4DCKA

Crystal structure of the c-terminus of voltage-gated sodium channel in complex with fgf13 and cam
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
153
Chain Sequence
SVATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Ternary Complex of a NaV C-Terminal Domain, a Fibroblast Growth Factor Homologous Factor, and Calmodulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/signaling protein
molecule keywords Sodium channel protein type 5 subunit alpha
total genus 51
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2012-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4dckA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4dckA02
1HQVA 3BOWA 2KI4B 1OQPA 2PVBA 1PRWA 4MEWA 1OOJA 2MHHA 3I5HB 4MRYA 4OKHA 1LVCD 1A29A 2WORA 5HLOA 1KWOB 2LAPA 1Q80A 2M1UA 2TN4A 3I5IB 2M3WA 2ZRTA 3O4YA 1CDPA 4NDBA 1JC2A 2KSPA 4OVNF 4GAOA 1KQMC 4DUQA 1GGZA 3WNXB 1MF8B 2KHNA 3JTDB 4PE7A 1EXRA 1F54A 3K21A 3C1VA 1YR5A 1S5GZ 4GBAA 4NQGA 5AEQA 3GK1A 5GQQC 3QRXA 4CLNA 2KNEA 5CSNA 1B8LA 2KGRA 2M7LA 2KFHA 3WHTB 3EVVA 2MJWB 2CCMA 1UHJA 1U5IA 3JVTC 2OPOA 1J7QA 1VRKA 1QJTA 3I5GC 2LMVA 1SPYA 2M0RA 4ZCUA 3CR4X 1XFXO 1SL8A 4UPGA 2M9GA 1ZFSA 4C0KA 1CDLA 3BUOB 2M29A 4PE0A 4I5KA 3FWBA 2JNXA 5DKQA 4FTGA 4AQIA 2M8UA 2NCPA 1CDNA 3TS5B 2M1KB 1JBAA 5AFPA 3A8RA 3LCPC 4N1GA 1XFVO 1UHNA 1NYAA 2CNPA 2JULA 4ORBB 3PN7B 2KAVA 1MR8A 1RFJA 2JT8A 1NX0A 3SG6A 2I94A 2CBLA 2ZFDA 3BUNB 3RM1A 1A03A 1JFJA 1MHOA 5KSZA 1NX1A 1BJFA 3VRPA 5D7FA 2NZ0A 2F8PA 1KK7Y 4PDZA 2K0JA 3OP0A 2Y1NA 4N1FA 1QTXA 5AERA 2Q4UA 2Q91A 4GUKA 4PHMA 4XJKB 2HPSA 1CDMA 1ZACA 2F3ZA 4PHKA 1JWDA 1DJZA 2L5XB 5J3XA 3H4SE 1UURA 3EK8A 4YI8A 2V53A 1M63B 3IQQA 4MBEA 1C7VA 3AKBA 2JOJA 4D1EA 1KFUS 1OZOA 1NPQA 5FYXA 3BUMB 1KSOA 2LM5A 4GPLB 3PFVA 1KK8C 1QXPA 1TNPA 2KFGA 3SG5A 1DJGA 1TNWA 4M2OA 2FCEA 2KBIA 4IL1A 1XO5A 2L0PA 1KK8B 1AJ5A 2LE9B 2ZNEA 3CTNA 2LLSA 2MLFC 5CSJA 1FBVA 1M31A 2KAYA 3TZ1A 3OX6A 4GFTA 1J55A 1SL9A 4P2YB 1CM1A 5DKRA 4HSZA 2LUCA 3OHMB 2ZKMX 2AAOA 3NSIA 2EC6B 2DOQA 1WLZA 1NSHA 1DJWA 2LVKA 2OTGC 2F3YA 2KOTA 3AAJA 1QX5B 2SCPA 3NXAA 1AHRA 1KWOC 1NUBA 2MBXA 4CFRA 2KAXA 2H61C 3ZWHA 2OS8C 4GGFC 1BOCA 1KFXS 1WY9A 4OR9B 1FI6A 3DVMA 2LMTA 1SR6C 1FW4A 1SW8A 1SK6D 3RLZA 1KSMA 1SMGA 4YBHB 1K2HA 3BOWB 4F0ZB 1PALA 1Y1XA 1JSAA 2MA2A 1YUUA 1PVBA 2JWWA 1QVIY 3EKHA 2JT3A 2WCEA 3OX5A 3PATA 2OTGB 1AK8A 1F4OA 1JF0A 2GGMA 1DVIA 1S1EA 2LMUA 1SCMC 2LNKA 1XA5A 2AMIA 2LANA 3SIBA 1J7PA 1S5GY 1OFCX 1SCVA 1QATA 1ZMZA 1J7RA 4WQ3A 2H61A 5KTYA 2L2EA 3I5HC 1OMVA 5G08A 1DMOA 1F55A 2PALA 2BL0C 1YUTA 2KDHA 2WCFA 1S36A 3KPXA 1YUSA 1BLQA 5PALA 1RK9A 2E6WA 1SRAA 1Y1AA 1YX8A 2HQWA 1ZOTB 2IS9A 1KFXL 1DF0A 2HQ8A 2F2PA 2FJUB 3BXKA 1TNXA 4ZCVA 2FCDA 3IQOA 1XYDA 1V1FA 1K96A 3FS7A 3PALA 4ORCB 3VRRA 4CIDA 4ETOA 1CLBA 2K2FA 1UHHA 4PHJA 1WRZA 1G8IA 2JXLA 1WLMA 2BBMA 3BUWB 4JPZB 1SCMB 3WXAA 2I7AA 3EK4A 1OE9B 2LHLA 1BR4B 1XK4C 3D0YA 3KO0A 1FPWA 1Y1UA 1PSBA 1JUOA 1TCOB 3SIAA 3PLFB 5CPVA 2I2RE 4E68A 1NWDA 1A75A 1IQ3A 2PRUA 2L51A 4Q04A 1TIZA 1B1GA 2JU0A 1DJXA 1R2UA 2Y1MA 1JFKA 3DF0B 1NP8A 3M0WA 3JTDC 2JTZA 3SG3A 2MAZA 4MRXA 1PK0D 2KGBC 4WQ2A 3GK4X 1XFYO 3A4UB 3O78A 4DIRA 1XFUO 4BY4A 1NX3A 1RWYA 1YX7A 1LA0A 1MUXA 1SL7A 2I18A 2E30A 2LC5A 1TCFA 1DTLA 1YVLA 1DT7B 3MSEB 5BPJA 3WHUB 3KF9A 4XJKA 1MXEA 1QIWA 3I5FC 1DJIA 1AP4A 1SNLA 1SBJA 3CR5X 4MZKA 1TOPA 2JRFA 4PE1A 1UWOA 1IJ5A 1K95A 1LINA 2L98A 1XFWO 1BODA 2LLTA 1QS7A 3O2PA 1D1OA 1ODBA 1YVHA 3OB1B 1QX7A 1EH2A 3NSOA 3PSRA 1CNPA 2BL0B 1KFUL 2M7NA 2EHBA 4YI9A 1CKKA 1CB1A 1WDCB 1B8CA 2L4HA 5JOLA 1L2OC 1CLLA 1B4CA 5HKZA 4USLA 1XFZO 4I5NB 1QLKA 2BCBA 3I5IC 2CTNA 1TRFA 1NX2A 4OCIA 1DGVA 1H8BA 1S6JA 4WRIA 1CFFA 2BECA 3I5FB 2KYCA 3NSLA 1LXFC 2GV5A 1JF2A 1CM4A 1K90D 1NCYA 5CSIA 4AQJA 3TDUA 1R6PA 3FWCA 1S6IA 3DVEA 1G33A 2F2OA 2QACA 5ER5A 3O6BA 1X02A 5AXIA 4GGFA 5I8NA 5K89A 1N0YA 1M39A 4GNKB 1EG4A 4A4CA 1CTRA 2ZRSA 4PE4A 1OMDA 1OMRA 2LCPA 3CGAA 1ALWA 1SKTA 1EJ3A 4HRGA 1KCYA 2WC8A 2G2BA 1Y0VH 1QX2A 2LV7A 2ISDA 1YRUB 2VRGA 2JZIA 1E8AA 1UHKA 4DCKA 2QPTA 1YTZC 2HETA 1B9AA 5HYDA 1J1EA 2LP2A 2D8NA 1K9KA 2WOSA 2O5GA 2LHIA 4M2PA 2EGDA 2R2IA 3CR2A 1BG1A 1BF5A 1WRLA 1QLSA 4OV2A 1SR6B 3EVUA 1K9PA 4NDDA 1MXLC 1K94A 2F33A 1CMFA 1OZSA 1QVIZ 3CZTX 1WDCC 3F45A 1UUSA 1DF0B 1W7JB 2KFFA 2K7OA 3ICBA 3LK0A 4JQ0D 4MLWA 4PHNA 1RTP1 3LLEA 1CMGA 1IKUA 3LL8B 3HX4A 1J1DA 2SASA 2Y9ZA 2PSRA 4QJ4B 5TNCA 2NLNA 4A4BA 1GJYA 1A2XA 1AVSA 1DJHA 3EVRA 2M97A 4FQOA 3EKJA 2NXQA 2MRDA 1BT6A 5I2QA 4YGBB 4PALA 1U5IB 2M49B 1BU3A 2WNDA 1J7OA 4PCWA 2WCBA 4CPVA 1MQ1A 1GQMA 2KQYA 1B8RA 4R1EA 2JXCA 2OS8B 2Y4QA 3SG2A 5I2LA 3VGOA 2GGZA 3HCMA 1K8UA 1YURA 1IRJA 5B8IB 3DF0A 1BMOA 1K93D 2BE6A 4YGEB 1DGUA 2K7CA 1B7TY 1A75B 1NCXA 2LVIA 1GGWA 1ZUZA 1A4PA 4YGDB 1PSRA 1WRKA 3DD4A 4GGNA 3VRQA 5ER4X 2K8MB 1SY9A 1AUIB 1B7TZ 1F8HA 3CS1A 4TNCA 1FI5A 2KYFA 1RECA 2L50A 1PULA 1S3PA 1QV1A 2AUCA 2PMYA 1M45A 3CWGA 2NCOA 2KI4C 2ZN9A 4MVFA 3JVTB 5IBWA 2Y9YA 1IGVA 1F4QA 3GK2A 4HRHA 1EL4A 5HKWA 3I5GB 1C7WA 1L2OB 1XK4A 3PM8A 2PASA 2BE4A 4P5OE 3TDZA 3LK1A 1IG5A 1HT9A 2COLB 2L4IA 2KI6C 3D10A 3PN7C 2B1UA 4L9MA 1SYMA 1RROA 3AKAA 1LKJA 3OB2B 2MLEC 3TS5C 4NDCA 1CFPA 1PVAA 2CT9A 2LLUA 1QV0A 2CXJA 1KK7Z 2ZNDA 3E3RA 1L7ZA 4ORAB 2KBMA 1TNQA 2JPTA 3TUYC 2EC6C 1CLMA 2JTTA 3AAKA 4ICBA 2BCXA 4I5JA 4YGAA 4MSPA 1KQMB 1NCZA 4I5LB 2JC2A 1FF1A 2BKHB 3TDIA 1N65A 4DS7A 2RGIA 5I2OA 3SJSA 1UHIA 4M2QA 4YGCB 1K9UA 2ZN8A 2LVVA 3BUXB 4MZLA 3VROA 1QIVA 3KHEA 3FIAA 4XYNA 4C0JA 1RJVA 4QJ5B 1IJ6A 1OSAA 4N5XA 1BR1B 1IWQA 4CFQA 2JNFA 5KU1A 1G4YR 1V1GA 2H2KA 2LVJA 2KI6D 1YRTB 1F71A 3D0YB 2P6BB 4JWQA 2O60A 3CLNA 2G9BA 1IQ5A 1M46A 4HREE 1XVJA 1TN4A 5CSFA 2JT0A 3SG7A 2KQ6A 4YRUA 3DVJA 3DVKA 5F6TA 2Y5IA 1N2DA 1KQVA 5DKNA 1NIWA 3BQ3A 5AANA 3ZNIA 3NSKA 1UP5A 5JJGA 4DRWA 1LA3A 2K61A 1ALVA 5HLVA 3EK7A 4MZJA 1S6CA 1S26D 1H4BA 4QJ3B 1DJYA 1IH0A 2K2AA 1F70A 3SG4A 1B47A 2LP3A 3GOFA 2K7BA 3TUYB 2JQ6A 2A4JA 2BCAA 2BBNA 3KEVA 2K7DA 2HF5A 1Y6WA 5HKYA 3IF7A 2FOTA 4AOMA 4MN0A 4BY5A 1MWNA 1EG3A 4U8DA 4C0LA 1C07A 1QASA 1W7IB 3VRNA 2BKIB 1AJ4A 1CFDA 3BYAA 2LUXA 1CFCA 5D69A 1TTXA
chains in the Genus database with same CATH superfamily
4W80A 3RBXA 3H1JE 1PRWA 1FZCC 4MEWA 3A0BH 1S5LX 3I5HB 5CCHD 2FFDC 2LAPA 2TN4A 2M1UA 4NDBA 2E74B 2P7JA 2KLEA 3OBVA 1N7SA 1PPJG 1SQPG 3WNXB 4AQRD 2KHNA 1EXRA 4N3YB 1YR5A 1WT6A 5GQQC 3QRXA 4CLNA 5CSNA 2FYUK 3P8CE 5AW0B 4UB6E 2NPSB 3EVVA 1S5LH 1U5IA 1Y47A 1VRKA 3ITKA 3V2NA 2LMVA 2QEOA 3CR4X 1YBKA 1SL8A 1SQQJ 4UPGA 1ZFSA 4WY4A 1OW7A 3HTKA 2E76C 5AVXB 2JNXA 1OOGA 1CDNA 1DELA 5AFPA 4IL6E 3T97A 1XFVO 1SFCB 1UHNA 1NYAA 2CNPA 3SSUA 1MR8A 1H89A 1SQQE 2WPQA 2OYHB 1A02J 1NX1A 2YKOA 5AW8B 2NZ0A 2F8PA 1KK7Y 3H1KD 2E5YA 3OP0A 2IDBA 3AEBC 5AERA 1CZQA 2D2CD 2Q4UA 4GUKA 1JY2P 2KB7P 2KSEA 3TGUJ 5K5GB 1KORA 1ZACA 3CX5I 2RH0A 2J58A 2N1TB 2L5XB 1NTZJ 3EK8A 2V53A 3IQQA 3L71G 3AKBA 2JOJA 1SFCD 3RK2C 1KFUS 3CXHD 4GPLB 1J1EB 1OZHA 4YXDC 5KLVD 3OJAB 1QXPA 2KFGA 1TNWA 3V2LA 2AXCA 2K1AA 2YXQB 1AJYA 1AJ5A 2LE9B 2MLFC 3CPWO 3K5BA 1KILE 1M31A 1FZFA 4GIFA 4PV1B 1J55A 1SL9A 5DKRA 2L2CA 1L4AC 2IYOA 3G6EP 3S9OA 2AAOA 1NSHA 1DJWA 3H1KE 3CCUP 5DICA 3NXAA 1SQBG 3D77A 2MBXA 5AW7B 1PFIA 1CW5A 2WC6A 2OS8C 1KQFB 1BOCA 1KFXS 2AEJA 5APWA 1WY9A 3DVMA 1SW8A 3RLZA 2R3SA 1KSMA 4I7ZB 2K88A 3BOWB 4F0ZB 1PALA 3I56P 1LT1A 2IZ1A 1H0TA 2MA2A 2XZRA 1NTMD 1SQXK 2WCEA 3OX5A 3PATA 1JF0A 3SIBA 2AMIA 4DT0A 1S5GY 1CI6A 4R4LA 1QATA 1SQBK 1JOCA 1N7LA 2H43A 2L2EA 1LWUC 1MKMA 2BL0C 3SS5A 4KJMA 2KDHA 1S36A 4IOIH 2BASA 1Y1AA 3NHIA 2HQWA 1ZOTB 1KFXL 4UB6H 5AVZB 3FS7A 3VRRA 1CLBA 2QEXP 3H6PA 1LTGC 1K73Q 1M1KQ 5BU5A 5B5EH 2BBMA 1KQGB 4JPZB 2I7AA 5B66E 4PD4I 1OE9B 3SS3A 1EZVE 3D0YA 4C7NB 4H13B 1RQUA 3TYYA 4M3LA 3N4XA 3B5NA 1NWDA 1L4AD 3A0BE 3CMAP 2JU0A 2Y1MA 3VOPA 3DF0B 1X22A 3SG3A 2R3CA 1JO5A 4WQ2A 3GK4X 1JY3P 2LXCB 3M91A 4DIRA 1JY3O 3FWLA 1LA0A 3E1IA 2E30A 2OYIA 1RF1B 5KLVJ 1DTLA 2HLOA 3WHUB 3L74G 3KF9A 1CI6B 3PJIA 1MXEA 1BCCD 3H1JG 1AP4A 1SQVE 3QMEA 3CR5X 3L71D 4NPEA 2JRFA 4PE1A 3IF4A 1IJ5A 1BODA 4NPFX 5AW2B 2R44A 3MUDC 3H1KJ 2A06D 1QX7A 3NSOA 4D6TJ 3PSRA 4WY4D 1BDDA 1KFUL 4YI9A 1CB1A 1FZCB 5KLIB 1PZQA 2JEEA 2FJYA 3O6QB 4USLA 2OTJP 3I5IC 2BCBA 3KZIE 1CFFA 1NTKK 2M3EA 2O1KA 2GV5A 3E7KA 1IFNA 2R32A 5CSIA 3E1RA 2FFDA 3HD7A 3B8EB 4INWA 2PFXA 2L5YA 5ER5A 1N7SC 5AW6B 2FBWC 2E76D 3QWOC 2ERBA 3CYZA 4R4MA 2ZRSA 2J5UA 2YGUA 4A7PA 2GUVA 2G2BA 5KAFE 2LV7A 3LIDA 1UHKA 1ZW0A 1M8OB 2YKQA 3KDPB 1LTJB 2HETA 1HTLC 3AE1C 2R2IA 3CR2A 2Q7CA 4OV2A 1SR6B 2WITA 1NU1K 4NDDA 1K94A 2F33A 1OZSA 1EZVI 1WDCC 1J2JB 2FXOA 2NPSC 1DF0B 4PHNA 2WSSH 4JQ0D 5B5EE 4Y28J 3VB1A 1IKUA 2KYVA 1H88A 4QJ4B 3W68A 5TNCA 1T6AA 2OGUA 2N1TC 3JC22 4FQOA 1DJHA 3EVRA 3H1HE 4PALA 3L70G 2OARA 2JP3A 3GHGB 2YO3A 1HGVA 3RL0C 3H1HG 3C9IA 3VP9A 1L0NG 2KQYA 3CC4P 3R2PA 1GU4A 3VGOA 2GGZA 3RZSA 3V6IA 2D2CB 1S9KD 1RH5B 1XTCC 5CCHA 1X8YA 1NCXA 3RK3D 1ZUZA 2WCMA 3D74A 1NOHA 2M8RA 3VRQA 5H2FE 1RE3C 1LTJC 3CS1A 3CXHE 4TLFA 2M5AB 1QL1A 1L4AA 1PULA 1QV1A 2AUCA 1Z56A 1LP1A 3GHGC 2ZN9A 5IBWA 1FJPA 1F4QA 1EL4A 3Q3DA 2KOGA 2NZ2A 3NTNA 3PM8A 2BE4A 3IN6A 1HT9A 2COLB 2L4IA 2KI6C 3D10A 3BATA 3L72E 2B1UA 1S72P 4L9MA 3C8VA 3AKAA 2A06G 1ZR4A 1PVAA 2LLUA 2XU6A 1GD2E 4ORAB 2KBMA 4JBZA 1YIJP 2ZYDA 1BCCJ 5APSA 1KQMB 1NCZA 3CX5D 2JC2A 3L72G 2KS1A 2FYUD 3V2QA 1N65A 4DS7A 2OYOA 3JSVC 2QSIA 2RGIA 5I2OA 1OIPA 2E74D 3FXEA 4M2QA 4RJTA 3AE7C 5AVWB 2LVVA 3K1EA 4XYNA 1FAVA 1IJ6A 1OSAA 4XA4A 4CFQA 2JNFA 2IYPA 1GK4A 5KU1A 1G4YR 2LVJA 3B71A 1NU1G 3MGNA 1PV3A 1YRTB 4PD4H 3B5NC 1DC1A 3D0YB 2Q9IA 2P6BB 4XFJA 2G9BA 2XKMA 1MFTA 3S0EA 1TN4A 1M7LA 4YRUA 3DVJA 2PGDA 1SQVG 1N2DA 2JKVA 1FJKA 1JEKA 2WMMA 5DKNA 1JM0A 1T2KC 5AANA 3R4YA 5JJGA 1UP5A 3BRVB 4OGQC 3S0BA 1L0NE 2WSEH 3H1JD 4QJ3B 1OW4A 2P67A 4ZNCA 1IH0A 1F70A 1SQBD 1B47A 2LP3A 1GM0A 5E79H 1E79H 3D70A 3TUYB 2JQ6A 2A4JA 1KYOI 3GLMA 2BCAA 1SQXD 3KEVA 3CCRP 5HKYA 2FOTA 3CDNA 3II6A 1SQXE 2QM8A 4MN0A 1A02F 3RGUA 4JYCA 4C0LA 1H0TB 4C46A 1VDFA 2V7QJ 4PV1C 1CFCA 2ZVNB 3L71J 1TTXA 3D6YA 4C7NA 3P7KA 1OQPA 2PVBA 1NTZE 2BEZF 1GL2C 2QA4P 4CPGA 1KN7A 1LT9C 2C9LY 2MHHA 3O4XA 3AEAC 3H32B 1A29A 5GTHH 2H88C 1Q80A 3L75G 4GAOA 1DIPA 4DUQA 1FC2C 2B87A 1NH4A 5KTBA 1MF8B 3JTDB 2JPOA 3K21A 4GBAA 3AECC 1C3YA 3GK1A 3UIAA 1KD1Q 2KNCB 2M7LA 1OMIA 1VQ8P 4IL6H 3VMZA 2MJWB 1GL2A 3N7HA 1BSNA 2LKMA 5BU8B 2OPOA 1J7QA 2M0RA 1SPYA 3GG2A 2G3AA 2QJPC 1USDA 1XFXO 4H13D 2WPSA 4I5KA 5KJ7D 3FWBA 5DKQA 2WSCJ 4FTGA 3EQ2A 2M8UA 3CX5E 3Q8IA 4Y99B 1D7MA 1JBAA 1S5LE 4N1GA 2JULA 2YMYA 2KAVA 1RFJA 2ZT9D 4ZKPA 3G9RA 1VQ9P 1G2CB 3RM1A 1JY2N 4EI2A 1EDIA 3L73G 3L72D 3M0AA 1T3UA 4D6TE 1FZAA 3EFGA 1VQLP 3HE5B 1DEKA 5AVUB 4XJKB 1X0TA 2HPSA 1DEBA 3L74E 5AW9B 1ZP0C 1JWDA 1BE3G 2ZFCA 1DJZA 3H1JJ 3H4SE 1QVFO 3V2PA 1M63B 1C7VA 2HPCA 1OZOA 2FXPA 2BCCD 2LM5A 5KLVG 4N78D 3SG5A 1DJGA 4FQTA 2FCEA 2KBIA 2Y0CA 1Q82Q 3I5CA 1XO5A 3V2RA 3H1LE 1KMIZ 2N9BA 3M0DC 3TNUA 4P2YB 4HSZA 5I94A 4H44B 3CL3D 4UB8H 3UO9A 2FFDB 2R5DA 3CWBD 4CFRA 3PRJA 1OVVA 1FOSF 3GW6A 3HE5A 3TDKA 3L4LA 2LMTA 3BFHA 2ZYGA 1Q7YQ 1FW4A 4YBHB 4TT3H 1RHZB 1K2HA 4GOEA 1SS1A 2FYUG 1YUUA 2XNXA 1K05A 3BCCJ 2ZT9B 2AXTE 1F4OA 2GGMA 3L74D 3NGVA 2W83C 2JWAA 1OFCX 1LWUB 1J7PA 1TUZA 1XFRA 3H1LG 2HR3A 1VQ7P 2H61A 1AVOA 1OMVA 5G08A 1F55A 2PALA 1YUTA 1FOSE 1KC8Q 2WCFA 4OZDA 4JKTA 1YUSA 5PALA 1RK9A 1BE3J 3CCLP 2E6WA 2P70A 1YX8A 2IS9A 1SQVD 1KB9D 1DF0A 4ZCVA 1UIXA 2C9NY 2Q3EA 1V1FA 3PALA 4ORCB 3CZ1A 2K2FA 3D78A 5CBOA 1ZRTE 4BRYB 1WLMA 3B5NB 3AEGC 1NTKJ 2WPVB 3Q2YA 3TGUE 1YQ3C 1BR4B 3L73E 3M9QA 3FE9A 2HODA 2ZJSE 1FPWA 1KB9H 2YXRB 3CCMP 1PSBA 1JUOA 3SS4A 3SIAA 4H44D 5CPVA 2I2RE 1T3JA 1RE4A 2PRUA 1SFCA 2I8DA 1TIZA 1B1GA 1DJXA 1R2UA 2IX7C 1NP8A 3TSIA 3B4SA 1M1JC 3L73D 1X9VA 3A4UB 3H1HJ 1XFUO 4BY4A 1NX3A 1RWYA 1P84D 3MIWA 1MUXA 4IJ7A 2LC5A 1TCFA 1DT7B 1ZRTD 2KP8A 3MSEB 1K9MQ 3KQGA 1JUNA 4XJKA 2JWDA 2CK3H 1DJIA 2IFNA 1EDLA 1SBJA 4MZKA 1TOPA 4WBAA 2L98A 1XFWO 4K3AA 2Q5UA 1D1OA 5KAIE 1ODBA 3PHLA 3M06A 1QWVA 2FYUJ 1KILA 1LTAC 4U3FE 1PGQA 4PJ0E 2E75D 1CKKA 4I7ZC 3JCUE 2A45I 1L2OC 3RL0D 1XFZO 4I5NB 2BCCJ 5APUA 3H32A 3GF7A 1AV1A 1H8BA 3BASA 4H0LD 4WRIA 2UWJE 4AUWA 1KFNA 1L0ND 1JF2A 1K90D 3NXSA 1G2CA 3V4WA 1HJBA 4OGQD 1T2KD 5AXIA 4GGFA 5K89A 1YJ9P 3O8ZA 1N0YA 3G3ZA 4PE4A 1OMRA 1JY3N 2E75C 1HF9A 5DJUB 1Y0VH 1SQPE 1QX2A 1NYHA 1FU1A 2W27A 1S1CX 2VRGA 2WSFH 3M0DA 3CI9A 5HYDA 1QX8A 1J1EA 1BE3E 3M9HA 3D76A 5AW4B 3H1LD 1NTKD 1BF5A 1WRLA 1K9PA 4D6TG 2BCCG 1MXLC 1P28A 4N78E 4L73A 3F45A 3A7OA 3MUDA 3LK0A 2K7OA 5CCGA 2ZYAA 2WCHA 3LLEA 2QVAA 3HX4A 1EDJA 1J1DA 2SPZA 1RE3A 3TF5A 3S0AA 4H44C 3EKJA 2NXQA 2CPBA 1PIXA 2WNDA 1J7OA 2WCBA 4CPVA 1QVGO 1MQ1A 2E76B 2C0WA 1OWAA 2ZT9C 3HTKB 2JXCA 1BGYD 3HCMA 5B8IB 2ZXEB 1NTMJ 3DF0A 3HD7B 5D3OA 2K7CA 1B7TY 1U7JA 2L91A 1A4PA 2NPSA 1JMBA 1FE6A 3DD4A 4INXA 2K8MB 3AEDC 1SY9A 5AVSB 4N6JA 1DH3A 1FI5A 1IC2A 1PGJA 2KYFA 2Q1KA 1RF1C 1RECA 4JD9A 2PMYA 1M45A 3CWGA 1GK6A 3B88A 4MVFA 3HRNA 1IGVA 3DY9A 4HRHA 3I5GB 3S0GA 1L2OB 1XK4A 3MTUE 3TDZA 1M56D 1IG5A 4O9BA 3PN7C 4NPDA 1KILB 4DZOA 2MLEC 4Y99C 1QV0A 2ZNDA 3E3RA 1EC5A 1OX3A 4ICBA 2Z5HA 3CC7P 2G8YA 1GL2D 3TDIA 1T14A 2AEMA 4PV1D 1JY2O 3SJSA 1UHIA 3HD7D 5HL1A 1K9UA 3CMEP 1IFDA 3VROA 1QIVA 1BE3D 4C0JA 1IWQA 1L0LD 2KIKA 2H2KA 3RBZA 1GTWA 2OYHA 2FYZA 1Z4HA 3OW2O 1SQPD 2YKPA 5KJ7A 1XVJA 1SVFA 1USEA 1E5WA 1KTMA 3CWBJ 4QMAA 1FDOA 3AE6C 1NGMB 1N73B 3PTZA 1OOHA 1K04A 5CCGD 1DD3A 1NIWA 3AE3C 3NSKA 4W7ZA 1LA3A 1YJNP 5HLVA 1RF0C 4MZJA 3OAKA 1S6CA 1VQ5P 3VP8A 2K2AA 3FX0A 3PM2A 3GOFA 2GUSA 1YTZT 3B5ND 3R72A 4HB1A 1Y6WA 1L0NK 4IFFA 3WU2H 2PQLA 2FYNB 1S3JA 3H1LJ 4I2LC 1VQNP 2A06E 1EG3A 1C07A 1W7IB 4IFDK 2BKIB 3BCCG 2QIWA 3BOWA 3ABVC 2VRSA 4H13C 2M5AA 2E43A 4MRYA 1P84I 5GTIH 5HLOA 3I5IB 2M3WA 3UNWA 1CDPA 1JC2A 1P84E 4LGDE 1PPJD 1GGZA 4PE7A 1RE4C 1SFCC 3FWNA 3NFQA 3RK2D 4EDFA 1S5GZ 1M1JA 5AEQA 1JMMA 1JTHA 2KNEA 1SLQA 1B8LA 2JR8A 4LC1A 1OOIX 1W2EA 2KFHA 1VL2A 3WHTB 1DEEG 3JVTC 3A0HH 3W67A 3F89A 1KYOE 4C0KA 1CDLA 1IIOA 2M29A 3D75A 3BFAA 3O6QA 3RK3C 5AVRB 1R8EA 4AQIA 2NCPA 1P84H 2M1KB 3A8RA 4ASVA 2RKLA 5AW1B 1HVVA 4ORBB 3PN7B 5CCGC 1MV8A 1NAFA 2JJLA 2I94A 1N8RQ 3BUNB 1JFJA 1EZVG 5EFWB 5KSZA 1VQMP 3M9BA 4GODA 2Y1NA 4N1FA 2Q91A 4HH2A 2CPSA 1OVUA 4PHKA 3IFMA 2YNYA 1JCDA 5J3XA 3B7AA 2KK7A 1NTME 4MBEA 2WPRA 3HD7C 4D1EA 3LW5J 3S0FA 2IZ0A 4M2OA 2QJKC 4ZMDA 3DZTA 4IL1A 1AVYA 3A5TA 2L0PA 1KK8B 2ZNEA 3CTNA 5CSJA 1SQXJ 2LLSA 3AE8C 3TZ1A 4GFTA 2P71A 1VF5D 1CM1A 3AEFC 3CWBE 2LUCA 3F5HA 2ZKMX 2KZJA 1BSHA 3PLNA 2DOQA 1WLZA 2F3YA 2KOTA 1KB9I 3VMAA 3CCSP 2SCPA 1ZV8A 1AHRA 1KWOC 3B87A 1NUBA 1W9ZA 2H61C 3ZWHA 3PJSK 1YI2P 4GGFC 4RESB 4OR9B 2OYHC 1NVOA 1SQBJ 2YMKA 2ITAA 1KFMA 2OTKE 3U1CA 1SK6D 1SMGA 3HUSB 1JSAA 1LTSC 1PVBA 2JWWA 3H1KG 1SP4A 3EKHA 1IO4A 3A2AA 1PP9J 1DVIA 2LNKA 1SCMC 1M90Q 2LANA 5TISE 2D2CC 4WY4C 1L0LG 3USSA 4LLHA 3I5HC 1DMOA 5AW3B 1QLED 3KPXA 2QEVA 1SRAA 3L71E 5C39A 2HQ8A 3L35A 2F2PA 2R5BA 1TNXA 1BCCE 2FCDA 3IQOA 4RKUJ 1XYDA 1LTTC 4IFMA 3TK1A 4ETOA 2Q6QA 2OYIC 2J59M 4GOFA 1UHHA 2B89A 4PHJA 3DXLA 3SFEC 2HG5D 1WRZA 1BGYJ 1G8IA 2JXLA 1S2EA 2W8ZA 1SCMB 3EK4A 4OWFA 2LHLA 3FXDA 1XK4C 3KO0A 2NRGA 1Y1UA 1NO4A 1W2BO 1BGYG 3AE2C 1IQ3A 1A75A 1VF5C 4U3FG 1GU5A 3M0WA 2JTZA 4MRXA 3OA7A 2KGBC 1U57A 1WMKA 1EZVD 1VPCA 1XFYO 5KLIC 1KQSO 2NPSD 3O78A 1YX7A 2XV5A 3CD6P 2KNCA 1YJWP 2WVRA 3V4QA 1QIWA 3GMAA 2IBZD 1BCCG 1YHQP 1SNLA 1HUCA 2WWWA 2FYNC 3H1IJ 3S4RA 4H0LC 1QS7A 3O2PA 1YVHA 3L37A 3OB1B 3HUSA 3L47A 1EH2A 1CNPA 3AEEC 2EHBA 3SWYA 1L0LE 1WDCB 5JOLA 1CLLA 1Y8AA 1B4CA 3DYEA 1N7SD 2K37A 3MP7B 4ZKUA 1QEXA 2CTNA 1SQBE 1TRFA 3L73J 1NX2A 4OCIA 1DGVA 1L4AB 2KYCA 1CM4A 4AQJA 1Z2CB 1R6PA 3DVEA 2F2OA 3O6BA 2Y0DA 1M39A 4A4CA 1EG4A 1RY3A 4HYTB 1CTRA 3IR9A 1OMDA 3AE4C 1EJ3A 4HRGA 1MFZA 4YTPC 2N1TA 1J1DC 2IBZI 2ISDA 1YRUB 2JZIA 1E8AA 3V5BA 3L4AA 3RK3B 2QPTA 1YTZC 3I55P 2D8NA 1OXZA 1K9KA 1VQ4P 2QEBA 1QL2A 2LHIA 4M2PA 2EGDA 1BG1A 2QJPB 3FGAD 1QLSA 3FE8A 2FYUE 3VMYA 1CMFA 1QVIZ 1PP9E 3B86A 4PD4E 2QJKB 1UUSA 3RK3E 2KFFA 1C3ZA 1RTP1 2L5GB 1U7MA 2OQQA 3L75E 3Q5SA 3LL8B 1K8AQ 2SASA 2Y9ZA 2NLNA 2MRDA 5I2QA 4YGBB 1U5IB 2M49B 1BU3A 3L70D 3CCEP 1URQB 2K9JB 5TJHA 1GQMA 3H1HD 1M57D 1SQQD 2K9YA 3L74J 4R1EA 5FI6A 2OS8B 4F7FA 1AQTA 2W90A 3Q1MA 3SG2A 2B9BA 5I2LA 2MKVA 1YURA 1LWUA 1MZ9A 4ASWA 3EFFK 1BMOA 2BE6A 1IFIA 2HFED 4BWNA 1DGUA 1CSBA 2LVIA 1GGWA 2O01J 1PSRA 1SQVJ 5ER4X 1KV4A 2KSJA 3CCJP 4TNCA 2H8PD 1NTKE 1EQ7A 1OW8A 1S3PA 4U7JA 2NCOA 1J1EC 3JVTB 3VTPC 3GK2A 2A45G 1C7WA 3LK1A 1IK9A 1BDCA 1T8ZA 1XTGB 2I1KA 1SYMA 1RROA 2IPPA 1LKJA 3OB2B 1GZLA 4WWIA 3H1IG 1KK7Z 4HJGH 1L7ZA 1AFOA 2QM7A 1TNQA 5CCHC 3TUYC 4AYCA 3TNUB 3H1IE 3AAKA 1G1IA 2BCXA 4YGAA 1Q86Q 4I5LB 2WT7A 3A3YB 4MN4C 2BKHB 2K9JA 1IFMA 5L8RJ 3KXDA 4YGCB 1FDIA 3BCCE 3L4FA 5TISH 1TU3F 3BUXB 4GT1A 3KHEA 3FIAA 3G71P 4QJ5B 4N5XA 4U3FJ 4I1LA 1F71A 1NU1D 2QG4A 2O60A 3CLNA 1EXJA 1M46A 3WMM0 5CBNA 1LGHB 2GM4A 3SG7A 3EWKA 1PGPA 1LTJA 2Y5IA 1KQVA 5CMZA 3BQ3A 3ZNIA 1DD4A 3WUTA 2WTYA 4DRWA 2K61A 3EK7A 2PRRA 1Q2NA 1S26D 1H4BA 1VQPP 1LJ2A 3LIEA 3SWFA 2RMZA 2POHA 2WZ7A 1IJDB 2K60A 3L70J 4KYNA 3PH0A 5DJTB 1SQXG 3PP5A 3A0HE 3IF7A 1L0LJ 4DJGA 1L0NJ 4AOMA 1YQ4C 4JYBA 1TUJA 2YIUC 2A45H 1PP9G 1QASA 3BCCD 3VRNA 3KZIH 1AJ4A 1CFDA 3TGUD 3L75J 2LUXA 1G1JA 3IVTA 1HQVA 2KI4B 1IZNB 1FBMA 2YO2A 1N86A 1OOJA 3LW5H 1JNMA 2QJYB 4OKHA 1LVCD 2WORA 1KWOB 3BFBA 2ZRTA 3FE6A 1KB9E 3O4YA 2KSPA 4OVNF 1LTBC 2M3BA 3CX5H 1KQMC 3CC2P 1F54A 3C1VA 4B86A 4NQGA 2KGRA 1YITP 4RO0A 5FI2A 2P58A 3R1PA 2C0XA 2CCMA 3WU2E 1UHJA 3MHVA 5APQA 2E75B 2Z5IA 1QJTA 3I5GC 4ZCUA 1NWQA 2W6AA 2N9YB 4EYYQ 2M9GA 1KYOH 2GA1A 1SQQK 3BUOB 4PE0A 5AVQB 1ZN5A 3ZDMA 1QGKB 3OGNA 3TS5B 3Q5RA 3IAOA 3LCPC 3HUSC 2O1JA 3B6XA 3D71A 2JT8A 1NAYA 5APTA 1NX0A 3SG6A 5B66H 2CBLA 1FZGA 2ZFDA 2QE7H 2V7QH 1A03A 1MHOA 1SQPJ 2O01H 1BJFA 1NU1J 3VRPA 5D7FA 4PDZA 2QJYC 2K0JA 2WSCH 4DOJA 1GW3A 1QTXA 2RN0A 2Q3IA 2HYNA 4PHMA 1OVRA 3SWKA 1CDMA 2MJZA 2F3ZA 3NMDA 1KILD 1UURA 4YI8A 2IBZG 2KLVA 1L0LK 3L75D 1NPQA 5FYXA 3BUMB 1KSOA 3PFVA 1Y9BA 1KK8C 1TNPA 2BCCE 3RL0B 1NTZK 1FBVA 1BGYE 1NTMK 2KAYA 1GDTA 3OX6A 4L76A 3OHMB 3NSIA 2EC6B 2LVKA 2OTGC 1LS8A 2OTLP 3AAJA 1QX5B 2KZIA 2KAXA 5GTHE 3WUVA 1NKZB 4BRYA 1FI6A 2BAPA 1SR6C 1JCCA 5AW5B 3L36A 5AVYB 1LP1B 5KLVE 1Y1XA 1N2DC 3CXHI 3D6ZA 1ZXGA 1QVIY 2JT3A 2OTGB 1AK8A 4IL6X 3VYIA 2LMUA 1S1EA 1XA5A 5EL2A 3KYQA 1SCVA 3P8CD 2KUBA 1ZMZA 1J7RA 3T97B 4WQ3A 5KTYA 5E79E 2KLDA 5CHXA 1N7SB 2E42A 1BLQA 2N1TD 2XNDH 1PL5A 4C7RA 3BXKA 2FJUB 2IBZE 2KLUA 1K96A 2KPHA 5AVTB 1DQEA 4CIDA 4YPCA 3RL0g 3KPEA 2QRXA 1SQPK 1HH0A 2W6BA 3BUWB 3WXAA 5H2FH 3GF3A 5APXA 3CWBG 1YYCA 2PAJA 1TCOB 1UIIA 3PLFB 4E68A 1KZUB 2L51A 4Q04A 4U3FD 2YIUB 1AQ5A 1JFKA 2WCLA 3JTDC 2MAZA 1PK0D 1SQVK 2Z4EA 1NTMG 1SL7A 2I18A 2FXMA 1URQA 1GL2B 2XDJA 1YVLA 1HGZA 1JB0J 5BPJA 1FDMA 1HJ0A 3I5FC 1NTZG 1YTZI 2WCJA 1UWOA 2HPCB 1K95A 1LINA 1ZLLA 2LLTA 4JF7A 2BL0B 1N73C 3P8MC 2M7NA 5KKZC 1B8CA 2L4HA 3CXHH 1RQVA 1Q90D 1URQC 5HKZA 3C1LA 1QLKA 1FZCA 1S6JA 2O3JA 3AE9C 2BECA 3I5FB 3NSLA 1LXFC 3CABA 3D73A 1DX7A 3R1OA 2PP6A 1NCYA 1SQQG 5M1BA 3TDUA 3FWCA 1S6IA 4YXWH 1G33A 4GKGA 5BVZA 1R5SA 2QACA 3H25A 1X02A 1URQD 5I8NA 5FI7A 5KJ7C 1TWOA 1VQ6P 4GNKB 4K35A 4GDOA 2H7HA 2LCPA 3CGAA 1ALWA 1SKTA 4KT0J 1LT9B 1KCYA 2WC8A 1VF5B 2FKWB 1GMJA 1RF1A 1NU1E 2OYIB 4DCKA 1ORGA 1B9AA 1J1DB 1SSEB 2LP2A 3HE4A 4PT1A 2WOSA 2O5GA 2W6JH 5APYA 3CCQP 2B87B 3EVUA 3MD0A 4WVZA 3N7NA 3CZTX 4I6MC 4UB8E 4L75A 1W7JB 4MLWA 3ICBA 1FZEA 2WSFJ 3KHUA 1IFJA 2LR2A 3H1ID 1CMGA 1S9KE 4H0LB 2M0BA 1KILC 3S1KA 1NJIQ 2WQYC 3JCUH 1NKNA 4PJ0H 2PSRA 2E5TA 3U1AA 4A4BA 3VN0A 1ZMEC 5KAFH 1GJYA 1A2XA 1AVSA 2M97A 5KAIH 1ZOYC 1BT6A 3CZ2A 1FS0E 4WY4B 1RF0A 3AE5C 4PCWA 2WSEJ 2ZAEB 1EXIA 2WC5A 1GW4A 5APVA 1B8RA 2Y4QA 3P32A 2WCKA 1K8UA 1IRJA 1EDKA 1IK7A 1K93D 4YGEB 2O01N 1A75B 2AXTH 4YGDB 1H8AA 1WRKA 1LNQA 4GGNA 2KI7B 4BXLA 1AUIB 1KYOD 1B7TZ 1F8HA 2P2UA 2L50A 3HE4B 1LTIC 2IFMA 4Z1MH 2KI4C 5AVVB 2ZXXA 2Y9YA 5CJ4A 5HKWA 5GTIE 1L2PA 1HBWA 1NTKG 1VQOP 2FY8A 2PASA 1W5CE 2P10A 3U59A 4P5OE 3L70E 1Q81Q 4D6TD 3BRTB 3BJHA 3CZ0A 2WT7B 2BNXA 2B88A 3TS5C 1CFPA 4NDCA 2QEHA 2CT9A 3BVHA 2CXJA 2QDIA 2JPTA 2DW3A 2EC6C 1CLMA 2ZVOB 2PYQA 2JDIH 2JTTA 4L74A 4W7YA 2GTEA 4I5JA 4MSPA 2E74C 2I1JA 1FF1A 1FZBA 1M1JB 1R5LA 4PD4D 1PP9D 5KKZB 1WRGA 3GHGA 4EIJA 2P1JA 1ZR2A 1PGOA 1X79B 3G4SP 2ZN8A 1OOFA 4MZLA 1S4XA 1VQKP 5CJ0A 1RJVA 1BR1B 2BEQD 3MZWB 1V1GA 3Q5PA 2KI6D 2AEFA 2Y0EA 2HODB 4JWQA 1KQLA 3WUUA 1IQ5A 4HREE 3SFDC 1JTHB 5CSFA 2JT0A 2KQ6A 4WB4A 4EOTA 1PPJE 3DVKA 4KHXA 5F6TA 3EG5B 1MUUA 3RK2B 3NHTA 1LT9A 1ALVA 2H89C 1NHLA 2V4HA 2JO1A 1NTZD 1IFPA 3VMXA 1DJYA 2H8VA 3CLQA 1OW6A 4OGQB 1AA0A 3SG4A 2LXBA 2K7BA 3QH9A 5KLVK 4HKZH 2KS1B 2BBNA 3CCVP 2K7DA 3S0DA 2K3RA 2HF5A 3L72J 3R1VA 4XE5B 1HWTC 4OH8B 1N73A 4BY5A 1MWNA 4U8DA 3TGUG 3BYAA 5D69A 2KXPB
chains in the Genus database with same CATH topology
1HQVA 3BOWA 2KI4B 1OQPA 2PVBA 1PRWA 4MEWA 1OOJA 2MHHA 3I5HB 4MRYA 4OKHA 1LVCD 1A29A 2WORA 5HLOA 1KWOB 2LAPA 1Q80A 2M1UA 2TN4A 3I5IB 2M3WA 2ZRTA 3O4YA 1CDPA 4NDBA 1JC2A 2KSPA 4OVNF 4GAOA 1KQMC 4DUQA 1GGZA 3WNXB 1MF8B 2KHNA 3JTDB 4PE7A 1EXRA 1F54A 3K21A 3C1VA 1YR5A 1S5GZ 4GBAA 4NQGA 5AEQA 3GK1A 5GQQC 3QRXA 4CLNA 2KNEA 5CSNA 1B8LA 2KGRA 2M7LA 2KFHA 3WHTB 3EVVA 2MJWB 2CCMA 1UHJA 1U5IA 3JVTC 2OPOA 1J7QA 1VRKA 1QJTA 3I5GC 2LMVA 1SPYA 2M0RA 4ZCUA 3CR4X 1XFXO 1SL8A 4UPGA 2M9GA 1ZFSA 4C0KA 1CDLA 3BUOB 2M29A 4PE0A 4I5KA 3FWBA 2JNXA 5DKQA 4FTGA 4AQIA 2M8UA 2NCPA 1CDNA 3TS5B 2M1KB 1JBAA 5AFPA 3A8RA 3LCPC 4N1GA 1XFVO 1UHNA 1NYAA 2CNPA 2JULA 4ORBB 3PN7B 2KAVA 1MR8A 1RFJA 2JT8A 1NX0A 3SG6A 2I94A 2CBLA 2ZFDA 3BUNB 3RM1A 1A03A 1JFJA 1MHOA 5KSZA 1NX1A 1BJFA 3VRPA 5D7FA 2NZ0A 2F8PA 1KK7Y 4PDZA 2K0JA 3OP0A 2Y1NA 4N1FA 1QTXA 5AERA 2Q4UA 2Q91A 4GUKA 4PHMA 4XJKB 2HPSA 1CDMA 1ZACA 2F3ZA 4PHKA 1JWDA 1DJZA 2L5XB 5J3XA 3H4SE 1UURA 3EK8A 4YI8A 2V53A 1M63B 3IQQA 4MBEA 1C7VA 3AKBA 2JOJA 4D1EA 1KFUS 1OZOA 1NPQA 5FYXA 3BUMB 1KSOA 2LM5A 4GPLB 3PFVA 1KK8C 1QXPA 1TNPA 2KFGA 3SG5A 1DJGA 1TNWA 4M2OA 2FCEA 2KBIA 4IL1A 1XO5A 2L0PA 1KK8B 1AJ5A 2LE9B 2ZNEA 3CTNA 2LLSA 2MLFC 5CSJA 1FBVA 1M31A 2KAYA 3TZ1A 3OX6A 4GFTA 1J55A 1SL9A 4P2YB 1CM1A 5DKRA 4HSZA 2LUCA 3OHMB 2ZKMX 2AAOA 3NSIA 2EC6B 2DOQA 1WLZA 1NSHA 1DJWA 2LVKA 2OTGC 2F3YA 2KOTA 3AAJA 1QX5B 2SCPA 3NXAA 1AHRA 1KWOC 1NUBA 2MBXA 4CFRA 2KAXA 2H61C 3ZWHA 2OS8C 4GGFC 1BOCA 1KFXS 1WY9A 4OR9B 1FI6A 3DVMA 2LMTA 1SR6C 1FW4A 1SW8A 1SK6D 3RLZA 1KSMA 1SMGA 4YBHB 1K2HA 3BOWB 4F0ZB 1PALA 1Y1XA 1JSAA 2MA2A 1YUUA 1PVBA 2JWWA 1QVIY 3EKHA 2JT3A 2WCEA 3OX5A 3PATA 2OTGB 1AK8A 1F4OA 1JF0A 2GGMA 1DVIA 1S1EA 2LMUA 1SCMC 2LNKA 1XA5A 2AMIA 2LANA 3SIBA 1J7PA 1S5GY 1OFCX 1SCVA 1QATA 1ZMZA 1J7RA 4WQ3A 2H61A 5KTYA 2L2EA 3I5HC 1OMVA 5G08A 1DMOA 1F55A 2PALA 2BL0C 1YUTA 2KDHA 2WCFA 1S36A 3KPXA 1YUSA 1BLQA 5PALA 1RK9A 2E6WA 1SRAA 1Y1AA 1YX8A 2HQWA 1ZOTB 2IS9A 1KFXL 1DF0A 2HQ8A 2F2PA 2FJUB 3BXKA 1TNXA 4ZCVA 2FCDA 3IQOA 1XYDA 1V1FA 1K96A 3FS7A 3PALA 4ORCB 3VRRA 4CIDA 4ETOA 1CLBA 2K2FA 1UHHA 4PHJA 1WRZA 1G8IA 2JXLA 1WLMA 2BBMA 3BUWB 4JPZB 1SCMB 3WXAA 2I7AA 3EK4A 1OE9B 2LHLA 1BR4B 1XK4C 3D0YA 3KO0A 1FPWA 1Y1UA 1PSBA 1JUOA 1TCOB 3SIAA 3PLFB 5CPVA 2I2RE 4E68A 1NWDA 1A75A 1IQ3A 2PRUA 2L51A 4Q04A 1TIZA 1B1GA 2JU0A 1DJXA 1R2UA 2Y1MA 1JFKA 3DF0B 1NP8A 3M0WA 3JTDC 2JTZA 3SG3A 2MAZA 4MRXA 1PK0D 2KGBC 4WQ2A 3GK4X 1XFYO 3A4UB 3O78A 4DIRA 1XFUO 4BY4A 1NX3A 1RWYA 1YX7A 1LA0A 1MUXA 1SL7A 2I18A 2E30A 2LC5A 1TCFA 1DTLA 1YVLA 1DT7B 3MSEB 5BPJA 3WHUB 3KF9A 4XJKA 1MXEA 1QIWA 3I5FC 1DJIA 1AP4A 1SNLA 1SBJA 3CR5X 4MZKA 1TOPA 2JRFA 4PE1A 1UWOA 1IJ5A 1K95A 1LINA 2L98A 1XFWO 1BODA 2LLTA 1QS7A 3O2PA 1D1OA 1ODBA 1YVHA 3OB1B 1QX7A 1EH2A 3NSOA 3PSRA 1CNPA 2BL0B 1KFUL 2M7NA 2EHBA 4YI9A 1CKKA 1CB1A 1WDCB 1B8CA 2L4HA 5JOLA 1L2OC 1CLLA 1B4CA 5HKZA 4USLA 1XFZO 4I5NB 1QLKA 2BCBA 3I5IC 2CTNA 1TRFA 1NX2A 4OCIA 1DGVA 1H8BA 1S6JA 4WRIA 1CFFA 2BECA 3I5FB 2KYCA 3NSLA 1LXFC 2GV5A 1JF2A 1CM4A 1K90D 1NCYA 5CSIA 4AQJA 3TDUA 1R6PA 3FWCA 1S6IA 3DVEA 1G33A 2F2OA 2QACA 5ER5A 3O6BA 1X02A 5AXIA 4GGFA 5I8NA 5K89A 1N0YA 1M39A 4GNKB 1EG4A 4A4CA 1CTRA 2ZRSA 4PE4A 1OMDA 1OMRA 2LCPA 3CGAA 1ALWA 1SKTA 1EJ3A 4HRGA 1KCYA 2WC8A 2G2BA 1Y0VH 1QX2A 2LV7A 2ISDA 1YRUB 2VRGA 2JZIA 1E8AA 1UHKA 4DCKA 2QPTA 1YTZC 2HETA 1B9AA 5HYDA 1J1EA 2LP2A 2D8NA 1K9KA 2WOSA 2O5GA 2LHIA 4M2PA 2EGDA 2R2IA 3CR2A 1BG1A 1BF5A 1WRLA 1QLSA 4OV2A 1SR6B 3EVUA 1K9PA 4NDDA 1MXLC 1K94A 2F33A 1CMFA 1OZSA 1QVIZ 3CZTX 1WDCC 3F45A 1UUSA 1DF0B 1W7JB 2KFFA 2K7OA 3ICBA 3LK0A 4JQ0D 4MLWA 4PHNA 1RTP1 3LLEA 1CMGA 1IKUA 3LL8B 3HX4A 1J1DA 2SASA 2Y9ZA 2PSRA 4QJ4B 5TNCA 2NLNA 4A4BA 1GJYA 1A2XA 1AVSA 1DJHA 3EVRA 2M97A 4FQOA 3EKJA 2NXQA 2MRDA 1BT6A 5I2QA 4YGBB 4PALA 1U5IB 2M49B 1BU3A 2WNDA 1J7OA 4PCWA 2WCBA 4CPVA 1MQ1A 1GQMA 2KQYA 1B8RA 4R1EA 2JXCA 2OS8B 2Y4QA 3SG2A 5I2LA 3VGOA 2GGZA 3HCMA 1K8UA 1YURA 1IRJA 5B8IB 3DF0A 1BMOA 1K93D 2BE6A 4YGEB 1DGUA 2K7CA 1B7TY 1A75B 1NCXA 2LVIA 1GGWA 1ZUZA 1A4PA 4YGDB 1PSRA 1WRKA 3DD4A 4GGNA 3VRQA 5ER4X 2K8MB 1SY9A 1AUIB 1B7TZ 1F8HA 3CS1A 4TNCA 1FI5A 2KYFA 1RECA 2L50A 1PULA 1S3PA 1QV1A 2AUCA 2PMYA 1M45A 3CWGA 2NCOA 2KI4C 2ZN9A 4MVFA 3JVTB 5IBWA 2Y9YA 1IGVA 1F4QA 3GK2A 4HRHA 1EL4A 5HKWA 3I5GB 1C7WA 1L2OB 1XK4A 3PM8A 2PASA 2BE4A 4P5OE 3TDZA 3LK1A 1IG5A 1HT9A 2COLB 2L4IA 2KI6C 3D10A 3PN7C 2B1UA 4L9MA 1SYMA 1RROA 3AKAA 1LKJA 3OB2B 2MLEC 3TS5C 4NDCA 1CFPA 1PVAA 2CT9A 2LLUA 1QV0A 2CXJA 1KK7Z 2ZNDA 3E3RA 1L7ZA 4ORAB 2KBMA 1TNQA 2JPTA 3TUYC 2EC6C 1CLMA 2JTTA 3AAKA 4ICBA 2BCXA 4I5JA 4YGAA 4MSPA 1KQMB 1NCZA 4I5LB 2JC2A 1FF1A 2BKHB 3TDIA 1N65A 4DS7A 2RGIA 5I2OA 3SJSA 1UHIA 4M2QA 4YGCB 1K9UA 2ZN8A 2LVVA 3BUXB 4MZLA 3VROA 1QIVA 3KHEA 3FIAA 4XYNA 4C0JA 1RJVA 4QJ5B 1IJ6A 1OSAA 4N5XA 1BR1B 1IWQA 4CFQA 2JNFA 5KU1A 1G4YR 1V1GA 2H2KA 2LVJA 2KI6D 1YRTB 1F71A 3D0YB 2P6BB 4JWQA 2O60A 3CLNA 2G9BA 1IQ5A 1M46A 4HREE 1XVJA 1TN4A 5CSFA 2JT0A 3SG7A 2KQ6A 4YRUA 3DVJA 3DVKA 5F6TA 2Y5IA 1N2DA 1KQVA 5DKNA 1NIWA 3BQ3A 5AANA 3ZNIA 3NSKA 1UP5A 5JJGA 4DRWA 1LA3A 2K61A 1ALVA 5HLVA 3EK7A 4MZJA 1S6CA 1S26D 1H4BA 4QJ3B 1DJYA 1IH0A 2K2AA 1F70A 3SG4A 1B47A 2LP3A 3GOFA 2K7BA 3TUYB 2JQ6A 2A4JA 2BCAA 2BBNA 3KEVA 2K7DA 2HF5A 1Y6WA 5HKYA 3IF7A 2FOTA 4AOMA 4MN0A 4BY5A 1MWNA 1EG3A 4U8DA 4C0LA 1C07A 1QASA 1W7IB 3VRNA 2BKIB 1AJ4A 1CFDA 3BYAA 2LUXA 1CFCA 5D69A 1TTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQV A;  3BOW A;  2KI4 B;  1OQP A;  2PVB A;  1PRW A;  4MEW A;  1OOJ A;  2MHH A;  3I5H B;  4MRY A;  4OKH A;  1LVC D;  1A29 A;  2WOR A;  5HLO A;  1KWO B;  2LAP A;  1Q80 A;  2M1U A;  2TN4 A;  3I5I B;  2M3W A;  2ZRT A;  3O4Y A;  1CDP A;  4NDB A;  1JC2 A;  2KSP A;  4OVN F;  4GAO A;  1KQM C;  4DUQ A;  1GGZ A;  3WNX B;  1MF8 B;  2KHN A;  3JTD B;  4PE7 A;  1EXR A;  1F54 A;  3K21 A;  3C1V A;  1YR5 A;  1S5G Z;  4GBA A;  4NQG A;  5AEQ A;  3GK1 A;  5GQQ C;  3QRX A;  4CLN A;  2KNE A;  5CSN A;  1B8L A;  2KGR A;  2M7L A;  2KFH A;  3WHT B;  3EVV A;  2MJW B;  2CCM A;  1UHJ A;  1U5I A;  3JVT C;  2OPO A;  1J7Q A;  1VRK A;  1QJT A;  3I5G C;  2LMV A;  1SPY A;  2M0R A;  4ZCU A;  3CR4 X;  1XFX O;  1SL8 A;  4UPG A;  2M9G A;  1ZFS A;  4C0K A;  1CDL A;  3BUO B;  2M29 A;  4PE0 A;  4I5K A;  3FWB A;  2JNX A;  5DKQ A;  4FTG A;  4AQI A;  2M8U A;  2NCP A;  1CDN A;  3TS5 B;  2M1K B;  1JBA A;  5AFP A;  3A8R A;  3LCP C;  4N1G A;  1XFV O;  1UHN A;  1NYA A;  2CNP A;  2JUL A;  4ORB B;  3PN7 B;  2KAV A;  1MR8 A;  1RFJ A;  2JT8 A;  1NX0 A;  3SG6 A;  2I94 A;  2CBL A;  2ZFD A;  3BUN B;  3RM1 A;  1A03 A;  1JFJ A;  1MHO A;  5KSZ A;  1NX1 A;  1BJF A;  3VRP A;  5D7F A;  2NZ0 A;  2F8P A;  1KK7 Y;  4PDZ A;  2K0J A;  3OP0 A;  2Y1N A;  4N1F A;  1QTX A;  5AER A;  2Q4U A;  2Q91 A;  4GUK A;  4PHM A;  4XJK B;  2HPS A;  1CDM A;  1ZAC A;  2F3Z A;  4PHK A;  1JWD A;  1DJZ A;  2L5X B;  5J3X A;  3H4S E;  1UUR A;  3EK8 A;  4YI8 A;  2V53 A;  1M63 B;  3IQQ A;  4MBE A;  1C7V A;  3AKB A;  2JOJ A;  4D1E A;  1KFU S;  1OZO A;  1NPQ A;  5FYX A;  3BUM B;  1KSO A;  2LM5 A;  4GPL B;  3PFV A;  1KK8 C;  1QXP A;  1TNP A;  2KFG A;  3SG5 A;  1DJG A;  1TNW A;  4M2O A;  2FCE A;  2KBI A;  4IL1 A;  1XO5 A;  2L0P A;  1KK8 B;  1AJ5 A;  2LE9 B;  2ZNE A;  3CTN A;  2LLS A;  2MLF C;  5CSJ A;  1FBV A;  1M31 A;  2KAY A;  3TZ1 A;  3OX6 A;  4GFT A;  1J55 A;  1SL9 A;  4P2Y B;  1CM1 A;  5DKR A;  4HSZ A;  2LUC A;  3OHM B;  2ZKM X;  2AAO A;  3NSI A;  2EC6 B;  2DOQ A;  1WLZ A;  1NSH A;  1DJW A;  2LVK A;  2OTG C;  2F3Y A;  2KOT A;  3AAJ A;  1QX5 B;  2SCP A;  3NXA A;  1AHR A;  1KWO C;  1NUB A;  2MBX A;  4CFR A;  2KAX A;  2H61 C;  3ZWH A;  2OS8 C;  4GGF C;  1BOC A;  1KFX S;  1WY9 A;  4OR9 B;  1FI6 A;  3DVM A;  2LMT A;  1SR6 C;  1FW4 A;  1SW8 A;  1SK6 D;  3RLZ A;  1KSM A;  1SMG A;  4YBH B;  1K2H A;  3BOW B;  4F0Z B;  1PAL A;  1Y1X A;  1JSA A;  2MA2 A;  1YUU A;  1PVB A;  2JWW A;  1QVI Y;  3EKH A;  2JT3 A;  2WCE A;  3OX5 A;  3PAT A;  2OTG B;  1AK8 A;  1F4O A;  1JF0 A;  2GGM A;  1DVI A;  1S1E A;  2LMU A;  1SCM C;  2LNK A;  1XA5 A;  2AMI A;  2LAN A;  3SIB A;  1J7P A;  1S5G Y;  1OFC X;  1SCV A;  1QAT A;  1ZMZ A;  1J7R A;  4WQ3 A;  2H61 A;  5KTY A;  2L2E A;  3I5H C;  1OMV A;  5G08 A;  1DMO A;  1F55 A;  2PAL A;  2BL0 C;  1YUT A;  2KDH A;  2WCF A;  1S36 A;  3KPX A;  1YUS A;  1BLQ A;  5PAL A;  1RK9 A;  2E6W A;  1SRA A;  1Y1A A;  1YX8 A;  2HQW A;  1ZOT B;  2IS9 A;  1KFX L;  1DF0 A;  2HQ8 A;  2F2P A;  2FJU B;  3BXK A;  1TNX A;  4ZCV A;  2FCD A;  3IQO A;  1XYD A;  1V1F A;  1K96 A;  3FS7 A;  3PAL A;  4ORC B;  3VRR A;  4CID A;  4ETO A;  1CLB A;  2K2F A;  1UHH A;  4PHJ A;  1WRZ A;  1G8I A;  2JXL A;  1WLM A;  2BBM A;  3BUW B;  4JPZ B;  1SCM B;  3WXA A;  2I7A A;  3EK4 A;  1OE9 B;  2LHL A;  1BR4 B;  1XK4 C;  3D0Y A;  3KO0 A;  1FPW A;  1Y1U A;  1PSB A;  1JUO A;  1TCO B;  3SIA A;  3PLF B;  5CPV A;  2I2R E;  4E68 A;  1NWD A;  1A75 A;  1IQ3 A;  2PRU A;  2L51 A;  4Q04 A;  1TIZ A;  1B1G A;  2JU0 A;  1DJX A;  1R2U A;  2Y1M A;  1JFK A;  3DF0 B;  1NP8 A;  3M0W A;  3JTD C;  2JTZ A;  3SG3 A;  2MAZ A;  4MRX A;  1PK0 D;  2KGB C;  4WQ2 A;  3GK4 X;  1XFY O;  3A4U B;  3O78 A;  4DIR A;  1XFU O;  4BY4 A;  1NX3 A;  1RWY A;  1YX7 A;  1LA0 A;  1MUX A;  1SL7 A;  2I18 A;  2E30 A;  2LC5 A;  1TCF A;  1DTL A;  1YVL A;  1DT7 B;  3MSE B;  5BPJ A;  3WHU B;  3KF9 A;  4XJK A;  1MXE A;  1QIW A;  3I5F C;  1DJI A;  1AP4 A;  1SNL A;  1SBJ A;  3CR5 X;  4MZK A;  1TOP A;  2JRF A;  4PE1 A;  1UWO A;  1IJ5 A;  1K95 A;  1LIN A;  2L98 A;  1XFW O;  1BOD A;  2LLT A;  1QS7 A;  3O2P A;  1D1O A;  1ODB A;  1YVH A;  3OB1 B;  1QX7 A;  1EH2 A;  3NSO A;  3PSR A;  1CNP A;  2BL0 B;  1KFU L;  2M7N A;  2EHB A;  4YI9 A;  1CKK A;  1CB1 A;  1WDC B;  1B8C A;  2L4H A;  5JOL A;  1L2O C;  1CLL A;  1B4C A;  5HKZ A;  4USL A;  1XFZ O;  4I5N B;  1QLK A;  2BCB A;  3I5I C;  2CTN A;  1TRF A;  1NX2 A;  4OCI A;  1DGV A;  1H8B A;  1S6J A;  4WRI A;  1CFF A;  2BEC A;  3I5F B;  2KYC A;  3NSL A;  1LXF C;  2GV5 A;  1JF2 A;  1CM4 A;  1K90 D;  1NCY A;  5CSI A;  4AQJ A;  3TDU A;  1R6P A;  3FWC A;  1S6I A;  3DVE A;  1G33 A;  2F2O A;  2QAC A;  5ER5 A;  3O6B A;  1X02 A;  5AXI A;  4GGF A;  5I8N A;  5K89 A;  1N0Y A;  1M39 A;  4GNK B;  1EG4 A;  4A4C A;  1CTR A;  2ZRS A;  4PE4 A;  1OMD A;  1OMR A;  2LCP A;  3CGA A;  1ALW A;  1SKT A;  1EJ3 A;  4HRG A;  1KCY A;  2WC8 A;  2G2B A;  1Y0V H;  1QX2 A;  2LV7 A;  2ISD A;  1YRU B;  2VRG A;  2JZI A;  1E8A A;  1UHK A;  4DCK A;  2QPT A;  1YTZ C;  2HET A;  1B9A A;  5HYD A;  1J1E A;  2LP2 A;  2D8N A;  1K9K A;  2WOS A;  2O5G A;  2LHI A;  4M2P A;  2EGD A;  2R2I A;  3CR2 A;  1BG1 A;  1BF5 A;  1WRL A;  1QLS A;  4OV2 A;  1SR6 B;  3EVU A;  1K9P A;  4NDD A;  1MXL C;  1K94 A;  2F33 A;  1CMF A;  1OZS A;  1QVI Z;  3CZT X;  1WDC C;  3F45 A;  1UUS A;  1DF0 B;  1W7J B;  2KFF A;  2K7O A;  3ICB A;  3LK0 A;  4JQ0 D;  4MLW A;  4PHN A;  1RTP 1;  3LLE A;  1CMG A;  1IKU A;  3LL8 B;  3HX4 A;  1J1D A;  2SAS A;  2Y9Z A;  2PSR A;  4QJ4 B;  5TNC A;  2NLN A;  4A4B A;  1GJY A;  1A2X A;  1AVS A;  1DJH A;  3EVR A;  2M97 A;  4FQO A;  3EKJ A;  2NXQ A;  2MRD A;  1BT6 A;  5I2Q A;  4YGB B;  4PAL A;  1U5I B;  2M49 B;  1BU3 A;  2WND A;  1J7O A;  4PCW A;  2WCB A;  4CPV A;  1MQ1 A;  1GQM A;  2KQY A;  1B8R A;  4R1E A;  2JXC A;  2OS8 B;  2Y4Q A;  3SG2 A;  5I2L A;  3VGO A;  2GGZ A;  3HCM A;  1K8U A;  1YUR A;  1IRJ A;  5B8I B;  3DF0 A;  1BMO A;  1K93 D;  2BE6 A;  4YGE B;  1DGU A;  2K7C A;  1B7T Y;  1A75 B;  1NCX A;  2LVI A;  1GGW A;  1ZUZ A;  1A4P A;  4YGD B;  1PSR A;  1WRK A;  3DD4 A;  4GGN A;  3VRQ A;  5ER4 X;  2K8M B;  1SY9 A;  1AUI B;  1B7T Z;  1F8H A;  3CS1 A;  4TNC A;  1FI5 A;  2KYF A;  1REC A;  2L50 A;  1PUL A;  1S3P A;  1QV1 A;  2AUC A;  2PMY A;  1M45 A;  3CWG A;  2NCO A;  2KI4 C;  2ZN9 A;  4MVF A;  3JVT B;  5IBW A;  2Y9Y A;  1IGV A;  1F4Q A;  3GK2 A;  4HRH A;  1EL4 A;  5HKW A;  3I5G B;  1C7W A;  1L2O B;  1XK4 A;  3PM8 A;  2PAS A;  2BE4 A;  4P5O E;  3TDZ A;  3LK1 A;  1IG5 A;  1HT9 A;  2COL B;  2L4I A;  2KI6 C;  3D10 A;  3PN7 C;  2B1U A;  4L9M A;  1SYM A;  1RRO A;  3AKA A;  1LKJ A;  3OB2 B;  2MLE C;  3TS5 C;  4NDC A;  1CFP A;  1PVA A;  2CT9 A;  2LLU A;  1QV0 A;  2CXJ A;  1KK7 Z;  2ZND A;  3E3R A;  1L7Z A;  4ORA B;  2KBM A;  1TNQ A;  2JPT A;  3TUY C;  2EC6 C;  1CLM A;  2JTT A;  3AAK A;  4ICB A;  2BCX A;  4I5J A;  4YGA A;  4MSP A;  1KQM B;  1NCZ A;  4I5L B;  2JC2 A;  1FF1 A;  2BKH B;  3TDI A;  1N65 A;  4DS7 A;  2RGI A;  5I2O A;  3SJS A;  1UHI A;  4M2Q A;  4YGC B;  1K9U A;  2ZN8 A;  2LVV A;  3BUX B;  4MZL A;  3VRO A;  1QIV A;  3KHE A;  3FIA A;  4XYN A;  4C0J A;  1RJV A;  4QJ5 B;  1IJ6 A;  1OSA A;  4N5X A;  1BR1 B;  1IWQ A;  4CFQ A;  2JNF A;  5KU1 A;  1G4Y R;  1V1G A;  2H2K A;  2LVJ A;  2KI6 D;  1YRT B;  1F71 A;  3D0Y B;  2P6B B;  4JWQ A;  2O60 A;  3CLN A;  2G9B A;  1IQ5 A;  1M46 A;  4HRE E;  1XVJ A;  1TN4 A;  5CSF A;  2JT0 A;  3SG7 A;  2KQ6 A;  4YRU A;  3DVJ A;  3DVK A;  5F6T A;  2Y5I A;  1N2D A;  1KQV A;  5DKN A;  1NIW A;  3BQ3 A;  5AAN A;  3ZNI A;  3NSK A;  1UP5 A;  5JJG A;  4DRW A;  1LA3 A;  2K61 A;  1ALV A;  5HLV A;  3EK7 A;  4MZJ A;  1S6C A;  1S26 D;  1H4B A;  4QJ3 B;  1DJY A;  1IH0 A;  2K2A A;  1F70 A;  3SG4 A;  1B47 A;  2LP3 A;  3GOF A;  2K7B A;  3TUY B;  2JQ6 A;  2A4J A;  2BCA A;  2BBN A;  3KEV A;  2K7D A;  2HF5 A;  1Y6W A;  5HKY A;  3IF7 A;  2FOT A;  4AOM A;  4MN0 A;  4BY5 A;  1MWN A;  1EG3 A;  4U8D A;  4C0L A;  1C07 A;  1QAS A;  1W7I B;  3VRN A;  2BKI B;  1AJ4 A;  1CFD A;  3BYA A;  2LUX A;  1CFC A;  5D69 A;  1TTX A; 
#chains in the Genus database with same CATH topology
 4W80 A;  3RBX A;  3H1J E;  1PRW A;  1FZC C;  4MEW A;  3A0B H;  1S5L X;  3I5H B;  5CCH D;  2FFD C;  2LAP A;  2TN4 A;  2M1U A;  4NDB A;  2E74 B;  2P7J A;  2KLE A;  3OBV A;  1N7S A;  1PPJ G;  1SQP G;  3WNX B;  4AQR D;  2KHN A;  1EXR A;  4N3Y B;  1YR5 A;  1WT6 A;  5GQQ C;  3QRX A;  4CLN A;  5CSN A;  2FYU K;  3P8C E;  5AW0 B;  4UB6 E;  2NPS B;  3EVV A;  1S5L H;  1U5I A;  1Y47 A;  1VRK A;  3ITK A;  3V2N A;  2LMV A;  2QEO A;  3CR4 X;  1YBK A;  1SL8 A;  1SQQ J;  4UPG A;  1ZFS A;  4WY4 A;  1OW7 A;  3HTK A;  2E76 C;  5AVX B;  2JNX A;  1OOG A;  1CDN A;  1DEL A;  5AFP A;  4IL6 E;  3T97 A;  1XFV O;  1SFC B;  1UHN A;  1NYA A;  2CNP A;  3SSU A;  1MR8 A;  1H89 A;  1SQQ E;  2WPQ A;  2OYH B;  1A02 J;  1NX1 A;  2YKO A;  5AW8 B;  2NZ0 A;  2F8P A;  1KK7 Y;  3H1K D;  2E5Y A;  3OP0 A;  2IDB A;  3AEB C;  5AER A;  1CZQ A;  2D2C D;  2Q4U A;  4GUK A;  1JY2 P;  2KB7 P;  2KSE A;  3TGU J;  5K5G B;  1KOR A;  1ZAC A;  3CX5 I;  2RH0 A;  2J58 A;  2N1T B;  2L5X B;  1NTZ J;  3EK8 A;  2V53 A;  3IQQ A;  3L71 G;  3AKB A;  2JOJ A;  1SFC D;  3RK2 C;  1KFU S;  3CXH D;  4GPL B;  1J1E B;  1OZH A;  4YXD C;  5KLV D;  3OJA B;  1QXP A;  2KFG A;  1TNW A;  3V2L A;  2AXC A;  2K1A A;  2YXQ B;  1AJY A;  1AJ5 A;  2LE9 B;  2MLF C;  3CPW O;  3K5B A;  1KIL E;  1M31 A;  1FZF A;  4GIF A;  4PV1 B;  1J55 A;  1SL9 A;  5DKR A;  2L2C A;  1L4A C;  2IYO A;  3G6E P;  3S9O A;  2AAO A;  1NSH A;  1DJW A;  3H1K E;  3CCU P;  5DIC A;  3NXA A;  1SQB G;  3D77 A;  2MBX A;  5AW7 B;  1PFI A;  1CW5 A;  2WC6 A;  2OS8 C;  1KQF B;  1BOC A;  1KFX S;  2AEJ A;  5APW A;  1WY9 A;  3DVM A;  1SW8 A;  3RLZ A;  2R3S A;  1KSM A;  4I7Z B;  2K88 A;  3BOW B;  4F0Z B;  1PAL A;  3I56 P;  1LT1 A;  2IZ1 A;  1H0T A;  2MA2 A;  2XZR A;  1NTM D;  1SQX K;  2WCE A;  3OX5 A;  3PAT A;  1JF0 A;  3SIB A;  2AMI A;  4DT0 A;  1S5G Y;  1CI6 A;  4R4L A;  1QAT A;  1SQB K;  1JOC A;  1N7L A;  2H43 A;  2L2E A;  1LWU C;  1MKM A;  2BL0 C;  3SS5 A;  4KJM A;  2KDH A;  1S36 A;  4IOI H;  2BAS A;  1Y1A A;  3NHI A;  2HQW A;  1ZOT B;  1KFX L;  4UB6 H;  5AVZ B;  3FS7 A;  3VRR A;  1CLB A;  2QEX P;  3H6P A;  1LTG C;  1K73 Q;  1M1K Q;  5BU5 A;  5B5E H;  2BBM A;  1KQG B;  4JPZ B;  2I7A A;  5B66 E;  4PD4 I;  1OE9 B;  3SS3 A;  1EZV E;  3D0Y A;  4C7N B;  4H13 B;  1RQU A;  3TYY A;  4M3L A;  3N4X A;  3B5N A;  1NWD A;  1L4A D;  3A0B E;  3CMA P;  2JU0 A;  2Y1M A;  3VOP A;  3DF0 B;  1X22 A;  3SG3 A;  2R3C A;  1JO5 A;  4WQ2 A;  3GK4 X;  1JY3 P;  2LXC B;  3M91 A;  4DIR A;  1JY3 O;  3FWL A;  1LA0 A;  3E1I A;  2E30 A;  2OYI A;  1RF1 B;  5KLV J;  1DTL A;  2HLO A;  3WHU B;  3L74 G;  3KF9 A;  1CI6 B;  3PJI A;  1MXE A;  1BCC D;  3H1J G;  1AP4 A;  1SQV E;  3QME A;  3CR5 X;  3L71 D;  4NPE A;  2JRF A;  4PE1 A;  3IF4 A;  1IJ5 A;  1BOD A;  4NPF X;  5AW2 B;  2R44 A;  3MUD C;  3H1K J;  2A06 D;  1QX7 A;  3NSO A;  4D6T J;  3PSR A;  4WY4 D;  1BDD A;  1KFU L;  4YI9 A;  1CB1 A;  1FZC B;  5KLI B;  1PZQ A;  2JEE A;  2FJY A;  3O6Q B;  4USL A;  2OTJ P;  3I5I C;  2BCB A;  3KZI E;  1CFF A;  1NTK K;  2M3E A;  2O1K A;  2GV5 A;  3E7K A;  1IFN A;  2R32 A;  5CSI A;  3E1R A;  2FFD A;  3HD7 A;  3B8E B;  4INW A;  2PFX A;  2L5Y A;  5ER5 A;  1N7S C;  5AW6 B;  2FBW C;  2E76 D;  3QWO C;  2ERB A;  3CYZ A;  4R4M A;  2ZRS A;  2J5U A;  2YGU A;  4A7P A;  2GUV A;  2G2B A;  5KAF E;  2LV7 A;  3LID A;  1UHK A;  1ZW0 A;  1M8O B;  2YKQ A;  3KDP B;  1LTJ B;  2HET A;  1HTL C;  3AE1 C;  2R2I A;  3CR2 A;  2Q7C A;  4OV2 A;  1SR6 B;  2WIT A;  1NU1 K;  4NDD A;  1K94 A;  2F33 A;  1OZS A;  1EZV I;  1WDC C;  1J2J B;  2FXO A;  2NPS C;  1DF0 B;  4PHN A;  2WSS H;  4JQ0 D;  5B5E E;  4Y28 J;  3VB1 A;  1IKU A;  2KYV A;  1H88 A;  4QJ4 B;  3W68 A;  5TNC A;  1T6A A;  2OGU A;  2N1T C;  3JC2 2;  4FQO A;  1DJH A;  3EVR A;  3H1H E;  4PAL A;  3L70 G;  2OAR A;  2JP3 A;  3GHG B;  2YO3 A;  1HGV A;  3RL0 C;  3H1H G;  3C9I A;  3VP9 A;  1L0N G;  2KQY A;  3CC4 P;  3R2P A;  1GU4 A;  3VGO A;  2GGZ A;  3RZS A;  3V6I A;  2D2C B;  1S9K D;  1RH5 B;  1XTC C;  5CCH A;  1X8Y A;  1NCX A;  3RK3 D;  1ZUZ A;  2WCM A;  3D74 A;  1NOH A;  2M8R A;  3VRQ A;  5H2F E;  1RE3 C;  1LTJ C;  3CS1 A;  3CXH E;  4TLF A;  2M5A B;  1QL1 A;  1L4A A;  1PUL A;  1QV1 A;  2AUC A;  1Z56 A;  1LP1 A;  3GHG C;  2ZN9 A;  5IBW A;  1FJP A;  1F4Q A;  1EL4 A;  3Q3D A;  2KOG A;  2NZ2 A;  3NTN A;  3PM8 A;  2BE4 A;  3IN6 A;  1HT9 A;  2COL B;  2L4I A;  2KI6 C;  3D10 A;  3BAT A;  3L72 E;  2B1U A;  1S72 P;  4L9M A;  3C8V A;  3AKA A;  2A06 G;  1ZR4 A;  1PVA A;  2LLU A;  2XU6 A;  1GD2 E;  4ORA B;  2KBM A;  4JBZ A;  1YIJ P;  2ZYD A;  1BCC J;  5APS A;  1KQM B;  1NCZ A;  3CX5 D;  2JC2 A;  3L72 G;  2KS1 A;  2FYU D;  3V2Q A;  1N65 A;  4DS7 A;  2OYO A;  3JSV C;  2QSI A;  2RGI A;  5I2O A;  1OIP A;  2E74 D;  3FXE A;  4M2Q A;  4RJT A;  3AE7 C;  5AVW B;  2LVV A;  3K1E A;  4XYN A;  1FAV A;  1IJ6 A;  1OSA A;  4XA4 A;  4CFQ A;  2JNF A;  2IYP A;  1GK4 A;  5KU1 A;  1G4Y R;  2LVJ A;  3B71 A;  1NU1 G;  3MGN A;  1PV3 A;  1YRT B;  4PD4 H;  3B5N C;  1DC1 A;  3D0Y B;  2Q9I A;  2P6B B;  4XFJ A;  2G9B A;  2XKM A;  1MFT A;  3S0E A;  1TN4 A;  1M7L A;  4YRU A;  3DVJ A;  2PGD A;  1SQV G;  1N2D A;  2JKV A;  1FJK A;  1JEK A;  2WMM A;  5DKN A;  1JM0 A;  1T2K C;  5AAN A;  3R4Y A;  5JJG A;  1UP5 A;  3BRV B;  4OGQ C;  3S0B A;  1L0N E;  2WSE H;  3H1J D;  4QJ3 B;  1OW4 A;  2P67 A;  4ZNC A;  1IH0 A;  1F70 A;  1SQB D;  1B47 A;  2LP3 A;  1GM0 A;  5E79 H;  1E79 H;  3D70 A;  3TUY B;  2JQ6 A;  2A4J A;  1KYO I;  3GLM A;  2BCA A;  1SQX D;  3KEV A;  3CCR P;  5HKY A;  2FOT A;  3CDN A;  3II6 A;  1SQX E;  2QM8 A;  4MN0 A;  1A02 F;  3RGU A;  4JYC A;  4C0L A;  1H0T B;  4C46 A;  1VDF A;  2V7Q J;  4PV1 C;  1CFC A;  2ZVN B;  3L71 J;  1TTX A;  3D6Y A;  4C7N A;  3P7K A;  1OQP A;  2PVB A;  1NTZ E;  2BEZ F;  1GL2 C;  2QA4 P;  4CPG A;  1KN7 A;  1LT9 C;  2C9L Y;  2MHH A;  3O4X A;  3AEA C;  3H32 B;  1A29 A;  5GTH H;  2H88 C;  1Q80 A;  3L75 G;  4GAO A;  1DIP A;  4DUQ A;  1FC2 C;  2B87 A;  1NH4 A;  5KTB A;  1MF8 B;  3JTD B;  2JPO A;  3K21 A;  4GBA A;  3AEC C;  1C3Y A;  3GK1 A;  3UIA A;  1KD1 Q;  2KNC B;  2M7L A;  1OMI A;  1VQ8 P;  4IL6 H;  3VMZ A;  2MJW B;  1GL2 A;  3N7H A;  1BSN A;  2LKM A;  5BU8 B;  2OPO A;  1J7Q A;  2M0R A;  1SPY A;  3GG2 A;  2G3A A;  2QJP C;  1USD A;  1XFX O;  4H13 D;  2WPS A;  4I5K A;  5KJ7 D;  3FWB A;  5DKQ A;  2WSC J;  4FTG A;  3EQ2 A;  2M8U A;  3CX5 E;  3Q8I A;  4Y99 B;  1D7M A;  1JBA A;  1S5L E;  4N1G A;  2JUL A;  2YMY A;  2KAV A;  1RFJ A;  2ZT9 D;  4ZKP A;  3G9R A;  1VQ9 P;  1G2C B;  3RM1 A;  1JY2 N;  4EI2 A;  1EDI A;  3L73 G;  3L72 D;  3M0A A;  1T3U A;  4D6T E;  1FZA A;  3EFG A;  1VQL P;  3HE5 B;  1DEK A;  5AVU B;  4XJK B;  1X0T A;  2HPS A;  1DEB A;  3L74 E;  5AW9 B;  1ZP0 C;  1JWD A;  1BE3 G;  2ZFC A;  1DJZ A;  3H1J J;  3H4S E;  1QVF O;  3V2P A;  1M63 B;  1C7V A;  2HPC A;  1OZO A;  2FXP A;  2BCC D;  2LM5 A;  5KLV G;  4N78 D;  3SG5 A;  1DJG A;  4FQT A;  2FCE A;  2KBI A;  2Y0C A;  1Q82 Q;  3I5C A;  1XO5 A;  3V2R A;  3H1L E;  1KMI Z;  2N9B A;  3M0D C;  3TNU A;  4P2Y B;  4HSZ A;  5I94 A;  4H44 B;  3CL3 D;  4UB8 H;  3UO9 A;  2FFD B;  2R5D A;  3CWB D;  4CFR A;  3PRJ A;  1OVV A;  1FOS F;  3GW6 A;  3HE5 A;  3TDK A;  3L4L A;  2LMT A;  3BFH A;  2ZYG A;  1Q7Y Q;  1FW4 A;  4YBH B;  4TT3 H;  1RHZ B;  1K2H A;  4GOE A;  1SS1 A;  2FYU G;  1YUU A;  2XNX A;  1K05 A;  3BCC J;  2ZT9 B;  2AXT E;  1F4O A;  2GGM A;  3L74 D;  3NGV A;  2W83 C;  2JWA A;  1OFC X;  1LWU B;  1J7P A;  1TUZ A;  1XFR A;  3H1L G;  2HR3 A;  1VQ7 P;  2H61 A;  1AVO A;  1OMV A;  5G08 A;  1F55 A;  2PAL A;  1YUT A;  1FOS E;  1KC8 Q;  2WCF A;  4OZD A;  4JKT A;  1YUS A;  5PAL A;  1RK9 A;  1BE3 J;  3CCL P;  2E6W A;  2P70 A;  1YX8 A;  2IS9 A;  1SQV D;  1KB9 D;  1DF0 A;  4ZCV A;  1UIX A;  2C9N Y;  2Q3E A;  1V1F A;  3PAL A;  4ORC B;  3CZ1 A;  2K2F A;  3D78 A;  5CBO A;  1ZRT E;  4BRY B;  1WLM A;  3B5N B;  3AEG C;  1NTK J;  2WPV B;  3Q2Y A;  3TGU E;  1YQ3 C;  1BR4 B;  3L73 E;  3M9Q A;  3FE9 A;  2HOD A;  2ZJS E;  1FPW A;  1KB9 H;  2YXR B;  3CCM P;  1PSB A;  1JUO A;  3SS4 A;  3SIA A;  4H44 D;  5CPV A;  2I2R E;  1T3J A;  1RE4 A;  2PRU A;  1SFC A;  2I8D A;  1TIZ A;  1B1G A;  1DJX A;  1R2U A;  2IX7 C;  1NP8 A;  3TSI A;  3B4S A;  1M1J C;  3L73 D;  1X9V A;  3A4U B;  3H1H J;  1XFU O;  4BY4 A;  1NX3 A;  1RWY A;  1P84 D;  3MIW A;  1MUX A;  4IJ7 A;  2LC5 A;  1TCF A;  1DT7 B;  1ZRT D;  2KP8 A;  3MSE B;  1K9M Q;  3KQG A;  1JUN A;  4XJK A;  2JWD A;  2CK3 H;  1DJI A;  2IFN A;  1EDL A;  1SBJ A;  4MZK A;  1TOP A;  4WBA A;  2L98 A;  1XFW O;  4K3A A;  2Q5U A;  1D1O A;  5KAI E;  1ODB A;  3PHL A;  3M06 A;  1QWV A;  2FYU J;  1KIL A;  1LTA C;  4U3F E;  1PGQ A;  4PJ0 E;  2E75 D;  1CKK A;  4I7Z C;  3JCU E;  2A45 I;  1L2O C;  3RL0 D;  1XFZ O;  4I5N B;  2BCC J;  5APU A;  3H32 A;  3GF7 A;  1AV1 A;  1H8B A;  3BAS A;  4H0L D;  4WRI A;  2UWJ E;  4AUW A;  1KFN A;  1L0N D;  1JF2 A;  1K90 D;  3NXS A;  1G2C A;  3V4W A;  1HJB A;  4OGQ D;  1T2K D;  5AXI A;  4GGF A;  5K89 A;  1YJ9 P;  3O8Z A;  1N0Y A;  3G3Z A;  4PE4 A;  1OMR A;  1JY3 N;  2E75 C;  1HF9 A;  5DJU B;  1Y0V H;  1SQP E;  1QX2 A;  1NYH A;  1FU1 A;  2W27 A;  1S1C X;  2VRG A;  2WSF H;  3M0D A;  3CI9 A;  5HYD A;  1QX8 A;  1J1E A;  1BE3 E;  3M9H A;  3D76 A;  5AW4 B;  3H1L D;  1NTK D;  1BF5 A;  1WRL A;  1K9P A;  4D6T G;  2BCC G;  1MXL C;  1P28 A;  4N78 E;  4L73 A;  3F45 A;  3A7O A;  3MUD A;  3LK0 A;  2K7O A;  5CCG A;  2ZYA A;  2WCH A;  3LLE A;  2QVA A;  3HX4 A;  1EDJ A;  1J1D A;  2SPZ A;  1RE3 A;  3TF5 A;  3S0A A;  4H44 C;  3EKJ A;  2NXQ A;  2CPB A;  1PIX A;  2WND A;  1J7O A;  2WCB A;  4CPV A;  1QVG O;  1MQ1 A;  2E76 B;  2C0W A;  1OWA A;  2ZT9 C;  3HTK B;  2JXC A;  1BGY D;  3HCM A;  5B8I B;  2ZXE B;  1NTM J;  3DF0 A;  3HD7 B;  5D3O A;  2K7C A;  1B7T Y;  1U7J A;  2L91 A;  1A4P A;  2NPS A;  1JMB A;  1FE6 A;  3DD4 A;  4INX A;  2K8M B;  3AED C;  1SY9 A;  5AVS B;  4N6J A;  1DH3 A;  1FI5 A;  1IC2 A;  1PGJ A;  2KYF A;  2Q1K A;  1RF1 C;  1REC A;  4JD9 A;  2PMY A;  1M45 A;  3CWG A;  1GK6 A;  3B88 A;  4MVF A;  3HRN A;  1IGV A;  3DY9 A;  4HRH A;  3I5G B;  3S0G A;  1L2O B;  1XK4 A;  3MTU E;  3TDZ A;  1M56 D;  1IG5 A;  4O9B A;  3PN7 C;  4NPD A;  1KIL B;  4DZO A;  2MLE C;  4Y99 C;  1QV0 A;  2ZND A;  3E3R A;  1EC5 A;  1OX3 A;  4ICB A;  2Z5H A;  3CC7 P;  2G8Y A;  1GL2 D;  3TDI A;  1T14 A;  2AEM A;  4PV1 D;  1JY2 O;  3SJS A;  1UHI A;  3HD7 D;  5HL1 A;  1K9U A;  3CME P;  1IFD A;  3VRO A;  1QIV A;  1BE3 D;  4C0J A;  1IWQ A;  1L0L D;  2KIK A;  2H2K A;  3RBZ A;  1GTW A;  2OYH A;  2FYZ A;  1Z4H A;  3OW2 O;  1SQP D;  2YKP A;  5KJ7 A;  1XVJ A;  1SVF A;  1USE A;  1E5W A;  1KTM A;  3CWB J;  4QMA A;  1FDO A;  3AE6 C;  1NGM B;  1N73 B;  3PTZ A;  1OOH A;  1K04 A;  5CCG D;  1DD3 A;  1NIW A;  3AE3 C;  3NSK A;  4W7Z A;  1LA3 A;  1YJN P;  5HLV A;  1RF0 C;  4MZJ A;  3OAK A;  1S6C A;  1VQ5 P;  3VP8 A;  2K2A A;  3FX0 A;  3PM2 A;  3GOF A;  2GUS A;  1YTZ T;  3B5N D;  3R72 A;  4HB1 A;  1Y6W A;  1L0N K;  4IFF A;  3WU2 H;  2PQL A;  2FYN B;  1S3J A;  3H1L J;  4I2L C;  1VQN P;  2A06 E;  1EG3 A;  1C07 A;  1W7I B;  4IFD K;  2BKI B;  3BCC G;  2QIW A;  3BOW A;  3ABV C;  2VRS A;  4H13 C;  2M5A A;  2E43 A;  4MRY A;  1P84 I;  5GTI H;  5HLO A;  3I5I B;  2M3W A;  3UNW A;  1CDP A;  1JC2 A;  1P84 E;  4LGD E;  1PPJ D;  1GGZ A;  4PE7 A;  1RE4 C;  1SFC C;  3FWN A;  3NFQ A;  3RK2 D;  4EDF A;  1S5G Z;  1M1J A;  5AEQ A;  1JMM A;  1JTH A;  2KNE A;  1SLQ A;  1B8L A;  2JR8 A;  4LC1 A;  1OOI X;  1W2E A;  2KFH A;  1VL2 A;  3WHT B;  1DEE G;  3JVT C;  3A0H H;  3W67 A;  3F89 A;  1KYO E;  4C0K A;  1CDL A;  1IIO A;  2M29 A;  3D75 A;  3BFA A;  3O6Q A;  3RK3 C;  5AVR B;  1R8E A;  4AQI A;  2NCP A;  1P84 H;  2M1K B;  3A8R A;  4ASV A;  2RKL A;  5AW1 B;  1HVV A;  4ORB B;  3PN7 B;  5CCG C;  1MV8 A;  1NAF A;  2JJL A;  2I94 A;  1N8R Q;  3BUN B;  1JFJ A;  1EZV G;  5EFW B;  5KSZ A;  1VQM P;  3M9B A;  4GOD A;  2Y1N A;  4N1F A;  2Q91 A;  4HH2 A;  2CPS A;  1OVU A;  4PHK A;  3IFM A;  2YNY A;  1JCD A;  5J3X A;  3B7A A;  2KK7 A;  1NTM E;  4MBE A;  2WPR A;  3HD7 C;  4D1E A;  3LW5 J;  3S0F A;  2IZ0 A;  4M2O A;  2QJK C;  4ZMD A;  3DZT A;  4IL1 A;  1AVY A;  3A5T A;  2L0P A;  1KK8 B;  2ZNE A;  3CTN A;  5CSJ A;  1SQX J;  2LLS A;  3AE8 C;  3TZ1 A;  4GFT A;  2P71 A;  1VF5 D;  1CM1 A;  3AEF C;  3CWB E;  2LUC A;  3F5H A;  2ZKM X;  2KZJ A;  1BSH A;  3PLN A;  2DOQ A;  1WLZ A;  2F3Y A;  2KOT A;  1KB9 I;  3VMA A;  3CCS P;  2SCP A;  1ZV8 A;  1AHR A;  1KWO C;  3B87 A;  1NUB A;  1W9Z A;  2H61 C;  3ZWH A;  3PJS K;  1YI2 P;  4GGF C;  4RES B;  4OR9 B;  2OYH C;  1NVO A;  1SQB J;  2YMK A;  2ITA A;  1KFM A;  2OTK E;  3U1C A;  1SK6 D;  1SMG A;  3HUS B;  1JSA A;  1LTS C;  1PVB A;  2JWW A;  3H1K G;  1SP4 A;  3EKH A;  1IO4 A;  3A2A A;  1PP9 J;  1DVI A;  2LNK A;  1SCM C;  1M90 Q;  2LAN A;  5TIS E;  2D2C C;  4WY4 C;  1L0L G;  3USS A;  4LLH A;  3I5H C;  1DMO A;  5AW3 B;  1QLE D;  3KPX A;  2QEV A;  1SRA A;  3L71 E;  5C39 A;  2HQ8 A;  3L35 A;  2F2P A;  2R5B A;  1TNX A;  1BCC E;  2FCD A;  3IQO A;  4RKU J;  1XYD A;  1LTT C;  4IFM A;  3TK1 A;  4ETO A;  2Q6Q A;  2OYI C;  2J59 M;  4GOF A;  1UHH A;  2B89 A;  4PHJ A;  3DXL A;  3SFE C;  2HG5 D;  1WRZ A;  1BGY J;  1G8I A;  2JXL A;  1S2E A;  2W8Z A;  1SCM B;  3EK4 A;  4OWF A;  2LHL A;  3FXD A;  1XK4 C;  3KO0 A;  2NRG A;  1Y1U A;  1NO4 A;  1W2B O;  1BGY G;  3AE2 C;  1IQ3 A;  1A75 A;  1VF5 C;  4U3F G;  1GU5 A;  3M0W A;  2JTZ A;  4MRX A;  3OA7 A;  2KGB C;  1U57 A;  1WMK A;  1EZV D;  1VPC A;  1XFY O;  5KLI C;  1KQS O;  2NPS D;  3O78 A;  1YX7 A;  2XV5 A;  3CD6 P;  2KNC A;  1YJW P;  2WVR A;  3V4Q A;  1QIW A;  3GMA A;  2IBZ D;  1BCC G;  1YHQ P;  1SNL A;  1HUC A;  2WWW A;  2FYN C;  3H1I J;  3S4R A;  4H0L C;  1QS7 A;  3O2P A;  1YVH A;  3L37 A;  3OB1 B;  3HUS A;  3L47 A;  1EH2 A;  1CNP A;  3AEE C;  2EHB A;  3SWY A;  1L0L E;  1WDC B;  5JOL A;  1CLL A;  1Y8A A;  1B4C A;  3DYE A;  1N7S D;  2K37 A;  3MP7 B;  4ZKU A;  1QEX A;  2CTN A;  1SQB E;  1TRF A;  3L73 J;  1NX2 A;  4OCI A;  1DGV A;  1L4A B;  2KYC A;  1CM4 A;  4AQJ A;  1Z2C B;  1R6P A;  3DVE A;  2F2O A;  3O6B A;  2Y0D A;  1M39 A;  4A4C A;  1EG4 A;  1RY3 A;  4HYT B;  1CTR A;  3IR9 A;  1OMD A;  3AE4 C;  1EJ3 A;  4HRG A;  1MFZ A;  4YTP C;  2N1T A;  1J1D C;  2IBZ I;  2ISD A;  1YRU B;  2JZI A;  1E8A A;  3V5B A;  3L4A A;  3RK3 B;  2QPT A;  1YTZ C;  3I55 P;  2D8N A;  1OXZ A;  1K9K A;  1VQ4 P;  2QEB A;  1QL2 A;  2LHI A;  4M2P A;  2EGD A;  1BG1 A;  2QJP B;  3FGA D;  1QLS A;  3FE8 A;  2FYU E;  3VMY A;  1CMF A;  1QVI Z;  1PP9 E;  3B86 A;  4PD4 E;  2QJK B;  1UUS A;  3RK3 E;  2KFF A;  1C3Z A;  1RTP 1;  2L5G B;  1U7M A;  2OQQ A;  3L75 E;  3Q5S A;  3LL8 B;  1K8A Q;  2SAS A;  2Y9Z A;  2NLN A;  2MRD A;  5I2Q A;  4YGB B;  1U5I B;  2M49 B;  1BU3 A;  3L70 D;  3CCE P;  1URQ B;  2K9J B;  5TJH A;  1GQM A;  3H1H D;  1M57 D;  1SQQ D;  2K9Y A;  3L74 J;  4R1E A;  5FI6 A;  2OS8 B;  4F7F A;  1AQT A;  2W90 A;  3Q1M A;  3SG2 A;  2B9B A;  5I2L A;  2MKV A;  1YUR A;  1LWU A;  1MZ9 A;  4ASW A;  3EFF K;  1BMO A;  2BE6 A;  1IFI A;  2HFE D;  4BWN A;  1DGU A;  1CSB A;  2LVI A;  1GGW A;  2O01 J;  1PSR A;  1SQV J;  5ER4 X;  1KV4 A;  2KSJ A;  3CCJ P;  4TNC A;  2H8P D;  1NTK E;  1EQ7 A;  1OW8 A;  1S3P A;  4U7J A;  2NCO A;  1J1E C;  3JVT B;  3VTP C;  3GK2 A;  2A45 G;  1C7W A;  3LK1 A;  1IK9 A;  1BDC A;  1T8Z A;  1XTG B;  2I1K A;  1SYM A;  1RRO A;  2IPP A;  1LKJ A;  3OB2 B;  1GZL A;  4WWI A;  3H1I G;  1KK7 Z;  4HJG H;  1L7Z A;  1AFO A;  2QM7 A;  1TNQ A;  5CCH C;  3TUY C;  4AYC A;  3TNU B;  3H1I E;  3AAK A;  1G1I A;  2BCX A;  4YGA A;  1Q86 Q;  4I5L B;  2WT7 A;  3A3Y B;  4MN4 C;  2BKH B;  2K9J A;  1IFM A;  5L8R J;  3KXD A;  4YGC B;  1FDI A;  3BCC E;  3L4F A;  5TIS H;  1TU3 F;  3BUX B;  4GT1 A;  3KHE A;  3FIA A;  3G71 P;  4QJ5 B;  4N5X A;  4U3F J;  4I1L A;  1F71 A;  1NU1 D;  2QG4 A;  2O60 A;  3CLN A;  1EXJ A;  1M46 A;  3WMM 0;  5CBN A;  1LGH B;  2GM4 A;  3SG7 A;  3EWK A;  1PGP A;  1LTJ A;  2Y5I A;  1KQV A;  5CMZ A;  3BQ3 A;  3ZNI A;  1DD4 A;  3WUT A;  2WTY A;  4DRW A;  2K61 A;  3EK7 A;  2PRR A;  1Q2N A;  1S26 D;  1H4B A;  1VQP P;  1LJ2 A;  3LIE A;  3SWF A;  2RMZ A;  2POH A;  2WZ7 A;  1IJD B;  2K60 A;  3L70 J;  4KYN A;  3PH0 A;  5DJT B;  1SQX G;  3PP5 A;  3A0H E;  3IF7 A;  1L0L J;  4DJG A;  1L0N J;  4AOM A;  1YQ4 C;  4JYB A;  1TUJ A;  2YIU C;  2A45 H;  1PP9 G;  1QAS A;  3BCC D;  3VRN A;  3KZI H;  1AJ4 A;  1CFD A;  3TGU D;  3L75 J;  2LUX A;  1G1J A;  3IVT A;  1HQV A;  2KI4 B;  1IZN B;  1FBM A;  2YO2 A;  1N86 A;  1OOJ A;  3LW5 H;  1JNM A;  2QJY B;  4OKH A;  1LVC D;  2WOR A;  1KWO B;  3BFB A;  2ZRT A;  3FE6 A;  1KB9 E;  3O4Y A;  2KSP A;  4OVN F;  1LTB C;  2M3B A;  3CX5 H;  1KQM C;  3CC2 P;  1F54 A;  3C1V A;  4B86 A;  4NQG A;  2KGR A;  1YIT P;  4RO0 A;  5FI2 A;  2P58 A;  3R1P A;  2C0X A;  2CCM A;  3WU2 E;  1UHJ A;  3MHV A;  5APQ A;  2E75 B;  2Z5I A;  1QJT A;  3I5G C;  4ZCU A;  1NWQ A;  2W6A A;  2N9Y B;  4EYY Q;  2M9G A;  1KYO H;  2GA1 A;  1SQQ K;  3BUO B;  4PE0 A;  5AVQ B;  1ZN5 A;  3ZDM A;  1QGK B;  3OGN A;  3TS5 B;  3Q5R A;  3IAO A;  3LCP C;  3HUS C;  2O1J A;  3B6X A;  3D71 A;  2JT8 A;  1NAY A;  5APT A;  1NX0 A;  3SG6 A;  5B66 H;  2CBL A;  1FZG A;  2ZFD A;  2QE7 H;  2V7Q H;  1A03 A;  1MHO A;  1SQP J;  2O01 H;  1BJF A;  1NU1 J;  3VRP A;  5D7F A;  4PDZ A;  2QJY C;  2K0J A;  2WSC H;  4DOJ A;  1GW3 A;  1QTX A;  2RN0 A;  2Q3I A;  2HYN A;  4PHM A;  1OVR A;  3SWK A;  1CDM A;  2MJZ A;  2F3Z A;  3NMD A;  1KIL D;  1UUR A;  4YI8 A;  2IBZ G;  2KLV A;  1L0L K;  3L75 D;  1NPQ A;  5FYX A;  3BUM B;  1KSO A;  3PFV A;  1Y9B A;  1KK8 C;  1TNP A;  2BCC E;  3RL0 B;  1NTZ K;  1FBV A;  1BGY E;  1NTM K;  2KAY A;  1GDT A;  3OX6 A;  4L76 A;  3OHM B;  3NSI A;  2EC6 B;  2LVK A;  2OTG C;  1LS8 A;  2OTL P;  3AAJ A;  1QX5 B;  2KZI A;  2KAX A;  5GTH E;  3WUV A;  1NKZ B;  4BRY A;  1FI6 A;  2BAP A;  1SR6 C;  1JCC A;  5AW5 B;  3L36 A;  5AVY B;  1LP1 B;  5KLV E;  1Y1X A;  1N2D C;  3CXH I;  3D6Z A;  1ZXG A;  1QVI Y;  2JT3 A;  2OTG B;  1AK8 A;  4IL6 X;  3VYI A;  2LMU A;  1S1E A;  1XA5 A;  5EL2 A;  3KYQ A;  1SCV A;  3P8C D;  2KUB A;  1ZMZ A;  1J7R A;  3T97 B;  4WQ3 A;  5KTY A;  5E79 E;  2KLD A;  5CHX A;  1N7S B;  2E42 A;  1BLQ A;  2N1T D;  2XND H;  1PL5 A;  4C7R A;  3BXK A;  2FJU B;  2IBZ E;  2KLU A;  1K96 A;  2KPH A;  5AVT B;  1DQE A;  4CID A;  4YPC A;  3RL0 g;  3KPE A;  2QRX A;  1SQP K;  1HH0 A;  2W6B A;  3BUW B;  3WXA A;  5H2F H;  3GF3 A;  5APX A;  3CWB G;  1YYC A;  2PAJ A;  1TCO B;  1UII A;  3PLF B;  4E68 A;  1KZU B;  2L51 A;  4Q04 A;  4U3F D;  2YIU B;  1AQ5 A;  1JFK A;  2WCL A;  3JTD C;  2MAZ A;  1PK0 D;  1SQV K;  2Z4E A;  1NTM G;  1SL7 A;  2I18 A;  2FXM A;  1URQ A;  1GL2 B;  2XDJ A;  1YVL A;  1HGZ A;  1JB0 J;  5BPJ A;  1FDM A;  1HJ0 A;  3I5F C;  1NTZ G;  1YTZ I;  2WCJ A;  1UWO A;  2HPC B;  1K95 A;  1LIN A;  1ZLL A;  2LLT A;  4JF7 A;  2BL0 B;  1N73 C;  3P8M C;  2M7N A;  5KKZ C;  1B8C A;  2L4H A;  3CXH H;  1RQV A;  1Q90 D;  1URQ C;  5HKZ A;  3C1L A;  1QLK A;  1FZC A;  1S6J A;  2O3J A;  3AE9 C;  2BEC A;  3I5F B;  3NSL A;  1LXF C;  3CAB A;  3D73 A;  1DX7 A;  3R1O A;  2PP6 A;  1NCY A;  1SQQ G;  5M1B A;  3TDU A;  3FWC A;  1S6I A;  4YXW H;  1G33 A;  4GKG A;  5BVZ A;  1R5S A;  2QAC A;  3H25 A;  1X02 A;  1URQ D;  5I8N A;  5FI7 A;  5KJ7 C;  1TWO A;  1VQ6 P;  4GNK B;  4K35 A;  4GDO A;  2H7H A;  2LCP A;  3CGA A;  1ALW A;  1SKT A;  4KT0 J;  1LT9 B;  1KCY A;  2WC8 A;  1VF5 B;  2FKW B;  1GMJ A;  1RF1 A;  1NU1 E;  2OYI B;  4DCK A;  1ORG A;  1B9A A;  1J1D B;  1SSE B;  2LP2 A;  3HE4 A;  4PT1 A;  2WOS A;  2O5G A;  2W6J H;  5APY A;  3CCQ P;  2B87 B;  3EVU A;  3MD0 A;  4WVZ A;  3N7N A;  3CZT X;  4I6M C;  4UB8 E;  4L75 A;  1W7J B;  4MLW A;  3ICB A;  1FZE A;  2WSF J;  3KHU A;  1IFJ A;  2LR2 A;  3H1I D;  1CMG A;  1S9K E;  4H0L B;  2M0B A;  1KIL C;  3S1K A;  1NJI Q;  2WQY C;  3JCU H;  1NKN A;  4PJ0 H;  2PSR A;  2E5T A;  3U1A A;  4A4B A;  3VN0 A;  1ZME C;  5KAF H;  1GJY A;  1A2X A;  1AVS A;  2M97 A;  5KAI H;  1ZOY C;  1BT6 A;  3CZ2 A;  1FS0 E;  4WY4 B;  1RF0 A;  3AE5 C;  4PCW A;  2WSE J;  2ZAE B;  1EXI A;  2WC5 A;  1GW4 A;  5APV A;  1B8R A;  2Y4Q A;  3P32 A;  2WCK A;  1K8U A;  1IRJ A;  1EDK A;  1IK7 A;  1K93 D;  4YGE B;  2O01 N;  1A75 B;  2AXT H;  4YGD B;  1H8A A;  1WRK A;  1LNQ A;  4GGN A;  2KI7 B;  4BXL A;  1AUI B;  1KYO D;  1B7T Z;  1F8H A;  2P2U A;  2L50 A;  3HE4 B;  1LTI C;  2IFM A;  4Z1M H;  2KI4 C;  5AVV B;  2ZXX A;  2Y9Y A;  5CJ4 A;  5HKW A;  5GTI E;  1L2P A;  1HBW A;  1NTK G;  1VQO P;  2FY8 A;  2PAS A;  1W5C E;  2P10 A;  3U59 A;  4P5O E;  3L70 E;  1Q81 Q;  4D6T D;  3BRT B;  3BJH A;  3CZ0 A;  2WT7 B;  2BNX A;  2B88 A;  3TS5 C;  1CFP A;  4NDC A;  2QEH A;  2CT9 A;  3BVH A;  2CXJ A;  2QDI A;  2JPT A;  2DW3 A;  2EC6 C;  1CLM A;  2ZVO B;  2PYQ A;  2JDI H;  2JTT A;  4L74 A;  4W7Y A;  2GTE A;  4I5J A;  4MSP A;  2E74 C;  2I1J A;  1FF1 A;  1FZB A;  1M1J B;  1R5L A;  4PD4 D;  1PP9 D;  5KKZ B;  1WRG A;  3GHG A;  4EIJ A;  2P1J A;  1ZR2 A;  1PGO A;  1X79 B;  3G4S P;  2ZN8 A;  1OOF A;  4MZL A;  1S4X A;  1VQK P;  5CJ0 A;  1RJV A;  1BR1 B;  2BEQ D;  3MZW B;  1V1G A;  3Q5P A;  2KI6 D;  2AEF A;  2Y0E A;  2HOD B;  4JWQ A;  1KQL A;  3WUU A;  1IQ5 A;  4HRE E;  3SFD C;  1JTH B;  5CSF A;  2JT0 A;  2KQ6 A;  4WB4 A;  4EOT A;  1PPJ E;  3DVK A;  4KHX A;  5F6T A;  3EG5 B;  1MUU A;  3RK2 B;  3NHT A;  1LT9 A;  1ALV A;  2H89 C;  1NHL A;  2V4H A;  2JO1 A;  1NTZ D;  1IFP A;  3VMX A;  1DJY A;  2H8V A;  3CLQ A;  1OW6 A;  4OGQ B;  1AA0 A;  3SG4 A;  2LXB A;  2K7B A;  3QH9 A;  5KLV K;  4HKZ H;  2KS1 B;  2BBN A;  3CCV P;  2K7D A;  3S0D A;  2K3R A;  2HF5 A;  3L72 J;  3R1V A;  4XE5 B;  1HWT C;  4OH8 B;  1N73 A;  4BY5 A;  1MWN A;  4U8D A;  3TGU G;  3BYA A;  5D69 A;  2KXP B; 
#chains in the Genus database with same CATH homology
 1HQV A;  3BOW A;  2KI4 B;  1OQP A;  2PVB A;  1PRW A;  4MEW A;  1OOJ A;  2MHH A;  3I5H B;  4MRY A;  4OKH A;  1LVC D;  1A29 A;  2WOR A;  5HLO A;  1KWO B;  2LAP A;  1Q80 A;  2M1U A;  2TN4 A;  3I5I B;  2M3W A;  2ZRT A;  3O4Y A;  1CDP A;  4NDB A;  1JC2 A;  2KSP A;  4OVN F;  4GAO A;  1KQM C;  4DUQ A;  1GGZ A;  3WNX B;  1MF8 B;  2KHN A;  3JTD B;  4PE7 A;  1EXR A;  1F54 A;  3K21 A;  3C1V A;  1YR5 A;  1S5G Z;  4GBA A;  4NQG A;  5AEQ A;  3GK1 A;  5GQQ C;  3QRX A;  4CLN A;  2KNE A;  5CSN A;  1B8L A;  2KGR A;  2M7L A;  2KFH A;  3WHT B;  3EVV A;  2MJW B;  2CCM A;  1UHJ A;  1U5I A;  3JVT C;  2OPO A;  1J7Q A;  1VRK A;  1QJT A;  3I5G C;  2LMV A;  1SPY A;  2M0R A;  4ZCU A;  3CR4 X;  1XFX O;  1SL8 A;  4UPG A;  2M9G A;  1ZFS A;  4C0K A;  1CDL A;  3BUO B;  2M29 A;  4PE0 A;  4I5K A;  3FWB A;  2JNX A;  5DKQ A;  4FTG A;  4AQI A;  2M8U A;  2NCP A;  1CDN A;  3TS5 B;  2M1K B;  1JBA A;  5AFP A;  3A8R A;  3LCP C;  4N1G A;  1XFV O;  1UHN A;  1NYA A;  2CNP A;  2JUL A;  4ORB B;  3PN7 B;  2KAV A;  1MR8 A;  1RFJ A;  2JT8 A;  1NX0 A;  3SG6 A;  2I94 A;  2CBL A;  2ZFD A;  3BUN B;  3RM1 A;  1A03 A;  1JFJ A;  1MHO A;  5KSZ A;  1NX1 A;  1BJF A;  3VRP A;  5D7F A;  2NZ0 A;  2F8P A;  1KK7 Y;  4PDZ A;  2K0J A;  3OP0 A;  2Y1N A;  4N1F A;  1QTX A;  5AER A;  2Q4U A;  2Q91 A;  4GUK A;  4PHM A;  4XJK B;  2HPS A;  1CDM A;  1ZAC A;  2F3Z A;  4PHK A;  1JWD A;  1DJZ A;  2L5X B;  5J3X A;  3H4S E;  1UUR A;  3EK8 A;  4YI8 A;  2V53 A;  1M63 B;  3IQQ A;  4MBE A;  1C7V A;  3AKB A;  2JOJ A;  4D1E A;  1KFU S;  1OZO A;  1NPQ A;  5FYX A;  3BUM B;  1KSO A;  2LM5 A;  4GPL B;  3PFV A;  1KK8 C;  1QXP A;  1TNP A;  2KFG A;  3SG5 A;  1DJG A;  1TNW A;  4M2O A;  2FCE A;  2KBI A;  4IL1 A;  1XO5 A;  2L0P A;  1KK8 B;  1AJ5 A;  2LE9 B;  2ZNE A;  3CTN A;  2LLS A;  2MLF C;  5CSJ A;  1FBV A;  1M31 A;  2KAY A;  3TZ1 A;  3OX6 A;  4GFT A;  1J55 A;  1SL9 A;  4P2Y B;  1CM1 A;  5DKR A;  4HSZ A;  2LUC A;  3OHM B;  2ZKM X;  2AAO A;  3NSI A;  2EC6 B;  2DOQ A;  1WLZ A;  1NSH A;  1DJW A;  2LVK A;  2OTG C;  2F3Y A;  2KOT A;  3AAJ A;  1QX5 B;  2SCP A;  3NXA A;  1AHR A;  1KWO C;  1NUB A;  2MBX A;  4CFR A;  2KAX A;  2H61 C;  3ZWH A;  2OS8 C;  4GGF C;  1BOC A;  1KFX S;  1WY9 A;  4OR9 B;  1FI6 A;  3DVM A;  2LMT A;  1SR6 C;  1FW4 A;  1SW8 A;  1SK6 D;  3RLZ A;  1KSM A;  1SMG A;  4YBH B;  1K2H A;  3BOW B;  4F0Z B;  1PAL A;  1Y1X A;  1JSA A;  2MA2 A;  1YUU A;  1PVB A;  2JWW A;  1QVI Y;  3EKH A;  2JT3 A;  2WCE A;  3OX5 A;  3PAT A;  2OTG B;  1AK8 A;  1F4O A;  1JF0 A;  2GGM A;  1DVI A;  1S1E A;  2LMU A;  1SCM C;  2LNK A;  1XA5 A;  2AMI A;  2LAN A;  3SIB A;  1J7P A;  1S5G Y;  1OFC X;  1SCV A;  1QAT A;  1ZMZ A;  1J7R A;  4WQ3 A;  2H61 A;  5KTY A;  2L2E A;  3I5H C;  1OMV A;  5G08 A;  1DMO A;  1F55 A;  2PAL A;  2BL0 C;  1YUT A;  2KDH A;  2WCF A;  1S36 A;  3KPX A;  1YUS A;  1BLQ A;  5PAL A;  1RK9 A;  2E6W A;  1SRA A;  1Y1A A;  1YX8 A;  2HQW A;  1ZOT B;  2IS9 A;  1KFX L;  1DF0 A;  2HQ8 A;  2F2P A;  2FJU B;  3BXK A;  1TNX A;  4ZCV A;  2FCD A;  3IQO A;  1XYD A;  1V1F A;  1K96 A;  3FS7 A;  3PAL A;  4ORC B;  3VRR A;  4CID A;  4ETO A;  1CLB A;  2K2F A;  1UHH A;  4PHJ A;  1WRZ A;  1G8I A;  2JXL A;  1WLM A;  2BBM A;  3BUW B;  4JPZ B;  1SCM B;  3WXA A;  2I7A A;  3EK4 A;  1OE9 B;  2LHL A;  1BR4 B;  1XK4 C;  3D0Y A;  3KO0 A;  1FPW A;  1Y1U A;  1PSB A;  1JUO A;  1TCO B;  3SIA A;  3PLF B;  5CPV A;  2I2R E;  4E68 A;  1NWD A;  1A75 A;  1IQ3 A;  2PRU A;  2L51 A;  4Q04 A;  1TIZ A;  1B1G A;  2JU0 A;  1DJX A;  1R2U A;  2Y1M A;  1JFK A;  3DF0 B;  1NP8 A;  3M0W A;  3JTD C;  2JTZ A;  3SG3 A;  2MAZ A;  4MRX A;  1PK0 D;  2KGB C;  4WQ2 A;  3GK4 X;  1XFY O;  3A4U B;  3O78 A;  4DIR A;  1XFU O;  4BY4 A;  1NX3 A;  1RWY A;  1YX7 A;  1LA0 A;  1MUX A;  1SL7 A;  2I18 A;  2E30 A;  2LC5 A;  1TCF A;  1DTL A;  1YVL A;  1DT7 B;  3MSE B;  5BPJ A;  3WHU B;  3KF9 A;  4XJK A;  1MXE A;  1QIW A;  3I5F C;  1DJI A;  1AP4 A;  1SNL A;  1SBJ A;  3CR5 X;  4MZK A;  1TOP A;  2JRF A;  4PE1 A;  1UWO A;  1IJ5 A;  1K95 A;  1LIN A;  2L98 A;  1XFW O;  1BOD A;  2LLT A;  1QS7 A;  3O2P A;  1D1O A;  1ODB A;  1YVH A;  3OB1 B;  1QX7 A;  1EH2 A;  3NSO A;  3PSR A;  1CNP A;  2BL0 B;  1KFU L;  2M7N A;  2EHB A;  4YI9 A;  1CKK A;  1CB1 A;  1WDC B;  1B8C A;  2L4H A;  5JOL A;  1L2O C;  1CLL A;  1B4C A;  5HKZ A;  4USL A;  1XFZ O;  4I5N B;  1QLK A;  2BCB A;  3I5I C;  2CTN A;  1TRF A;  1NX2 A;  4OCI A;  1DGV A;  1H8B A;  1S6J A;  4WRI A;  1CFF A;  2BEC A;  3I5F B;  2KYC A;  3NSL A;  1LXF C;  2GV5 A;  1JF2 A;  1CM4 A;  1K90 D;  1NCY A;  5CSI A;  4AQJ A;  3TDU A;  1R6P A;  3FWC A;  1S6I A;  3DVE A;  1G33 A;  2F2O A;  2QAC A;  5ER5 A;  3O6B A;  1X02 A;  5AXI A;  4GGF A;  5I8N A;  5K89 A;  1N0Y A;  1M39 A;  4GNK B;  1EG4 A;  4A4C A;  1CTR A;  2ZRS A;  4PE4 A;  1OMD A;  1OMR A;  2LCP A;  3CGA A;  1ALW A;  1SKT A;  1EJ3 A;  4HRG A;  1KCY A;  2WC8 A;  2G2B A;  1Y0V H;  1QX2 A;  2LV7 A;  2ISD A;  1YRU B;  2VRG A;  2JZI A;  1E8A A;  1UHK A;  4DCK A;  2QPT A;  1YTZ C;  2HET A;  1B9A A;  5HYD A;  1J1E A;  2LP2 A;  2D8N A;  1K9K A;  2WOS A;  2O5G A;  2LHI A;  4M2P A;  2EGD A;  2R2I A;  3CR2 A;  1BG1 A;  1BF5 A;  1WRL A;  1QLS A;  4OV2 A;  1SR6 B;  3EVU A;  1K9P A;  4NDD A;  1MXL C;  1K94 A;  2F33 A;  1CMF A;  1OZS A;  1QVI Z;  3CZT X;  1WDC C;  3F45 A;  1UUS A;  1DF0 B;  1W7J B;  2KFF A;  2K7O A;  3ICB A;  3LK0 A;  4JQ0 D;  4MLW A;  4PHN A;  1RTP 1;  3LLE A;  1CMG A;  1IKU A;  3LL8 B;  3HX4 A;  1J1D A;  2SAS A;  2Y9Z A;  2PSR A;  4QJ4 B;  5TNC A;  2NLN A;  4A4B A;  1GJY A;  1A2X A;  1AVS A;  1DJH A;  3EVR A;  2M97 A;  4FQO A;  3EKJ A;  2NXQ A;  2MRD A;  1BT6 A;  5I2Q A;  4YGB B;  4PAL A;  1U5I B;  2M49 B;  1BU3 A;  2WND A;  1J7O A;  4PCW A;  2WCB A;  4CPV A;  1MQ1 A;  1GQM A;  2KQY A;  1B8R A;  4R1E A;  2JXC A;  2OS8 B;  2Y4Q A;  3SG2 A;  5I2L A;  3VGO A;  2GGZ A;  3HCM A;  1K8U A;  1YUR A;  1IRJ A;  5B8I B;  3DF0 A;  1BMO A;  1K93 D;  2BE6 A;  4YGE B;  1DGU A;  2K7C A;  1B7T Y;  1A75 B;  1NCX A;  2LVI A;  1GGW A;  1ZUZ A;  1A4P A;  4YGD B;  1PSR A;  1WRK A;  3DD4 A;  4GGN A;  3VRQ A;  5ER4 X;  2K8M B;  1SY9 A;  1AUI B;  1B7T Z;  1F8H A;  3CS1 A;  4TNC A;  1FI5 A;  2KYF A;  1REC A;  2L50 A;  1PUL A;  1S3P A;  1QV1 A;  2AUC A;  2PMY A;  1M45 A;  3CWG A;  2NCO A;  2KI4 C;  2ZN9 A;  4MVF A;  3JVT B;  5IBW A;  2Y9Y A;  1IGV A;  1F4Q A;  3GK2 A;  4HRH A;  1EL4 A;  5HKW A;  3I5G B;  1C7W A;  1L2O B;  1XK4 A;  3PM8 A;  2PAS A;  2BE4 A;  4P5O E;  3TDZ A;  3LK1 A;  1IG5 A;  1HT9 A;  2COL B;  2L4I A;  2KI6 C;  3D10 A;  3PN7 C;  2B1U A;  4L9M A;  1SYM A;  1RRO A;  3AKA A;  1LKJ A;  3OB2 B;  2MLE C;  3TS5 C;  4NDC A;  1CFP A;  1PVA A;  2CT9 A;  2LLU A;  1QV0 A;  2CXJ A;  1KK7 Z;  2ZND A;  3E3R A;  1L7Z A;  4ORA B;  2KBM A;  1TNQ A;  2JPT A;  3TUY C;  2EC6 C;  1CLM A;  2JTT A;  3AAK A;  4ICB A;  2BCX A;  4I5J A;  4YGA A;  4MSP A;  1KQM B;  1NCZ A;  4I5L B;  2JC2 A;  1FF1 A;  2BKH B;  3TDI A;  1N65 A;  4DS7 A;  2RGI A;  5I2O A;  3SJS A;  1UHI A;  4M2Q A;  4YGC B;  1K9U A;  2ZN8 A;  2LVV A;  3BUX B;  4MZL A;  3VRO A;  1QIV A;  3KHE A;  3FIA A;  4XYN A;  4C0J A;  1RJV A;  4QJ5 B;  1IJ6 A;  1OSA A;  4N5X A;  1BR1 B;  1IWQ A;  4CFQ A;  2JNF A;  5KU1 A;  1G4Y R;  1V1G A;  2H2K A;  2LVJ A;  2KI6 D;  1YRT B;  1F71 A;  3D0Y B;  2P6B B;  4JWQ A;  2O60 A;  3CLN A;  2G9B A;  1IQ5 A;  1M46 A;  4HRE E;  1XVJ A;  1TN4 A;  5CSF A;  2JT0 A;  3SG7 A;  2KQ6 A;  4YRU A;  3DVJ A;  3DVK A;  5F6T A;  2Y5I A;  1N2D A;  1KQV A;  5DKN A;  1NIW A;  3BQ3 A;  5AAN A;  3ZNI A;  3NSK A;  1UP5 A;  5JJG A;  4DRW A;  1LA3 A;  2K61 A;  1ALV A;  5HLV A;  3EK7 A;  4MZJ A;  1S6C A;  1S26 D;  1H4B A;  4QJ3 B;  1DJY A;  1IH0 A;  2K2A A;  1F70 A;  3SG4 A;  1B47 A;  2LP3 A;  3GOF A;  2K7B A;  3TUY B;  2JQ6 A;  2A4J A;  2BCA A;  2BBN A;  3KEV A;  2K7D A;  2HF5 A;  1Y6W A;  5HKY A;  3IF7 A;  2FOT A;  4AOM A;  4MN0 A;  4BY5 A;  1MWN A;  1EG3 A;  4U8D A;  4C0L A;  1C07 A;  1QAS A;  1W7I B;  3VRN A;  2BKI B;  1AJ4 A;  1CFD A;  3BYA A;  2LUX A;  1CFC A;  5D69 A;  1TTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...