4DCKA

Crystal structure of the c-terminus of voltage-gated sodium channel in complex with fgf13 and cam
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
153
Chain Sequence
SVATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sodium channel protein type 5 subunit alpha
publication title Crystal Structure of the Ternary Complex of a NaV C-Terminal Domain, a Fibroblast Growth Factor Homologous Factor, and Calmodulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/signaling protein
total genus 51
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2012-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4dckA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4dckA02
1B47A 4M2QA 5D69A 5G08A 4NDCA 1UUSA 2KI4B 1AK8A 1XVJA 3BUWB 1PVBA 1QJTA 3SG4A 1YUSA 1YRTB 3C1VA 1TN4A 2EGDA 3A8RA 1K94A 3MSEB 4MN0A 3CTNA 1IQ5A 4NQGA 1CLMA 2P6BB 1CM4A 2L0PA 4MLWA 1N2DA 3BOWA 3LK1A 1FBVA 3KHEA 1YX7A 2KBMA 2KSPA 4PHKA 1YVHA 1J1EA 1BF5A 1CLBA 1ZMZA 4N1FA 1JWDA 2M3WA 3HCMA 1YVLA 3PATA 1KQVA 3HX4A 5KTYA 3SJSA 1K90D 1C7VA 2AUCA 1WLZA 2NLNA 2A4JA 3LK0A 3SG6A 5B8IB 4P2YB 2JT8A 1NIWA 1YRUB 2LVKA 1PRWA 3SIAA 4DRWA 2JNFA 2HQWA 2EC6C 3VRNA 2Q91A 1ALWA 1U5IA 1OMVA 1X02A 3FS7A 1CFFA 1SKTA 2KFHA 1SL7A 5BPJA 3OP0A 5CSFA 1DJYA 2H2KA 1M45A 3OHMB 4JPZB 1K9KA 1FW4A 2BCXA 2I7AA 1WDCB 2LM5A 3ICBA 1A03A 2M0RA 2ZRTA 3DF0A 3I5HC 3WHTB 3JTDC 1OQPA 3OX6A 1XA5A 4I5JA 1KFXS 4MEWA 1QVIZ 1S5GZ 2WCEA 1K8UA 4WRIA 1XFVO 3BUNB 4ORCB 3EKHA 3PSRA 3DVJA 1SMGA 1EL4A 1E8AA 1U5IB 2JQ6A 2KYFA 2V53A 2ZNEA 1GJYA 5DKNA 2OTGB 2L4IA 4TNCA 3I5GC 5HKZA 1BOCA 3O6BA 3I5IC 3EVRA 1K93D 3GOFA 4PE7A 2B1UA 4DUQA 2LLSA 2OS8B 1CKKA 2M7NA 2PRUA 1IH0A 2CTNA 1DF0B 3VGOA 1SL8A 3TUYC 1TOPA 4FTGA 1RFJA 2I2RE 2JTTA 1K96A 3DVKA 1AJ5A 1MQ1A 1DJXA 1S26D 1KSOA 1UHHA 1KQMB 1JF0A 1UHJA 1SY9A 3GK1A 2MA2A 1YTZC 1XFXO 2JC2A 4FQOA 5AERA 5I2LA 1EH2A 3D10A 2D8NA 5CSJA 3PFVA 3ZNIA 1RWYA 2LMVA 4ZCUA 3VRPA 5IBWA 5KSZA 2Y1MA 1H8BA 2LMTA 4C0LA 2IS9A 1NX2A 1W7IB 1QLKA 5I2QA 1XK4A 1D1OA 1SR6C 4U8DA 1FI5A 4PE0A 5DKRA 1A4PA 4JWQA 1CMGA 1JC2A 1NYAA 2PALA 1R2UA 1ODBA 2NZ0A 3WHUB 2MHHA 3BYAA 4NDDA 2H61A 1IKUA 1CDNA 5HLVA 2Y9ZA 2JXLA 1J7PA 2OPOA 3WNXB 1AVSA 1NX0A 4GUKA 2WCBA 2GV5A 1QATA 2WOSA 1DJGA 1BR4B 4PHMA 3VRQA 3E3RA 1SL9A 3IF7A 2BL0B 1QASA 2JWWA 4AQJA 1KK8C 3CLNA 4C0KA 1DVIA 1MUXA 1SK6D 3K21A 1TNWA 1NUBA 1OOJA 3IQQA 1IQ3A 1N65A 1BMOA 5CSNA 5HLOA 2KAVA 4GGFA 3TS5C 1QX7A 3CR2A 1WLMA 1NX1A 2SCPA 2GGZA 3EK4A 4E68A 2GGMA 1S6JA 3RLZA 1M63B 1Y1XA 3BXKA 1B1GA 2JOJA 5JJGA 1L2OC 3FIAA 1YR5A 2HF5A 1KCYA 1DJHA 2WC8A 3FWBA 4MVFA 4QJ4B 1H4BA 1CM1A 3D0YB 4XYNA 3EVUA 1DJIA 4DS7A 1KSMA 1MWNA 1EJ3A 2LHIA 3KO0A 4MRXA 1K95A 4C0JA 4PALA 1WRKA 4PE4A 3DVMA 3EVVA 1TNPA 1KWOB 1NCXA 1SCVA 1AJ4A 1EG4A 1TIZA 2LVVA 3IQOA 1OZOA 3KPXA 5HKWA 3SG2A 5CSIA 1S6IA 2F8PA 1KK7Z 1SBJA 2BBMA 5HYDA 1CB1A 1UWOA 3LLEA 2L4HA 2ISDA 1SYMA 2K7DA 4M2PA 3CR5X 4NDBA 2BKHB 5JOLA 1MXEA 1A75A 1KFXL 1QLSA 2CBLA 1QX5B 2BECA 5D7FA 2CXJA 2LLUA 1QV1A 2JT3A 1AHRA 1XFYO 2Y5IA 3H4SE 4PHNA 3KF9A 1LXFC 5F6TA 3AKBA 1LINA 1J55A 2RGIA 1FPWA 1YX8A 2COLB 4GFTA 1SCMC 2LV7A 1B7TZ 3PN7B 1RJVA 5FYXA 2KHNA 3JVTB 1DF0A 1CTRA 1WRLA 2JXCA 3O4YA 2KAYA 2JTZA 1XK4C 2ZN8A 3I5FB 4GAOA 1A75B 4HRGA 5PALA 1JF2A 2LLTA 2LANA 1CDMA 1BG1A 3PALA 5ER5A 4YI8A 3QRXA 1NX3A 4HREE 3TDIA 3SIBA 1F70A 2H61C 1F71A 4OR9B 2KI6C 2KFFA 2Q4UA 4Q04A 1KFUS 1QIVA 2PASA 3M0WA 4F0ZB 5KU1A 2L2EA 1OE9B 2KI4C 2JPTA 1OSAA 4I5LB 4N1GA 1CNPA 2MLFC 2PMYA 2NXQA 4PDZA 2K7CA 4BY5A 1LKJA 2I18A 3CWGA 4CLNA 1UP5A 1F4QA 2K0JA 1GGZA 3CS1A 1OFCX 3NSOA 2BE4A 1V1GA 2F2OA 4ORAB 4AOMA 1TTXA 1XYDA 4CFQA 2QACA 2PVBA 4MSPA 1BT6A 1Y1UA 2ZRSA 1BJFA 1UHNA 4PHJA 2LNKA 5DKQA 1Y0VH 1NCYA 1J7OA 1SNLA 2F3ZA 1NWDA 3CGAA 1B8RA 3NXAA 1AP4A 4YGEB 4GNKB 4MZJA 1JSAA 4ZCVA 1AUIB 2Y4QA 1Y6WA 1XFZO 1N0YA 1B8LA 2L50A 2KDHA 2LP3A 2BBNA 2ZNDA 4R1EA 1J7QA 2JZIA 3ZWHA 2G9BA 5CPVA 1OMDA 1SRAA 3WXAA 1K2HA 2WORA 2BCBA 4MBEA 4ORBB 4I5NB 4WQ3A 4OKHA 3F45A 2TN4A 3PLFB 2M29A 3CZTX 1PALA 2FCDA 3D0YA 2EHBA 1WDCC 2K7BA 4UPGA 2EC6B 2M9GA 1ALVA 2LE9B 1TRFA 1CMFA 1J1DA 1QIWA 1IWQA 4DCKA 1R6PA 1PK0D 1TNXA 1BLQA 1ZACA 2LVJA 3GK4X 1MR8A 2JNXA 1UURA 2LHLA 3SG5A 4BY4A 4OCIA 1NP8A 5TNCA 2Y1NA 1B9AA 1PSBA 4I5KA 1G4YR 5GQQC 2OTGC 3OB2B 1IG5A 3DD4A 2HETA 3I5HB 3JTDB 1CFCA 1XFUO 2M8UA 2M97A 3SG3A 2AAOA 1GQMA 2JULA 1F55A 2OS8C 2K7OA 2L51A 4QJ5B 1QV0A 2KI6D 1RK9A 2JRFA 4CFRA 2K2AA 1ZOTB 1TCFA 2MRDA 3NSKA 5HKYA 1F8HA 1QVIY 1S5GY 1KQMC 5ER4X 1MF8B 3I5GB 1NSHA 1QX2A 3DVEA 3I5IB 4XJKB 1RROA 4QJ3B 3BUXB 1WY9A 3A4UB 4L9MA 1JBAA 4P5OE 1LVCD 2WNDA 4OV2A 1PVAA 3TUYB 1YURA 2MAZA 1DGVA 1TCOB 2E30A 1S1EA 1QTXA 2LAPA 2M1KB 2F3YA 1W7JB 2JT0A 1IGVA 2FCEA 1IRJA 3TDZA 2VRGA 2KFGA 2KQYA 4A4CA 1Y1AA 5AEQA 3EK7A 4GBAA 1FF1A 2L5XB 1DJWA 1IJ6A 3O2PA 2KYCA 1KFUL 1PSRA 1SR6B 1G33A 1G8IA 4MRYA 1ZUZA 2O5GA 2ZFDA 1BODA 2E6WA 1S3PA 1DMOA 1K9UA 2CT9A 5I8NA 4A4BA 2KAXA 1DT7B 4USLA 4PCWA 2CNPA 2K2FA 3BOWB 1UHKA 2BL0C 2NCPA 1L7ZA 1SPYA 4CIDA 2K61A 4DIRA 1K9PA 2BKIB 2JU0A 1CLLA 3PM8A 4WQ2A 3TDUA 2BCAA 1Q80A 2KNEA 3CR4X 1M39A 1A29A 4IL1A 5I2OA 4HRHA 4ICBA 4MZLA 4YGBB 2KQ6A 4JQ0D 2L98A 1JUOA 1OMRA 2ZKMX 4GPLB 1RTP1 2LUXA 1YUUA 1WRZA 1NCZA 2BE6A 2KGRA 2M1UA 1HT9A 1J7RA 1KK8B 3BQ3A 2LVIA 2FJUB 2O60A 2PSRA 1TNQA 4N5XA 4YGCB 1C07A 4YBHB 1B8CA 1OZSA 3TS5B 2KOTA 2G2BA 1CDPA 1PULA 4ETOA 1S6CA 2NCOA 4OVNF 4PE1A 1EXRA 3NSLA 1MXLC 2F2PA 2MBXA 3VROA 4GGFC 4D1EA 2HQ8A 5K89A 1KWOC 1L2OB 4HSZA 2HPSA 2LCPA 2MJWB 1S36A 1M46A 2LC5A 1F54A 3DF0B 3LL8B 1XFWO 2F33A 4YI9A 3LCPC 1JFJA 2CCMA 1DTLA 3RM1A 1B4CA 2LMUA 2MLEC 3GK2A 3AKAA 1GGWA 5AANA 1ZFSA 2R2IA 4GGNA 1YUTA 2K8MB 1DGUA 2DOQA 2SASA 4M2OA 1C7WA 3VRRA 1BR1B 1VRKA 1F4OA 1V1FA 3NSIA 1M31A 2LP2A 2QPTA 3EKJA 1KK7Y 3PN7C 1UHIA 5J3XA 1MHOA 3JVTC 1LA0A 3BUMB 2M49B 4MZKA 1QXPA 4YRUA 3I5FC 3O78A 1XO5A 2AMIA 2KGBC 3SG7A 4XJKA 4YGAA 1DJZA 3AAJA 1SCMB 3FWCA 1NPQA 3TZ1A 2FOTA 1CFDA 3BUOB 3OX5A 4CPVA 5AFPA 5AXIA 1SW8A 2Y9YA 1BU3A 2M7LA 2WCFA 1HQVA 2ZN9A 1CFPA 1RECA 1EG3A 1CDLA 2KBIA 3KEVA 1B7TY 3OB1B 3AAKA 1JFKA 1LA3A 1QS7A 3EK8A 1FI6A 2LUCA 4AQIA 1IJ5A 2I94A 1A2XA 4YGDB
chains in the Genus database with same CATH superfamily
2WCHA 4IFDK 5G08A 4NDCA 1VQ4P 3CX5I 1YUSA 1RQUA 1YRTB 3RK2C 3AEFC 3CABA 4MN0A 1U57A 1BCCD 4NQGA 1YBKA 1DEKA 2XZRA 2P6BB 1CM4A 1FBMA 3SFEC 3LK1A 3KHEA 3KHUA 5KJ7D 3HUSB 1LP1A 3QH9A 3L74G 2IBZD 5APYA 1VQNP 3CCRP 1OOGA 2AUCA 1WLZA 3IFMA 2NLNA 4U3FD 2A4JA 1QX8A 1NIWA 3G71P 1PRWA 3FE9A 4DRWA 3CLQA 2JNFA 1VQ8P 4INWA 2KI7B 2Q91A 2E75D 2A06E 2K9JA 3AECC 3PTZA 1CFFA 2KFHA 5BPJA 1KB9E 4JPZB 2JEEA 3PHLA 4RO0A 1T3UA 1XA5A 1L4AD 4D6TD 1KFXS 3B88A 1QL2A 4GDOA 1L4AB 3D6YA 3PLNA 1SMGA 3C1LA 4U7JA 2ZNEA 4HKZH 5APVA 1BOCA 4PD4E 1BGYJ 2B1UA 3VP9A 3S0AA 2LLSA 1C3ZA 1MFZA 1CKKA 4HB1A 2BNXA 3VGOA 3M06A 4FTGA 1SLQA 4H44D 3ITKA 1JEKA 2W8ZA 1MQ1A 3E1IA 3U1AA 4H44B 1K04A 1UHJA 1JF0A 3A3YB 5AERA 5I2LA 5CSJA 3PFVA 3A0HE 2QJKC 3L74D 4C0LA 2IS9A 3FE6A 1QLKA 1SR6C 1IFPA 3S0GA 4PE0A 4JWQA 2HODA 1SQPE 1KN7A 1RE4C 4NDDA 2GUSA 5HLVA 1J7PA 2OPOA 2QE7H 4CPGA 3WNXB 1AVSA 2IFNA 3RBXA 1S5LE 4IFMA 2ZYGA 3VMAA 3OJAB 3TK1A 4PHMA 1KILD 1Q82Q 3CXHH 2JWAA 1QASA 5CCHD 4AQJA 1KILB 5KLIC 1BMOA 3MHVA 5HLOA 2K60A 2QJYB 2R5DA 3CR2A 3AEDC 5H2FH 2L5GB 2GGZA 3EK4A 1LS8A 1B1GA 3CCMP 1L2OC 1M1JC 2HF5A 2WCJA 1XTCC 2KK7A 3D78A 3MTUE 5CHXA 1DJIA 4DS7A 4W80A 1EJ3A 2FXPA 2AXTH 4MRXA 3NGVA 1M90Q 2OYIB 3OBVA 3GW6A 1MV8A 2YNYA 1YQ4C 1ZXGA 1TNPA 3SWFA 1NCXA 1QLED 1EG4A 1RF1A 4W7YA 1BCCE 5K5GB 1KK7Z 2BBMA 3AEGC 1SYMA 2K7DA 4M2PA 3CR5X 1S3JA 1N7SA 4Z1MH 2BECA 2WTYA 2H88C 3S0DA 5APSA 2JT3A 3R1OA 2C9NY 1L0LG 3P8CD 2Y5IA 3SSUA 1LT9C 5F6TA 1NVOA 2P1JA 3CCQP 3BATA 2GUVA 4U3FE 4WY4D 5B66E 1DD3A 1SCMC 2IX7C 1B7TZ 2FYUE 3R1VA 3WUUA 2NPSD 3D76A 4WY4B 2JXCA 3WUVA 4HRGA 2JTZA 3HTKB 5PALA 1JF2A 1SQQG 2NPSB 3PALA 5ER5A 1S2EA 3KXDA 1F70A 1FU1A 2KSJA 1KFUS 2PASA 1BGYD 4D6TE 1S72P 3CZ2A 2JPTA 4EOTA 2PMYA 5BU5A 3I55P 1IFNA 3BRVB 1GU4A 4YXWH 1F4QA 2PQLA 2ZYAA 1GGZA 1OFCX 1ZLLA 2YMKA 3NSOA 1DQEA 1EDJA 1H0TA 2BE4A 2CPSA 3RK2D 2B89A 2F2OA 1TTXA 2QACA 3T97A 1BT6A 3RK2B 1BJFA 4PHJA 3P8MC 4IFFA 5AVXB 1NWDA 5KLVJ 3CGAA 3NXAA 3N7NA 1FZAA 4ASVA 4GNKB 4MZJA 3WU2E 5KLVK 3Q1MA 1XFZO 1M57D 1A02F 1N0YA 3L4AA 3L74E 3L72J 1ZP0C 1UIIA 2B9BA 1SRAA 5GTIH 3L4FA 1EDIA 4WQ3A 4OKHA 1KYOH 2WSSH 2TN4A 2M29A 3SS3A 1WDCC 1R5SA 5M1BA 2LE9B 1SVFA 1CMFA 3V4WA 1NKNA 1IWQA 1IO4A 1LGHB 1NTZJ 1KB9I 3M9HA 1FOSE 3SG5A 4OCIA 1QVGO 1NTZK 1PSBA 1OVVA 1KILE 2H89C 1VQPP 5GQQC 1IG5A 1JMBA 1XFUO 2PYQA 1UIXA 4I6MC 1FZCC 1OW6A 2P2UA 3H1IG 2FKWB 4PV1C 2WWWA 2OTLP 2XV5A 1QVIY 1KQMC 1NSHA 4PD4I 1JCDA 5AW9B 1JBAA 3C9IA 5KLVG 2W90A 3GG2A 1PVAA 1PZQA 1YURA 1TCOB 1QTXA 3R2PA 1IGVA 2KQYA 4A4CA 4IL6X 5GTHE 3KZIH 2QJKB 1LTGC 1GMJA 2GTEA 1SR6B 1G8IA 2WSCH 3CC7P 2CPBA 2E6WA 1S3PA 2E76C 1DELA 4UB8E 1K9UA 3GF7A 4A4BA 1DT7B 2KLVA 1NTZG 3P8CE 2CNPA 2NCPA 1L7ZA 2K61A 3SWKA 1KV4A 3PM8A 3TDUA 1J1EB 1JY2O 2KNEA 1M39A 3B5NA 3RL0C 2IPPA 4YGBB 2KQ6A 4JQ0D 2OYHC 2KIKA 1OMRA 2LUXA 5KAIH 1WRZA 2BE6A 2ZXEB 1SQBG 3AEEC 3VTPC 1DEBA 2LVIA 4GOEA 1TNQA 4N5XA 5KLIB 1OZSA 2HG5D 2E5YA 2NCOA 3BFBA 3NSLA 2YO3A 1L2OB 2KLUA 1M1JB 4WVZA 2LCPA 5KLVD 2V7QH 3DF0B 2F33A 4YI9A 3O6QA 1JFJA 1DTLA 1X79B 2K37A 1LTAC 2I1KA 2WSFJ 2Y0DA 3L72D 2MLEC 2UWJE 1L2PA 5AANA 2YMYA 3H32B 4M2OA 1K73Q 1SQPJ 1KQGB 5FI7A 2A45G 1SQPK 2E75C 1N73C 2QJPC 1UHIA 3JVTC 1JTHB 3H1HJ 2ERBA 3I5FC 1URQC 2AMIA 3CX5H 1L0LE 1NTZD 1LT9B 2KGBC 3SG7A 4XJKA 2FJYA 1M56D 1QGKB 1YJ9P 5EL2A 3AAJA 1SCMB 4EI2A 1NPQA 2BCCG 3G4SP 5AFPA 3ZDMA 1SW8A 2Y9YA 1NO4A 2XNXA 1RECA 3CC2P 1SQQE 2WQYC 1WT6A 1JFKA 4DT0A 3EK8A 1FI6A 3HUSA 2KZIA 4ZNCA 3BCCJ 2ZFCA 3B4SA 4M2QA 5D69A 1M8OB 2P7JA 3GMAA 1XVJA 2XU6A 3MIWA 5AVRB 3SG4A 2EGDA 1IQ5A 3I56P 3CCJP 1N2DA 3BOWA 1FBVA 1BDCA 1YX7A 2C0XA 2KBMA 4BXLA 4R4LA 4PHKA 1JCCA 1CLBA 2M3WA 2KUBA 2M5AB 4C7NA 5CJ4A 5KTYA 1K90D 1OOIX 3H1HG 1KB9D 3LK0A 5B8IB 2WZ7A 1RE3C 1YRUB 2EC6C 2FYUJ 1KFMA 2W6AA 1ALWA 3TYYA 1KILC 2FYUK 3L75G 2W6JH 3GLMA 5CCHC 3CZ1A 3OP0A 5CSFA 1DJYA 3H1LG 3EWKA 4XFJA 2N1TD 1WDCB 3ICBA 2O01N 2ZRTA 3JTDC 3SWYA 1OQPA 3OX6A 4I5JA 4PD4D 4TT3H 2KS1A 5APQA 4UB6E 1S5GZ 2WCEA 2MJZA 2XNDH 3BUNB 4ORCB 4H13C 3DVJA 3RZSA 1U5IB 2V53A 1GJYA 2L4IA 4TNCA 5HKZA 3O6BA 3EVRA 1K93D 1KQLA 4PV1D 3OW2O 1FZCB 3CXHD 2PRUA 1JB0J 1BDDA 2CTNA 1DF0B 3TNUB 1SL8A 1NHLA 1TOPA 4PV1B 2JTTA 1K96A 3OA7A 1AJ5A 3AE7C 1DJXA 1SFCA 3D74A 1GDTA 1UHHA 1KQMB 1SY9A 1XFXO 3CPWO 4FQOA 1EH2A 1AA0A 1SQPD 2D8NA 2E43A 1EZVG 5KLVE 1GL2D 5IBWA 5KSZA 2Y1MA 2WITA 3G9RA 1NX2A 1W7IB 4BWNA 5I2QA 3BRTB 1XK4A 4U8DA 5I94A 1RF0A 3CC4P 3H1HD 1A4PA 5E79H 1G2CA 1ODBA 2HFED 3TDKA 2NPSC 1HVVA 5APTA 3CL3D 2FBWC 4GUKA 1PL5A 1YJWP 2WCBA 3PJSK 1IK9A 1KORA 5CJ0A 2QEXP 1DJGA 2R3SA 2E76B 1BR4B 2R32A 1IJDB 2PRRA 3E3RA 1SL9A 1NTZE 3IF7A 1FJPA 3RL0D 3CLNA 1SK6D 4JD9A 3L36A 5CSNA 3RL0B 2KAVA 4GGFA 3TS5C 1QX7A 3BCCD 2OYHB 2B88A 1NX1A 1M63B 1Y1XA 2JOJA 1SQBE 4IJ7A 1YR5A 1OW7A 1KCYA 1DJHA 2WC8A 4MVFA 2YIUB 1JY2N 1MWNA 3BASA 3AE5C 3CDNA 2KB7P 3KO0A 2WCMA 5AW4B 4PALA 3DVMA 4Y28J 1FZFA 1TIZA 1X0TA 3IQOA 2F8PA 4K35A 5HYDA 1EZVD 2KZJA 4RJTA 1QLSA 2FYUD 1PV3A 1QX5B 5CCGA 1VQOP 1NOHA 3L73G 1XFYO 3H4SE 3KF9A 1LXFC 1LINA 2E75B 1N73B 2QJPB 1YX8A 1FDOA 2LV7A 1URQD 5FYXA 2WPRA 3JVTB 2O1JA 5BU8B 2SPZA 3O4YA 3I5FB 1URQB 1A75B 3K5BA 2Y0CA 3QRXA 3TDIA 1TUZA 3JCUH 2BCCE 1CI6B 1RQVA 4Q04A 1QIVA 3M0WA 3R4YA 4N1GA 2NXQA 2NZ2A 1NTMG 3TGUG 1LKJA 1VQ5P 2C9LY 3CI9A 2H43A 2WSEJ 1D7MA 3LIEA 2QEHA 2H8VA 2KP8A 3VB1A 3CXHE 1S9KE 3L71J 2ZRSA 1C3YA 2LNKA 1Y0VH 3A5TA 4DZOA 3HRNA 1B8RA 2KNCB 3D77A 1JSAA 1CZQA 4ZCVA 1AUIB 1H88A 2L50A 2LP3A 2ZNDA 4R1EA 4N78E 2JZIA 3RL0g 3S0FA 1J1EC 1Z2CB 3DZTA 3GF3A 3H1HE 1MKMA 1L0LJ 1WMKA 2AXTE 2BCBA 4I5NB 4GT1A 3F45A 2RN0A 4IL6E 4OGQD 1L0LK 3D0YA 4PJ0H 3VN0A 2K7BA 2FY8A 2EC6B 3I5CA 1ALVA 4OGQB 1TRFA 4LC1A 3PRJA 1N7SC 4DCKA 1R6PA 1BLQA 2LVJA 3GK4X 1SQQJ 4KYNA 2JJLA 2LHLA 2W6BA 1KQSO 3C8VA 4I7ZC 1ZOYC 1SQQK 3B71A 3HE5A 2OTGC 3DD4A 3JTDB 3Q8IA 2BEQD 4H13D 3WMM0 1T14A 2OS8C 3BCCE 2O01H 2L51A 1J2JB 3PP5A 1QV0A 2KI6D 4H13B 1RK9A 4CFRA 2K2AA 3NMDA 4OH8B 2MRDA 1TCFA 3L71G 5HKYA 4BRYA 1QX2A 1NAYA 1WY9A 2K3RA 3A4UB 4L9MA 1KFNA 2D2CD 1LT1A 1TUJA 3M9QA 2F3YA 1HBWA 5EFWB 2JT0A 2QRXA 3P32A 1HUCA 2FCEA 2KPHA 1S5LH 3IAOA 2E74C 2KFGA 2M3EA 2FYNC 5AEQA 5AVTB 3QMEA 1EZVE 3L37A 3HD7A 3O2PA 2KYCA 4N3YB 1E79H 1BODA 2WC5A 3AE4C 2CT9A 2JPOA 5I8NA 3MD0A 3NHIA 1GD2E 1L0NJ 1SPYA 1OIPA 1LP1B 1L0NK 3A7OA 5L8RJ 2POHA 1A29A 5I2OA 2P10A 2L91A 1N86A 2JKVA 2FFDC 2M1UA 2WMMA 1HT9A 1J7RA 2FJUB 2O60A 2PSRA 1SQVG 3TS5B 5GTIE 2KOTA 2Q3IA 3H1IJ 1KYOE 3H32A 2K9JB 1EXRA 2NRGA 1YI2P 3L71D 1GK6A 1OOFA 3W67A 1FOSF 3B7AA 4HSZA 1RY3A 4EYYQ 3L47A 3NTNA 2LR2A 2QM8A 3LCPC 1OOHA 5B66H 3RM1A 1SP4A 1SQXJ 1B4CA 2LMUA 3GK2A 1GGWA 2B87B 2K8MB 1SQXK 3HE4A 2DOQA 5TISH 1L0LD 1V1FA 2BASA 2QSIA 2R5BA 3EQ2A 1L0NG 3PN7C 1JM0A 1MHOA 3BUMB 2M49B 1OW8A 3IN6A 1QXPA 3AE3C 4YRUA 2N1TC 1VQ7P 1SQQD 2A45I 3V2QA 5AVYB 1NH4A 4B86A 2M8RA 4JF7A 3TZ1A 3BUOB 4CPVA 4TLFA 1BU3A 2M7LA 2ZN9A 3B6XA 2E42A 2HODB 2WT7A 4GIFA 3AAKA 1SQBJ 1LA3A 1FZBA 2WC6A 1VQ6P 4AQIA 2I94A 1SQBK 1WRGA 4K3AA 2HYNA 5B5EE 2QIWA 1UUSA 1PVBA 1QJTA 3C1VA 2AEJA 3A8RA 3MSEB 1AV1A 1LTJA 1GL2C 3CTNA 1CLMA 1SQXG 2L0PA 1OX3A 1LTTC 4RKUJ 1XFRA 2KSPA 1YVHA 3CXHI 5KAIE 1ZMZA 4N1FA 2YO2A 1JWDA 2P67A 1PPJG 1NAFA 1KQVA 2AEMA 1CW5A 3D75A 5KAFH 3HX4A 1S4XA 3SJSA 1C7VA 3FWNA 3SG6A 1NKZB 4P2YB 1ORGA 2JT8A 2P70A 1M1KQ 1DC1A 1KC8Q 1L0ND 2HQWA 3U1CA 1NTKJ 1PP9G 1U5IA 1OMVA 4YPCA 3V2NA 3UIAA 1IC2A 1SL7A 3PH0A 2H2KA 1M45A 3OHMB 1W5CE 1Y9BA 3E7KA 2V4HA 1N7SD 1FW4A 2Q6QA 2PP6A 2LM5A 3TNUA 4YXDC 2G3AA 1YHQP 2BCCJ 1BSNA 2RKLA 2YIUC 1N7SB 2QVAA 1NWQA 5AW0B 2JP3A 1QVIZ 1K8UA 4WRIA 1XFVO 3H1ID 1AQ5A 4I7ZB 3TF5A 1J1DC 2KYFA 2YXQB 4ASWA 5DKNA 2OTGB 2FXOA 1G1JA 1LTBC 3I5IC 2HPCA 2M3BA 3RK3D 3V2LA 5GTHH 2OS8B 2M7NA 3TUYC 5FI6A 1P84H 2I2RE 1BE3J 3DVKA 1S26D 1KSOA 1MFTA 3L71E 1SQXD 5AVWB 2FYZA 1Q90D 3GK1A 1JY3P 3RBZA 2JC2A 1NGMB 2HLOA 2JR8A 3ZNIA 1RWYA 2LMVA 4ZCUA 1R8EA 2LMTA 1PPJD 2E74D 1D1OA 1FI5A 5DKRA 3AE1C 3H1KJ 2O01J 2E74B 1NTKG 1NYAA 2PALA 2FYNB 1R2UA 2AEFA 1EC5A 1EZVI 3WHUB 2MHHA 2Y0EA 1H8AA 1N2DC 2H61A 2KLDA 1IKUA 2QA4P 1IZNB 2Y9ZA 2JXLA 2OYHA 5AW8B 1H0TB 2A06G 5AW6B 1NX0A 3T97B 2GV5A 1VQMP 3L75J 5CBOA 3IVTA 3H1LJ 2PGDA 1X22A 3A0BH 1SQBD 1HWTC 3EG5B 2JWWA 4C0KA 1MUXA 3IQQA 1N65A 2QEVA 1WLMA 5HL1A 2SCPA 5KJ7A 4E68A 1S6JA 3RLZA 2LXBA 3BXKA 5JJGA 3FIAA 2Z4EA 1BE3G 4L75A 2FFDB 3FWBA 3PM2A 1IFJA 3EVUA 2G8YA 1KSMA 4INXA 3UO9A 2LHIA 1KYOI 3FX0A 2BEZF 1USEA 1K95A 4C0JA 2WVRA 3W68A 4PE4A 3EVVA 4A7PA 3KPXA 2LVVA 1N73A 5HKWA 5CSIA 3H1JG 1PGQA 3V6IA 1SBJA 1CB1A 1UWOA 3LLEA 2L4HA 3H1KG 1NU1G 2BKHB 1MXEA 1A75A 3CCSP 1VL2A 1KFXL 2CBLA 3OGNA 3Q5RA 1L4AA 1NTKD 4OGQC 1QV1A 1SFCC 1Y8AA 4PHNA 2Q1KA 1FJKA 1J55A 4HH2A 2YKQA 3PN7B 1L0NE 1GU5A 2BCCD 3MZWB 1CTRA 2ZN8A 4GAOA 1XK4C 2N1TB 4WWIA 1GK4A 1RF0C 5DJTB 1IFIA 4LGDE 2LANA 1CDMA 2CK3H 1OXZA 4YI8A 1NX3A 2J58A 1F71A 4OR9B 2KI6C 2Q4UA 5E79E 5AVVB 4F0ZB 5KU1A 1LWUC 2KI4C 1HJ0A 1LTIC 2MLFC 4JKTA 1S9KD 1ZV8A 3H1IE 4BY5A 2I18A 3CWGA 1BE3D 3VMXA 1UP5A 3FGAD 1OW4A 1W2BO 2D2CC 2GA1A 2K88A 2K0JA 3B5ND 3S0BA 2ZVNB 1USDA 3GHGC 2ZT9C 3RK3E 4ORAB 2ZXXA 4CFQA 2PVBA 4MSPA 3G6EP 4N78D 3S4RA 4ZKUA 5DKQA 1NCYA 1GL2B 2F3ZA 3K1EA 1SQXE 3H1KD 4L73A 4YGEB 4O9BA 1QL1A 2VRSA 4XE5B 5FI2A 1KILA 4L76A 3SS4A 2IBZG 1K9MQ 5CCHA 1PPJE 5AW1B 2O1KA 1OMDA 3L75D 1FC2C 1N7LA 3N4XA 3L73J 4U3FG 3WXAA 1K2HA 2WORA 4MBEA 3H1LD 3PLFB 2BAPA 3M0DA 4KT0J 1PALA 2KYVA 1Z4HA 2YKOA 3O6QB 1KQFB 3BVHA 1PP9E 2OYIA 1PK0D 4KJMA 1ZACA 3V2PA 1MR8A 5CCGC 1W9ZA 1UURA 2JNXA 3FWLA 1Z56A 5TNCA 1T6AA 2K1AA 4I5KA 4JBZA 3OB2B 2WSCJ 2HETA 3CCVP 4D6TG 3SG3A 2M97A 2AAOA 2JULA 1F55A 1YQ3C 3P7KA 1X8YA 1OVUA 2K7OA 4QJ5B 1NTMJ 3TGUJ 1YITP 1J1DB 2JRFA 5D3OA 3CYZA 1QWVA 1F8HA 1NTMK 3ABVC 3MUDA 5ER4X 1MF8B 1PGJA 3I5IB 4XJKB 1W2EA 1RROA 2GM4A 2OYOA 4P5OE 1LVCD 2WCKA 1OMIA 2H7HA 4OV2A 3TUYB 2MAZA 2E30A 2ZAEB 1S1EA 1QVFO 4WY4A 1ZR2A 1W7JB 1IIOA 2K9YA 3HTKA 1DH3A 3JCUE 5AVQB 2QDIA 5CBNA 1TU3F 1IRJA 2NPSA 3M0AA 3V2RA 2VRGA 3AEBC 3E1RA 3EK7A 4GBAA 3F5HA 4R4MA 4AQRD 3IR9A 2L5XB 3AE2C 1YTZT 3S0EA 5KTBA 1KFUL 1DX7A 2V7QJ 4MRYA 2Q3EA 2QM7A 1ZUZA 2O5GA 2ZFDA 1NTKE 4OZDA 2KOGA 4QMAA 3R72A 4PCWA 3BOWB 2BL0C 3AE8C 4CIDA 4DIRA 1K9PA 2BKIB 4FQTA 2JU0A 1CLLA 1K8AQ 4WQ2A 2BCAA 1Q80A 1AVYA 2ITAA 4ICBA 3VMZA 2L98A 4C7NB 1KYOD 2ZKMX 4GPLB 4WBAA 1YUUA 5AVSB 3L70G 4IOIH 3BQ3A 3H6PA 5TJHA 1C07A 4YGCB 2ZVOB 1P28A 1JNMA 1VPCA 2G2BA 1CDPA 2B87A 1PULA 4H0LD 4PE1A 3O8ZA 3LW5H 1MXLC 1FZEA 3VROA 4PJ0E 1FDMA 4D1EA 4XA4A 1KWOC 1HTLC 1BE3E 4H0LB 4EIJA 2MJWB 1S36A 1M46A 2LC5A 1KZUB 2A45H 1KB9H 5H2FE 1XFWO 2I8DA 2KS1B 2E5TA 2PAJA 3AKAA 1E5WA 4GGNA 1YUTA 1YIJP 3H1JE 1SSEB 1C7WA 1OVRA 3L73D 3H1KE 3OAKA 3CMAP 1NU1E 1RF1C 1Q81Q 2N9BA 1M31A 2LP2A 2QPTA 1DD4A 3EKJA 1KK7Y 1SFCD 5AVZB 1FDIA 1LA0A 1SS1A 3O4XA 4MZKA 4PD4H 1SFCB 1VQ9P 1XO5A 3PJIA 3L75E 3H1LE 2JWDA 3DY9A 3HD7C 2Q9IA 3AEAC 2FOTA 1CFDA 3Q5PA 1OWAA 2P58A 1VF5C 2WCFA 1HQVA 1MUUA 3A0HH 3M9BA 1HH0A 1CDLA 2KBIA 3KEVA 1B7TY 3OB1B 3II6A 1G2CB 3RK3C 1NTMD 3L70D 4I1LA 3TGUD 1PGPA 2IYOA 2LUCA 2WSFH 1S1CX 4AYCA 4GOFA 1X9VA 1SQVJ 1NJIQ 1B47A 1BGYG 1LWUB 2KI4B 2P71A 1AK8A 1SQVK 3BUWB 3B87A 3F89A 4PT1A 1TN4A 3DYEA 1Q7YQ 1K94A 1AFOA 2D2CB 2ZT9D 1RE4A 3L35A 4MLWA 4JYCA 3QWOC 3GHGB 3M91A 2ZT9B 1DIPA 4IL6H 4AUWA 1J1EA 1BF5A 1GM0A 1QEXA 1T2KC 4GKGA 2AXCA 3CCUP 1EDLA 2PFXA 1GTWA 3HCMA 1YVLA 1G1IA 3N7HA 3PATA 3NFQA 1JY3N 1P84D 4DJGA 3SFDC 2LVKA 2KLEA 3SIAA 2IBZE 2WPSA 3VRNA 2Z5IA 2W83C 4C46A 3LIDA 4I2LC 1X02A 3FS7A 1ZRTD 1SKTA 3AE9C 3CMEP 2FXMA 2O3JA 1IK7A 1M1JA 1K9KA 2BCXA 2W27A 2QEBA 1AJYA 2I7AA 1CSBA 1A03A 2M0RA 3DF0A 3WHTB 3I5HC 2OGUA 3JC22 4MN4C 5CCGD 4MEWA 1AVOA 1LTSC 3Q3DA 2KSEA 3CX5D 5TISE 1MZ9A 2LKMA 3EKHA 3PSRA 1EL4A 1E8AA 3D70A 4JYBA 1JY2P 2JQ6A 3TSIA 3NXSA 3I5GC 1LNQA 3CCLP 3GOFA 1IFMA 1Q2NA 3A2AA 4PE7A 4DUQA 1IH0A 1RFJA 1JTHA 2ZYDA 1DEEG 3KDPB 1TWOA 1LT9A 2MA2A 1YTZC 4C7RA 3D10A 3S1KA 3VRPA 1H8BA 5APWA 2JO1A 3FXEA 1ZMEC 1K05A 1R5LA 5BVZA 1CMGA 1JC2A 1GW4A 1LTJC 2LXCB 2NZ0A 4YTPC 4N6JA 3IF4A 3BYAA 3L73E 1XTGB 1CDNA 1YTZI 4LLHA 3VP8A 1PP9J 1QATA 2WOSA 2FFDA 3CD6P 2IFMA 3CWBJ 3VRQA 3KZIE 1BSHA 2J59M 2BL0B 5AW5B 1FZGA 3CZ0A 1KK8C 1DVIA 3K21A 1TNWA 1NUBA 1OOJA 1IQ3A 5KAFE 2RH0A 2WCLA 1SQVD 1NYHA 2GGMA 2M5AA 3WU2H 3B5NC 1EXIA 2YKPA 1NTME 3L70E 3TGUE 4QJ4B 3U59A 1H4BA 1CM1A 3D0YB 4XYNA 5CMZA 4L74A 4Y99C 1VDFA 3AE6C 2Z5HA 1WRKA 2OARA 1KWOB 1SCVA 1AJ4A 3SG2A 1OZOA 2YXRB 3HE5B 1S6IA 5KKZC 2ISDA 3UNWA 4NDBA 5JOLA 2N1TA 1PFIA 3L72G 1RHZB 1H89A 1S5LX 5D7FA 2CXJA 2LLUA 4F7FA 3LW5J 4BRYB 1AHRA 5C39A 3G3ZA 1NTKK 3AKBA 1P84E 1RF1B 2RGIA 2IZ0A 1FPWA 3CWBG 1YJNP 2COLB 4GFTA 1FZCA 1RJVA 2KHNA 5B5EH 1DF0A 4HYTB 1M7LA 1WRLA 2KAYA 1ZRTE 2LLTA 3HD7D 5DJUB 1GW3A 1BG1A 3SS5A 5DICA 3V5BA 4HREE 3HD7B 3SIBA 1VF5D 5AW3B 2H61C 2KFFA 1JOCA 3MGNA 3DXLA 2QG4A 2L2EA 1VF5B 1OE9B 1FS0E 1OSAA 4I5LB 1CNPA 1FAVA 1GL2A 3CX5E 4PDZA 2K7CA 4CLNA 3B86A 4RESB 3RK3B 1JUNA 1Y47A 3CS1A 3KYQA 1BGYE 1VQLP 1V1GA 4UB8H 3HUSC 4AOMA 1XYDA 1KTMA 3A0BE 3BFHA 1Y1UA 4HJGH 5KJ7C 1UHNA 4NPEA 3WUTA 1J7OA 3H1JJ 5AW7B 1SNLA 1T2KD 2J5UA 1AP4A 2L2CA 2MKVA 2JDIH 1NU1J 1KD1Q 3RGUA 2Y4QA 1EDKA 1Y6WA 1U7JA 1B8LA 2KDHA 3R1PA 2BBNA 1NU1K 2XDJA 1J7QA 1ZW0A 1LJ2A 3ZWHA 2G9BA 3NHTA 5CPVA 1PP9D 2R44A 2Q7CA 4ORBB 3KQGA 1ZR4A 3CWBD 3CZTX 2I1JA 4WB4A 2FCDA 2IBZI 2EHBA 4UPGA 2M9GA 3D71A 1J1DA 1QIWA 2H8PD 2WSEH 3CCEP 1TNXA 1L4AC 4BY4A 1NP8A 1FE6A 3HE4B 2Y1NA 1B9AA 2HR3A 1G4YR 1IFDA 4DOJA 2YGUA 2WPQA 3I5HB 1CFCA 4H0LC 3EFGA 2M8UA 1JMMA 1GQMA 3Q5SA 2L5YA 2ZJSE 1SQVE 3H25A 4NPFX 2C0WA 2N9YB 1ZOTB 3NSKA 4H44C 1S5GY 3I5GB 1PIXA 3DVEA 4QJ3B 3BUXB 1GZLA 3V4QA 2WPVB 2WNDA 1N8RQ 1DGVA 2LAPA 2M1KB 4ZMDA 1BCCJ 1URQA 2WT7B 4EDFA 3TDZA 1Y1AA 1SQPG 1FF1A 2QEOA 3VYIA 1CI6A 1DJWA 1IJ6A 4ZKPA 2A06D 1T3JA 1PSRA 1G33A 3S9OA 3VOPA 1DMOA 4U3FJ 2OQQA 1LTJB 2KAXA 4USLA 2K2FA 1UHKA 3BFAA 4KHXA 3CR4X 4IL1A 4HRHA 4MZLA 2QJYC 2IDBA 1JO5A 1JUOA 1HF9A 1RTP1 1T8ZA 2OTJP 1NCZA 1PGOA 2KGRA 1Q86Q 2KNCA 5AVUB 3M0DC 1KK8B 1U7MA 4D6TJ 3B8EB 4YBHB 1B8CA 3BCCG 1JY3O 2OTKE 4ETOA 1OZHA 1S6CA 4OVNF 5APUA 3EFFK 1AQTA 2OYIC 3B5NB 2F2PA 2MBXA 4GGFC 5K89A 2HQ8A 2HPSA 1BCCG 1EQ7A 1RE3A 3H1JD 2XKMA 1EXJA 1F54A 4Y99B 3FE8A 3LL8B 1NU1D 4NPDA 2CCMA 4W7ZA 2RMZA 1ZFSA 2R2IA 2IYPA 1DGUA 2SASA 3VRRA 5KKZB 1BR1B 2IZ1A 3KPEA 3FXDA 3MUDC 4UB6H 1VRKA 5AW2B 1F4OA 3L74J 2HPCB 3NSIA 1HJBA 2DW3A 4OWFA 3L72E 1YYCA 2FYUG 5J3XA 4M3LA 4WY4C 3L4LA 3O78A 3MP7B 1P84I 2E76D 3CWBE 4YGAA 1DJZA 1LWUA 4GODA 2M0BA 3FWCA 1ZN5A 2KXPB 3OX5A 3JSVC 5APXA 5AXIA 3USSA 3VMYA 1KMIZ 3Q2YA 1VQKP 1CFPA 1HGZA 1EG3A 3D73A 1HGVA 1RH5B 3BJHA 3GHGA 1QS7A 3L70J 3D6ZA 1A02J 1IJ5A 2R3CA 2Q5UA 1A2XA 4YGDB
chains in the Genus database with same CATH topology
1B47A 4M2QA 5D69A 5G08A 4NDCA 1UUSA 2KI4B 1AK8A 1XVJA 3BUWB 1PVBA 1QJTA 3SG4A 1YUSA 1YRTB 3C1VA 1TN4A 2EGDA 3A8RA 1K94A 3MSEB 4MN0A 3CTNA 1IQ5A 4NQGA 1CLMA 2P6BB 1CM4A 2L0PA 4MLWA 1N2DA 3BOWA 3LK1A 1FBVA 3KHEA 1YX7A 2KBMA 2KSPA 4PHKA 1YVHA 1J1EA 1BF5A 1CLBA 1ZMZA 4N1FA 1JWDA 2M3WA 3HCMA 1YVLA 3PATA 1KQVA 3HX4A 5KTYA 3SJSA 1K90D 1C7VA 2AUCA 1WLZA 2NLNA 2A4JA 3LK0A 3SG6A 5B8IB 4P2YB 2JT8A 1NIWA 1YRUB 2LVKA 1PRWA 3SIAA 4DRWA 2JNFA 2HQWA 2EC6C 3VRNA 2Q91A 1ALWA 1U5IA 1OMVA 1X02A 3FS7A 1CFFA 1SKTA 2KFHA 1SL7A 5BPJA 3OP0A 5CSFA 1DJYA 2H2KA 1M45A 3OHMB 4JPZB 1K9KA 1FW4A 2BCXA 2I7AA 1WDCB 2LM5A 3ICBA 1A03A 2M0RA 2ZRTA 3DF0A 3I5HC 3WHTB 3JTDC 1OQPA 3OX6A 1XA5A 4I5JA 1KFXS 4MEWA 1QVIZ 1S5GZ 2WCEA 1K8UA 4WRIA 1XFVO 3BUNB 4ORCB 3EKHA 3PSRA 3DVJA 1SMGA 1EL4A 1E8AA 1U5IB 2JQ6A 2KYFA 2V53A 2ZNEA 1GJYA 5DKNA 2OTGB 2L4IA 4TNCA 3I5GC 5HKZA 1BOCA 3O6BA 3I5IC 3EVRA 1K93D 3GOFA 4PE7A 2B1UA 4DUQA 2LLSA 2OS8B 1CKKA 2M7NA 2PRUA 1IH0A 2CTNA 1DF0B 3VGOA 1SL8A 3TUYC 1TOPA 4FTGA 1RFJA 2I2RE 2JTTA 1K96A 3DVKA 1AJ5A 1MQ1A 1DJXA 1S26D 1KSOA 1UHHA 1KQMB 1JF0A 1UHJA 1SY9A 3GK1A 2MA2A 1YTZC 1XFXO 2JC2A 4FQOA 5AERA 5I2LA 1EH2A 3D10A 2D8NA 5CSJA 3PFVA 3ZNIA 1RWYA 2LMVA 4ZCUA 3VRPA 5IBWA 5KSZA 2Y1MA 1H8BA 2LMTA 4C0LA 2IS9A 1NX2A 1W7IB 1QLKA 5I2QA 1XK4A 1D1OA 1SR6C 4U8DA 1FI5A 4PE0A 5DKRA 1A4PA 4JWQA 1CMGA 1JC2A 1NYAA 2PALA 1R2UA 1ODBA 2NZ0A 3WHUB 2MHHA 3BYAA 4NDDA 2H61A 1IKUA 1CDNA 5HLVA 2Y9ZA 2JXLA 1J7PA 2OPOA 3WNXB 1AVSA 1NX0A 4GUKA 2WCBA 2GV5A 1QATA 2WOSA 1DJGA 1BR4B 4PHMA 3VRQA 3E3RA 1SL9A 3IF7A 2BL0B 1QASA 2JWWA 4AQJA 1KK8C 3CLNA 4C0KA 1DVIA 1MUXA 1SK6D 3K21A 1TNWA 1NUBA 1OOJA 3IQQA 1IQ3A 1N65A 1BMOA 5CSNA 5HLOA 2KAVA 4GGFA 3TS5C 1QX7A 3CR2A 1WLMA 1NX1A 2SCPA 2GGZA 3EK4A 4E68A 2GGMA 1S6JA 3RLZA 1M63B 1Y1XA 3BXKA 1B1GA 2JOJA 5JJGA 1L2OC 3FIAA 1YR5A 2HF5A 1KCYA 1DJHA 2WC8A 3FWBA 4MVFA 4QJ4B 1H4BA 1CM1A 3D0YB 4XYNA 3EVUA 1DJIA 4DS7A 1KSMA 1MWNA 1EJ3A 2LHIA 3KO0A 4MRXA 1K95A 4C0JA 4PALA 1WRKA 4PE4A 3DVMA 3EVVA 1TNPA 1KWOB 1NCXA 1SCVA 1AJ4A 1EG4A 1TIZA 2LVVA 3IQOA 1OZOA 3KPXA 5HKWA 3SG2A 5CSIA 1S6IA 2F8PA 1KK7Z 1SBJA 2BBMA 5HYDA 1CB1A 1UWOA 3LLEA 2L4HA 2ISDA 1SYMA 2K7DA 4M2PA 3CR5X 4NDBA 2BKHB 5JOLA 1MXEA 1A75A 1KFXL 1QLSA 2CBLA 1QX5B 2BECA 5D7FA 2CXJA 2LLUA 1QV1A 2JT3A 1AHRA 1XFYO 2Y5IA 3H4SE 4PHNA 3KF9A 1LXFC 5F6TA 3AKBA 1LINA 1J55A 2RGIA 1FPWA 1YX8A 2COLB 4GFTA 1SCMC 2LV7A 1B7TZ 3PN7B 1RJVA 5FYXA 2KHNA 3JVTB 1DF0A 1CTRA 1WRLA 2JXCA 3O4YA 2KAYA 2JTZA 1XK4C 2ZN8A 3I5FB 4GAOA 1A75B 4HRGA 5PALA 1JF2A 2LLTA 2LANA 1CDMA 1BG1A 3PALA 5ER5A 4YI8A 3QRXA 1NX3A 4HREE 3TDIA 3SIBA 1F70A 2H61C 1F71A 4OR9B 2KI6C 2KFFA 2Q4UA 4Q04A 1KFUS 1QIVA 2PASA 3M0WA 4F0ZB 5KU1A 2L2EA 1OE9B 2KI4C 2JPTA 1OSAA 4I5LB 4N1GA 1CNPA 2MLFC 2PMYA 2NXQA 4PDZA 2K7CA 4BY5A 1LKJA 2I18A 3CWGA 4CLNA 1UP5A 1F4QA 2K0JA 1GGZA 3CS1A 1OFCX 3NSOA 2BE4A 1V1GA 2F2OA 4ORAB 4AOMA 1TTXA 1XYDA 4CFQA 2QACA 2PVBA 4MSPA 1BT6A 1Y1UA 2ZRSA 1BJFA 1UHNA 4PHJA 2LNKA 5DKQA 1Y0VH 1NCYA 1J7OA 1SNLA 2F3ZA 1NWDA 3CGAA 1B8RA 3NXAA 1AP4A 4YGEB 4GNKB 4MZJA 1JSAA 4ZCVA 1AUIB 2Y4QA 1Y6WA 1XFZO 1N0YA 1B8LA 2L50A 2KDHA 2LP3A 2BBNA 2ZNDA 4R1EA 1J7QA 2JZIA 3ZWHA 2G9BA 5CPVA 1OMDA 1SRAA 3WXAA 1K2HA 2WORA 2BCBA 4MBEA 4ORBB 4I5NB 4WQ3A 4OKHA 3F45A 2TN4A 3PLFB 2M29A 3CZTX 1PALA 2FCDA 3D0YA 2EHBA 1WDCC 2K7BA 4UPGA 2EC6B 2M9GA 1ALVA 2LE9B 1TRFA 1CMFA 1J1DA 1QIWA 1IWQA 4DCKA 1R6PA 1PK0D 1TNXA 1BLQA 1ZACA 2LVJA 3GK4X 1MR8A 2JNXA 1UURA 2LHLA 3SG5A 4BY4A 4OCIA 1NP8A 5TNCA 2Y1NA 1B9AA 1PSBA 4I5KA 1G4YR 5GQQC 2OTGC 3OB2B 1IG5A 3DD4A 2HETA 3I5HB 3JTDB 1CFCA 1XFUO 2M8UA 2M97A 3SG3A 2AAOA 1GQMA 2JULA 1F55A 2OS8C 2K7OA 2L51A 4QJ5B 1QV0A 2KI6D 1RK9A 2JRFA 4CFRA 2K2AA 1ZOTB 1TCFA 2MRDA 3NSKA 5HKYA 1F8HA 1QVIY 1S5GY 1KQMC 5ER4X 1MF8B 3I5GB 1NSHA 1QX2A 3DVEA 3I5IB 4XJKB 1RROA 4QJ3B 3BUXB 1WY9A 3A4UB 4L9MA 1JBAA 4P5OE 1LVCD 2WNDA 4OV2A 1PVAA 3TUYB 1YURA 2MAZA 1DGVA 1TCOB 2E30A 1S1EA 1QTXA 2LAPA 2M1KB 2F3YA 1W7JB 2JT0A 1IGVA 2FCEA 1IRJA 3TDZA 2VRGA 2KFGA 2KQYA 4A4CA 1Y1AA 5AEQA 3EK7A 4GBAA 1FF1A 2L5XB 1DJWA 1IJ6A 3O2PA 2KYCA 1KFUL 1PSRA 1SR6B 1G33A 1G8IA 4MRYA 1ZUZA 2O5GA 2ZFDA 1BODA 2E6WA 1S3PA 1DMOA 1K9UA 2CT9A 5I8NA 4A4BA 2KAXA 1DT7B 4USLA 4PCWA 2CNPA 2K2FA 3BOWB 1UHKA 2BL0C 2NCPA 1L7ZA 1SPYA 4CIDA 2K61A 4DIRA 1K9PA 2BKIB 2JU0A 1CLLA 3PM8A 4WQ2A 3TDUA 2BCAA 1Q80A 2KNEA 3CR4X 1M39A 1A29A 4IL1A 5I2OA 4HRHA 4ICBA 4MZLA 4YGBB 2KQ6A 4JQ0D 2L98A 1JUOA 1OMRA 2ZKMX 4GPLB 1RTP1 2LUXA 1YUUA 1WRZA 1NCZA 2BE6A 2KGRA 2M1UA 1HT9A 1J7RA 1KK8B 3BQ3A 2LVIA 2FJUB 2O60A 2PSRA 1TNQA 4N5XA 4YGCB 1C07A 4YBHB 1B8CA 1OZSA 3TS5B 2KOTA 2G2BA 1CDPA 1PULA 4ETOA 1S6CA 2NCOA 4OVNF 4PE1A 1EXRA 3NSLA 1MXLC 2F2PA 2MBXA 3VROA 4GGFC 4D1EA 2HQ8A 5K89A 1KWOC 1L2OB 4HSZA 2HPSA 2LCPA 2MJWB 1S36A 1M46A 2LC5A 1F54A 3DF0B 3LL8B 1XFWO 2F33A 4YI9A 3LCPC 1JFJA 2CCMA 1DTLA 3RM1A 1B4CA 2LMUA 2MLEC 3GK2A 3AKAA 1GGWA 5AANA 1ZFSA 2R2IA 4GGNA 1YUTA 2K8MB 1DGUA 2DOQA 2SASA 4M2OA 1C7WA 3VRRA 1BR1B 1VRKA 1F4OA 1V1FA 3NSIA 1M31A 2LP2A 2QPTA 3EKJA 1KK7Y 3PN7C 1UHIA 5J3XA 1MHOA 3JVTC 1LA0A 3BUMB 2M49B 4MZKA 1QXPA 4YRUA 3I5FC 3O78A 1XO5A 2AMIA 2KGBC 3SG7A 4XJKA 4YGAA 1DJZA 3AAJA 1SCMB 3FWCA 1NPQA 3TZ1A 2FOTA 1CFDA 3BUOB 3OX5A 4CPVA 5AFPA 5AXIA 1SW8A 2Y9YA 1BU3A 2M7LA 2WCFA 1HQVA 2ZN9A 1CFPA 1RECA 1EG3A 1CDLA 2KBIA 3KEVA 1B7TY 3OB1B 3AAKA 1JFKA 1LA3A 1QS7A 3EK8A 1FI6A 2LUCA 4AQIA 1IJ5A 2I94A 1A2XA 4YGDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B47 A;  4M2Q A;  5D69 A;  5G08 A;  4NDC A;  1UUS A;  2KI4 B;  1AK8 A;  1XVJ A;  3BUW B;  1PVB A;  1QJT A;  3SG4 A;  1YUS A;  1YRT B;  3C1V A;  1TN4 A;  2EGD A;  3A8R A;  1K94 A;  3MSE B;  4MN0 A;  3CTN A;  1IQ5 A;  4NQG A;  1CLM A;  2P6B B;  1CM4 A;  2L0P A;  4MLW A;  1N2D A;  3BOW A;  3LK1 A;  1FBV A;  3KHE A;  1YX7 A;  2KBM A;  2KSP A;  4PHK A;  1YVH A;  1J1E A;  1BF5 A;  1CLB A;  1ZMZ A;  4N1F A;  1JWD A;  2M3W A;  3HCM A;  1YVL A;  3PAT A;  1KQV A;  3HX4 A;  5KTY A;  3SJS A;  1K90 D;  1C7V A;  2AUC A;  1WLZ A;  2NLN A;  2A4J A;  3LK0 A;  3SG6 A;  5B8I B;  4P2Y B;  2JT8 A;  1NIW A;  1YRU B;  2LVK A;  1PRW A;  3SIA A;  4DRW A;  2JNF A;  2HQW A;  2EC6 C;  3VRN A;  2Q91 A;  1ALW A;  1U5I A;  1OMV A;  1X02 A;  3FS7 A;  1CFF A;  1SKT A;  2KFH A;  1SL7 A;  5BPJ A;  3OP0 A;  5CSF A;  1DJY A;  2H2K A;  1M45 A;  3OHM B;  4JPZ B;  1K9K A;  1FW4 A;  2BCX A;  2I7A A;  1WDC B;  2LM5 A;  3ICB A;  1A03 A;  2M0R A;  2ZRT A;  3DF0 A;  3I5H C;  3WHT B;  3JTD C;  1OQP A;  3OX6 A;  1XA5 A;  4I5J A;  1KFX S;  4MEW A;  1QVI Z;  1S5G Z;  2WCE A;  1K8U A;  4WRI A;  1XFV O;  3BUN B;  4ORC B;  3EKH A;  3PSR A;  3DVJ A;  1SMG A;  1EL4 A;  1E8A A;  1U5I B;  2JQ6 A;  2KYF A;  2V53 A;  2ZNE A;  1GJY A;  5DKN A;  2OTG B;  2L4I A;  4TNC A;  3I5G C;  5HKZ A;  1BOC A;  3O6B A;  3I5I C;  3EVR A;  1K93 D;  3GOF A;  4PE7 A;  2B1U A;  4DUQ A;  2LLS A;  2OS8 B;  1CKK A;  2M7N A;  2PRU A;  1IH0 A;  2CTN A;  1DF0 B;  3VGO A;  1SL8 A;  3TUY C;  1TOP A;  4FTG A;  1RFJ A;  2I2R E;  2JTT A;  1K96 A;  3DVK A;  1AJ5 A;  1MQ1 A;  1DJX A;  1S26 D;  1KSO A;  1UHH A;  1KQM B;  1JF0 A;  1UHJ A;  1SY9 A;  3GK1 A;  2MA2 A;  1YTZ C;  1XFX O;  2JC2 A;  4FQO A;  5AER A;  5I2L A;  1EH2 A;  3D10 A;  2D8N A;  5CSJ A;  3PFV A;  3ZNI A;  1RWY A;  2LMV A;  4ZCU A;  3VRP A;  5IBW A;  5KSZ A;  2Y1M A;  1H8B A;  2LMT A;  4C0L A;  2IS9 A;  1NX2 A;  1W7I B;  1QLK A;  5I2Q A;  1XK4 A;  1D1O A;  1SR6 C;  4U8D A;  1FI5 A;  4PE0 A;  5DKR A;  1A4P A;  4JWQ A;  1CMG A;  1JC2 A;  1NYA A;  2PAL A;  1R2U A;  1ODB A;  2NZ0 A;  3WHU B;  2MHH A;  3BYA A;  4NDD A;  2H61 A;  1IKU A;  1CDN A;  5HLV A;  2Y9Z A;  2JXL A;  1J7P A;  2OPO A;  3WNX B;  1AVS A;  1NX0 A;  4GUK A;  2WCB A;  2GV5 A;  1QAT A;  2WOS A;  1DJG A;  1BR4 B;  4PHM A;  3VRQ A;  3E3R A;  1SL9 A;  3IF7 A;  2BL0 B;  1QAS A;  2JWW A;  4AQJ A;  1KK8 C;  3CLN A;  4C0K A;  1DVI A;  1MUX A;  1SK6 D;  3K21 A;  1TNW A;  1NUB A;  1OOJ A;  3IQQ A;  1IQ3 A;  1N65 A;  1BMO A;  5CSN A;  5HLO A;  2KAV A;  4GGF A;  3TS5 C;  1QX7 A;  3CR2 A;  1WLM A;  1NX1 A;  2SCP A;  2GGZ A;  3EK4 A;  4E68 A;  2GGM A;  1S6J A;  3RLZ A;  1M63 B;  1Y1X A;  3BXK A;  1B1G A;  2JOJ A;  5JJG A;  1L2O C;  3FIA A;  1YR5 A;  2HF5 A;  1KCY A;  1DJH A;  2WC8 A;  3FWB A;  4MVF A;  4QJ4 B;  1H4B A;  1CM1 A;  3D0Y B;  4XYN A;  3EVU A;  1DJI A;  4DS7 A;  1KSM A;  1MWN A;  1EJ3 A;  2LHI A;  3KO0 A;  4MRX A;  1K95 A;  4C0J A;  4PAL A;  1WRK A;  4PE4 A;  3DVM A;  3EVV A;  1TNP A;  1KWO B;  1NCX A;  1SCV A;  1AJ4 A;  1EG4 A;  1TIZ A;  2LVV A;  3IQO A;  1OZO A;  3KPX A;  5HKW A;  3SG2 A;  5CSI A;  1S6I A;  2F8P A;  1KK7 Z;  1SBJ A;  2BBM A;  5HYD A;  1CB1 A;  1UWO A;  3LLE A;  2L4H A;  2ISD A;  1SYM A;  2K7D A;  4M2P A;  3CR5 X;  4NDB A;  2BKH B;  5JOL A;  1MXE A;  1A75 A;  1KFX L;  1QLS A;  2CBL A;  1QX5 B;  2BEC A;  5D7F A;  2CXJ A;  2LLU A;  1QV1 A;  2JT3 A;  1AHR A;  1XFY O;  2Y5I A;  3H4S E;  4PHN A;  3KF9 A;  1LXF C;  5F6T A;  3AKB A;  1LIN A;  1J55 A;  2RGI A;  1FPW A;  1YX8 A;  2COL B;  4GFT A;  1SCM C;  2LV7 A;  1B7T Z;  3PN7 B;  1RJV A;  5FYX A;  2KHN A;  3JVT B;  1DF0 A;  1CTR A;  1WRL A;  2JXC A;  3O4Y A;  2KAY A;  2JTZ A;  1XK4 C;  2ZN8 A;  3I5F B;  4GAO A;  1A75 B;  4HRG A;  5PAL A;  1JF2 A;  2LLT A;  2LAN A;  1CDM A;  1BG1 A;  3PAL A;  5ER5 A;  4YI8 A;  3QRX A;  1NX3 A;  4HRE E;  3TDI A;  3SIB A;  1F70 A;  2H61 C;  1F71 A;  4OR9 B;  2KI6 C;  2KFF A;  2Q4U A;  4Q04 A;  1KFU S;  1QIV A;  2PAS A;  3M0W A;  4F0Z B;  5KU1 A;  2L2E A;  1OE9 B;  2KI4 C;  2JPT A;  1OSA A;  4I5L B;  4N1G A;  1CNP A;  2MLF C;  2PMY A;  2NXQ A;  4PDZ A;  2K7C A;  4BY5 A;  1LKJ A;  2I18 A;  3CWG A;  4CLN A;  1UP5 A;  1F4Q A;  2K0J A;  1GGZ A;  3CS1 A;  1OFC X;  3NSO A;  2BE4 A;  1V1G A;  2F2O A;  4ORA B;  4AOM A;  1TTX A;  1XYD A;  4CFQ A;  2QAC A;  2PVB A;  4MSP A;  1BT6 A;  1Y1U A;  2ZRS A;  1BJF A;  1UHN A;  4PHJ A;  2LNK A;  5DKQ A;  1Y0V H;  1NCY A;  1J7O A;  1SNL A;  2F3Z A;  1NWD A;  3CGA A;  1B8R A;  3NXA A;  1AP4 A;  4YGE B;  4GNK B;  4MZJ A;  1JSA A;  4ZCV A;  1AUI B;  2Y4Q A;  1Y6W A;  1XFZ O;  1N0Y A;  1B8L A;  2L50 A;  2KDH A;  2LP3 A;  2BBN A;  2ZND A;  4R1E A;  1J7Q A;  2JZI A;  3ZWH A;  2G9B A;  5CPV A;  1OMD A;  1SRA A;  3WXA A;  1K2H A;  2WOR A;  2BCB A;  4MBE A;  4ORB B;  4I5N B;  4WQ3 A;  4OKH A;  3F45 A;  2TN4 A;  3PLF B;  2M29 A;  3CZT X;  1PAL A;  2FCD A;  3D0Y A;  2EHB A;  1WDC C;  2K7B A;  4UPG A;  2EC6 B;  2M9G A;  1ALV A;  2LE9 B;  1TRF A;  1CMF A;  1J1D A;  1QIW A;  1IWQ A;  4DCK A;  1R6P A;  1PK0 D;  1TNX A;  1BLQ A;  1ZAC A;  2LVJ A;  3GK4 X;  1MR8 A;  2JNX A;  1UUR A;  2LHL A;  3SG5 A;  4BY4 A;  4OCI A;  1NP8 A;  5TNC A;  2Y1N A;  1B9A A;  1PSB A;  4I5K A;  1G4Y R;  5GQQ C;  2OTG C;  3OB2 B;  1IG5 A;  3DD4 A;  2HET A;  3I5H B;  3JTD B;  1CFC A;  1XFU O;  2M8U A;  2M97 A;  3SG3 A;  2AAO A;  1GQM A;  2JUL A;  1F55 A;  2OS8 C;  2K7O A;  2L51 A;  4QJ5 B;  1QV0 A;  2KI6 D;  1RK9 A;  2JRF A;  4CFR A;  2K2A A;  1ZOT B;  1TCF A;  2MRD A;  3NSK A;  5HKY A;  1F8H A;  1QVI Y;  1S5G Y;  1KQM C;  5ER4 X;  1MF8 B;  3I5G B;  1NSH A;  1QX2 A;  3DVE A;  3I5I B;  4XJK B;  1RRO A;  4QJ3 B;  3BUX B;  1WY9 A;  3A4U B;  4L9M A;  1JBA A;  4P5O E;  1LVC D;  2WND A;  4OV2 A;  1PVA A;  3TUY B;  1YUR A;  2MAZ A;  1DGV A;  1TCO B;  2E30 A;  1S1E A;  1QTX A;  2LAP A;  2M1K B;  2F3Y A;  1W7J B;  2JT0 A;  1IGV A;  2FCE A;  1IRJ A;  3TDZ A;  2VRG A;  2KFG A;  2KQY A;  4A4C A;  1Y1A A;  5AEQ A;  3EK7 A;  4GBA A;  1FF1 A;  2L5X B;  1DJW A;  1IJ6 A;  3O2P A;  2KYC A;  1KFU L;  1PSR A;  1SR6 B;  1G33 A;  1G8I A;  4MRY A;  1ZUZ A;  2O5G A;  2ZFD A;  1BOD A;  2E6W A;  1S3P A;  1DMO A;  1K9U A;  2CT9 A;  5I8N A;  4A4B A;  2KAX A;  1DT7 B;  4USL A;  4PCW A;  2CNP A;  2K2F A;  3BOW B;  1UHK A;  2BL0 C;  2NCP A;  1L7Z A;  1SPY A;  4CID A;  2K61 A;  4DIR A;  1K9P A;  2BKI B;  2JU0 A;  1CLL A;  3PM8 A;  4WQ2 A;  3TDU A;  2BCA A;  1Q80 A;  2KNE A;  3CR4 X;  1M39 A;  1A29 A;  4IL1 A;  5I2O A;  4HRH A;  4ICB A;  4MZL A;  4YGB B;  2KQ6 A;  4JQ0 D;  2L98 A;  1JUO A;  1OMR A;  2ZKM X;  4GPL B;  1RTP 1;  2LUX A;  1YUU A;  1WRZ A;  1NCZ A;  2BE6 A;  2KGR A;  2M1U A;  1HT9 A;  1J7R A;  1KK8 B;  3BQ3 A;  2LVI A;  2FJU B;  2O60 A;  2PSR A;  1TNQ A;  4N5X A;  4YGC B;  1C07 A;  4YBH B;  1B8C A;  1OZS A;  3TS5 B;  2KOT A;  2G2B A;  1CDP A;  1PUL A;  4ETO A;  1S6C A;  2NCO A;  4OVN F;  4PE1 A;  1EXR A;  3NSL A;  1MXL C;  2F2P A;  2MBX A;  3VRO A;  4GGF C;  4D1E A;  2HQ8 A;  5K89 A;  1KWO C;  1L2O B;  4HSZ A;  2HPS A;  2LCP A;  2MJW B;  1S36 A;  1M46 A;  2LC5 A;  1F54 A;  3DF0 B;  3LL8 B;  1XFW O;  2F33 A;  4YI9 A;  3LCP C;  1JFJ A;  2CCM A;  1DTL A;  3RM1 A;  1B4C A;  2LMU A;  2MLE C;  3GK2 A;  3AKA A;  1GGW A;  5AAN A;  1ZFS A;  2R2I A;  4GGN A;  1YUT A;  2K8M B;  1DGU A;  2DOQ A;  2SAS A;  4M2O A;  1C7W A;  3VRR A;  1BR1 B;  1VRK A;  1F4O A;  1V1F A;  3NSI A;  1M31 A;  2LP2 A;  2QPT A;  3EKJ A;  1KK7 Y;  3PN7 C;  1UHI A;  5J3X A;  1MHO A;  3JVT C;  1LA0 A;  3BUM B;  2M49 B;  4MZK A;  1QXP A;  4YRU A;  3I5F C;  3O78 A;  1XO5 A;  2AMI A;  2KGB C;  3SG7 A;  4XJK A;  4YGA A;  1DJZ A;  3AAJ A;  1SCM B;  3FWC A;  1NPQ A;  3TZ1 A;  2FOT A;  1CFD A;  3BUO B;  3OX5 A;  4CPV A;  5AFP A;  5AXI A;  1SW8 A;  2Y9Y A;  1BU3 A;  2M7L A;  2WCF A;  1HQV A;  2ZN9 A;  1CFP A;  1REC A;  1EG3 A;  1CDL A;  2KBI A;  3KEV A;  1B7T Y;  3OB1 B;  3AAK A;  1JFK A;  1LA3 A;  1QS7 A;  3EK8 A;  1FI6 A;  2LUC A;  4AQI A;  1IJ5 A;  2I94 A;  1A2X A;  4YGD B; 
#chains in the Genus database with same CATH topology
 2WCH A;  4IFD K;  5G08 A;  4NDC A;  1VQ4 P;  3CX5 I;  1YUS A;  1RQU A;  1YRT B;  3RK2 C;  3AEF C;  3CAB A;  4MN0 A;  1U57 A;  1BCC D;  4NQG A;  1YBK A;  1DEK A;  2XZR A;  2P6B B;  1CM4 A;  1FBM A;  3SFE C;  3LK1 A;  3KHE A;  3KHU A;  5KJ7 D;  3HUS B;  1LP1 A;  3QH9 A;  3L74 G;  2IBZ D;  5APY A;  1VQN P;  3CCR P;  1OOG A;  2AUC A;  1WLZ A;  3IFM A;  2NLN A;  4U3F D;  2A4J A;  1QX8 A;  1NIW A;  3G71 P;  1PRW A;  3FE9 A;  4DRW A;  3CLQ A;  2JNF A;  1VQ8 P;  4INW A;  2KI7 B;  2Q91 A;  2E75 D;  2A06 E;  2K9J A;  3AEC C;  3PTZ A;  1CFF A;  2KFH A;  5BPJ A;  1KB9 E;  4JPZ B;  2JEE A;  3PHL A;  4RO0 A;  1T3U A;  1XA5 A;  1L4A D;  4D6T D;  1KFX S;  3B88 A;  1QL2 A;  4GDO A;  1L4A B;  3D6Y A;  3PLN A;  1SMG A;  3C1L A;  4U7J A;  2ZNE A;  4HKZ H;  5APV A;  1BOC A;  4PD4 E;  1BGY J;  2B1U A;  3VP9 A;  3S0A A;  2LLS A;  1C3Z A;  1MFZ A;  1CKK A;  4HB1 A;  2BNX A;  3VGO A;  3M06 A;  4FTG A;  1SLQ A;  4H44 D;  3ITK A;  1JEK A;  2W8Z A;  1MQ1 A;  3E1I A;  3U1A A;  4H44 B;  1K04 A;  1UHJ A;  1JF0 A;  3A3Y B;  5AER A;  5I2L A;  5CSJ A;  3PFV A;  3A0H E;  2QJK C;  3L74 D;  4C0L A;  2IS9 A;  3FE6 A;  1QLK A;  1SR6 C;  1IFP A;  3S0G A;  4PE0 A;  4JWQ A;  2HOD A;  1SQP E;  1KN7 A;  1RE4 C;  4NDD A;  2GUS A;  5HLV A;  1J7P A;  2OPO A;  2QE7 H;  4CPG A;  3WNX B;  1AVS A;  2IFN A;  3RBX A;  1S5L E;  4IFM A;  2ZYG A;  3VMA A;  3OJA B;  3TK1 A;  4PHM A;  1KIL D;  1Q82 Q;  3CXH H;  2JWA A;  1QAS A;  5CCH D;  4AQJ A;  1KIL B;  5KLI C;  1BMO A;  3MHV A;  5HLO A;  2K60 A;  2QJY B;  2R5D A;  3CR2 A;  3AED C;  5H2F H;  2L5G B;  2GGZ A;  3EK4 A;  1LS8 A;  1B1G A;  3CCM P;  1L2O C;  1M1J C;  2HF5 A;  2WCJ A;  1XTC C;  2KK7 A;  3D78 A;  3MTU E;  5CHX A;  1DJI A;  4DS7 A;  4W80 A;  1EJ3 A;  2FXP A;  2AXT H;  4MRX A;  3NGV A;  1M90 Q;  2OYI B;  3OBV A;  3GW6 A;  1MV8 A;  2YNY A;  1YQ4 C;  1ZXG A;  1TNP A;  3SWF A;  1NCX A;  1QLE D;  1EG4 A;  1RF1 A;  4W7Y A;  1BCC E;  5K5G B;  1KK7 Z;  2BBM A;  3AEG C;  1SYM A;  2K7D A;  4M2P A;  3CR5 X;  1S3J A;  1N7S A;  4Z1M H;  2BEC A;  2WTY A;  2H88 C;  3S0D A;  5APS A;  2JT3 A;  3R1O A;  2C9N Y;  1L0L G;  3P8C D;  2Y5I A;  3SSU A;  1LT9 C;  5F6T A;  1NVO A;  2P1J A;  3CCQ P;  3BAT A;  2GUV A;  4U3F E;  4WY4 D;  5B66 E;  1DD3 A;  1SCM C;  2IX7 C;  1B7T Z;  2FYU E;  3R1V A;  3WUU A;  2NPS D;  3D76 A;  4WY4 B;  2JXC A;  3WUV A;  4HRG A;  2JTZ A;  3HTK B;  5PAL A;  1JF2 A;  1SQQ G;  2NPS B;  3PAL A;  5ER5 A;  1S2E A;  3KXD A;  1F70 A;  1FU1 A;  2KSJ A;  1KFU S;  2PAS A;  1BGY D;  4D6T E;  1S72 P;  3CZ2 A;  2JPT A;  4EOT A;  2PMY A;  5BU5 A;  3I55 P;  1IFN A;  3BRV B;  1GU4 A;  4YXW H;  1F4Q A;  2PQL A;  2ZYA A;  1GGZ A;  1OFC X;  1ZLL A;  2YMK A;  3NSO A;  1DQE A;  1EDJ A;  1H0T A;  2BE4 A;  2CPS A;  3RK2 D;  2B89 A;  2F2O A;  1TTX A;  2QAC A;  3T97 A;  1BT6 A;  3RK2 B;  1BJF A;  4PHJ A;  3P8M C;  4IFF A;  5AVX B;  1NWD A;  5KLV J;  3CGA A;  3NXA A;  3N7N A;  1FZA A;  4ASV A;  4GNK B;  4MZJ A;  3WU2 E;  5KLV K;  3Q1M A;  1XFZ O;  1M57 D;  1A02 F;  1N0Y A;  3L4A A;  3L74 E;  3L72 J;  1ZP0 C;  1UII A;  2B9B A;  1SRA A;  5GTI H;  3L4F A;  1EDI A;  4WQ3 A;  4OKH A;  1KYO H;  2WSS H;  2TN4 A;  2M29 A;  3SS3 A;  1WDC C;  1R5S A;  5M1B A;  2LE9 B;  1SVF A;  1CMF A;  3V4W A;  1NKN A;  1IWQ A;  1IO4 A;  1LGH B;  1NTZ J;  1KB9 I;  3M9H A;  1FOS E;  3SG5 A;  4OCI A;  1QVG O;  1NTZ K;  1PSB A;  1OVV A;  1KIL E;  2H89 C;  1VQP P;  5GQQ C;  1IG5 A;  1JMB A;  1XFU O;  2PYQ A;  1UIX A;  4I6M C;  1FZC C;  1OW6 A;  2P2U A;  3H1I G;  2FKW B;  4PV1 C;  2WWW A;  2OTL P;  2XV5 A;  1QVI Y;  1KQM C;  1NSH A;  4PD4 I;  1JCD A;  5AW9 B;  1JBA A;  3C9I A;  5KLV G;  2W90 A;  3GG2 A;  1PVA A;  1PZQ A;  1YUR A;  1TCO B;  1QTX A;  3R2P A;  1IGV A;  2KQY A;  4A4C A;  4IL6 X;  5GTH E;  3KZI H;  2QJK B;  1LTG C;  1GMJ A;  2GTE A;  1SR6 B;  1G8I A;  2WSC H;  3CC7 P;  2CPB A;  2E6W A;  1S3P A;  2E76 C;  1DEL A;  4UB8 E;  1K9U A;  3GF7 A;  4A4B A;  1DT7 B;  2KLV A;  1NTZ G;  3P8C E;  2CNP A;  2NCP A;  1L7Z A;  2K61 A;  3SWK A;  1KV4 A;  3PM8 A;  3TDU A;  1J1E B;  1JY2 O;  2KNE A;  1M39 A;  3B5N A;  3RL0 C;  2IPP A;  4YGB B;  2KQ6 A;  4JQ0 D;  2OYH C;  2KIK A;  1OMR A;  2LUX A;  5KAI H;  1WRZ A;  2BE6 A;  2ZXE B;  1SQB G;  3AEE C;  3VTP C;  1DEB A;  2LVI A;  4GOE A;  1TNQ A;  4N5X A;  5KLI B;  1OZS A;  2HG5 D;  2E5Y A;  2NCO A;  3BFB A;  3NSL A;  2YO3 A;  1L2O B;  2KLU A;  1M1J B;  4WVZ A;  2LCP A;  5KLV D;  2V7Q H;  3DF0 B;  2F33 A;  4YI9 A;  3O6Q A;  1JFJ A;  1DTL A;  1X79 B;  2K37 A;  1LTA C;  2I1K A;  2WSF J;  2Y0D A;  3L72 D;  2MLE C;  2UWJ E;  1L2P A;  5AAN A;  2YMY A;  3H32 B;  4M2O A;  1K73 Q;  1SQP J;  1KQG B;  5FI7 A;  2A45 G;  1SQP K;  2E75 C;  1N73 C;  2QJP C;  1UHI A;  3JVT C;  1JTH B;  3H1H J;  2ERB A;  3I5F C;  1URQ C;  2AMI A;  3CX5 H;  1L0L E;  1NTZ D;  1LT9 B;  2KGB C;  3SG7 A;  4XJK A;  2FJY A;  1M56 D;  1QGK B;  1YJ9 P;  5EL2 A;  3AAJ A;  1SCM B;  4EI2 A;  1NPQ A;  2BCC G;  3G4S P;  5AFP A;  3ZDM A;  1SW8 A;  2Y9Y A;  1NO4 A;  2XNX A;  1REC A;  3CC2 P;  1SQQ E;  2WQY C;  1WT6 A;  1JFK A;  4DT0 A;  3EK8 A;  1FI6 A;  3HUS A;  2KZI A;  4ZNC A;  3BCC J;  2ZFC A;  3B4S A;  4M2Q A;  5D69 A;  1M8O B;  2P7J A;  3GMA A;  1XVJ A;  2XU6 A;  3MIW A;  5AVR B;  3SG4 A;  2EGD A;  1IQ5 A;  3I56 P;  3CCJ P;  1N2D A;  3BOW A;  1FBV A;  1BDC A;  1YX7 A;  2C0X A;  2KBM A;  4BXL A;  4R4L A;  4PHK A;  1JCC A;  1CLB A;  2M3W A;  2KUB A;  2M5A B;  4C7N A;  5CJ4 A;  5KTY A;  1K90 D;  1OOI X;  3H1H G;  1KB9 D;  3LK0 A;  5B8I B;  2WZ7 A;  1RE3 C;  1YRU B;  2EC6 C;  2FYU J;  1KFM A;  2W6A A;  1ALW A;  3TYY A;  1KIL C;  2FYU K;  3L75 G;  2W6J H;  3GLM A;  5CCH C;  3CZ1 A;  3OP0 A;  5CSF A;  1DJY A;  3H1L G;  3EWK A;  4XFJ A;  2N1T D;  1WDC B;  3ICB A;  2O01 N;  2ZRT A;  3JTD C;  3SWY A;  1OQP A;  3OX6 A;  4I5J A;  4PD4 D;  4TT3 H;  2KS1 A;  5APQ A;  4UB6 E;  1S5G Z;  2WCE A;  2MJZ A;  2XND H;  3BUN B;  4ORC B;  4H13 C;  3DVJ A;  3RZS A;  1U5I B;  2V53 A;  1GJY A;  2L4I A;  4TNC A;  5HKZ A;  3O6B A;  3EVR A;  1K93 D;  1KQL A;  4PV1 D;  3OW2 O;  1FZC B;  3CXH D;  2PRU A;  1JB0 J;  1BDD A;  2CTN A;  1DF0 B;  3TNU B;  1SL8 A;  1NHL A;  1TOP A;  4PV1 B;  2JTT A;  1K96 A;  3OA7 A;  1AJ5 A;  3AE7 C;  1DJX A;  1SFC A;  3D74 A;  1GDT A;  1UHH A;  1KQM B;  1SY9 A;  1XFX O;  3CPW O;  4FQO A;  1EH2 A;  1AA0 A;  1SQP D;  2D8N A;  2E43 A;  1EZV G;  5KLV E;  1GL2 D;  5IBW A;  5KSZ A;  2Y1M A;  2WIT A;  3G9R A;  1NX2 A;  1W7I B;  4BWN A;  5I2Q A;  3BRT B;  1XK4 A;  4U8D A;  5I94 A;  1RF0 A;  3CC4 P;  3H1H D;  1A4P A;  5E79 H;  1G2C A;  1ODB A;  2HFE D;  3TDK A;  2NPS C;  1HVV A;  5APT A;  3CL3 D;  2FBW C;  4GUK A;  1PL5 A;  1YJW P;  2WCB A;  3PJS K;  1IK9 A;  1KOR A;  5CJ0 A;  2QEX P;  1DJG A;  2R3S A;  2E76 B;  1BR4 B;  2R32 A;  1IJD B;  2PRR A;  3E3R A;  1SL9 A;  1NTZ E;  3IF7 A;  1FJP A;  3RL0 D;  3CLN A;  1SK6 D;  4JD9 A;  3L36 A;  5CSN A;  3RL0 B;  2KAV A;  4GGF A;  3TS5 C;  1QX7 A;  3BCC D;  2OYH B;  2B88 A;  1NX1 A;  1M63 B;  1Y1X A;  2JOJ A;  1SQB E;  4IJ7 A;  1YR5 A;  1OW7 A;  1KCY A;  1DJH A;  2WC8 A;  4MVF A;  2YIU B;  1JY2 N;  1MWN A;  3BAS A;  3AE5 C;  3CDN A;  2KB7 P;  3KO0 A;  2WCM A;  5AW4 B;  4PAL A;  3DVM A;  4Y28 J;  1FZF A;  1TIZ A;  1X0T A;  3IQO A;  2F8P A;  4K35 A;  5HYD A;  1EZV D;  2KZJ A;  4RJT A;  1QLS A;  2FYU D;  1PV3 A;  1QX5 B;  5CCG A;  1VQO P;  1NOH A;  3L73 G;  1XFY O;  3H4S E;  3KF9 A;  1LXF C;  1LIN A;  2E75 B;  1N73 B;  2QJP B;  1YX8 A;  1FDO A;  2LV7 A;  1URQ D;  5FYX A;  2WPR A;  3JVT B;  2O1J A;  5BU8 B;  2SPZ A;  3O4Y A;  3I5F B;  1URQ B;  1A75 B;  3K5B A;  2Y0C A;  3QRX A;  3TDI A;  1TUZ A;  3JCU H;  2BCC E;  1CI6 B;  1RQV A;  4Q04 A;  1QIV A;  3M0W A;  3R4Y A;  4N1G A;  2NXQ A;  2NZ2 A;  1NTM G;  3TGU G;  1LKJ A;  1VQ5 P;  2C9L Y;  3CI9 A;  2H43 A;  2WSE J;  1D7M A;  3LIE A;  2QEH A;  2H8V A;  2KP8 A;  3VB1 A;  3CXH E;  1S9K E;  3L71 J;  2ZRS A;  1C3Y A;  2LNK A;  1Y0V H;  3A5T A;  4DZO A;  3HRN A;  1B8R A;  2KNC B;  3D77 A;  1JSA A;  1CZQ A;  4ZCV A;  1AUI B;  1H88 A;  2L50 A;  2LP3 A;  2ZND A;  4R1E A;  4N78 E;  2JZI A;  3RL0 g;  3S0F A;  1J1E C;  1Z2C B;  3DZT A;  3GF3 A;  3H1H E;  1MKM A;  1L0L J;  1WMK A;  2AXT E;  2BCB A;  4I5N B;  4GT1 A;  3F45 A;  2RN0 A;  4IL6 E;  4OGQ D;  1L0L K;  3D0Y A;  4PJ0 H;  3VN0 A;  2K7B A;  2FY8 A;  2EC6 B;  3I5C A;  1ALV A;  4OGQ B;  1TRF A;  4LC1 A;  3PRJ A;  1N7S C;  4DCK A;  1R6P A;  1BLQ A;  2LVJ A;  3GK4 X;  1SQQ J;  4KYN A;  2JJL A;  2LHL A;  2W6B A;  1KQS O;  3C8V A;  4I7Z C;  1ZOY C;  1SQQ K;  3B71 A;  3HE5 A;  2OTG C;  3DD4 A;  3JTD B;  3Q8I A;  2BEQ D;  4H13 D;  3WMM 0;  1T14 A;  2OS8 C;  3BCC E;  2O01 H;  2L51 A;  1J2J B;  3PP5 A;  1QV0 A;  2KI6 D;  4H13 B;  1RK9 A;  4CFR A;  2K2A A;  3NMD A;  4OH8 B;  2MRD A;  1TCF A;  3L71 G;  5HKY A;  4BRY A;  1QX2 A;  1NAY A;  1WY9 A;  2K3R A;  3A4U B;  4L9M A;  1KFN A;  2D2C D;  1LT1 A;  1TUJ A;  3M9Q A;  2F3Y A;  1HBW A;  5EFW B;  2JT0 A;  2QRX A;  3P32 A;  1HUC A;  2FCE A;  2KPH A;  1S5L H;  3IAO A;  2E74 C;  2KFG A;  2M3E A;  2FYN C;  5AEQ A;  5AVT B;  3QME A;  1EZV E;  3L37 A;  3HD7 A;  3O2P A;  2KYC A;  4N3Y B;  1E79 H;  1BOD A;  2WC5 A;  3AE4 C;  2CT9 A;  2JPO A;  5I8N A;  3MD0 A;  3NHI A;  1GD2 E;  1L0N J;  1SPY A;  1OIP A;  1LP1 B;  1L0N K;  3A7O A;  5L8R J;  2POH A;  1A29 A;  5I2O A;  2P10 A;  2L91 A;  1N86 A;  2JKV A;  2FFD C;  2M1U A;  2WMM A;  1HT9 A;  1J7R A;  2FJU B;  2O60 A;  2PSR A;  1SQV G;  3TS5 B;  5GTI E;  2KOT A;  2Q3I A;  3H1I J;  1KYO E;  3H32 A;  2K9J B;  1EXR A;  2NRG A;  1YI2 P;  3L71 D;  1GK6 A;  1OOF A;  3W67 A;  1FOS F;  3B7A A;  4HSZ A;  1RY3 A;  4EYY Q;  3L47 A;  3NTN A;  2LR2 A;  2QM8 A;  3LCP C;  1OOH A;  5B66 H;  3RM1 A;  1SP4 A;  1SQX J;  1B4C A;  2LMU A;  3GK2 A;  1GGW A;  2B87 B;  2K8M B;  1SQX K;  3HE4 A;  2DOQ A;  5TIS H;  1L0L D;  1V1F A;  2BAS A;  2QSI A;  2R5B A;  3EQ2 A;  1L0N G;  3PN7 C;  1JM0 A;  1MHO A;  3BUM B;  2M49 B;  1OW8 A;  3IN6 A;  1QXP A;  3AE3 C;  4YRU A;  2N1T C;  1VQ7 P;  1SQQ D;  2A45 I;  3V2Q A;  5AVY B;  1NH4 A;  4B86 A;  2M8R A;  4JF7 A;  3TZ1 A;  3BUO B;  4CPV A;  4TLF A;  1BU3 A;  2M7L A;  2ZN9 A;  3B6X A;  2E42 A;  2HOD B;  2WT7 A;  4GIF A;  3AAK A;  1SQB J;  1LA3 A;  1FZB A;  2WC6 A;  1VQ6 P;  4AQI A;  2I94 A;  1SQB K;  1WRG A;  4K3A A;  2HYN A;  5B5E E;  2QIW A;  1UUS A;  1PVB A;  1QJT A;  3C1V A;  2AEJ A;  3A8R A;  3MSE B;  1AV1 A;  1LTJ A;  1GL2 C;  3CTN A;  1CLM A;  1SQX G;  2L0P A;  1OX3 A;  1LTT C;  4RKU J;  1XFR A;  2KSP A;  1YVH A;  3CXH I;  5KAI E;  1ZMZ A;  4N1F A;  2YO2 A;  1JWD A;  2P67 A;  1PPJ G;  1NAF A;  1KQV A;  2AEM A;  1CW5 A;  3D75 A;  5KAF H;  3HX4 A;  1S4X A;  3SJS A;  1C7V A;  3FWN A;  3SG6 A;  1NKZ B;  4P2Y B;  1ORG A;  2JT8 A;  2P70 A;  1M1K Q;  1DC1 A;  1KC8 Q;  1L0N D;  2HQW A;  3U1C A;  1NTK J;  1PP9 G;  1U5I A;  1OMV A;  4YPC A;  3V2N A;  3UIA A;  1IC2 A;  1SL7 A;  3PH0 A;  2H2K A;  1M45 A;  3OHM B;  1W5C E;  1Y9B A;  3E7K A;  2V4H A;  1N7S D;  1FW4 A;  2Q6Q A;  2PP6 A;  2LM5 A;  3TNU A;  4YXD C;  2G3A A;  1YHQ P;  2BCC J;  1BSN A;  2RKL A;  2YIU C;  1N7S B;  2QVA A;  1NWQ A;  5AW0 B;  2JP3 A;  1QVI Z;  1K8U A;  4WRI A;  1XFV O;  3H1I D;  1AQ5 A;  4I7Z B;  3TF5 A;  1J1D C;  2KYF A;  2YXQ B;  4ASW A;  5DKN A;  2OTG B;  2FXO A;  1G1J A;  1LTB C;  3I5I C;  2HPC A;  2M3B A;  3RK3 D;  3V2L A;  5GTH H;  2OS8 B;  2M7N A;  3TUY C;  5FI6 A;  1P84 H;  2I2R E;  1BE3 J;  3DVK A;  1S26 D;  1KSO A;  1MFT A;  3L71 E;  1SQX D;  5AVW B;  2FYZ A;  1Q90 D;  3GK1 A;  1JY3 P;  3RBZ A;  2JC2 A;  1NGM B;  2HLO A;  2JR8 A;  3ZNI A;  1RWY A;  2LMV A;  4ZCU A;  1R8E A;  2LMT A;  1PPJ D;  2E74 D;  1D1O A;  1FI5 A;  5DKR A;  3AE1 C;  3H1K J;  2O01 J;  2E74 B;  1NTK G;  1NYA A;  2PAL A;  2FYN B;  1R2U A;  2AEF A;  1EC5 A;  1EZV I;  3WHU B;  2MHH A;  2Y0E A;  1H8A A;  1N2D C;  2H61 A;  2KLD A;  1IKU A;  2QA4 P;  1IZN B;  2Y9Z A;  2JXL A;  2OYH A;  5AW8 B;  1H0T B;  2A06 G;  5AW6 B;  1NX0 A;  3T97 B;  2GV5 A;  1VQM P;  3L75 J;  5CBO A;  3IVT A;  3H1L J;  2PGD A;  1X22 A;  3A0B H;  1SQB D;  1HWT C;  3EG5 B;  2JWW A;  4C0K A;  1MUX A;  3IQQ A;  1N65 A;  2QEV A;  1WLM A;  5HL1 A;  2SCP A;  5KJ7 A;  4E68 A;  1S6J A;  3RLZ A;  2LXB A;  3BXK A;  5JJG A;  3FIA A;  2Z4E A;  1BE3 G;  4L75 A;  2FFD B;  3FWB A;  3PM2 A;  1IFJ A;  3EVU A;  2G8Y A;  1KSM A;  4INX A;  3UO9 A;  2LHI A;  1KYO I;  3FX0 A;  2BEZ F;  1USE A;  1K95 A;  4C0J A;  2WVR A;  3W68 A;  4PE4 A;  3EVV A;  4A7P A;  3KPX A;  2LVV A;  1N73 A;  5HKW A;  5CSI A;  3H1J G;  1PGQ A;  3V6I A;  1SBJ A;  1CB1 A;  1UWO A;  3LLE A;  2L4H A;  3H1K G;  1NU1 G;  2BKH B;  1MXE A;  1A75 A;  3CCS P;  1VL2 A;  1KFX L;  2CBL A;  3OGN A;  3Q5R A;  1L4A A;  1NTK D;  4OGQ C;  1QV1 A;  1SFC C;  1Y8A A;  4PHN A;  2Q1K A;  1FJK A;  1J55 A;  4HH2 A;  2YKQ A;  3PN7 B;  1L0N E;  1GU5 A;  2BCC D;  3MZW B;  1CTR A;  2ZN8 A;  4GAO A;  1XK4 C;  2N1T B;  4WWI A;  1GK4 A;  1RF0 C;  5DJT B;  1IFI A;  4LGD E;  2LAN A;  1CDM A;  2CK3 H;  1OXZ A;  4YI8 A;  1NX3 A;  2J58 A;  1F71 A;  4OR9 B;  2KI6 C;  2Q4U A;  5E79 E;  5AVV B;  4F0Z B;  5KU1 A;  1LWU C;  2KI4 C;  1HJ0 A;  1LTI C;  2MLF C;  4JKT A;  1S9K D;  1ZV8 A;  3H1I E;  4BY5 A;  2I18 A;  3CWG A;  1BE3 D;  3VMX A;  1UP5 A;  3FGA D;  1OW4 A;  1W2B O;  2D2C C;  2GA1 A;  2K88 A;  2K0J A;  3B5N D;  3S0B A;  2ZVN B;  1USD A;  3GHG C;  2ZT9 C;  3RK3 E;  4ORA B;  2ZXX A;  4CFQ A;  2PVB A;  4MSP A;  3G6E P;  4N78 D;  3S4R A;  4ZKU A;  5DKQ A;  1NCY A;  1GL2 B;  2F3Z A;  3K1E A;  1SQX E;  3H1K D;  4L73 A;  4YGE B;  4O9B A;  1QL1 A;  2VRS A;  4XE5 B;  5FI2 A;  1KIL A;  4L76 A;  3SS4 A;  2IBZ G;  1K9M Q;  5CCH A;  1PPJ E;  5AW1 B;  2O1K A;  1OMD A;  3L75 D;  1FC2 C;  1N7L A;  3N4X A;  3L73 J;  4U3F G;  3WXA A;  1K2H A;  2WOR A;  4MBE A;  3H1L D;  3PLF B;  2BAP A;  3M0D A;  4KT0 J;  1PAL A;  2KYV A;  1Z4H A;  2YKO A;  3O6Q B;  1KQF B;  3BVH A;  1PP9 E;  2OYI A;  1PK0 D;  4KJM A;  1ZAC A;  3V2P A;  1MR8 A;  5CCG C;  1W9Z A;  1UUR A;  2JNX A;  3FWL A;  1Z56 A;  5TNC A;  1T6A A;  2K1A A;  4I5K A;  4JBZ A;  3OB2 B;  2WSC J;  2HET A;  3CCV P;  4D6T G;  3SG3 A;  2M97 A;  2AAO A;  2JUL A;  1F55 A;  1YQ3 C;  3P7K A;  1X8Y A;  1OVU A;  2K7O A;  4QJ5 B;  1NTM J;  3TGU J;  1YIT P;  1J1D B;  2JRF A;  5D3O A;  3CYZ A;  1QWV A;  1F8H A;  1NTM K;  3ABV C;  3MUD A;  5ER4 X;  1MF8 B;  1PGJ A;  3I5I B;  4XJK B;  1W2E A;  1RRO A;  2GM4 A;  2OYO A;  4P5O E;  1LVC D;  2WCK A;  1OMI A;  2H7H A;  4OV2 A;  3TUY B;  2MAZ A;  2E30 A;  2ZAE B;  1S1E A;  1QVF O;  4WY4 A;  1ZR2 A;  1W7J B;  1IIO A;  2K9Y A;  3HTK A;  1DH3 A;  3JCU E;  5AVQ B;  2QDI A;  5CBN A;  1TU3 F;  1IRJ A;  2NPS A;  3M0A A;  3V2R A;  2VRG A;  3AEB C;  3E1R A;  3EK7 A;  4GBA A;  3F5H A;  4R4M A;  4AQR D;  3IR9 A;  2L5X B;  3AE2 C;  1YTZ T;  3S0E A;  5KTB A;  1KFU L;  1DX7 A;  2V7Q J;  4MRY A;  2Q3E A;  2QM7 A;  1ZUZ A;  2O5G A;  2ZFD A;  1NTK E;  4OZD A;  2KOG A;  4QMA A;  3R72 A;  4PCW A;  3BOW B;  2BL0 C;  3AE8 C;  4CID A;  4DIR A;  1K9P A;  2BKI B;  4FQT A;  2JU0 A;  1CLL A;  1K8A Q;  4WQ2 A;  2BCA A;  1Q80 A;  1AVY A;  2ITA A;  4ICB A;  3VMZ A;  2L98 A;  4C7N B;  1KYO D;  2ZKM X;  4GPL B;  4WBA A;  1YUU A;  5AVS B;  3L70 G;  4IOI H;  3BQ3 A;  3H6P A;  5TJH A;  1C07 A;  4YGC B;  2ZVO B;  1P28 A;  1JNM A;  1VPC A;  2G2B A;  1CDP A;  2B87 A;  1PUL A;  4H0L D;  4PE1 A;  3O8Z A;  3LW5 H;  1MXL C;  1FZE A;  3VRO A;  4PJ0 E;  1FDM A;  4D1E A;  4XA4 A;  1KWO C;  1HTL C;  1BE3 E;  4H0L B;  4EIJ A;  2MJW B;  1S36 A;  1M46 A;  2LC5 A;  1KZU B;  2A45 H;  1KB9 H;  5H2F E;  1XFW O;  2I8D A;  2KS1 B;  2E5T A;  2PAJ A;  3AKA A;  1E5W A;  4GGN A;  1YUT A;  1YIJ P;  3H1J E;  1SSE B;  1C7W A;  1OVR A;  3L73 D;  3H1K E;  3OAK A;  3CMA P;  1NU1 E;  1RF1 C;  1Q81 Q;  2N9B A;  1M31 A;  2LP2 A;  2QPT A;  1DD4 A;  3EKJ A;  1KK7 Y;  1SFC D;  5AVZ B;  1FDI A;  1LA0 A;  1SS1 A;  3O4X A;  4MZK A;  4PD4 H;  1SFC B;  1VQ9 P;  1XO5 A;  3PJI A;  3L75 E;  3H1L E;  2JWD A;  3DY9 A;  3HD7 C;  2Q9I A;  3AEA C;  2FOT A;  1CFD A;  3Q5P A;  1OWA A;  2P58 A;  1VF5 C;  2WCF A;  1HQV A;  1MUU A;  3A0H H;  3M9B A;  1HH0 A;  1CDL A;  2KBI A;  3KEV A;  1B7T Y;  3OB1 B;  3II6 A;  1G2C B;  3RK3 C;  1NTM D;  3L70 D;  4I1L A;  3TGU D;  1PGP A;  2IYO A;  2LUC A;  2WSF H;  1S1C X;  4AYC A;  4GOF A;  1X9V A;  1SQV J;  1NJI Q;  1B47 A;  1BGY G;  1LWU B;  2KI4 B;  2P71 A;  1AK8 A;  1SQV K;  3BUW B;  3B87 A;  3F89 A;  4PT1 A;  1TN4 A;  3DYE A;  1Q7Y Q;  1K94 A;  1AFO A;  2D2C B;  2ZT9 D;  1RE4 A;  3L35 A;  4MLW A;  4JYC A;  3QWO C;  3GHG B;  3M91 A;  2ZT9 B;  1DIP A;  4IL6 H;  4AUW A;  1J1E A;  1BF5 A;  1GM0 A;  1QEX A;  1T2K C;  4GKG A;  2AXC A;  3CCU P;  1EDL A;  2PFX A;  1GTW A;  3HCM A;  1YVL A;  1G1I A;  3N7H A;  3PAT A;  3NFQ A;  1JY3 N;  1P84 D;  4DJG A;  3SFD C;  2LVK A;  2KLE A;  3SIA A;  2IBZ E;  2WPS A;  3VRN A;  2Z5I A;  2W83 C;  4C46 A;  3LID A;  4I2L C;  1X02 A;  3FS7 A;  1ZRT D;  1SKT A;  3AE9 C;  3CME P;  2FXM A;  2O3J A;  1IK7 A;  1M1J A;  1K9K A;  2BCX A;  2W27 A;  2QEB A;  1AJY A;  2I7A A;  1CSB A;  1A03 A;  2M0R A;  3DF0 A;  3WHT B;  3I5H C;  2OGU A;  3JC2 2;  4MN4 C;  5CCG D;  4MEW A;  1AVO A;  1LTS C;  3Q3D A;  2KSE A;  3CX5 D;  5TIS E;  1MZ9 A;  2LKM A;  3EKH A;  3PSR A;  1EL4 A;  1E8A A;  3D70 A;  4JYB A;  1JY2 P;  2JQ6 A;  3TSI A;  3NXS A;  3I5G C;  1LNQ A;  3CCL P;  3GOF A;  1IFM A;  1Q2N A;  3A2A A;  4PE7 A;  4DUQ A;  1IH0 A;  1RFJ A;  1JTH A;  2ZYD A;  1DEE G;  3KDP B;  1TWO A;  1LT9 A;  2MA2 A;  1YTZ C;  4C7R A;  3D10 A;  3S1K A;  3VRP A;  1H8B A;  5APW A;  2JO1 A;  3FXE A;  1ZME C;  1K05 A;  1R5L A;  5BVZ A;  1CMG A;  1JC2 A;  1GW4 A;  1LTJ C;  2LXC B;  2NZ0 A;  4YTP C;  4N6J A;  3IF4 A;  3BYA A;  3L73 E;  1XTG B;  1CDN A;  1YTZ I;  4LLH A;  3VP8 A;  1PP9 J;  1QAT A;  2WOS A;  2FFD A;  3CD6 P;  2IFM A;  3CWB J;  3VRQ A;  3KZI E;  1BSH A;  2J59 M;  2BL0 B;  5AW5 B;  1FZG A;  3CZ0 A;  1KK8 C;  1DVI A;  3K21 A;  1TNW A;  1NUB A;  1OOJ A;  1IQ3 A;  5KAF E;  2RH0 A;  2WCL A;  1SQV D;  1NYH A;  2GGM A;  2M5A A;  3WU2 H;  3B5N C;  1EXI A;  2YKP A;  1NTM E;  3L70 E;  3TGU E;  4QJ4 B;  3U59 A;  1H4B A;  1CM1 A;  3D0Y B;  4XYN A;  5CMZ A;  4L74 A;  4Y99 C;  1VDF A;  3AE6 C;  2Z5H A;  1WRK A;  2OAR A;  1KWO B;  1SCV A;  1AJ4 A;  3SG2 A;  1OZO A;  2YXR B;  3HE5 B;  1S6I A;  5KKZ C;  2ISD A;  3UNW A;  4NDB A;  5JOL A;  2N1T A;  1PFI A;  3L72 G;  1RHZ B;  1H89 A;  1S5L X;  5D7F A;  2CXJ A;  2LLU A;  4F7F A;  3LW5 J;  4BRY B;  1AHR A;  5C39 A;  3G3Z A;  1NTK K;  3AKB A;  1P84 E;  1RF1 B;  2RGI A;  2IZ0 A;  1FPW A;  3CWB G;  1YJN P;  2COL B;  4GFT A;  1FZC A;  1RJV A;  2KHN A;  5B5E H;  1DF0 A;  4HYT B;  1M7L A;  1WRL A;  2KAY A;  1ZRT E;  2LLT A;  3HD7 D;  5DJU B;  1GW3 A;  1BG1 A;  3SS5 A;  5DIC A;  3V5B A;  4HRE E;  3HD7 B;  3SIB A;  1VF5 D;  5AW3 B;  2H61 C;  2KFF A;  1JOC A;  3MGN A;  3DXL A;  2QG4 A;  2L2E A;  1VF5 B;  1OE9 B;  1FS0 E;  1OSA A;  4I5L B;  1CNP A;  1FAV A;  1GL2 A;  3CX5 E;  4PDZ A;  2K7C A;  4CLN A;  3B86 A;  4RES B;  3RK3 B;  1JUN A;  1Y47 A;  3CS1 A;  3KYQ A;  1BGY E;  1VQL P;  1V1G A;  4UB8 H;  3HUS C;  4AOM A;  1XYD A;  1KTM A;  3A0B E;  3BFH A;  1Y1U A;  4HJG H;  5KJ7 C;  1UHN A;  4NPE A;  3WUT A;  1J7O A;  3H1J J;  5AW7 B;  1SNL A;  1T2K D;  2J5U A;  1AP4 A;  2L2C A;  2MKV A;  2JDI H;  1NU1 J;  1KD1 Q;  3RGU A;  2Y4Q A;  1EDK A;  1Y6W A;  1U7J A;  1B8L A;  2KDH A;  3R1P A;  2BBN A;  1NU1 K;  2XDJ A;  1J7Q A;  1ZW0 A;  1LJ2 A;  3ZWH A;  2G9B A;  3NHT A;  5CPV A;  1PP9 D;  2R44 A;  2Q7C A;  4ORB B;  3KQG A;  1ZR4 A;  3CWB D;  3CZT X;  2I1J A;  4WB4 A;  2FCD A;  2IBZ I;  2EHB A;  4UPG A;  2M9G A;  3D71 A;  1J1D A;  1QIW A;  2H8P D;  2WSE H;  3CCE P;  1TNX A;  1L4A C;  4BY4 A;  1NP8 A;  1FE6 A;  3HE4 B;  2Y1N A;  1B9A A;  2HR3 A;  1G4Y R;  1IFD A;  4DOJ A;  2YGU A;  2WPQ A;  3I5H B;  1CFC A;  4H0L C;  3EFG A;  2M8U A;  1JMM A;  1GQM A;  3Q5S A;  2L5Y A;  2ZJS E;  1SQV E;  3H25 A;  4NPF X;  2C0W A;  2N9Y B;  1ZOT B;  3NSK A;  4H44 C;  1S5G Y;  3I5G B;  1PIX A;  3DVE A;  4QJ3 B;  3BUX B;  1GZL A;  3V4Q A;  2WPV B;  2WND A;  1N8R Q;  1DGV A;  2LAP A;  2M1K B;  4ZMD A;  1BCC J;  1URQ A;  2WT7 B;  4EDF A;  3TDZ A;  1Y1A A;  1SQP G;  1FF1 A;  2QEO A;  3VYI A;  1CI6 A;  1DJW A;  1IJ6 A;  4ZKP A;  2A06 D;  1T3J A;  1PSR A;  1G33 A;  3S9O A;  3VOP A;  1DMO A;  4U3F J;  2OQQ A;  1LTJ B;  2KAX A;  4USL A;  2K2F A;  1UHK A;  3BFA A;  4KHX A;  3CR4 X;  4IL1 A;  4HRH A;  4MZL A;  2QJY C;  2IDB A;  1JO5 A;  1JUO A;  1HF9 A;  1RTP 1;  1T8Z A;  2OTJ P;  1NCZ A;  1PGO A;  2KGR A;  1Q86 Q;  2KNC A;  5AVU B;  3M0D C;  1KK8 B;  1U7M A;  4D6T J;  3B8E B;  4YBH B;  1B8C A;  3BCC G;  1JY3 O;  2OTK E;  4ETO A;  1OZH A;  1S6C A;  4OVN F;  5APU A;  3EFF K;  1AQT A;  2OYI C;  3B5N B;  2F2P A;  2MBX A;  4GGF C;  5K89 A;  2HQ8 A;  2HPS A;  1BCC G;  1EQ7 A;  1RE3 A;  3H1J D;  2XKM A;  1EXJ A;  1F54 A;  4Y99 B;  3FE8 A;  3LL8 B;  1NU1 D;  4NPD A;  2CCM A;  4W7Z A;  2RMZ A;  1ZFS A;  2R2I A;  2IYP A;  1DGU A;  2SAS A;  3VRR A;  5KKZ B;  1BR1 B;  2IZ1 A;  3KPE A;  3FXD A;  3MUD C;  4UB6 H;  1VRK A;  5AW2 B;  1F4O A;  3L74 J;  2HPC B;  3NSI A;  1HJB A;  2DW3 A;  4OWF A;  3L72 E;  1YYC A;  2FYU G;  5J3X A;  4M3L A;  4WY4 C;  3L4L A;  3O78 A;  3MP7 B;  1P84 I;  2E76 D;  3CWB E;  4YGA A;  1DJZ A;  1LWU A;  4GOD A;  2M0B A;  3FWC A;  1ZN5 A;  2KXP B;  3OX5 A;  3JSV C;  5APX A;  5AXI A;  3USS A;  3VMY A;  1KMI Z;  3Q2Y A;  1VQK P;  1CFP A;  1HGZ A;  1EG3 A;  3D73 A;  1HGV A;  1RH5 B;  3BJH A;  3GHG A;  1QS7 A;  3L70 J;  3D6Z A;  1A02 J;  1IJ5 A;  2R3C A;  2Q5U A;  1A2X A;  4YGD B; 
#chains in the Genus database with same CATH homology
 1B47 A;  4M2Q A;  5D69 A;  5G08 A;  4NDC A;  1UUS A;  2KI4 B;  1AK8 A;  1XVJ A;  3BUW B;  1PVB A;  1QJT A;  3SG4 A;  1YUS A;  1YRT B;  3C1V A;  1TN4 A;  2EGD A;  3A8R A;  1K94 A;  3MSE B;  4MN0 A;  3CTN A;  1IQ5 A;  4NQG A;  1CLM A;  2P6B B;  1CM4 A;  2L0P A;  4MLW A;  1N2D A;  3BOW A;  3LK1 A;  1FBV A;  3KHE A;  1YX7 A;  2KBM A;  2KSP A;  4PHK A;  1YVH A;  1J1E A;  1BF5 A;  1CLB A;  1ZMZ A;  4N1F A;  1JWD A;  2M3W A;  3HCM A;  1YVL A;  3PAT A;  1KQV A;  3HX4 A;  5KTY A;  3SJS A;  1K90 D;  1C7V A;  2AUC A;  1WLZ A;  2NLN A;  2A4J A;  3LK0 A;  3SG6 A;  5B8I B;  4P2Y B;  2JT8 A;  1NIW A;  1YRU B;  2LVK A;  1PRW A;  3SIA A;  4DRW A;  2JNF A;  2HQW A;  2EC6 C;  3VRN A;  2Q91 A;  1ALW A;  1U5I A;  1OMV A;  1X02 A;  3FS7 A;  1CFF A;  1SKT A;  2KFH A;  1SL7 A;  5BPJ A;  3OP0 A;  5CSF A;  1DJY A;  2H2K A;  1M45 A;  3OHM B;  4JPZ B;  1K9K A;  1FW4 A;  2BCX A;  2I7A A;  1WDC B;  2LM5 A;  3ICB A;  1A03 A;  2M0R A;  2ZRT A;  3DF0 A;  3I5H C;  3WHT B;  3JTD C;  1OQP A;  3OX6 A;  1XA5 A;  4I5J A;  1KFX S;  4MEW A;  1QVI Z;  1S5G Z;  2WCE A;  1K8U A;  4WRI A;  1XFV O;  3BUN B;  4ORC B;  3EKH A;  3PSR A;  3DVJ A;  1SMG A;  1EL4 A;  1E8A A;  1U5I B;  2JQ6 A;  2KYF A;  2V53 A;  2ZNE A;  1GJY A;  5DKN A;  2OTG B;  2L4I A;  4TNC A;  3I5G C;  5HKZ A;  1BOC A;  3O6B A;  3I5I C;  3EVR A;  1K93 D;  3GOF A;  4PE7 A;  2B1U A;  4DUQ A;  2LLS A;  2OS8 B;  1CKK A;  2M7N A;  2PRU A;  1IH0 A;  2CTN A;  1DF0 B;  3VGO A;  1SL8 A;  3TUY C;  1TOP A;  4FTG A;  1RFJ A;  2I2R E;  2JTT A;  1K96 A;  3DVK A;  1AJ5 A;  1MQ1 A;  1DJX A;  1S26 D;  1KSO A;  1UHH A;  1KQM B;  1JF0 A;  1UHJ A;  1SY9 A;  3GK1 A;  2MA2 A;  1YTZ C;  1XFX O;  2JC2 A;  4FQO A;  5AER A;  5I2L A;  1EH2 A;  3D10 A;  2D8N A;  5CSJ A;  3PFV A;  3ZNI A;  1RWY A;  2LMV A;  4ZCU A;  3VRP A;  5IBW A;  5KSZ A;  2Y1M A;  1H8B A;  2LMT A;  4C0L A;  2IS9 A;  1NX2 A;  1W7I B;  1QLK A;  5I2Q A;  1XK4 A;  1D1O A;  1SR6 C;  4U8D A;  1FI5 A;  4PE0 A;  5DKR A;  1A4P A;  4JWQ A;  1CMG A;  1JC2 A;  1NYA A;  2PAL A;  1R2U A;  1ODB A;  2NZ0 A;  3WHU B;  2MHH A;  3BYA A;  4NDD A;  2H61 A;  1IKU A;  1CDN A;  5HLV A;  2Y9Z A;  2JXL A;  1J7P A;  2OPO A;  3WNX B;  1AVS A;  1NX0 A;  4GUK A;  2WCB A;  2GV5 A;  1QAT A;  2WOS A;  1DJG A;  1BR4 B;  4PHM A;  3VRQ A;  3E3R A;  1SL9 A;  3IF7 A;  2BL0 B;  1QAS A;  2JWW A;  4AQJ A;  1KK8 C;  3CLN A;  4C0K A;  1DVI A;  1MUX A;  1SK6 D;  3K21 A;  1TNW A;  1NUB A;  1OOJ A;  3IQQ A;  1IQ3 A;  1N65 A;  1BMO A;  5CSN A;  5HLO A;  2KAV A;  4GGF A;  3TS5 C;  1QX7 A;  3CR2 A;  1WLM A;  1NX1 A;  2SCP A;  2GGZ A;  3EK4 A;  4E68 A;  2GGM A;  1S6J A;  3RLZ A;  1M63 B;  1Y1X A;  3BXK A;  1B1G A;  2JOJ A;  5JJG A;  1L2O C;  3FIA A;  1YR5 A;  2HF5 A;  1KCY A;  1DJH A;  2WC8 A;  3FWB A;  4MVF A;  4QJ4 B;  1H4B A;  1CM1 A;  3D0Y B;  4XYN A;  3EVU A;  1DJI A;  4DS7 A;  1KSM A;  1MWN A;  1EJ3 A;  2LHI A;  3KO0 A;  4MRX A;  1K95 A;  4C0J A;  4PAL A;  1WRK A;  4PE4 A;  3DVM A;  3EVV A;  1TNP A;  1KWO B;  1NCX A;  1SCV A;  1AJ4 A;  1EG4 A;  1TIZ A;  2LVV A;  3IQO A;  1OZO A;  3KPX A;  5HKW A;  3SG2 A;  5CSI A;  1S6I A;  2F8P A;  1KK7 Z;  1SBJ A;  2BBM A;  5HYD A;  1CB1 A;  1UWO A;  3LLE A;  2L4H A;  2ISD A;  1SYM A;  2K7D A;  4M2P A;  3CR5 X;  4NDB A;  2BKH B;  5JOL A;  1MXE A;  1A75 A;  1KFX L;  1QLS A;  2CBL A;  1QX5 B;  2BEC A;  5D7F A;  2CXJ A;  2LLU A;  1QV1 A;  2JT3 A;  1AHR A;  1XFY O;  2Y5I A;  3H4S E;  4PHN A;  3KF9 A;  1LXF C;  5F6T A;  3AKB A;  1LIN A;  1J55 A;  2RGI A;  1FPW A;  1YX8 A;  2COL B;  4GFT A;  1SCM C;  2LV7 A;  1B7T Z;  3PN7 B;  1RJV A;  5FYX A;  2KHN A;  3JVT B;  1DF0 A;  1CTR A;  1WRL A;  2JXC A;  3O4Y A;  2KAY A;  2JTZ A;  1XK4 C;  2ZN8 A;  3I5F B;  4GAO A;  1A75 B;  4HRG A;  5PAL A;  1JF2 A;  2LLT A;  2LAN A;  1CDM A;  1BG1 A;  3PAL A;  5ER5 A;  4YI8 A;  3QRX A;  1NX3 A;  4HRE E;  3TDI A;  3SIB A;  1F70 A;  2H61 C;  1F71 A;  4OR9 B;  2KI6 C;  2KFF A;  2Q4U A;  4Q04 A;  1KFU S;  1QIV A;  2PAS A;  3M0W A;  4F0Z B;  5KU1 A;  2L2E A;  1OE9 B;  2KI4 C;  2JPT A;  1OSA A;  4I5L B;  4N1G A;  1CNP A;  2MLF C;  2PMY A;  2NXQ A;  4PDZ A;  2K7C A;  4BY5 A;  1LKJ A;  2I18 A;  3CWG A;  4CLN A;  1UP5 A;  1F4Q A;  2K0J A;  1GGZ A;  3CS1 A;  1OFC X;  3NSO A;  2BE4 A;  1V1G A;  2F2O A;  4ORA B;  4AOM A;  1TTX A;  1XYD A;  4CFQ A;  2QAC A;  2PVB A;  4MSP A;  1BT6 A;  1Y1U A;  2ZRS A;  1BJF A;  1UHN A;  4PHJ A;  2LNK A;  5DKQ A;  1Y0V H;  1NCY A;  1J7O A;  1SNL A;  2F3Z A;  1NWD A;  3CGA A;  1B8R A;  3NXA A;  1AP4 A;  4YGE B;  4GNK B;  4MZJ A;  1JSA A;  4ZCV A;  1AUI B;  2Y4Q A;  1Y6W A;  1XFZ O;  1N0Y A;  1B8L A;  2L50 A;  2KDH A;  2LP3 A;  2BBN A;  2ZND A;  4R1E A;  1J7Q A;  2JZI A;  3ZWH A;  2G9B A;  5CPV A;  1OMD A;  1SRA A;  3WXA A;  1K2H A;  2WOR A;  2BCB A;  4MBE A;  4ORB B;  4I5N B;  4WQ3 A;  4OKH A;  3F45 A;  2TN4 A;  3PLF B;  2M29 A;  3CZT X;  1PAL A;  2FCD A;  3D0Y A;  2EHB A;  1WDC C;  2K7B A;  4UPG A;  2EC6 B;  2M9G A;  1ALV A;  2LE9 B;  1TRF A;  1CMF A;  1J1D A;  1QIW A;  1IWQ A;  4DCK A;  1R6P A;  1PK0 D;  1TNX A;  1BLQ A;  1ZAC A;  2LVJ A;  3GK4 X;  1MR8 A;  2JNX A;  1UUR A;  2LHL A;  3SG5 A;  4BY4 A;  4OCI A;  1NP8 A;  5TNC A;  2Y1N A;  1B9A A;  1PSB A;  4I5K A;  1G4Y R;  5GQQ C;  2OTG C;  3OB2 B;  1IG5 A;  3DD4 A;  2HET A;  3I5H B;  3JTD B;  1CFC A;  1XFU O;  2M8U A;  2M97 A;  3SG3 A;  2AAO A;  1GQM A;  2JUL A;  1F55 A;  2OS8 C;  2K7O A;  2L51 A;  4QJ5 B;  1QV0 A;  2KI6 D;  1RK9 A;  2JRF A;  4CFR A;  2K2A A;  1ZOT B;  1TCF A;  2MRD A;  3NSK A;  5HKY A;  1F8H A;  1QVI Y;  1S5G Y;  1KQM C;  5ER4 X;  1MF8 B;  3I5G B;  1NSH A;  1QX2 A;  3DVE A;  3I5I B;  4XJK B;  1RRO A;  4QJ3 B;  3BUX B;  1WY9 A;  3A4U B;  4L9M A;  1JBA A;  4P5O E;  1LVC D;  2WND A;  4OV2 A;  1PVA A;  3TUY B;  1YUR A;  2MAZ A;  1DGV A;  1TCO B;  2E30 A;  1S1E A;  1QTX A;  2LAP A;  2M1K B;  2F3Y A;  1W7J B;  2JT0 A;  1IGV A;  2FCE A;  1IRJ A;  3TDZ A;  2VRG A;  2KFG A;  2KQY A;  4A4C A;  1Y1A A;  5AEQ A;  3EK7 A;  4GBA A;  1FF1 A;  2L5X B;  1DJW A;  1IJ6 A;  3O2P A;  2KYC A;  1KFU L;  1PSR A;  1SR6 B;  1G33 A;  1G8I A;  4MRY A;  1ZUZ A;  2O5G A;  2ZFD A;  1BOD A;  2E6W A;  1S3P A;  1DMO A;  1K9U A;  2CT9 A;  5I8N A;  4A4B A;  2KAX A;  1DT7 B;  4USL A;  4PCW A;  2CNP A;  2K2F A;  3BOW B;  1UHK A;  2BL0 C;  2NCP A;  1L7Z A;  1SPY A;  4CID A;  2K61 A;  4DIR A;  1K9P A;  2BKI B;  2JU0 A;  1CLL A;  3PM8 A;  4WQ2 A;  3TDU A;  2BCA A;  1Q80 A;  2KNE A;  3CR4 X;  1M39 A;  1A29 A;  4IL1 A;  5I2O A;  4HRH A;  4ICB A;  4MZL A;  4YGB B;  2KQ6 A;  4JQ0 D;  2L98 A;  1JUO A;  1OMR A;  2ZKM X;  4GPL B;  1RTP 1;  2LUX A;  1YUU A;  1WRZ A;  1NCZ A;  2BE6 A;  2KGR A;  2M1U A;  1HT9 A;  1J7R A;  1KK8 B;  3BQ3 A;  2LVI A;  2FJU B;  2O60 A;  2PSR A;  1TNQ A;  4N5X A;  4YGC B;  1C07 A;  4YBH B;  1B8C A;  1OZS A;  3TS5 B;  2KOT A;  2G2B A;  1CDP A;  1PUL A;  4ETO A;  1S6C A;  2NCO A;  4OVN F;  4PE1 A;  1EXR A;  3NSL A;  1MXL C;  2F2P A;  2MBX A;  3VRO A;  4GGF C;  4D1E A;  2HQ8 A;  5K89 A;  1KWO C;  1L2O B;  4HSZ A;  2HPS A;  2LCP A;  2MJW B;  1S36 A;  1M46 A;  2LC5 A;  1F54 A;  3DF0 B;  3LL8 B;  1XFW O;  2F33 A;  4YI9 A;  3LCP C;  1JFJ A;  2CCM A;  1DTL A;  3RM1 A;  1B4C A;  2LMU A;  2MLE C;  3GK2 A;  3AKA A;  1GGW A;  5AAN A;  1ZFS A;  2R2I A;  4GGN A;  1YUT A;  2K8M B;  1DGU A;  2DOQ A;  2SAS A;  4M2O A;  1C7W A;  3VRR A;  1BR1 B;  1VRK A;  1F4O A;  1V1F A;  3NSI A;  1M31 A;  2LP2 A;  2QPT A;  3EKJ A;  1KK7 Y;  3PN7 C;  1UHI A;  5J3X A;  1MHO A;  3JVT C;  1LA0 A;  3BUM B;  2M49 B;  4MZK A;  1QXP A;  4YRU A;  3I5F C;  3O78 A;  1XO5 A;  2AMI A;  2KGB C;  3SG7 A;  4XJK A;  4YGA A;  1DJZ A;  3AAJ A;  1SCM B;  3FWC A;  1NPQ A;  3TZ1 A;  2FOT A;  1CFD A;  3BUO B;  3OX5 A;  4CPV A;  5AFP A;  5AXI A;  1SW8 A;  2Y9Y A;  1BU3 A;  2M7L A;  2WCF A;  1HQV A;  2ZN9 A;  1CFP A;  1REC A;  1EG3 A;  1CDL A;  2KBI A;  3KEV A;  1B7T Y;  3OB1 B;  3AAK A;  1JFK A;  1LA3 A;  1QS7 A;  3EK8 A;  1FI6 A;  2LUC A;  4AQI A;  1IJ5 A;  2I94 A;  1A2X A;  4YGD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...