4DCKA

Crystal structure of the c-terminus of voltage-gated sodium channel in complex with fgf13 and cam
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
153
Chain Sequence
SVATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sodium channel protein type 5 subunit alpha
publication title Crystal Structure of the Ternary Complex of a NaV C-Terminal Domain, a Fibroblast Growth Factor Homologous Factor, and Calmodulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/signaling protein
total genus 51
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2012-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4dckA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4dckA02
2K2AA 1A75B 1WRZA 1XFWO 2MHHA 2KAVA 1IRJA 2I94A 4MZLA 1EXRA 1H8BA 1S5GZ 3O4YA 2R2IA 1DF0B 3GK4X 1VRKA 4PHKA 1JF2A 2MAZA 2LUCA 1OMVA 4IL1A 1LXFC 1YUTA 2JZIA 3BQ3A 2EHBA 2I2RE 3BUWB 3PLFB 3AAJA 3I5GB 2HQWA 1JUOA 1Y1UA 2BCXA 4ORAB 4I5NB 5DKNA 3GK2A 2SCPA 1A03A 2GGZA 1DGVA 1DGUA 1BU3A 5AXIA 1UHJA 1J1DA 2COLB 4MRXA 4ZCUA 1A29A 1JF0A 2KNEA 1RJVA 3TDUA 3E3RA 1WLZA 2K7OA 2LVKA 2Y1NA 1EJ3A 1AJ5A 4PE7A 1RROA 2K7CA 2HETA 2NXQA 2HF5A 1EG3A 5I2OA 1B8CA 3TS5B 1RWYA 4QJ3B 2F3YA 2P6BB 1V1GA 3DVEA 1UWOA 3WXAA 1GGWA 2F33A 1NYAA 1NPQA 4PE0A 4OV2A 2O5GA 5CSNA 2WCBA 1IGVA 4M2PA 3EVVA 3SG7A 2NLNA 3O78A 4PE1A 2AMIA 1EG4A 1K93D 3EVUA 3O6BA 2I18A 1CFDA 1OFCX 1KFXL 1CDNA 2L4HA 3IQOA 2KDHA 5IBWA 5ER4X 2BKIB 2JOJA 4AOMA 1RECA 1ALWA 4MSPA 3TUYB 1QTXA 2BL0B 2LVIA 1BG1A 3VRPA 1QIVA 3VRRA 1TNWA 1MF8B 1NCZA 1SCMB 1Q80A 2MLFC 2OS8B 2MLEC 1KK7Y 1U5IA 1KK8B 1Y1XA 2LVVA 2PSRA 3OX6A 4PHMA 5KU1A 1Y6WA 3DVJA 1J7PA 1F70A 3PSRA 5TNCA 4I5JA 2JTTA 1CFPA 1CKKA 1QLSA 2LUXA 5CSFA 4OCIA 2M8UA 1U5IB 1AHRA 4GGFC 1CM1A 1TNQA 1PVBA 2KAYA 2F2OA 4YGCB 4NDDA 3GOFA 2L5XB 4CFRA 5KTYA 1JFKA 1ZFSA 1QX2A 1N2DA 1UURA 2L51A 2LP2A 3LK0A 5CSIA 3WHUB 1JWDA 4HRGA 5J3XA 3BYAA 4Q04A 1S5GY 4I5KA 3QRXA 1F8HA 2FCDA 2KFGA 1M63B 3PFVA 2CBLA 1LVCD 5AANA 1F55A 5GQQC 4ORBB 1KQMC 2PRUA 1OOJA 1TIZA 2Y4QA 4YBHB 4DCKA 1KWOB 2M97A 2WCFA 3SG5A 1SW8A 4MVFA 4XYNA 3OP0A 2KQ6A 1CMGA 1SPYA 4GUKA 2WC8A 2A4JA 2JU0A 2M1KB 3IF7A 4WRIA 1RFJA 2JXLA 3CWGA 3TDIA 4N1GA 4JPZB 1NSHA 1OZSA 2HPSA 4PHNA 1CFCA 1B9AA 1AP4A 1QV1A 2ZRTA 1NWDA 2K2FA 1IKUA 1R2UA 3D10A 4AQIA 5ER5A 4MN0A 1J7RA 3PN7C 5F6TA 1NX2A 2OPOA 3EK4A 3A8RA 1F4OA 1AVSA 3NSLA 5AFPA 5JJGA 2LAPA 2KGRA 1L2OB 4U8DA 2EGDA 2BECA 1YVHA 2ZFDA 4YI9A 1S1EA 1XK4C 5AEQA 4ETOA 1MQ1A 3ZWHA 1S36A 1CLLA 2Q4UA 5FYXA 3VRNA 1QV0A 1DJGA 1XK4A 1CNPA 4GBAA 1QJTA 1S6CA 3CR4X 4DRWA 1C07A 4OR9B 3NXAA 2JT8A 4ORCB 4MZJA 1FI5A 1SRAA 4ZCVA 1IWQA 2M49B 1YTZC 1N65A 4YGBB 4PE4A 4DIRA 3LL8B 1CLBA 2KI4C 1XVJA 4MZKA 5KSZA 1PK0D 1PSBA 2F2PA 4JQ0D 1J7OA 2KSPA 2H61C 1S26D 3VGOA 2LCPA 2LLUA 3HCMA 1W7JB 1CMFA 1QIWA 2H61A 3JTDC 1TNPA 5HYDA 5G08A 1QS7A 1TCOB 1UHIA 2JQ6A 3OB1B 2JRFA 4YGDB 5D7FA 1PVAA 3KHEA 3VROA 2BKHB 1F71A 3TZ1A 3TS5C 2LANA 1J7QA 2KOTA 1LA0A 4MRYA 1DT7B 1C7VA 1YVLA 1IJ5A 2JT0A 3BUXB 2ZNEA 4QJ5B 1XFVO 2M1UA 2WCEA 2CCMA 1DJZA 2LNKA 3EVRA 5HKZA 1K8UA 5HLVA 1QX5B 2LMVA 4N1FA 1NIWA 1SY9A 1SYMA 1XA5A 2MJWB 3BOWA 3LLEA 5I2LA 4GFTA 1G33A 5PALA 2PMYA 4ICBA 1KFUS 2KI6C 1UHNA 4WQ3A 1JBAA 1LA3A 3DF0A 3VRQA 1YRUB 3CGAA 3RM1A 1YUSA 4L9MA 4C0JA 4E68A 1C7WA 2PVBA 1ZACA 5K89A 3K21A 3BUMB 4JWQA 3DVKA 1A4PA 1CFFA 1TOPA 1SBJA 3HX4A 3JVTC 2E30A 3PALA 4AQJA 5BPJA 2WORA 1K2HA 1G8IA 1WDCC 2ZRSA 1B8RA 1E8AA 1DVIA 1SR6B 1BR4B 1MWNA 2JNXA 1K9PA 4WQ2A 1B4CA 1RTP1 2B1UA 4GGFA 4PHJA 4F0ZB 1TTXA 1OSAA 1MHOA 1JFJA 2ZN9A 1N0YA 2LHLA 2M7LA 2IS9A 1ODBA 1QVIZ 3BUOB 1XFYO 1OZOA 4GGNA 3I5IB 1HQVA 1CDPA 2LMTA 1JC2A 3NSOA 1MUXA 3I5HC 1PSRA 4A4BA 2WOSA 3RLZA 2CT9A 1V1FA 4R1EA 3KPXA 1CM4A 1IH0A 2JT3A 1W7IB 1NCXA 1K95A 2CNPA 1XFUO 3LK1A 1CDLA 2FCEA 4PCWA 2KI6D 3AAKA 1M45A 1R6PA 2JPTA 1KQMB 1CTRA 2JWWA 2KHNA 3NSIA 1D1OA 4GNKB 1MR8A 4P2YB 3EKJA 1K9KA 3OB2B 1NX3A 1S6IA 1K94A 4DS7A 2L50A 4OKHA 2ZKMX 1UP5A 2H2KA 2OTGB 1AJ4A 2LE9B 1YR5A 5I2QA 3KO0A 2NCOA 1NX0A 1UHHA 3A4UB 4OVNF 2BBNA 2ZN8A 2E6WA 1NP8A 2EC6C 4HRHA 3WNXB 3CTNA 1BMOA 1UUSA 2JULA 1LKJA 4MEWA 1BF5A 1ALVA 1GGZA 2LHIA 1YUUA 2KQYA 3I5FB 3OHMB 3PN7B 3EK7A 2G9BA 1KSMA 2KGBC 2FJUB 3CLNA 1XO5A 1PULA 5HLOA 1FBVA 5B8IB 1F54A 2BE4A 1A75A 2M7NA 1BODA 3CS1A 3FWBA 4M2OA 3LCPC 1YX8A 1DF0A 4TNCA 4YGAA 3SG4A 4QJ4B 1J55A 4CFQA 1TCFA 1PALA 1DTLA 3NSKA 3SJSA 1NUBA 2V53A 3I5GC 2ISDA 2BCAA 2LC5A 1QXPA 2WNDA 2Y1MA 4MBEA 1XFXO 2M9GA 2M29A 5DKQA 1GJYA 4FTGA 2M3WA 2F3ZA 3AKBA 1FPWA 3CR5X 1SK6D 2KBIA 1IQ3A 1IQ5A 2KI4B 4MLWA 1DMOA 2KFFA 4YGEB 2AAOA 2K0JA 4PALA 4BY5A 2PASA 1QATA 3FIAA 3M0WA 4YRUA 1GQMA 2Y9ZA 2KAXA 1M46A 1AUIB 1DJHA 1S3PA 1SNLA 3C1VA 5JOLA 1DJIA 1QVIY 1YRTB 2L2EA 3KEVA 4I5LB 1KCYA 2KFHA 1K9UA 2GGMA 1NCYA 3JTDB 3SIAA 3DD4A 4FQOA 3PM8A 1OQPA 4CIDA 2JTZA 2L0PA 1S6JA 4HREE 2CXJA 1BOCA 2ZNDA 1TRFA 2NZ0A 2PALA 3SG2A 4XJKA 1KFXS 1FF1A 1QASA 4A4CA 1WY9A 1MXLC 1QLKA 1PRWA 1DJXA 3SIBA 5HKWA 4BY4A 5I8NA 1B7TZ 4CLNA 1IG5A 3GK1A 4XJKB 2O60A 2QPTA 2Y9YA 1DJWA 3TUYC 2BL0C 2I7AA 3BOWB 4GPLB 1Y1AA 2KYFA 3CR2A 2F8PA 3ZNIA 1CB1A 2OS8C 1SCMC 3H4SE 1G4YR 1ZOTB 1CLMA 3D0YA 1KK8C 1SMGA 2GV5A 1KSOA 3DF0B 2AUCA 2FOTA 2LVJA 2QACA 5DKRA 1OMDA 5CPVA 1XYDA 3O2PA 1OE9B 4NQGA 3D0YB 1BLQA 2LMUA 1OMRA 2MRDA 2TN4A 1KFUL 4P5OE 1NX1A 1K96A 1WRLA 1SR6C 1JSAA 5CSJA 3DVMA 3ICBA 1YX7A 3JVTB 2SASA 1EH2A 2RGIA 4USLA 1H4BA 1BR1B 1WDCB 3CZTX 1X02A 2JC2A 3EKHA 2KYCA 1KQVA 3WHTB 4M2QA 1BJFA 4C0KA 3BUNB 1F4QA 3I5IC 1A2XA 2K7BA 2JXCA 1FW4A 2NCPA 2D8NA 2LLTA 1M39A 3KF9A 1J1EA 1L7ZA 1QX7A 2BBMA 3BXKA 3SG6A 1DJYA 3AKAA 3FWCA 2JNFA 3SG3A 2DOQA 1KWOC 2BE6A 1ZMZA 2MA2A 1SKTA 2LV7A 4DUQA 2HQ8A 3I5HB 5D69A 4C0LA 2K8MB 4PDZA 1YURA 1RK9A 1WRKA 1SL9A 5HKYA 2G2BA 2KBMA 1B47A 4UPGA 1HT9A 3OX5A 1SL8A 1WLMA 4CPVA 5AERA 1B1GA 3PATA 1CDMA 1FI6A 2Q91A 1B8LA 1UHKA 3IQQA 3FS7A 1K90D 4N5XA 2CTNA 2BCBA 1EL4A 1AK8A 1IJ6A 2OTGC 4HSZA 2LM5A 2LP3A 2VRGA 1BT6A 1M31A 1KK7Z 2LLSA 1L2OC 1LINA 3EK8A 1SCVA 1Y0VH 2K7DA 1XFZO 2K61A 3I5FC 2Y5IA 3F45A 1TNXA 1B7TY 2EC6B 3TDZA 4NDCA 4GAOA 2L98A 1SL7A 2M0RA 2MBXA 1TN4A 4D1EA 1ZUZA 2L4IA 4NDBA 4YI8A 1MXEA 3MSEB
chains in the Genus database with same CATH superfamily
3BCCE 1A75B 2MHHA 1XFWO 2M8RA 3L71D 1EXRA 2ZVNB 3O4YA 2R2IA 2CPSA 1SQQK 3CWBG 2XV5A 1YUTA 2O3JA 3NHIA 1PIXA 1LP1A 2M3EA 4FQTA 3I5GB 2HQWA 3B8EB 4HKZH 4ORAB 1KQGB 3VMYA 4PD4H 5AVSB 2W27A 2IFNA 2E74D 1YJNP 2BCCD 4MRXA 4ZCUA 1RJVA 1IFJA 1ZXGA 5APXA 1WLZA 2LVKA 3IVTA 2WVRA 1K73Q 4W80A 2HETA 2HF5A 5K5GB 4K35A 1UIIA 5AVUB 2HYNA 1BDDA 3WXAA 2KUBA 1PPJG 3FE6A 1LWUC 2P58A 1SQBG 2JWDA 2KNCA 1VQPP 1LWUA 3BJHA 2KZIA 1VL2A 2M3BA 1K93D 1CFDA 3TGUE 1GL2C 1KFXL 1YHQP 2L4HA 3BFAA 2KDHA 1KFMA 1H89A 2OYIC 2WSSH 5ER4X 3N7NA 4AOMA 1RECA 1GU4A 3K1EA 2LVIA 1W2BO 1BG1A 3VRRA 1TNWA 2P7JA 1FZCB 2MLFC 3H1IJ 3R1OA 2MLEC 1Y1XA 3L4FA 2G8YA 2PP6A 5TNCA 4XA4A 3CCUP 4UB6H 4I5JA 2ZT9C 1EZVD 1CFPA 1HJBA 4OCIA 1AHRA 3VN0A 1NTZJ 3U59A 4YGCB 1BGYJ 4NDDA 3GOFA 2WMMA 5AVRB 5KTYA 2A06E 1ZFSA 1QX2A 2L51A 2LP2A 3LK0A 5CSIA 1ZRTD 2AEMA 2K37A 2GA1A 4AUWA 3RL0g 3QRXA 2YGUA 2FCDA 1JMBA 2IYOA 1KN7A 3NMDA 1HTLC 1LVCD 5AANA 4PD4D 2PRUA 2Y0CA 1TIZA 3B5NB 4YBHB 1H88A 3V2LA 1KWOB 2M97A 2WCFA 3SG5A 1SW8A 4MVFA 3OP0A 3KQGA 1CMGA 1P84I 2LXCB 2A4JA 2GTEA 3V6IA 1OXZA 3V2RA 4JPZB 2P67A 3D78A 1NSHA 1OZSA 3VYIA 4NPFX 1NWDA 1H0TA 4GOEA 1Z2CB 1R2UA 1NTKE 3KYQA 1URQD 5ER5A 4MN0A 4ZNCA 3C8VA 3A8RA 3R72A 1NKZB 1F4OA 2BASA 3CX5E 3NSLA 2IPPA 1L2OB 2BECA 4EIJA 4PT1A 3OW2O 1Q81Q 2ZFDA 1NO4A 1NTMK 1S1EA 5AEQA 4ETOA 1MQ1A 1S36A 1KMIZ 3V4WA 1DJGA 4L76A 4INWA 5KLIC 1S6CA 1C07A 4OR9B 3L4AA 3UIAA 1KQSO 4WY4A 4YGBB 4DIRA 1LTTC 2KLDA 3CWBD 5GTHE 3LW5H 4MZKA 1XVJA 4W7ZA 2JO1A 5KSZA 5CCHD 4JQ0D 3RK2C 1LP1B 2H61C 1S26D 1E5WA 3VGOA 1KORA 2LCPA 3BASA 1KB9I 2Q6QA 2H61A 5HYDA 1QS7A 2ZVOB 3OB1B 2KK7A 2QEBA 2JRFA 1L0NJ 3PRJA 3VROA 4IL6H 3BATA 1BE3J 3MZWB 3CZ0A 2O01H 4MRYA 3S9OA 2WCKA 3CZ1A 1IJ5A 5BU8B 4EOTA 3BUXB 2ZNEA 3VMXA 4QJ5B 2WITA 1PPJD 1NTMG 2M1UA 2CCMA 1DJZA 3EVRA 5HLVA 1SYMA 2ZFCA 3H1IE 1LWUB 4GFTA 4EI2A 1FOSF 3H6PA 4F7FA 3CDNA 3G9RA 4U7JA 3RM1A 1VF5D 3DVKA 1A4PA 2OYIB 2W6AA 4ASWA 1SBJA 3HX4A 1NTZE 1BGYE 2QM7A 5BPJA 3L35A 1K05A 1E8AA 1QL2A 4OGQC 3L47A 4H0LB 1MWNA 2R3SA 1EXIA 4GGFA 4F0ZB 1TTXA 2WCMA 1N0YA 5CCGD 2LHLA 2ZT9B 2M7LA 5FI6A 3HD7A 3JCUH 1IK9A 2J58A 4GGNA 3I5IB 3KZIE 2FYUG 2LMTA 1MUXA 3I5HC 4RJTA 3RLZA 2CT9A 1T3JA 1GK4A 4O9BA 4D6TJ 1NCXA 1G1IA 1K95A 1XFUO 1DH3A 2YXQB 1HUCA 3TYYA 2KI6D 3B86A 3AAKA 2O1JA 1M45A 2JPTA 1CTRA 3D75A 4EYYQ 1L0LD 4GNKB 2QDIA 1K9KA 1NX3A 1S6IA 2C0XA 4DS7A 3CI9A 3FWNA 2OTGB 1NKNA 1IO4A 2JEEA 5APTA 3KO0A 1UHHA 3A4UB 4OVNF 1LGHB 2ZN8A 2E6WA 2W90A 3I56P 4YTPC 5APUA 2L2CA 1AFOA 3IAOA 2LHIA 2WSFH 3I5FB 3AEDC 1PP9G 5BVZA 2L5GB 1CZQA 2FJUB 1R5LA 1JM0A 2BE4A 1SQPG 1K9MQ 4TNCA 1J55A 3NHTA 1Q90D 5KLIB 1QL1A 5KAFH 2ZXXA 2F3ZA 1L0NE 2KBIA 1T6AA 2CK3H 1M57D 1BE3E 1LS8A 1RQUA 1R8EA 1DMOA 1NH4A 5GTIE 4PALA 1PFIA 3RK2B 3M0WA 4YRUA 3RL0B 3PTZA 4N78E 3C1VA 1OOIX 1SNLA 1SQXJ 2PRRA 3SIAA 1RF0A 3PM8A 4CIDA 1JTHA 1S5LE 4HREE 1TRFA 3L37A 1QASA 2W83C 1WY9A 1PRWA 1DJXA 4KYNA 1EDJA 3L74G 5I8NA 3CABA 4WVZA 1IG5A 1NU1K 2O60A 1PZQA 1DJWA 2Z5HA 2OTKE 3TUYC 2HPCA 2BL0C 2I7AA 2QEHA 3CX5I 4PJ0E 3ZNIA 1CB1A 3H4SE 3A0HH 4H13C 1T3UA 2LVJA 1G1JA 1W9ZA 2WC5A 5KLVK 3O2PA 1OE9B 4NQGA 3D0YB 2TN4A 1KFUL 4P5OE 1WRLA 5AVZB 1Q86Q 4WWIA 3DVMA 1YX7A 3L71J 2D2CB 3CZTX 1JY3P 2LXBA 4OGQB 5B66H 1KQVA 4D6TE 3WHTB 5KJ7C 4OH8B 3CYZA 4INXA 3HD7B 1T2KC 3AE3C 3D6YA 1HGZA 5KJ7A 2LLTA 1J1EA 2FYUD 2MJZA 2BBMA 2GUVA 3GG2A 3NXSA 4N6JA 3VTPC 2MA2A 2Q9IA 1LNQA 3I5HB 2YXRB 1L2PA 5D69A 4C0LA 2K8MB 1QX8A 5CBOA 4LGDE 2G2BA 4IL6X 1B47A 4UPGA 1HT9A 3L70G 1L4AD 1SL8A 1B1GA 2GUSA 1FI6A 3IQQA 3HRNA 2E75C 5DJTB 1K90D 3L75J 1IJ6A 3WUUA 1Q2NA 2LM5A 5KLVG 2VRGA 3HE4A 5H2FH 3M9HA 3EK8A 2ZYAA 1LTIC 2QG4A 1FU1A 2QJYC 2Y5IA 1YQ3C 1JY2N 2IFMA 1TNXA 2HLOA 1PP9D 3A0BE 3P7KA 2MBXA 1TN4A 1EC5A 2L4IA 1YTZT 1MXEA 3MSEB 1N7LA 1SQPD 2UWJE 2I94A 4IFMA 1VRKA 1KV4A 2LUCA 3RK3D 3PM2A 4H44C 1OMVA 4IL1A 1LXFC 2E5TA 3Q5RA 2EHBA 2I2RE 1KZUB 3BUWB 2BCCG 1JUOA 4ZKUA 1SQXE 1JEKA 2HFED 2YMYA 1J1DC 1VF5C 3B6XA 2SCPA 1A03A 5AW7B 2GGZA 3D73A 2KSJA 2RH0A 1J1DA 3L72J 1A29A 3TDUA 3E3RA 1GTWA 2K7OA 1AJ5A 1OW4A 2H8VA 2K7CA 3AEBC 2NXQA 1EG3A 5I2OA 1FJKA 4QJ3B 1VQ7P 2P6BB 1GGWA 2F33A 1NYAA 1TUZA 4PE0A 1HWTC 4OV2A 5CSNA 3SG7A 2G3AA 5HL1A 1S9KD 1JY3N 4Z1MH 1JY2O 2IBZG 1WMKA 2I18A 4I6MC 1OFCX 1N73C 1CDNA 2HPCB 1PGQA 5AVWB 5IBWA 1ZMEC 4WY4D 3W67A 2JOJA 3H1HJ 3TSIA 1ALWA 4MSPA 3TUYB 2BL0B 3L71E 3VRPA 3T97A 2WC6A 4H13B 1OW7A 1J7PA 1F70A 3PSRA 2E42A 3L73J 3LIDA 1IFMA 3B87A 2JTTA 1CKKA 2QRXA 1MUUA 5AW3B 2KXPB 3CD6P 1CM1A 1KILC 4KJMA 1TNQA 1PVBA 2L5XB 1JFKA 1N2DA 2BNXA 4CPGA 2OYOA 4Q04A 2KLVA 4I5KA 2O1KA 3CC7P 3B5NA 3PFVA 1J1EB 2CBLA 2AXCA 1FZBA 1OOJA 3L75E 1U7MA 3NFQA 3OGNA 4XYNA 1FAVA 2IZ1A 4HB1A 2WC8A 3L70D 2M1KB 4JD9A 1RFJA 2JXLA 3CWGA 3TDIA 1S4XA 1M8OB 1VPCA 2IYPA 1N86A 1X22A 2K2FA 3U1AA 4AQIA 2E75B 3PH0A 1SQBJ 4R4MA 1FDIA 3PN7C 5F6TA 3A2AA 4IFFA 2NPSD 4A7PA 2EGDA 1YVHA 4YI9A 1X79B 1XK4C 3ZWHA 2KP8A 2AXTH 1SQQJ 2QJYB 1PV3A 4KT0J 3OA7A 1CLLA 1XK4A 3R2PA 2B9BA 1FJPA 4DRWA 3P8CE 3NXAA 4ORCB 1FI5A 2XDJA 1YTZC 3LL8B 2H8PD 2YO3A 3L72E 5APYA 3WU2E 1PSBA 2F2PA 3IFMA 4H44B 3H1KD 2QJPB 2RN0A 3LW5J 3M0AA 1K8AQ 3JTDC 3O4XA 1C3ZA 3S0DA 4JYBA 2A06G 1NYHA 1J1DB 5D7FA 3E1RA 1PVAA 5AW8B 3TZ1A 4AQRD 1OOFA 3TS5C 1QWVA 1C7VA 1YITP 1YVLA 3SS3A 3I55P 3H1HE 1XFVO 4OZDA 1K8UA 4TLFA 2LMVA 3BOWA 5I2LA 1GL2A 2OYIA 2PMYA 2IBZD 2B87A 3L73E 1LA3A 3DF0A 5EFWB 3CGAA 1YUSA 4L9MA 4E68A 5K89A 1N73B 3BUMB 4JWQA 3T97B 1HVVA 1LTSC 3JVTC 3H1JG 4BRYB 1K2HA 3KPEA 1OVVA 4HYTB 2ZRSA 1DVIA 1SR6B 3CLQA 2JNXA 1K9PA 1RTP1 1DEEG 4PHJA 1FS0E 1OSAA 3UO9A 1W5CE 2PYQA 2IS9A 4L73A 2Q5UA 4N3YB 1RF1C 2H7HA 3VB1A 1KILB 4RKUJ 1RF1A 2YMKA 4A4BA 2WOSA 1JB0J 4R1EA 2H89C 1IH0A 1CM4A 2WCJA 1W7IB 1KC8Q 1L0LG 1HBWA 1N7SD 1R6PA 1PPJE 3RK3C 2KHNA 1SQBE 1NJIQ 4C46A 1MR8A 3NTNA 4B86A 2JPOA 2L50A 2ZKMX 1VQ5P 2E76D 2WSEH 5I2QA 2N1TC 1NTMJ 1SQVG 1SQQE 2EC6C 4HRHA 1EDKA 3WNXB 3V5BA 2FYNC 4HH2A 3SSUA 2JULA 1FOSE 2OYHC 1SVFA 3RBXA 1ALVA 1JMMA 2KQYA 3PN7B 3MTUE 2KLEA 1YBKA 1XO5A 3H1IG 1PULA 5B8IB 3P8MC 2M7NA 5CMZA 4XFJA 4M2OA 1EXJA 1YX8A 1ZP0C 2H88C 1K04A 2WTYA 4PV1D 3SG4A 1MFTA 1HJ0A 3AEFC 5DICA 2LC5A 3D71A 2W6JH 4U3FJ 2Y1MA 2RMZA 1BGYG 5DKQA 4ZMDA 1FPWA 3AKBA 3A3YB 2H43A 3HUSC 4RESB 1YQ4C 1VQKP 1D7MA 3AE9C 2I1JA 2KFFA 2AAOA 4BY5A 3FIAA 3A7OA 2Y9ZA 3S0AA 2FYUK 3II6A 1AUIB 2YKQA 4IL6E 1MKMA 2A06D 2POHA 1NHLA 2GGMA 3JTDB 3DD4A 1OW8A 1S6JA 1BOCA 2CXJA 1HF9A 1SFCC 3PLNA 4DOJA 1LTJC 1KILE 3VMZA 1FZFA 1QLKA 3GLMA 4ASVA 2XU6A 1LTJA 2R44A 1NAYA 2A45G 3OBVA 5HKWA 2XKMA 2QSIA 1IFPA 4XJKB 2Y9YA 5AW2B 3C9IA 4GT1A 3BOWB 1VQNP 1GL2B 3B7AA 2OS8C 1SCMC 2LR2A 4OWFA 3D0YA 3IR9A 1KK8C 2B89A 2B87B 1EZVI 2GV5A 5TJHA 1NGMB 3DF0B 3PJSK 2AUCA 2FOTA 1XTGB 3E7KA 2PFXA 3S0EA 1DIPA 5DKRA 1IC2A 1OMDA 5CPVA 1Y9BA 1NTKD 4DT0A 4WBAA 2N9BA 1OMRA 3EFFK 3H1JD 1NX1A 3AE8C 1JSAA 3FX0A 3JVTB 1T14A 1EH2A 2RGIA 1SQPK 1H4BA 3JCUE 3DXLA 2JP3A 2JC2A 4LLHA 1QEXA 2KYCA 4NPEA 4PD4I 4M2QA 4C0KA 1F4QA 2HG5D 1A2XA 2PQLA 2NCPA 2JXCA 5EL2A 2D8NA 1RE3C 1L7ZA 1QX7A 4XE5B 3SG6A 1RF1B 3AKAA 1RE3A 3SG3A 2BE6A 2I8DA 1KFNA 4ZKPA 3RGUA 4DUQA 3ABVC 1VQMP 1LTGC 1L0NG 1RK9A 1SL9A 2K88A 1IFDA 1M7LA 5AERA 3F5HA 5L8RJ 4CPVA 3PATA 1NTME 3V2QA 4YXDC 4DJGA 2A45H 2E74C 5KAIE 5DJUB 1AK8A 3S4RA 5CHXA 4JKTA 2M0BA 2LP3A 1ZW0A 1KD1Q 2LLSA 5E79E 3L74J 1RE4C 4I7ZC 1CSBA 2QJKC 3AE5C 1SQVD 1Y0VH 1PGOA 1RE4A 2K61A 2N1TB 2KOGA 3Q2YA 2ZXEB 2EC6B 2WWWA 4NDCA 2FYNB 1ZUZA 2OYHB 4U3FE 2WT7A 3H1ID 2Q7CA 4C7RA 1S72P 2K2AA 1WRZA 3B5ND 1IZNB 1H8BA 3GMAA 1JNMA 2FYZA 2W6BA 4PHKA 3O6QB 3Q5SA 1FDOA 2JZIA 1NTZD 3MHVA 3AAJA 1BGYD 1KYOH 5AVTB 1Y1UA 2BCXA 3GK2A 5AW0B 1DGVA 5AXIA 1UHJA 4JBZA 3HUSB 3D76A 2WSCJ 1QVGO 1WT6A 1LTBC 4PE7A 1RROA 3DVEA 1NU1J 2QM8A 3TDKA 2VRSA 3HTKA 1XTCC 2WCBA 1SFCB 1S5LH 1LTJB 2NLNA 3K5BA 3G6EP 2KYVA 3O78A 1BDCA 2AMIA 3EVUA 1M1JC 2XNDH 1M1KQ 5KLVJ 1GM0A 3M0DC 3IQOA 1Z4HA 3CCLP 5BU5A 1QIVA 1N7SC 2OS8B 1SCMB 2LVVA 4PJ0H 1KK8B 3WUTA 5KU1A 3DVJA 3RK3E 2ZYDA 3CXHH 1A02F 3EWKA 1URQC 2JJLA 1QLSA 5CSFA 4IOIH 1U5IB 2V7QH 3R4YA 2NRGA 5B66E 1BCCG 2KAYA 1FZEA 3Q3DA 3S0BA 1JWDA 4HRGA 1VQ9P 1S5GY 4R4LA 5KTBA 3SWYA 2QVAA 1F8HA 2KFGA 1KYOD 2BCCJ 5FI2A 1VQ4P 1F55A 1VQOP 3IN6A 2JKVA 3AE7C 1DEKA 1SQXG 1L0ND 5CCHC 4GUKA 1BE3D 3L74E 3UNWA 2XNXA 4WRIA 2JU0A 3SWFA 3IF7A 1Y47A 4H0LD 1CFCA 1AP4A 2ZRTA 5H2FE 3TK1A 2ZT9D 1IFNA 2E74B 1J7RA 3EK4A 3GF7A 2NZ2A 5AFPA 5JJGA 2LAPA 3BRVB 3GHGC 2ZYGA 4I7ZB 5AVQB 3SFDC 2WPSA 4KHXA 3VRNA 5FYXA 5APSA 2L91A 2WT7B 1QJTA 5B5EH 2WQYC 2JT8A 3CXHD 1SRAA 4ZCVA 3H1KG 4PE4A 3SS4A 1AVOA 2KI4C 1JOCA 1PK0D 3WUVA 2WCLA 2KSPA 1NVOA 5TISE 2FBWC 1DD4A 3HCMA 1QIWA 1NU1E 2JQ6A 4UB8H 1Y8AA 2KSEA 4YGDB 5CCGC 4D6TD 3AE4C 3KHEA 1GU5A 5FI7A 1Z56A 1Q82Q 2BKHB 5CCGA 1RH5B 1YTZI 2KOTA 1LA0A 1DT7B 1OW6A 5KLVE 2FFDC 1AV1A 3HTKB 1P84H 5D3OA 3VOPA 2LNKA 3AEAC 1CW5A 1QX5B 1NIWA 1XA5A 1N73A 5PALA 2FXPA 1TWOA 2KI6C 2K1AA 2KLUA 3H1LG 1RY3A 3B4SA 4GIFA 4BRYA 3VRQA 1YRUB 2SPZA 4K3AA 4C7NA 3CMEP 1C7WA 1JCCA 1FZCC 1CFFA 3RK2D 3RL0D 2WORA 1HH0A 1YYCA 2WZ7A 1LT9C 1BR4B 3P32A 1KILA 3CWBJ 3QH9A 4GOFA 1OX3A 1LT9A 3BCCG 2BCCE 2ZN9A 1QGKB 4L75A 1URQB 3CCEP 1BCCD 1ODBA 3QMEA 3BUOB 1OZOA 1YI2P 1HQVA 1JC2A 1S3JA 3BFHA 3RBZA 3NSOA 1PSRA 2FKWB 2FXMA 1DX7A 1GW3A 2K3RA 4EDFA 1V1FA 2XZRA 1EDIA 3SS5A 2JT3A 3L72G 1KB9H 2CNPA 1CDLA 4PCWA 1JY3O 1RHZB 1SQXD 1ORGA 4L74A 3W68A 2JWWA 3NSIA 3H25A 4GKGA 2WCHA 4Y99C 4P2YB 2E5YA 4OKHA 2IBZE 2P1JA 2H2KA 3CZ2A 3KXDA 2D2CD 2LE9B 3OAKA 1S5LX 2K9YA 3FWLA 1OVRA 2NCOA 1NX0A 3M9QA 4OGQD 2BBNA 1P84D 2RKLA 1X0TA 1EZVE 1C3YA 3HD7D 3CTNA 2WSEJ 1FBMA 4MEWA 3GF3A 5AVVB 1BF5A 2YKOA 1GGZA 3TGUG 3EK7A 3AE2C 3C1LA 1KSMA 2HR3A 3VP9A 1F54A 1ZRTE 1NWQA 2KI7B 3GHGB 3CS1A 3FWBA 1BSNA 3LCPC 1DF0A 3MGNA 1NTKK 2HODB 3H1JJ 4QJ4B 4CFQA 1TCFA 1PALA 3NSKA 1NUBA 2V53A 2P2UA 2BCAA 4PD4E 1QXPA 2WNDA 2JR8A 3DY9A 2M9GA 2M29A 1N8RQ 4FTGA 2M3WA 1IQ3A 1IQ5A 2KI4B 1FE6A 1VF5B 2Q3EA 3AECC 1GQMA 3WU2H 3D6ZA 1M46A 1DJHA 3EFGA 5JOLA 1YRTB 1QVIY 2L2EA 4M3LA 3CCMP 2KFHA 2V4HA 1K9UA 2KS1A 1JUNA 1NCYA 4RO0A 1OQPA 2JTZA 2L0PA 1KB9D 3D77A 1L0LJ 2ZNDA 3AEGC 3SG2A 2O01J 1L0LK 4XJKA 1KFXS 2W8ZA 4A4CA 1KTMA 3JSVC 3M06A 4BY4A 2R3CA 4Y28J 4YPCA 3L75D 2FFDB 3GK1A 2QPTA 1DELA 3U1CA 1Y1AA 2KYFA 1NOHA 2F8PA 2YKPA 3B71A 2KB7P 1NTKG 4GODA 1G4YR 1CLMA 2BEQD 2QEXP 2C9LY 4UB6E 1L4AC 3H1LD 1SMGA 1SQVJ 1KSOA 3N4XA 2QACA 1SQVK 3CWBE 4C7NB 1L4AA 1XYDA 1XFRA 3PP5A 1SQQG 2FJYA 2MRDA 2QE7H 4H0LC 5AVXB 3ICBA 3FE8A 2P70A 1BR1B 1X02A 3BCCD 1LT9B 3A5TA 3CCVP 1BJFA 1AJYA 3BUNB 3I5IC 2K7BA 3H32B 2JWAA 1NTZK 3KF9A 1SS1A 3P8CD 1CI6A 3FWCA 2JNFA 2M5AB 1ZMZA 1SKTA 2LV7A 1OIPA 2HQ8A 3L72D 4PDZA 1YURA 1BSHA 3PJIA 4H13D 2J59M 1KQLA 5AW4B 3EQ2A 2Q91A 1J2JB 1B8LA 1UHKA 3O8ZA 2CTNA 1EL4A 2OTGC 4HSZA 1OWAA 2KPHA 1TU3F 1BT6A 2N1TA 4Y99B 1QVFO 1E79H 1LINA 3JC22 1PGJA 3EG5B 1SCVA 2OYHA 2K7DA 3N7HA 2PGDA 1AQ5A 3H1JE 3I5FC 3RZSA 2WSFJ 3CX5H 5KJ7D 4NPDA 1B7TY 3H1HD 2Q3IA 3TGUD 4GAOA 1T2KD 4D1EA 3O6QA 5KKZC 4NDBA 3L36A 5APVA 2KAVA 1IRJA 4MZLA 3USSA 1S5GZ 1NTZG 3L73D 3TNUA 1DF0B 3GK4X 3CL3D 2YIUC 1JF2A 3HE5B 2MAZA 2IDBA 1GD2E 4IFDK 4WY4C 3BQ3A 3PLFB 1X8YA 3HUSA 5GTHH 1RQVA 2FYUJ 4I5NB 5DKNA 1A02J 1IIOA 2E75D 1L0LE 1DGUA 1BU3A 3RL0C 2COLB 1JF0A 2KNEA 1ZN5A 2Y1NA 1EJ3A 2KS1B 2BEZF 3FXDA 1SFCA 1B8CA 3TS5B 1RWYA 2F3YA 2OTLP 1V1GA 1UWOA 1L0NK 3AE6C 3VP8A 2IBZI 4WB4A 1MV8A 1NPQA 3CCQP 3CCJP 2O5GA 1JCDA 1SQVE 1IGVA 4M2PA 3EVVA 2WPQA 1DC1A 4PE1A 3CCSP 5C39A 1EG4A 3O6BA 1HGVA 1S1CX 1IK7A 1SQBD 5AW9B 4H44D 2BKIB 2KNCB 1PP9J 1QTXA 4I2LC 1MF8B 1NCZA 3FE9A 1Q80A 1KK7Y 1U5IA 2PSRA 1L4AB 4TT3H 1SQPJ 3OX6A 4PHMA 3CX5D 1Y6WA 2R5DA 1SQQD 5CBNA 1VQ8P 1AVYA 2LUXA 2M8UA 2D2CC 4GGFC 3G3ZA 4AYCA 2NPSC 3M9BA 2F2OA 5AW6B 4U3FG 4CFRA 2NPSA 3HD7C 1UURA 3WHUB 2V7QJ 5J3XA 1T8ZA 3QWOC 1G2CA 3WMM0 3BYAA 1M90Q 2OQQA 4LC1A 3KZIH 3BRTB 1M63B 2E43A 1YJWP 1CI6B 5GQQC 1GMJA 4ORBB 2C9NY 2OTJP 1BE3G 2QIWA 1KQMC 1Q7YQ 2Y4QA 1OOGA 4DCKA 1LJ2A 2Z5IA 4QMAA 2I1KA 3CPWO 3BFBA 2KQ6A 4W7YA 2DW3A 1SPYA 3RK3B 1OZHA 4IJ7A 1FC2C 1VQ6P 5AW1B 2ZAEB 3CC4P 2O01N 4N1GA 3GW6A 2HPSA 4PHNA 1B9AA 1IJDB 1QV1A 1EQ7A 1IKUA 2Y0DA 3D10A 2Y0EA 1ZOYC 1X9VA 1NX2A 2OPOA 2K9JA 5KAIH 1AVSA 1KILD 1FDMA 3SFEC 1H0TB 2FXOA 2KGRA 4U8DA 1IFIA 1VQLP 5E79H 3ITKA 3KHUA 2Q4UA 5KAFE 3Q1MA 1QV0A 1CNPA 4GBAA 3CR4X 2FYUE 5KKZB 4MZJA 3TNUB 1IWQA 2M49B 2WPRA 3M91A 1H8AA 3CCRP 1N65A 1MZ9A 1KYOE 1SSEB 1TUJA 1CLBA 3BVHA 1DEBA 1EDLA 2YIUB 1BCCJ 1AA0A 1J7OA 1LT1A 4WY4B 3F89A 2FY8A 2YNYA 2LLUA 1W7JB 4D6TG 3V2PA 1W2EA 1CMFA 2ERBA 1ZV8A 3MIWA 4I1LA 1TNPA 5G08A 1OMIA 1UHIA 1TCOB 1GZLA 4BXLA 1JY2P 5GTIH 1F71A 1RF0C 3L70J 3V4QA 2LANA 1J7QA 2IZ0A 2JT0A 1SQXK 3D70A 3A0HE 3S1KA 1PP9E 2WCEA 5HKZA 4JF7A 4N1FA 1SY9A 3LLEA 2MJWB 1M1JA 3L4LA 1G33A 3M0DA 3I5CA 1SQPE 1U7JA 4ICBA 1KFUS 1UHNA 4WQ3A 1JBAA 1NTMD 4JYCA 4C0JA 1ZR2A 2OARA 2PVBA 1N7SA 1ZACA 1PGPA 3AE1C 3K21A 3D74A 1ZLLA 1TOPA 3DYEA 3CXHE 2E30A 3PALA 4AQJA 1GW4A 1QLED 2E76C 1URQA 3IF4A 1G8IA 1WDCC 3MUDC 2AEJA 1B8RA 3ZDMA 4WQ2A 1B4CA 2B1UA 5CJ4A 3MUDA 1MHOA 1JFJA 1OVUA 5APQA 3H1KJ 1QVIZ 1XFYO 3Q8IA 3DZTA 4U3FD 2NPSB 1CDPA 1G2CB 3TF5A 5I94A 1J1EC 4PV1C 1GL2D 1SP4A 3KPXA 2YO2A 1GDTA 1S9KE 1PL5A 3LK1A 2FCEA 5CCHA 1KQMB 4N78D 3MD0A 1D1OA 1FZGA 4HJGH 1NU1G 1SLQA 2PAJA 3EKJA 3OB2B 1LTAC 1K94A 1UP5A 3FXEA 1WRGA 1AJ4A 1YR5A 4GDOA 1NP8A 2QJKB 5M1BA 2K60A 1GK6A 2ITAA 2K9JB 2L5YA 1BMOA 1UUSA 1LKJA 1MFZA 3GHGA 1YUUA 3OHMB 2G9BA 3H1LJ 2HODA 2J5UA 2R5BA 2KGBC 1R5SA 3CLNA 5HLOA 1FBVA 5B5EE 1A75A 3A0BH 1BODA 2LKMA 3L71G 1FZAA 1BCCE 3FGAD 1KQFB 4YGAA 1DTLA 3SJSA 3I5GC 2ISDA 2N9YB 2MKVA 4MBEA 1XFXO 2P71A 3BCCJ 1GJYA 1DD3A 3CR5X 1SK6D 3R1VA 2QJPC 3AEEC 4MLWA 3L70E 4YGEB 4UB8E 2K0JA 2PASA 1QATA 2KAXA 3R1PA 1S3PA 4DZOA 1DJIA 1DQEA 3KEVA 4I5LB 1KCYA 2WSCH 5TISH 2OGUA 2R32A 2N1TD 3CMAP 4FQOA 3KDPB 3G4SP 1OOHA 1VDFA 2A45I 2Z4EA 2C0WA 2NZ0A 2PALA 2FFDA 3L75G 2QA4P 1FF1A 1USDA 3VMAA 1P84E 1NAFA 1MXLC 3SIBA 1JTHB 1S2EA 1B7TZ 1JO5A 4CLNA 2Q1KA 2WPVB 5AW5B 4GPLB 1P28A 1M1JB 3CR2A 3L74D 1ZOTB 3OJAB 1FZCA 5CJ0A 2BAPA 1N7SB 2AEFA 3B88A 3TGUJ 1BLQA 2LMUA 2KZJA 2CPBA 3H1KE 1EZVG 3LIEA 1K96A 1SR6C 5CSJA 2SASA 2E76B 3V2NA 3H32A 4USLA 1KYOI 1WDCB 1M56D 2QEOA 3EKHA 2JDIH 4YXWH 5APWA 2M5AA 1N2DC 1FW4A 1SFCD 1M39A 3S0FA 3BXKA 1DJYA 3B5NC 2KIKA 4MN4C 2DOQA 1KWOC 1KB9E 3G71P 1UIXA 5AVYB 2GM4A 4PV1B 1WRKA 1USEA 2ZJSE 5HKYA 2KBMA 2IX7C 3OX5A 3PHLA 1WLMA 1U57A 1CDMA 3FS7A 1NU1D 3S0GA 3E1IA 4N5XA 2BCBA 1YIJP 3H1LE 1M31A 1KK7Z 1L2OC 3MP7B 3SWKA 3H1HG 2B88A 3NGVA 4BWNA 2AXTE 1YJ9P 1XFZO 5KLVD 1ZR4A 3Q5PA 3F45A 3HE4B 2QEVA 1SQBK 1NTKJ 3CXHI 3TDZA 3L73G 2P10A 3CC2P 2L98A 1SL7A 2M0RA 1AQTA 3HE5A 4YI8A
chains in the Genus database with same CATH topology
2K2AA 1A75B 1WRZA 1XFWO 2MHHA 2KAVA 1IRJA 2I94A 4MZLA 1EXRA 1H8BA 1S5GZ 3O4YA 2R2IA 1DF0B 3GK4X 1VRKA 4PHKA 1JF2A 2MAZA 2LUCA 1OMVA 4IL1A 1LXFC 1YUTA 2JZIA 3BQ3A 2EHBA 2I2RE 3BUWB 3PLFB 3AAJA 3I5GB 2HQWA 1JUOA 1Y1UA 2BCXA 4ORAB 4I5NB 5DKNA 3GK2A 2SCPA 1A03A 2GGZA 1DGVA 1DGUA 1BU3A 5AXIA 1UHJA 1J1DA 2COLB 4MRXA 4ZCUA 1A29A 1JF0A 2KNEA 1RJVA 3TDUA 3E3RA 1WLZA 2K7OA 2LVKA 2Y1NA 1EJ3A 1AJ5A 4PE7A 1RROA 2K7CA 2HETA 2NXQA 2HF5A 1EG3A 5I2OA 1B8CA 3TS5B 1RWYA 4QJ3B 2F3YA 2P6BB 1V1GA 3DVEA 1UWOA 3WXAA 1GGWA 2F33A 1NYAA 1NPQA 4PE0A 4OV2A 2O5GA 5CSNA 2WCBA 1IGVA 4M2PA 3EVVA 3SG7A 2NLNA 3O78A 4PE1A 2AMIA 1EG4A 1K93D 3EVUA 3O6BA 2I18A 1CFDA 1OFCX 1KFXL 1CDNA 2L4HA 3IQOA 2KDHA 5IBWA 5ER4X 2BKIB 2JOJA 4AOMA 1RECA 1ALWA 4MSPA 3TUYB 1QTXA 2BL0B 2LVIA 1BG1A 3VRPA 1QIVA 3VRRA 1TNWA 1MF8B 1NCZA 1SCMB 1Q80A 2MLFC 2OS8B 2MLEC 1KK7Y 1U5IA 1KK8B 1Y1XA 2LVVA 2PSRA 3OX6A 4PHMA 5KU1A 1Y6WA 3DVJA 1J7PA 1F70A 3PSRA 5TNCA 4I5JA 2JTTA 1CFPA 1CKKA 1QLSA 2LUXA 5CSFA 4OCIA 2M8UA 1U5IB 1AHRA 4GGFC 1CM1A 1TNQA 1PVBA 2KAYA 2F2OA 4YGCB 4NDDA 3GOFA 2L5XB 4CFRA 5KTYA 1JFKA 1ZFSA 1QX2A 1N2DA 1UURA 2L51A 2LP2A 3LK0A 5CSIA 3WHUB 1JWDA 4HRGA 5J3XA 3BYAA 4Q04A 1S5GY 4I5KA 3QRXA 1F8HA 2FCDA 2KFGA 1M63B 3PFVA 2CBLA 1LVCD 5AANA 1F55A 5GQQC 4ORBB 1KQMC 2PRUA 1OOJA 1TIZA 2Y4QA 4YBHB 4DCKA 1KWOB 2M97A 2WCFA 3SG5A 1SW8A 4MVFA 4XYNA 3OP0A 2KQ6A 1CMGA 1SPYA 4GUKA 2WC8A 2A4JA 2JU0A 2M1KB 3IF7A 4WRIA 1RFJA 2JXLA 3CWGA 3TDIA 4N1GA 4JPZB 1NSHA 1OZSA 2HPSA 4PHNA 1CFCA 1B9AA 1AP4A 1QV1A 2ZRTA 1NWDA 2K2FA 1IKUA 1R2UA 3D10A 4AQIA 5ER5A 4MN0A 1J7RA 3PN7C 5F6TA 1NX2A 2OPOA 3EK4A 3A8RA 1F4OA 1AVSA 3NSLA 5AFPA 5JJGA 2LAPA 2KGRA 1L2OB 4U8DA 2EGDA 2BECA 1YVHA 2ZFDA 4YI9A 1S1EA 1XK4C 5AEQA 4ETOA 1MQ1A 3ZWHA 1S36A 1CLLA 2Q4UA 5FYXA 3VRNA 1QV0A 1DJGA 1XK4A 1CNPA 4GBAA 1QJTA 1S6CA 3CR4X 4DRWA 1C07A 4OR9B 3NXAA 2JT8A 4ORCB 4MZJA 1FI5A 1SRAA 4ZCVA 1IWQA 2M49B 1YTZC 1N65A 4YGBB 4PE4A 4DIRA 3LL8B 1CLBA 2KI4C 1XVJA 4MZKA 5KSZA 1PK0D 1PSBA 2F2PA 4JQ0D 1J7OA 2KSPA 2H61C 1S26D 3VGOA 2LCPA 2LLUA 3HCMA 1W7JB 1CMFA 1QIWA 2H61A 3JTDC 1TNPA 5HYDA 5G08A 1QS7A 1TCOB 1UHIA 2JQ6A 3OB1B 2JRFA 4YGDB 5D7FA 1PVAA 3KHEA 3VROA 2BKHB 1F71A 3TZ1A 3TS5C 2LANA 1J7QA 2KOTA 1LA0A 4MRYA 1DT7B 1C7VA 1YVLA 1IJ5A 2JT0A 3BUXB 2ZNEA 4QJ5B 1XFVO 2M1UA 2WCEA 2CCMA 1DJZA 2LNKA 3EVRA 5HKZA 1K8UA 5HLVA 1QX5B 2LMVA 4N1FA 1NIWA 1SY9A 1SYMA 1XA5A 2MJWB 3BOWA 3LLEA 5I2LA 4GFTA 1G33A 5PALA 2PMYA 4ICBA 1KFUS 2KI6C 1UHNA 4WQ3A 1JBAA 1LA3A 3DF0A 3VRQA 1YRUB 3CGAA 3RM1A 1YUSA 4L9MA 4C0JA 4E68A 1C7WA 2PVBA 1ZACA 5K89A 3K21A 3BUMB 4JWQA 3DVKA 1A4PA 1CFFA 1TOPA 1SBJA 3HX4A 3JVTC 2E30A 3PALA 4AQJA 5BPJA 2WORA 1K2HA 1G8IA 1WDCC 2ZRSA 1B8RA 1E8AA 1DVIA 1SR6B 1BR4B 1MWNA 2JNXA 1K9PA 4WQ2A 1B4CA 1RTP1 2B1UA 4GGFA 4PHJA 4F0ZB 1TTXA 1OSAA 1MHOA 1JFJA 2ZN9A 1N0YA 2LHLA 2M7LA 2IS9A 1ODBA 1QVIZ 3BUOB 1XFYO 1OZOA 4GGNA 3I5IB 1HQVA 1CDPA 2LMTA 1JC2A 3NSOA 1MUXA 3I5HC 1PSRA 4A4BA 2WOSA 3RLZA 2CT9A 1V1FA 4R1EA 3KPXA 1CM4A 1IH0A 2JT3A 1W7IB 1NCXA 1K95A 2CNPA 1XFUO 3LK1A 1CDLA 2FCEA 4PCWA 2KI6D 3AAKA 1M45A 1R6PA 2JPTA 1KQMB 1CTRA 2JWWA 2KHNA 3NSIA 1D1OA 4GNKB 1MR8A 4P2YB 3EKJA 1K9KA 3OB2B 1NX3A 1S6IA 1K94A 4DS7A 2L50A 4OKHA 2ZKMX 1UP5A 2H2KA 2OTGB 1AJ4A 2LE9B 1YR5A 5I2QA 3KO0A 2NCOA 1NX0A 1UHHA 3A4UB 4OVNF 2BBNA 2ZN8A 2E6WA 1NP8A 2EC6C 4HRHA 3WNXB 3CTNA 1BMOA 1UUSA 2JULA 1LKJA 4MEWA 1BF5A 1ALVA 1GGZA 2LHIA 1YUUA 2KQYA 3I5FB 3OHMB 3PN7B 3EK7A 2G9BA 1KSMA 2KGBC 2FJUB 3CLNA 1XO5A 1PULA 5HLOA 1FBVA 5B8IB 1F54A 2BE4A 1A75A 2M7NA 1BODA 3CS1A 3FWBA 4M2OA 3LCPC 1YX8A 1DF0A 4TNCA 4YGAA 3SG4A 4QJ4B 1J55A 4CFQA 1TCFA 1PALA 1DTLA 3NSKA 3SJSA 1NUBA 2V53A 3I5GC 2ISDA 2BCAA 2LC5A 1QXPA 2WNDA 2Y1MA 4MBEA 1XFXO 2M9GA 2M29A 5DKQA 1GJYA 4FTGA 2M3WA 2F3ZA 3AKBA 1FPWA 3CR5X 1SK6D 2KBIA 1IQ3A 1IQ5A 2KI4B 4MLWA 1DMOA 2KFFA 4YGEB 2AAOA 2K0JA 4PALA 4BY5A 2PASA 1QATA 3FIAA 3M0WA 4YRUA 1GQMA 2Y9ZA 2KAXA 1M46A 1AUIB 1DJHA 1S3PA 1SNLA 3C1VA 5JOLA 1DJIA 1QVIY 1YRTB 2L2EA 3KEVA 4I5LB 1KCYA 2KFHA 1K9UA 2GGMA 1NCYA 3JTDB 3SIAA 3DD4A 4FQOA 3PM8A 1OQPA 4CIDA 2JTZA 2L0PA 1S6JA 4HREE 2CXJA 1BOCA 2ZNDA 1TRFA 2NZ0A 2PALA 3SG2A 4XJKA 1KFXS 1FF1A 1QASA 4A4CA 1WY9A 1MXLC 1QLKA 1PRWA 1DJXA 3SIBA 5HKWA 4BY4A 5I8NA 1B7TZ 4CLNA 1IG5A 3GK1A 4XJKB 2O60A 2QPTA 2Y9YA 1DJWA 3TUYC 2BL0C 2I7AA 3BOWB 4GPLB 1Y1AA 2KYFA 3CR2A 2F8PA 3ZNIA 1CB1A 2OS8C 1SCMC 3H4SE 1G4YR 1ZOTB 1CLMA 3D0YA 1KK8C 1SMGA 2GV5A 1KSOA 3DF0B 2AUCA 2FOTA 2LVJA 2QACA 5DKRA 1OMDA 5CPVA 1XYDA 3O2PA 1OE9B 4NQGA 3D0YB 1BLQA 2LMUA 1OMRA 2MRDA 2TN4A 1KFUL 4P5OE 1NX1A 1K96A 1WRLA 1SR6C 1JSAA 5CSJA 3DVMA 3ICBA 1YX7A 3JVTB 2SASA 1EH2A 2RGIA 4USLA 1H4BA 1BR1B 1WDCB 3CZTX 1X02A 2JC2A 3EKHA 2KYCA 1KQVA 3WHTB 4M2QA 1BJFA 4C0KA 3BUNB 1F4QA 3I5IC 1A2XA 2K7BA 2JXCA 1FW4A 2NCPA 2D8NA 2LLTA 1M39A 3KF9A 1J1EA 1L7ZA 1QX7A 2BBMA 3BXKA 3SG6A 1DJYA 3AKAA 3FWCA 2JNFA 3SG3A 2DOQA 1KWOC 2BE6A 1ZMZA 2MA2A 1SKTA 2LV7A 4DUQA 2HQ8A 3I5HB 5D69A 4C0LA 2K8MB 4PDZA 1YURA 1RK9A 1WRKA 1SL9A 5HKYA 2G2BA 2KBMA 1B47A 4UPGA 1HT9A 3OX5A 1SL8A 1WLMA 4CPVA 5AERA 1B1GA 3PATA 1CDMA 1FI6A 2Q91A 1B8LA 1UHKA 3IQQA 3FS7A 1K90D 4N5XA 2CTNA 2BCBA 1EL4A 1AK8A 1IJ6A 2OTGC 4HSZA 2LM5A 2LP3A 2VRGA 1BT6A 1M31A 1KK7Z 2LLSA 1L2OC 1LINA 3EK8A 1SCVA 1Y0VH 2K7DA 1XFZO 2K61A 3I5FC 2Y5IA 3F45A 1TNXA 1B7TY 2EC6B 3TDZA 4NDCA 4GAOA 2L98A 1SL7A 2M0RA 2MBXA 1TN4A 4D1EA 1ZUZA 2L4IA 4NDBA 4YI8A 1MXEA 3MSEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2A A;  1A75 B;  1WRZ A;  1XFW O;  2MHH A;  2KAV A;  1IRJ A;  2I94 A;  4MZL A;  1EXR A;  1H8B A;  1S5G Z;  3O4Y A;  2R2I A;  1DF0 B;  3GK4 X;  1VRK A;  4PHK A;  1JF2 A;  2MAZ A;  2LUC A;  1OMV A;  4IL1 A;  1LXF C;  1YUT A;  2JZI A;  3BQ3 A;  2EHB A;  2I2R E;  3BUW B;  3PLF B;  3AAJ A;  3I5G B;  2HQW A;  1JUO A;  1Y1U A;  2BCX A;  4ORA B;  4I5N B;  5DKN A;  3GK2 A;  2SCP A;  1A03 A;  2GGZ A;  1DGV A;  1DGU A;  1BU3 A;  5AXI A;  1UHJ A;  1J1D A;  2COL B;  4MRX A;  4ZCU A;  1A29 A;  1JF0 A;  2KNE A;  1RJV A;  3TDU A;  3E3R A;  1WLZ A;  2K7O A;  2LVK A;  2Y1N A;  1EJ3 A;  1AJ5 A;  4PE7 A;  1RRO A;  2K7C A;  2HET A;  2NXQ A;  2HF5 A;  1EG3 A;  5I2O A;  1B8C A;  3TS5 B;  1RWY A;  4QJ3 B;  2F3Y A;  2P6B B;  1V1G A;  3DVE A;  1UWO A;  3WXA A;  1GGW A;  2F33 A;  1NYA A;  1NPQ A;  4PE0 A;  4OV2 A;  2O5G A;  5CSN A;  2WCB A;  1IGV A;  4M2P A;  3EVV A;  3SG7 A;  2NLN A;  3O78 A;  4PE1 A;  2AMI A;  1EG4 A;  1K93 D;  3EVU A;  3O6B A;  2I18 A;  1CFD A;  1OFC X;  1KFX L;  1CDN A;  2L4H A;  3IQO A;  2KDH A;  5IBW A;  5ER4 X;  2BKI B;  2JOJ A;  4AOM A;  1REC A;  1ALW A;  4MSP A;  3TUY B;  1QTX A;  2BL0 B;  2LVI A;  1BG1 A;  3VRP A;  1QIV A;  3VRR A;  1TNW A;  1MF8 B;  1NCZ A;  1SCM B;  1Q80 A;  2MLF C;  2OS8 B;  2MLE C;  1KK7 Y;  1U5I A;  1KK8 B;  1Y1X A;  2LVV A;  2PSR A;  3OX6 A;  4PHM A;  5KU1 A;  1Y6W A;  3DVJ A;  1J7P A;  1F70 A;  3PSR A;  5TNC A;  4I5J A;  2JTT A;  1CFP A;  1CKK A;  1QLS A;  2LUX A;  5CSF A;  4OCI A;  2M8U A;  1U5I B;  1AHR A;  4GGF C;  1CM1 A;  1TNQ A;  1PVB A;  2KAY A;  2F2O A;  4YGC B;  4NDD A;  3GOF A;  2L5X B;  4CFR A;  5KTY A;  1JFK A;  1ZFS A;  1QX2 A;  1N2D A;  1UUR A;  2L51 A;  2LP2 A;  3LK0 A;  5CSI A;  3WHU B;  1JWD A;  4HRG A;  5J3X A;  3BYA A;  4Q04 A;  1S5G Y;  4I5K A;  3QRX A;  1F8H A;  2FCD A;  2KFG A;  1M63 B;  3PFV A;  2CBL A;  1LVC D;  5AAN A;  1F55 A;  5GQQ C;  4ORB B;  1KQM C;  2PRU A;  1OOJ A;  1TIZ A;  2Y4Q A;  4YBH B;  4DCK A;  1KWO B;  2M97 A;  2WCF A;  3SG5 A;  1SW8 A;  4MVF A;  4XYN A;  3OP0 A;  2KQ6 A;  1CMG A;  1SPY A;  4GUK A;  2WC8 A;  2A4J A;  2JU0 A;  2M1K B;  3IF7 A;  4WRI A;  1RFJ A;  2JXL A;  3CWG A;  3TDI A;  4N1G A;  4JPZ B;  1NSH A;  1OZS A;  2HPS A;  4PHN A;  1CFC A;  1B9A A;  1AP4 A;  1QV1 A;  2ZRT A;  1NWD A;  2K2F A;  1IKU A;  1R2U A;  3D10 A;  4AQI A;  5ER5 A;  4MN0 A;  1J7R A;  3PN7 C;  5F6T A;  1NX2 A;  2OPO A;  3EK4 A;  3A8R A;  1F4O A;  1AVS A;  3NSL A;  5AFP A;  5JJG A;  2LAP A;  2KGR A;  1L2O B;  4U8D A;  2EGD A;  2BEC A;  1YVH A;  2ZFD A;  4YI9 A;  1S1E A;  1XK4 C;  5AEQ A;  4ETO A;  1MQ1 A;  3ZWH A;  1S36 A;  1CLL A;  2Q4U A;  5FYX A;  3VRN A;  1QV0 A;  1DJG A;  1XK4 A;  1CNP A;  4GBA A;  1QJT A;  1S6C A;  3CR4 X;  4DRW A;  1C07 A;  4OR9 B;  3NXA A;  2JT8 A;  4ORC B;  4MZJ A;  1FI5 A;  1SRA A;  4ZCV A;  1IWQ A;  2M49 B;  1YTZ C;  1N65 A;  4YGB B;  4PE4 A;  4DIR A;  3LL8 B;  1CLB A;  2KI4 C;  1XVJ A;  4MZK A;  5KSZ A;  1PK0 D;  1PSB A;  2F2P A;  4JQ0 D;  1J7O A;  2KSP A;  2H61 C;  1S26 D;  3VGO A;  2LCP A;  2LLU A;  3HCM A;  1W7J B;  1CMF A;  1QIW A;  2H61 A;  3JTD C;  1TNP A;  5HYD A;  5G08 A;  1QS7 A;  1TCO B;  1UHI A;  2JQ6 A;  3OB1 B;  2JRF A;  4YGD B;  5D7F A;  1PVA A;  3KHE A;  3VRO A;  2BKH B;  1F71 A;  3TZ1 A;  3TS5 C;  2LAN A;  1J7Q A;  2KOT A;  1LA0 A;  4MRY A;  1DT7 B;  1C7V A;  1YVL A;  1IJ5 A;  2JT0 A;  3BUX B;  2ZNE A;  4QJ5 B;  1XFV O;  2M1U A;  2WCE A;  2CCM A;  1DJZ A;  2LNK A;  3EVR A;  5HKZ A;  1K8U A;  5HLV A;  1QX5 B;  2LMV A;  4N1F A;  1NIW A;  1SY9 A;  1SYM A;  1XA5 A;  2MJW B;  3BOW A;  3LLE A;  5I2L A;  4GFT A;  1G33 A;  5PAL A;  2PMY A;  4ICB A;  1KFU S;  2KI6 C;  1UHN A;  4WQ3 A;  1JBA A;  1LA3 A;  3DF0 A;  3VRQ A;  1YRU B;  3CGA A;  3RM1 A;  1YUS A;  4L9M A;  4C0J A;  4E68 A;  1C7W A;  2PVB A;  1ZAC A;  5K89 A;  3K21 A;  3BUM B;  4JWQ A;  3DVK A;  1A4P A;  1CFF A;  1TOP A;  1SBJ A;  3HX4 A;  3JVT C;  2E30 A;  3PAL A;  4AQJ A;  5BPJ A;  2WOR A;  1K2H A;  1G8I A;  1WDC C;  2ZRS A;  1B8R A;  1E8A A;  1DVI A;  1SR6 B;  1BR4 B;  1MWN A;  2JNX A;  1K9P A;  4WQ2 A;  1B4C A;  1RTP 1;  2B1U A;  4GGF A;  4PHJ A;  4F0Z B;  1TTX A;  1OSA A;  1MHO A;  1JFJ A;  2ZN9 A;  1N0Y A;  2LHL A;  2M7L A;  2IS9 A;  1ODB A;  1QVI Z;  3BUO B;  1XFY O;  1OZO A;  4GGN A;  3I5I B;  1HQV A;  1CDP A;  2LMT A;  1JC2 A;  3NSO A;  1MUX A;  3I5H C;  1PSR A;  4A4B A;  2WOS A;  3RLZ A;  2CT9 A;  1V1F A;  4R1E A;  3KPX A;  1CM4 A;  1IH0 A;  2JT3 A;  1W7I B;  1NCX A;  1K95 A;  2CNP A;  1XFU O;  3LK1 A;  1CDL A;  2FCE A;  4PCW A;  2KI6 D;  3AAK A;  1M45 A;  1R6P A;  2JPT A;  1KQM B;  1CTR A;  2JWW A;  2KHN A;  3NSI A;  1D1O A;  4GNK B;  1MR8 A;  4P2Y B;  3EKJ A;  1K9K A;  3OB2 B;  1NX3 A;  1S6I A;  1K94 A;  4DS7 A;  2L50 A;  4OKH A;  2ZKM X;  1UP5 A;  2H2K A;  2OTG B;  1AJ4 A;  2LE9 B;  1YR5 A;  5I2Q A;  3KO0 A;  2NCO A;  1NX0 A;  1UHH A;  3A4U B;  4OVN F;  2BBN A;  2ZN8 A;  2E6W A;  1NP8 A;  2EC6 C;  4HRH A;  3WNX B;  3CTN A;  1BMO A;  1UUS A;  2JUL A;  1LKJ A;  4MEW A;  1BF5 A;  1ALV A;  1GGZ A;  2LHI A;  1YUU A;  2KQY A;  3I5F B;  3OHM B;  3PN7 B;  3EK7 A;  2G9B A;  1KSM A;  2KGB C;  2FJU B;  3CLN A;  1XO5 A;  1PUL A;  5HLO A;  1FBV A;  5B8I B;  1F54 A;  2BE4 A;  1A75 A;  2M7N A;  1BOD A;  3CS1 A;  3FWB A;  4M2O A;  3LCP C;  1YX8 A;  1DF0 A;  4TNC A;  4YGA A;  3SG4 A;  4QJ4 B;  1J55 A;  4CFQ A;  1TCF A;  1PAL A;  1DTL A;  3NSK A;  3SJS A;  1NUB A;  2V53 A;  3I5G C;  2ISD A;  2BCA A;  2LC5 A;  1QXP A;  2WND A;  2Y1M A;  4MBE A;  1XFX O;  2M9G A;  2M29 A;  5DKQ A;  1GJY A;  4FTG A;  2M3W A;  2F3Z A;  3AKB A;  1FPW A;  3CR5 X;  1SK6 D;  2KBI A;  1IQ3 A;  1IQ5 A;  2KI4 B;  4MLW A;  1DMO A;  2KFF A;  4YGE B;  2AAO A;  2K0J A;  4PAL A;  4BY5 A;  2PAS A;  1QAT A;  3FIA A;  3M0W A;  4YRU A;  1GQM A;  2Y9Z A;  2KAX A;  1M46 A;  1AUI B;  1DJH A;  1S3P A;  1SNL A;  3C1V A;  5JOL A;  1DJI A;  1QVI Y;  1YRT B;  2L2E A;  3KEV A;  4I5L B;  1KCY A;  2KFH A;  1K9U A;  2GGM A;  1NCY A;  3JTD B;  3SIA A;  3DD4 A;  4FQO A;  3PM8 A;  1OQP A;  4CID A;  2JTZ A;  2L0P A;  1S6J A;  4HRE E;  2CXJ A;  1BOC A;  2ZND A;  1TRF A;  2NZ0 A;  2PAL A;  3SG2 A;  4XJK A;  1KFX S;  1FF1 A;  1QAS A;  4A4C A;  1WY9 A;  1MXL C;  1QLK A;  1PRW A;  1DJX A;  3SIB A;  5HKW A;  4BY4 A;  5I8N A;  1B7T Z;  4CLN A;  1IG5 A;  3GK1 A;  4XJK B;  2O60 A;  2QPT A;  2Y9Y A;  1DJW A;  3TUY C;  2BL0 C;  2I7A A;  3BOW B;  4GPL B;  1Y1A A;  2KYF A;  3CR2 A;  2F8P A;  3ZNI A;  1CB1 A;  2OS8 C;  1SCM C;  3H4S E;  1G4Y R;  1ZOT B;  1CLM A;  3D0Y A;  1KK8 C;  1SMG A;  2GV5 A;  1KSO A;  3DF0 B;  2AUC A;  2FOT A;  2LVJ A;  2QAC A;  5DKR A;  1OMD A;  5CPV A;  1XYD A;  3O2P A;  1OE9 B;  4NQG A;  3D0Y B;  1BLQ A;  2LMU A;  1OMR A;  2MRD A;  2TN4 A;  1KFU L;  4P5O E;  1NX1 A;  1K96 A;  1WRL A;  1SR6 C;  1JSA A;  5CSJ A;  3DVM A;  3ICB A;  1YX7 A;  3JVT B;  2SAS A;  1EH2 A;  2RGI A;  4USL A;  1H4B A;  1BR1 B;  1WDC B;  3CZT X;  1X02 A;  2JC2 A;  3EKH A;  2KYC A;  1KQV A;  3WHT B;  4M2Q A;  1BJF A;  4C0K A;  3BUN B;  1F4Q A;  3I5I C;  1A2X A;  2K7B A;  2JXC A;  1FW4 A;  2NCP A;  2D8N A;  2LLT A;  1M39 A;  3KF9 A;  1J1E A;  1L7Z A;  1QX7 A;  2BBM A;  3BXK A;  3SG6 A;  1DJY A;  3AKA A;  3FWC A;  2JNF A;  3SG3 A;  2DOQ A;  1KWO C;  2BE6 A;  1ZMZ A;  2MA2 A;  1SKT A;  2LV7 A;  4DUQ A;  2HQ8 A;  3I5H B;  5D69 A;  4C0L A;  2K8M B;  4PDZ A;  1YUR A;  1RK9 A;  1WRK A;  1SL9 A;  5HKY A;  2G2B A;  2KBM A;  1B47 A;  4UPG A;  1HT9 A;  3OX5 A;  1SL8 A;  1WLM A;  4CPV A;  5AER A;  1B1G A;  3PAT A;  1CDM A;  1FI6 A;  2Q91 A;  1B8L A;  1UHK A;  3IQQ A;  3FS7 A;  1K90 D;  4N5X A;  2CTN A;  2BCB A;  1EL4 A;  1AK8 A;  1IJ6 A;  2OTG C;  4HSZ A;  2LM5 A;  2LP3 A;  2VRG A;  1BT6 A;  1M31 A;  1KK7 Z;  2LLS A;  1L2O C;  1LIN A;  3EK8 A;  1SCV A;  1Y0V H;  2K7D A;  1XFZ O;  2K61 A;  3I5F C;  2Y5I A;  3F45 A;  1TNX A;  1B7T Y;  2EC6 B;  3TDZ A;  4NDC A;  4GAO A;  2L98 A;  1SL7 A;  2M0R A;  2MBX A;  1TN4 A;  4D1E A;  1ZUZ A;  2L4I A;  4NDB A;  4YI8 A;  1MXE A;  3MSE B; 
#chains in the Genus database with same CATH topology
 3BCC E;  1A75 B;  2MHH A;  1XFW O;  2M8R A;  3L71 D;  1EXR A;  2ZVN B;  3O4Y A;  2R2I A;  2CPS A;  1SQQ K;  3CWB G;  2XV5 A;  1YUT A;  2O3J A;  3NHI A;  1PIX A;  1LP1 A;  2M3E A;  4FQT A;  3I5G B;  2HQW A;  3B8E B;  4HKZ H;  4ORA B;  1KQG B;  3VMY A;  4PD4 H;  5AVS B;  2W27 A;  2IFN A;  2E74 D;  1YJN P;  2BCC D;  4MRX A;  4ZCU A;  1RJV A;  1IFJ A;  1ZXG A;  5APX A;  1WLZ A;  2LVK A;  3IVT A;  2WVR A;  1K73 Q;  4W80 A;  2HET A;  2HF5 A;  5K5G B;  4K35 A;  1UII A;  5AVU B;  2HYN A;  1BDD A;  3WXA A;  2KUB A;  1PPJ G;  3FE6 A;  1LWU C;  2P58 A;  1SQB G;  2JWD A;  2KNC A;  1VQP P;  1LWU A;  3BJH A;  2KZI A;  1VL2 A;  2M3B A;  1K93 D;  1CFD A;  3TGU E;  1GL2 C;  1KFX L;  1YHQ P;  2L4H A;  3BFA A;  2KDH A;  1KFM A;  1H89 A;  2OYI C;  2WSS H;  5ER4 X;  3N7N A;  4AOM A;  1REC A;  1GU4 A;  3K1E A;  2LVI A;  1W2B O;  1BG1 A;  3VRR A;  1TNW A;  2P7J A;  1FZC B;  2MLF C;  3H1I J;  3R1O A;  2MLE C;  1Y1X A;  3L4F A;  2G8Y A;  2PP6 A;  5TNC A;  4XA4 A;  3CCU P;  4UB6 H;  4I5J A;  2ZT9 C;  1EZV D;  1CFP A;  1HJB A;  4OCI A;  1AHR A;  3VN0 A;  1NTZ J;  3U59 A;  4YGC B;  1BGY J;  4NDD A;  3GOF A;  2WMM A;  5AVR B;  5KTY A;  2A06 E;  1ZFS A;  1QX2 A;  2L51 A;  2LP2 A;  3LK0 A;  5CSI A;  1ZRT D;  2AEM A;  2K37 A;  2GA1 A;  4AUW A;  3RL0 g;  3QRX A;  2YGU A;  2FCD A;  1JMB A;  2IYO A;  1KN7 A;  3NMD A;  1HTL C;  1LVC D;  5AAN A;  4PD4 D;  2PRU A;  2Y0C A;  1TIZ A;  3B5N B;  4YBH B;  1H88 A;  3V2L A;  1KWO B;  2M97 A;  2WCF A;  3SG5 A;  1SW8 A;  4MVF A;  3OP0 A;  3KQG A;  1CMG A;  1P84 I;  2LXC B;  2A4J A;  2GTE A;  3V6I A;  1OXZ A;  3V2R A;  4JPZ B;  2P67 A;  3D78 A;  1NSH A;  1OZS A;  3VYI A;  4NPF X;  1NWD A;  1H0T A;  4GOE A;  1Z2C B;  1R2U A;  1NTK E;  3KYQ A;  1URQ D;  5ER5 A;  4MN0 A;  4ZNC A;  3C8V A;  3A8R A;  3R72 A;  1NKZ B;  1F4O A;  2BAS A;  3CX5 E;  3NSL A;  2IPP A;  1L2O B;  2BEC A;  4EIJ A;  4PT1 A;  3OW2 O;  1Q81 Q;  2ZFD A;  1NO4 A;  1NTM K;  1S1E A;  5AEQ A;  4ETO A;  1MQ1 A;  1S36 A;  1KMI Z;  3V4W A;  1DJG A;  4L76 A;  4INW A;  5KLI C;  1S6C A;  1C07 A;  4OR9 B;  3L4A A;  3UIA A;  1KQS O;  4WY4 A;  4YGB B;  4DIR A;  1LTT C;  2KLD A;  3CWB D;  5GTH E;  3LW5 H;  4MZK A;  1XVJ A;  4W7Z A;  2JO1 A;  5KSZ A;  5CCH D;  4JQ0 D;  3RK2 C;  1LP1 B;  2H61 C;  1S26 D;  1E5W A;  3VGO A;  1KOR A;  2LCP A;  3BAS A;  1KB9 I;  2Q6Q A;  2H61 A;  5HYD A;  1QS7 A;  2ZVO B;  3OB1 B;  2KK7 A;  2QEB A;  2JRF A;  1L0N J;  3PRJ A;  3VRO A;  4IL6 H;  3BAT A;  1BE3 J;  3MZW B;  3CZ0 A;  2O01 H;  4MRY A;  3S9O A;  2WCK A;  3CZ1 A;  1IJ5 A;  5BU8 B;  4EOT A;  3BUX B;  2ZNE A;  3VMX A;  4QJ5 B;  2WIT A;  1PPJ D;  1NTM G;  2M1U A;  2CCM A;  1DJZ A;  3EVR A;  5HLV A;  1SYM A;  2ZFC A;  3H1I E;  1LWU B;  4GFT A;  4EI2 A;  1FOS F;  3H6P A;  4F7F A;  3CDN A;  3G9R A;  4U7J A;  3RM1 A;  1VF5 D;  3DVK A;  1A4P A;  2OYI B;  2W6A A;  4ASW A;  1SBJ A;  3HX4 A;  1NTZ E;  1BGY E;  2QM7 A;  5BPJ A;  3L35 A;  1K05 A;  1E8A A;  1QL2 A;  4OGQ C;  3L47 A;  4H0L B;  1MWN A;  2R3S A;  1EXI A;  4GGF A;  4F0Z B;  1TTX A;  2WCM A;  1N0Y A;  5CCG D;  2LHL A;  2ZT9 B;  2M7L A;  5FI6 A;  3HD7 A;  3JCU H;  1IK9 A;  2J58 A;  4GGN A;  3I5I B;  3KZI E;  2FYU G;  2LMT A;  1MUX A;  3I5H C;  4RJT A;  3RLZ A;  2CT9 A;  1T3J A;  1GK4 A;  4O9B A;  4D6T J;  1NCX A;  1G1I A;  1K95 A;  1XFU O;  1DH3 A;  2YXQ B;  1HUC A;  3TYY A;  2KI6 D;  3B86 A;  3AAK A;  2O1J A;  1M45 A;  2JPT A;  1CTR A;  3D75 A;  4EYY Q;  1L0L D;  4GNK B;  2QDI A;  1K9K A;  1NX3 A;  1S6I A;  2C0X A;  4DS7 A;  3CI9 A;  3FWN A;  2OTG B;  1NKN A;  1IO4 A;  2JEE A;  5APT A;  3KO0 A;  1UHH A;  3A4U B;  4OVN F;  1LGH B;  2ZN8 A;  2E6W A;  2W90 A;  3I56 P;  4YTP C;  5APU A;  2L2C A;  1AFO A;  3IAO A;  2LHI A;  2WSF H;  3I5F B;  3AED C;  1PP9 G;  5BVZ A;  2L5G B;  1CZQ A;  2FJU B;  1R5L A;  1JM0 A;  2BE4 A;  1SQP G;  1K9M Q;  4TNC A;  1J55 A;  3NHT A;  1Q90 D;  5KLI B;  1QL1 A;  5KAF H;  2ZXX A;  2F3Z A;  1L0N E;  2KBI A;  1T6A A;  2CK3 H;  1M57 D;  1BE3 E;  1LS8 A;  1RQU A;  1R8E A;  1DMO A;  1NH4 A;  5GTI E;  4PAL A;  1PFI A;  3RK2 B;  3M0W A;  4YRU A;  3RL0 B;  3PTZ A;  4N78 E;  3C1V A;  1OOI X;  1SNL A;  1SQX J;  2PRR A;  3SIA A;  1RF0 A;  3PM8 A;  4CID A;  1JTH A;  1S5L E;  4HRE E;  1TRF A;  3L37 A;  1QAS A;  2W83 C;  1WY9 A;  1PRW A;  1DJX A;  4KYN A;  1EDJ A;  3L74 G;  5I8N A;  3CAB A;  4WVZ A;  1IG5 A;  1NU1 K;  2O60 A;  1PZQ A;  1DJW A;  2Z5H A;  2OTK E;  3TUY C;  2HPC A;  2BL0 C;  2I7A A;  2QEH A;  3CX5 I;  4PJ0 E;  3ZNI A;  1CB1 A;  3H4S E;  3A0H H;  4H13 C;  1T3U A;  2LVJ A;  1G1J A;  1W9Z A;  2WC5 A;  5KLV K;  3O2P A;  1OE9 B;  4NQG A;  3D0Y B;  2TN4 A;  1KFU L;  4P5O E;  1WRL A;  5AVZ B;  1Q86 Q;  4WWI A;  3DVM A;  1YX7 A;  3L71 J;  2D2C B;  3CZT X;  1JY3 P;  2LXB A;  4OGQ B;  5B66 H;  1KQV A;  4D6T E;  3WHT B;  5KJ7 C;  4OH8 B;  3CYZ A;  4INX A;  3HD7 B;  1T2K C;  3AE3 C;  3D6Y A;  1HGZ A;  5KJ7 A;  2LLT A;  1J1E A;  2FYU D;  2MJZ A;  2BBM A;  2GUV A;  3GG2 A;  3NXS A;  4N6J A;  3VTP C;  2MA2 A;  2Q9I A;  1LNQ A;  3I5H B;  2YXR B;  1L2P A;  5D69 A;  4C0L A;  2K8M B;  1QX8 A;  5CBO A;  4LGD E;  2G2B A;  4IL6 X;  1B47 A;  4UPG A;  1HT9 A;  3L70 G;  1L4A D;  1SL8 A;  1B1G A;  2GUS A;  1FI6 A;  3IQQ A;  3HRN A;  2E75 C;  5DJT B;  1K90 D;  3L75 J;  1IJ6 A;  3WUU A;  1Q2N A;  2LM5 A;  5KLV G;  2VRG A;  3HE4 A;  5H2F H;  3M9H A;  3EK8 A;  2ZYA A;  1LTI C;  2QG4 A;  1FU1 A;  2QJY C;  2Y5I A;  1YQ3 C;  1JY2 N;  2IFM A;  1TNX A;  2HLO A;  1PP9 D;  3A0B E;  3P7K A;  2MBX A;  1TN4 A;  1EC5 A;  2L4I A;  1YTZ T;  1MXE A;  3MSE B;  1N7L A;  1SQP D;  2UWJ E;  2I94 A;  4IFM A;  1VRK A;  1KV4 A;  2LUC A;  3RK3 D;  3PM2 A;  4H44 C;  1OMV A;  4IL1 A;  1LXF C;  2E5T A;  3Q5R A;  2EHB A;  2I2R E;  1KZU B;  3BUW B;  2BCC G;  1JUO A;  4ZKU A;  1SQX E;  1JEK A;  2HFE D;  2YMY A;  1J1D C;  1VF5 C;  3B6X A;  2SCP A;  1A03 A;  5AW7 B;  2GGZ A;  3D73 A;  2KSJ A;  2RH0 A;  1J1D A;  3L72 J;  1A29 A;  3TDU A;  3E3R A;  1GTW A;  2K7O A;  1AJ5 A;  1OW4 A;  2H8V A;  2K7C A;  3AEB C;  2NXQ A;  1EG3 A;  5I2O A;  1FJK A;  4QJ3 B;  1VQ7 P;  2P6B B;  1GGW A;  2F33 A;  1NYA A;  1TUZ A;  4PE0 A;  1HWT C;  4OV2 A;  5CSN A;  3SG7 A;  2G3A A;  5HL1 A;  1S9K D;  1JY3 N;  4Z1M H;  1JY2 O;  2IBZ G;  1WMK A;  2I18 A;  4I6M C;  1OFC X;  1N73 C;  1CDN A;  2HPC B;  1PGQ A;  5AVW B;  5IBW A;  1ZME C;  4WY4 D;  3W67 A;  2JOJ A;  3H1H J;  3TSI A;  1ALW A;  4MSP A;  3TUY B;  2BL0 B;  3L71 E;  3VRP A;  3T97 A;  2WC6 A;  4H13 B;  1OW7 A;  1J7P A;  1F70 A;  3PSR A;  2E42 A;  3L73 J;  3LID A;  1IFM A;  3B87 A;  2JTT A;  1CKK A;  2QRX A;  1MUU A;  5AW3 B;  2KXP B;  3CD6 P;  1CM1 A;  1KIL C;  4KJM A;  1TNQ A;  1PVB A;  2L5X B;  1JFK A;  1N2D A;  2BNX A;  4CPG A;  2OYO A;  4Q04 A;  2KLV A;  4I5K A;  2O1K A;  3CC7 P;  3B5N A;  3PFV A;  1J1E B;  2CBL A;  2AXC A;  1FZB A;  1OOJ A;  3L75 E;  1U7M A;  3NFQ A;  3OGN A;  4XYN A;  1FAV A;  2IZ1 A;  4HB1 A;  2WC8 A;  3L70 D;  2M1K B;  4JD9 A;  1RFJ A;  2JXL A;  3CWG A;  3TDI A;  1S4X A;  1M8O B;  1VPC A;  2IYP A;  1N86 A;  1X22 A;  2K2F A;  3U1A A;  4AQI A;  2E75 B;  3PH0 A;  1SQB J;  4R4M A;  1FDI A;  3PN7 C;  5F6T A;  3A2A A;  4IFF A;  2NPS D;  4A7P A;  2EGD A;  1YVH A;  4YI9 A;  1X79 B;  1XK4 C;  3ZWH A;  2KP8 A;  2AXT H;  1SQQ J;  2QJY B;  1PV3 A;  4KT0 J;  3OA7 A;  1CLL A;  1XK4 A;  3R2P A;  2B9B A;  1FJP A;  4DRW A;  3P8C E;  3NXA A;  4ORC B;  1FI5 A;  2XDJ A;  1YTZ C;  3LL8 B;  2H8P D;  2YO3 A;  3L72 E;  5APY A;  3WU2 E;  1PSB A;  2F2P A;  3IFM A;  4H44 B;  3H1K D;  2QJP B;  2RN0 A;  3LW5 J;  3M0A A;  1K8A Q;  3JTD C;  3O4X A;  1C3Z A;  3S0D A;  4JYB A;  2A06 G;  1NYH A;  1J1D B;  5D7F A;  3E1R A;  1PVA A;  5AW8 B;  3TZ1 A;  4AQR D;  1OOF A;  3TS5 C;  1QWV A;  1C7V A;  1YIT P;  1YVL A;  3SS3 A;  3I55 P;  3H1H E;  1XFV O;  4OZD A;  1K8U A;  4TLF A;  2LMV A;  3BOW A;  5I2L A;  1GL2 A;  2OYI A;  2PMY A;  2IBZ D;  2B87 A;  3L73 E;  1LA3 A;  3DF0 A;  5EFW B;  3CGA A;  1YUS A;  4L9M A;  4E68 A;  5K89 A;  1N73 B;  3BUM B;  4JWQ A;  3T97 B;  1HVV A;  1LTS C;  3JVT C;  3H1J G;  4BRY B;  1K2H A;  3KPE A;  1OVV A;  4HYT B;  2ZRS A;  1DVI A;  1SR6 B;  3CLQ A;  2JNX A;  1K9P A;  1RTP 1;  1DEE G;  4PHJ A;  1FS0 E;  1OSA A;  3UO9 A;  1W5C E;  2PYQ A;  2IS9 A;  4L73 A;  2Q5U A;  4N3Y B;  1RF1 C;  2H7H A;  3VB1 A;  1KIL B;  4RKU J;  1RF1 A;  2YMK A;  4A4B A;  2WOS A;  1JB0 J;  4R1E A;  2H89 C;  1IH0 A;  1CM4 A;  2WCJ A;  1W7I B;  1KC8 Q;  1L0L G;  1HBW A;  1N7S D;  1R6P A;  1PPJ E;  3RK3 C;  2KHN A;  1SQB E;  1NJI Q;  4C46 A;  1MR8 A;  3NTN A;  4B86 A;  2JPO A;  2L50 A;  2ZKM X;  1VQ5 P;  2E76 D;  2WSE H;  5I2Q A;  2N1T C;  1NTM J;  1SQV G;  1SQQ E;  2EC6 C;  4HRH A;  1EDK A;  3WNX B;  3V5B A;  2FYN C;  4HH2 A;  3SSU A;  2JUL A;  1FOS E;  2OYH C;  1SVF A;  3RBX A;  1ALV A;  1JMM A;  2KQY A;  3PN7 B;  3MTU E;  2KLE A;  1YBK A;  1XO5 A;  3H1I G;  1PUL A;  5B8I B;  3P8M C;  2M7N A;  5CMZ A;  4XFJ A;  4M2O A;  1EXJ A;  1YX8 A;  1ZP0 C;  2H88 C;  1K04 A;  2WTY A;  4PV1 D;  3SG4 A;  1MFT A;  1HJ0 A;  3AEF C;  5DIC A;  2LC5 A;  3D71 A;  2W6J H;  4U3F J;  2Y1M A;  2RMZ A;  1BGY G;  5DKQ A;  4ZMD A;  1FPW A;  3AKB A;  3A3Y B;  2H43 A;  3HUS C;  4RES B;  1YQ4 C;  1VQK P;  1D7M A;  3AE9 C;  2I1J A;  2KFF A;  2AAO A;  4BY5 A;  3FIA A;  3A7O A;  2Y9Z A;  3S0A A;  2FYU K;  3II6 A;  1AUI B;  2YKQ A;  4IL6 E;  1MKM A;  2A06 D;  2POH A;  1NHL A;  2GGM A;  3JTD B;  3DD4 A;  1OW8 A;  1S6J A;  1BOC A;  2CXJ A;  1HF9 A;  1SFC C;  3PLN A;  4DOJ A;  1LTJ C;  1KIL E;  3VMZ A;  1FZF A;  1QLK A;  3GLM A;  4ASV A;  2XU6 A;  1LTJ A;  2R44 A;  1NAY A;  2A45 G;  3OBV A;  5HKW A;  2XKM A;  2QSI A;  1IFP A;  4XJK B;  2Y9Y A;  5AW2 B;  3C9I A;  4GT1 A;  3BOW B;  1VQN P;  1GL2 B;  3B7A A;  2OS8 C;  1SCM C;  2LR2 A;  4OWF A;  3D0Y A;  3IR9 A;  1KK8 C;  2B89 A;  2B87 B;  1EZV I;  2GV5 A;  5TJH A;  1NGM B;  3DF0 B;  3PJS K;  2AUC A;  2FOT A;  1XTG B;  3E7K A;  2PFX A;  3S0E A;  1DIP A;  5DKR A;  1IC2 A;  1OMD A;  5CPV A;  1Y9B A;  1NTK D;  4DT0 A;  4WBA A;  2N9B A;  1OMR A;  3EFF K;  3H1J D;  1NX1 A;  3AE8 C;  1JSA A;  3FX0 A;  3JVT B;  1T14 A;  1EH2 A;  2RGI A;  1SQP K;  1H4B A;  3JCU E;  3DXL A;  2JP3 A;  2JC2 A;  4LLH A;  1QEX A;  2KYC A;  4NPE A;  4PD4 I;  4M2Q A;  4C0K A;  1F4Q A;  2HG5 D;  1A2X A;  2PQL A;  2NCP A;  2JXC A;  5EL2 A;  2D8N A;  1RE3 C;  1L7Z A;  1QX7 A;  4XE5 B;  3SG6 A;  1RF1 B;  3AKA A;  1RE3 A;  3SG3 A;  2BE6 A;  2I8D A;  1KFN A;  4ZKP A;  3RGU A;  4DUQ A;  3ABV C;  1VQM P;  1LTG C;  1L0N G;  1RK9 A;  1SL9 A;  2K88 A;  1IFD A;  1M7L A;  5AER A;  3F5H A;  5L8R J;  4CPV A;  3PAT A;  1NTM E;  3V2Q A;  4YXD C;  4DJG A;  2A45 H;  2E74 C;  5KAI E;  5DJU B;  1AK8 A;  3S4R A;  5CHX A;  4JKT A;  2M0B A;  2LP3 A;  1ZW0 A;  1KD1 Q;  2LLS A;  5E79 E;  3L74 J;  1RE4 C;  4I7Z C;  1CSB A;  2QJK C;  3AE5 C;  1SQV D;  1Y0V H;  1PGO A;  1RE4 A;  2K61 A;  2N1T B;  2KOG A;  3Q2Y A;  2ZXE B;  2EC6 B;  2WWW A;  4NDC A;  2FYN B;  1ZUZ A;  2OYH B;  4U3F E;  2WT7 A;  3H1I D;  2Q7C A;  4C7R A;  1S72 P;  2K2A A;  1WRZ A;  3B5N D;  1IZN B;  1H8B A;  3GMA A;  1JNM A;  2FYZ A;  2W6B A;  4PHK A;  3O6Q B;  3Q5S A;  1FDO A;  2JZI A;  1NTZ D;  3MHV A;  3AAJ A;  1BGY D;  1KYO H;  5AVT B;  1Y1U A;  2BCX A;  3GK2 A;  5AW0 B;  1DGV A;  5AXI A;  1UHJ A;  4JBZ A;  3HUS B;  3D76 A;  2WSC J;  1QVG O;  1WT6 A;  1LTB C;  4PE7 A;  1RRO A;  3DVE A;  1NU1 J;  2QM8 A;  3TDK A;  2VRS A;  3HTK A;  1XTC C;  2WCB A;  1SFC B;  1S5L H;  1LTJ B;  2NLN A;  3K5B A;  3G6E P;  2KYV A;  3O78 A;  1BDC A;  2AMI A;  3EVU A;  1M1J C;  2XND H;  1M1K Q;  5KLV J;  1GM0 A;  3M0D C;  3IQO A;  1Z4H A;  3CCL P;  5BU5 A;  1QIV A;  1N7S C;  2OS8 B;  1SCM B;  2LVV A;  4PJ0 H;  1KK8 B;  3WUT A;  5KU1 A;  3DVJ A;  3RK3 E;  2ZYD A;  3CXH H;  1A02 F;  3EWK A;  1URQ C;  2JJL A;  1QLS A;  5CSF A;  4IOI H;  1U5I B;  2V7Q H;  3R4Y A;  2NRG A;  5B66 E;  1BCC G;  2KAY A;  1FZE A;  3Q3D A;  3S0B A;  1JWD A;  4HRG A;  1VQ9 P;  1S5G Y;  4R4L A;  5KTB A;  3SWY A;  2QVA A;  1F8H A;  2KFG A;  1KYO D;  2BCC J;  5FI2 A;  1VQ4 P;  1F55 A;  1VQO P;  3IN6 A;  2JKV A;  3AE7 C;  1DEK A;  1SQX G;  1L0N D;  5CCH C;  4GUK A;  1BE3 D;  3L74 E;  3UNW A;  2XNX A;  4WRI A;  2JU0 A;  3SWF A;  3IF7 A;  1Y47 A;  4H0L D;  1CFC A;  1AP4 A;  2ZRT A;  5H2F E;  3TK1 A;  2ZT9 D;  1IFN A;  2E74 B;  1J7R A;  3EK4 A;  3GF7 A;  2NZ2 A;  5AFP A;  5JJG A;  2LAP A;  3BRV B;  3GHG C;  2ZYG A;  4I7Z B;  5AVQ B;  3SFD C;  2WPS A;  4KHX A;  3VRN A;  5FYX A;  5APS A;  2L91 A;  2WT7 B;  1QJT A;  5B5E H;  2WQY C;  2JT8 A;  3CXH D;  1SRA A;  4ZCV A;  3H1K G;  4PE4 A;  3SS4 A;  1AVO A;  2KI4 C;  1JOC A;  1PK0 D;  3WUV A;  2WCL A;  2KSP A;  1NVO A;  5TIS E;  2FBW C;  1DD4 A;  3HCM A;  1QIW A;  1NU1 E;  2JQ6 A;  4UB8 H;  1Y8A A;  2KSE A;  4YGD B;  5CCG C;  4D6T D;  3AE4 C;  3KHE A;  1GU5 A;  5FI7 A;  1Z56 A;  1Q82 Q;  2BKH B;  5CCG A;  1RH5 B;  1YTZ I;  2KOT A;  1LA0 A;  1DT7 B;  1OW6 A;  5KLV E;  2FFD C;  1AV1 A;  3HTK B;  1P84 H;  5D3O A;  3VOP A;  2LNK A;  3AEA C;  1CW5 A;  1QX5 B;  1NIW A;  1XA5 A;  1N73 A;  5PAL A;  2FXP A;  1TWO A;  2KI6 C;  2K1A A;  2KLU A;  3H1L G;  1RY3 A;  3B4S A;  4GIF A;  4BRY A;  3VRQ A;  1YRU B;  2SPZ A;  4K3A A;  4C7N A;  3CME P;  1C7W A;  1JCC A;  1FZC C;  1CFF A;  3RK2 D;  3RL0 D;  2WOR A;  1HH0 A;  1YYC A;  2WZ7 A;  1LT9 C;  1BR4 B;  3P32 A;  1KIL A;  3CWB J;  3QH9 A;  4GOF A;  1OX3 A;  1LT9 A;  3BCC G;  2BCC E;  2ZN9 A;  1QGK B;  4L75 A;  1URQ B;  3CCE P;  1BCC D;  1ODB A;  3QME A;  3BUO B;  1OZO A;  1YI2 P;  1HQV A;  1JC2 A;  1S3J A;  3BFH A;  3RBZ A;  3NSO A;  1PSR A;  2FKW B;  2FXM A;  1DX7 A;  1GW3 A;  2K3R A;  4EDF A;  1V1F A;  2XZR A;  1EDI A;  3SS5 A;  2JT3 A;  3L72 G;  1KB9 H;  2CNP A;  1CDL A;  4PCW A;  1JY3 O;  1RHZ B;  1SQX D;  1ORG A;  4L74 A;  3W68 A;  2JWW A;  3NSI A;  3H25 A;  4GKG A;  2WCH A;  4Y99 C;  4P2Y B;  2E5Y A;  4OKH A;  2IBZ E;  2P1J A;  2H2K A;  3CZ2 A;  3KXD A;  2D2C D;  2LE9 B;  3OAK A;  1S5L X;  2K9Y A;  3FWL A;  1OVR A;  2NCO A;  1NX0 A;  3M9Q A;  4OGQ D;  2BBN A;  1P84 D;  2RKL A;  1X0T A;  1EZV E;  1C3Y A;  3HD7 D;  3CTN A;  2WSE J;  1FBM A;  4MEW A;  3GF3 A;  5AVV B;  1BF5 A;  2YKO A;  1GGZ A;  3TGU G;  3EK7 A;  3AE2 C;  3C1L A;  1KSM A;  2HR3 A;  3VP9 A;  1F54 A;  1ZRT E;  1NWQ A;  2KI7 B;  3GHG B;  3CS1 A;  3FWB A;  1BSN A;  3LCP C;  1DF0 A;  3MGN A;  1NTK K;  2HOD B;  3H1J J;  4QJ4 B;  4CFQ A;  1TCF A;  1PAL A;  3NSK A;  1NUB A;  2V53 A;  2P2U A;  2BCA A;  4PD4 E;  1QXP A;  2WND A;  2JR8 A;  3DY9 A;  2M9G A;  2M29 A;  1N8R Q;  4FTG A;  2M3W A;  1IQ3 A;  1IQ5 A;  2KI4 B;  1FE6 A;  1VF5 B;  2Q3E A;  3AEC C;  1GQM A;  3WU2 H;  3D6Z A;  1M46 A;  1DJH A;  3EFG A;  5JOL A;  1YRT B;  1QVI Y;  2L2E A;  4M3L A;  3CCM P;  2KFH A;  2V4H A;  1K9U A;  2KS1 A;  1JUN A;  1NCY A;  4RO0 A;  1OQP A;  2JTZ A;  2L0P A;  1KB9 D;  3D77 A;  1L0L J;  2ZND A;  3AEG C;  3SG2 A;  2O01 J;  1L0L K;  4XJK A;  1KFX S;  2W8Z A;  4A4C A;  1KTM A;  3JSV C;  3M06 A;  4BY4 A;  2R3C A;  4Y28 J;  4YPC A;  3L75 D;  2FFD B;  3GK1 A;  2QPT A;  1DEL A;  3U1C A;  1Y1A A;  2KYF A;  1NOH A;  2F8P A;  2YKP A;  3B71 A;  2KB7 P;  1NTK G;  4GOD A;  1G4Y R;  1CLM A;  2BEQ D;  2QEX P;  2C9L Y;  4UB6 E;  1L4A C;  3H1L D;  1SMG A;  1SQV J;  1KSO A;  3N4X A;  2QAC A;  1SQV K;  3CWB E;  4C7N B;  1L4A A;  1XYD A;  1XFR A;  3PP5 A;  1SQQ G;  2FJY A;  2MRD A;  2QE7 H;  4H0L C;  5AVX B;  3ICB A;  3FE8 A;  2P70 A;  1BR1 B;  1X02 A;  3BCC D;  1LT9 B;  3A5T A;  3CCV P;  1BJF A;  1AJY A;  3BUN B;  3I5I C;  2K7B A;  3H32 B;  2JWA A;  1NTZ K;  3KF9 A;  1SS1 A;  3P8C D;  1CI6 A;  3FWC A;  2JNF A;  2M5A B;  1ZMZ A;  1SKT A;  2LV7 A;  1OIP A;  2HQ8 A;  3L72 D;  4PDZ A;  1YUR A;  1BSH A;  3PJI A;  4H13 D;  2J59 M;  1KQL A;  5AW4 B;  3EQ2 A;  2Q91 A;  1J2J B;  1B8L A;  1UHK A;  3O8Z A;  2CTN A;  1EL4 A;  2OTG C;  4HSZ A;  1OWA A;  2KPH A;  1TU3 F;  1BT6 A;  2N1T A;  4Y99 B;  1QVF O;  1E79 H;  1LIN A;  3JC2 2;  1PGJ A;  3EG5 B;  1SCV A;  2OYH A;  2K7D A;  3N7H A;  2PGD A;  1AQ5 A;  3H1J E;  3I5F C;  3RZS A;  2WSF J;  3CX5 H;  5KJ7 D;  4NPD A;  1B7T Y;  3H1H D;  2Q3I A;  3TGU D;  4GAO A;  1T2K D;  4D1E A;  3O6Q A;  5KKZ C;  4NDB A;  3L36 A;  5APV A;  2KAV A;  1IRJ A;  4MZL A;  3USS A;  1S5G Z;  1NTZ G;  3L73 D;  3TNU A;  1DF0 B;  3GK4 X;  3CL3 D;  2YIU C;  1JF2 A;  3HE5 B;  2MAZ A;  2IDB A;  1GD2 E;  4IFD K;  4WY4 C;  3BQ3 A;  3PLF B;  1X8Y A;  3HUS A;  5GTH H;  1RQV A;  2FYU J;  4I5N B;  5DKN A;  1A02 J;  1IIO A;  2E75 D;  1L0L E;  1DGU A;  1BU3 A;  3RL0 C;  2COL B;  1JF0 A;  2KNE A;  1ZN5 A;  2Y1N A;  1EJ3 A;  2KS1 B;  2BEZ F;  3FXD A;  1SFC A;  1B8C A;  3TS5 B;  1RWY A;  2F3Y A;  2OTL P;  1V1G A;  1UWO A;  1L0N K;  3AE6 C;  3VP8 A;  2IBZ I;  4WB4 A;  1MV8 A;  1NPQ A;  3CCQ P;  3CCJ P;  2O5G A;  1JCD A;  1SQV E;  1IGV A;  4M2P A;  3EVV A;  2WPQ A;  1DC1 A;  4PE1 A;  3CCS P;  5C39 A;  1EG4 A;  3O6B A;  1HGV A;  1S1C X;  1IK7 A;  1SQB D;  5AW9 B;  4H44 D;  2BKI B;  2KNC B;  1PP9 J;  1QTX A;  4I2L C;  1MF8 B;  1NCZ A;  3FE9 A;  1Q80 A;  1KK7 Y;  1U5I A;  2PSR A;  1L4A B;  4TT3 H;  1SQP J;  3OX6 A;  4PHM A;  3CX5 D;  1Y6W A;  2R5D A;  1SQQ D;  5CBN A;  1VQ8 P;  1AVY A;  2LUX A;  2M8U A;  2D2C C;  4GGF C;  3G3Z A;  4AYC A;  2NPS C;  3M9B A;  2F2O A;  5AW6 B;  4U3F G;  4CFR A;  2NPS A;  3HD7 C;  1UUR A;  3WHU B;  2V7Q J;  5J3X A;  1T8Z A;  3QWO C;  1G2C A;  3WMM 0;  3BYA A;  1M90 Q;  2OQQ A;  4LC1 A;  3KZI H;  3BRT B;  1M63 B;  2E43 A;  1YJW P;  1CI6 B;  5GQQ C;  1GMJ A;  4ORB B;  2C9N Y;  2OTJ P;  1BE3 G;  2QIW A;  1KQM C;  1Q7Y Q;  2Y4Q A;  1OOG A;  4DCK A;  1LJ2 A;  2Z5I A;  4QMA A;  2I1K A;  3CPW O;  3BFB A;  2KQ6 A;  4W7Y A;  2DW3 A;  1SPY A;  3RK3 B;  1OZH A;  4IJ7 A;  1FC2 C;  1VQ6 P;  5AW1 B;  2ZAE B;  3CC4 P;  2O01 N;  4N1G A;  3GW6 A;  2HPS A;  4PHN A;  1B9A A;  1IJD B;  1QV1 A;  1EQ7 A;  1IKU A;  2Y0D A;  3D10 A;  2Y0E A;  1ZOY C;  1X9V A;  1NX2 A;  2OPO A;  2K9J A;  5KAI H;  1AVS A;  1KIL D;  1FDM A;  3SFE C;  1H0T B;  2FXO A;  2KGR A;  4U8D A;  1IFI A;  1VQL P;  5E79 H;  3ITK A;  3KHU A;  2Q4U A;  5KAF E;  3Q1M A;  1QV0 A;  1CNP A;  4GBA A;  3CR4 X;  2FYU E;  5KKZ B;  4MZJ A;  3TNU B;  1IWQ A;  2M49 B;  2WPR A;  3M91 A;  1H8A A;  3CCR P;  1N65 A;  1MZ9 A;  1KYO E;  1SSE B;  1TUJ A;  1CLB A;  3BVH A;  1DEB A;  1EDL A;  2YIU B;  1BCC J;  1AA0 A;  1J7O A;  1LT1 A;  4WY4 B;  3F89 A;  2FY8 A;  2YNY A;  2LLU A;  1W7J B;  4D6T G;  3V2P A;  1W2E A;  1CMF A;  2ERB A;  1ZV8 A;  3MIW A;  4I1L A;  1TNP A;  5G08 A;  1OMI A;  1UHI A;  1TCO B;  1GZL A;  4BXL A;  1JY2 P;  5GTI H;  1F71 A;  1RF0 C;  3L70 J;  3V4Q A;  2LAN A;  1J7Q A;  2IZ0 A;  2JT0 A;  1SQX K;  3D70 A;  3A0H E;  3S1K A;  1PP9 E;  2WCE A;  5HKZ A;  4JF7 A;  4N1F A;  1SY9 A;  3LLE A;  2MJW B;  1M1J A;  3L4L A;  1G33 A;  3M0D A;  3I5C A;  1SQP E;  1U7J A;  4ICB A;  1KFU S;  1UHN A;  4WQ3 A;  1JBA A;  1NTM D;  4JYC A;  4C0J A;  1ZR2 A;  2OAR A;  2PVB A;  1N7S A;  1ZAC A;  1PGP A;  3AE1 C;  3K21 A;  3D74 A;  1ZLL A;  1TOP A;  3DYE A;  3CXH E;  2E30 A;  3PAL A;  4AQJ A;  1GW4 A;  1QLE D;  2E76 C;  1URQ A;  3IF4 A;  1G8I A;  1WDC C;  3MUD C;  2AEJ A;  1B8R A;  3ZDM A;  4WQ2 A;  1B4C A;  2B1U A;  5CJ4 A;  3MUD A;  1MHO A;  1JFJ A;  1OVU A;  5APQ A;  3H1K J;  1QVI Z;  1XFY O;  3Q8I A;  3DZT A;  4U3F D;  2NPS B;  1CDP A;  1G2C B;  3TF5 A;  5I94 A;  1J1E C;  4PV1 C;  1GL2 D;  1SP4 A;  3KPX A;  2YO2 A;  1GDT A;  1S9K E;  1PL5 A;  3LK1 A;  2FCE A;  5CCH A;  1KQM B;  4N78 D;  3MD0 A;  1D1O A;  1FZG A;  4HJG H;  1NU1 G;  1SLQ A;  2PAJ A;  3EKJ A;  3OB2 B;  1LTA C;  1K94 A;  1UP5 A;  3FXE A;  1WRG A;  1AJ4 A;  1YR5 A;  4GDO A;  1NP8 A;  2QJK B;  5M1B A;  2K60 A;  1GK6 A;  2ITA A;  2K9J B;  2L5Y A;  1BMO A;  1UUS A;  1LKJ A;  1MFZ A;  3GHG A;  1YUU A;  3OHM B;  2G9B A;  3H1L J;  2HOD A;  2J5U A;  2R5B A;  2KGB C;  1R5S A;  3CLN A;  5HLO A;  1FBV A;  5B5E E;  1A75 A;  3A0B H;  1BOD A;  2LKM A;  3L71 G;  1FZA A;  1BCC E;  3FGA D;  1KQF B;  4YGA A;  1DTL A;  3SJS A;  3I5G C;  2ISD A;  2N9Y B;  2MKV A;  4MBE A;  1XFX O;  2P71 A;  3BCC J;  1GJY A;  1DD3 A;  3CR5 X;  1SK6 D;  3R1V A;  2QJP C;  3AEE C;  4MLW A;  3L70 E;  4YGE B;  4UB8 E;  2K0J A;  2PAS A;  1QAT A;  2KAX A;  3R1P A;  1S3P A;  4DZO A;  1DJI A;  1DQE A;  3KEV A;  4I5L B;  1KCY A;  2WSC H;  5TIS H;  2OGU A;  2R32 A;  2N1T D;  3CMA P;  4FQO A;  3KDP B;  3G4S P;  1OOH A;  1VDF A;  2A45 I;  2Z4E A;  2C0W A;  2NZ0 A;  2PAL A;  2FFD A;  3L75 G;  2QA4 P;  1FF1 A;  1USD A;  3VMA A;  1P84 E;  1NAF A;  1MXL C;  3SIB A;  1JTH B;  1S2E A;  1B7T Z;  1JO5 A;  4CLN A;  2Q1K A;  2WPV B;  5AW5 B;  4GPL B;  1P28 A;  1M1J B;  3CR2 A;  3L74 D;  1ZOT B;  3OJA B;  1FZC A;  5CJ0 A;  2BAP A;  1N7S B;  2AEF A;  3B88 A;  3TGU J;  1BLQ A;  2LMU A;  2KZJ A;  2CPB A;  3H1K E;  1EZV G;  3LIE A;  1K96 A;  1SR6 C;  5CSJ A;  2SAS A;  2E76 B;  3V2N A;  3H32 A;  4USL A;  1KYO I;  1WDC B;  1M56 D;  2QEO A;  3EKH A;  2JDI H;  4YXW H;  5APW A;  2M5A A;  1N2D C;  1FW4 A;  1SFC D;  1M39 A;  3S0F A;  3BXK A;  1DJY A;  3B5N C;  2KIK A;  4MN4 C;  2DOQ A;  1KWO C;  1KB9 E;  3G71 P;  1UIX A;  5AVY B;  2GM4 A;  4PV1 B;  1WRK A;  1USE A;  2ZJS E;  5HKY A;  2KBM A;  2IX7 C;  3OX5 A;  3PHL A;  1WLM A;  1U57 A;  1CDM A;  3FS7 A;  1NU1 D;  3S0G A;  3E1I A;  4N5X A;  2BCB A;  1YIJ P;  3H1L E;  1M31 A;  1KK7 Z;  1L2O C;  3MP7 B;  3SWK A;  3H1H G;  2B88 A;  3NGV A;  4BWN A;  2AXT E;  1YJ9 P;  1XFZ O;  5KLV D;  1ZR4 A;  3Q5P A;  3F45 A;  3HE4 B;  2QEV A;  1SQB K;  1NTK J;  3CXH I;  3TDZ A;  3L73 G;  2P10 A;  3CC2 P;  2L98 A;  1SL7 A;  2M0R A;  1AQT A;  3HE5 A;  4YI8 A; 
#chains in the Genus database with same CATH homology
 2K2A A;  1A75 B;  1WRZ A;  1XFW O;  2MHH A;  2KAV A;  1IRJ A;  2I94 A;  4MZL A;  1EXR A;  1H8B A;  1S5G Z;  3O4Y A;  2R2I A;  1DF0 B;  3GK4 X;  1VRK A;  4PHK A;  1JF2 A;  2MAZ A;  2LUC A;  1OMV A;  4IL1 A;  1LXF C;  1YUT A;  2JZI A;  3BQ3 A;  2EHB A;  2I2R E;  3BUW B;  3PLF B;  3AAJ A;  3I5G B;  2HQW A;  1JUO A;  1Y1U A;  2BCX A;  4ORA B;  4I5N B;  5DKN A;  3GK2 A;  2SCP A;  1A03 A;  2GGZ A;  1DGV A;  1DGU A;  1BU3 A;  5AXI A;  1UHJ A;  1J1D A;  2COL B;  4MRX A;  4ZCU A;  1A29 A;  1JF0 A;  2KNE A;  1RJV A;  3TDU A;  3E3R A;  1WLZ A;  2K7O A;  2LVK A;  2Y1N A;  1EJ3 A;  1AJ5 A;  4PE7 A;  1RRO A;  2K7C A;  2HET A;  2NXQ A;  2HF5 A;  1EG3 A;  5I2O A;  1B8C A;  3TS5 B;  1RWY A;  4QJ3 B;  2F3Y A;  2P6B B;  1V1G A;  3DVE A;  1UWO A;  3WXA A;  1GGW A;  2F33 A;  1NYA A;  1NPQ A;  4PE0 A;  4OV2 A;  2O5G A;  5CSN A;  2WCB A;  1IGV A;  4M2P A;  3EVV A;  3SG7 A;  2NLN A;  3O78 A;  4PE1 A;  2AMI A;  1EG4 A;  1K93 D;  3EVU A;  3O6B A;  2I18 A;  1CFD A;  1OFC X;  1KFX L;  1CDN A;  2L4H A;  3IQO A;  2KDH A;  5IBW A;  5ER4 X;  2BKI B;  2JOJ A;  4AOM A;  1REC A;  1ALW A;  4MSP A;  3TUY B;  1QTX A;  2BL0 B;  2LVI A;  1BG1 A;  3VRP A;  1QIV A;  3VRR A;  1TNW A;  1MF8 B;  1NCZ A;  1SCM B;  1Q80 A;  2MLF C;  2OS8 B;  2MLE C;  1KK7 Y;  1U5I A;  1KK8 B;  1Y1X A;  2LVV A;  2PSR A;  3OX6 A;  4PHM A;  5KU1 A;  1Y6W A;  3DVJ A;  1J7P A;  1F70 A;  3PSR A;  5TNC A;  4I5J A;  2JTT A;  1CFP A;  1CKK A;  1QLS A;  2LUX A;  5CSF A;  4OCI A;  2M8U A;  1U5I B;  1AHR A;  4GGF C;  1CM1 A;  1TNQ A;  1PVB A;  2KAY A;  2F2O A;  4YGC B;  4NDD A;  3GOF A;  2L5X B;  4CFR A;  5KTY A;  1JFK A;  1ZFS A;  1QX2 A;  1N2D A;  1UUR A;  2L51 A;  2LP2 A;  3LK0 A;  5CSI A;  3WHU B;  1JWD A;  4HRG A;  5J3X A;  3BYA A;  4Q04 A;  1S5G Y;  4I5K A;  3QRX A;  1F8H A;  2FCD A;  2KFG A;  1M63 B;  3PFV A;  2CBL A;  1LVC D;  5AAN A;  1F55 A;  5GQQ C;  4ORB B;  1KQM C;  2PRU A;  1OOJ A;  1TIZ A;  2Y4Q A;  4YBH B;  4DCK A;  1KWO B;  2M97 A;  2WCF A;  3SG5 A;  1SW8 A;  4MVF A;  4XYN A;  3OP0 A;  2KQ6 A;  1CMG A;  1SPY A;  4GUK A;  2WC8 A;  2A4J A;  2JU0 A;  2M1K B;  3IF7 A;  4WRI A;  1RFJ A;  2JXL A;  3CWG A;  3TDI A;  4N1G A;  4JPZ B;  1NSH A;  1OZS A;  2HPS A;  4PHN A;  1CFC A;  1B9A A;  1AP4 A;  1QV1 A;  2ZRT A;  1NWD A;  2K2F A;  1IKU A;  1R2U A;  3D10 A;  4AQI A;  5ER5 A;  4MN0 A;  1J7R A;  3PN7 C;  5F6T A;  1NX2 A;  2OPO A;  3EK4 A;  3A8R A;  1F4O A;  1AVS A;  3NSL A;  5AFP A;  5JJG A;  2LAP A;  2KGR A;  1L2O B;  4U8D A;  2EGD A;  2BEC A;  1YVH A;  2ZFD A;  4YI9 A;  1S1E A;  1XK4 C;  5AEQ A;  4ETO A;  1MQ1 A;  3ZWH A;  1S36 A;  1CLL A;  2Q4U A;  5FYX A;  3VRN A;  1QV0 A;  1DJG A;  1XK4 A;  1CNP A;  4GBA A;  1QJT A;  1S6C A;  3CR4 X;  4DRW A;  1C07 A;  4OR9 B;  3NXA A;  2JT8 A;  4ORC B;  4MZJ A;  1FI5 A;  1SRA A;  4ZCV A;  1IWQ A;  2M49 B;  1YTZ C;  1N65 A;  4YGB B;  4PE4 A;  4DIR A;  3LL8 B;  1CLB A;  2KI4 C;  1XVJ A;  4MZK A;  5KSZ A;  1PK0 D;  1PSB A;  2F2P A;  4JQ0 D;  1J7O A;  2KSP A;  2H61 C;  1S26 D;  3VGO A;  2LCP A;  2LLU A;  3HCM A;  1W7J B;  1CMF A;  1QIW A;  2H61 A;  3JTD C;  1TNP A;  5HYD A;  5G08 A;  1QS7 A;  1TCO B;  1UHI A;  2JQ6 A;  3OB1 B;  2JRF A;  4YGD B;  5D7F A;  1PVA A;  3KHE A;  3VRO A;  2BKH B;  1F71 A;  3TZ1 A;  3TS5 C;  2LAN A;  1J7Q A;  2KOT A;  1LA0 A;  4MRY A;  1DT7 B;  1C7V A;  1YVL A;  1IJ5 A;  2JT0 A;  3BUX B;  2ZNE A;  4QJ5 B;  1XFV O;  2M1U A;  2WCE A;  2CCM A;  1DJZ A;  2LNK A;  3EVR A;  5HKZ A;  1K8U A;  5HLV A;  1QX5 B;  2LMV A;  4N1F A;  1NIW A;  1SY9 A;  1SYM A;  1XA5 A;  2MJW B;  3BOW A;  3LLE A;  5I2L A;  4GFT A;  1G33 A;  5PAL A;  2PMY A;  4ICB A;  1KFU S;  2KI6 C;  1UHN A;  4WQ3 A;  1JBA A;  1LA3 A;  3DF0 A;  3VRQ A;  1YRU B;  3CGA A;  3RM1 A;  1YUS A;  4L9M A;  4C0J A;  4E68 A;  1C7W A;  2PVB A;  1ZAC A;  5K89 A;  3K21 A;  3BUM B;  4JWQ A;  3DVK A;  1A4P A;  1CFF A;  1TOP A;  1SBJ A;  3HX4 A;  3JVT C;  2E30 A;  3PAL A;  4AQJ A;  5BPJ A;  2WOR A;  1K2H A;  1G8I A;  1WDC C;  2ZRS A;  1B8R A;  1E8A A;  1DVI A;  1SR6 B;  1BR4 B;  1MWN A;  2JNX A;  1K9P A;  4WQ2 A;  1B4C A;  1RTP 1;  2B1U A;  4GGF A;  4PHJ A;  4F0Z B;  1TTX A;  1OSA A;  1MHO A;  1JFJ A;  2ZN9 A;  1N0Y A;  2LHL A;  2M7L A;  2IS9 A;  1ODB A;  1QVI Z;  3BUO B;  1XFY O;  1OZO A;  4GGN A;  3I5I B;  1HQV A;  1CDP A;  2LMT A;  1JC2 A;  3NSO A;  1MUX A;  3I5H C;  1PSR A;  4A4B A;  2WOS A;  3RLZ A;  2CT9 A;  1V1F A;  4R1E A;  3KPX A;  1CM4 A;  1IH0 A;  2JT3 A;  1W7I B;  1NCX A;  1K95 A;  2CNP A;  1XFU O;  3LK1 A;  1CDL A;  2FCE A;  4PCW A;  2KI6 D;  3AAK A;  1M45 A;  1R6P A;  2JPT A;  1KQM B;  1CTR A;  2JWW A;  2KHN A;  3NSI A;  1D1O A;  4GNK B;  1MR8 A;  4P2Y B;  3EKJ A;  1K9K A;  3OB2 B;  1NX3 A;  1S6I A;  1K94 A;  4DS7 A;  2L50 A;  4OKH A;  2ZKM X;  1UP5 A;  2H2K A;  2OTG B;  1AJ4 A;  2LE9 B;  1YR5 A;  5I2Q A;  3KO0 A;  2NCO A;  1NX0 A;  1UHH A;  3A4U B;  4OVN F;  2BBN A;  2ZN8 A;  2E6W A;  1NP8 A;  2EC6 C;  4HRH A;  3WNX B;  3CTN A;  1BMO A;  1UUS A;  2JUL A;  1LKJ A;  4MEW A;  1BF5 A;  1ALV A;  1GGZ A;  2LHI A;  1YUU A;  2KQY A;  3I5F B;  3OHM B;  3PN7 B;  3EK7 A;  2G9B A;  1KSM A;  2KGB C;  2FJU B;  3CLN A;  1XO5 A;  1PUL A;  5HLO A;  1FBV A;  5B8I B;  1F54 A;  2BE4 A;  1A75 A;  2M7N A;  1BOD A;  3CS1 A;  3FWB A;  4M2O A;  3LCP C;  1YX8 A;  1DF0 A;  4TNC A;  4YGA A;  3SG4 A;  4QJ4 B;  1J55 A;  4CFQ A;  1TCF A;  1PAL A;  1DTL A;  3NSK A;  3SJS A;  1NUB A;  2V53 A;  3I5G C;  2ISD A;  2BCA A;  2LC5 A;  1QXP A;  2WND A;  2Y1M A;  4MBE A;  1XFX O;  2M9G A;  2M29 A;  5DKQ A;  1GJY A;  4FTG A;  2M3W A;  2F3Z A;  3AKB A;  1FPW A;  3CR5 X;  1SK6 D;  2KBI A;  1IQ3 A;  1IQ5 A;  2KI4 B;  4MLW A;  1DMO A;  2KFF A;  4YGE B;  2AAO A;  2K0J A;  4PAL A;  4BY5 A;  2PAS A;  1QAT A;  3FIA A;  3M0W A;  4YRU A;  1GQM A;  2Y9Z A;  2KAX A;  1M46 A;  1AUI B;  1DJH A;  1S3P A;  1SNL A;  3C1V A;  5JOL A;  1DJI A;  1QVI Y;  1YRT B;  2L2E A;  3KEV A;  4I5L B;  1KCY A;  2KFH A;  1K9U A;  2GGM A;  1NCY A;  3JTD B;  3SIA A;  3DD4 A;  4FQO A;  3PM8 A;  1OQP A;  4CID A;  2JTZ A;  2L0P A;  1S6J A;  4HRE E;  2CXJ A;  1BOC A;  2ZND A;  1TRF A;  2NZ0 A;  2PAL A;  3SG2 A;  4XJK A;  1KFX S;  1FF1 A;  1QAS A;  4A4C A;  1WY9 A;  1MXL C;  1QLK A;  1PRW A;  1DJX A;  3SIB A;  5HKW A;  4BY4 A;  5I8N A;  1B7T Z;  4CLN A;  1IG5 A;  3GK1 A;  4XJK B;  2O60 A;  2QPT A;  2Y9Y A;  1DJW A;  3TUY C;  2BL0 C;  2I7A A;  3BOW B;  4GPL B;  1Y1A A;  2KYF A;  3CR2 A;  2F8P A;  3ZNI A;  1CB1 A;  2OS8 C;  1SCM C;  3H4S E;  1G4Y R;  1ZOT B;  1CLM A;  3D0Y A;  1KK8 C;  1SMG A;  2GV5 A;  1KSO A;  3DF0 B;  2AUC A;  2FOT A;  2LVJ A;  2QAC A;  5DKR A;  1OMD A;  5CPV A;  1XYD A;  3O2P A;  1OE9 B;  4NQG A;  3D0Y B;  1BLQ A;  2LMU A;  1OMR A;  2MRD A;  2TN4 A;  1KFU L;  4P5O E;  1NX1 A;  1K96 A;  1WRL A;  1SR6 C;  1JSA A;  5CSJ A;  3DVM A;  3ICB A;  1YX7 A;  3JVT B;  2SAS A;  1EH2 A;  2RGI A;  4USL A;  1H4B A;  1BR1 B;  1WDC B;  3CZT X;  1X02 A;  2JC2 A;  3EKH A;  2KYC A;  1KQV A;  3WHT B;  4M2Q A;  1BJF A;  4C0K A;  3BUN B;  1F4Q A;  3I5I C;  1A2X A;  2K7B A;  2JXC A;  1FW4 A;  2NCP A;  2D8N A;  2LLT A;  1M39 A;  3KF9 A;  1J1E A;  1L7Z A;  1QX7 A;  2BBM A;  3BXK A;  3SG6 A;  1DJY A;  3AKA A;  3FWC A;  2JNF A;  3SG3 A;  2DOQ A;  1KWO C;  2BE6 A;  1ZMZ A;  2MA2 A;  1SKT A;  2LV7 A;  4DUQ A;  2HQ8 A;  3I5H B;  5D69 A;  4C0L A;  2K8M B;  4PDZ A;  1YUR A;  1RK9 A;  1WRK A;  1SL9 A;  5HKY A;  2G2B A;  2KBM A;  1B47 A;  4UPG A;  1HT9 A;  3OX5 A;  1SL8 A;  1WLM A;  4CPV A;  5AER A;  1B1G A;  3PAT A;  1CDM A;  1FI6 A;  2Q91 A;  1B8L A;  1UHK A;  3IQQ A;  3FS7 A;  1K90 D;  4N5X A;  2CTN A;  2BCB A;  1EL4 A;  1AK8 A;  1IJ6 A;  2OTG C;  4HSZ A;  2LM5 A;  2LP3 A;  2VRG A;  1BT6 A;  1M31 A;  1KK7 Z;  2LLS A;  1L2O C;  1LIN A;  3EK8 A;  1SCV A;  1Y0V H;  2K7D A;  1XFZ O;  2K61 A;  3I5F C;  2Y5I A;  3F45 A;  1TNX A;  1B7T Y;  2EC6 B;  3TDZ A;  4NDC A;  4GAO A;  2L98 A;  1SL7 A;  2M0R A;  2MBX A;  1TN4 A;  4D1E A;  1ZUZ A;  2L4I A;  4NDB A;  4YI8 A;  1MXE A;  3MSE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...