KGBC 2QACA 4GGNA 2LP3A 3EKHA 1DVIA 4MBEA 2BL0B 4PE1A 1KWOC 3DD4A 2K7BA 4OVNF 4PDZA 1NCXA 1K9KA 2ZRTA 3D0YA 2JNFA 1AHRA 1RECA 2Y1MA 3CGAA 3CTNA 2MBXA 3RLZA 5KTYA 4YGBB 1DJYA 2KI6C 1TNXA 5HKZA 3KO0A 5AFPA 4JWQA 5AERA 2ZNDA 1S3PA 1TNPA 1N0YA 1XO5A 1H4BA 1K90D 3OB2B 2JT3A 2LHLA 1UP5A 1GGWA 1IJ5A 2HQ8A 3O2PA 3OHMB 2KDHA 2FJUB 4FTGA 3DVJA 5D7FA 4PHNA 1K95A 3CS1A 4JQ0D 2SASA 1KFUS 2LMUA 1KSOA 3OP0A 4L9MA 3WNXB 1K9UA 3TUYC 3BUWB 1CNPA 5I8NA 1UHNA 2A4JA 1KK7Z 2EC6C 1CM1A 1S5GZ 2F3YA 1LA3A 2M29A 2KGRA 1AJ5A 1J1DA 4PE4A 1S6IA 3ICBA 1WRKA 1XFUO 1NCYA 2KOTA 1YUUA 2LAPA 1AUIB 3IF7A 3PLFB 1TCFA 2LNKA 1MF8B 2Y9ZA 2OPOA 2MRDA 2LP2A 2PASA 1SCMB 3TDIA 1S6JA 1OE9B 5TNCA 2I18A 5AXIA 4A4BA 1MQ1A 5K89A 1M46A 1W7IB 4GAOA 1RWYA 1YVHA 5HYDA 1BG1A 4P5OE 3PN7C 2K7OA 2JC2A 1J1EA 4IL1A 5B8IB 1WY9A 3KPXA 3EVUA 2DOQA 5HKWA 2LUCA 1KK8C 2M1KB 2Y1NA 4BY4A 1L2OB 1D1OA 5I2OA 1M63B 1N65A 2L0PA 1UWOA 3F45A 1QXPA 1PRWA 1DF0A 1QV1A 1R2UA 2K2AA 2HETA 1ZOTB 1DJZA 2NXQA 1F4OA 2JT8A 5DKRA 1RJVA 1F71A 2KNEA 1OQPA 1CLLA 3BOWA 2LVVA 4MRYA 4GFTA 4PHKA 1AK8A 1IGVA 2K2FA 3JVTC 1EL4A 1N2DA 1ALWA 2LMTA 1V1FA 2K7CA 1RROA 2KYFA 3WXAA 2L98A 2KI4B 3CZTX 4OR9B 3KEVA 1M45A 1A4PA 1LVCD 4I5KA 3TZ1A 1WDCC 5JJGA 4MN0A 1XFVO 2JNXA 2PRUA 1MXEA 2LVIA 3OB1B 1XK4A 2KFGA 2BE6A 1GGZA 2O60A 2M7LA 1OFCX 1DJWA 2V53A 3VRPA 2ISDA 1CFDA 2RGIA 3DF0B 1UHHA 1J55A 5ER4X 5ER5A 1XFYO 2NCPA 1A75A 1YRUB 1LXFC 1ZMZA 2K0JA 4GGFC 4OV2A 3PFVA 3QRXA 3A4UB 1QVIZ 3BUXB 2M0RA 1CMFA 3FIAA 5KU1A 1OMDA 3CR4X 3AAJA 2WNDA 3I5FB 1SL9A 1SKTA 1TTXA 3KHEA 3PN7B 1B47A 1MWNA 1SRAA 4WQ3A 1LA0A 2CCMA 4QJ3B 3SIAA 1M39A 4GGFA 4HSZA 3ZWHA 1DGUA 2GGMA 1BU3A 2JTTA 1ZACA 3DVEA 2L4IA 2WC8A 1QLKA 1QV0A 1KK7Y 1S5GY 2H61C 5CPVA 2LLUA 1GJYA 1J7QA 1GQMA 3EVVA 1KQMB 4ZCUA 1NUBA 5HLOA 4E68A 1QIWA 2ZNEA 3JTDC 1PSRA 4MEWA 1IQ5A 1W7JB 4MZLA 2CNPA 2JTZA 4BY5A 4HRHA 4M2PA 1CM4A 1SL8A 2Y9YA 1JC2A 2H61A 1K93D 1KFXS 2OS8C 1F70A 2E30A 1S1EA 1KCYA 1AP4A 2NLNA 1B7TZ 1CDLA 1SL7A 1LINA 1F54A 1RTP1 2KBMA 1BR1B 2FOTA 2M49B
chains in the Genus database with same CATH superfamily
2R3SA 3VP9A 3U1AA 2B9BA 1WLZA 2I1KA 3S0DA 2COLB 2D2CB 4JPZB 4YGCB 1NGMB 1FDIA 2L91A 3OGNA 2KFHA 1YR5A 2BEQD 1PPJE 2WSEJ 1Y0VH 2ZN9A 1RE4A 2IFNA 2QIWA 1JFKA 2R3CA 3SG2A 3Q5SA 1UURA 1NU1E 1L4AC 5AW7B 1CSBA 1NWDA 3SIBA 2GTEA 2KAXA 1QIVA 1BLQA 1DJHA 3L74G 3A0BH 1TIZA 5B5EE 2KYCA 1L0LG 2M5AA 1VQ6P 2LCPA 3TGUJ 1ZMEC 3IAOA 1V1GA 1H88A 2Q91A 1PP9G 2MLEC 1LTIC 2KI6D 2OTGC 3H32A 1EH2A 3NHIA 3AEAC 3L70D 3SJSA 1NTZG 1IQ3A 4R1EA 1SPYA 3IFMA 1TNQA 3JCUE 1NPQA 3SWFA 1U5IB 5AEQA 2ZFDA 2NZ0A 3G3ZA 2GUVA 1JTHA 1XFZO 4A4CA 3H1JJ 1A2XA 4DJGA 1OW4A 1KYOD 2PQLA 1LTAC 4UB8E 1KZUB 2WZ7A 3HTKB 1Z4HA 3DY9A 2KFFA 3BUMB 2WMMA 2C0XA 5FI6A 2JXCA 1S5LX 5CSJA 2BCCG 1BE3G 1DH3A 3CLNA 5C39A 5KAIH 3SG5A 1M31A 4PCWA 1FF1A 1L0LK 2RMZA 2LC5A 4U3FE 1F8HA 3NSKA 1FPWA 2PYQA 5APQA 3W68A 1QTXA 2IBZI 3FWCA 1LWUB 4JD9A 1S5LE 1XFWO 1PPJG 5GTHH 1NTKK 1MV8A 1EXRA 2L5XB 1NU1G 4PD4I 3HE5A 1ZRTD 4MSPA 3L47A 4WBAA 3AEEC 2WCEA 1QVGO 4AUWA 1UHJA 3IR9A 5B66H 2WC5A 2HPSA 3H1KD 2K9JB 2JU0A 4DCKA 1IC2A 3L73J 2FXPA 1EDKA 1L0NE 3GHGC 1J7OA 1VPCA 2H89C 5AVVB 4OCIA 4EDFA 4R4LA 1HT9A 3B7AA 3CCMP 4WRIA 5CCHC 1Q82Q 2WCHA 3LL8B 4ZNCA 2AMIA 1JY2O 4PJ0H 1HWTC 3BXKA 1HVVA 2FYUE 3V2LA 4R4MA 2PGDA 1H0TA 2ZT9D 1CLMA 2B87B 2M97A 4C46A 1EZVI 3AE3C 1J7RA 3CXHD 2AEJA 4D1EA 2M8RA 3DYEA 2WPQA 1DTLA 3VGOA 1C7WA 2ZT9B 3KHUA 1K96A 1IH0A 3BFHA 1NU1K 1NKZB 2NPSC 2O1KA 2K1AA 3A3YB 1DMOA 4IL6X 4C0KA 4HH2A 1XFRA 2V4HA 4XJKA 3O6BA 3FXDA 3RL0g 1IIOA 4YGEB 1G2CB 4U8DA 5AVXB 4MVFA 5CMZA 4U3FG 4PE7A 3L4AA 4PHJA 3DVKA 2K7DA 4GPLB 3A5TA 1BGYJ 3CX5I 3BRTB 2MJWB 3GF7A 2P6BB 4IL6E 3AEGC 2RH0A 4W7ZA 2LXBA 3C1VA 2N1TC 4TNCA 1KFNA 3B5NC 2M7NA 1NIWA 2IBZE 2JXLA 5CBOA 1SBJA 1CTRA 4H0LB 2OS8B 3NXAA 3C1LA 3CYZA 1JY2N 4PD4E 2E76C 2W6BA 3DVMA 3M0DC 5DJUB 3RK2C 2FCEA 2LKMA 4U7JA 5AVTB 3VN0A 1QGKB 4QJ5B 2CK3H 1UIXA 1TWOA 3L74D 1L0NG 2HQWA 2R5BA 2YKOA 3AE5C 1DJIA 3U1CA 3HUSC 3H32B 2I7AA 3SS3A 1RF0C 1M57D 4GNKB 1SMGA 1SFCB 1BR4B 4AQJA 2KS1A 2FYUG 4GIFA 4I6MC 2LANA 1NTZD 2A06G 1FOSE 1SY9A 1FZEA 1OMVA 1IFMA 3O8ZA 3I5IB 1K94A 2D8NA 2LVJA 3SG3A 3RL0D 1JTHB 3GLMA 1EZVE 1S4XA 1AVOA 1PULA 2WCBA 3OX6A 2E75C 1JOCA 2R2IA 4C0JA 4GDOA 1ZV8A 2JWDA 4GODA 3IQQA 2ITAA 3L4LA 2NCOA 3CZ0A 3WHTB 1EXJA 1YX7A 3RL0B 3VOPA 3WU2H 1KYOI 5DICA 3ABVC 1GU4A 2JDIH 2E6WA 3VROA 1BDCA 1NTME 2TN4A 2QACA 4GGNA 1QLED 2YKQA 1Q86Q 4PDZA 2K7BA 1BE3D 1OIPA 3D0YA 1L0NK 2BCCD 2Q5UA 2JNFA 1RECA 4GOEA 3CGAA 3CTNA 3CCEP 1Q90D 2KI6C 3KQGA 2W90A 3CX5E 2IBZG 2H7HA 1S3PA 2OYHA 2B88A 1YQ4C 1H4BA 3NXSA 3CMAP 1GGWA 3CCLP 2G3AA 3OHMB 2KDHA 1SQQJ 4PJ0E 2FYUK 4JQ0D 2SASA 2BEZF 1QVFO 1KFUS 3PM2A 1KSOA 1K9UA 2O01H 3CWBJ 3VMXA 3T97B 1LTBC 4OH8B 2KGRA 1J1DA 4PE4A 1S6IA 2QJYC 4W7YA 3ICBA 1WRKA 1NCYA 2KOTA 1YIJP 1AUIB 3IF7A 2AXTH 4NPFX 1IFNA 1MF8B 2MRDA 1S6JA 3S0AA 1J2JB 2QJKC 1W7IB 2AEMA 4GAOA 3S0GA 3NGVA 3PN7C 3S0FA 1PGOA 3BCCJ 3MGNA 2M1KB 4LLHA 1H0TB 3I56P 1U57A 5I2OA 2PP6A 1N65A 2L0PA 3F45A 1T2KD 1EZVG 2ZXXA 3S0EA 4DZOA 1DJZA 1F4OA 4RESB 2KLDA 5DKRA 3G9RA 2POHA 2QEHA 2O1JA 3CCRP 1FZGA 3P8MC 1E79H 1IGVA 1KYOE 1NTMG 1OMIA 4RJTA 1LT9A 2WSFH 4LC1A 4WWIA 3E1RA 2K3RA 1N73C 1DD3A 4MN0A 1XTGB 2M0BA 2AXCA 4U3FD 2LVIA 1HUCA 1S9KD 2WPRA 1GGZA 1FZBA 1DJWA 3FE6A 2RGIA 1RQVA 1T6AA 4WB4A 2P71A 1XFYO 1A75A 1ZMZA 1YTZT 2YXQB 1FDOA 3QH9A 1QVIZ 1GU5A 1ZXGA 1OMDA 4BWNA 4BRYA 1SKTA 1TTXA 3H1LJ 4Y99B 1NAYA 1ZRTE 4D6TD 1VQ7P 2WT7B 3O6QA 1K05A 3D71A 1ZACA 3JC22 1FU1A 1QLKA 1S5GY 3M06A 1GM0A 3GW6A 1GJYA 3WU2E 3H1KE 1KQFB 1GQMA 1KQMB 4ZCUA 4E68A 2WQYC 1ZR4A 1PZQA 1PSRA 5AW3B 3S1KA 1OX3A 5I94A 3A7OA 2KS1B 1SL8A 2H61A 1KFXS 2FYUD 2OS8C 4H0LC 1S1EA 1DQEA 3BJHA 1AP4A 1KILE 1SQXD 2A06D 1LINA 3FX0A 4B86A 4ASVA 2KBMA 1FW4A 2QM8A 2MHHA 3QMEA 1WDCB 2WCFA 2FCDA 3V5BA 2BE4A 1EDIA 4ORBB 3RZSA 1KD1Q 1J1EC 2BECA 1CZQA 4HYTB 2ZYAA 2ZAEB 2GGZA 3EQ2A 1BF5A 2IX7C 3VRNA 2QEXP 1XFXO 4ZCVA 1SFCC 1P84H 1EG3A 1VF5C 3TS5B 1VQNP 3MSEB 3D0YB 1SP4A 3L4FA 3A0HH 4NPEA 1GW4A 2YNYA 1AQ5A 1M90Q 3L75D 2L51A 3LIEA 3SG7A 2I2RE 3F5HA 2OYHB 1F4QA 4EOTA 3PJIA 3I5IC 1EG4A 1N2DC 3O78A 2H8VA 3ZDMA 2R44A 4N1GA 5F6TA 3L72J 1YRTB 1OMRA 1K9MQ 3JSVC 1GDTA 3GK1A 3V4WA 3MUDA 4C7NB 1XK4C 2WCLA 1ZW0A 3AE8C 4YXDC 4ETOA 5GTIH 1OVUA 1SW8A 1QLSA 4KJMA 4IFDK 2AUCA 2LLSA 1QX7A 4WVZA 3H1KG 1OW8A 1FE6A 1A03A 3TUYB 2BBMA 2BBNA 1KSMA 3L74E 5J3XA 2WCKA 1YUSA 4PV1D 1JMMA 4OKHA 2EGDA 1P84I 1RE3C 3H1HJ 2FXMA 4DOJA 3B6XA 5KLVE 2EHBA 1LT1A 3SG4A 1W5CE 5PALA 4PV1B 2BCXA 3RBXA 2BCBA 3CR2A 4IFFA 1AJ4A 1NP8A 1CKKA 1RF1A 1SNLA 1B7TY 3H1IJ 2KSPA 1B1GA 3F89A 2K8MB 2W6AA 1KK8B 3EK4A 3D76A 3P32A 1USEA 5DKQA 1LJ2A 2WPSA 3PSRA 1SQVE 1PVAA 1CB1A 1AFOA 4M3LA 1LT9B 1NTMD 1QJTA 4DIRA 2L4HA 1URQB 3B71A 5KJ7A 3D10A 3BYAA 2KSJA 4MZJA 1IJ6A 5AW0B 1JBAA 1MXLC 1YHQP 2JT0A 2QPTA 1B4CA 1OOFA 1A75B 3HD7C 5TISE 2Q4UA 5AANA 2KZIA 1Y8AA 1N86A 2E42A 3L71E 1IFIA 1OZSA 4ZKUA 4F0ZB 1MZ9A 1HGZA 2HFED 1LS8A 1QATA 4OGQD 2VRGA 1HTLC 3H1JD 4RKUJ 4CLNA 2GV5A 1ODBA 3FS7A 1LP1A 1QASA 3BUNB 2IFMA 3Q5PA 1BJFA 5EFWB 3I5GC 5CJ0A 1CFFA 3SS4A 4PALA 3E1IA 4OGQB 4DRWA 1OOJA 1S2EA 5KLVG 5AVQB 1P84E 2SPZA 3CCUP 1BCCJ 2M1UA 5CJ4A 5TJHA 5K5GB 2F2PA 1LTJA 4GBAA 3M0WA 3PJSK 1ZN5A 2CXJA 1B8RA 1PGPA 1K04A 2Z5IA 1YUTA 1SQVG 4N6JA 5AVSB 3R1VA 2WTYA 2PMYA 2XKMA 1PALA 2R5DA 1KQMC 1RK9A 2QSIA 4L75A 3AEBC 1FZCB 2M8UA 2MA2A 2DW3A 1IG5A 3VMYA 2E43A 4INXA 2KQYA 1SVFA 3L73D 4I7ZC 4CIDA 4HB1A 1RY3A 2QG4A 1X79B 1SQBE 1S9KE 2WCJA 2IPPA 1BOCA 2YIUB 3PRJA 2PSRA 1AQTA 5AVWB 2O5GA 3CR5X 3L71G 4PHMA 2YO3A 3MZWB 1SQPG 2ZRSA 3EK8A 2Q1KA 2MAZA 1PSBA 4YBHB 1Y47A 5DJTB 1NTZK 3CWGA 3R1PA 1QX5B 1KB9H 2WSEH 3BUOB 4XYNA 3GG2A 1NYAA 3SFEC 4USLA 1PVBA 1X9VA 1KV4A 1SCMC 3L70J 2P7JA 4ORCB 1R5LA 1ZLLA 4MRXA 3TS5C 4D6TE 2JWWA 2L5YA 1AVSA 4NQGA 5D3OA 1XA5A 4C0LA 2FYZA 2BCAA 2BKHB 3IVTA 1JF0A 3RK3D 5D69A 2OYHC 1NO4A 3QWOC 5EL2A 2LP3A 3EKHA 3I5CA 4OZDA 4OVNF 2ZRTA 1BGYD 3RK3B 3B4SA 1KILD 2Y1MA 3AE9C 3KO0A 1R8EA 1KFMA 2B89A 2ZNDA 2PFXA 1XO5A 1SQXE 2E74C 2I1JA 2A06E 1YJNP 1K8AQ 3OB2B 2JT3A 2LHLA 1CW5A 1UP5A 2K88A 3O2PA 2KLVA 1N7SA 1KQSO 1KILB 4FTGA 3DVJA 5D7FA 5M1BA 3CS1A 3FWNA 5KJ7D 1KTMA 2JJLA 3CDNA 2LMUA 4L9MA 3WNXB 3TUYC 3BUWB 5I8NA 4GKGA 5CCGC 1CM1A 2ZVOB 1GK4A 4W80A 4GOFA 1AJ5A 2KLEA 2QEBA 3B88A 1YUUA 3A0BE 2OYIA 5E79H 3KDPB 1TCFA 1SQBG 2OPOA 3CC7P 3AE6C 4PV1C 2WCMA 1NH4A 5AXIA 3L75E 1RWYA 5HYDA 2IDBA 2IYPA 3TK1A 2K7OA 4IL1A 5B8IB 1WY9A 2QEOA 4C7RA 1DIPA 2E5TA 3EVUA 2O3JA 1L4AA 1EQ7A 2LUCA 2JR8A 1KK8C 1QXPA 1DF0A 1R2UA 2WPVB 1LT9C 1M8OB 1RJVA 2FFDC 4D6TG 4IJ7A 1BDDA 1CLLA 1URQC 3BOWA 1LP1B 2LVVA 4GFTA 2M3BA 2Q3IA 1FJKA 1EL4A 2M5AB 4XA4A 1ALWA 2QDIA 4XFJA 2K7CA 3VMZA 1T14A 3N7NA 3TZ1A 5KLVD 1A02F 2JNXA 1MXEA 5KAIE 2BE6A 3M9QA 2D2CC 2W83C 2O60A 4WY4A 1SQXG 1QWVA 3VRPA 1VL2A 1J55A 2NCPA 1YRUB 2K0JA 1U7JA 3A4UB 4EIJA 3BUXB 1OXZA 3FIAA 1DELA 2YO2A 2XDJA 2JPOA 5GTHE 2YXRB 1SQVD 3AEDC 3N4XA 2WSSH 1FOSF 3I5FB 3CPWO 3CWBD 1LA0A 2CCMA 3SIAA 4FQTA 1M39A 3MIWA 1NWQA 3R72A 1N7LA 5B66E 2KNCA 1YITP 3MP7B 1YQ3C 1QV0A 1KK7Y 5FI2A 1VQ5P 2H61C 1VDFA 3CLQA 3BFAA 1J7QA 3L75G 1Q2NA 1NUBA 3TGUE 4MZLA 1GMJA 4BY5A 4HRHA 1HGVA 2FXOA 5AW4B 3L74J 4YXWH 2Y9YA 3L71D 1GD2E 1F70A 2E30A 1L0LJ 1SQPD 1KCYA 5AW8B 1CDLA 1SL7A 1LTSC 1WT6A 3HE5B 3HE4A 1PP9J 3U59A 2R32A 1R5SA 1SQXK 1VQMP 2KQ6A 2AAOA 3AEFC 2F33A 2IS9A 2I94A 2ZKMX 1MKMA 4N78E 1FZCC 1GL2A 3I5HB 2K61A 5FYXA 3O4YA 3BASA 4K3AA 1NTZJ 1SYMA 1NTKJ 3EWKA 3H1JE 4N5XA 1BODA 4AQIA 4ASWA 2KPHA 4H13D 2CBLA 3OBVA 5CCHA 3EFGA 3CMEP 2M3WA 1UHKA 2K37A 2W27A 1BSHA 1QX8A 1OOGA 1P84D 1JY3P 1XVJA 3AE7C 3M91A 4H13B 1N7SD 1IWQA 1LWUC 1E5WA 5APWA 2KHNA 2LE9B 1JY2P 1HBWA 3AECC 1GZLA 1YTZI 3AE2C 5CSFA 1QL1A 3V2NA 1N7SB 3D6YA 4TLFA 2BCCJ 1S36A 1BE3J 2KOGA 1WRZA 1NYHA 3OJAB 1TCOB 1K9PA 4M2OA 3H1LD 1NSHA 1JO5A 1YYCA 3PALA 4CPGA 3LW5J 4XJKB 1LTGC 1X22A 2PALA 1QEXA 3LK1A 4YI9A 3AKBA 2OYIB 2G2BA 3EK7A 4UPGA 3H4SE 4DT0A 2KIKA 3TGUG 1NU1J 2JRFA 2JZIA 2QA4P 1L4AD 2LLTA 1FS0E 3L73E 2OARA 2EC6B 1S26D 2WORA 1SQBD 1ZOYC 2YMYA 2FYNB 2L2EA 1KORA 1YBKA 3O4XA 1JNMA 3VRQA 1KILC 3M0DA 2M3EA 2HG5D 2Q3EA 1UUSA 1FBVA 1MHOA 2ZT9C 2ERBA 5KSZA 1DX7A 1X02A 3H1JG 3C9IA 4YPCA 1OWAA 3HUSA 1RF0A 1VQOP 2E5YA 5G08A 1W9ZA 2H8PD 3GK4X 2H43A 2LXCB 4WY4D 1ZUZA 1NTMK 3RK3E 1UIIA 1M1KQ 3GK2A 3HCMA 1AA0A 1KMIZ 2F8PA 1OZOA 3OW2O 3JVTB 3DZTA 3VRRA 1FZFA 2J5UA 1C7VA 3WUVA 4WY4B 2WC6A 1PK0D 5APVA 5GQQC 1BGYE 3A2AA 1D7MA 1Y1XA 1RE4C 1CMGA 4TT3H 1DJGA 1JUOA 4ZMDA 3L72D 2JULA 5APXA 1H8BA 3S4RA 4U3FJ 4I5LB 4AOMA 3P7KA 1N8RQ 1WRLA 5H2FH 1S6CA 1FAVA 3Q2YA 4DS7A 2LM5A 3EFFK 1M7LA 1UHIA 1ALVA 2JQ6A 1IFPA 2LV7A 3SWYA 2W6JH 3B8EB 1M1JA 3AKAA 4I1LA 5KAFH 3GOFA 1G8IA 1IJDB 3LIDA 2JOJA 3L73G 4BXLA 1ZP0C 1U5IA 1OVRA 2AXTE 1B8CA 1PGJA 1RQUA 5I2LA 2LMVA 1JUNA 1L2PA 2SCPA 2CTNA 3HRNA 3L37A 3SFDC 1E8AA 2F3ZA 4N1FA 2HPCA 1JWDA 2PRRA 5B5EH 1NKNA 1FC2C 1GL2D 3HTKA 1L0NJ 3MD0A 1X0TA 3HE4B 3RGUA 3RM1A 2WSCJ 5CCHD 3I5FC 2Y0DA 2Y5IA 3FGAD 1U7MA 2ZXEB 3H1ID 4FQOA 1RHZB 3RL0C 1CFCA 1GL2B 5IBWA 4JYCA 3NMDA 4DUQA 2HR3A 2OQQA 4ICBA 2FYUJ 1J1DB 4IOIH 1IRJA 5FI7A 2XNDH 3EG5B 2CT9A 2NZ2A 5APYA 1YJ9P 1MUUA 2V7QJ 3LLEA 4YGAA 5JOLA 1OW7A 4UB8H 2K60A 3EVRA 4I5NB 2YKPA 3M9HA 1C3YA 1CI6A 2QJPB 1SR6B 3NSLA 1VQKP 1BGYG 1JF2A 1B9AA 4GUKA 3KPEA 4GT1A 3AAKA 3TSIA 1TNWA 1SLQA 4INWA 2K9JA 1EC5A 1HQVA 5AVZB 3I5HC 1SQQE 3OAKA 1KB9D 1WLMA 1XTCC 3LCPC 3VP8A 1OSAA 3DXLA 1S5LH 3D78A 1N73A 2LR2A 3CWBE 3Q1MA 2BASA 2QEVA 4NDBA 1CDNA 1EJ3A 1VRKA 3CL3D 1PL5A 1YJWP 2E76D 1OOIX 3RBZA 3TGUD 1FI6A 3TDZA 5L8RJ 4AQRD 1SS1A 1A02J 5AVYB 1DVIA 1EDJA 1BCCD 2BL0B 4PE1A 1N7SC 3P8CD 3DD4A 4YTPC 3C8VA 1AHRA 3BCCE 3FE9A 5KTYA 3RLZA 4KHXA 4KT0J 4YGBB 1TNXA 4BRYB 5AFPA 2WSCH 2IZ0A 5KLIB 5AERA 1SQPE 1G2CA 2JEEA 2KZJA 1N0YA 1T2KC 4N78D 1PGQA 1OOHA 2BAPA 2FJUB 3HUSB 3O6QB 1K95A 2OYOA 3TF5A 3D70A 3TNUA 2P2UA 2V7QH 2EC6C 1S5GZ 2F3YA 1LA3A 2M29A 2RN0A 5KAFE 2E75D 1OW6A 2FYNC 1NVOA 3CD6P 3PLFB 3KYQA 1HJ0A 3A0HE 5BVZA 2Y9ZA 3UNWA 1GK6A 2H88C 1OE9B 1IK9A 1NTMJ 2E75B 1MQ1A 3D77A 1IK7A 3VTPC 3CZ2A 1YVHA 1LGHB 1BG1A 3B86A 2JC2A 1J1EA 2P1JA 1SQQG 2WWWA 4O9BA 3KPXA 4Y99C 4XE5B 2DOQA 1JM0A 5APUA 3TYYA 2Y1NA 4A7PA 4BY4A 4IL6H 4I2LC 1L2OB 1M63B 3CWBG 1PRWA 1SFCA 1QV1A 2HETA 2NXQA 3H1LE 5CBNA 1M1JB 1NTKG 5GTIE 1OQPA 3USSA 4MRYA 4PHKA 4NPDA 4PD4H 3PHLA 1AK8A 3JVTC 3SSUA 1VQ8P 3BATA 1N2DA 1NHLA 2ZVNB 3CCQP 4WY4C 2LMTA 2P10A 3L36A 1RROA 3GMAA 3WXAA 3GF3A 2HPCB 1MFTA 2L98A 2KI4B 4OR9B 1M45A 4I5KA 3BCCG 1WDCC 5JJGA 1KQGB 3UIAA 5KLVK 2FBWC 1TUJA 3OA7A 3OB1B 1XK4A 2KFGA 1VQ9P 1OFCX 2V53A 2ISDA 1CFDA 5KKZB 5ER5A 2QJYB 1LXFC 1IFJA 5HL1A 1SQQK 2QJKB 1DEEG 3CR4X 3AAJA 2KP8A 2HLOA 2N9BA 3PN7B 1RE3A 3KHEA 1SQVK 1SRAA 4QJ3B 2WVRA 4GGFA 3ZWHA 2KXPB 1BU3A 1Q7YQ 3DVEA 1CI6B 1LNQA 5CPVA 5AW6B 2UWJE 3EVVA 3SS5A 1FBMA 5AW5B 3T97A 1USDA 1W7JB 2JTZA 4H44D 1RF1B 1CM4A 1GTWA 1GL2C 1G1IA 1JC2A 2MKVA 3L72E 4LGDE 1J1DC 3CX5H 1JY3O 3V6IA 2NLNA 1B7TZ 1SQPK 3H1LG 1MFZA 1RTP1 1BR1B 2FOTA 1F55A 2XV5A 1TOPA 1KB9I 1N73B 4H44B 2Q6QA 1CFPA 1W2EA 2HODA 2FKWB 2Y0EA 1DEBA 4JYBA 1EXIA 1YVLA 5AW9B 2BKIB 2QJPC 3HD7A 1SR6C 2Q7CA 4L73A 3IQOA 2J58A 2M9GA 1ZFSA 1NX2A 1FI5A 1RFJA 5HLVA 1A29A 4RO0A 3OX5A 1H89A 3H1HE 3D73A 3CCJP 3H1KJ 1NX3A 4JF7A 3E3RA 1AVYA 1RH5B 3BQ3A 3IF4A 1AJYA 3WUTA 1TN4A 5CSIA 4NDDA 4ORAB 1KWOB 2JKVA 5BPJA 2YMKA 4H0LD 4L74A 3H1IE 1G4YR 4HREE 1BSNA 2IZ1A 4PE0A 3S0BA 4MLWA 1QVIY 2KSEA 1CDPA 3TNUB 2A45H 3I55P 2Z4EA 3FWBA 1JY3N 4JKTA 1KC8Q 1NJIQ 4YI8A 1DT7B 3W67A 2P67A 1W2BO 1VQLP 3V4QA 1R6PA 1Y1UA 3NSOA 2JWAA 2BL0C 2O01J 1KYOH 3LK0A 3FWLA 1DJXA 1SQBK 5KLIC 2Y0CA 2WT7A 1QL2A 1J1EB 3NSIA 1SFCD 1VF5D 4UB6H 4I5JA 3L72G 1LTJB 1EDLA 1L0LD 1SQQD 3KF9A 4IFMA 4JBZA 1T3UA 1PP9D 3CZ1A 1K8UA 5APTA 2PAJA 1VF5B 2FJYA 1BT6A 2G9BA 3SG6A 2H2KA 1KB9E 4EI2A 1IFDA 4HKZH 3HX4A 4MZKA 1JFJA 4OGQC 1SCVA 1NTKD 1TRFA 2A45I 2GM4A 3VB1A 2KB7P 1DGVA 5BU5A 1JCDA 2L2CA 1SK6D 1KFUL 2CPBA 4MN4C 2P58A 1SSEB 2L5GB 3H1HG 3CC2P 4YGDB 2PVBA 1NCZA 1Z2CB 1HF9A 3BCCD 4WQ2A 3BFBA 1OZHA 3N7HA 1L7ZA 1BCCE 2MJZA 1JB0J 3P8CE 1L2OC 4Q04A 2KAVA 3TDUA 3FXEA 3G6EP 2WSFJ 1LKJA 1FZAA 1C07A 3H1IG 1M1JC 5KLVJ 2ZYGA 1K2HA 5AW2B 2P70A 2KBIA 5BU8B 3GHGA 4OWFA 1IKUA 1KQLA 1B8LA 2W8ZA 2CPSA 1WRGA 1BMOA 3IN6A 2NRGA 1QS7A 1G1JA 1PPJD 3CXHH 2J59M 2KI4C 1YURA 1NU1D 2YIUC 2KAYA 1SQVJ 1NX1A 4YRUA 3PATA 2WITA 1HJBA 3EKJA 5E79E 1YI2P 1NAFA 2F2OA 4C7NA 2LUXA 2KI7B 2QE7H 4HRGA 1AV1A 2HF5A 3V2RA 5KKZC 1JMBA 3MUDC 4AYCA 5DKNA 3G71P 3K1EA 4CFRA 1KQVA 2VRSA 5I2QA 3II6A 3K21A 4KYNA 2NPSA 1K73Q 4QJ4B 5CCGA 3JTDB 1T8ZA 3HD7D 3ITKA 3A8RA 2QM7A 3DF0A 2ZFCA 1CDMA 1IZNB 3M9BA 3WUUA 2HODB 3L71J 2ZJSE 3L70E 1SQPJ 2ZYDA 3CI9A 3HD7B 3K5BA 1JEKA 2KLUA 2WOSA 2JP3A 3VMAA 5APSA 1X8YA 3Q3DA 2N1TA 3PLNA 4M2QA 2ZN8A 3B5NA 3RK3C 4NDCA 3WHUB 3CXHI 1PV3A 1MR8A 1JSAA 3D6ZA 1Q80A 1YX8A 1BCCG 1T3JA 1RF1C 1MUXA 3M0AA 1GW3A 3E7KA 1CLBA 1H8AA 4QMAA 1L4AB 5CSNA 1YTZC 1J7PA 2FFDA 3H6PA 3B87A 1URQA 1DF0B 4UB6E 3V2QA 4H44C 2MLFC 3I5GB 3AE1C 4CPVA 2JPTA 2B1UA 4ZKPA 1NX0A 3PP5A 1Y6WA 3BOWB 2L50A 1XYDA 4F7FA 1KFXL 2OTGB 1Y1AA 4K35A 1PIXA 5KJ7C 1P28A 4CFQA 2Y4QA 5AW1B 1G33A 3Q5RA 5HKYA 2XZRA 1DEKA 1ORGA 3NFQA 2N9YB 3D75A 3R4YA 3PM8A 4P2YB 1S1CX 2IYOA 1PFIA 3ZNIA 1QX2A 2O01N 2LHIA 3AE4C 2LVKA 3KZIH 2KGBC 3SWKA 4MBEA 5AVUB 1L0ND 3MHVA 1KWOC 1NCXA 1K9KA 4L76A 2MBXA 1DJYA 2I8DA 3MTUE 1SQBJ 2Q9IA 5HKZA 2C9NY 1NOHA 5TISH 4JWQA 1TNPA 1K90D 4I7ZB 3L70G 1TU3F 1IJ5A 2HQ8A 3LW5H 2A45G 4PHNA 2HYNA 2KNCB 1HH0A 3NHTA 3OP0A 2QRXA 1CNPA 5AVRB 1S72P 1UHNA 2A4JA 5KTBA 1KK7Z 3CXHE 3H25A 3H1HD 4D6TJ 1XFUO 3G4SP 1LTJC 2K9YA 1DD4A 2LAPA 3PH0A 1JCCA 1TUZA 2LNKA 2LP2A 2PASA 1SCMB 3TDIA 1IO4A 5TNCA 2GUSA 1OVVA 2I18A 4A4BA 1FZCA 5K89A 1M46A 3D74A 3KXDA 4P5OE 2G8YA 3CC4P 2GA1A 4PT1A 3CCVP 2C0WA 3BRVB 5HKWA 2QVAA 3GHGB 1D1OA 1UWOA 3JCUH 2JO1A 2IBZD 1SQXJ 2E74D 2OTKE 2K2AA 1ZOTB 1ZR2A 2JT8A 1WMKA 3S9OA 1FDMA 2XNXA 4Y28J 1LWUA 1S3JA 1F71A 2KNEA 1Z56A 2RKLA 4PD4D 4Z1MH 2KYVA 2OTLP 2K2FA 2E74B 2NPSD 1DC1A 2XU6A 5CCGD 1V1FA 2KYFA 1M56D 3CZTX 4HJGH 3KEVA 1A4PA 1LVCD 3R2PA 3VYIA 2NPSB 1XFVO 3BVHA 3NTNA 2PRUA 3FE8A 1Y9BA 2M7LA 3L75J 1L0LE 2AEFA 4EYYQ 3DF0B 1UHHA 5ER4X 3Q8IA 1LTTC 1PP9E 4OV2A 4GGFC 2N1TD 3B5ND 5CHXA 3PFVA 3QRXA 2M0RA 1CMFA 2BNXA 5KU1A 2OGUA 4N3YB 2WNDA 1NTZE 1NTKE 1FJPA 3WMM0 3R1OA 1EZVD 1SL9A 4WQ3A 1Q81Q 3CCSP 1B47A 1MWNA 2N1TB 4H13C 3B5NB 2B87A 3RK2D 4HSZA 1KN7A 1KILA 1DGUA 1URQD 2GGMA 3V2PA 2JTTA 2L4IA 1VQPP 2WC8A 3L35A 3CABA 2E76B 2KUBA 2LLUA 2YGUA 2KK7A 3RK2B 5HLOA 2FFDB 1QIWA 1C3ZA 2ZNEA 3JTDC 4MEWA 3KZIE 1IQ5A 2CNPA 2OTJP 3TDKA 1VQ4P 3PTZA 4M2PA 2C9LY 3CX5D 1K93D 2FY8A 2D2CD 2BCCE 1BE3E 2Z5HA 3UO9A 1F54A 2OYIC 5H2FE 2M49B
chains in the Genus database with same CATH topology
1TOPA 2KQ6A 2MHHA 2AAOA 2F33A 1WDCB 2IS9A 2I94A 2WCFA 1WLZA 1CFPA 2FCDA 2ZKMX 2COLB 3I5HB 2K61A 2BE4A 4JPZB 4YGCB 5FYXA 3O4YA 4ORBB 1SYMA 4N5XA 2KFHA 1YVLA 1YR5A 2BECA 4AQIA 1BODA 2BKIB 1Y0VH 2ZN9A 1JFKA 1SR6C 2CBLA 3SG2A 1UURA 3IQOA 2GGZA 1UHKA 2M3WA 1BF5A 2M9GA 1ZFSA 1NX2A 1FI5A 3VRNA 1NWDA 1RFJA 5HLVA 1A29A 3SIBA 1XFXO 1XVJA 2KAXA 1QIVA 1BLQA 3OX5A 4ZCVA 1DJHA 1EG3A 1TIZA 3TS5B 3MSEB 3D0YB 1NX3A 2KYCA 1IWQA 2LCPA 2KHNA 2L51A 1V1GA 2LE9B 2Q91A 3E3RA 2MLEC 3SG7A 2I2RE 2KI6D 3BQ3A 1F4QA 2OTGC 1F55A 5CSFA 3I5IC 1EG4A 3O78A 1TN4A 5CSIA 1EH2A 4N1GA 4NDDA 1KWOB 4ORAB 5F6TA 5BPJA 3SJSA 1S36A 1YRTB 1OMRA 1WRZA 1IQ3A 1G4YR 1TCOB 4R1EA 1SPYA 1K9PA 4HREE 1TNQA 4PE0A 3GK1A 4MLWA 4M2OA 1QVIY 1CDPA 1NSHA 1NPQA 1U5IB 3PALA 3FWBA 2ZFDA 5AEQA 2NZ0A 1XK4C 4XJKB 4ETOA 2PALA 1SW8A 1XFZO 1QLSA 3LK1A 4YI8A 1DT7B 4YI9A 3AKBA 2AUCA 1A2XA 2LLSA 1R6PA 4A4CA 1QX7A 1Y1UA 2G2BA 3EK7A 4UPGA 3H4SE 3NSOA 2BL0C 1A03A 2JRFA 2JZIA 3TUYB 2BBMA 2BBNA 2LLTA 3LK0A 1KSMA 2EC6B 1DJXA 1S26D 2WORA 5J3XA 1YUSA 2KFFA 4OKHA 3BUMB 2EGDA 3NSIA 2JXCA 2L2EA 4I5JA 5CSJA 3VRQA 2EHBA 3CLNA 3KF9A 3SG4A 3SG5A 1M31A 4PCWA 5PALA 1FF1A 2LC5A 1F8HA 2BCXA 1UUSA 1K8UA 3NSKA 2BCBA 3CR2A 1FBVA 1FPWA 1AJ4A 1MHOA 1BT6A 1QTXA 1NP8A 2G9BA 3SG6A 5KSZA 2H2KA 3FWCA 1CKKA 1SNLA 1X02A 1B7TY 3HX4A 4MZKA 2KSPA 1B1GA 1JFJA 1SCVA 1XFWO 2K8MB 1KK8B 3EK4A 1TRFA 1EXRA 2L5XB 5DKQA 4MSPA 3PSRA 1DGVA 5G08A 1SK6D 3GK4X 2WCEA 1KFUL 1PVAA 1CB1A 1ZUZA 1UHJA 1QJTA 4DIRA 2L4HA 2HPSA 3GK2A 3HCMA 2F8PA 2JU0A 1OZOA 4YGDB 2PVBA 1NCZA 3JVTB 3VRRA 3D10A 4DCKA 4WQ2A 3BYAA 1L7ZA 4MZJA 1IJ6A 1C7VA 1JBAA 1PK0D 1J7OA 1MXLC 1L2OC 4Q04A 2KAVA 2JT0A 3TDUA 2QPTA 5GQQC 1B4CA 1A75B 4OCIA 1Y1XA 1LKJA 1HT9A 1CMGA 4WRIA 2Q4UA 5AANA 1C07A 1DJGA 1JUOA 2JULA 1K2HA 3LL8B 1H8BA 2AMIA 4I5LB 4AOMA 2KBIA 3BXKA 1WRLA 1OZSA 1S6CA 1IKUA 4DS7A 2LM5A 1B8LA 1CLMA 4F0ZB 1UHIA 1BMOA 2M97A 1ALVA 2JQ6A 1J7RA 2LV7A 1QATA 1QS7A 4D1EA 2VRGA 3AKAA 3GOFA 1DTLA 1G8IA 2KI4C 4CLNA 3VGOA 1YURA 1C7WA 2GV5A 1ODBA 2JOJA 3FS7A 1QASA 1K96A 2KAYA 1IH0A 1NX1A 3BUNB 4YRUA 3PATA 1BJFA 1U5IA 3EKJA 3I5GC 1CFFA 1B8CA 1DMOA 2F2OA 4PALA 5I2LA 2LUXA 4C0KA 4XJKA 4DRWA 3O6BA 2LMVA 4HRGA 1OOJA 2SCPA 2HF5A 2CTNA 4YGEB 4U8DA 1E8AA 2F3ZA 4N1FA 5DKNA 1JWDA 4MVFA 4CFRA 1KQVA 4PE7A 5I2QA 4PHJA 3DVKA 2K7DA 3K21A 4GPLB 4QJ4B 2M1UA 2MJWB 2P6BB 3JTDB 3RM1A 3I5FC 3C1VA 2Y5IA 3A8RA 2F2PA 3DF0A 4TNCA 1CDMA 2M7NA 4FQOA 1NIWA 1CFCA 2JXLA 4GBAA 3M0WA 5IBWA 2CXJA 1SBJA 4DUQA 1B8RA 4ICBA 1CTRA 2OS8B 3NXAA 1YUTA 1IRJA 2PMYA 2WOSA 2CT9A 1PALA 3DVMA 1KQMC 1RK9A 4M2QA 2ZN8A 3LLEA 4NDCA 3WHUB 2FCEA 2M8UA 1MR8A 2MA2A 4YGAA 1JSAA 5JOLA 1IG5A 1Q80A 1YX8A 4QJ5B 2KQYA 3EVRA 4I5NB 1MUXA 2HQWA 4CIDA 1SR6B 3NSLA 1CLBA 1DJIA 1JF2A 1B9AA 4GUKA 5CSNA 1YTZC 1FW4A 1J7PA 2I7AA 1BOCA 1DF0B 2PSRA 1SMGA 3AAKA 1TNWA 4GNKB 2MLFC 2O5GA 1BR4B 3CR5X 3I5GB 4AQJA 4PHMA 4CPVA 1HQVA 2B1UA 2JPTA 3I5HC 2ZRSA 3EK8A 1NX0A 2LANA 1PSBA 1Y6WA 2MAZA 2L50A 1SY9A 3BOWB 4YBHB 1XYDA 1OMVA 1KFXL 1WLMA 2OTGB 1Y1AA 3CWGA 1QX5B 3LCPC 1OSAA 4CFQA 3I5IB 1K94A 2D8NA 2LVJA 2Y4QA 3BUOB 3SG3A 4XYNA 1NYAA 1G33A 4USLA 1PVBA 1PULA 1SCMC 5HKYA 4NDBA 1CDNA 2WCBA 4ORCB 3OX6A 1EJ3A 1VRKA 2R2IA 4C0JA 4MRXA 3IQQA 3TS5C 2JWWA 2NCOA 3WHTB 1AVSA 3PM8A 4NQGA 4P2YB 1YX7A 1XA5A 3ZNIA 1QX2A 2BCAA 4C0LA 1FI6A 2BKHB 1JF0A 3TDZA 2LHIA 2E6WA 5D69A 3VROA 2LVKA 2TN4A 2KGBC 2QACA 4GGNA 2LP3A 3EKHA 1DVIA 4MBEA 2BL0B 4PE1A 1KWOC 3DD4A 2K7BA 4OVNF 4PDZA 1NCXA 1K9KA 2ZRTA 3D0YA 2JNFA 1AHRA 1RECA 2Y1MA 3CGAA 3CTNA 2MBXA 3RLZA 5KTYA 4YGBB 1DJYA 2KI6C 1TNXA 5HKZA 3KO0A 5AFPA 4JWQA 5AERA 2ZNDA 1S3PA 1TNPA 1N0YA 1XO5A 1H4BA 1K90D 3OB2B 2JT3A 2LHLA 1UP5A 1GGWA 1IJ5A 2HQ8A 3O2PA 3OHMB 2KDHA 2FJUB 4FTGA 3DVJA 5D7FA 4PHNA 1K95A 3CS1A 4JQ0D 2SASA 1KFUS 2LMUA 1KSOA 3OP0A 4L9MA 3WNXB 1K9UA 3TUYC 3BUWB 1CNPA 5I8NA 1UHNA 2A4JA 1KK7Z 2EC6C 1CM1A 1S5GZ 2F3YA 1LA3A 2M29A 2KGRA 1AJ5A 1J1DA 4PE4A 1S6IA 3ICBA 1WRKA 1XFUO 1NCYA 2KOTA 1YUUA 2LAPA 1AUIB 3IF7A 3PLFB 1TCFA 2LNKA 1MF8B 2Y9ZA 2OPOA 2MRDA 2LP2A 2PASA 1SCMB 3TDIA 1S6JA 1OE9B 5TNCA 2I18A 5AXIA 4A4BA 1MQ1A 5K89A 1M46A 1W7IB 4GAOA 1RWYA 1YVHA 5HYDA 1BG1A 4P5OE 3PN7C 2K7OA 2JC2A 1J1EA 4IL1A 5B8IB 1WY9A 3KPXA 3EVUA 2DOQA 5HKWA 2LUCA 1KK8C 2M1KB 2Y1NA 4BY4A 1L2OB 1D1OA 5I2OA 1M63B 1N65A 2L0PA 1UWOA 3F45A 1QXPA 1PRWA 1DF0A 1QV1A 1R2UA 2K2AA 2HETA 1ZOTB 1DJZA 2NXQA 1F4OA 2JT8A 5DKRA 1RJVA 1F71A 2KNEA 1OQPA 1CLLA 3BOWA 2LVVA 4MRYA 4GFTA 4PHKA 1AK8A 1IGVA 2K2FA 3JVTC 1EL4A 1N2DA 1ALWA 2LMTA 1V1FA 2K7CA 1RROA 2KYFA 3WXAA 2L98A 2KI4B 3CZTX 4OR9B 3KEVA 1M45A 1A4PA 1LVCD 4I5KA 3TZ1A 1WDCC 5JJGA 4MN0A 1XFVO 2JNXA 2PRUA 1MXEA 2LVIA 3OB1B 1XK4A 2KFGA 2BE6A 1GGZA 2O60A 2M7LA 1OFCX 1DJWA 2V53A 3VRPA 2ISDA 1CFDA 2RGIA 3DF0B 1UHHA 1J55A 5ER4X 5ER5A 1XFYO 2NCPA 1A75A 1YRUB 1LXFC 1ZMZA 2K0JA 4GGFC 4OV2A 3PFVA 3QRXA 3A4UB 1QVIZ 3BUXB 2M0RA 1CMFA 3FIAA 5KU1A 1OMDA 3CR4X 3AAJA 2WNDA 3I5FB 1SL9A 1SKTA 1TTXA 3KHEA 3PN7B 1B47A 1MWNA 1SRAA 4WQ3A 1LA0A 2CCMA 4QJ3B 3SIAA 1M39A 4GGFA 4HSZA 3ZWHA 1DGUA 2GGMA 1BU3A 2JTTA 1ZACA 3DVEA 2L4IA 2WC8A 1QLKA 1QV0A 1KK7Y 1S5GY 2H61C 5CPVA 2LLUA 1GJYA 1J7QA 1GQMA 3EVVA 1KQMB 4ZCUA 1NUBA 5HLOA 4E68A 1QIWA 2ZNEA 3JTDC 1PSRA 4MEWA 1IQ5A 1W7JB 4MZLA 2CNPA 2JTZA 4BY5A 4HRHA 4M2PA 1CM4A 1SL8A 2Y9YA 1JC2A 2H61A 1K93D 1KFXS 2OS8C 1F70A 2E30A 1S1EA 1KCYA 1AP4A 2NLNA 1B7TZ 1CDLA 1SL7A 1LINA 1F54A 1RTP1 2KBMA 1BR1B 2FOTA 2M49B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TOP A;  2KQ6 A;  2MHH A;  2AAO A;  2F33 A;  1WDC B;  2IS9 A;  2I94 A;  2WCF A;  1WLZ A;  1CFP A;  2FCD A;  2ZKM X;  2COL B;  3I5H B;  2K61 A;  2BE4 A;  4JPZ B;  4YGC B;  5FYX A;  3O4Y A;  4ORB B;  1SYM A;  4N5X A;  2KFH A;  1YVL A;  1YR5 A;  2BEC A;  4AQI A;  1BOD A;  2BKI B;  1Y0V H;  2ZN9 A;  1JFK A;  1SR6 C;  2CBL A;  3SG2 A;  1UUR A;  3IQO A;  2GGZ A;  1UHK A;  2M3W A;  1BF5 A;  2M9G A;  1ZFS A;  1NX2 A;  1FI5 A;  3VRN A;  1NWD A;  1RFJ A;  5HLV A;  1A29 A;  3SIB A;  1XFX O;  1XVJ A;  2KAX A;  1QIV A;  1BLQ A;  3OX5 A;  4ZCV A;  1DJH A;  1EG3 A;  1TIZ A;  3TS5 B;  3MSE B;  3D0Y B;  1NX3 A;  2KYC A;  1IWQ A;  2LCP A;  2KHN A;  2L51 A;  1V1G A;  2LE9 B;  2Q91 A;  3E3R A;  2MLE C;  3SG7 A;  2I2R E;  2KI6 D;  3BQ3 A;  1F4Q A;  2OTG C;  1F55 A;  5CSF A;  3I5I C;  1EG4 A;  3O78 A;  1TN4 A;  5CSI A;  1EH2 A;  4N1G A;  4NDD A;  1KWO B;  4ORA B;  5F6T A;  5BPJ A;  3SJS A;  1S36 A;  1YRT B;  1OMR A;  1WRZ A;  1IQ3 A;  1G4Y R;  1TCO B;  4R1E A;  1SPY A;  1K9P A;  4HRE E;  1TNQ A;  4PE0 A;  3GK1 A;  4MLW A;  4M2O A;  1QVI Y;  1CDP A;  1NSH A;  1NPQ A;  1U5I B;  3PAL A;  3FWB A;  2ZFD A;  5AEQ A;  2NZ0 A;  1XK4 C;  4XJK B;  4ETO A;  2PAL A;  1SW8 A;  1XFZ O;  1QLS A;  3LK1 A;  4YI8 A;  1DT7 B;  4YI9 A;  3AKB A;  2AUC A;  1A2X A;  2LLS A;  1R6P A;  4A4C A;  1QX7 A;  1Y1U A;  2G2B A;  3EK7 A;  4UPG A;  3H4S E;  3NSO A;  2BL0 C;  1A03 A;  2JRF A;  2JZI A;  3TUY B;  2BBM A;  2BBN A;  2LLT A;  3LK0 A;  1KSM A;  2EC6 B;  1DJX A;  1S26 D;  2WOR A;  5J3X A;  1YUS A;  2KFF A;  4OKH A;  3BUM B;  2EGD A;  3NSI A;  2JXC A;  2L2E A;  4I5J A;  5CSJ A;  3VRQ A;  2EHB A;  3CLN A;  3KF9 A;  3SG4 A;  3SG5 A;  1M31 A;  4PCW A;  5PAL A;  1FF1 A;  2LC5 A;  1F8H A;  2BCX A;  1UUS A;  1K8U A;  3NSK A;  2BCB A;  3CR2 A;  1FBV A;  1FPW A;  1AJ4 A;  1MHO A;  1BT6 A;  1QTX A;  1NP8 A;  2G9B A;  3SG6 A;  5KSZ A;  2H2K A;  3FWC A;  1CKK A;  1SNL A;  1X02 A;  1B7T Y;  3HX4 A;  4MZK A;  2KSP A;  1B1G A;  1JFJ A;  1SCV A;  1XFW O;  2K8M B;  1KK8 B;  3EK4 A;  1TRF A;  1EXR A;  2L5X B;  5DKQ A;  4MSP A;  3PSR A;  1DGV A;  5G08 A;  1SK6 D;  3GK4 X;  2WCE A;  1KFU L;  1PVA A;  1CB1 A;  1ZUZ A;  1UHJ A;  1QJT A;  4DIR A;  2L4H A;  2HPS A;  3GK2 A;  3HCM A;  2F8P A;  2JU0 A;  1OZO A;  4YGD B;  2PVB A;  1NCZ A;  3JVT B;  3VRR A;  3D10 A;  4DCK A;  4WQ2 A;  3BYA A;  1L7Z A;  4MZJ A;  1IJ6 A;  1C7V A;  1JBA A;  1PK0 D;  1J7O A;  1MXL C;  1L2O C;  4Q04 A;  2KAV A;  2JT0 A;  3TDU A;  2QPT A;  5GQQ C;  1B4C A;  1A75 B;  4OCI A;  1Y1X A;  1LKJ A;  1HT9 A;  1CMG A;  4WRI A;  2Q4U A;  5AAN A;  1C07 A;  1DJG A;  1JUO A;  2JUL A;  1K2H A;  3LL8 B;  1H8B A;  2AMI A;  4I5L B;  4AOM A;  2KBI A;  3BXK A;  1WRL A;  1OZS A;  1S6C A;  1IKU A;  4DS7 A;  2LM5 A;  1B8L A;  1CLM A;  4F0Z B;  1UHI A;  1BMO A;  2M97 A;  1ALV A;  2JQ6 A;  1J7R A;  2LV7 A;  1QAT A;  1QS7 A;  4D1E A;  2VRG A;  3AKA A;  3GOF A;  1DTL A;  1G8I A;  2KI4 C;  4CLN A;  3VGO A;  1YUR A;  1C7W A;  2GV5 A;  1ODB A;  2JOJ A;  3FS7 A;  1QAS A;  1K96 A;  2KAY A;  1IH0 A;  1NX1 A;  3BUN B;  4YRU A;  3PAT A;  1BJF A;  1U5I A;  3EKJ A;  3I5G C;  1CFF A;  1B8C A;  1DMO A;  2F2O A;  4PAL A;  5I2L A;  2LUX A;  4C0K A;  4XJK A;  4DRW A;  3O6B A;  2LMV A;  4HRG A;  1OOJ A;  2SCP A;  2HF5 A;  2CTN A;  4YGE B;  4U8D A;  1E8A A;  2F3Z A;  4N1F A;  5DKN A;  1JWD A;  4MVF A;  4CFR A;  1KQV A;  4PE7 A;  5I2Q A;  4PHJ A;  3DVK A;  2K7D A;  3K21 A;  4GPL B;  4QJ4 B;  2M1U A;  2MJW B;  2P6B B;  3JTD B;  3RM1 A;  3I5F C;  3C1V A;  2Y5I A;  3A8R A;  2F2P A;  3DF0 A;  4TNC A;  1CDM A;  2M7N A;  4FQO A;  1NIW A;  1CFC A;  2JXL A;  4GBA A;  3M0W A;  5IBW A;  2CXJ A;  1SBJ A;  4DUQ A;  1B8R A;  4ICB A;  1CTR A;  2OS8 B;  3NXA A;  1YUT A;  1IRJ A;  2PMY A;  2WOS A;  2CT9 A;  1PAL A;  3DVM A;  1KQM C;  1RK9 A;  4M2Q A;  2ZN8 A;  3LLE A;  4NDC A;  3WHU B;  2FCE A;  2M8U A;  1MR8 A;  2MA2 A;  4YGA A;  1JSA A;  5JOL A;  1IG5 A;  1Q80 A;  1YX8 A;  4QJ5 B;  2KQY A;  3EVR A;  4I5N B;  1MUX A;  2HQW A;  4CID A;  1SR6 B;  3NSL A;  1CLB A;  1DJI A;  1JF2 A;  1B9A A;  4GUK A;  5CSN A;  1YTZ C;  1FW4 A;  1J7P A;  2I7A A;  1BOC A;  1DF0 B;  2PSR A;  1SMG A;  3AAK A;  1TNW A;  4GNK B;  2MLF C;  2O5G A;  1BR4 B;  3CR5 X;  3I5G B;  4AQJ A;  4PHM A;  4CPV A;  1HQV A;  2B1U A;  2JPT A;  3I5H C;  2ZRS A;  3EK8 A;  1NX0 A;  2LAN A;  1PSB A;  1Y6W A;  2MAZ A;  2L50 A;  1SY9 A;  3BOW B;  4YBH B;  1XYD A;  1OMV A;  1KFX L;  1WLM A;  2OTG B;  1Y1A A;  3CWG A;  1QX5 B;  3LCP C;  1OSA A;  4CFQ A;  3I5I B;  1K94 A;  2D8N A;  2LVJ A;  2Y4Q A;  3BUO B;  3SG3 A;  4XYN A;  1NYA A;  1G33 A;  4USL A;  1PVB A;  1PUL A;  1SCM C;  5HKY A;  4NDB A;  1CDN A;  2WCB A;  4ORC B;  3OX6 A;  1EJ3 A;  1VRK A;  2R2I A;  4C0J A;  4MRX A;  3IQQ A;  3TS5 C;  2JWW A;  2NCO A;  3WHT B;  1AVS A;  3PM8 A;  4NQG A;  4P2Y B;  1YX7 A;  1XA5 A;  3ZNI A;  1QX2 A;  2BCA A;  4C0L A;  1FI6 A;  2BKH B;  1JF0 A;  3TDZ A;  2LHI A;  2E6W A;  5D69 A;  3VRO A;  2LVK A;  2TN4 A;  2KGB C;  2QAC A;  4GGN A;  2LP3 A;  3EKH A;  1DVI A;  4MBE A;  2BL0 B;  4PE1 A;  1KWO C;  3DD4 A;  2K7B A;  4OVN F;  4PDZ A;  1NCX A;  1K9K A;  2ZRT A;  3D0Y A;  2JNF A;  1AHR A;  1REC A;  2Y1M A;  3CGA A;  3CTN A;  2MBX A;  3RLZ A;  5KTY A;  4YGB B;  1DJY A;  2KI6 C;  1TNX A;  5HKZ A;  3KO0 A;  5AFP A;  4JWQ A;  5AER A;  2ZND A;  1S3P A;  1TNP A;  1N0Y A;  1XO5 A;  1H4B A;  1K90 D;  3OB2 B;  2JT3 A;  2LHL A;  1UP5 A;  1GGW A;  1IJ5 A;  2HQ8 A;  3O2P A;  3OHM B;  2KDH A;  2FJU B;  4FTG A;  3DVJ A;  5D7F A;  4PHN A;  1K95 A;  3CS1 A;  4JQ0 D;  2SAS A;  1KFU S;  2LMU A;  1KSO A;  3OP0 A;  4L9M A;  3WNX B;  1K9U A;  3TUY C;  3BUW B;  1CNP A;  5I8N A;  1UHN A;  2A4J A;  1KK7 Z;  2EC6 C;  1CM1 A;  1S5G Z;  2F3Y A;  1LA3 A;  2M29 A;  2KGR A;  1AJ5 A;  1J1D A;  4PE4 A;  1S6I A;  3ICB A;  1WRK A;  1XFU O;  1NCY A;  2KOT A;  1YUU A;  2LAP A;  1AUI B;  3IF7 A;  3PLF B;  1TCF A;  2LNK A;  1MF8 B;  2Y9Z A;  2OPO A;  2MRD A;  2LP2 A;  2PAS A;  1SCM B;  3TDI A;  1S6J A;  1OE9 B;  5TNC A;  2I18 A;  5AXI A;  4A4B A;  1MQ1 A;  5K89 A;  1M46 A;  1W7I B;  4GAO A;  1RWY A;  1YVH A;  5HYD A;  1BG1 A;  4P5O E;  3PN7 C;  2K7O A;  2JC2 A;  1J1E A;  4IL1 A;  5B8I B;  1WY9 A;  3KPX A;  3EVU A;  2DOQ A;  5HKW A;  2LUC A;  1KK8 C;  2M1K B;  2Y1N A;  4BY4 A;  1L2O B;  1D1O A;  5I2O A;  1M63 B;  1N65 A;  2L0P A;  1UWO A;  3F45 A;  1QXP A;  1PRW A;  1DF0 A;  1QV1 A;  1R2U A;  2K2A A;  2HET A;  1ZOT B;  1DJZ A;  2NXQ A;  1F4O A;  2JT8 A;  5DKR A;  1RJV A;  1F71 A;  2KNE A;  1OQP A;  1CLL A;  3BOW A;  2LVV A;  4MRY A;  4GFT A;  4PHK A;  1AK8 A;  1IGV A;  2K2F A;  3JVT C;  1EL4 A;  1N2D A;  1ALW A;  2LMT A;  1V1F A;  2K7C A;  1RRO A;  2KYF A;  3WXA A;  2L98 A;  2KI4 B;  3CZT X;  4OR9 B;  3KEV A;  1M45 A;  1A4P A;  1LVC D;  4I5K A;  3TZ1 A;  1WDC C;  5JJG A;  4MN0 A;  1XFV O;  2JNX A;  2PRU A;  1MXE A;  2LVI A;  3OB1 B;  1XK4 A;  2KFG A;  2BE6 A;  1GGZ A;  2O60 A;  2M7L A;  1OFC X;  1DJW A;  2V53 A;  3VRP A;  2ISD A;  1CFD A;  2RGI A;  3DF0 B;  1UHH A;  1J55 A;  5ER4 X;  5ER5 A;  1XFY O;  2NCP A;  1A75 A;  1YRU B;  1LXF C;  1ZMZ A;  2K0J A;  4GGF C;  4OV2 A;  3PFV A;  3QRX A;  3A4U B;  1QVI Z;  3BUX B;  2M0R A;  1CMF A;  3FIA A;  5KU1 A;  1OMD A;  3CR4 X;  3AAJ A;  2WND A;  3I5F B;  1SL9 A;  1SKT A;  1TTX A;  3KHE A;  3PN7 B;  1B47 A;  1MWN A;  1SRA A;  4WQ3 A;  1LA0 A;  2CCM A;  4QJ3 B;  3SIA A;  1M39 A;  4GGF A;  4HSZ A;  3ZWH A;  1DGU A;  2GGM A;  1BU3 A;  2JTT A;  1ZAC A;  3DVE A;  2L4I A;  2WC8 A;  1QLK A;  1QV0 A;  1KK7 Y;  1S5G Y;  2H61 C;  5CPV A;  2LLU A;  1GJY A;  1J7Q A;  1GQM A;  3EVV A;  1KQM B;  4ZCU A;  1NUB A;  5HLO A;  4E68 A;  1QIW A;  2ZNE A;  3JTD C;  1PSR A;  4MEW A;  1IQ5 A;  1W7J B;  4MZL A;  2CNP A;  2JTZ A;  4BY5 A;  4HRH A;  4M2P A;  1CM4 A;  1SL8 A;  2Y9Y A;  1JC2 A;  2H61 A;  1K93 D;  1KFX S;  2OS8 C;  1F70 A;  2E30 A;  1S1E A;  1KCY A;  1AP4 A;  2NLN A;  1B7T Z;  1CDL A;  1SL7 A;  1LIN A;  1F54 A;  1RTP 1;  2KBM A;  1BR1 B;  2FOT A;  2M49 B; 
#chains in the Genus database with same CATH topology
 2R3S A;  3VP9 A;  3U1A A;  2B9B A;  1WLZ A;  2I1K A;  3S0D A;  2COL B;  2D2C B;  4JPZ B;  4YGC B;  1NGM B;  1FDI A;  2L91 A;  3OGN A;  2KFH A;  1YR5 A;  2BEQ D;  1PPJ E;  2WSE J;  1Y0V H;  2ZN9 A;  1RE4 A;  2IFN A;  2QIW A;  1JFK A;  2R3C A;  3SG2 A;  3Q5S A;  1UUR A;  1NU1 E;  1L4A C;  5AW7 B;  1CSB A;  1NWD A;  3SIB A;  2GTE A;  2KAX A;  1QIV A;  1BLQ A;  1DJH A;  3L74 G;  3A0B H;  1TIZ A;  5B5E E;  2KYC A;  1L0L G;  2M5A A;  1VQ6 P;  2LCP A;  3TGU J;  1ZME C;  3IAO A;  1V1G A;  1H88 A;  2Q91 A;  1PP9 G;  2MLE C;  1LTI C;  2KI6 D;  2OTG C;  3H32 A;  1EH2 A;  3NHI A;  3AEA C;  3L70 D;  3SJS A;  1NTZ G;  1IQ3 A;  4R1E A;  1SPY A;  3IFM A;  1TNQ A;  3JCU E;  1NPQ A;  3SWF A;  1U5I B;  5AEQ A;  2ZFD A;  2NZ0 A;  3G3Z A;  2GUV A;  1JTH A;  1XFZ O;  4A4C A;  3H1J J;  1A2X A;  4DJG A;  1OW4 A;  1KYO D;  2PQL A;  1LTA C;  4UB8 E;  1KZU B;  2WZ7 A;  3HTK B;  1Z4H A;  3DY9 A;  2KFF A;  3BUM B;  2WMM A;  2C0X A;  5FI6 A;  2JXC A;  1S5L X;  5CSJ A;  2BCC G;  1BE3 G;  1DH3 A;  3CLN A;  5C39 A;  5KAI H;  3SG5 A;  1M31 A;  4PCW A;  1FF1 A;  1L0L K;  2RMZ A;  2LC5 A;  4U3F E;  1F8H A;  3NSK A;  1FPW A;  2PYQ A;  5APQ A;  3W68 A;  1QTX A;  2IBZ I;  3FWC A;  1LWU B;  4JD9 A;  1S5L E;  1XFW O;  1PPJ G;  5GTH H;  1NTK K;  1MV8 A;  1EXR A;  2L5X B;  1NU1 G;  4PD4 I;  3HE5 A;  1ZRT D;  4MSP A;  3L47 A;  4WBA A;  3AEE C;  2WCE A;  1QVG O;  4AUW A;  1UHJ A;  3IR9 A;  5B66 H;  2WC5 A;  2HPS A;  3H1K D;  2K9J B;  2JU0 A;  4DCK A;  1IC2 A;  3L73 J;  2FXP A;  1EDK A;  1L0N E;  3GHG C;  1J7O A;  1VPC A;  2H89 C;  5AVV B;  4OCI A;  4EDF A;  4R4L A;  1HT9 A;  3B7A A;  3CCM P;  4WRI A;  5CCH C;  1Q82 Q;  2WCH A;  3LL8 B;  4ZNC A;  2AMI A;  1JY2 O;  4PJ0 H;  1HWT C;  3BXK A;  1HVV A;  2FYU E;  3V2L A;  4R4M A;  2PGD A;  1H0T A;  2ZT9 D;  1CLM A;  2B87 B;  2M97 A;  4C46 A;  1EZV I;  3AE3 C;  1J7R A;  3CXH D;  2AEJ A;  4D1E A;  2M8R A;  3DYE A;  2WPQ A;  1DTL A;  3VGO A;  1C7W A;  2ZT9 B;  3KHU A;  1K96 A;  1IH0 A;  3BFH A;  1NU1 K;  1NKZ B;  2NPS C;  2O1K A;  2K1A A;  3A3Y B;  1DMO A;  4IL6 X;  4C0K A;  4HH2 A;  1XFR A;  2V4H A;  4XJK A;  3O6B A;  3FXD A;  3RL0 g;  1IIO A;  4YGE B;  1G2C B;  4U8D A;  5AVX B;  4MVF A;  5CMZ A;  4U3F G;  4PE7 A;  3L4A A;  4PHJ A;  3DVK A;  2K7D A;  4GPL B;  3A5T A;  1BGY J;  3CX5 I;  3BRT B;  2MJW B;  3GF7 A;  2P6B B;  4IL6 E;  3AEG C;  2RH0 A;  4W7Z A;  2LXB A;  3C1V A;  2N1T C;  4TNC A;  1KFN A;  3B5N C;  2M7N A;  1NIW A;  2IBZ E;  2JXL A;  5CBO A;  1SBJ A;  1CTR A;  4H0L B;  2OS8 B;  3NXA A;  3C1L A;  3CYZ A;  1JY2 N;  4PD4 E;  2E76 C;  2W6B A;  3DVM A;  3M0D C;  5DJU B;  3RK2 C;  2FCE A;  2LKM A;  4U7J A;  5AVT B;  3VN0 A;  1QGK B;  4QJ5 B;  2CK3 H;  1UIX A;  1TWO A;  3L74 D;  1L0N G;  2HQW A;  2R5B A;  2YKO A;  3AE5 C;  1DJI A;  3U1C A;  3HUS C;  3H32 B;  2I7A A;  3SS3 A;  1RF0 C;  1M57 D;  4GNK B;  1SMG A;  1SFC B;  1BR4 B;  4AQJ A;  2KS1 A;  2FYU G;  4GIF A;  4I6M C;  2LAN A;  1NTZ D;  2A06 G;  1FOS E;  1SY9 A;  1FZE A;  1OMV A;  1IFM A;  3O8Z A;  3I5I B;  1K94 A;  2D8N A;  2LVJ A;  3SG3 A;  3RL0 D;  1JTH B;  3GLM A;  1EZV E;  1S4X A;  1AVO A;  1PUL A;  2WCB A;  3OX6 A;  2E75 C;  1JOC A;  2R2I A;  4C0J A;  4GDO A;  1ZV8 A;  2JWD A;  4GOD A;  3IQQ A;  2ITA A;  3L4L A;  2NCO A;  3CZ0 A;  3WHT B;  1EXJ A;  1YX7 A;  3RL0 B;  3VOP A;  3WU2 H;  1KYO I;  5DIC A;  3ABV C;  1GU4 A;  2JDI H;  2E6W A;  3VRO A;  1BDC A;  1NTM E;  2TN4 A;  2QAC A;  4GGN A;  1QLE D;  2YKQ A;  1Q86 Q;  4PDZ A;  2K7B A;  1BE3 D;  1OIP A;  3D0Y A;  1L0N K;  2BCC D;  2Q5U A;  2JNF A;  1REC A;  4GOE A;  3CGA A;  3CTN A;  3CCE P;  1Q90 D;  2KI6 C;  3KQG A;  2W90 A;  3CX5 E;  2IBZ G;  2H7H A;  1S3P A;  2OYH A;  2B88 A;  1YQ4 C;  1H4B A;  3NXS A;  3CMA P;  1GGW A;  3CCL P;  2G3A A;  3OHM B;  2KDH A;  1SQQ J;  4PJ0 E;  2FYU K;  4JQ0 D;  2SAS A;  2BEZ F;  1QVF O;  1KFU S;  3PM2 A;  1KSO A;  1K9U A;  2O01 H;  3CWB J;  3VMX A;  3T97 B;  1LTB C;  4OH8 B;  2KGR A;  1J1D A;  4PE4 A;  1S6I A;  2QJY C;  4W7Y A;  3ICB A;  1WRK A;  1NCY A;  2KOT A;  1YIJ P;  1AUI B;  3IF7 A;  2AXT H;  4NPF X;  1IFN A;  1MF8 B;  2MRD A;  1S6J A;  3S0A A;  1J2J B;  2QJK C;  1W7I B;  2AEM A;  4GAO A;  3S0G A;  3NGV A;  3PN7 C;  3S0F A;  1PGO A;  3BCC J;  3MGN A;  2M1K B;  4LLH A;  1H0T B;  3I56 P;  1U57 A;  5I2O A;  2PP6 A;  1N65 A;  2L0P A;  3F45 A;  1T2K D;  1EZV G;  2ZXX A;  3S0E A;  4DZO A;  1DJZ A;  1F4O A;  4RES B;  2KLD A;  5DKR A;  3G9R A;  2POH A;  2QEH A;  2O1J A;  3CCR P;  1FZG A;  3P8M C;  1E79 H;  1IGV A;  1KYO E;  1NTM G;  1OMI A;  4RJT A;  1LT9 A;  2WSF H;  4LC1 A;  4WWI A;  3E1R A;  2K3R A;  1N73 C;  1DD3 A;  4MN0 A;  1XTG B;  2M0B A;  2AXC A;  4U3F D;  2LVI A;  1HUC A;  1S9K D;  2WPR A;  1GGZ A;  1FZB A;  1DJW A;  3FE6 A;  2RGI A;  1RQV A;  1T6A A;  4WB4 A;  2P71 A;  1XFY O;  1A75 A;  1ZMZ A;  1YTZ T;  2YXQ B;  1FDO A;  3QH9 A;  1QVI Z;  1GU5 A;  1ZXG A;  1OMD A;  4BWN A;  4BRY A;  1SKT A;  1TTX A;  3H1L J;  4Y99 B;  1NAY A;  1ZRT E;  4D6T D;  1VQ7 P;  2WT7 B;  3O6Q A;  1K05 A;  3D71 A;  1ZAC A;  3JC2 2;  1FU1 A;  1QLK A;  1S5G Y;  3M06 A;  1GM0 A;  3GW6 A;  1GJY A;  3WU2 E;  3H1K E;  1KQF B;  1GQM A;  1KQM B;  4ZCU A;  4E68 A;  2WQY C;  1ZR4 A;  1PZQ A;  1PSR A;  5AW3 B;  3S1K A;  1OX3 A;  5I94 A;  3A7O A;  2KS1 B;  1SL8 A;  2H61 A;  1KFX S;  2FYU D;  2OS8 C;  4H0L C;  1S1E A;  1DQE A;  3BJH A;  1AP4 A;  1KIL E;  1SQX D;  2A06 D;  1LIN A;  3FX0 A;  4B86 A;  4ASV A;  2KBM A;  1FW4 A;  2QM8 A;  2MHH A;  3QME A;  1WDC B;  2WCF A;  2FCD A;  3V5B A;  2BE4 A;  1EDI A;  4ORB B;  3RZS A;  1KD1 Q;  1J1E C;  2BEC A;  1CZQ A;  4HYT B;  2ZYA A;  2ZAE B;  2GGZ A;  3EQ2 A;  1BF5 A;  2IX7 C;  3VRN A;  2QEX P;  1XFX O;  4ZCV A;  1SFC C;  1P84 H;  1EG3 A;  1VF5 C;  3TS5 B;  1VQN P;  3MSE B;  3D0Y B;  1SP4 A;  3L4F A;  3A0H H;  4NPE A;  1GW4 A;  2YNY A;  1AQ5 A;  1M90 Q;  3L75 D;  2L51 A;  3LIE A;  3SG7 A;  2I2R E;  3F5H A;  2OYH B;  1F4Q A;  4EOT A;  3PJI A;  3I5I C;  1EG4 A;  1N2D C;  3O78 A;  2H8V A;  3ZDM A;  2R44 A;  4N1G A;  5F6T A;  3L72 J;  1YRT B;  1OMR A;  1K9M Q;  3JSV C;  1GDT A;  3GK1 A;  3V4W A;  3MUD A;  4C7N B;  1XK4 C;  2WCL A;  1ZW0 A;  3AE8 C;  4YXD C;  4ETO A;  5GTI H;  1OVU A;  1SW8 A;  1QLS A;  4KJM A;  4IFD K;  2AUC A;  2LLS A;  1QX7 A;  4WVZ A;  3H1K G;  1OW8 A;  1FE6 A;  1A03 A;  3TUY B;  2BBM A;  2BBN A;  1KSM A;  3L74 E;  5J3X A;  2WCK A;  1YUS A;  4PV1 D;  1JMM A;  4OKH A;  2EGD A;  1P84 I;  1RE3 C;  3H1H J;  2FXM A;  4DOJ A;  3B6X A;  5KLV E;  2EHB A;  1LT1 A;  3SG4 A;  1W5C E;  5PAL A;  4PV1 B;  2BCX A;  3RBX A;  2BCB A;  3CR2 A;  4IFF A;  1AJ4 A;  1NP8 A;  1CKK A;  1RF1 A;  1SNL A;  1B7T Y;  3H1I J;  2KSP A;  1B1G A;  3F89 A;  2K8M B;  2W6A A;  1KK8 B;  3EK4 A;  3D76 A;  3P32 A;  1USE A;  5DKQ A;  1LJ2 A;  2WPS A;  3PSR A;  1SQV E;  1PVA A;  1CB1 A;  1AFO A;  4M3L A;  1LT9 B;  1NTM D;  1QJT A;  4DIR A;  2L4H A;  1URQ B;  3B71 A;  5KJ7 A;  3D10 A;  3BYA A;  2KSJ A;  4MZJ A;  1IJ6 A;  5AW0 B;  1JBA A;  1MXL C;  1YHQ P;  2JT0 A;  2QPT A;  1B4C A;  1OOF A;  1A75 B;  3HD7 C;  5TIS E;  2Q4U A;  5AAN A;  2KZI A;  1Y8A A;  1N86 A;  2E42 A;  3L71 E;  1IFI A;  1OZS A;  4ZKU A;  4F0Z B;  1MZ9 A;  1HGZ A;  2HFE D;  1LS8 A;  1QAT A;  4OGQ D;  2VRG A;  1HTL C;  3H1J D;  4RKU J;  4CLN A;  2GV5 A;  1ODB A;  3FS7 A;  1LP1 A;  1QAS A;  3BUN B;  2IFM A;  3Q5P A;  1BJF A;  5EFW B;  3I5G C;  5CJ0 A;  1CFF A;  3SS4 A;  4PAL A;  3E1I A;  4OGQ B;  4DRW A;  1OOJ A;  1S2E A;  5KLV G;  5AVQ B;  1P84 E;  2SPZ A;  3CCU P;  1BCC J;  2M1U A;  5CJ4 A;  5TJH A;  5K5G B;  2F2P A;  1LTJ A;  4GBA A;  3M0W A;  3PJS K;  1ZN5 A;  2CXJ A;  1B8R A;  1PGP A;  1K04 A;  2Z5I A;  1YUT A;  1SQV G;  4N6J A;  5AVS B;  3R1V A;  2WTY A;  2PMY A;  2XKM A;  1PAL A;  2R5D A;  1KQM C;  1RK9 A;  2QSI A;  4L75 A;  3AEB C;  1FZC B;  2M8U A;  2MA2 A;  2DW3 A;  1IG5 A;  3VMY A;  2E43 A;  4INX A;  2KQY A;  1SVF A;  3L73 D;  4I7Z C;  4CID A;  4HB1 A;  1RY3 A;  2QG4 A;  1X79 B;  1SQB E;  1S9K E;  2WCJ A;  2IPP A;  1BOC A;  2YIU B;  3PRJ A;  2PSR A;  1AQT A;  5AVW B;  2O5G A;  3CR5 X;  3L71 G;  4PHM A;  2YO3 A;  3MZW B;  1SQP G;  2ZRS A;  3EK8 A;  2Q1K A;  2MAZ A;  1PSB A;  4YBH B;  1Y47 A;  5DJT B;  1NTZ K;  3CWG A;  3R1P A;  1QX5 B;  1KB9 H;  2WSE H;  3BUO B;  4XYN A;  3GG2 A;  1NYA A;  3SFE C;  4USL A;  1PVB A;  1X9V A;  1KV4 A;  1SCM C;  3L70 J;  2P7J A;  4ORC B;  1R5L A;  1ZLL A;  4MRX A;  3TS5 C;  4D6T E;  2JWW A;  2L5Y A;  1AVS A;  4NQG A;  5D3O A;  1XA5 A;  4C0L A;  2FYZ A;  2BCA A;  2BKH B;  3IVT A;  1JF0 A;  3RK3 D;  5D69 A;  2OYH C;  1NO4 A;  3QWO C;  5EL2 A;  2LP3 A;  3EKH A;  3I5C A;  4OZD A;  4OVN F;  2ZRT A;  1BGY D;  3RK3 B;  3B4S A;  1KIL D;  2Y1M A;  3AE9 C;  3KO0 A;  1R8E A;  1KFM A;  2B89 A;  2ZND A;  2PFX A;  1XO5 A;  1SQX E;  2E74 C;  2I1J A;  2A06 E;  1YJN P;  1K8A Q;  3OB2 B;  2JT3 A;  2LHL A;  1CW5 A;  1UP5 A;  2K88 A;  3O2P A;  2KLV A;  1N7S A;  1KQS O;  1KIL B;  4FTG A;  3DVJ A;  5D7F A;  5M1B A;  3CS1 A;  3FWN A;  5KJ7 D;  1KTM A;  2JJL A;  3CDN A;  2LMU A;  4L9M A;  3WNX B;  3TUY C;  3BUW B;  5I8N A;  4GKG A;  5CCG C;  1CM1 A;  2ZVO B;  1GK4 A;  4W80 A;  4GOF A;  1AJ5 A;  2KLE A;  2QEB A;  3B88 A;  1YUU A;  3A0B E;  2OYI A;  5E79 H;  3KDP B;  1TCF A;  1SQB G;  2OPO A;  3CC7 P;  3AE6 C;  4PV1 C;  2WCM A;  1NH4 A;  5AXI A;  3L75 E;  1RWY A;  5HYD A;  2IDB A;  2IYP A;  3TK1 A;  2K7O A;  4IL1 A;  5B8I B;  1WY9 A;  2QEO A;  4C7R A;  1DIP A;  2E5T A;  3EVU A;  2O3J A;  1L4A A;  1EQ7 A;  2LUC A;  2JR8 A;  1KK8 C;  1QXP A;  1DF0 A;  1R2U A;  2WPV B;  1LT9 C;  1M8O B;  1RJV A;  2FFD C;  4D6T G;  4IJ7 A;  1BDD A;  1CLL A;  1URQ C;  3BOW A;  1LP1 B;  2LVV A;  4GFT A;  2M3B A;  2Q3I A;  1FJK A;  1EL4 A;  2M5A B;  4XA4 A;  1ALW A;  2QDI A;  4XFJ A;  2K7C A;  3VMZ A;  1T14 A;  3N7N A;  3TZ1 A;  5KLV D;  1A02 F;  2JNX A;  1MXE A;  5KAI E;  2BE6 A;  3M9Q A;  2D2C C;  2W83 C;  2O60 A;  4WY4 A;  1SQX G;  1QWV A;  3VRP A;  1VL2 A;  1J55 A;  2NCP A;  1YRU B;  2K0J A;  1U7J A;  3A4U B;  4EIJ A;  3BUX B;  1OXZ A;  3FIA A;  1DEL A;  2YO2 A;  2XDJ A;  2JPO A;  5GTH E;  2YXR B;  1SQV D;  3AED C;  3N4X A;  2WSS H;  1FOS F;  3I5F B;  3CPW O;  3CWB D;  1LA0 A;  2CCM A;  3SIA A;  4FQT A;  1M39 A;  3MIW A;  1NWQ A;  3R72 A;  1N7L A;  5B66 E;  2KNC A;  1YIT P;  3MP7 B;  1YQ3 C;  1QV0 A;  1KK7 Y;  5FI2 A;  1VQ5 P;  2H61 C;  1VDF A;  3CLQ A;  3BFA A;  1J7Q A;  3L75 G;  1Q2N A;  1NUB A;  3TGU E;  4MZL A;  1GMJ A;  4BY5 A;  4HRH A;  1HGV A;  2FXO A;  5AW4 B;  3L74 J;  4YXW H;  2Y9Y A;  3L71 D;  1GD2 E;  1F70 A;  2E30 A;  1L0L J;  1SQP D;  1KCY A;  5AW8 B;  1CDL A;  1SL7 A;  1LTS C;  1WT6 A;  3HE5 B;  3HE4 A;  1PP9 J;  3U59 A;  2R32 A;  1R5S A;  1SQX K;  1VQM P;  2KQ6 A;  2AAO A;  3AEF C;  2F33 A;  2IS9 A;  2I94 A;  2ZKM X;  1MKM A;  4N78 E;  1FZC C;  1GL2 A;  3I5H B;  2K61 A;  5FYX A;  3O4Y A;  3BAS A;  4K3A A;  1NTZ J;  1SYM A;  1NTK J;  3EWK A;  3H1J E;  4N5X A;  1BOD A;  4AQI A;  4ASW A;  2KPH A;  4H13 D;  2CBL A;  3OBV A;  5CCH A;  3EFG A;  3CME P;  2M3W A;  1UHK A;  2K37 A;  2W27 A;  1BSH A;  1QX8 A;  1OOG A;  1P84 D;  1JY3 P;  1XVJ A;  3AE7 C;  3M91 A;  4H13 B;  1N7S D;  1IWQ A;  1LWU C;  1E5W A;  5APW A;  2KHN A;  2LE9 B;  1JY2 P;  1HBW A;  3AEC C;  1GZL A;  1YTZ I;  3AE2 C;  5CSF A;  1QL1 A;  3V2N A;  1N7S B;  3D6Y A;  4TLF A;  2BCC J;  1S36 A;  1BE3 J;  2KOG A;  1WRZ A;  1NYH A;  3OJA B;  1TCO B;  1K9P A;  4M2O A;  3H1L D;  1NSH A;  1JO5 A;  1YYC A;  3PAL A;  4CPG A;  3LW5 J;  4XJK B;  1LTG C;  1X22 A;  2PAL A;  1QEX A;  3LK1 A;  4YI9 A;  3AKB A;  2OYI B;  2G2B A;  3EK7 A;  4UPG A;  3H4S E;  4DT0 A;  2KIK A;  3TGU G;  1NU1 J;  2JRF A;  2JZI A;  2QA4 P;  1L4A D;  2LLT A;  1FS0 E;  3L73 E;  2OAR A;  2EC6 B;  1S26 D;  2WOR A;  1SQB D;  1ZOY C;  2YMY A;  2FYN B;  2L2E A;  1KOR A;  1YBK A;  3O4X A;  1JNM A;  3VRQ A;  1KIL C;  3M0D A;  2M3E A;  2HG5 D;  2Q3E A;  1UUS A;  1FBV A;  1MHO A;  2ZT9 C;  2ERB A;  5KSZ A;  1DX7 A;  1X02 A;  3H1J G;  3C9I A;  4YPC A;  1OWA A;  3HUS A;  1RF0 A;  1VQO P;  2E5Y A;  5G08 A;  1W9Z A;  2H8P D;  3GK4 X;  2H43 A;  2LXC B;  4WY4 D;  1ZUZ A;  1NTM K;  3RK3 E;  1UII A;  1M1K Q;  3GK2 A;  3HCM A;  1AA0 A;  1KMI Z;  2F8P A;  1OZO A;  3OW2 O;  3JVT B;  3DZT A;  3VRR A;  1FZF A;  2J5U A;  1C7V A;  3WUV A;  4WY4 B;  2WC6 A;  1PK0 D;  5APV A;  5GQQ C;  1BGY E;  3A2A A;  1D7M A;  1Y1X A;  1RE4 C;  1CMG A;  4TT3 H;  1DJG A;  1JUO A;  4ZMD A;  3L72 D;  2JUL A;  5APX A;  1H8B A;  3S4R A;  4U3F J;  4I5L B;  4AOM A;  3P7K A;  1N8R Q;  1WRL A;  5H2F H;  1S6C A;  1FAV A;  3Q2Y A;  4DS7 A;  2LM5 A;  3EFF K;  1M7L A;  1UHI A;  1ALV A;  2JQ6 A;  1IFP A;  2LV7 A;  3SWY A;  2W6J H;  3B8E B;  1M1J A;  3AKA A;  4I1L A;  5KAF H;  3GOF A;  1G8I A;  1IJD B;  3LID A;  2JOJ A;  3L73 G;  4BXL A;  1ZP0 C;  1U5I A;  1OVR A;  2AXT E;  1B8C A;  1PGJ A;  1RQU A;  5I2L A;  2LMV A;  1JUN A;  1L2P A;  2SCP A;  2CTN A;  3HRN A;  3L37 A;  3SFD C;  1E8A A;  2F3Z A;  4N1F A;  2HPC A;  1JWD A;  2PRR A;  5B5E H;  1NKN A;  1FC2 C;  1GL2 D;  3HTK A;  1L0N J;  3MD0 A;  1X0T A;  3HE4 B;  3RGU A;  3RM1 A;  2WSC J;  5CCH D;  3I5F C;  2Y0D A;  2Y5I A;  3FGA D;  1U7M A;  2ZXE B;  3H1I D;  4FQO A;  1RHZ B;  3RL0 C;  1CFC A;  1GL2 B;  5IBW A;  4JYC A;  3NMD A;  4DUQ A;  2HR3 A;  2OQQ A;  4ICB A;  2FYU J;  1J1D B;  4IOI H;  1IRJ A;  5FI7 A;  2XND H;  3EG5 B;  2CT9 A;  2NZ2 A;  5APY A;  1YJ9 P;  1MUU A;  2V7Q J;  3LLE A;  4YGA A;  5JOL A;  1OW7 A;  4UB8 H;  2K60 A;  3EVR A;  4I5N B;  2YKP A;  3M9H A;  1C3Y A;  1CI6 A;  2QJP B;  1SR6 B;  3NSL A;  1VQK P;  1BGY G;  1JF2 A;  1B9A A;  4GUK A;  3KPE A;  4GT1 A;  3AAK A;  3TSI A;  1TNW A;  1SLQ A;  4INW A;  2K9J A;  1EC5 A;  1HQV A;  5AVZ B;  3I5H C;  1SQQ E;  3OAK A;  1KB9 D;  1WLM A;  1XTC C;  3LCP C;  3VP8 A;  1OSA A;  3DXL A;  1S5L H;  3D78 A;  1N73 A;  2LR2 A;  3CWB E;  3Q1M A;  2BAS A;  2QEV A;  4NDB A;  1CDN A;  1EJ3 A;  1VRK A;  3CL3 D;  1PL5 A;  1YJW P;  2E76 D;  1OOI X;  3RBZ A;  3TGU D;  1FI6 A;  3TDZ A;  5L8R J;  4AQR D;  1SS1 A;  1A02 J;  5AVY B;  1DVI A;  1EDJ A;  1BCC D;  2BL0 B;  4PE1 A;  1N7S C;  3P8C D;  3DD4 A;  4YTP C;  3C8V A;  1AHR A;  3BCC E;  3FE9 A;  5KTY A;  3RLZ A;  4KHX A;  4KT0 J;  4YGB B;  1TNX A;  4BRY B;  5AFP A;  2WSC H;  2IZ0 A;  5KLI B;  5AER A;  1SQP E;  1G2C A;  2JEE A;  2KZJ A;  1N0Y A;  1T2K C;  4N78 D;  1PGQ A;  1OOH A;  2BAP A;  2FJU B;  3HUS B;  3O6Q B;  1K95 A;  2OYO A;  3TF5 A;  3D70 A;  3TNU A;  2P2U A;  2V7Q H;  2EC6 C;  1S5G Z;  2F3Y A;  1LA3 A;  2M29 A;  2RN0 A;  5KAF E;  2E75 D;  1OW6 A;  2FYN C;  1NVO A;  3CD6 P;  3PLF B;  3KYQ A;  1HJ0 A;  3A0H E;  5BVZ A;  2Y9Z A;  3UNW A;  1GK6 A;  2H88 C;  1OE9 B;  1IK9 A;  1NTM J;  2E75 B;  1MQ1 A;  3D77 A;  1IK7 A;  3VTP C;  3CZ2 A;  1YVH A;  1LGH B;  1BG1 A;  3B86 A;  2JC2 A;  1J1E A;  2P1J A;  1SQQ G;  2WWW A;  4O9B A;  3KPX A;  4Y99 C;  4XE5 B;  2DOQ A;  1JM0 A;  5APU A;  3TYY A;  2Y1N A;  4A7P A;  4BY4 A;  4IL6 H;  4I2L C;  1L2O B;  1M63 B;  3CWB G;  1PRW A;  1SFC A;  1QV1 A;  2HET A;  2NXQ A;  3H1L E;  5CBN A;  1M1J B;  1NTK G;  5GTI E;  1OQP A;  3USS A;  4MRY A;  4PHK A;  4NPD A;  4PD4 H;  3PHL A;  1AK8 A;  3JVT C;  3SSU A;  1VQ8 P;  3BAT A;  1N2D A;  1NHL A;  2ZVN B;  3CCQ P;  4WY4 C;  2LMT A;  2P10 A;  3L36 A;  1RRO A;  3GMA A;  3WXA A;  3GF3 A;  2HPC B;  1MFT A;  2L98 A;  2KI4 B;  4OR9 B;  1M45 A;  4I5K A;  3BCC G;  1WDC C;  5JJG A;  1KQG B;  3UIA A;  5KLV K;  2FBW C;  1TUJ A;  3OA7 A;  3OB1 B;  1XK4 A;  2KFG A;  1VQ9 P;  1OFC X;  2V53 A;  2ISD A;  1CFD A;  5KKZ B;  5ER5 A;  2QJY B;  1LXF C;  1IFJ A;  5HL1 A;  1SQQ K;  2QJK B;  1DEE G;  3CR4 X;  3AAJ A;  2KP8 A;  2HLO A;  2N9B A;  3PN7 B;  1RE3 A;  3KHE A;  1SQV K;  1SRA A;  4QJ3 B;  2WVR A;  4GGF A;  3ZWH A;  2KXP B;  1BU3 A;  1Q7Y Q;  3DVE A;  1CI6 B;  1LNQ A;  5CPV A;  5AW6 B;  2UWJ E;  3EVV A;  3SS5 A;  1FBM A;  5AW5 B;  3T97 A;  1USD A;  1W7J B;  2JTZ A;  4H44 D;  1RF1 B;  1CM4 A;  1GTW A;  1GL2 C;  1G1I A;  1JC2 A;  2MKV A;  3L72 E;  4LGD E;  1J1D C;  3CX5 H;  1JY3 O;  3V6I A;  2NLN A;  1B7T Z;  1SQP K;  3H1L G;  1MFZ A;  1RTP 1;  1BR1 B;  2FOT A;  1F55 A;  2XV5 A;  1TOP A;  1KB9 I;  1N73 B;  4H44 B;  2Q6Q A;  1CFP A;  1W2E A;  2HOD A;  2FKW B;  2Y0E A;  1DEB A;  4JYB A;  1EXI A;  1YVL A;  5AW9 B;  2BKI B;  2QJP C;  3HD7 A;  1SR6 C;  2Q7C A;  4L73 A;  3IQO A;  2J58 A;  2M9G A;  1ZFS A;  1NX2 A;  1FI5 A;  1RFJ A;  5HLV A;  1A29 A;  4RO0 A;  3OX5 A;  1H89 A;  3H1H E;  3D73 A;  3CCJ P;  3H1K J;  1NX3 A;  4JF7 A;  3E3R A;  1AVY A;  1RH5 B;  3BQ3 A;  3IF4 A;  1AJY A;  3WUT A;  1TN4 A;  5CSI A;  4NDD A;  4ORA B;  1KWO B;  2JKV A;  5BPJ A;  2YMK A;  4H0L D;  4L74 A;  3H1I E;  1G4Y R;  4HRE E;  1BSN A;  2IZ1 A;  4PE0 A;  3S0B A;  4MLW A;  1QVI Y;  2KSE A;  1CDP A;  3TNU B;  2A45 H;  3I55 P;  2Z4E A;  3FWB A;  1JY3 N;  4JKT A;  1KC8 Q;  1NJI Q;  4YI8 A;  1DT7 B;  3W67 A;  2P67 A;  1W2B O;  1VQL P;  3V4Q A;  1R6P A;  1Y1U A;  3NSO A;  2JWA A;  2BL0 C;  2O01 J;  1KYO H;  3LK0 A;  3FWL A;  1DJX A;  1SQB K;  5KLI C;  2Y0C A;  2WT7 A;  1QL2 A;  1J1E B;  3NSI A;  1SFC D;  1VF5 D;  4UB6 H;  4I5J A;  3L72 G;  1LTJ B;  1EDL A;  1L0L D;  1SQQ D;  3KF9 A;  4IFM A;  4JBZ A;  1T3U A;  1PP9 D;  3CZ1 A;  1K8U A;  5APT A;  2PAJ A;  1VF5 B;  2FJY A;  1BT6 A;  2G9B A;  3SG6 A;  2H2K A;  1KB9 E;  4EI2 A;  1IFD A;  4HKZ H;  3HX4 A;  4MZK A;  1JFJ A;  4OGQ C;  1SCV A;  1NTK D;  1TRF A;  2A45 I;  2GM4 A;  3VB1 A;  2KB7 P;  1DGV A;  5BU5 A;  1JCD A;  2L2C A;  1SK6 D;  1KFU L;  2CPB A;  4MN4 C;  2P58 A;  1SSE B;  2L5G B;  3H1H G;  3CC2 P;  4YGD B;  2PVB A;  1NCZ A;  1Z2C B;  1HF9 A;  3BCC D;  4WQ2 A;  3BFB A;  1OZH A;  3N7H A;  1L7Z A;  1BCC E;  2MJZ A;  1JB0 J;  3P8C E;  1L2O C;  4Q04 A;  2KAV A;  3TDU A;  3FXE A;  3G6E P;  2WSF J;  1LKJ A;  1FZA A;  1C07 A;  3H1I G;  1M1J C;  5KLV J;  2ZYG A;  1K2H A;  5AW2 B;  2P70 A;  2KBI A;  5BU8 B;  3GHG A;  4OWF A;  1IKU A;  1KQL A;  1B8L A;  2W8Z A;  2CPS A;  1WRG A;  1BMO A;  3IN6 A;  2NRG A;  1QS7 A;  1G1J A;  1PPJ D;  3CXH H;  2J59 M;  2KI4 C;  1YUR A;  1NU1 D;  2YIU C;  2KAY A;  1SQV J;  1NX1 A;  4YRU A;  3PAT A;  2WIT A;  1HJB A;  3EKJ A;  5E79 E;  1YI2 P;  1NAF A;  2F2O A;  4C7N A;  2LUX A;  2KI7 B;  2QE7 H;  4HRG A;  1AV1 A;  2HF5 A;  3V2R A;  5KKZ C;  1JMB A;  3MUD C;  4AYC A;  5DKN A;  3G71 P;  3K1E A;  4CFR A;  1KQV A;  2VRS A;  5I2Q A;  3II6 A;  3K21 A;  4KYN A;  2NPS A;  1K73 Q;  4QJ4 B;  5CCG A;  3JTD B;  1T8Z A;  3HD7 D;  3ITK A;  3A8R A;  2QM7 A;  3DF0 A;  2ZFC A;  1CDM A;  1IZN B;  3M9B A;  3WUU A;  2HOD B;  3L71 J;  2ZJS E;  3L70 E;  1SQP J;  2ZYD A;  3CI9 A;  3HD7 B;  3K5B A;  1JEK A;  2KLU A;  2WOS A;  2JP3 A;  3VMA A;  5APS A;  1X8Y A;  3Q3D A;  2N1T A;  3PLN A;  4M2Q A;  2ZN8 A;  3B5N A;  3RK3 C;  4NDC A;  3WHU B;  3CXH I;  1PV3 A;  1MR8 A;  1JSA A;  3D6Z A;  1Q80 A;  1YX8 A;  1BCC G;  1T3J A;  1RF1 C;  1MUX A;  3M0A A;  1GW3 A;  3E7K A;  1CLB A;  1H8A A;  4QMA A;  1L4A B;  5CSN A;  1YTZ C;  1J7P A;  2FFD A;  3H6P A;  3B87 A;  1URQ A;  1DF0 B;  4UB6 E;  3V2Q A;  4H44 C;  2MLF C;  3I5G B;  3AE1 C;  4CPV A;  2JPT A;  2B1U A;  4ZKP A;  1NX0 A;  3PP5 A;  1Y6W A;  3BOW B;  2L50 A;  1XYD A;  4F7F A;  1KFX L;  2OTG B;  1Y1A A;  4K35 A;  1PIX A;  5KJ7 C;  1P28 A;  4CFQ A;  2Y4Q A;  5AW1 B;  1G33 A;  3Q5R A;  5HKY A;  2XZR A;  1DEK A;  1ORG A;  3NFQ A;  2N9Y B;  3D75 A;  3R4Y A;  3PM8 A;  4P2Y B;  1S1C X;  2IYO A;  1PFI A;  3ZNI A;  1QX2 A;  2O01 N;  2LHI A;  3AE4 C;  2LVK A;  3KZI H;  2KGB C;  3SWK A;  4MBE A;  5AVU B;  1L0N D;  3MHV A;  1KWO C;  1NCX A;  1K9K A;  4L76 A;  2MBX A;  1DJY A;  2I8D A;  3MTU E;  1SQB J;  2Q9I A;  5HKZ A;  2C9N Y;  1NOH A;  5TIS H;  4JWQ A;  1TNP A;  1K90 D;  4I7Z B;  3L70 G;  1TU3 F;  1IJ5 A;  2HQ8 A;  3LW5 H;  2A45 G;  4PHN A;  2HYN A;  2KNC B;  1HH0 A;  3NHT A;  3OP0 A;  2QRX A;  1CNP A;  5AVR B;  1S72 P;  1UHN A;  2A4J A;  5KTB A;  1KK7 Z;  3CXH E;  3H25 A;  3H1H D;  4D6T J;  1XFU O;  3G4S P;  1LTJ C;  2K9Y A;  1DD4 A;  2LAP A;  3PH0 A;  1JCC A;  1TUZ A;  2LNK A;  2LP2 A;  2PAS A;  1SCM B;  3TDI A;  1IO4 A;  5TNC A;  2GUS A;  1OVV A;  2I18 A;  4A4B A;  1FZC A;  5K89 A;  1M46 A;  3D74 A;  3KXD A;  4P5O E;  2G8Y A;  3CC4 P;  2GA1 A;  4PT1 A;  3CCV P;  2C0W A;  3BRV B;  5HKW A;  2QVA A;  3GHG B;  1D1O A;  1UWO A;  3JCU H;  2JO1 A;  2IBZ D;  1SQX J;  2E74 D;  2OTK E;  2K2A A;  1ZOT B;  1ZR2 A;  2JT8 A;  1WMK A;  3S9O A;  1FDM A;  2XNX A;  4Y28 J;  1LWU A;  1S3J A;  1F71 A;  2KNE A;  1Z56 A;  2RKL A;  4PD4 D;  4Z1M H;  2KYV A;  2OTL P;  2K2F A;  2E74 B;  2NPS D;  1DC1 A;  2XU6 A;  5CCG D;  1V1F A;  2KYF A;  1M56 D;  3CZT X;  4HJG H;  3KEV A;  1A4P A;  1LVC D;  3R2P A;  3VYI A;  2NPS B;  1XFV O;  3BVH A;  3NTN A;  2PRU A;  3FE8 A;  1Y9B A;  2M7L A;  3L75 J;  1L0L E;  2AEF A;  4EYY Q;  3DF0 B;  1UHH A;  5ER4 X;  3Q8I A;  1LTT C;  1PP9 E;  4OV2 A;  4GGF C;  2N1T D;  3B5N D;  5CHX A;  3PFV A;  3QRX A;  2M0R A;  1CMF A;  2BNX A;  5KU1 A;  2OGU A;  4N3Y B;  2WND A;  1NTZ E;  1NTK E;  1FJP A;  3WMM 0;  3R1O A;  1EZV D;  1SL9 A;  4WQ3 A;  1Q81 Q;  3CCS P;  1B47 A;  1MWN A;  2N1T B;  4H13 C;  3B5N B;  2B87 A;  3RK2 D;  4HSZ A;  1KN7 A;  1KIL A;  1DGU A;  1URQ D;  2GGM A;  3V2P A;  2JTT A;  2L4I A;  1VQP P;  2WC8 A;  3L35 A;  3CAB A;  2E76 B;  2KUB A;  2LLU A;  2YGU A;  2KK7 A;  3RK2 B;  5HLO A;  2FFD B;  1QIW A;  1C3Z A;  2ZNE A;  3JTD C;  4MEW A;  3KZI E;  1IQ5 A;  2CNP A;  2OTJ P;  3TDK A;  1VQ4 P;  3PTZ A;  4M2P A;  2C9L Y;  3CX5 D;  1K93 D;  2FY8 A;  2D2C D;  2BCC E;  1BE3 E;  2Z5H A;  3UO9 A;  1F54 A;  2OYI C;  5H2F E;  2M49 B; 
#chains in the Genus database with same CATH homology
 1TOP A;  2KQ6 A;  2MHH A;  2AAO A;  2F33 A;  1WDC B;  2IS9 A;  2I94 A;  2WCF A;  1WLZ A;  1CFP A;  2FCD A;  2ZKM X;  2COL B;  3I5H B;  2K61 A;  2BE4 A;  4JPZ B;  4YGC B;  5FYX A;  3O4Y A;  4ORB B;  1SYM A;  4N5X A;  2KFH A;  1YVL A;  1YR5 A;  2BEC A;  4AQI A;  1BOD A;  2BKI B;  1Y0V H;  2ZN9 A;  1JFK A;  1SR6 C;  2CBL A;  3SG2 A;  1UUR A;  3IQO A;  2GGZ A;  1UHK A;  2M3W A;  1BF5 A;  2M9G A;  1ZFS A;  1NX2 A;  1FI5 A;  3VRN A;  1NWD A;  1RFJ A;  5HLV A;  1A29 A;  3SIB A;  1XFX O;  1XVJ A;  2KAX A;  1QIV A;  1BLQ A;  3OX5 A;  4ZCV A;  1DJH A;  1EG3 A;  1TIZ A;  3TS5 B;  3MSE B;  3D0Y B;  1NX3 A;  2KYC A;  1IWQ A;  2LCP A;  2KHN A;  2L51 A;  1V1G A;  2LE9 B;  2Q91 A;  3E3R A;  2MLE C;  3SG7 A;  2I2R E;  2KI6 D;  3BQ3 A;  1F4Q A;  2OTG C;  1F55 A;  5CSF A;  3I5I C;  1EG4 A;  3O78 A;  1TN4 A;  5CSI A;  1EH2 A;  4N1G A;  4NDD A;  1KWO B;  4ORA B;  5F6T A;  5BPJ A;  3SJS A;  1S36 A;  1YRT B;  1OMR A;  1WRZ A;  1IQ3 A;  1G4Y R;  1TCO B;  4R1E A;  1SPY A;  1K9P A;  4HRE E;  1TNQ A;  4PE0 A;  3GK1 A;  4MLW A;  4M2O A;  1QVI Y;  1CDP A;  1NSH A;  1NPQ A;  1U5I B;  3PAL A;  3FWB A;  2ZFD A;  5AEQ A;  2NZ0 A;  1XK4 C;  4XJK B;  4ETO A;  2PAL A;  1SW8 A;  1XFZ O;  1QLS A;  3LK1 A;  4YI8 A;  1DT7 B;  4YI9 A;  3AKB A;  2AUC A;  1A2X A;  2LLS A;  1R6P A;  4A4C A;  1QX7 A;  1Y1U A;  2G2B A;  3EK7 A;  4UPG A;  3H4S E;  3NSO A;  2BL0 C;  1A03 A;  2JRF A;  2JZI A;  3TUY B;  2BBM A;  2BBN A;  2LLT A;  3LK0 A;  1KSM A;  2EC6 B;  1DJX A;  1S26 D;  2WOR A;  5J3X A;  1YUS A;  2KFF A;  4OKH A;  3BUM B;  2EGD A;  3NSI A;  2JXC A;  2L2E A;  4I5J A;  5CSJ A;  3VRQ A;  2EHB A;  3CLN A;  3KF9 A;  3SG4 A;  3SG5 A;  1M31 A;  4PCW A;  5PAL A;  1FF1 A;  2LC5 A;  1F8H A;  2BCX A;  1UUS A;  1K8U A;  3NSK A;  2BCB A;  3CR2 A;  1FBV A;  1FPW A;  1AJ4 A;  1MHO A;  1BT6 A;  1QTX A;  1NP8 A;  2G9B A;  3SG6 A;  5KSZ A;  2H2K A;  3FWC A;  1CKK A;  1SNL A;  1X02 A;  1B7T Y;  3HX4 A;  4MZK A;  2KSP A;  1B1G A;  1JFJ A;  1SCV A;  1XFW O;  2K8M B;  1KK8 B;  3EK4 A;  1TRF A;  1EXR A;  2L5X B;  5DKQ A;  4MSP A;  3PSR A;  1DGV A;  5G08 A;  1SK6 D;  3GK4 X;  2WCE A;  1KFU L;  1PVA A;  1CB1 A;  1ZUZ A;  1UHJ A;  1QJT A;  4DIR A;  2L4H A;  2HPS A;  3GK2 A;  3HCM A;  2F8P A;  2JU0 A;  1OZO A;  4YGD B;  2PVB A;  1NCZ A;  3JVT B;  3VRR A;  3D10 A;  4DCK A;  4WQ2 A;  3BYA A;  1L7Z A;  4MZJ A;  1IJ6 A;  1C7V A;  1JBA A;  1PK0 D;  1J7O A;  1MXL C;  1L2O C;  4Q04 A;  2KAV A;  2JT0 A;  3TDU A;  2QPT A;  5GQQ C;  1B4C A;  1A75 B;  4OCI A;  1Y1X A;  1LKJ A;  1HT9 A;  1CMG A;  4WRI A;  2Q4U A;  5AAN A;  1C07 A;  1DJG A;  1JUO A;  2JUL A;  1K2H A;  3LL8 B;  1H8B A;  2AMI A;  4I5L B;  4AOM A;  2KBI A;  3BXK A;  1WRL A;  1OZS A;  1S6C A;  1IKU A;  4DS7 A;  2LM5 A;  1B8L A;  1CLM A;  4F0Z B;  1UHI A;  1BMO A;  2M97 A;  1ALV A;  2JQ6 A;  1J7R A;  2LV7 A;  1QAT A;  1QS7 A;  4D1E A;  2VRG A;  3AKA A;  3GOF A;  1DTL A;  1G8I A;  2KI4 C;  4CLN A;  3VGO A;  1YUR A;  1C7W A;  2GV5 A;  1ODB A;  2JOJ A;  3FS7 A;  1QAS A;  1K96 A;  2KAY A;  1IH0 A;  1NX1 A;  3BUN B;  4YRU A;  3PAT A;  1BJF A;  1U5I A;  3EKJ A;  3I5G C;  1CFF A;  1B8C A;  1DMO A;  2F2O A;  4PAL A;  5I2L A;  2LUX A;  4C0K A;  4XJK A;  4DRW A;  3O6B A;  2LMV A;  4HRG A;  1OOJ A;  2SCP A;  2HF5 A;  2CTN A;  4YGE B;  4U8D A;  1E8A A;  2F3Z A;  4N1F A;  5DKN A;  1JWD A;  4MVF A;  4CFR A;  1KQV A;  4PE7 A;  5I2Q A;  4PHJ A;  3DVK A;  2K7D A;  3K21 A;  4GPL B;  4QJ4 B;  2M1U A;  2MJW B;  2P6B B;  3JTD B;  3RM1 A;  3I5F C;  3C1V A;  2Y5I A;  3A8R A;  2F2P A;  3DF0 A;  4TNC A;  1CDM A;  2M7N A;  4FQO A;  1NIW A;  1CFC A;  2JXL A;  4GBA A;  3M0W A;  5IBW A;  2CXJ A;  1SBJ A;  4DUQ A;  1B8R A;  4ICB A;  1CTR A;  2OS8 B;  3NXA A;  1YUT A;  1IRJ A;  2PMY A;  2WOS A;  2CT9 A;  1PAL A;  3DVM A;  1KQM C;  1RK9 A;  4M2Q A;  2ZN8 A;  3LLE A;  4NDC A;  3WHU B;  2FCE A;  2M8U A;  1MR8 A;  2MA2 A;  4YGA A;  1JSA A;  5JOL A;  1IG5 A;  1Q80 A;  1YX8 A;  4QJ5 B;  2KQY A;  3EVR A;  4I5N B;  1MUX A;  2HQW A;  4CID A;  1SR6 B;  3NSL A;  1CLB A;  1DJI A;  1JF2 A;  1B9A A;  4GUK A;  5CSN A;  1YTZ C;  1FW4 A;  1J7P A;  2I7A A;  1BOC A;  1DF0 B;  2PSR A;  1SMG A;  3AAK A;  1TNW A;  4GNK B;  2MLF C;  2O5G A;  1BR4 B;  3CR5 X;  3I5G B;  4AQJ A;  4PHM A;  4CPV A;  1HQV A;  2B1U A;  2JPT A;  3I5H C;  2ZRS A;  3EK8 A;  1NX0 A;  2LAN A;  1PSB A;  1Y6W A;  2MAZ A;  2L50 A;  1SY9 A;  3BOW B;  4YBH B;  1XYD A;  1OMV A;  1KFX L;  1WLM A;  2OTG B;  1Y1A A;  3CWG A;  1QX5 B;  3LCP C;  1OSA A;  4CFQ A;  3I5I B;  1K94 A;  2D8N A;  2LVJ A;  2Y4Q A;  3BUO B;  3SG3 A;  4XYN A;  1NYA A;  1G33 A;  4USL A;  1PVB A;  1PUL A;  1SCM C;  5HKY A;  4NDB A;  1CDN A;  2WCB A;  4ORC B;  3OX6 A;  1EJ3 A;  1VRK A;  2R2I A;  4C0J A;  4MRX A;  3IQQ A;  3TS5 C;  2JWW A;  2NCO A;  3WHT B;  1AVS A;  3PM8 A;  4NQG A;  4P2Y B;  1YX7 A;  1XA5 A;  3ZNI A;  1QX2 A;  2BCA A;  4C0L A;  1FI6 A;  2BKH B;  1JF0 A;  3TDZ A;  2LHI A;  2E6W A;  5D69 A;  3VRO A;  2LVK A;  2TN4 A;  2KGB C;  2QAC A;  4GGN A;  2LP3 A;  3EKH A;  1DVI A;  4MBE A;  2BL0 B;  4PE1 A;  1KWO C;  3DD4 A;  2K7B A;  4OVN F;  4PDZ A;  1NCX A;  1K9K A;  2ZRT A;  3D0Y A;  2JNF A;  1AHR A;  1REC A;  2Y1M A;  3CGA A;  3CTN A;  2MBX A;  3RLZ A;  5KTY A;  4YGB B;  1DJY A;  2KI6 C;  1TNX A;  5HKZ A;  3KO0 A;  5AFP A;  4JWQ A;  5AER A;  2ZND A;  1S3P A;  1TNP A;  1N0Y A;  1XO5 A;  1H4B A;  1K90 D;  3OB2 B;  2JT3 A;  2LHL A;  1UP5 A;  1GGW A;  1IJ5 A;  2HQ8 A;  3O2P A;  3OHM B;  2KDH A;  2FJU B;  4FTG A;  3DVJ A;  5D7F A;  4PHN A;  1K95 A;  3CS1 A;  4JQ0 D;  2SAS A;  1KFU S;  2LMU A;  1KSO A;  3OP0 A;  4L9M A;  3WNX B;  1K9U A;  3TUY C;  3BUW B;  1CNP A;  5I8N A;  1UHN A;  2A4J A;  1KK7 Z;  2EC6 C;  1CM1 A;  1S5G Z;  2F3Y A;  1LA3 A;  2M29 A;  2KGR A;  1AJ5 A;  1J1D A;  4PE4 A;  1S6I A;  3ICB A;  1WRK A;  1XFU O;  1NCY A;  2KOT A;  1YUU A;  2LAP A;  1AUI B;  3IF7 A;  3PLF B;  1TCF A;  2LNK A;  1MF8 B;  2Y9Z A;  2OPO A;  2MRD A;  2LP2 A;  2PAS A;  1SCM B;  3TDI A;  1S6J A;  1OE9 B;  5TNC A;  2I18 A;  5AXI A;  4A4B A;  1MQ1 A;  5K89 A;  1M46 A;  1W7I B;  4GAO A;  1RWY A;  1YVH A;  5HYD A;  1BG1 A;  4P5O E;  3PN7 C;  2K7O A;  2JC2 A;  1J1E A;  4IL1 A;  5B8I B;  1WY9 A;  3KPX A;  3EVU A;  2DOQ A;  5HKW A;  2LUC A;  1KK8 C;  2M1K B;  2Y1N A;  4BY4 A;  1L2O B;  1D1O A;  5I2O A;  1M63 B;  1N65 A;  2L0P A;  1UWO A;  3F45 A;  1QXP A;  1PRW A;  1DF0 A;  1QV1 A;  1R2U A;  2K2A A;  2HET A;  1ZOT B;  1DJZ A;  2NXQ A;  1F4O A;  2JT8 A;  5DKR A;  1RJV A;  1F71 A;  2KNE A;  1OQP A;  1CLL A;  3BOW A;  2LVV A;  4MRY A;  4GFT A;  4PHK A;  1AK8 A;  1IGV A;  2K2F A;  3JVT C;  1EL4 A;  1N2D A;  1ALW A;  2LMT A;  1V1F A;  2K7C A;  1RRO A;  2KYF A;  3WXA A;  2L98 A;  2KI4 B;  3CZT X;  4OR9 B;  3KEV A;  1M45 A;  1A4P A;  1LVC D;  4I5K A;  3TZ1 A;  1WDC C;  5JJG A;  4MN0 A;  1XFV O;  2JNX A;  2PRU A;  1MXE A;  2LVI A;  3OB1 B;  1XK4 A;  2KFG A;  2BE6 A;  1GGZ A;  2O60 A;  2M7L A;  1OFC X;  1DJW A;  2V53 A;  3VRP A;  2ISD A;  1CFD A;  2RGI A;  3DF0 B;  1UHH A;  1J55 A;  5ER4 X;  5ER5 A;  1XFY O;  2NCP A;  1A75 A;  1YRU B;  1LXF C;  1ZMZ A;  2K0J A;  4GGF C;  4OV2 A;  3PFV A;  3QRX A;  3A4U B;  1QVI Z;  3BUX B;  2M0R A;  1CMF A;  3FIA A;  5KU1 A;  1OMD A;  3CR4 X;  3AAJ A;  2WND A;  3I5F B;  1SL9 A;  1SKT A;  1TTX A;  3KHE A;  3PN7 B;  1B47 A;  1MWN A;  1SRA A;  4WQ3 A;  1LA0 A;  2CCM A;  4QJ3 B;  3SIA A;  1M39 A;  4GGF A;  4HSZ A;  3ZWH A;  1DGU A;  2GGM A;  1BU3 A;  2JTT A;  1ZAC A;  3DVE A;  2L4I A;  2WC8 A;  1QLK A;  1QV0 A;  1KK7 Y;  1S5G Y;  2H61 C;  5CPV A;  2LLU A;  1GJY A;  1J7Q A;  1GQM A;  3EVV A;  1KQM B;  4ZCU A;  1NUB A;  5HLO A;  4E68 A;  1QIW A;  2ZNE A;  3JTD C;  1PSR A;  4MEW A;  1IQ5 A;  1W7J B;  4MZL A;  2CNP A;  2JTZ A;  4BY5 A;  4HRH A;  4M2P A;  1CM4 A;  1SL8 A;  2Y9Y A;  1JC2 A;  2H61 A;  1K93 D;  1KFX S;  2OS8 C;  1F70 A;  2E30 A;  1S1E A;  1KCY A;  1AP4 A;  2NLN A;  1B7T Z;  1CDL A;  1SL7 A;  1LIN A;  1F54 A;  1RTP 1;  2KBM A;  1BR1 B;  2FOT A;  2M49 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...