4DCKA

Crystal structure of the c-terminus of voltage-gated sodium channel in complex with fgf13 and cam
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
153
Chain Sequence
b'SVATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sodium channel protein type 5 subunit alpha
publication title Crystal Structure of the Ternary Complex of a NaV C-Terminal Domain, a Fibroblast Growth Factor Homologous Factor, and Calmodulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/signaling protein
total genus 51
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2012-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4dckA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4dckA02
1DJIA 1A75B 4PE7A 5CSJA 3VGOA 2COLB 2H2KA 2KAXA 4MEWA 3I5HB 3VRNA 2M49B 1XFVO 1K94A 1KWOB 2QPTA 4I5LB 1JUOA 1L2OC 1QLSA 2KFGA 1EL4A 1DT7B 1XK4C 3F45A 2G9BA 1S3PA 1QASA 1J55A 2BCXA 2VRGA 2LCPA 1IKUA 3LCPC 5B8IB 5CPVA 3CZTX 4HSZA 1QS7A 4MZKA 2HPSA 1DGUA 5I2OA 1F54A 1DJHA 1XFUO 2LANA 3VRQA 5AERA 5HKWA 2F8PA 1SYMA 3CGAA 1NPQA 2L2EA 1YURA 2M1UA 5CSFA 3I5HC 2HETA 4ORBB 1QTXA 3EK4A 1KWOC 1CFPA 2AMIA 2MJWB 1AP4A 2FJUB 1SCVA 4R1EA 4JWQA 1E8AA 4MLWA 2LAPA 1PALA 1CMFA 3EK7A 4ZCUA 1EG3A 1BMOA 2NXQA 2K7BA 1IJ6A 2ZN8A 1ALWA 2IS9A 1M45A 2F2PA 1S5GY 1GGZA 2JZIA 4PALA 2MBXA 1R6PA 4CLNA 1DJYA 4C0JA 1U5IB 1QV1A 2JXLA 1AVSA 4PCWA 1CLMA 3NXAA 2Q4UA 2ZNEA 3PFVA 1OMRA 4OCIA 3LLEA 1MHOA 5I2QA 1W7JB 1V1GA 2PALA 1JWDA 1KCYA 1XFZO 3I5IB 3TDZA 1DJXA 2WCFA 2I7AA 3BOWA 2MA2A 2CCMA 4YRUA 1PULA 1CKKA 3NSLA 1J7OA 4BY4A 2KBIA 2R2IA 3IQOA 2Y4QA 5HLOA 1EXRA 1RWYA 2LVVA 2M1KB 2MRDA 2BKHB 2LMVA 2K7OA 3SJSA 1SKTA 1TNQA 4MZLA 4CIDA 5HKYA 1CDMA 2L51A 3PATA 3ICBA 3SIBA 2EC6B 3KEVA 4FTGA 1LVCD 3AAJA 2KI4B 3I5IC 1SNLA 4DRWA 1RROA 1MR8A 2WORA 4MBEA 4N1FA 2BBNA 4NDCA 1NX1A 2GV5A 5DKQA 2K8MB 3DVMA 4YI9A 1B7TY 1BR4B 2NCPA 4OKHA 1IRJA 3BUOB 1RECA 3WHTB 2KAVA 4FQOA 2KGBC 1M63B 4Q04A 1DJWA 1OE9B 1S36A 3BYAA 1OSAA 4JPZB 5I8NA 3FIAA 1KK7Y 1C7WA 1S5GZ 1QXPA 4OR9B 2EC6C 2WC8A 2CXJA 1F8HA 2KI4C 2FCEA 2PMYA 1MUXA 1EG4A 1YRTB 3VRPA 4MRYA 2M8UA 3DVEA 1K96A 3M0WA 2ZNDA 1DF0A 5KTYA 2B1UA 1FBVA 1MXLC 2KI6D 2ZRSA 2K7DA 3BUWB 2JNFA 4XJKB 1J1DA 3O4YA 1B4CA 1FPWA 2GGMA 1TTXA 4HREE 2I2RE 1PSBA 1QATA 2OPOA 1CLBA 4A4CA 4JQ0D 2SCPA 3LK1A 3D0YB 1UUSA 3IF7A 2FOTA 1CDPA 2DOQA 1BF5A 2NLNA 2ZFDA 3WXAA 3A4UB 4WQ3A 3OX6A 4QJ5B 1PSRA 2WOSA 3BQ3A 3FS7A 1CM4A 3EKHA 1K9UA 1XFXO 2HQ8A 2MAZA 1TN4A 2LLTA 4GFTA 1B1GA 1DGVA 1C07A 3QRXA 4CPVA 2HF5A 3KO0A 3LL8B 3CTNA 1ZFSA 1LA3A 2FCDA 1ZOTB 3SG6A 2PASA 2LV7A 3I5FB 2CT9A 3KF9A 1NCYA 4AOMA 2RGIA 1NP8A 2JRFA 1AUIB 2GGZA 2WNDA 2PRUA 2PSRA 4M2PA 4MVFA 3PALA 1KK7Z 3CR5X 1V1FA 2Y9YA 3A8RA 1WY9A 1WLZA 3RLZA 1QIVA 1ODBA 2KFFA 3PN7B 1CFDA 2JWWA 2K2FA 3I5FC 1QV0A 2KBMA 3SG5A 3ZNIA 2L5XB 1C7VA 1U5IA 3FWCA 1QJTA 2LLUA 3IQQA 3TUYB 1PRWA 4ORAB 5BPJA 1DJGA 5DKNA 2KGRA 2HQWA 3NSIA 1QX2A 2JOJA 4MRXA 4CFRA 4QJ4B 1B8CA 1J7QA 2KSPA 3BXKA 1HT9A 1CDLA 2M7NA 1MQ1A 4YBHB 1OMDA 2LE9B 2TN4A 4DIRA 2BECA 4L9MA 2OS8B 5ER4X 5AANA 2H61C 2JC2A 2LMTA 3FWBA 4GGFC 1JF0A 5PALA 1GGWA 1S6IA 1NSHA 1QLKA 3PN7C 2JQ6A 2LUCA 1CMGA 1KSMA 2JXCA 4GBAA 4N1GA 3TUYC 2EGDA 4YI8A 3SIAA 1LINA 1Y1UA 5GQQC 1SL7A 2BBMA 5ER5A 5G08A 5I2LA 1JC2A 2LM5A 4M2QA 4USLA 2EHBA 1OMVA 1ZMZA 2E30A 2JTTA 2M3WA 1DVIA 3SG2A 1EH2A 1KK8B 2WCEA 2D8NA 4WQ2A 1YUUA 3BUXB 4YGDB 2MLEC 1G8IA 1SL8A 2ZKMX 2OS8C 1N65A 1TCOB 3BUMB 3VRRA 1AJ4A 3CS1A 3OHMB 3DVKA 2Y5IA 2V53A 3K21A 2CTNA 2Y9ZA 1IQ3A 2BE6A 2JTZA 1TIZA 1KFXL 1XVJA 2KNEA 3TZ1A 2CNPA 1NUBA 3TS5B 5HKZA 2KQ6A 3WHUB 4ICBA 1H4BA 1KFUL 1NX0A 1W7IB 1YVLA 3ZWHA 1Y1AA 3PM8A 1KK8C 3BUNB 1A29A 1K8UA 3AAKA 2KAYA 3PSRA 2LP3A 2LMUA 4GAOA 1K95A 3JVTB 2A4JA 1IH0A 3SG4A 2G2BA 4PHKA 4XJKA 1UHNA 4BY5A 1YRUB 3AKAA 1JF2A 1IG5A 2JU0A 2KOTA 3DF0A 3H4SE 2SASA 1M31A 4HRGA 4OVNF 4PHMA 2KQYA 2F33A 5CSIA 3TS5C 1ZACA 1DTLA 1FI5A 1RFJA 3D0YA 2WCBA 4HRHA 3DF0B 1F70A 4I5KA 4YGAA 4OV2A 2BL0B 3MSEB 1F55A 4C0LA 1IJ5A 1PVBA 3DD4A 1WLMA 2LHIA 1Y0VH 5F6TA 4YGBB 1BU3A 3JVTC 1NCXA 1BG1A 3AKBA 5AEQA 2Y1NA 3WNXB 5JJGA 2K7CA 1YX7A 1ZUZA 1HQVA 2M7LA 3OB2B 1YR5A 3CR2A 1CDNA 1OZSA 1K2HA 2LHLA 2M29A 3NSKA 4I5JA 1YUSA 5HLVA 4QJ3B 4E68A 1N2DA 4CFQA 2KHNA 4PHNA 5KSZA 2LP2A 4XYNA 1IWQA 1WRKA 2BKIB 3SG3A 1CNPA 1S6JA 2BL0C 4GNKB 1KSOA 3TDIA 3I5GB 3TDUA 1SK6D 2NZ0A 1MXEA 3E3RA 1B7TZ 3OP0A 5DKRA 1TNWA 2M0RA 2MHHA 2BE4A 3CLNA 4PE4A 1AK8A 1KQMB 3JTDB 2H61A 1RTP1 1YX8A 4GGFA 1OOJA 1BLQA 2Q91A 2M9GA 4N5XA 2OTGB 1S26D 5AXIA 2F3ZA 1QIWA 5TNCA 1TRFA 4GGNA 4MZJA 1NIWA 4NQGA 4YGEB 3GK2A 2LC5A 1DMOA 2L0PA 1XA5A 3O78A 2L4IA 1CFFA 1SW8A 3I5GC 2KFHA 1SR6B 1UHIA 1IQ5A 2MLFC 4M2OA 1WRZA 2NCOA 1YVHA 4PE1A 1KQMC 3JTDC 1CTRA 1RJVA 1NX3A 2ZRTA 2JT8A 4GPLB 1BOCA 5AFPA 1WRLA 2CBLA 1UP5A 1FF1A 2JT3A 1FI6A 2JT0A 1B47A 1Y1XA 2OTGC 1BODA 3EVUA 3EKJA 4ZCVA 1F71A 1N0YA 1NWDA 2L50A 3RM1A 4C0KA 4UPGA 5K89A 2ZN9A 1A4PA 3LK0A 1SCMB 2I18A 2KDHA 2LLSA 2LVJA 5D7FA 2LVKA 1K9PA 1UHJA 3O6BA 1SY9A 2M97A 1SR6C 1ALVA 4P5OE 3D10A 3HX4A 2KI6C 1IGVA 1B8LA 4YGCB 2K61A 3O2PA 1M39A 2AAOA 3KHEA 3KPXA 1WDCB 4I5NB 4U8DA 1KFXS 1JFJA 3PLFB 5JOLA 1AHRA 1OFCX 1JSAA 4DUQA 3NSOA 2Y1MA 1SMGA 2PVBA 1KQVA 4D1EA 1KFUS 1QX5B 5J3XA 1BR1B 1SCMC 1EJ3A 2P6BB 4DS7A 1X02A 4PE0A 1MWNA 1S6CA 3GK4X 3GOFA 3OB1B 1BJFA 1UURA 5HYDA 1QVIY 2I94A 2K0JA 4AQIA 2F2OA 4DCKA 2O60A 3EVVA 2QACA 2KYCA 3BOWB 5CSNA 1CFCA 1LXFC 4MSPA 1J7RA 1R2UA 1WDCC 1XFYO 1TOPA 3GK1A 1D1OA 2JPTA 1DJZA 1TNPA 4PDZA 2JULA 2K2AA 3EK8A 1F4QA 3OX5A 1J1EA 1UHKA 2ISDA 4GUKA 3HCMA 1PK0D 1A2XA 1B9AA 1MF8B 5FYXA 1K90D 4MN0A 1VRKA 1B8RA 1XO5A 2E6WA 3DVJA 1AJ5A 2AUCA 1UWOA 1XFWO 1OQPA 1JBAA 5IBWA 2JNXA 1NYAA 1M46A 1PVAA 1XYDA 4TNCA 1OZOA 1YUTA 2LUXA 4WRIA 4ETOA 1A03A 1L7ZA 1GJYA 1Y6WA 1QX7A 1CLLA 1K9KA 3EVRA 2O5GA 1K93D 1BT6A 4NDBA 4PHJA 3C1VA 1G4YR 2LNKA 1FW4A 1XK4A 1GQMA 1NX2A 2L4HA 4F0ZB 1J7PA 3CWGA 1NCZA 1F4OA 1Q80A 1SBJA 1SL9A 1CB1A 3VROA 1S1EA 1L2OB 2F3YA 1G33A 1TCFA 2BCBA 1RK9A 1TNXA 5D69A 2KYFA 1JFKA 2BCAA 1LA0A 4P2YB 4NDDA 1A75A 1H8BA 5KU1A 3SG7A 1QVIZ 1SPYA 2L98A 4AQJA 1YTZC 2LVIA 1CM1A 1LKJA 1SRAA 1UHHA 4ORCB 4A4BA 1DF0B 3CR4X 4IL1A
chains in the Genus database with same CATH superfamily
1DJIA 3H1KG 3II6A 3B5NA 5B5EH 2E76C 3VRNA 1XFVO 2IBZD 3L70D 1JUOA 1L2OC 2P67A 2KZJA 3B5NB 4I6MC 1S3PA 2BCXA 2J59M 4MN4C 5AVWB 4MZKA 1F54A 2CPBA 5AERA 4NPDA 5EFWB 1PGOA 4D6TD 5CSFA 3EK4A 4HB1A 1NTMJ 2MJWB 4WWIA 3VMZA 1IO4A 1SCVA 2YXRB 4IL6X 3CCRP 1JEKA 3HTKA 4GT1A 2LAPA 1PALA 1CMFA 2W8ZA 3OBVA 3EK7A 1BE3E 4XE5B 1EG3A 1KYOH 3TYYA 1G1IA 1CI6A 4BRYA 1NTZE 1H0TB 2ZN8A 3BJHA 1S5LE 1QVGO 2IS9A 3HTKB 1GGZA 2JZIA 1SQBJ 4C0JA 4BRYB 2K3RA 4OGQD 1AVSA 4PCWA 1JCCA 2Q4UA 1NU1J 3L72J 4OCIA 4Z1MH 2AXTE 1W7JB 2QIWA 4RO0A 2A45I 3NSLA 4K3AA 1KTMA 4DJGA 3NGVA 2Y4QA 1EXRA 2E42A 2AEJA 2KB7P 4N3YB 2LVVA 1G2CA 1NAYA 3TNUA 2MRDA 2KK7A 2XDJA 1DEKA 2OYOA 1CDMA 2BEQD 3MHVA 1IFNA 1URQC 1GTWA 2OARA 1SNLA 1MR8A 2MJZA 4RJTA 3GMAA 1NX1A 1JNMA 1BR4B 4OKHA 3L4AA 1RE3C 1SQPE 2OGUA 1RECA 1LNQA 1M63B 4Q04A 2R5BA 1ORGA 1DJWA 3L73J 1IC2A 3FIAA 4FQTA 1KFMA 4GIFA 5CCHD 5FI6A 4K35A 2EC6C 4PV1B 1F8HA 4DOJA 3H1KD 4MRYA 3DVEA 1VQ4P 1K96A 1X22A 3CZ1A 1NAFA 2KI6D 1MXLC 3BUWB 2N1TC 3VOPA 1YIJP 3L71D 1PGPA 1KN7A 2I2RE 5KLVJ 3T97A 3O4XA 1JY2O 1UUSA 2H89C 1CDPA 1LTTC 2K60A 1BF5A 2NLNA 2NZ2A 3WMM0 3A4UB 4WQ3A 3OX6A 4H13D 2WOSA 1K9UA 1XFXO 2IFNA 1NU1K 4OGQC 1C07A 3QRXA 4CPVA 2P1JA 2HF5A 1JY2N 1RF0C 2PAJA 3CTNA 1LA3A 1BE3G 2RMZA 1NTZG 4AOMA 1NP8A 2I8DA 2B87A 2JRFA 2H88C 1AUIB 1LWUB 1SQQE 2WNDA 3H1LJ 2PSRA 3PALA 1RF1B 3H25A 3CMAP 1LTGC 2M5AB 5AVYB 1V1FA 2Y9YA 2FFDB 2LXBA 3OA7A 3CCEP 1QIVA 2KS1B 1ODBA 3RZSA 3FWLA 3I5FC 3SG5A 2L5XB 1C7VA 2QM7A 1U5IA 2LLUA 2WSFJ 1QGKB 3L75D 2KGRA 2HQWA 4CFRA 3NHIA 4DIRA 3CXHI 2JC2A 3S0FA 3CXHE 3V2LA 4EDFA 2LUCA 2BCCJ 2JXCA 3L36A 2EGDA 1QX8A 2WMMA 4PD4I 1JC2A 3N7NA 1S3JA 4USLA 2EHBA 1OMVA 2Y0CA 4I2LC 1X79B 1SQPG 2M3WA 5KLVK 3BUXB 5FI2A 1L0LE 3RBXA 1G8IA 1KB9I 1Q86Q 1EXIA 5KAIE 2OYHB 1AJ4A 2ZT9C 2V53A 3MZWB 3L74G 1NTKJ 2QRXA 2BE6A 1FZCC 3CABA 4JD9A 1KFXL 2P58A 2KNEA 2FYUE 2KQ6A 2Z5IA 2R5DA 5KAFE 1L4AA 1KFUL 1NX0A 3R1PA 3IF4A 4IL6E 1A29A 1USDA 3CWBD 3PSRA 2YNYA 1WT6A 3B5ND 1ZR4A 1KYOD 3JVTB 1IH0A 3SG4A 2G2BA 4AUWA 4XJKA 1LTAC 1UHNA 4BY5A 5CCGA 5KAIH 4INXA 2IDBA 2KOTA 2JU0A 1NJIQ 1NH4A 2E43A 5CSIA 3TS5C 1FI5A 1RFJA 1SLQA 3PLNA 2FKWB 4I5KA 5TJHA 2E5YA 4C0LA 4IL6H 3B86A 1VDFA 3DD4A 1BG1A 1GM0A 1SVFA 5AEQA 2Y1NA 2WITA 3AEDC 1YX7A 1SQQG 1YR5A 3PHLA 3AE1C 2LHLA 2M29A 4I5JA 1L0NK 5HLVA 4GKGA 1N2DA 3S0GA 2V7QJ 4PHNA 2C9LY 1DELA 5AVZB 4XYNA 1CNPA 1S6JA 4GNKB 1XTGB 1SK6D 5AW5B 1MXEA 1K8AQ 1RQUA 2YMYA 4PE4A 3CLNA 1P84H 4Y28J 1LTBC 2JJLA 4N5XA 2OTGB 1GU5A 5TNCA 1NIWA 4YGEB 3GK2A 2L0PA 3LW5H 1XA5A 1CFFA 1JY3P 4W7YA 3B88A 1GL2C 1DX7A 3HD7A 1YVHA 4L75A 1CTRA 1HF9A 4GPLB 5AFPA 1WRLA 1FF1A 3CMEP 3G71P 1BODA 3EKJA 4ZCVA 1L0LG 1N0YA 2W6BA 1VQ8P 2LVJA 1JCDA 1LJ2A 1KQLA 3TDKA 1BCCJ 1OW7A 1MUUA 1SY9A 1SR6C 4P5OE 1P28A 4INWA 3CZ0A 4PV1D 4KJMA 3L74D 2IBZE 2FYUG 2WPQA 3L70E 4AQRD 4KYNA 1W2EA 1QEXA 4YGCB 2OYIC 1JMBA 3O2PA 1X8YA 2AAOA 3KPXA 2FYNB 4DUQA 3NSOA 3KXDA 1LT9A 2PVBA 1SCMC 1EJ3A 4DS7A 1VL2A 1MWNA 4D6TE 1OX3A 2I94A 2ZYDA 5GTIE 1LT9B 5M1BA 2F2OA 4DCKA 2O60A 2QACA 5CSNA 4MSPA 2Q7CA 1WDCC 1N7SA 3V2PA 5KLIB 2JPTA 5AVXB 1F4QA 3CX5I 4GUKA 3H1JD 1PK0D 5FYXA 2KI7B 3A0HE 1M56D 3B87A 1AJ5A 3B6XA 1BE3J 2RH0A 1JBAA 2JNXA 1U57A 1NTZJ 1PVAA 2LUXA 4WRIA 1Y6WA 3USSA 4ZNCA 4XA4A 3EVRA 3MUDC 5AW9B 2O5GA 4NDBA 1KQSO 1G4YR 2IZ0A 3V4WA 2L4HA 3CWGA 1NCZA 2QEXP 1F4OA 1Q80A 1OOFA 3FE8A 1KD1Q 1GZLA 1J1EC 1G33A 4ASWA 1TNXA 2KNCA 1VQNP 4N78D 2BCAA 3L47A 4P2YB 2QVAA 1S1CX 4C7NB 3FXEA 1LKJA 4ZKUA 3BCCG 3DZTA 2R3SA 3NFQA 3HE5B 2COLB 2H2KA 1S4XA 2KAXA 1OW8A 3I5HB 2L2CA 2AEMA 2QPTA 4I5LB 1NOHA 2PYQA 3O8ZA 2KFGA 1GU4A 1XK4C 1GDTA 3F45A 1IKUA 3VMXA 3LCPC 5CPVA 1SQPJ 1D7MA 4HSZA 5I2OA 1DGUA 2NPSA 1DJHA 1YQ3C 2LANA 3VRQA 1OVRA 5HKWA 3HE4A 1T2KC 3H1KE 2F8PA 1SYMA 1Z56A 1SQXK 2IBZG 4I7ZC 2L2EA 3L70G 3GLMA 5D3OA 1M8OB 2HETA 4ORBB 2WPRA 1KWOC 3L71E 2AMIA 5AW8B 1AP4A 4EYYQ 2FJUB 4R1EA 1BDDA 1E8AA 3N4XA 3S0BA 2WPSA 2NXQA 1BMOA 4KHXA 5B66E 3H6PA 1PV3A 4D6TG 2K7BA 1L4AD 2M8RA 2F2PA 1S5GY 2Z4EA 2K9YA 3WUUA 3L35A 2JXLA 4IOIH 1CLMA 4W80A 2ZNEA 3VMYA 4L74A 3CL3D 5CCGD 5I2QA 1MHOA 1XFZO 2WCFA 2I7AA 1P84D 2MA2A 5AVSB 2KBIA 2R2IA 2WCJA 5B66H 3IQOA 2QEVA 2M1KB 2HLOA 3RK3B 2LMVA 2K7OA 3SJSA 1TNQA 3G3ZA 1SFCB 4MZLA 4BWNA 4H0LD 3G6EP 1SQQJ 3ICBA 2QJPB 3KEVA 3JCUE 3L75E 3I5IC 2KI4B 3RGUA 1RROA 4WY4A 2WORA 4N1FA 3CCJP 2BBNA 4NDCA 1EZVD 5AW6B 1N73A 1KILB 5DKQA 3DVMA 2NCPA 3BUOB 3ZDMA 3DXLA 2I1KA 1EDLA 2KAVA 2E5TA 2KGBC 1VF5B 1SQPK 3PM2A 3BYAA 1GW3A 2I1JA 1M1JB 4U3FD 3N7HA 1C7WA 2QJYC 1S5GZ 1QXPA 2YMKA 1ZN5A 3VYIA 1Q2NA 5B5EE 3NTNA 3SS3A 4L76A 1MZ9A 3BCCD 2FCEA 1MUXA 3AE2C 3VRPA 2L5YA 1DF0A 1FBVA 5CJ0A 1HTLC 1J1DA 2GGMA 1TTXA 1MFZA 3R1VA 4L73A 1PSBA 1QATA 4A4CA 3HD7D 3HUSB 1J1DB 5AVTB 1L4AC 2FOTA 1L0LJ 3M06A 3BQ3A 3PH0A 4N6JA 1KFNA 1NO4A 2E75D 1B1GA 2SPZA 5DJUB 1DGVA 3L71G 3CWBE 5CCGC 4H44B 4XFJA 1KYOE 2FYUJ 1ZOTB 3AE6C 3SG6A 2PASA 2LV7A 1HGZA 2WQYC 1S72P 3D77A 4Y99C 1N86A 3PJSK 5APUA 1MFTA 4M2PA 3JSVC 4ZMDA 2B88A 4H0LC 1H0TA 1A02J 3M91A 3V2QA 2FBWC 2KFFA 3PN7B 1QV0A 2KBMA 3ZNIA 1N2DC 3TUYB 1SQVD 3IQQA 2JKVA 2C9NY 4GOEA 1FC2C 1PRWA 4ORAB 1NVOA 2Y0DA 2M0BA 4MRXA 1J7QA 1N7SD 3BXKA 3FX0A 2WPVB 4YBHB 5HL1A 2TN4A 1SS1A 4L9MA 3K5BA 1WMKA 1AQ5A 3EWKA 2YKQA 3OGNA 3S0DA 1S6IA 1QLKA 2JQ6A 3L75G 1MV8A 3LW5J 2CK3H 3CLQA 3C1LA 1DC1A 3SIAA 1AQTA 1OW6A 2PFXA 1LINA 4NPEA 5BU8B 2ZXEB 2WVRA 5I2LA 2LM5A 3DYEA 3VTPC 3BRTB 2JTTA 3L37A 4WB4A 3SG2A 1EH2A 2ERBA 2WCEA 3BFBA 3EFGA 2MLEC 1DD3A 2ZKMX 2LR2A 2OS8C 3HD7C 3VN0A 4NPFX 3WUVA 3BUMB 2P71A 3FE6A 3V4QA 4M3LA 3VRRA 3Q8IA 4O9BA 3OHMB 3DVKA 3IVTA 3K21A 2CTNA 1XVJA 3TZ1A 3D78A 2E75C 1RY3A 5HKZA 1EXJA 1L0ND 3WHUB 2WSCH 2WSEJ 3ZWHA 3QMEA 1KK8C 3BUNB 3M0DC 1S2EA 1HH0A 3AAKA 2KAYA 1OMIA 2LP3A 2ZVNB 2JP3A 2YIUB 1LTIC 3L74E 1YYCA 4OVNF 1NTMK 4PHMA 2KQYA 2F33A 1VQ5P 1DTLA 2WCBA 5KJ7A 3CWBG 1CW5A 1F70A 1M57D 2NPSD 4OV2A 1DD4A 3L70J 1OXZA 1VQ7P 3KHUA 1Y0VH 2UWJE 3AECC 1NCXA 1SQBK 5AVUB 2W6JH 1N7SC 3AKBA 3WNXB 5JJGA 1IK7A 2K7CA 4ASVA 2WTYA 3Q1MA 3CR2A 3PJIA 1K2HA 1OZSA 5APSA 5AW1B 1KQGB 1YUSA 2Q3EA 4QJ3B 1FZFA 5KSZA 4D6TJ 2LP2A 5AW2B 2JO1A 3H1JE 4JYCA 3HRNA 2BL0C 3TDIA 1LWUA 3I5GB 4C7RA 1RF1A 1GK6A 5E79E 2K9JB 1IFPA 2M0RA 2M5AA 2BE4A 1AK8A 1LGHB 3M9QA 2FFDA 1AVOA 2H61A 1RTP1 1YX8A 4GGFA 1OOJA 3I56P 1BLQA 2KLVA 2KS1A 1W5CE 1YJWP 1JY2P 1S26D 5AXIA 3C8VA 3LIEA 4LGDE 4U7JA 3IAOA 1Q81Q 2QJKC 4NQGA 3H1HD 1DMOA 2O01J 3GHGB 2MLFC 3MTUE 1URQD 4M2OA 5AVRB 1WRZA 5E79H 1KQMC 3JTDC 2D2CB 4RKUJ 2Z5HA 1C3YA 4N78E 2JT3A 3EVUA 1USEA 4C0KA 5CCHC 2I18A 2LLSA 4WY4D 1G1JA 2QG4A 5D7FA 5KKZB 4GODA 2LVKA 1AVYA 2M97A 2KSEA 3RK2D 3V2NA 3HX4A 4CPGA 1TWOA 2KI6C 3B4SA 1T8ZA 1B8LA 2OYHA 3KHEA 3PLFB 2NPSC 1EDKA 2R32A 3U59A 1JSAA 3RL0B 1VQOP 1KQVA 2E74D 1QX5B 2BASA 3GK4X 3GOFA 1BJFA 4H13C 1N8RQ 5HYDA 1LTJB 1GD2E 2K0JA 2KLEA 2OTKE 3EVVA 3BOWB 4OH8B 1HWTC 1LXFC 3GK1A 3H1KJ 1TNPA 1YTZI 1PGQA 4PDZA 3EK8A 2K2AA 3U1AA 4EI2A 1NWQA 5APWA 2GM4A 3L71J 1K90D 2P10A 1DQEA 2AXCA 1VRKA 3DVJA 3SS4A 5CMZA 4UB6E 4AYCA 5AW3B 2G3AA 3CD6P 4PD4H 1M46A 1XYDA 2H8VA 3RL0g 1OZOA 2AEFA 4ETOA 1A03A 1GJYA 3H1JG 2JPOA 5APTA 1P84E 3C1VA 2LNKA 1Q7YQ 2N9BA 3EQ2A 1KB9H 1GQMA 2E76B 1SQXD 1SBJA 1S1EA 1L2OB 1TCFA 2BCBA 3NMDA 2KYFA 2YXQB 1H8BA 4WY4C 3TGUD 3SG7A 3LIDA 2L98A 4UB6H 1N73C 3CR4X 2O3JA 3CYZA 3RK2C 2ZXXA 4PE7A 5CSJA 4MEWA 1AV1A 5H2FH 3D76A 4LLHA 3L75J 2A06D 2JDIH 1EL4A 2Q5UA 4U3FE 2G9BA 1J55A 2E74C 2KUBA 2PRRA 3AE7C 1NTKK 3CCMP 2GTEA 3AE9C 5L8RJ 3CZTX 3BCCE 3VP9A 1QS7A 2WZ7A 3V2RA 2Q9IA 1E5WA 2J58A 1FBMA 1U7MA 1OOHA 2M1UA 4IFDK 5TISH 1ZRTD 1QTXA 2VRSA 3S1KA 1PGJA 3GW6A 3K1EA 3QWOC 1AFOA 4PJ0E 3B5NC 4MLWA 1JO5A 2R44A 1M1KQ 5APXA 1IFDA 1IJ6A 1ALWA 4BXLA 3H1ID 1UIIA 1M45A 2IBZI 2K88A 2NRGA 4PALA 2MBXA 1R6PA 4CLNA 2P2UA 1QV1A 1H88A 3NXAA 3AE8C 3PFVA 1RE4A 2M3EA 3LLEA 1URQB 2PALA 1JWDA 1JM0A 3MIWA 3CCUP 3TDZA 1DJXA 4PJ0H 1J7OA 1PULA 3CWBJ 4BY4A 2O1KA 5KJ7D 3KZIH 1RWYA 1T14A 2BKHB 3E7KA 4WVZA 2XZRA 3FE9A 4CIDA 5HKYA 1IIOA 3KYQA 1JMMA 1VQPP 3R1OA 3SIBA 2HPCB 2EC6B 4FTGA 1SQVE 1LVCD 3AAJA 1PP9D 4YXWH 4EOTA 3Q5PA 3V5BA 2QEHA 3UNWA 1ZR2A 2K8MB 4YI9A 1B7TY 2N1TB 4HYTB 3WHTB 4FQOA 1VPCA 3S9OA 1OSAA 2FYZA 1KK7Y 2PGDA 3C9IA 1RF0A 3CCQP 2KYVA 1EZVG 5DJTB 3CZ2A 1NU1G 3L72G 4C7NA 4OGQB 4TT3H 1JTHB 2XKMA 2B1UA 2D2CD 2JNFA 1B4CA 1FPWA 4U3FG 3HE5A 2WSCJ 4HREE 2IFMA 1BGYD 3D0YB 3IF7A 3AEGC 3CDNA 4PV1C 3AEEC 3CX5H 4QJ5B 1S5LX 1PSRA 1L0NE 2R3CA 3EKHA 2HQ8A 1TN4A 2LLTA 2ZYAA 4GOFA 3KO0A 1FAVA 1ZFSA 4ZKPA 3GF7A 5K5GB 2OTLP 2WSFH 3I5FB 1ZMEC 3I55P 2QEBA 3E1RA 2W27A 1NCYA 2RGIA 5KJ7C 3L73G 2QA4P 2GGZA 1DEBA 3A0BE 2PRUA 3CC2P 4MVFA 1QL2A 4PD4D 1KK7Z 3WU2E 3CR5X 3L74J 1WY9A 2JR8A 1WLZA 3RLZA 3W68A 1NKNA 2K2FA 3S4RA 2L5GB 1KB9D 3TF5A 3FWCA 1QJTA 1N7LA 5BPJA 1GMJA 1DJGA 1NTZK 4QJ4B 1H8AA 1B8CA 2C0XA 1LWUC 1HT9A 1CDLA 3PRJA 2Q6QA 4PT1A 1RF1C 2HODB 1LP1A 2LE9B 4I1LA 3A0BH 5DICA 3WU2H 5ER4X 2FFDC 2H61C 2LMTA 2HR3A 3FWBA 4GGFC 1GGWA 2ZT9B 1SQVG 2KXPB 3JC22 2CPSA 1LP1B 1KSMA 1FZCB 1K04A 1TU3F 4GBAA 1SFCA 4N1GA 1KV4A 1FZEA 3P8MC 1NTMD 3H1JJ 5GQQC 5ER5A 2BBMA 4OZDA 5G08A 2RN0A 4OWFA 4HJGH 1DVIA 3S0AA 1AA0A 4WQ2A 5C39A 1YUUA 3H1HE 1HUCA 4YGDB 2JWDA 1JUNA 3CCSP 1TCOB 1KILA 1SQBD 2Y5IA 3UO9A 2Y9ZA 4QMAA 1W9ZA 5AVVB 3P8CD 1TIZA 3TS5B 1C3ZA 1M1JA 1NU1D 3L72D 1NKZB 1H4BA 1EC5A 1W7IB 1YVLA 1Y1AA 3SWFA 3F5HA 3G9RA 1EQ7A 1K8UA 2LMUA 3AE3C 2POHA 2OYHC 4W7ZA 4PHKA 1YRUB 3AKAA 1JF2A 1Q82Q 1L0NG 3DF0A 4HRGA 2JEEA 1M31A 3H32B 1ZACA 1JOCA 3HUSA 3GF3A 5KTBA 3DF0B 1KORA 1VQKP 1F55A 1IJ5A 1PVBA 2LHIA 2WCKA 2KPHA 3AE4C 3RBZA 4YGBB 1BU3A 3JVTC 1HBWA 3MGNA 2IPPA 1HQVA 1FE6A 3SS5A 3L73D 3NSKA 1AJYA 1KC8Q 1M90Q 1GL2A 1IWQA 1WRKA 1KYOI 1KSOA 2FXPA 2WT7B 2J5UA 4A7PA 3AE5C 3OP0A 3M0AA 1GL2B 3P32A 2KP8A 1PIXA 1K73Q 2K37A 2H8PD 2LKMA 5KLVD 2Q91A 2M9GA 1W2BO 1SQQK 1M7LA 1TRFA 4GGNA 3SWKA 2LC5A 2ZYGA 3D73A 1X9VA 2OYIA 3D74A 2L4IA 1SR6B 2HG5D 1UHIA 1SQXE 1IQ5A 2NCOA 3AEBC 4PE1A 1YI2P 1NX3A 2ZRTA 2JT8A 2OYIB 1BOCA 1BDCA 1UP5A 1FI6A 2JT0A 1VQLP 1B47A 2OTGC 1IFIA 3A3YB 3TGUE 1F71A 3H1HG 2N1TD 5K89A 1A4PA 1SCMB 2YGUA 1VQMP 2W90A 3H1LD 1EDJA 3O6BA 3CX5D 3NHTA 1R8EA 2XNXA 2FY8A 1IGVA 2A06E 4U8DA 1DEEG 1CI6B 1WDCB 1YQ4C 1ZLLA 1KFXS 1JFJA 5JOLA 1AHRA 1FZGA 5GTHE 2Y1MA 1SMGA 1L0LK 4D1EA 1KFUS 1BR1B 1QVIY 4U3FJ 3MUDA 1ZRTE 1S5LH 1K05A 1XFRA 3BCCJ 1SP4A 2FYUK 1CFCA 2QE7H 1J7RA 1R2UA 1XFYO 1HJ0A 1TOPA 1D1OA 2BCCD 3SFEC 1DJZA 1G2CB 1J1EA 2FYNC 3TNUB 2ISDA 3SSUA 1WRGA 3HCMA 5GTHH 1A2XA 1B9AA 3H1IE 1X0TA 2AXTH 2RKLA 1PPJD 2Q1KA 1B8RA 1XO5A 2E6WA 2A45H 1RE4C 1J1EB 1LT9C 1UWOA 1XFWO 4B86A 1OQPA 5IBWA 1ZOYC 1BCCG 1R5SA 4TNCA 2JWAA 1NHLA 1YUTA 1L7ZA 5KLIC 1NTKD 1TUJA 1OZHA 3BFHA 1K93D 1DIPA 1J2JB 3CPWO 3Q5SA 1FW4A 1XK4A 3WUTA 4EIJA 2YO2A 1PZQA 4F0ZB 1FDOA 5CHXA 1MKMA 3F89A 1IJDB 1PFIA 1RK9A 2WSSH 4RESB 5D69A 3Q2YA 1Y8AA 2K9JA 1LA0A 4NDDA 1A75A 3B7AA 3AEFC 1QVIZ 4AQJA 2LVIA 1Z2CB 1SRAA 5CBNA 4A4BA 1PP9E 4DT0A 4JKTA 5BU5A 4IL1A 4YTPC 1SQXG 1A75B 2ZT9D 2WCHA 3VGOA 4I7ZB 3T97B 1YITP 2M49B 3GHGA 1K94A 3BRVB 1KWOB 1SQVJ 2GUVA 3W67A 5EL2A 4DZOA 1QLSA 3GG2A 3TGUG 1DT7B 3P7KA 3EG5B 3RK3D 2VRGA 1QASA 1FU1A 2LCPA 1SFCD 3Q3DA 5B8IB 5AW0B 2H43A 3VB1A 2HPSA 2YKOA 1GK4A 1XFUO 3S0EA 2WWWA 3CGAA 1NPQA 3EFFK 2LXCB 1YURA 3I5HC 2A06G 4WBAA 1CFPA 4KT0J 3BATA 1KILD 2P7JA 1BGYE 2B87B 4JWQA 5I94A 3Q5RA 1VF5D 1FJPA 4ZCUA 3VMAA 2A45G 2W6AA 1IFMA 3R72A 3BASA 2GUSA 1QL1A 5APQA 3SWYA 3OJAB 1DJYA 2MKVA 1U5IB 3OAKA 1L0NJ 1LTJA 1OMRA 1V1GA 1KCYA 3I5IB 1IZNB 1LTSC 3BOWA 4YRUA 2CCMA 1CKKA 3H1IG 3TSIA 1T3JA 5HLOA 4PD4E 2WC5A 1SKTA 1TUZA 2FXMA 2Y0EA 1YJ9P 1BCCD 1S9KD 2QJYB 2L51A 3PATA 1KB9E 2HFED 4H44D 3CXHH 4JF7A 3B8EB 3CI9A 2XNDH 2H7HA 4DRWA 1SQVK 2IYPA 4MBEA 4IJ7A 1GL2D 3BVHA 1DH3A 2GV5A 1IRJA 3OW2O 2XU6A 3RK3C 3NXSA 4YXDC 2ITAA 5CJ4A 1SFCC 1OE9B 1S36A 4JPZB 5I8NA 1P84I 1PP9G 1L4AB 4OR9B 2WC8A 2QJPC 2CXJA 5H2FE 2KI4C 1NTME 2PMYA 1EG4A 1H89A 3SFDC 1YRTB 2WCLA 3MD0A 2M8UA 3UIAA 2YKPA 3M0WA 2ZNDA 1KILC 5KTYA 2ZRSA 4XJKB 2K7DA 3O4YA 5KAFH 2QEOA 1VF5C 2C0WA 2OPOA 1CLBA 1K9MQ 1M1JC 4JQ0D 1SQBE 1NYHA 2SCPA 3LK1A 3P8CE 1BE3D 1GW4A 4Y99B 2DOQA 3H1HJ 2ZFDA 1EZVI 3WXAA 1EZVE 5TISE 1NTZD 1OIPA 4JBZA 3FS7A 1CM4A 1NU1E 3L72E 4R4LA 2MAZA 1CSBA 4GFTA 3CC4P 4C46A 1JY3O 4H0LB 1BGYG 3LL8B 2FCDA 1FOSE 1RQVA 1RH5B 2CT9A 3PTZA 2W83C 3HUSC 3KF9A 1QWVA 1J1DC 2IYOA 4TLFA 3QH9A 1JY3N 3L4FA 2FXOA 3AEAC 3A8RA 2BNXA 4H44C 1KQFB 1CFDA 2JWWA 1OWAA 3KZIE 2ZJSE 3ITKA 2ZFCA 5DKNA 3L73E 3NSIA 1QX2A 2JOJA 2DW3A 4HKZH 2KSPA 1URQA 1Y9BA 2BAPA 3L4LA 2M7NA 1MQ1A 2P70A 1OMDA 1SQPD 2BECA 4UB8E 2OS8B 3HD7B 1Z4HA 3A2AA 5AANA 1ZP0C 5PALA 1JF0A 4HH2A 1NSHA 1RE3A 1FZAA 2ZVOB 3U1CA 3PN7C 3M9BA 3CC7P 2OTJP 3R2PA 1CMGA 3FGAD 1YTZT 3M0DA 3TUYC 2E75B 4YI8A 1A02F 2IZ1A 1Y1UA 5KLVE 2WSEH 1SL7A 1OVVA 4M2QA 1ZMZA 2E30A 2HPCA 1YBKA 1KK8B 2D8NA 3D6ZA 3D75A 1SL8A 3A5TA 1EDIA 5AW7B 1N65A 4UB8H 4GDOA 5APYA 3CS1A 2N1TA 2B9BA 1NTMG 1JB0J 1IQ3A 2JTZA 1PL5A 1T2KD 3D70A 2CNPA 1NUBA 4F7FA 3MP7B 4LC1A 4ICBA 5AVQB 1UIXA 1SQXJ 3PM8A 2OQQA 1KZUB 2G8YA 3H1LE 1SQBG 1HJBA 1FOSF 3CX5E 4GAOA 1K95A 1JTHA 2A4JA 3B71A 1N7SB 3DY9A 3TGUJ 3ABVC 1QVFO 5CBOA 1IG5A 2WC6A 3H4SE 2SASA 3CCVP 5AW4B 1RHZB 2IX7C 2KOGA 5GTIH 1SQQD 3D0YA 4HRHA 4YGAA 2L91A 4R4MA 2BL0B 3MSEB 5APVA 1WLMA 2ZAEB 5F6TA 2YIUC 1ZUZA 2M7LA 1ZW0A 3OB2B 1CDNA 3A0HH 1BSNA 4E68A 4CFQA 2KHNA 2BCCE 2O01H 2QJKB 2BKIB 3SG3A 1R5LA 2QDIA 3TDUA 3V6IA 3CXHD 3IFMA 2NZ0A 1PPJE 3E3RA 1BSHA 3RL0D 2KNCB 1B7TZ 5DKRA 1TNWA 2MHHA 1KQMB 3JTDB 1YJNP 2GA1A 5CCHA 1HVVA 3IR9A 2Q3IA 2XV5A 3H1IJ 2F3ZA 1QIWA 1T3UA 1YHQP 1NTKE 2KSJA 1OOGA 1OVUA 4MZJA 1L2PA 1L0LD 2K1AA 3E1IA 3CCLP 3O78A 1VQ6P 4JYBA 1SW8A 3I5GC 2KFHA 2QSIA 2HODA 1SSEB 5KLVG 1RJVA 3O6QA 2CBLA 2FYUD 3PP5A 2NPSB 2HYNA 1QLED 1Y1XA 2V4HA 3HE4B 1FZCA 1NWDA 2L50A 3RM1A 4UPGA 3TK1A 1LS8A 2ZN9A 3O6QB 3LK0A 1Q90D 2KDHA 2KIKA 3GHGC 3KQGA 3D6YA 4H13B 1FZBA 1K9PA 1UHJA 3FWNA 1ALVA 3D10A 1U7JA 1CZQA 3VP8A 1NGMB 1PP9J 2E76D 2KLUA 2D2CC 2BEZF 2KLDA 2K61A 4I5NB 1M39A 1FDMA 3RK3E 1OFCX 1OOIX 4IFFA 2KZIA 3H1LG 1KMIZ 5J3XA 2P6BB 1X02A 4PE0A 1S6CA 3OB1B 5KKZC 3KPEA 2O1JA 1UURA 2M3BA 1XTCC 4AQIA 1ZXGA 1FS0E 2KYCA 1KILE 2FJYA 4IFMA 3M9HA 3BFAA 5FI7A 2JULA 2PQLA 3OX5A 3KDPB 3D71A 1UHKA 3RL0C 3H32A 2B89A 1MF8B 3IN6A 1BGYJ 4MN0A 2QM8A 1LTJC 4YPCA 2AUCA 2V7QH 1T6AA 1FJKA 2N9YB 2BCCG 2PP6A 1NYAA 4WY4B 3I5CA 1QX7A 1CLLA 1IK9A 1Y47A 1N73B 5BVZA 1VQ9P 1K9KA 4PHJA 1BT6A 1PPJG 3R4YA 1HGVA 3RK2B 1FDIA 2YO3A 2O01N 1NX2A 1J7PA 3JCUH 1SL9A 1CB1A 3VROA 3G4SP 2F3YA 3FXDA 1OW4A 3A7OA 1ZV8A 1BCCE 2WT7A 1JFKA 1NTKG 1IFJA 2E74B 1S9KE 1LT1A 5KU1A 1SPYA 1YTZC 1CM1A 1UHHA 4ORCB 1DF0B 2WCMA 1E79H
chains in the Genus database with same CATH topology
1DJIA 1A75B 4PE7A 5CSJA 3VGOA 2COLB 2H2KA 2KAXA 4MEWA 3I5HB 3VRNA 2M49B 1XFVO 1K94A 1KWOB 2QPTA 4I5LB 1JUOA 1L2OC 1QLSA 2KFGA 1EL4A 1DT7B 1XK4C 3F45A 2G9BA 1S3PA 1QASA 1J55A 2BCXA 2VRGA 2LCPA 1IKUA 3LCPC 5B8IB 5CPVA 3CZTX 4HSZA 1QS7A 4MZKA 2HPSA 1DGUA 5I2OA 1F54A 1DJHA 1XFUO 2LANA 3VRQA 5AERA 5HKWA 2F8PA 1SYMA 3CGAA 1NPQA 2L2EA 1YURA 2M1UA 5CSFA 3I5HC 2HETA 4ORBB 1QTXA 3EK4A 1KWOC 1CFPA 2AMIA 2MJWB 1AP4A 2FJUB 1SCVA 4R1EA 4JWQA 1E8AA 4MLWA 2LAPA 1PALA 1CMFA 3EK7A 4ZCUA 1EG3A 1BMOA 2NXQA 2K7BA 1IJ6A 2ZN8A 1ALWA 2IS9A 1M45A 2F2PA 1S5GY 1GGZA 2JZIA 4PALA 2MBXA 1R6PA 4CLNA 1DJYA 4C0JA 1U5IB 1QV1A 2JXLA 1AVSA 4PCWA 1CLMA 3NXAA 2Q4UA 2ZNEA 3PFVA 1OMRA 4OCIA 3LLEA 1MHOA 5I2QA 1W7JB 1V1GA 2PALA 1JWDA 1KCYA 1XFZO 3I5IB 3TDZA 1DJXA 2WCFA 2I7AA 3BOWA 2MA2A 2CCMA 4YRUA 1PULA 1CKKA 3NSLA 1J7OA 4BY4A 2KBIA 2R2IA 3IQOA 2Y4QA 5HLOA 1EXRA 1RWYA 2LVVA 2M1KB 2MRDA 2BKHB 2LMVA 2K7OA 3SJSA 1SKTA 1TNQA 4MZLA 4CIDA 5HKYA 1CDMA 2L51A 3PATA 3ICBA 3SIBA 2EC6B 3KEVA 4FTGA 1LVCD 3AAJA 2KI4B 3I5IC 1SNLA 4DRWA 1RROA 1MR8A 2WORA 4MBEA 4N1FA 2BBNA 4NDCA 1NX1A 2GV5A 5DKQA 2K8MB 3DVMA 4YI9A 1B7TY 1BR4B 2NCPA 4OKHA 1IRJA 3BUOB 1RECA 3WHTB 2KAVA 4FQOA 2KGBC 1M63B 4Q04A 1DJWA 1OE9B 1S36A 3BYAA 1OSAA 4JPZB 5I8NA 3FIAA 1KK7Y 1C7WA 1S5GZ 1QXPA 4OR9B 2EC6C 2WC8A 2CXJA 1F8HA 2KI4C 2FCEA 2PMYA 1MUXA 1EG4A 1YRTB 3VRPA 4MRYA 2M8UA 3DVEA 1K96A 3M0WA 2ZNDA 1DF0A 5KTYA 2B1UA 1FBVA 1MXLC 2KI6D 2ZRSA 2K7DA 3BUWB 2JNFA 4XJKB 1J1DA 3O4YA 1B4CA 1FPWA 2GGMA 1TTXA 4HREE 2I2RE 1PSBA 1QATA 2OPOA 1CLBA 4A4CA 4JQ0D 2SCPA 3LK1A 3D0YB 1UUSA 3IF7A 2FOTA 1CDPA 2DOQA 1BF5A 2NLNA 2ZFDA 3WXAA 3A4UB 4WQ3A 3OX6A 4QJ5B 1PSRA 2WOSA 3BQ3A 3FS7A 1CM4A 3EKHA 1K9UA 1XFXO 2HQ8A 2MAZA 1TN4A 2LLTA 4GFTA 1B1GA 1DGVA 1C07A 3QRXA 4CPVA 2HF5A 3KO0A 3LL8B 3CTNA 1ZFSA 1LA3A 2FCDA 1ZOTB 3SG6A 2PASA 2LV7A 3I5FB 2CT9A 3KF9A 1NCYA 4AOMA 2RGIA 1NP8A 2JRFA 1AUIB 2GGZA 2WNDA 2PRUA 2PSRA 4M2PA 4MVFA 3PALA 1KK7Z 3CR5X 1V1FA 2Y9YA 3A8RA 1WY9A 1WLZA 3RLZA 1QIVA 1ODBA 2KFFA 3PN7B 1CFDA 2JWWA 2K2FA 3I5FC 1QV0A 2KBMA 3SG5A 3ZNIA 2L5XB 1C7VA 1U5IA 3FWCA 1QJTA 2LLUA 3IQQA 3TUYB 1PRWA 4ORAB 5BPJA 1DJGA 5DKNA 2KGRA 2HQWA 3NSIA 1QX2A 2JOJA 4MRXA 4CFRA 4QJ4B 1B8CA 1J7QA 2KSPA 3BXKA 1HT9A 1CDLA 2M7NA 1MQ1A 4YBHB 1OMDA 2LE9B 2TN4A 4DIRA 2BECA 4L9MA 2OS8B 5ER4X 5AANA 2H61C 2JC2A 2LMTA 3FWBA 4GGFC 1JF0A 5PALA 1GGWA 1S6IA 1NSHA 1QLKA 3PN7C 2JQ6A 2LUCA 1CMGA 1KSMA 2JXCA 4GBAA 4N1GA 3TUYC 2EGDA 4YI8A 3SIAA 1LINA 1Y1UA 5GQQC 1SL7A 2BBMA 5ER5A 5G08A 5I2LA 1JC2A 2LM5A 4M2QA 4USLA 2EHBA 1OMVA 1ZMZA 2E30A 2JTTA 2M3WA 1DVIA 3SG2A 1EH2A 1KK8B 2WCEA 2D8NA 4WQ2A 1YUUA 3BUXB 4YGDB 2MLEC 1G8IA 1SL8A 2ZKMX 2OS8C 1N65A 1TCOB 3BUMB 3VRRA 1AJ4A 3CS1A 3OHMB 3DVKA 2Y5IA 2V53A 3K21A 2CTNA 2Y9ZA 1IQ3A 2BE6A 2JTZA 1TIZA 1KFXL 1XVJA 2KNEA 3TZ1A 2CNPA 1NUBA 3TS5B 5HKZA 2KQ6A 3WHUB 4ICBA 1H4BA 1KFUL 1NX0A 1W7IB 1YVLA 3ZWHA 1Y1AA 3PM8A 1KK8C 3BUNB 1A29A 1K8UA 3AAKA 2KAYA 3PSRA 2LP3A 2LMUA 4GAOA 1K95A 3JVTB 2A4JA 1IH0A 3SG4A 2G2BA 4PHKA 4XJKA 1UHNA 4BY5A 1YRUB 3AKAA 1JF2A 1IG5A 2JU0A 2KOTA 3DF0A 3H4SE 2SASA 1M31A 4HRGA 4OVNF 4PHMA 2KQYA 2F33A 5CSIA 3TS5C 1ZACA 1DTLA 1FI5A 1RFJA 3D0YA 2WCBA 4HRHA 3DF0B 1F70A 4I5KA 4YGAA 4OV2A 2BL0B 3MSEB 1F55A 4C0LA 1IJ5A 1PVBA 3DD4A 1WLMA 2LHIA 1Y0VH 5F6TA 4YGBB 1BU3A 3JVTC 1NCXA 1BG1A 3AKBA 5AEQA 2Y1NA 3WNXB 5JJGA 2K7CA 1YX7A 1ZUZA 1HQVA 2M7LA 3OB2B 1YR5A 3CR2A 1CDNA 1OZSA 1K2HA 2LHLA 2M29A 3NSKA 4I5JA 1YUSA 5HLVA 4QJ3B 4E68A 1N2DA 4CFQA 2KHNA 4PHNA 5KSZA 2LP2A 4XYNA 1IWQA 1WRKA 2BKIB 3SG3A 1CNPA 1S6JA 2BL0C 4GNKB 1KSOA 3TDIA 3I5GB 3TDUA 1SK6D 2NZ0A 1MXEA 3E3RA 1B7TZ 3OP0A 5DKRA 1TNWA 2M0RA 2MHHA 2BE4A 3CLNA 4PE4A 1AK8A 1KQMB 3JTDB 2H61A 1RTP1 1YX8A 4GGFA 1OOJA 1BLQA 2Q91A 2M9GA 4N5XA 2OTGB 1S26D 5AXIA 2F3ZA 1QIWA 5TNCA 1TRFA 4GGNA 4MZJA 1NIWA 4NQGA 4YGEB 3GK2A 2LC5A 1DMOA 2L0PA 1XA5A 3O78A 2L4IA 1CFFA 1SW8A 3I5GC 2KFHA 1SR6B 1UHIA 1IQ5A 2MLFC 4M2OA 1WRZA 2NCOA 1YVHA 4PE1A 1KQMC 3JTDC 1CTRA 1RJVA 1NX3A 2ZRTA 2JT8A 4GPLB 1BOCA 5AFPA 1WRLA 2CBLA 1UP5A 1FF1A 2JT3A 1FI6A 2JT0A 1B47A 1Y1XA 2OTGC 1BODA 3EVUA 3EKJA 4ZCVA 1F71A 1N0YA 1NWDA 2L50A 3RM1A 4C0KA 4UPGA 5K89A 2ZN9A 1A4PA 3LK0A 1SCMB 2I18A 2KDHA 2LLSA 2LVJA 5D7FA 2LVKA 1K9PA 1UHJA 3O6BA 1SY9A 2M97A 1SR6C 1ALVA 4P5OE 3D10A 3HX4A 2KI6C 1IGVA 1B8LA 4YGCB 2K61A 3O2PA 1M39A 2AAOA 3KHEA 3KPXA 1WDCB 4I5NB 4U8DA 1KFXS 1JFJA 3PLFB 5JOLA 1AHRA 1OFCX 1JSAA 4DUQA 3NSOA 2Y1MA 1SMGA 2PVBA 1KQVA 4D1EA 1KFUS 1QX5B 5J3XA 1BR1B 1SCMC 1EJ3A 2P6BB 4DS7A 1X02A 4PE0A 1MWNA 1S6CA 3GK4X 3GOFA 3OB1B 1BJFA 1UURA 5HYDA 1QVIY 2I94A 2K0JA 4AQIA 2F2OA 4DCKA 2O60A 3EVVA 2QACA 2KYCA 3BOWB 5CSNA 1CFCA 1LXFC 4MSPA 1J7RA 1R2UA 1WDCC 1XFYO 1TOPA 3GK1A 1D1OA 2JPTA 1DJZA 1TNPA 4PDZA 2JULA 2K2AA 3EK8A 1F4QA 3OX5A 1J1EA 1UHKA 2ISDA 4GUKA 3HCMA 1PK0D 1A2XA 1B9AA 1MF8B 5FYXA 1K90D 4MN0A 1VRKA 1B8RA 1XO5A 2E6WA 3DVJA 1AJ5A 2AUCA 1UWOA 1XFWO 1OQPA 1JBAA 5IBWA 2JNXA 1NYAA 1M46A 1PVAA 1XYDA 4TNCA 1OZOA 1YUTA 2LUXA 4WRIA 4ETOA 1A03A 1L7ZA 1GJYA 1Y6WA 1QX7A 1CLLA 1K9KA 3EVRA 2O5GA 1K93D 1BT6A 4NDBA 4PHJA 3C1VA 1G4YR 2LNKA 1FW4A 1XK4A 1GQMA 1NX2A 2L4HA 4F0ZB 1J7PA 3CWGA 1NCZA 1F4OA 1Q80A 1SBJA 1SL9A 1CB1A 3VROA 1S1EA 1L2OB 2F3YA 1G33A 1TCFA 2BCBA 1RK9A 1TNXA 5D69A 2KYFA 1JFKA 2BCAA 1LA0A 4P2YB 4NDDA 1A75A 1H8BA 5KU1A 3SG7A 1QVIZ 1SPYA 2L98A 4AQJA 1YTZC 2LVIA 1CM1A 1LKJA 1SRAA 1UHHA 4ORCB 4A4BA 1DF0B 3CR4X 4IL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJI A;  1A75 B;  4PE7 A;  5CSJ A;  3VGO A;  2COL B;  2H2K A;  2KAX A;  4MEW A;  3I5H B;  3VRN A;  2M49 B;  1XFV O;  1K94 A;  1KWO B;  2QPT A;  4I5L B;  1JUO A;  1L2O C;  1QLS A;  2KFG A;  1EL4 A;  1DT7 B;  1XK4 C;  3F45 A;  2G9B A;  1S3P A;  1QAS A;  1J55 A;  2BCX A;  2VRG A;  2LCP A;  1IKU A;  3LCP C;  5B8I B;  5CPV A;  3CZT X;  4HSZ A;  1QS7 A;  4MZK A;  2HPS A;  1DGU A;  5I2O A;  1F54 A;  1DJH A;  1XFU O;  2LAN A;  3VRQ A;  5AER A;  5HKW A;  2F8P A;  1SYM A;  3CGA A;  1NPQ A;  2L2E A;  1YUR A;  2M1U A;  5CSF A;  3I5H C;  2HET A;  4ORB B;  1QTX A;  3EK4 A;  1KWO C;  1CFP A;  2AMI A;  2MJW B;  1AP4 A;  2FJU B;  1SCV A;  4R1E A;  4JWQ A;  1E8A A;  4MLW A;  2LAP A;  1PAL A;  1CMF A;  3EK7 A;  4ZCU A;  1EG3 A;  1BMO A;  2NXQ A;  2K7B A;  1IJ6 A;  2ZN8 A;  1ALW A;  2IS9 A;  1M45 A;  2F2P A;  1S5G Y;  1GGZ A;  2JZI A;  4PAL A;  2MBX A;  1R6P A;  4CLN A;  1DJY A;  4C0J A;  1U5I B;  1QV1 A;  2JXL A;  1AVS A;  4PCW A;  1CLM A;  3NXA A;  2Q4U A;  2ZNE A;  3PFV A;  1OMR A;  4OCI A;  3LLE A;  1MHO A;  5I2Q A;  1W7J B;  1V1G A;  2PAL A;  1JWD A;  1KCY A;  1XFZ O;  3I5I B;  3TDZ A;  1DJX A;  2WCF A;  2I7A A;  3BOW A;  2MA2 A;  2CCM A;  4YRU A;  1PUL A;  1CKK A;  3NSL A;  1J7O A;  4BY4 A;  2KBI A;  2R2I A;  3IQO A;  2Y4Q A;  5HLO A;  1EXR A;  1RWY A;  2LVV A;  2M1K B;  2MRD A;  2BKH B;  2LMV A;  2K7O A;  3SJS A;  1SKT A;  1TNQ A;  4MZL A;  4CID A;  5HKY A;  1CDM A;  2L51 A;  3PAT A;  3ICB A;  3SIB A;  2EC6 B;  3KEV A;  4FTG A;  1LVC D;  3AAJ A;  2KI4 B;  3I5I C;  1SNL A;  4DRW A;  1RRO A;  1MR8 A;  2WOR A;  4MBE A;  4N1F A;  2BBN A;  4NDC A;  1NX1 A;  2GV5 A;  5DKQ A;  2K8M B;  3DVM A;  4YI9 A;  1B7T Y;  1BR4 B;  2NCP A;  4OKH A;  1IRJ A;  3BUO B;  1REC A;  3WHT B;  2KAV A;  4FQO A;  2KGB C;  1M63 B;  4Q04 A;  1DJW A;  1OE9 B;  1S36 A;  3BYA A;  1OSA A;  4JPZ B;  5I8N A;  3FIA A;  1KK7 Y;  1C7W A;  1S5G Z;  1QXP A;  4OR9 B;  2EC6 C;  2WC8 A;  2CXJ A;  1F8H A;  2KI4 C;  2FCE A;  2PMY A;  1MUX A;  1EG4 A;  1YRT B;  3VRP A;  4MRY A;  2M8U A;  3DVE A;  1K96 A;  3M0W A;  2ZND A;  1DF0 A;  5KTY A;  2B1U A;  1FBV A;  1MXL C;  2KI6 D;  2ZRS A;  2K7D A;  3BUW B;  2JNF A;  4XJK B;  1J1D A;  3O4Y A;  1B4C A;  1FPW A;  2GGM A;  1TTX A;  4HRE E;  2I2R E;  1PSB A;  1QAT A;  2OPO A;  1CLB A;  4A4C A;  4JQ0 D;  2SCP A;  3LK1 A;  3D0Y B;  1UUS A;  3IF7 A;  2FOT A;  1CDP A;  2DOQ A;  1BF5 A;  2NLN A;  2ZFD A;  3WXA A;  3A4U B;  4WQ3 A;  3OX6 A;  4QJ5 B;  1PSR A;  2WOS A;  3BQ3 A;  3FS7 A;  1CM4 A;  3EKH A;  1K9U A;  1XFX O;  2HQ8 A;  2MAZ A;  1TN4 A;  2LLT A;  4GFT A;  1B1G A;  1DGV A;  1C07 A;  3QRX A;  4CPV A;  2HF5 A;  3KO0 A;  3LL8 B;  3CTN A;  1ZFS A;  1LA3 A;  2FCD A;  1ZOT B;  3SG6 A;  2PAS A;  2LV7 A;  3I5F B;  2CT9 A;  3KF9 A;  1NCY A;  4AOM A;  2RGI A;  1NP8 A;  2JRF A;  1AUI B;  2GGZ A;  2WND A;  2PRU A;  2PSR A;  4M2P A;  4MVF A;  3PAL A;  1KK7 Z;  3CR5 X;  1V1F A;  2Y9Y A;  3A8R A;  1WY9 A;  1WLZ A;  3RLZ A;  1QIV A;  1ODB A;  2KFF A;  3PN7 B;  1CFD A;  2JWW A;  2K2F A;  3I5F C;  1QV0 A;  2KBM A;  3SG5 A;  3ZNI A;  2L5X B;  1C7V A;  1U5I A;  3FWC A;  1QJT A;  2LLU A;  3IQQ A;  3TUY B;  1PRW A;  4ORA B;  5BPJ A;  1DJG A;  5DKN A;  2KGR A;  2HQW A;  3NSI A;  1QX2 A;  2JOJ A;  4MRX A;  4CFR A;  4QJ4 B;  1B8C A;  1J7Q A;  2KSP A;  3BXK A;  1HT9 A;  1CDL A;  2M7N A;  1MQ1 A;  4YBH B;  1OMD A;  2LE9 B;  2TN4 A;  4DIR A;  2BEC A;  4L9M A;  2OS8 B;  5ER4 X;  5AAN A;  2H61 C;  2JC2 A;  2LMT A;  3FWB A;  4GGF C;  1JF0 A;  5PAL A;  1GGW A;  1S6I A;  1NSH A;  1QLK A;  3PN7 C;  2JQ6 A;  2LUC A;  1CMG A;  1KSM A;  2JXC A;  4GBA A;  4N1G A;  3TUY C;  2EGD A;  4YI8 A;  3SIA A;  1LIN A;  1Y1U A;  5GQQ C;  1SL7 A;  2BBM A;  5ER5 A;  5G08 A;  5I2L A;  1JC2 A;  2LM5 A;  4M2Q A;  4USL A;  2EHB A;  1OMV A;  1ZMZ A;  2E30 A;  2JTT A;  2M3W A;  1DVI A;  3SG2 A;  1EH2 A;  1KK8 B;  2WCE A;  2D8N A;  4WQ2 A;  1YUU A;  3BUX B;  4YGD B;  2MLE C;  1G8I A;  1SL8 A;  2ZKM X;  2OS8 C;  1N65 A;  1TCO B;  3BUM B;  3VRR A;  1AJ4 A;  3CS1 A;  3OHM B;  3DVK A;  2Y5I A;  2V53 A;  3K21 A;  2CTN A;  2Y9Z A;  1IQ3 A;  2BE6 A;  2JTZ A;  1TIZ A;  1KFX L;  1XVJ A;  2KNE A;  3TZ1 A;  2CNP A;  1NUB A;  3TS5 B;  5HKZ A;  2KQ6 A;  3WHU B;  4ICB A;  1H4B A;  1KFU L;  1NX0 A;  1W7I B;  1YVL A;  3ZWH A;  1Y1A A;  3PM8 A;  1KK8 C;  3BUN B;  1A29 A;  1K8U A;  3AAK A;  2KAY A;  3PSR A;  2LP3 A;  2LMU A;  4GAO A;  1K95 A;  3JVT B;  2A4J A;  1IH0 A;  3SG4 A;  2G2B A;  4PHK A;  4XJK A;  1UHN A;  4BY5 A;  1YRU B;  3AKA A;  1JF2 A;  1IG5 A;  2JU0 A;  2KOT A;  3DF0 A;  3H4S E;  2SAS A;  1M31 A;  4HRG A;  4OVN F;  4PHM A;  2KQY A;  2F33 A;  5CSI A;  3TS5 C;  1ZAC A;  1DTL A;  1FI5 A;  1RFJ A;  3D0Y A;  2WCB A;  4HRH A;  3DF0 B;  1F70 A;  4I5K A;  4YGA A;  4OV2 A;  2BL0 B;  3MSE B;  1F55 A;  4C0L A;  1IJ5 A;  1PVB A;  3DD4 A;  1WLM A;  2LHI A;  1Y0V H;  5F6T A;  4YGB B;  1BU3 A;  3JVT C;  1NCX A;  1BG1 A;  3AKB A;  5AEQ A;  2Y1N A;  3WNX B;  5JJG A;  2K7C A;  1YX7 A;  1ZUZ A;  1HQV A;  2M7L A;  3OB2 B;  1YR5 A;  3CR2 A;  1CDN A;  1OZS A;  1K2H A;  2LHL A;  2M29 A;  3NSK A;  4I5J A;  1YUS A;  5HLV A;  4QJ3 B;  4E68 A;  1N2D A;  4CFQ A;  2KHN A;  4PHN A;  5KSZ A;  2LP2 A;  4XYN A;  1IWQ A;  1WRK A;  2BKI B;  3SG3 A;  1CNP A;  1S6J A;  2BL0 C;  4GNK B;  1KSO A;  3TDI A;  3I5G B;  3TDU A;  1SK6 D;  2NZ0 A;  1MXE A;  3E3R A;  1B7T Z;  3OP0 A;  5DKR A;  1TNW A;  2M0R A;  2MHH A;  2BE4 A;  3CLN A;  4PE4 A;  1AK8 A;  1KQM B;  3JTD B;  2H61 A;  1RTP 1;  1YX8 A;  4GGF A;  1OOJ A;  1BLQ A;  2Q91 A;  2M9G A;  4N5X A;  2OTG B;  1S26 D;  5AXI A;  2F3Z A;  1QIW A;  5TNC A;  1TRF A;  4GGN A;  4MZJ A;  1NIW A;  4NQG A;  4YGE B;  3GK2 A;  2LC5 A;  1DMO A;  2L0P A;  1XA5 A;  3O78 A;  2L4I A;  1CFF A;  1SW8 A;  3I5G C;  2KFH A;  1SR6 B;  1UHI A;  1IQ5 A;  2MLF C;  4M2O A;  1WRZ A;  2NCO A;  1YVH A;  4PE1 A;  1KQM C;  3JTD C;  1CTR A;  1RJV A;  1NX3 A;  2ZRT A;  2JT8 A;  4GPL B;  1BOC A;  5AFP A;  1WRL A;  2CBL A;  1UP5 A;  1FF1 A;  2JT3 A;  1FI6 A;  2JT0 A;  1B47 A;  1Y1X A;  2OTG C;  1BOD A;  3EVU A;  3EKJ A;  4ZCV A;  1F71 A;  1N0Y A;  1NWD A;  2L50 A;  3RM1 A;  4C0K A;  4UPG A;  5K89 A;  2ZN9 A;  1A4P A;  3LK0 A;  1SCM B;  2I18 A;  2KDH A;  2LLS A;  2LVJ A;  5D7F A;  2LVK A;  1K9P A;  1UHJ A;  3O6B A;  1SY9 A;  2M97 A;  1SR6 C;  1ALV A;  4P5O E;  3D10 A;  3HX4 A;  2KI6 C;  1IGV A;  1B8L A;  4YGC B;  2K61 A;  3O2P A;  1M39 A;  2AAO A;  3KHE A;  3KPX A;  1WDC B;  4I5N B;  4U8D A;  1KFX S;  1JFJ A;  3PLF B;  5JOL A;  1AHR A;  1OFC X;  1JSA A;  4DUQ A;  3NSO A;  2Y1M A;  1SMG A;  2PVB A;  1KQV A;  4D1E A;  1KFU S;  1QX5 B;  5J3X A;  1BR1 B;  1SCM C;  1EJ3 A;  2P6B B;  4DS7 A;  1X02 A;  4PE0 A;  1MWN A;  1S6C A;  3GK4 X;  3GOF A;  3OB1 B;  1BJF A;  1UUR A;  5HYD A;  1QVI Y;  2I94 A;  2K0J A;  4AQI A;  2F2O A;  4DCK A;  2O60 A;  3EVV A;  2QAC A;  2KYC A;  3BOW B;  5CSN A;  1CFC A;  1LXF C;  4MSP A;  1J7R A;  1R2U A;  1WDC C;  1XFY O;  1TOP A;  3GK1 A;  1D1O A;  2JPT A;  1DJZ A;  1TNP A;  4PDZ A;  2JUL A;  2K2A A;  3EK8 A;  1F4Q A;  3OX5 A;  1J1E A;  1UHK A;  2ISD A;  4GUK A;  3HCM A;  1PK0 D;  1A2X A;  1B9A A;  1MF8 B;  5FYX A;  1K90 D;  4MN0 A;  1VRK A;  1B8R A;  1XO5 A;  2E6W A;  3DVJ A;  1AJ5 A;  2AUC A;  1UWO A;  1XFW O;  1OQP A;  1JBA A;  5IBW A;  2JNX A;  1NYA A;  1M46 A;  1PVA A;  1XYD A;  4TNC A;  1OZO A;  1YUT A;  2LUX A;  4WRI A;  4ETO A;  1A03 A;  1L7Z A;  1GJY A;  1Y6W A;  1QX7 A;  1CLL A;  1K9K A;  3EVR A;  2O5G A;  1K93 D;  1BT6 A;  4NDB A;  4PHJ A;  3C1V A;  1G4Y R;  2LNK A;  1FW4 A;  1XK4 A;  1GQM A;  1NX2 A;  2L4H A;  4F0Z B;  1J7P A;  3CWG A;  1NCZ A;  1F4O A;  1Q80 A;  1SBJ A;  1SL9 A;  1CB1 A;  3VRO A;  1S1E A;  1L2O B;  2F3Y A;  1G33 A;  1TCF A;  2BCB A;  1RK9 A;  1TNX A;  5D69 A;  2KYF A;  1JFK A;  2BCA A;  1LA0 A;  4P2Y B;  4NDD A;  1A75 A;  1H8B A;  5KU1 A;  3SG7 A;  1QVI Z;  1SPY A;  2L98 A;  4AQJ A;  1YTZ C;  2LVI A;  1CM1 A;  1LKJ A;  1SRA A;  1UHH A;  4ORC B;  4A4B A;  1DF0 B;  3CR4 X;  4IL1 A; 
#chains in the Genus database with same CATH topology
 1DJI A;  3H1K G;  3II6 A;  3B5N A;  5B5E H;  2E76 C;  3VRN A;  1XFV O;  2IBZ D;  3L70 D;  1JUO A;  1L2O C;  2P67 A;  2KZJ A;  3B5N B;  4I6M C;  1S3P A;  2BCX A;  2J59 M;  4MN4 C;  5AVW B;  4MZK A;  1F54 A;  2CPB A;  5AER A;  4NPD A;  5EFW B;  1PGO A;  4D6T D;  5CSF A;  3EK4 A;  4HB1 A;  1NTM J;  2MJW B;  4WWI A;  3VMZ A;  1IO4 A;  1SCV A;  2YXR B;  4IL6 X;  3CCR P;  1JEK A;  3HTK A;  4GT1 A;  2LAP A;  1PAL A;  1CMF A;  2W8Z A;  3OBV A;  3EK7 A;  1BE3 E;  4XE5 B;  1EG3 A;  1KYO H;  3TYY A;  1G1I A;  1CI6 A;  4BRY A;  1NTZ E;  1H0T B;  2ZN8 A;  3BJH A;  1S5L E;  1QVG O;  2IS9 A;  3HTK B;  1GGZ A;  2JZI A;  1SQB J;  4C0J A;  4BRY B;  2K3R A;  4OGQ D;  1AVS A;  4PCW A;  1JCC A;  2Q4U A;  1NU1 J;  3L72 J;  4OCI A;  4Z1M H;  2AXT E;  1W7J B;  2QIW A;  4RO0 A;  2A45 I;  3NSL A;  4K3A A;  1KTM A;  4DJG A;  3NGV A;  2Y4Q A;  1EXR A;  2E42 A;  2AEJ A;  2KB7 P;  4N3Y B;  2LVV A;  1G2C A;  1NAY A;  3TNU A;  2MRD A;  2KK7 A;  2XDJ A;  1DEK A;  2OYO A;  1CDM A;  2BEQ D;  3MHV A;  1IFN A;  1URQ C;  1GTW A;  2OAR A;  1SNL A;  1MR8 A;  2MJZ A;  4RJT A;  3GMA A;  1NX1 A;  1JNM A;  1BR4 B;  4OKH A;  3L4A A;  1RE3 C;  1SQP E;  2OGU A;  1REC A;  1LNQ A;  1M63 B;  4Q04 A;  2R5B A;  1ORG A;  1DJW A;  3L73 J;  1IC2 A;  3FIA A;  4FQT A;  1KFM A;  4GIF A;  5CCH D;  5FI6 A;  4K35 A;  2EC6 C;  4PV1 B;  1F8H A;  4DOJ A;  3H1K D;  4MRY A;  3DVE A;  1VQ4 P;  1K96 A;  1X22 A;  3CZ1 A;  1NAF A;  2KI6 D;  1MXL C;  3BUW B;  2N1T C;  3VOP A;  1YIJ P;  3L71 D;  1PGP A;  1KN7 A;  2I2R E;  5KLV J;  3T97 A;  3O4X A;  1JY2 O;  1UUS A;  2H89 C;  1CDP A;  1LTT C;  2K60 A;  1BF5 A;  2NLN A;  2NZ2 A;  3WMM 0;  3A4U B;  4WQ3 A;  3OX6 A;  4H13 D;  2WOS A;  1K9U A;  1XFX O;  2IFN A;  1NU1 K;  4OGQ C;  1C07 A;  3QRX A;  4CPV A;  2P1J A;  2HF5 A;  1JY2 N;  1RF0 C;  2PAJ A;  3CTN A;  1LA3 A;  1BE3 G;  2RMZ A;  1NTZ G;  4AOM A;  1NP8 A;  2I8D A;  2B87 A;  2JRF A;  2H88 C;  1AUI B;  1LWU B;  1SQQ E;  2WND A;  3H1L J;  2PSR A;  3PAL A;  1RF1 B;  3H25 A;  3CMA P;  1LTG C;  2M5A B;  5AVY B;  1V1F A;  2Y9Y A;  2FFD B;  2LXB A;  3OA7 A;  3CCE P;  1QIV A;  2KS1 B;  1ODB A;  3RZS A;  3FWL A;  3I5F C;  3SG5 A;  2L5X B;  1C7V A;  2QM7 A;  1U5I A;  2LLU A;  2WSF J;  1QGK B;  3L75 D;  2KGR A;  2HQW A;  4CFR A;  3NHI A;  4DIR A;  3CXH I;  2JC2 A;  3S0F A;  3CXH E;  3V2L A;  4EDF A;  2LUC A;  2BCC J;  2JXC A;  3L36 A;  2EGD A;  1QX8 A;  2WMM A;  4PD4 I;  1JC2 A;  3N7N A;  1S3J A;  4USL A;  2EHB A;  1OMV A;  2Y0C A;  4I2L C;  1X79 B;  1SQP G;  2M3W A;  5KLV K;  3BUX B;  5FI2 A;  1L0L E;  3RBX A;  1G8I A;  1KB9 I;  1Q86 Q;  1EXI A;  5KAI E;  2OYH B;  1AJ4 A;  2ZT9 C;  2V53 A;  3MZW B;  3L74 G;  1NTK J;  2QRX A;  2BE6 A;  1FZC C;  3CAB A;  4JD9 A;  1KFX L;  2P58 A;  2KNE A;  2FYU E;  2KQ6 A;  2Z5I A;  2R5D A;  5KAF E;  1L4A A;  1KFU L;  1NX0 A;  3R1P A;  3IF4 A;  4IL6 E;  1A29 A;  1USD A;  3CWB D;  3PSR A;  2YNY A;  1WT6 A;  3B5N D;  1ZR4 A;  1KYO D;  3JVT B;  1IH0 A;  3SG4 A;  2G2B A;  4AUW A;  4XJK A;  1LTA C;  1UHN A;  4BY5 A;  5CCG A;  5KAI H;  4INX A;  2IDB A;  2KOT A;  2JU0 A;  1NJI Q;  1NH4 A;  2E43 A;  5CSI A;  3TS5 C;  1FI5 A;  1RFJ A;  1SLQ A;  3PLN A;  2FKW B;  4I5K A;  5TJH A;  2E5Y A;  4C0L A;  4IL6 H;  3B86 A;  1VDF A;  3DD4 A;  1BG1 A;  1GM0 A;  1SVF A;  5AEQ A;  2Y1N A;  2WIT A;  3AED C;  1YX7 A;  1SQQ G;  1YR5 A;  3PHL A;  3AE1 C;  2LHL A;  2M29 A;  4I5J A;  1L0N K;  5HLV A;  4GKG A;  1N2D A;  3S0G A;  2V7Q J;  4PHN A;  2C9L Y;  1DEL A;  5AVZ B;  4XYN A;  1CNP A;  1S6J A;  4GNK B;  1XTG B;  1SK6 D;  5AW5 B;  1MXE A;  1K8A Q;  1RQU A;  2YMY A;  4PE4 A;  3CLN A;  1P84 H;  4Y28 J;  1LTB C;  2JJL A;  4N5X A;  2OTG B;  1GU5 A;  5TNC A;  1NIW A;  4YGE B;  3GK2 A;  2L0P A;  3LW5 H;  1XA5 A;  1CFF A;  1JY3 P;  4W7Y A;  3B88 A;  1GL2 C;  1DX7 A;  3HD7 A;  1YVH A;  4L75 A;  1CTR A;  1HF9 A;  4GPL B;  5AFP A;  1WRL A;  1FF1 A;  3CME P;  3G71 P;  1BOD A;  3EKJ A;  4ZCV A;  1L0L G;  1N0Y A;  2W6B A;  1VQ8 P;  2LVJ A;  1JCD A;  1LJ2 A;  1KQL A;  3TDK A;  1BCC J;  1OW7 A;  1MUU A;  1SY9 A;  1SR6 C;  4P5O E;  1P28 A;  4INW A;  3CZ0 A;  4PV1 D;  4KJM A;  3L74 D;  2IBZ E;  2FYU G;  2WPQ A;  3L70 E;  4AQR D;  4KYN A;  1W2E A;  1QEX A;  4YGC B;  2OYI C;  1JMB A;  3O2P A;  1X8Y A;  2AAO A;  3KPX A;  2FYN B;  4DUQ A;  3NSO A;  3KXD A;  1LT9 A;  2PVB A;  1SCM C;  1EJ3 A;  4DS7 A;  1VL2 A;  1MWN A;  4D6T E;  1OX3 A;  2I94 A;  2ZYD A;  5GTI E;  1LT9 B;  5M1B A;  2F2O A;  4DCK A;  2O60 A;  2QAC A;  5CSN A;  4MSP A;  2Q7C A;  1WDC C;  1N7S A;  3V2P A;  5KLI B;  2JPT A;  5AVX B;  1F4Q A;  3CX5 I;  4GUK A;  3H1J D;  1PK0 D;  5FYX A;  2KI7 B;  3A0H E;  1M56 D;  3B87 A;  1AJ5 A;  3B6X A;  1BE3 J;  2RH0 A;  1JBA A;  2JNX A;  1U57 A;  1NTZ J;  1PVA A;  2LUX A;  4WRI A;  1Y6W A;  3USS A;  4ZNC A;  4XA4 A;  3EVR A;  3MUD C;  5AW9 B;  2O5G A;  4NDB A;  1KQS O;  1G4Y R;  2IZ0 A;  3V4W A;  2L4H A;  3CWG A;  1NCZ A;  2QEX P;  1F4O A;  1Q80 A;  1OOF A;  3FE8 A;  1KD1 Q;  1GZL A;  1J1E C;  1G33 A;  4ASW A;  1TNX A;  2KNC A;  1VQN P;  4N78 D;  2BCA A;  3L47 A;  4P2Y B;  2QVA A;  1S1C X;  4C7N B;  3FXE A;  1LKJ A;  4ZKU A;  3BCC G;  3DZT A;  2R3S A;  3NFQ A;  3HE5 B;  2COL B;  2H2K A;  1S4X A;  2KAX A;  1OW8 A;  3I5H B;  2L2C A;  2AEM A;  2QPT A;  4I5L B;  1NOH A;  2PYQ A;  3O8Z A;  2KFG A;  1GU4 A;  1XK4 C;  1GDT A;  3F45 A;  1IKU A;  3VMX A;  3LCP C;  5CPV A;  1SQP J;  1D7M A;  4HSZ A;  5I2O A;  1DGU A;  2NPS A;  1DJH A;  1YQ3 C;  2LAN A;  3VRQ A;  1OVR A;  5HKW A;  3HE4 A;  1T2K C;  3H1K E;  2F8P A;  1SYM A;  1Z56 A;  1SQX K;  2IBZ G;  4I7Z C;  2L2E A;  3L70 G;  3GLM A;  5D3O A;  1M8O B;  2HET A;  4ORB B;  2WPR A;  1KWO C;  3L71 E;  2AMI A;  5AW8 B;  1AP4 A;  4EYY Q;  2FJU B;  4R1E A;  1BDD A;  1E8A A;  3N4X A;  3S0B A;  2WPS A;  2NXQ A;  1BMO A;  4KHX A;  5B66 E;  3H6P A;  1PV3 A;  4D6T G;  2K7B A;  1L4A D;  2M8R A;  2F2P A;  1S5G Y;  2Z4E A;  2K9Y A;  3WUU A;  3L35 A;  2JXL A;  4IOI H;  1CLM A;  4W80 A;  2ZNE A;  3VMY A;  4L74 A;  3CL3 D;  5CCG D;  5I2Q A;  1MHO A;  1XFZ O;  2WCF A;  2I7A A;  1P84 D;  2MA2 A;  5AVS B;  2KBI A;  2R2I A;  2WCJ A;  5B66 H;  3IQO A;  2QEV A;  2M1K B;  2HLO A;  3RK3 B;  2LMV A;  2K7O A;  3SJS A;  1TNQ A;  3G3Z A;  1SFC B;  4MZL A;  4BWN A;  4H0L D;  3G6E P;  1SQQ J;  3ICB A;  2QJP B;  3KEV A;  3JCU E;  3L75 E;  3I5I C;  2KI4 B;  3RGU A;  1RRO A;  4WY4 A;  2WOR A;  4N1F A;  3CCJ P;  2BBN A;  4NDC A;  1EZV D;  5AW6 B;  1N73 A;  1KIL B;  5DKQ A;  3DVM A;  2NCP A;  3BUO B;  3ZDM A;  3DXL A;  2I1K A;  1EDL A;  2KAV A;  2E5T A;  2KGB C;  1VF5 B;  1SQP K;  3PM2 A;  3BYA A;  1GW3 A;  2I1J A;  1M1J B;  4U3F D;  3N7H A;  1C7W A;  2QJY C;  1S5G Z;  1QXP A;  2YMK A;  1ZN5 A;  3VYI A;  1Q2N A;  5B5E E;  3NTN A;  3SS3 A;  4L76 A;  1MZ9 A;  3BCC D;  2FCE A;  1MUX A;  3AE2 C;  3VRP A;  2L5Y A;  1DF0 A;  1FBV A;  5CJ0 A;  1HTL C;  1J1D A;  2GGM A;  1TTX A;  1MFZ A;  3R1V A;  4L73 A;  1PSB A;  1QAT A;  4A4C A;  3HD7 D;  3HUS B;  1J1D B;  5AVT B;  1L4A C;  2FOT A;  1L0L J;  3M06 A;  3BQ3 A;  3PH0 A;  4N6J A;  1KFN A;  1NO4 A;  2E75 D;  1B1G A;  2SPZ A;  5DJU B;  1DGV A;  3L71 G;  3CWB E;  5CCG C;  4H44 B;  4XFJ A;  1KYO E;  2FYU J;  1ZOT B;  3AE6 C;  3SG6 A;  2PAS A;  2LV7 A;  1HGZ A;  2WQY C;  1S72 P;  3D77 A;  4Y99 C;  1N86 A;  3PJS K;  5APU A;  1MFT A;  4M2P A;  3JSV C;  4ZMD A;  2B88 A;  4H0L C;  1H0T A;  1A02 J;  3M91 A;  3V2Q A;  2FBW C;  2KFF A;  3PN7 B;  1QV0 A;  2KBM A;  3ZNI A;  1N2D C;  3TUY B;  1SQV D;  3IQQ A;  2JKV A;  2C9N Y;  4GOE A;  1FC2 C;  1PRW A;  4ORA B;  1NVO A;  2Y0D A;  2M0B A;  4MRX A;  1J7Q A;  1N7S D;  3BXK A;  3FX0 A;  2WPV B;  4YBH B;  5HL1 A;  2TN4 A;  1SS1 A;  4L9M A;  3K5B A;  1WMK A;  1AQ5 A;  3EWK A;  2YKQ A;  3OGN A;  3S0D A;  1S6I A;  1QLK A;  2JQ6 A;  3L75 G;  1MV8 A;  3LW5 J;  2CK3 H;  3CLQ A;  3C1L A;  1DC1 A;  3SIA A;  1AQT A;  1OW6 A;  2PFX A;  1LIN A;  4NPE A;  5BU8 B;  2ZXE B;  2WVR A;  5I2L A;  2LM5 A;  3DYE A;  3VTP C;  3BRT B;  2JTT A;  3L37 A;  4WB4 A;  3SG2 A;  1EH2 A;  2ERB A;  2WCE A;  3BFB A;  3EFG A;  2MLE C;  1DD3 A;  2ZKM X;  2LR2 A;  2OS8 C;  3HD7 C;  3VN0 A;  4NPF X;  3WUV A;  3BUM B;  2P71 A;  3FE6 A;  3V4Q A;  4M3L A;  3VRR A;  3Q8I A;  4O9B A;  3OHM B;  3DVK A;  3IVT A;  3K21 A;  2CTN A;  1XVJ A;  3TZ1 A;  3D78 A;  2E75 C;  1RY3 A;  5HKZ A;  1EXJ A;  1L0N D;  3WHU B;  2WSC H;  2WSE J;  3ZWH A;  3QME A;  1KK8 C;  3BUN B;  3M0D C;  1S2E A;  1HH0 A;  3AAK A;  2KAY A;  1OMI A;  2LP3 A;  2ZVN B;  2JP3 A;  2YIU B;  1LTI C;  3L74 E;  1YYC A;  4OVN F;  1NTM K;  4PHM A;  2KQY A;  2F33 A;  1VQ5 P;  1DTL A;  2WCB A;  5KJ7 A;  3CWB G;  1CW5 A;  1F70 A;  1M57 D;  2NPS D;  4OV2 A;  1DD4 A;  3L70 J;  1OXZ A;  1VQ7 P;  3KHU A;  1Y0V H;  2UWJ E;  3AEC C;  1NCX A;  1SQB K;  5AVU B;  2W6J H;  1N7S C;  3AKB A;  3WNX B;  5JJG A;  1IK7 A;  2K7C A;  4ASV A;  2WTY A;  3Q1M A;  3CR2 A;  3PJI A;  1K2H A;  1OZS A;  5APS A;  5AW1 B;  1KQG B;  1YUS A;  2Q3E A;  4QJ3 B;  1FZF A;  5KSZ A;  4D6T J;  2LP2 A;  5AW2 B;  2JO1 A;  3H1J E;  4JYC A;  3HRN A;  2BL0 C;  3TDI A;  1LWU A;  3I5G B;  4C7R A;  1RF1 A;  1GK6 A;  5E79 E;  2K9J B;  1IFP A;  2M0R A;  2M5A A;  2BE4 A;  1AK8 A;  1LGH B;  3M9Q A;  2FFD A;  1AVO A;  2H61 A;  1RTP 1;  1YX8 A;  4GGF A;  1OOJ A;  3I56 P;  1BLQ A;  2KLV A;  2KS1 A;  1W5C E;  1YJW P;  1JY2 P;  1S26 D;  5AXI A;  3C8V A;  3LIE A;  4LGD E;  4U7J A;  3IAO A;  1Q81 Q;  2QJK C;  4NQG A;  3H1H D;  1DMO A;  2O01 J;  3GHG B;  2MLF C;  3MTU E;  1URQ D;  4M2O A;  5AVR B;  1WRZ A;  5E79 H;  1KQM C;  3JTD C;  2D2C B;  4RKU J;  2Z5H A;  1C3Y A;  4N78 E;  2JT3 A;  3EVU A;  1USE A;  4C0K A;  5CCH C;  2I18 A;  2LLS A;  4WY4 D;  1G1J A;  2QG4 A;  5D7F A;  5KKZ B;  4GOD A;  2LVK A;  1AVY A;  2M97 A;  2KSE A;  3RK2 D;  3V2N A;  3HX4 A;  4CPG A;  1TWO A;  2KI6 C;  3B4S A;  1T8Z A;  1B8L A;  2OYH A;  3KHE A;  3PLF B;  2NPS C;  1EDK A;  2R32 A;  3U59 A;  1JSA A;  3RL0 B;  1VQO P;  1KQV A;  2E74 D;  1QX5 B;  2BAS A;  3GK4 X;  3GOF A;  1BJF A;  4H13 C;  1N8R Q;  5HYD A;  1LTJ B;  1GD2 E;  2K0J A;  2KLE A;  2OTK E;  3EVV A;  3BOW B;  4OH8 B;  1HWT C;  1LXF C;  3GK1 A;  3H1K J;  1TNP A;  1YTZ I;  1PGQ A;  4PDZ A;  3EK8 A;  2K2A A;  3U1A A;  4EI2 A;  1NWQ A;  5APW A;  2GM4 A;  3L71 J;  1K90 D;  2P10 A;  1DQE A;  2AXC A;  1VRK A;  3DVJ A;  3SS4 A;  5CMZ A;  4UB6 E;  4AYC A;  5AW3 B;  2G3A A;  3CD6 P;  4PD4 H;  1M46 A;  1XYD A;  2H8V A;  3RL0 g;  1OZO A;  2AEF A;  4ETO A;  1A03 A;  1GJY A;  3H1J G;  2JPO A;  5APT A;  1P84 E;  3C1V A;  2LNK A;  1Q7Y Q;  2N9B A;  3EQ2 A;  1KB9 H;  1GQM A;  2E76 B;  1SQX D;  1SBJ A;  1S1E A;  1L2O B;  1TCF A;  2BCB A;  3NMD A;  2KYF A;  2YXQ B;  1H8B A;  4WY4 C;  3TGU D;  3SG7 A;  3LID A;  2L98 A;  4UB6 H;  1N73 C;  3CR4 X;  2O3J A;  3CYZ A;  3RK2 C;  2ZXX A;  4PE7 A;  5CSJ A;  4MEW A;  1AV1 A;  5H2F H;  3D76 A;  4LLH A;  3L75 J;  2A06 D;  2JDI H;  1EL4 A;  2Q5U A;  4U3F E;  2G9B A;  1J55 A;  2E74 C;  2KUB A;  2PRR A;  3AE7 C;  1NTK K;  3CCM P;  2GTE A;  3AE9 C;  5L8R J;  3CZT X;  3BCC E;  3VP9 A;  1QS7 A;  2WZ7 A;  3V2R A;  2Q9I A;  1E5W A;  2J58 A;  1FBM A;  1U7M A;  1OOH A;  2M1U A;  4IFD K;  5TIS H;  1ZRT D;  1QTX A;  2VRS A;  3S1K A;  1PGJ A;  3GW6 A;  3K1E A;  3QWO C;  1AFO A;  4PJ0 E;  3B5N C;  4MLW A;  1JO5 A;  2R44 A;  1M1K Q;  5APX A;  1IFD A;  1IJ6 A;  1ALW A;  4BXL A;  3H1I D;  1UII A;  1M45 A;  2IBZ I;  2K88 A;  2NRG A;  4PAL A;  2MBX A;  1R6P A;  4CLN A;  2P2U A;  1QV1 A;  1H88 A;  3NXA A;  3AE8 C;  3PFV A;  1RE4 A;  2M3E A;  3LLE A;  1URQ B;  2PAL A;  1JWD A;  1JM0 A;  3MIW A;  3CCU P;  3TDZ A;  1DJX A;  4PJ0 H;  1J7O A;  1PUL A;  3CWB J;  4BY4 A;  2O1K A;  5KJ7 D;  3KZI H;  1RWY A;  1T14 A;  2BKH B;  3E7K A;  4WVZ A;  2XZR A;  3FE9 A;  4CID A;  5HKY A;  1IIO A;  3KYQ A;  1JMM A;  1VQP P;  3R1O A;  3SIB A;  2HPC B;  2EC6 B;  4FTG A;  1SQV E;  1LVC D;  3AAJ A;  1PP9 D;  4YXW H;  4EOT A;  3Q5P A;  3V5B A;  2QEH A;  3UNW A;  1ZR2 A;  2K8M B;  4YI9 A;  1B7T Y;  2N1T B;  4HYT B;  3WHT B;  4FQO A;  1VPC A;  3S9O A;  1OSA A;  2FYZ A;  1KK7 Y;  2PGD A;  3C9I A;  1RF0 A;  3CCQ P;  2KYV A;  1EZV G;  5DJT B;  3CZ2 A;  1NU1 G;  3L72 G;  4C7N A;  4OGQ B;  4TT3 H;  1JTH B;  2XKM A;  2B1U A;  2D2C D;  2JNF A;  1B4C A;  1FPW A;  4U3F G;  3HE5 A;  2WSC J;  4HRE E;  2IFM A;  1BGY D;  3D0Y B;  3IF7 A;  3AEG C;  3CDN A;  4PV1 C;  3AEE C;  3CX5 H;  4QJ5 B;  1S5L X;  1PSR A;  1L0N E;  2R3C A;  3EKH A;  2HQ8 A;  1TN4 A;  2LLT A;  2ZYA A;  4GOF A;  3KO0 A;  1FAV A;  1ZFS A;  4ZKP A;  3GF7 A;  5K5G B;  2OTL P;  2WSF H;  3I5F B;  1ZME C;  3I55 P;  2QEB A;  3E1R A;  2W27 A;  1NCY A;  2RGI A;  5KJ7 C;  3L73 G;  2QA4 P;  2GGZ A;  1DEB A;  3A0B E;  2PRU A;  3CC2 P;  4MVF A;  1QL2 A;  4PD4 D;  1KK7 Z;  3WU2 E;  3CR5 X;  3L74 J;  1WY9 A;  2JR8 A;  1WLZ A;  3RLZ A;  3W68 A;  1NKN A;  2K2F A;  3S4R A;  2L5G B;  1KB9 D;  3TF5 A;  3FWC A;  1QJT A;  1N7L A;  5BPJ A;  1GMJ A;  1DJG A;  1NTZ K;  4QJ4 B;  1H8A A;  1B8C A;  2C0X A;  1LWU C;  1HT9 A;  1CDL A;  3PRJ A;  2Q6Q A;  4PT1 A;  1RF1 C;  2HOD B;  1LP1 A;  2LE9 B;  4I1L A;  3A0B H;  5DIC A;  3WU2 H;  5ER4 X;  2FFD C;  2H61 C;  2LMT A;  2HR3 A;  3FWB A;  4GGF C;  1GGW A;  2ZT9 B;  1SQV G;  2KXP B;  3JC2 2;  2CPS A;  1LP1 B;  1KSM A;  1FZC B;  1K04 A;  1TU3 F;  4GBA A;  1SFC A;  4N1G A;  1KV4 A;  1FZE A;  3P8M C;  1NTM D;  3H1J J;  5GQQ C;  5ER5 A;  2BBM A;  4OZD A;  5G08 A;  2RN0 A;  4OWF A;  4HJG H;  1DVI A;  3S0A A;  1AA0 A;  4WQ2 A;  5C39 A;  1YUU A;  3H1H E;  1HUC A;  4YGD B;  2JWD A;  1JUN A;  3CCS P;  1TCO B;  1KIL A;  1SQB D;  2Y5I A;  3UO9 A;  2Y9Z A;  4QMA A;  1W9Z A;  5AVV B;  3P8C D;  1TIZ A;  3TS5 B;  1C3Z A;  1M1J A;  1NU1 D;  3L72 D;  1NKZ B;  1H4B A;  1EC5 A;  1W7I B;  1YVL A;  1Y1A A;  3SWF A;  3F5H A;  3G9R A;  1EQ7 A;  1K8U A;  2LMU A;  3AE3 C;  2POH A;  2OYH C;  4W7Z A;  4PHK A;  1YRU B;  3AKA A;  1JF2 A;  1Q82 Q;  1L0N G;  3DF0 A;  4HRG A;  2JEE A;  1M31 A;  3H32 B;  1ZAC A;  1JOC A;  3HUS A;  3GF3 A;  5KTB A;  3DF0 B;  1KOR A;  1VQK P;  1F55 A;  1IJ5 A;  1PVB A;  2LHI A;  2WCK A;  2KPH A;  3AE4 C;  3RBZ A;  4YGB B;  1BU3 A;  3JVT C;  1HBW A;  3MGN A;  2IPP A;  1HQV A;  1FE6 A;  3SS5 A;  3L73 D;  3NSK A;  1AJY A;  1KC8 Q;  1M90 Q;  1GL2 A;  1IWQ A;  1WRK A;  1KYO I;  1KSO A;  2FXP A;  2WT7 B;  2J5U A;  4A7P A;  3AE5 C;  3OP0 A;  3M0A A;  1GL2 B;  3P32 A;  2KP8 A;  1PIX A;  1K73 Q;  2K37 A;  2H8P D;  2LKM A;  5KLV D;  2Q91 A;  2M9G A;  1W2B O;  1SQQ K;  1M7L A;  1TRF A;  4GGN A;  3SWK A;  2LC5 A;  2ZYG A;  3D73 A;  1X9V A;  2OYI A;  3D74 A;  2L4I A;  1SR6 B;  2HG5 D;  1UHI A;  1SQX E;  1IQ5 A;  2NCO A;  3AEB C;  4PE1 A;  1YI2 P;  1NX3 A;  2ZRT A;  2JT8 A;  2OYI B;  1BOC A;  1BDC A;  1UP5 A;  1FI6 A;  2JT0 A;  1VQL P;  1B47 A;  2OTG C;  1IFI A;  3A3Y B;  3TGU E;  1F71 A;  3H1H G;  2N1T D;  5K89 A;  1A4P A;  1SCM B;  2YGU A;  1VQM P;  2W90 A;  3H1L D;  1EDJ A;  3O6B A;  3CX5 D;  3NHT A;  1R8E A;  2XNX A;  2FY8 A;  1IGV A;  2A06 E;  4U8D A;  1DEE G;  1CI6 B;  1WDC B;  1YQ4 C;  1ZLL A;  1KFX S;  1JFJ A;  5JOL A;  1AHR A;  1FZG A;  5GTH E;  2Y1M A;  1SMG A;  1L0L K;  4D1E A;  1KFU S;  1BR1 B;  1QVI Y;  4U3F J;  3MUD A;  1ZRT E;  1S5L H;  1K05 A;  1XFR A;  3BCC J;  1SP4 A;  2FYU K;  1CFC A;  2QE7 H;  1J7R A;  1R2U A;  1XFY O;  1HJ0 A;  1TOP A;  1D1O A;  2BCC D;  3SFE C;  1DJZ A;  1G2C B;  1J1E A;  2FYN C;  3TNU B;  2ISD A;  3SSU A;  1WRG A;  3HCM A;  5GTH H;  1A2X A;  1B9A A;  3H1I E;  1X0T A;  2AXT H;  2RKL A;  1PPJ D;  2Q1K A;  1B8R A;  1XO5 A;  2E6W A;  2A45 H;  1RE4 C;  1J1E B;  1LT9 C;  1UWO A;  1XFW O;  4B86 A;  1OQP A;  5IBW A;  1ZOY C;  1BCC G;  1R5S A;  4TNC A;  2JWA A;  1NHL A;  1YUT A;  1L7Z A;  5KLI C;  1NTK D;  1TUJ A;  1OZH A;  3BFH A;  1K93 D;  1DIP A;  1J2J B;  3CPW O;  3Q5S A;  1FW4 A;  1XK4 A;  3WUT A;  4EIJ A;  2YO2 A;  1PZQ A;  4F0Z B;  1FDO A;  5CHX A;  1MKM A;  3F89 A;  1IJD B;  1PFI A;  1RK9 A;  2WSS H;  4RES B;  5D69 A;  3Q2Y A;  1Y8A A;  2K9J A;  1LA0 A;  4NDD A;  1A75 A;  3B7A A;  3AEF C;  1QVI Z;  4AQJ A;  2LVI A;  1Z2C B;  1SRA A;  5CBN A;  4A4B A;  1PP9 E;  4DT0 A;  4JKT A;  5BU5 A;  4IL1 A;  4YTP C;  1SQX G;  1A75 B;  2ZT9 D;  2WCH A;  3VGO A;  4I7Z B;  3T97 B;  1YIT P;  2M49 B;  3GHG A;  1K94 A;  3BRV B;  1KWO B;  1SQV J;  2GUV A;  3W67 A;  5EL2 A;  4DZO A;  1QLS A;  3GG2 A;  3TGU G;  1DT7 B;  3P7K A;  3EG5 B;  3RK3 D;  2VRG A;  1QAS A;  1FU1 A;  2LCP A;  1SFC D;  3Q3D A;  5B8I B;  5AW0 B;  2H43 A;  3VB1 A;  2HPS A;  2YKO A;  1GK4 A;  1XFU O;  3S0E A;  2WWW A;  3CGA A;  1NPQ A;  3EFF K;  2LXC B;  1YUR A;  3I5H C;  2A06 G;  4WBA A;  1CFP A;  4KT0 J;  3BAT A;  1KIL D;  2P7J A;  1BGY E;  2B87 B;  4JWQ A;  5I94 A;  3Q5R A;  1VF5 D;  1FJP A;  4ZCU A;  3VMA A;  2A45 G;  2W6A A;  1IFM A;  3R72 A;  3BAS A;  2GUS A;  1QL1 A;  5APQ A;  3SWY A;  3OJA B;  1DJY A;  2MKV A;  1U5I B;  3OAK A;  1L0N J;  1LTJ A;  1OMR A;  1V1G A;  1KCY A;  3I5I B;  1IZN B;  1LTS C;  3BOW A;  4YRU A;  2CCM A;  1CKK A;  3H1I G;  3TSI A;  1T3J A;  5HLO A;  4PD4 E;  2WC5 A;  1SKT A;  1TUZ A;  2FXM A;  2Y0E A;  1YJ9 P;  1BCC D;  1S9K D;  2QJY B;  2L51 A;  3PAT A;  1KB9 E;  2HFE D;  4H44 D;  3CXH H;  4JF7 A;  3B8E B;  3CI9 A;  2XND H;  2H7H A;  4DRW A;  1SQV K;  2IYP A;  4MBE A;  4IJ7 A;  1GL2 D;  3BVH A;  1DH3 A;  2GV5 A;  1IRJ A;  3OW2 O;  2XU6 A;  3RK3 C;  3NXS A;  4YXD C;  2ITA A;  5CJ4 A;  1SFC C;  1OE9 B;  1S36 A;  4JPZ B;  5I8N A;  1P84 I;  1PP9 G;  1L4A B;  4OR9 B;  2WC8 A;  2QJP C;  2CXJ A;  5H2F E;  2KI4 C;  1NTM E;  2PMY A;  1EG4 A;  1H89 A;  3SFD C;  1YRT B;  2WCL A;  3MD0 A;  2M8U A;  3UIA A;  2YKP A;  3M0W A;  2ZND A;  1KIL C;  5KTY A;  2ZRS A;  4XJK B;  2K7D A;  3O4Y A;  5KAF H;  2QEO A;  1VF5 C;  2C0W A;  2OPO A;  1CLB A;  1K9M Q;  1M1J C;  4JQ0 D;  1SQB E;  1NYH A;  2SCP A;  3LK1 A;  3P8C E;  1BE3 D;  1GW4 A;  4Y99 B;  2DOQ A;  3H1H J;  2ZFD A;  1EZV I;  3WXA A;  1EZV E;  5TIS E;  1NTZ D;  1OIP A;  4JBZ A;  3FS7 A;  1CM4 A;  1NU1 E;  3L72 E;  4R4L A;  2MAZ A;  1CSB A;  4GFT A;  3CC4 P;  4C46 A;  1JY3 O;  4H0L B;  1BGY G;  3LL8 B;  2FCD A;  1FOS E;  1RQV A;  1RH5 B;  2CT9 A;  3PTZ A;  2W83 C;  3HUS C;  3KF9 A;  1QWV A;  1J1D C;  2IYO A;  4TLF A;  3QH9 A;  1JY3 N;  3L4F A;  2FXO A;  3AEA C;  3A8R A;  2BNX A;  4H44 C;  1KQF B;  1CFD A;  2JWW A;  1OWA A;  3KZI E;  2ZJS E;  3ITK A;  2ZFC A;  5DKN A;  3L73 E;  3NSI A;  1QX2 A;  2JOJ A;  2DW3 A;  4HKZ H;  2KSP A;  1URQ A;  1Y9B A;  2BAP A;  3L4L A;  2M7N A;  1MQ1 A;  2P70 A;  1OMD A;  1SQP D;  2BEC A;  4UB8 E;  2OS8 B;  3HD7 B;  1Z4H A;  3A2A A;  5AAN A;  1ZP0 C;  5PAL A;  1JF0 A;  4HH2 A;  1NSH A;  1RE3 A;  1FZA A;  2ZVO B;  3U1C A;  3PN7 C;  3M9B A;  3CC7 P;  2OTJ P;  3R2P A;  1CMG A;  3FGA D;  1YTZ T;  3M0D A;  3TUY C;  2E75 B;  4YI8 A;  1A02 F;  2IZ1 A;  1Y1U A;  5KLV E;  2WSE H;  1SL7 A;  1OVV A;  4M2Q A;  1ZMZ A;  2E30 A;  2HPC A;  1YBK A;  1KK8 B;  2D8N A;  3D6Z A;  3D75 A;  1SL8 A;  3A5T A;  1EDI A;  5AW7 B;  1N65 A;  4UB8 H;  4GDO A;  5APY A;  3CS1 A;  2N1T A;  2B9B A;  1NTM G;  1JB0 J;  1IQ3 A;  2JTZ A;  1PL5 A;  1T2K D;  3D70 A;  2CNP A;  1NUB A;  4F7F A;  3MP7 B;  4LC1 A;  4ICB A;  5AVQ B;  1UIX A;  1SQX J;  3PM8 A;  2OQQ A;  1KZU B;  2G8Y A;  3H1L E;  1SQB G;  1HJB A;  1FOS F;  3CX5 E;  4GAO A;  1K95 A;  1JTH A;  2A4J A;  3B71 A;  1N7S B;  3DY9 A;  3TGU J;  3ABV C;  1QVF O;  5CBO A;  1IG5 A;  2WC6 A;  3H4S E;  2SAS A;  3CCV P;  5AW4 B;  1RHZ B;  2IX7 C;  2KOG A;  5GTI H;  1SQQ D;  3D0Y A;  4HRH A;  4YGA A;  2L91 A;  4R4M A;  2BL0 B;  3MSE B;  5APV A;  1WLM A;  2ZAE B;  5F6T A;  2YIU C;  1ZUZ A;  2M7L A;  1ZW0 A;  3OB2 B;  1CDN A;  3A0H H;  1BSN A;  4E68 A;  4CFQ A;  2KHN A;  2BCC E;  2O01 H;  2QJK B;  2BKI B;  3SG3 A;  1R5L A;  2QDI A;  3TDU A;  3V6I A;  3CXH D;  3IFM A;  2NZ0 A;  1PPJ E;  3E3R A;  1BSH A;  3RL0 D;  2KNC B;  1B7T Z;  5DKR A;  1TNW A;  2MHH A;  1KQM B;  3JTD B;  1YJN P;  2GA1 A;  5CCH A;  1HVV A;  3IR9 A;  2Q3I A;  2XV5 A;  3H1I J;  2F3Z A;  1QIW A;  1T3U A;  1YHQ P;  1NTK E;  2KSJ A;  1OOG A;  1OVU A;  4MZJ A;  1L2P A;  1L0L D;  2K1A A;  3E1I A;  3CCL P;  3O78 A;  1VQ6 P;  4JYB A;  1SW8 A;  3I5G C;  2KFH A;  2QSI A;  2HOD A;  1SSE B;  5KLV G;  1RJV A;  3O6Q A;  2CBL A;  2FYU D;  3PP5 A;  2NPS B;  2HYN A;  1QLE D;  1Y1X A;  2V4H A;  3HE4 B;  1FZC A;  1NWD A;  2L50 A;  3RM1 A;  4UPG A;  3TK1 A;  1LS8 A;  2ZN9 A;  3O6Q B;  3LK0 A;  1Q90 D;  2KDH A;  2KIK A;  3GHG C;  3KQG A;  3D6Y A;  4H13 B;  1FZB A;  1K9P A;  1UHJ A;  3FWN A;  1ALV A;  3D10 A;  1U7J A;  1CZQ A;  3VP8 A;  1NGM B;  1PP9 J;  2E76 D;  2KLU A;  2D2C C;  2BEZ F;  2KLD A;  2K61 A;  4I5N B;  1M39 A;  1FDM A;  3RK3 E;  1OFC X;  1OOI X;  4IFF A;  2KZI A;  3H1L G;  1KMI Z;  5J3X A;  2P6B B;  1X02 A;  4PE0 A;  1S6C A;  3OB1 B;  5KKZ C;  3KPE A;  2O1J A;  1UUR A;  2M3B A;  1XTC C;  4AQI A;  1ZXG A;  1FS0 E;  2KYC A;  1KIL E;  2FJY A;  4IFM A;  3M9H A;  3BFA A;  5FI7 A;  2JUL A;  2PQL A;  3OX5 A;  3KDP B;  3D71 A;  1UHK A;  3RL0 C;  3H32 A;  2B89 A;  1MF8 B;  3IN6 A;  1BGY J;  4MN0 A;  2QM8 A;  1LTJ C;  4YPC A;  2AUC A;  2V7Q H;  1T6A A;  1FJK A;  2N9Y B;  2BCC G;  2PP6 A;  1NYA A;  4WY4 B;  3I5C A;  1QX7 A;  1CLL A;  1IK9 A;  1Y47 A;  1N73 B;  5BVZ A;  1VQ9 P;  1K9K A;  4PHJ A;  1BT6 A;  1PPJ G;  3R4Y A;  1HGV A;  3RK2 B;  1FDI A;  2YO3 A;  2O01 N;  1NX2 A;  1J7P A;  3JCU H;  1SL9 A;  1CB1 A;  3VRO A;  3G4S P;  2F3Y A;  3FXD A;  1OW4 A;  3A7O A;  1ZV8 A;  1BCC E;  2WT7 A;  1JFK A;  1NTK G;  1IFJ A;  2E74 B;  1S9K E;  1LT1 A;  5KU1 A;  1SPY A;  1YTZ C;  1CM1 A;  1UHH A;  4ORC B;  1DF0 B;  2WCM A;  1E79 H; 
#chains in the Genus database with same CATH homology
 1DJI A;  1A75 B;  4PE7 A;  5CSJ A;  3VGO A;  2COL B;  2H2K A;  2KAX A;  4MEW A;  3I5H B;  3VRN A;  2M49 B;  1XFV O;  1K94 A;  1KWO B;  2QPT A;  4I5L B;  1JUO A;  1L2O C;  1QLS A;  2KFG A;  1EL4 A;  1DT7 B;  1XK4 C;  3F45 A;  2G9B A;  1S3P A;  1QAS A;  1J55 A;  2BCX A;  2VRG A;  2LCP A;  1IKU A;  3LCP C;  5B8I B;  5CPV A;  3CZT X;  4HSZ A;  1QS7 A;  4MZK A;  2HPS A;  1DGU A;  5I2O A;  1F54 A;  1DJH A;  1XFU O;  2LAN A;  3VRQ A;  5AER A;  5HKW A;  2F8P A;  1SYM A;  3CGA A;  1NPQ A;  2L2E A;  1YUR A;  2M1U A;  5CSF A;  3I5H C;  2HET A;  4ORB B;  1QTX A;  3EK4 A;  1KWO C;  1CFP A;  2AMI A;  2MJW B;  1AP4 A;  2FJU B;  1SCV A;  4R1E A;  4JWQ A;  1E8A A;  4MLW A;  2LAP A;  1PAL A;  1CMF A;  3EK7 A;  4ZCU A;  1EG3 A;  1BMO A;  2NXQ A;  2K7B A;  1IJ6 A;  2ZN8 A;  1ALW A;  2IS9 A;  1M45 A;  2F2P A;  1S5G Y;  1GGZ A;  2JZI A;  4PAL A;  2MBX A;  1R6P A;  4CLN A;  1DJY A;  4C0J A;  1U5I B;  1QV1 A;  2JXL A;  1AVS A;  4PCW A;  1CLM A;  3NXA A;  2Q4U A;  2ZNE A;  3PFV A;  1OMR A;  4OCI A;  3LLE A;  1MHO A;  5I2Q A;  1W7J B;  1V1G A;  2PAL A;  1JWD A;  1KCY A;  1XFZ O;  3I5I B;  3TDZ A;  1DJX A;  2WCF A;  2I7A A;  3BOW A;  2MA2 A;  2CCM A;  4YRU A;  1PUL A;  1CKK A;  3NSL A;  1J7O A;  4BY4 A;  2KBI A;  2R2I A;  3IQO A;  2Y4Q A;  5HLO A;  1EXR A;  1RWY A;  2LVV A;  2M1K B;  2MRD A;  2BKH B;  2LMV A;  2K7O A;  3SJS A;  1SKT A;  1TNQ A;  4MZL A;  4CID A;  5HKY A;  1CDM A;  2L51 A;  3PAT A;  3ICB A;  3SIB A;  2EC6 B;  3KEV A;  4FTG A;  1LVC D;  3AAJ A;  2KI4 B;  3I5I C;  1SNL A;  4DRW A;  1RRO A;  1MR8 A;  2WOR A;  4MBE A;  4N1F A;  2BBN A;  4NDC A;  1NX1 A;  2GV5 A;  5DKQ A;  2K8M B;  3DVM A;  4YI9 A;  1B7T Y;  1BR4 B;  2NCP A;  4OKH A;  1IRJ A;  3BUO B;  1REC A;  3WHT B;  2KAV A;  4FQO A;  2KGB C;  1M63 B;  4Q04 A;  1DJW A;  1OE9 B;  1S36 A;  3BYA A;  1OSA A;  4JPZ B;  5I8N A;  3FIA A;  1KK7 Y;  1C7W A;  1S5G Z;  1QXP A;  4OR9 B;  2EC6 C;  2WC8 A;  2CXJ A;  1F8H A;  2KI4 C;  2FCE A;  2PMY A;  1MUX A;  1EG4 A;  1YRT B;  3VRP A;  4MRY A;  2M8U A;  3DVE A;  1K96 A;  3M0W A;  2ZND A;  1DF0 A;  5KTY A;  2B1U A;  1FBV A;  1MXL C;  2KI6 D;  2ZRS A;  2K7D A;  3BUW B;  2JNF A;  4XJK B;  1J1D A;  3O4Y A;  1B4C A;  1FPW A;  2GGM A;  1TTX A;  4HRE E;  2I2R E;  1PSB A;  1QAT A;  2OPO A;  1CLB A;  4A4C A;  4JQ0 D;  2SCP A;  3LK1 A;  3D0Y B;  1UUS A;  3IF7 A;  2FOT A;  1CDP A;  2DOQ A;  1BF5 A;  2NLN A;  2ZFD A;  3WXA A;  3A4U B;  4WQ3 A;  3OX6 A;  4QJ5 B;  1PSR A;  2WOS A;  3BQ3 A;  3FS7 A;  1CM4 A;  3EKH A;  1K9U A;  1XFX O;  2HQ8 A;  2MAZ A;  1TN4 A;  2LLT A;  4GFT A;  1B1G A;  1DGV A;  1C07 A;  3QRX A;  4CPV A;  2HF5 A;  3KO0 A;  3LL8 B;  3CTN A;  1ZFS A;  1LA3 A;  2FCD A;  1ZOT B;  3SG6 A;  2PAS A;  2LV7 A;  3I5F B;  2CT9 A;  3KF9 A;  1NCY A;  4AOM A;  2RGI A;  1NP8 A;  2JRF A;  1AUI B;  2GGZ A;  2WND A;  2PRU A;  2PSR A;  4M2P A;  4MVF A;  3PAL A;  1KK7 Z;  3CR5 X;  1V1F A;  2Y9Y A;  3A8R A;  1WY9 A;  1WLZ A;  3RLZ A;  1QIV A;  1ODB A;  2KFF A;  3PN7 B;  1CFD A;  2JWW A;  2K2F A;  3I5F C;  1QV0 A;  2KBM A;  3SG5 A;  3ZNI A;  2L5X B;  1C7V A;  1U5I A;  3FWC A;  1QJT A;  2LLU A;  3IQQ A;  3TUY B;  1PRW A;  4ORA B;  5BPJ A;  1DJG A;  5DKN A;  2KGR A;  2HQW A;  3NSI A;  1QX2 A;  2JOJ A;  4MRX A;  4CFR A;  4QJ4 B;  1B8C A;  1J7Q A;  2KSP A;  3BXK A;  1HT9 A;  1CDL A;  2M7N A;  1MQ1 A;  4YBH B;  1OMD A;  2LE9 B;  2TN4 A;  4DIR A;  2BEC A;  4L9M A;  2OS8 B;  5ER4 X;  5AAN A;  2H61 C;  2JC2 A;  2LMT A;  3FWB A;  4GGF C;  1JF0 A;  5PAL A;  1GGW A;  1S6I A;  1NSH A;  1QLK A;  3PN7 C;  2JQ6 A;  2LUC A;  1CMG A;  1KSM A;  2JXC A;  4GBA A;  4N1G A;  3TUY C;  2EGD A;  4YI8 A;  3SIA A;  1LIN A;  1Y1U A;  5GQQ C;  1SL7 A;  2BBM A;  5ER5 A;  5G08 A;  5I2L A;  1JC2 A;  2LM5 A;  4M2Q A;  4USL A;  2EHB A;  1OMV A;  1ZMZ A;  2E30 A;  2JTT A;  2M3W A;  1DVI A;  3SG2 A;  1EH2 A;  1KK8 B;  2WCE A;  2D8N A;  4WQ2 A;  1YUU A;  3BUX B;  4YGD B;  2MLE C;  1G8I A;  1SL8 A;  2ZKM X;  2OS8 C;  1N65 A;  1TCO B;  3BUM B;  3VRR A;  1AJ4 A;  3CS1 A;  3OHM B;  3DVK A;  2Y5I A;  2V53 A;  3K21 A;  2CTN A;  2Y9Z A;  1IQ3 A;  2BE6 A;  2JTZ A;  1TIZ A;  1KFX L;  1XVJ A;  2KNE A;  3TZ1 A;  2CNP A;  1NUB A;  3TS5 B;  5HKZ A;  2KQ6 A;  3WHU B;  4ICB A;  1H4B A;  1KFU L;  1NX0 A;  1W7I B;  1YVL A;  3ZWH A;  1Y1A A;  3PM8 A;  1KK8 C;  3BUN B;  1A29 A;  1K8U A;  3AAK A;  2KAY A;  3PSR A;  2LP3 A;  2LMU A;  4GAO A;  1K95 A;  3JVT B;  2A4J A;  1IH0 A;  3SG4 A;  2G2B A;  4PHK A;  4XJK A;  1UHN A;  4BY5 A;  1YRU B;  3AKA A;  1JF2 A;  1IG5 A;  2JU0 A;  2KOT A;  3DF0 A;  3H4S E;  2SAS A;  1M31 A;  4HRG A;  4OVN F;  4PHM A;  2KQY A;  2F33 A;  5CSI A;  3TS5 C;  1ZAC A;  1DTL A;  1FI5 A;  1RFJ A;  3D0Y A;  2WCB A;  4HRH A;  3DF0 B;  1F70 A;  4I5K A;  4YGA A;  4OV2 A;  2BL0 B;  3MSE B;  1F55 A;  4C0L A;  1IJ5 A;  1PVB A;  3DD4 A;  1WLM A;  2LHI A;  1Y0V H;  5F6T A;  4YGB B;  1BU3 A;  3JVT C;  1NCX A;  1BG1 A;  3AKB A;  5AEQ A;  2Y1N A;  3WNX B;  5JJG A;  2K7C A;  1YX7 A;  1ZUZ A;  1HQV A;  2M7L A;  3OB2 B;  1YR5 A;  3CR2 A;  1CDN A;  1OZS A;  1K2H A;  2LHL A;  2M29 A;  3NSK A;  4I5J A;  1YUS A;  5HLV A;  4QJ3 B;  4E68 A;  1N2D A;  4CFQ A;  2KHN A;  4PHN A;  5KSZ A;  2LP2 A;  4XYN A;  1IWQ A;  1WRK A;  2BKI B;  3SG3 A;  1CNP A;  1S6J A;  2BL0 C;  4GNK B;  1KSO A;  3TDI A;  3I5G B;  3TDU A;  1SK6 D;  2NZ0 A;  1MXE A;  3E3R A;  1B7T Z;  3OP0 A;  5DKR A;  1TNW A;  2M0R A;  2MHH A;  2BE4 A;  3CLN A;  4PE4 A;  1AK8 A;  1KQM B;  3JTD B;  2H61 A;  1RTP 1;  1YX8 A;  4GGF A;  1OOJ A;  1BLQ A;  2Q91 A;  2M9G A;  4N5X A;  2OTG B;  1S26 D;  5AXI A;  2F3Z A;  1QIW A;  5TNC A;  1TRF A;  4GGN A;  4MZJ A;  1NIW A;  4NQG A;  4YGE B;  3GK2 A;  2LC5 A;  1DMO A;  2L0P A;  1XA5 A;  3O78 A;  2L4I A;  1CFF A;  1SW8 A;  3I5G C;  2KFH A;  1SR6 B;  1UHI A;  1IQ5 A;  2MLF C;  4M2O A;  1WRZ A;  2NCO A;  1YVH A;  4PE1 A;  1KQM C;  3JTD C;  1CTR A;  1RJV A;  1NX3 A;  2ZRT A;  2JT8 A;  4GPL B;  1BOC A;  5AFP A;  1WRL A;  2CBL A;  1UP5 A;  1FF1 A;  2JT3 A;  1FI6 A;  2JT0 A;  1B47 A;  1Y1X A;  2OTG C;  1BOD A;  3EVU A;  3EKJ A;  4ZCV A;  1F71 A;  1N0Y A;  1NWD A;  2L50 A;  3RM1 A;  4C0K A;  4UPG A;  5K89 A;  2ZN9 A;  1A4P A;  3LK0 A;  1SCM B;  2I18 A;  2KDH A;  2LLS A;  2LVJ A;  5D7F A;  2LVK A;  1K9P A;  1UHJ A;  3O6B A;  1SY9 A;  2M97 A;  1SR6 C;  1ALV A;  4P5O E;  3D10 A;  3HX4 A;  2KI6 C;  1IGV A;  1B8L A;  4YGC B;  2K61 A;  3O2P A;  1M39 A;  2AAO A;  3KHE A;  3KPX A;  1WDC B;  4I5N B;  4U8D A;  1KFX S;  1JFJ A;  3PLF B;  5JOL A;  1AHR A;  1OFC X;  1JSA A;  4DUQ A;  3NSO A;  2Y1M A;  1SMG A;  2PVB A;  1KQV A;  4D1E A;  1KFU S;  1QX5 B;  5J3X A;  1BR1 B;  1SCM C;  1EJ3 A;  2P6B B;  4DS7 A;  1X02 A;  4PE0 A;  1MWN A;  1S6C A;  3GK4 X;  3GOF A;  3OB1 B;  1BJF A;  1UUR A;  5HYD A;  1QVI Y;  2I94 A;  2K0J A;  4AQI A;  2F2O A;  4DCK A;  2O60 A;  3EVV A;  2QAC A;  2KYC A;  3BOW B;  5CSN A;  1CFC A;  1LXF C;  4MSP A;  1J7R A;  1R2U A;  1WDC C;  1XFY O;  1TOP A;  3GK1 A;  1D1O A;  2JPT A;  1DJZ A;  1TNP A;  4PDZ A;  2JUL A;  2K2A A;  3EK8 A;  1F4Q A;  3OX5 A;  1J1E A;  1UHK A;  2ISD A;  4GUK A;  3HCM A;  1PK0 D;  1A2X A;  1B9A A;  1MF8 B;  5FYX A;  1K90 D;  4MN0 A;  1VRK A;  1B8R A;  1XO5 A;  2E6W A;  3DVJ A;  1AJ5 A;  2AUC A;  1UWO A;  1XFW O;  1OQP A;  1JBA A;  5IBW A;  2JNX A;  1NYA A;  1M46 A;  1PVA A;  1XYD A;  4TNC A;  1OZO A;  1YUT A;  2LUX A;  4WRI A;  4ETO A;  1A03 A;  1L7Z A;  1GJY A;  1Y6W A;  1QX7 A;  1CLL A;  1K9K A;  3EVR A;  2O5G A;  1K93 D;  1BT6 A;  4NDB A;  4PHJ A;  3C1V A;  1G4Y R;  2LNK A;  1FW4 A;  1XK4 A;  1GQM A;  1NX2 A;  2L4H A;  4F0Z B;  1J7P A;  3CWG A;  1NCZ A;  1F4O A;  1Q80 A;  1SBJ A;  1SL9 A;  1CB1 A;  3VRO A;  1S1E A;  1L2O B;  2F3Y A;  1G33 A;  1TCF A;  2BCB A;  1RK9 A;  1TNX A;  5D69 A;  2KYF A;  1JFK A;  2BCA A;  1LA0 A;  4P2Y B;  4NDD A;  1A75 A;  1H8B A;  5KU1 A;  3SG7 A;  1QVI Z;  1SPY A;  2L98 A;  4AQJ A;  1YTZ C;  2LVI A;  1CM1 A;  1LKJ A;  1SRA A;  1UHH A;  4ORC B;  4A4B A;  1DF0 B;  3CR4 X;  4IL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...