4DCKA

Crystal structure of the c-terminus of voltage-gated sodium channel in complex with fgf13 and cam
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
153
Chain Sequence
SVATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Ternary Complex of a NaV C-Terminal Domain, a Fibroblast Growth Factor Homologous Factor, and Calmodulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/signaling protein
molecule keywords Sodium channel protein type 5 subunit alpha
total genus 51
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2012-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4dckA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4dckA02
1JF0A 3CR4X 2JTZA 1DJIA 4NQGA 1F54A 2BBMA 1J7PA 1C7WA 1YX7A 2LMVA 1B7TY 1NP8A 1LINA 1EL4A 1M46A 2PSRA 4MZLA 4GGNA 4HREE 4ORAB 3KF9A 5J3XA 2KOTA 3OB2B 1WDCC 2LVJA 2JT3A 4OKHA 5DKRA 1PVAA 1LXFC 1K90D 2IS9A 3H4SE 1DGUA 4I5NB 5GQQC 2LP2A 4PE4A 2PRUA 1IQ3A 1GJYA 1ZMZA 5ER5A 4C0JA 2WC8A 4MEWA 1R2UA 1G33A 2Y5IA 3IF7A 2BL0B 1N0YA 4E68A 3CR2A 2HQ8A 2LP3A 2LVKA 1G8IA 1DJHA 5JJGA 3O78A 1KK8B 1UUSA 1UWOA 1XK4C 1RROA 4M2QA 4USLA 1JWDA 1DJWA 3NSOA 2MA2A 1K2HA 3WHTB 1JFKA 1MHOA 2FJUB 1XO5A 2Q91A 1CLLA 4PE1A 3OX5A 1B7TZ 3BUWB 3EKJA 1AVSA 1Q80A 1QVIY 2ZNDA 5AEQA 1LA3A 3FWCA 4N5XA 5I2LA 2PASA 5I2OA 2LHLA 1CMFA 1RK9A 4GUKA 4OR9B 4GAOA 1IH0A 1SCMB 1SRAA 1RTP1 1WLZA 4NDBA 5CPVA 4GNKB 1OSAA 1MWNA 4MSPA 1J7QA 4YGCB 1Y6WA 2WCFA 1CFFA 1E8AA 1XVJA 2KBIA 2LC5A 1B47A 2Y9ZA 2KFHA 3CR5X 1OMDA 4C0LA 1HQVA 1FF1A 1R6PA 2JU0A 1DMOA 1MXLC 1EG3A 3TUYB 3VRQA 4MZKA 1WRLA 1S36A 1OMRA 3NSKA 2JRFA 1FI6A 3DF0A 1CDPA 2LAPA 3WNXB 3BUMB 1FPWA 5JOLA 2WNDA 3PFVA 4YI9A 4XJKB 2ZKMX 3OB1B 1QIWA 2KI4C 2NZ0A 2KYFA 1EH2A 4YBHB 5I2QA 1RJVA 4ZCUA 2I2RE 2LLSA 1C07A 1PALA 3AAJA 2D8NA 2PMYA 3PATA 2JT0A 4I5LB 3VGOA 4XJKA 2JULA 2LVVA 2H61A 2KGRA 3BUXB 1TNPA 4A4BA 2OS8C 1KFUL 1SYMA 2LVIA 4QJ3B 1F71A 4QJ5B 2KBMA 2WORA 1OMVA 4AQJA 2K2AA 2ZNEA 3KHEA 1XFXO 3K21A 2F33A 1CLMA 1NUBA 1OZSA 1S5GZ 5G08A 5AFPA 1K95A 2JXLA 2JT8A 2EC6C 4OCIA 2CXJA 1UHJA 5CSIA 1QX7A 2KHNA 1HT9A 4BY4A 1XFYO 5HKYA 2OPOA 2BCXA 3I5HC 4DUQA 1F8HA 1OQPA 1D1OA 4WQ2A 1NX2A 2I94A 4DS7A 1V1GA 1BLQA 4PDZA 2BCAA 3VROA 1BG1A 1QLSA 4MZJA 1ZUZA 3SG4A 3BOWB 2JPTA 1CMGA 2M7NA 1QXPA 5K89A 1VRKA 4JWQA 1H4BA 1J7RA 3OHMB 2F3ZA 1SR6B 1B9AA 4M2OA 2Y1NA 1SL9A 2K7BA 1TCOB 5AERA 3I5HB 4N1FA 1BOCA 1AJ4A 5DKQA 4A4CA 5BPJA 1EJ3A 5HYDA 2OTGC 5CSFA 5ER4X 2M49B 2M97A 3SG5A 1CFCA 3GK2A 2DOQA 3CGAA 1K94A 2PALA 1QVIZ 1S6CA 1S3PA 4MVFA 1KWOC 4F0ZB 2AMIA 2PVBA 2TN4A 4DRWA 1IKUA 2KI6D 2MRDA 3FIAA 2KYCA 1EXRA 1F4QA 1G4YR 2E6WA 3EKHA 5I8NA 3KPXA 2LV7A 1NYAA 2M3WA 2LLUA 1F55A 1M45A 1YVLA 3JVTC 3PLFB 1TIZA 1DJYA 1CB1A 1MQ1A 2LUXA 2GV5A 3EVUA 4C0KA 4U8DA 1LVCD 1YUSA 2K7CA 1N65A 2LCPA 1SR6C 4PE0A 1BJFA 1W7IB 2KSPA 1UHIA 1K8UA 2MLFC 4P2YB 2MLEC 3GK4X 1K96A 1TNQA 1Y1AA 1S1EA 2OTGB 2FOTA 2M1KB 3TZ1A 1KFXS 2MHHA 5AANA 1AJ5A 4YGAA 3SG2A 4ETOA 1SK6D 3AKAA 2L4IA 1KK7Y 1YVHA 2KNEA 4WRIA 1J7OA 1CLBA 2CT9A 2JWWA 1NCYA 3RLZA 2L50A 1ALWA 2F3YA 4YGEB 2M0RA 1KCYA 3TS5C 1SL8A 1YX8A 3O4YA 2I18A 2CBLA 3BOWA 3ICBA 1TNXA 3F45A 4UPGA 1CTRA 1CNPA 4TNCA 1IRJA 2FCDA 2L5XB 3D0YA 1DF0B 3VRRA 3I5FB 1PULA 1S6JA 3FWBA 2A4JA 1KWOB 3RM1A 1PVBA 2R2IA 3E3RA 1OFCX 4CLNA 1S6IA 5AXIA 1IG5A 2L2EA 1SKTA 4HSZA 2ZRSA 1OOJA 1OZOA 1PK0D 4CIDA 1A75B 1QLKA 1F70A 1DF0A 1XFUO 2Y1MA 1TN4A 4PHMA 1DTLA 4MBEA 1A75A 4PHKA 1CM4A 4HRGA 2BCBA 1JSAA 1A4PA 2CCMA 1J1EA 3EVRA 3SG7A 4CFQA 1WRKA 1V1FA 2H2KA 5HLOA 3GOFA 2K0JA 3I5FC 1M39A 3M0WA 2ZRTA 3LK0A 1XFZO 1YR5A 5KTYA 3I5GB 3NSLA 5KU1A 5IBWA 1NX3A 2AAOA 3FS7A 2GGZA 1SCVA 4OVNF 1IWQA 2M7LA 3DF0B 1B8CA 2BBNA 1DJXA 1SY9A 3EVVA 1QJTA 1IQ5A 1NPQA 1YRTB 3AAKA 4ZCVA 1AUIB 1NX0A 3LL8B 2KQ6A 1BR1B 3HX4A 2NLNA 1BF5A 2O5GA 2Y4QA 1QTXA 1LA0A 1L7ZA 5B8IB 4QJ4B 1QATA 4MLWA 3BQ3A 5D7FA 1TRFA 4ICBA 3PN7C 1J55A 5HKZA 1UURA 4Q04A 1XA5A 3NSIA 4L9MA 1F4OA 2AUCA 3CWGA 1SBJA 1CKKA 2BE4A 1SMGA 2M8UA 1NWDA 1ZOTB 2ZFDA 2ZN8A 1CDNA 4YGDB 3OX6A 4XYNA 1U5IB 2BL0C 4ORBB 1GGWA 3BXKA 1L2OB 1AK8A 1TOPA 1NSHA 4OV2A 1B4CA 5KSZA 2ZN9A 1M63B 3EK8A 3SG3A 1WY9A 4PCWA 4ORCB 4IL1A 1S5GY 2MAZA 3OP0A 3VRNA 1UP5A 1Y1XA 1K93D 1J1DA 2M1UA 4FQOA 4FTGA 1RFJA 2BECA 2KI4B 1IJ5A 1XYDA 2KAVA 2KFGA 2VRGA 3DVMA 3CTNA 3JVTB 5HLVA 2K7DA 1CFPA 1DVIA 2L98A 1LKJA 1UHNA 4NDDA 1MF8B 4PHJA 2NCPA 1QX2A 1NIWA 2LMUA 5D69A 1KK7Z 1PRWA 2KGBC 2ISDA 3TS5B 1TNWA 1JFJA 1AP4A 4D1EA 3C1VA 2O60A 2L0PA 4YGBB 1EG4A 3TDUA 2KAYA 3DVKA 3CLNA 1QV0A 4MRYA 3PN7B 2KAXA 1XFWO 3GK1A 2F2OA 1FI5A 2COLB 1YRUB 1YTZC 3MSEB 2JZIA 2HQWA 2MBXA 1DT7B 1JBAA 3SIBA 4GGFC 4PE7A 1RWYA 2BKIB 2LHIA 3KEVA 1JUOA 4AQIA 2EGDA 1KSMA 2KQYA 2G2BA 4MN0A 1IGVA 2RGIA 3BYAA 3I5IB 2LLTA 3TDZA 1JC2A 1A29A 2JTTA 2K7OA 1QX5B 4N1GA 2GGMA 2K2FA 1KSOA 3KO0A 2SCPA 3D0YB 3AKBA 2B1UA 1SW8A 1WLMA 1CFDA 1QS7A 2JNFA 2M9GA 2K61A 1NCZA 5TNCA 3TUYC 2E30A 2JNXA 3BUNB 4PALA 2JOJA 1XFVO 1ZACA 1KFUS 3PALA 2L51A 2LM5A 1TTXA 4I5KA 4HRHA 3A8RA 1K9KA 1QV1A 2K8MB 2CNPA 2KFFA 1WDCB 5CSNA 1BODA 2NXQA 1SCMC 2JQ6A 1BT6A 2I7AA 3CZTX 2KDHA 3SG6A 2H61C 4BY5A 3WXAA 2LE9B 1BMOA 3O6BA 1GGZA 4I5JA 5DKNA 1PSBA 2WOSA 2HF5A 1B8RA 1A03A 3IQQA 1YURA 1UHHA 2OS8B 1C7VA 3LK1A 2P6BB 1KFXL 5PALA 3CS1A 1SNLA 1WRZA 3DVJA 5FYXA 2F8PA 4GFTA 4JPZB 1B1GA 1CDMA 1CM1A 2SASA 1QASA 1Y0VH 1H8BA 1NX1A 1DJGA 2HETA 1CDLA 1DJZA 4JQ0D 3O2PA 3IQOA 4AOMA 3EK7A 1TCFA 2EHBA 1YUTA 3I5GC 2LNKA 1RECA 1QIVA 1U5IA 2G9BA 3HCMA 4WQ3A 3D10A 1L2OC 1N2DA 2NCOA 2F2PA 3A4UB 3JTDB 1MXEA 1ODBA 2M29A 3I5IC 3LLEA 4MRXA 1JF2A 1K9PA 3ZNIA 2JXCA 4DIRA 1MUXA 3TDIA 2WCEA 3ZWHA 3EK4A 2FCEA 3SIAA 3DD4A 1MR8A 1W7JB 4M2PA 1UHKA 4CPVA 1NCXA 1DGVA 2EC6B 1BU3A 1ALVA 5F6TA 1IJ6A 1AHRA 1FW4A 1XK4A 2LANA 5CSJA 3PSRA 1KQMB 3QRXA 4YRUA 3DVEA 3JTDC 5HKWA 2QPTA 3VRPA 1KK8C 4YI8A 4R1EA 3LCPC 2Q4UA 1PSRA 2QACA 1ZFSA 1YUUA 4GGFA 4DCKA 1S26D 2MJWB 1X02A 4NDCA 3PM8A 2BKHB 3SJSA 2Y9YA 4P5OE 1K9UA 1B8LA 4CFRA 1GQMA 2KI6C 2HPSA 1FBVA 2CTNA 4GPLB 1OE9B 2LMTA 2V53A 2WCBA 1Y1UA 2JC2A 3WHUB 1SL7A 1M31A 4PHNA 1KQVA 2LUCA 1KQMC 1BR4B 3NXAA 1A2XA 2L4HA 1SPYA 2BE6A 4GBAA 3BUOB
chains in the Genus database with same CATH superfamily
2V4HA 3CR4X 2JTZA 1DJIA 2WMMA 2E74B 1J7PA 3V4WA 5B5EH 2LMVA 1K73Q 1B7TY 2PSRA 1N73B 1L0LK 5B66E 1NTMG 1SQQE 2J58A 2QEXP 1Q81Q 1NU1K 1IQ3A 1KB9E 3CCUP 5KLVJ 2WC8A 3S0EA 1CW5A 1N0YA 4E68A 1G1IA 2C9LY 2HQ8A 4JD9A 3O78A 1YJNP 1GL2A 1XK4C 1GL2C 1SFCC 3CI9A 2WITA 3SSUA 1FZGA 3VMXA 2GM4A 1DJWA 3F5HA 3GMAA 2A06G 1M1JA 2IBZG 2Q91A 4PE1A 1B7TZ 3EKJA 4R4LA 4JYCA 4Y99B 1Q80A 1X9VA 2PASA 3EFFK 2OYHB 2Y0DA 4WY4B 1CMFA 4GUKA 1SQXG 3GW6A 4GAOA 4NDBA 5KAIE 3PH0A 1Y6WA 1G2CB 2Y9ZA 4C0LA 1OMDA 2Q5UA 1FF1A 1N7SD 1AVOA 3DXLA 1FZBA 4KHXA 3AE3C 2IPPA 3RK3E 1MXLC 1EG3A 3VRQA 4C7NA 1WRLA 2AEMA 3L73E 1XTCC 4IL6E 1ZLLA 1KILE 3WNXB 3GHGC 3BUMB 5JOLA 2WNDA 4YI9A 1TUJA 4XJKB 2ZKMX 3OB1B 1QIWA 3P8MC 1RJVA 1C07A 2I2RE 3AAJA 1T3UA 1TWOA 5CHXA 3WU2H 2D8NA 2YO3A 1ZW0A 1FDOA 2PMYA 3D71A 3PATA 4IJ7A 3CXHH 4XJKA 2JULA 1TNPA 2OS8C 2WSCJ 1F71A 1LTJB 2WORA 1RQVA 1GU5A 1BE3E 4WY4D 1XFXO 1EZVI 2NPSC 1CLMA 1U57A 1VL2A 2QG4A 1K95A 3H1IJ 2EC6C 1NKNA 1XFYO 5HKYA 1KMIZ 1MFZA 3AECC 1OQPA 1NTZG 3IVTA 3S1KA 2IBZE 2W83C 2D2CC 1S5LX 2GUVA 3BFHA 1KQGB 2JPTA 5K89A 4JWQA 1N86A 1SR6B 2N1TA 3WMM0 1X0TA 2Y1NA 5AERA 1AJ4A 3R4YA 5GTIH 1EJ3A 4OGQB 5HL1A 5ER4X 3AE6C 2M49B 3SG5A 4IOIH 3CGAA 1KORA 1QVIZ 3HTKA 4MVFA 4F0ZB 3R1OA 2KI6D 2MRDA 3CX5E 3FIAA 2QRXA 1JNMA 1EXRA 3L71E 1G4YR 4WBAA 3KPXA 4BRYA 3CCSP 2IBZD 1F55A 3L71J 1OW6A 1LT9B 1NWQA 3VTPC 1MQ1A 1N7SC 1OVVA 4U8DA 2B89A 3CX5D 2WTYA 3B7AA 1VDFA 1BJFA 1W7IB 2WCHA 4W80A 2MLEC 3GK4X 1TNQA 1Y1AA 2HFED 2K60A 2K9YA 2MHHA 1IK9A 5AANA 4YGAA 2LR2A 3M0DC 4ETOA 1XTGB 4PD4D 4H44D 3DYEA 4WRIA 2BAPA 2N9BA 3L37A 1SQVD 1GW3A 3RLZA 3H1JJ 2L50A 1DH3A 1RE3A 3RGUA 2OYOA 1HF9A 2CBLA 1CI6A 1VF5D 2XNXA 3H1LG 2FXOA 3L74D 3VRRA 4Y99C 1PULA 1S6JA 2KZJA 2A4JA 2YIUB 5TJHA 2L2EA 2ZRSA 2GUSA 2M3BA 4KYNA 1F70A 4ASVA 1L0NJ 1DF0A 5TISH 4L75A 1DTLA 3F89A 1JSAA 1SQVE 3EVRA 3SG7A 4CFQA 2L91A 2ZXXA 2H2KA 5HLOA 1FZFA 5EL2A 3I5FC 1GZLA 2BCCJ 2ZRTA 3CABA 1YR5A 2FKWB 3H1IE 5AW1B 1HJBA 1W2EA 3G9RA 3NSLA 4GOFA 3H6PA 1KQSO 4H13D 2K37A 2M7LA 3DF0B 3EVVA 3CCLP 1NPQA 1YRTB 3KXDA 2WSCH 3B8EB 1AUIB 1IC2A 3G4SP 1BF5A 2O5GA 2QJPC 2KUBA 3BQ3A 3RK2D 1TRFA 4ICBA 3CX5I 5APSA 1J55A 5HKZA 1XA5A 1NHLA 1HTLC 3N7NA 1LT9A 1SMGA 2M8UA 2KPHA 3HRNA 2ZN8A 4XYNA 1SQBG 2BL0C 1GGWA 3BXKA 1R5LA 4IL6X 1B4CA 3Q2YA 2H89C 2YKOA 5AVZB 1HH0A 3SG3A 2OTJP 3GHGB 3JSVC 2WSFJ 3S9OA 2UWJE 2MAZA 3OP0A 2VRSA 3A5TA 2KNCB 1Y1XA 3B5ND 3Q5PA 1RFJA 5GTHH 2KAVA 4DT0A 2VRGA 1GM0A 4WWIA 5HLVA 1H0TB 2L98A 1RQUA 2K88A 2LMUA 2O01H 2P1JA 1ZMEC 4YGBB 5E79E 3TDUA 4WVZA 1OOHA 4W7ZA 1KB9I 2C0WA 3CL3D 3QH9A 3PN7B 1X22A 1FI5A 2XNDH 1IFIA 1J1DB 2FBWC 1DT7B 1JBAA 1Q7YQ 2WT7B 3B6XA 4AQIA 2G2BA 2ZFCA 2A06E 3I5IB 3TDZA 5AVYB 1A29A 2K7OA 4N1GA 2N1TC 3L75J 1KSOA 1NTKD 2O01N 5KLIC 3AKBA 2JDIH 2B1UA 1SW8A 1WLMA 2JPOA 1SFCA 1T3JA 3L75E 3LIDA 1LTJA 2E30A 3BUNB 5H2FH 3AEGC 3KPEA 1URQA 2L51A 4I5KA 4HRHA 1NTKJ 1K9KA 1QV1A 1PPJD 2CNPA 3USSA 1WDCB 5CSNA 1BODA 1JM0A 5AVTB 1FJKA 5AVUB 5APXA 2I7AA 3H1LE 2RN0A 2KDHA 3P32A 1AFOA 1ZP0C 3A3YB 3AE8C 1BMOA 1JY3P 2L5GB 2W27A 1U7MA 1FU1A 2KXPB 1B8RA 1A03A 3IQQA 1YURA 2WZ7A 1UHHA 2OS8B 1L2PA 3LK1A 1KFXL 2QVAA 3L70J 1WRZA 5L8RJ 1LWUB 1DD4A 1KILC 2FXMA 3I56P 2O01J 3KQGA 3U1CA 1Q90D 3NHTA 3H1JG 5AVVB 3IQOA 3L72G 1YIJP 1NTKE 2HLOA 5KLIB 2LNKA 1RECA 3HCMA 3L47A 4WQ3A 3D10A 1N2DA 2F2PA 4MRXA 3I5IC 3LLEA 3ZDMA 4DIRA 3H1LJ 1BSHA 4PV1D 3TDIA 4I7ZB 3KZIH 1KB9H 3VMYA 1MR8A 4TLFA 5AVRB 1NYHA 2HODB 1W7JB 1KZUB 3H1LD 2IYPA 2EC6B 1S1CX 3V2QA 1BU3A 1YI2P 4XA4A 3TGUG 1OW7A 1NH4A 2WVRA 2FXPA 4H0LB 3RZSA 1CSBA 3GHGA 1KQMB 2W6BA 1PP9D 2YMKA 3DVEA 3VRPA 2IX7C 1VQOP 1L4AC 1KYOE 4DCKA 4NDCA 1IFMA 1LTIC 1B8LA 1FBVA 2HPSA 4GPLB 1OE9B 2WCBA 1BCCE 5AW5B 5TISE 1NJIQ 1A2XA 4YPCA 1JF0A 2ERBA 2KS1B 4U3FG 2KOGA 1C7WA 1URQC 3H1KG 5AW9B 1M46A 2DW3A 3KF9A 2B87B 3OB2B 1HGZA 3OJAB 2LVJA 3AEFC 3WUUA 2XZRA 5GQQC 3H4SE 4I5NB 1DGUA 2PRUA 1GJYA 2QJYC 4C0JA 4JF7A 4ASWA 1FZEA 1R2UA 2OYHC 4D6TJ 1LTAC 2LP3A 1JY2N 5JJGA 1LTJC 2E42A 1UUSA 1UWOA 1FZCA 1KILB 1KC8Q 1L0NE 2WWWA 3S0FA 4N78D 1QVIY 2QEBA 5AEQA 1LA3A 3FWCA 1IO4A 3VMZA 2IZ0A 4OR9B 5KLVK 1RTP1 3L73G 5CPVA 1MWNA 4MSPA 1J7QA 3PHLA 4C7RA 1JMMA 5FI2A 2JU0A 4U3FJ 2M0BA 3DY9A 2KIKA 2RH0A 1S36A 1OMRA 2QEOA 1DEBA 1LWUC 2I1JA 1FI6A 1CDPA 3Q3DA 3H1HE 1P28A 3PFVA 3N7HA 3SFDC 3PLNA 2ITAA 2NZ0A 2KYFA 4PJ0E 3CPWO 2LLSA 3N4XA 2ZYDA 3VGOA 1SFCB 3CCQP 1WRGA 1PPJG 1W9ZA 2LVIA 4QJ3B 4QJ5B 3CX5H 1OMVA 5AW3B 2K2AA 2AXTH 2IDBA 2WC6A 2F33A 1LT9C 1S5GZ 2B87A 2YMYA 1EZVD 5FI7A 1PZQA 1DD3A 1UHJA 3CCRP 4FQTA 3I5HC 2FYUJ 5CCHA 1F8HA 3A0HH 2L5YA 1KN7A 1SQBE 5APQA 4IFDK 4DS7A 1FZAA 3EFGA 1USDA 1BG1A 1NU1G 2XKMA 1ZUZA 5AW4B 2M7NA 2KSEA 1YTZI 2P67A 3HD7B 2FYUD 1J7RA 2WPRA 2F3ZA 1FE6A 1L0LD 1S5LE 2WPSA 1RH5B 1OVRA 2BASA 1BOCA 4A4CA 5DKQA 2E74D 3CWBG 1N73C 5HYDA 1MFTA 1GW4A 4QMAA 1NU1D 1YQ4C 1S6CA 3MUDC 5DJTB 2IFMA 1S3PA 1KWOC 4AQRD 2AMIA 2TN4A 1H89A 3D6ZA 2KYCA 3EKHA 2E6WA 5I8NA 2LV7A 1QGKB 2A45I 2KYVA 2O3JA 2LLUA 2KK7A 2P7JA 2CK3H 2W6AA 1YVLA 3JVTC 4DOJA 4INWA 3PLFB 1VQ9P 1TIZA 3H1KE 2GV5A 1X8YA 4RJTA 1G2CA 1N65A 2KLDA 4JKTA 4PE0A 1PGPA 1E79H 3V5BA 2MLFC 5AW7B 4MN4C 1K96A 2OTGB 3PJSK 1DX7A 2D2CB 1KFXS 3H1KD 1K04A 2JKVA 1AJ5A 3SG2A 1L4AD 1YVHA 2KNEA 4IFFA 3UO9A 2H43A 4YGEB 2H88C 1SS1A 4C7NB 3O4YA 2CPSA 3BOWA 1JY2P 1TNXA 4UPGA 1CTRA 1CNPA 1KV4A 2FCDA 3D0YA 1DF0B 2NPSA 1QL2A 4CPGA 1KWOB 3E3RA 4CLNA 1S6IA 4HH2A 1VQ5P 4Y28J 3MHVA 1NAFA 4PD4H 1OZOA 1PK0D 5KLVD 1SQQJ 4PHMA 1TU3F 1A75A 1CM4A 3MIWA 3WUVA 3H1IG 1V1FA 3L72E 3L74J 3CD6P 3GOFA 4BRYB 3W67A 2K0JA 2NPSB 5KTYA 1T6AA 3T97B 3I5GB 1PGJA 2PYQA 3S0BA 3HD7A 2QIWA 3FS7A 2Z5HA 3TF5A 2Q3EA 3D70A 3AEAC 3H1JD 2BBNA 2M3EA 3HUSB 1NTMK 1OOFA 1NX0A 2HODA 3NHIA 2Y4QA 1MZ9A 1L7ZA 4MLWA 3A0HE 3PN7C 5KLVE 3NSIA 1DELA 1A02F 3B5NC 1GK4A 2BNXA 1ZOTB 2ZFDA 3OX6A 4ORBB 5KJ7D 2WPQA 3HTKB 2YKPA 1P84E 3DZTA 3BRTB 4K35A 2K9JA 2QE7H 2MJZA 1WY9A 3VRNA 1UP5A 1RE3C 1Q82Q 4IL6H 3CTNA 3JVTB 3ABVC 1DEEG 1IK7A 1DVIA 1UHNA 2FYUK 1SP4A 1NIWA 1HJ0A 1YYCA 1KK7Z 2KGBC 4PT1A 2PFXA 1AP4A 3AE5C 4D1EA 1SQVG 2L0PA 1VQ8P 1EG4A 2AEFA 2HPCB 2KAYA 2N1TD 3CLNA 1QV0A 4MRYA 1EDJA 3FE6A 4Z1MH 1LT1A 3PJIA 3MSEB 3SIBA 1VQKP 2BKIB 3CZ0A 1D7MA 2FYNC 4RESB 1KSMA 4NPDA 3BYAA 3D74A 2E76C 3VN0A 3A0BH 5APTA 1R8EA 1SQVJ 1ZXGA 1M1KQ 5DICA 3D0YB 3AEEC 4BXLA 3CMEP 1CFDA 2M9GA 1NCZA 2JNXA 2JOJA 1ZACA 3D75A 1H8AA 1YQ3C 3PALA 2FFDC 3HD7C 5AW8B 2WCKA 2P2UA 4EDFA 2JQ6A 2E5YA 2I8DA 4ZKUA 1JY3O 1NTZK 1S2EA 2R5DA 4HYTB 3VP8A 1GGZA 4HB1A 4KJMA 1BGYG 4I5JA 5DKNA 1PSBA 1Y47A 5KAFE 2WOSA 1NAYA 1H0TA 1PGOA 2QJKB 1OX3A 3T97A 2WSSH 2F8PA 4JPZB 1CDMA 1EQ7A 1Y0VH 2R32A 2QM7A 3RK2C 3BJHA 2IFNA 3RBZA 2KS1A 4YXDC 4AOMA 3EK7A 1TCFA 2EHBA 2P71A 1DIPA 1YUTA 3V6IA 1URQD 3RL0D 3A4UB 1RF1B 2E76B 4D6TE 2R44A 4EYYQ 1MUUA 3BVHA 2JXCA 2V7QJ 2WT7A 3CWBD 3EK4A 2FCEA 3SIAA 4PV1B 1SQXE 2Z5IA 1WMKA 3DD4A 2HG5D 2ZYGA 1NVOA 1AJYA 2QJPB 2QEHA 1WT6A 1KQLA 1DGVA 1ALVA 5F6TA 2W8ZA 1AHRA 1FW4A 3TSIA 1XK4A 5CSJA 3PSRA 1S9KD 3B88A 2P10A 5CCGD 1RE4A 3JTDC 5HKWA 2V7QH 3RL0g 3LCPC 4GGFA 1C3ZA 1S26D 2Y9YA 1R5SA 3PM8A 4P5OE 1HWTC 1K9UA 2KI6C 3D77A 2CTNA 2LMTA 2JC2A 2E75C 2LUCA 3NXAA 1N8RQ 2BE6A 3BUOB 3MD0A 5D3OA 3D6YA 2QDIA 2BBMA 2MKVA 3TNUA 2OQQA 1NP8A 1LINA 1EL4A 5J3XA 4MZLA 3RL0C 4GGNA 1Z2CB 4HREE 4DZOA 2KOTA 3MZWB 1WDCC 4F7FA 4L74A 2JT3A 5KKZB 1LXFC 1K90D 2IS9A 5CCHC 2LP2A 1SQQK 2ZT9C 1ZMZA 2POHA 4MEWA 1G33A 2QSIA 3VMAA 1MKMA 2O1JA 3CR2A 1PIXA 2WSEH 3QMEA 2LVKA 4BWNA 1DJHA 4N6JA 1URQB 4USLA 4M2QA 1RROA 1JWDA 1SQPJ 3SWFA 4UB8E 5CCHD 3NSOA 2MA2A 1EZVE 5KJ7C 1KILD 3CZ2A 3FWNA 3IAOA 2FJUB 1XO5A 1CLLA 3OX5A 3BUWB 2BEQD 2OTKE 1EDIA 4XFJA 2LHLA 2ZVOB 3TYYA 1SCMB 2B9BA 1BDCA 5KTBA 1OSAA 3GG2A 2WCFA 1T2KC 3JCUH 3CWBE 1E8AA 2LC5A 3M9QA 1B47A 2KFHA 3CR5X 1HQVA 5K5GB 1OWAA 3L70D 1DMOA 2RKLA 1ZR2A 3KZIE 2G8YA 3NSKA 2JRFA 2H8PD 3DF0A 3CCEP 1NOHA 2BCCG 1FZCC 1VPCA 2J5UA 1AA0A 1T2KD 3FE9A 3AE4C 2KI4C 4YBHB 4ZCUA 2ZT9D 1PALA 3LW5H 2XDJA 1VQ6P 1NTZD 3SFEC 2H7HA 2JT0A 4I5LB 2LVVA 2K9JB 3O8ZA 2KGRA 5GTIE 3BUXB 3TDKA 4A4BA 1BSNA 1QX8A 1KFUL 1SYMA 1KYOH 5E79H 3UIAA 4L73A 2KNCA 1ZR4A 2FJYA 1LGHB 1M90Q 3K21A 2QEVA 5AFPA 3IFMA 5G08A 3V2PA 2JXLA 3CDNA 3KDPB 4H0LD 1N73A 3BRVB 2WSFH 1YHQP 2KHNA 1GL2D 4BY4A 4DJGA 3OW2O 1YJWP 1RF1A 1M1JB 4DUQA 1D1OA 4WQ2A 3QWOC 3M9HA 2I94A 1A02J 1NTMJ 1FAVA 3HUSA 3L74G 1BLQA 1AVYA 5H2FE 1QLSA 3SG4A 2E76D 1SQPD 1QXPA 2HPCA 1VQ7P 1VRKA 1PP9J 3S0GA 1H4BA 1JCDA 2KLEA 3C8VA 5APVA 2K7BA 3H25A 3BCCJ 5BPJA 4YTPC 2OTGC 5CSFA 2M97A 1CFCA 2DOQA 3AE7C 3NGVA 1RE4C 3D78A 3EQ2A 2PVBA 1IKUA 2FYUG 1F4QA 1NYAA 2M3WA 1BE3J 1DC1A 1L0NG 1M45A 2G3AA 1DJYA 1CB1A 3K5BA 1N7SA 1E5WA 1LVCD 2K7CA 1BGYJ 1EDKA 3VB1A 2KSPA 2JJLA 4I1LA 1UHIA 2PRRA 2JP3A 4P2YB 1OMIA 3D76A 2FOTA 2M1KB 1AQTA 1SK6D 3AKAA 2L4IA 3EG5B 3L73D 3L4AA 1YBKA 3B86A 5AW2B 1P84H 1UIXA 2CT9A 1KFMA 4ZKPA 3KYQA 2H8VA 1EZVG 3L72J 1SL8A 2PQLA 3B71A 2Q6QA 3Q1MA 4I6MC 1LNQA 1SQQG 3ICBA 1C3YA 1KB9D 3F45A 1RF0C 1IRJA 4U7JA 1PVBA 1FJPA 2R3CA 1LJ2A 1SKTA 3RK3D 3V4QA 3TK1A 3E1IA 3L75D 4CIDA 1A75B 1QLKA 1BDDA 1USEA 1TN4A 2Z4EA 4MBEA 4PHKA 4HRGA 1G1JA 2BCBA 3A0BE 2M5AA 5CCGA 2CCMA 2WC5A 3IN6A 1WRKA 3R1PA 1FOSE 3E7KA 4PV1C 1ZRTE 1M39A 1SQXJ 1JTHA 5KU1A 1M8OB 1S5LH 1SCVA 1AQ5A 1IWQA 1RY3A 1DJXA 1SY9A 1M1JC 1PPJE 1JY2O 1QJTA 1ZRTD 3P8CE 2QM8A 1EXJA 3AAKA 1EC5A 3D73A 5KAFH 4ZCVA 2KB7P 3LL8B 3HX4A 3H1KJ 2NLNA 1IFDA 1L4AA 2R5BA 4QJ4B 1JEKA 5D7FA 1RF0A 3WU2E 4L76A 1L0LJ 2QA4P 3UNWA 2KLUA 3CWGA 1SBJA 1CKKA 1JY3N 2QJYB 2BE4A 3H32A 4H13B 3L71D 4YGDB 1S72P 1CI6B 1K05A 4OV2A 2PAJA 2W6JH 3HD7D 3R2PA 1PV3A 4ORCB 4IL1A 1S5GY 1LP1A 1TUZA 1K93D 1J1DA 2M1UA 4FQOA 1OOIX 2BECA 1VQ4P 2KI4B 1IJ5A 1XYDA 2KFGA 4WY4C 1NTME 3B5NA 1CFPA 1FZCB 3HE4A 3B4SA 3G71P 4NDDA 4N78E 2Q7CA 4PHJA 2NCPA 4GODA 1QX2A 4PJ0H 5D69A 3TS5B 2ISDA 1TNWA 1JFJA 1IFPA 3C1VA 2YXQB 5GTHE 3DVKA 2FFDB 3CC4P 2E5TA 5CBOA 1XFWO 3GF3A 2F2OA 2COLB 4H13C 1YTZC 5I94A 2JZIA 2HQWA 4RO0A 1SQBD 3G6EP 2OARA 4PE7A 2LHIA 2EGDA 4MN0A 1IGVA 2RGIA 3S0DA 2LLTA 1UIIA 1JC2A 2JTTA 1QX5B 2K2FA 1KFNA 1KILA 2SCPA 1H88A 2JNFA 2K61A 5TNCA 1JO5A 2E74C 1GL2B 1KFUS 2LM5A 1TTXA 1Y8AA 2KFFA 5KLVG 3OA7A 1SCMC 1BT6A 4K3AA 2YIUC 1ZOYC 3CZTX 4HKZH 2FYZA 2LE9B 3O6BA 1VF5C 2HF5A 1JCCA 2P6BB 2SPZA 5PALA 1IIOA 1SNLA 1VQNP 3DVJA 2PP6A 3FWLA 1B1GA 1BCCJ 1CM1A 1VQLP 1U7JA 2SASA 2ZXEB 1GD2E 4PD4I 2P70A 1DJZA 2E43A 4JQ0D 3NMDA 5BVZA 2C9NY 1QIVA 1U5IA 3TGUJ 1QVFO 1L2OC 4A7PA 4OCIA 3JTDB 1MXEA 3ZNIA 1IFNA 3JCUE 1ZN5A 1MUXA 2J59M 4UB6E 1NO4A 2BCCD 1KD1Q 2PGDA 1NTZE 2JR8A 4M2PA 2N9YB 1L0LE 4CPVA 1NCXA 3PP5A 3JC22 3CC7P 4W7YA 3H1ID 3L73J 4UB6H 3CXHD 5BU5A 3QRXA 3FE8A 4YRUA 1KQFB 3G3ZA 3GF7A 1T8ZA 2A45G 3MUDA 5CBNA 3TGUE 4U3FD 4YI8A 4R1EA 2WPVB 1ZFSA 1YUUA 2BKHB 2BCCE 4CFRA 4EI2A 3O6QA 3L70E 5KAIH 1Y1UA 3E1RA 1SL7A 4PHNA 4R4MA 1KQVA 1KQMC 1BR4B 2L4HA 1P84I 4NQGA 5FI6A 1YJ9P 1F54A 1BGYE 1YX7A 1JOCA 4RKUJ 4ORAB 3CCMP 1HGVA 1PP9E 1GMJA 4OKHA 2KLVA 5DKRA 1PVAA 1OIPA 1J1DC 4PE4A 1FBMA 4IFMA 3TGUD 3U59A 4I2LC 3A2AA 2E75B 3HE4B 5ER5A 3M06A 2Y5IA 3IF7A 3ITKA 2BL0B 4INXA 1SQQD 2C0XA 1MV8A 2O1KA 3RK3B 2YO2A 4NPFX 1G8IA 5CJ4A 1KK8B 2B88A 2IBZI 3OBVA 1S4XA 3GLMA 2FYUE 3BFBA 3CWBJ 1J2JB 3PTZA 1K2HA 3WHTB 3S0AA 1JFKA 1MHOA 2WCMA 2HR3A 2YKQA 3MGNA 1AVSA 2ZNDA 1SSEB 4N5XA 1Q2NA 3L72D 5I2LA 5I2OA 1RK9A 3CCVP 1PFIA 1IH0A 1SRAA 3Q5RA 1WLZA 1JUNA 4WY4A 4GNKB 3O4XA 4YGCB 2KZIA 1CFFA 1XVJA 2KBIA 2A06D 4C46A 3L35A 1FDMA 1R6PA 3C9IA 3BCCE 1OXZA 3RL0B 3TUYB 4MZKA 3P8CD 1QWVA 1SVFA 2LAPA 2GTEA 1FPWA 1GTWA 5AVSB 1EH2A 4JYBA 5I2QA 2AXTE 3AE2C 5EFWB 5APWA 3NXSA 1M57D 5DJUB 3M0DA 4U3FE 2BEZF 2WQYC 2H61A 4NPEA 2KP8A 1PP9G 1Z4HA 4UB8H 2KBMA 3BFAA 1NTKG 4AQJA 1PGQA 3EWKA 2ZNEA 3H1JE 2M5AB 3KHEA 1SQPG 3S4RA 1NUBA 1LTGC 1OZSA 1OW8A 2JT8A 2JWAA 3FXEA 1ORGA 1BGYD 2CXJA 3M9BA 5CSIA 1QX7A 1HT9A 2OPOA 3AEBC 2BCXA 1SQBK 1BCCD 1Z56A 2KSJA 1NX2A 1VQMP 5CJ0A 1V1GA 4PDZA 4OH8B 2BCAA 3VROA 1DEKA 5APUA 4OWFA 4MZJA 2WSEJ 3OGNA 1Y9BA 3V2RA 3BOWB 1CMGA 3R1VA 2K1AA 1W5CE 2HYNA 2GA1A 4O9BA 3AEDC 3OHMB 1SQXK 4N3YB 1B9AA 4M2OA 1SL9A 1TCOB 1HUCA 3I5HB 4N1FA 1L0ND 2N1TB 4ZNCA 3SS3A 1IZNB 3GK2A 2Q3IA 1K94A 2PALA 1PL5A 1JTHB 4OZDA 2ZAEB 1J1EB 2FY8A 4DRWA 2ZYAA 4YXWH 3TNUB 5AW0B 1HBWA 3SS4A 1OVUA 2ZT9B 2LUXA 1SQBJ 3EVUA 4C0KA 2IZ1A 3AE1C 1YUSA 3L36A 1GU4A 2LCPA 1SR6C 4LGDE 1KYOD 1K8UA 1IFJA 3RBXA 3C1LA 3IR9A 1BE3G 1S1EA 1QLED 3MP7B 1IJDB 3TZ1A 3W68A 3A7OA 1SQVK 2RMZA 2FFDA 2Y0EA 3I55P 4AUWA 2P58A 1KK7Y 2FYNB 3FX0A 1J7OA 3M0AA 1CLBA 2JWWA 1NCYA 1M7LA 1ALWA 2F3YA 2M0RA 1KCYA 3TS5C 2NZ2A 3RK3C 1YX8A 2I18A 3SWKA 4PD4E 1JMBA 4GDOA 3SWYA 3VOPA 4TNCA 1SQPK 1NU1J 2L5XB 1NTKK 5M1BA 3I5FB 1K9MQ 3RM1A 3FWBA 4OGQD 2JWDA 2R2IA 1OFCX 1QVGO 5AXIA 1IG5A 1YTZT 4HSZA 2NPSD 3CMAP 1OOJA 2XU6A 2OYIB 1XFUO 4D6TD 2Y1MA 3O6QB 5CCGC 4H0LC 4XE5B 2IYOA 2QJKC 3SS5A 1A4PA 3U1AA 1J1EA 2OYIA 1VQPP 3HUSC 3CYZA 3R72A 1L4AB 1KTMA 1FS0E 3MTUE 3M0WA 3LK0A 2I1KA 1XFZO 4D6TG 2D2CD 1NU1E 5IBWA 1NX3A 2AAOA 2GGZA 4OVNF 3H1HD 3CCJP 3L70G 1B8CA 1SQXD 1HVVA 2KI7B 2ZVNB 1IQ5A 5CMZA 1YITP 1Q86Q 2K3RA 2LKMA 2KQ6A 1BR1B 3CZ1A 1K8AQ 3B87A 4I7ZC 1QTXA 1LA0A 5B8IB 5KKZC 1QATA 2Q9IA 1UURA 4Q04A 1DQEA 4L9MA 1F4OA 1LTTC 3H1HJ 2AUCA 5B66H 2LXBA 1NWDA 2WCJA 1LS8A 1CDNA 1U5IB 4GOEA 2LXCB 3L74E 1L2OB 1AK8A 1TOPA 1N2DC 3M91A 5AVQB 1NGMB 1NSHA 3WUTA 1BE3D 1RHZB 5KSZA 1S3JA 2ZN9A 1M63B 3EK8A 1NTMD 2A45H 4PCWA 2ZJSE 4FTGA 3B5NB 3P7KA 3DVMA 1GK6A 3V2NA 3K1EA 2K7DA 1S9KE 1FC2C 1LKJA 1MF8B 1EDLA 2YNYA 5AW6B 1PRWA 3AE9C 1L0NK 3L71G 5APYA 5BU8B 2O60A 1FDIA 4JBZA 4GIFA 5KJ7A 1VF5B 1P84D 2KAXA 3GK1A 4M3LA 1X79B 3CC2P 5AVXB 4GT1A 5AVWB 1YRUB 4KT0J 2MBXA 2JEEA 2OYIC 4GGFC 1NTZJ 1RWYA 3KEVA 2OYHA 4GKGA 1JUOA 3CLQA 1JB0J 3NTNA 2KQYA 1SFCD 2E75D 4H44B 2GGMA 3KO0A 1N7LA 2YXRB 3LIEA 1NKZB 1QS7A 3TUYC 1EXIA 4PALA 3BASA 1XFVO 3CXHI 4LC1A 2XV5A 3CXHE 1KYOI 3A8RA 3BCCG 2CPBA 2K8MB 2OTLP 3Q5SA 3OAKA 2YGUA 2NXQA 3L75G 3NFQA 2Y0CA 3RK2B 1SLQA 2W90A 1BCCG 1RF1C 4OGQC 2JO1A 3SG6A 1QL1A 2H61C 1OOGA 4BY5A 3WXAA 4B86A 1M56D 1XFRA 1LP1B 1J1EC 1ZV8A 1C7VA 1GDTA 3CS1A 4ZMDA 5FYXA 3V2LA 4GFTA 2WCLA 2Q1KA 3HE5B 1QASA 4WB4A 1H8BA 1NX1A 1DJGA 2HETA 1CDLA 3BATA 3L4LA 3O2PA 3H32B 3BCCD 2AEJA 3I5GC 5C39A 2G9BA 4EOTA 4H44C 3FXDA 2NCOA 2M29A 1ODBA 1JF2A 1K9PA 1N7SB 1L0LG 1LTBC 1CZQA 4HJGH 3II6A 1FOSF 2AXCA 2WCEA 3ZWHA 3PM2A 1LWUA 3PRJA 1OZHA 4TT3H 1W2BO 1UHKA 3Q8IA 3IF4A 3LW5J 1IJ6A 4EIJA 2LANA 2NRGA 3KHUA 2R3SA 3VP9A 3I5CA 1SQPE 3FGAD 2QPTA 2M8RA 1KK8C 2Q4UA 1PSRA 2QACA 1T14A 2MJWB 1X02A 5B5EE 1LTSC 3SJSA 1GQMA 1QEXA 3L4FA 3H1HG 2V53A 1AV1A 3WHUB 1M31A 4AYCA 3HE5A 4LLHA 2OGUA 2L2CA 1SPYA 4GBAA 1OW4A 3VYIA
chains in the Genus database with same CATH topology
1JF0A 3CR4X 2JTZA 1DJIA 4NQGA 1F54A 2BBMA 1J7PA 1C7WA 1YX7A 2LMVA 1B7TY 1NP8A 1LINA 1EL4A 1M46A 2PSRA 4MZLA 4GGNA 4HREE 4ORAB 3KF9A 5J3XA 2KOTA 3OB2B 1WDCC 2LVJA 2JT3A 4OKHA 5DKRA 1PVAA 1LXFC 1K90D 2IS9A 3H4SE 1DGUA 4I5NB 5GQQC 2LP2A 4PE4A 2PRUA 1IQ3A 1GJYA 1ZMZA 5ER5A 4C0JA 2WC8A 4MEWA 1R2UA 1G33A 2Y5IA 3IF7A 2BL0B 1N0YA 4E68A 3CR2A 2HQ8A 2LP3A 2LVKA 1G8IA 1DJHA 5JJGA 3O78A 1KK8B 1UUSA 1UWOA 1XK4C 1RROA 4M2QA 4USLA 1JWDA 1DJWA 3NSOA 2MA2A 1K2HA 3WHTB 1JFKA 1MHOA 2FJUB 1XO5A 2Q91A 1CLLA 4PE1A 3OX5A 1B7TZ 3BUWB 3EKJA 1AVSA 1Q80A 1QVIY 2ZNDA 5AEQA 1LA3A 3FWCA 4N5XA 5I2LA 2PASA 5I2OA 2LHLA 1CMFA 1RK9A 4GUKA 4OR9B 4GAOA 1IH0A 1SCMB 1SRAA 1RTP1 1WLZA 4NDBA 5CPVA 4GNKB 1OSAA 1MWNA 4MSPA 1J7QA 4YGCB 1Y6WA 2WCFA 1CFFA 1E8AA 1XVJA 2KBIA 2LC5A 1B47A 2Y9ZA 2KFHA 3CR5X 1OMDA 4C0LA 1HQVA 1FF1A 1R6PA 2JU0A 1DMOA 1MXLC 1EG3A 3TUYB 3VRQA 4MZKA 1WRLA 1S36A 1OMRA 3NSKA 2JRFA 1FI6A 3DF0A 1CDPA 2LAPA 3WNXB 3BUMB 1FPWA 5JOLA 2WNDA 3PFVA 4YI9A 4XJKB 2ZKMX 3OB1B 1QIWA 2KI4C 2NZ0A 2KYFA 1EH2A 4YBHB 5I2QA 1RJVA 4ZCUA 2I2RE 2LLSA 1C07A 1PALA 3AAJA 2D8NA 2PMYA 3PATA 2JT0A 4I5LB 3VGOA 4XJKA 2JULA 2LVVA 2H61A 2KGRA 3BUXB 1TNPA 4A4BA 2OS8C 1KFUL 1SYMA 2LVIA 4QJ3B 1F71A 4QJ5B 2KBMA 2WORA 1OMVA 4AQJA 2K2AA 2ZNEA 3KHEA 1XFXO 3K21A 2F33A 1CLMA 1NUBA 1OZSA 1S5GZ 5G08A 5AFPA 1K95A 2JXLA 2JT8A 2EC6C 4OCIA 2CXJA 1UHJA 5CSIA 1QX7A 2KHNA 1HT9A 4BY4A 1XFYO 5HKYA 2OPOA 2BCXA 3I5HC 4DUQA 1F8HA 1OQPA 1D1OA 4WQ2A 1NX2A 2I94A 4DS7A 1V1GA 1BLQA 4PDZA 2BCAA 3VROA 1BG1A 1QLSA 4MZJA 1ZUZA 3SG4A 3BOWB 2JPTA 1CMGA 2M7NA 1QXPA 5K89A 1VRKA 4JWQA 1H4BA 1J7RA 3OHMB 2F3ZA 1SR6B 1B9AA 4M2OA 2Y1NA 1SL9A 2K7BA 1TCOB 5AERA 3I5HB 4N1FA 1BOCA 1AJ4A 5DKQA 4A4CA 5BPJA 1EJ3A 5HYDA 2OTGC 5CSFA 5ER4X 2M49B 2M97A 3SG5A 1CFCA 3GK2A 2DOQA 3CGAA 1K94A 2PALA 1QVIZ 1S6CA 1S3PA 4MVFA 1KWOC 4F0ZB 2AMIA 2PVBA 2TN4A 4DRWA 1IKUA 2KI6D 2MRDA 3FIAA 2KYCA 1EXRA 1F4QA 1G4YR 2E6WA 3EKHA 5I8NA 3KPXA 2LV7A 1NYAA 2M3WA 2LLUA 1F55A 1M45A 1YVLA 3JVTC 3PLFB 1TIZA 1DJYA 1CB1A 1MQ1A 2LUXA 2GV5A 3EVUA 4C0KA 4U8DA 1LVCD 1YUSA 2K7CA 1N65A 2LCPA 1SR6C 4PE0A 1BJFA 1W7IB 2KSPA 1UHIA 1K8UA 2MLFC 4P2YB 2MLEC 3GK4X 1K96A 1TNQA 1Y1AA 1S1EA 2OTGB 2FOTA 2M1KB 3TZ1A 1KFXS 2MHHA 5AANA 1AJ5A 4YGAA 3SG2A 4ETOA 1SK6D 3AKAA 2L4IA 1KK7Y 1YVHA 2KNEA 4WRIA 1J7OA 1CLBA 2CT9A 2JWWA 1NCYA 3RLZA 2L50A 1ALWA 2F3YA 4YGEB 2M0RA 1KCYA 3TS5C 1SL8A 1YX8A 3O4YA 2I18A 2CBLA 3BOWA 3ICBA 1TNXA 3F45A 4UPGA 1CTRA 1CNPA 4TNCA 1IRJA 2FCDA 2L5XB 3D0YA 1DF0B 3VRRA 3I5FB 1PULA 1S6JA 3FWBA 2A4JA 1KWOB 3RM1A 1PVBA 2R2IA 3E3RA 1OFCX 4CLNA 1S6IA 5AXIA 1IG5A 2L2EA 1SKTA 4HSZA 2ZRSA 1OOJA 1OZOA 1PK0D 4CIDA 1A75B 1QLKA 1F70A 1DF0A 1XFUO 2Y1MA 1TN4A 4PHMA 1DTLA 4MBEA 1A75A 4PHKA 1CM4A 4HRGA 2BCBA 1JSAA 1A4PA 2CCMA 1J1EA 3EVRA 3SG7A 4CFQA 1WRKA 1V1FA 2H2KA 5HLOA 3GOFA 2K0JA 3I5FC 1M39A 3M0WA 2ZRTA 3LK0A 1XFZO 1YR5A 5KTYA 3I5GB 3NSLA 5KU1A 5IBWA 1NX3A 2AAOA 3FS7A 2GGZA 1SCVA 4OVNF 1IWQA 2M7LA 3DF0B 1B8CA 2BBNA 1DJXA 1SY9A 3EVVA 1QJTA 1IQ5A 1NPQA 1YRTB 3AAKA 4ZCVA 1AUIB 1NX0A 3LL8B 2KQ6A 1BR1B 3HX4A 2NLNA 1BF5A 2O5GA 2Y4QA 1QTXA 1LA0A 1L7ZA 5B8IB 4QJ4B 1QATA 4MLWA 3BQ3A 5D7FA 1TRFA 4ICBA 3PN7C 1J55A 5HKZA 1UURA 4Q04A 1XA5A 3NSIA 4L9MA 1F4OA 2AUCA 3CWGA 1SBJA 1CKKA 2BE4A 1SMGA 2M8UA 1NWDA 1ZOTB 2ZFDA 2ZN8A 1CDNA 4YGDB 3OX6A 4XYNA 1U5IB 2BL0C 4ORBB 1GGWA 3BXKA 1L2OB 1AK8A 1TOPA 1NSHA 4OV2A 1B4CA 5KSZA 2ZN9A 1M63B 3EK8A 3SG3A 1WY9A 4PCWA 4ORCB 4IL1A 1S5GY 2MAZA 3OP0A 3VRNA 1UP5A 1Y1XA 1K93D 1J1DA 2M1UA 4FQOA 4FTGA 1RFJA 2BECA 2KI4B 1IJ5A 1XYDA 2KAVA 2KFGA 2VRGA 3DVMA 3CTNA 3JVTB 5HLVA 2K7DA 1CFPA 1DVIA 2L98A 1LKJA 1UHNA 4NDDA 1MF8B 4PHJA 2NCPA 1QX2A 1NIWA 2LMUA 5D69A 1KK7Z 1PRWA 2KGBC 2ISDA 3TS5B 1TNWA 1JFJA 1AP4A 4D1EA 3C1VA 2O60A 2L0PA 4YGBB 1EG4A 3TDUA 2KAYA 3DVKA 3CLNA 1QV0A 4MRYA 3PN7B 2KAXA 1XFWO 3GK1A 2F2OA 1FI5A 2COLB 1YRUB 1YTZC 3MSEB 2JZIA 2HQWA 2MBXA 1DT7B 1JBAA 3SIBA 4GGFC 4PE7A 1RWYA 2BKIB 2LHIA 3KEVA 1JUOA 4AQIA 2EGDA 1KSMA 2KQYA 2G2BA 4MN0A 1IGVA 2RGIA 3BYAA 3I5IB 2LLTA 3TDZA 1JC2A 1A29A 2JTTA 2K7OA 1QX5B 4N1GA 2GGMA 2K2FA 1KSOA 3KO0A 2SCPA 3D0YB 3AKBA 2B1UA 1SW8A 1WLMA 1CFDA 1QS7A 2JNFA 2M9GA 2K61A 1NCZA 5TNCA 3TUYC 2E30A 2JNXA 3BUNB 4PALA 2JOJA 1XFVO 1ZACA 1KFUS 3PALA 2L51A 2LM5A 1TTXA 4I5KA 4HRHA 3A8RA 1K9KA 1QV1A 2K8MB 2CNPA 2KFFA 1WDCB 5CSNA 1BODA 2NXQA 1SCMC 2JQ6A 1BT6A 2I7AA 3CZTX 2KDHA 3SG6A 2H61C 4BY5A 3WXAA 2LE9B 1BMOA 3O6BA 1GGZA 4I5JA 5DKNA 1PSBA 2WOSA 2HF5A 1B8RA 1A03A 3IQQA 1YURA 1UHHA 2OS8B 1C7VA 3LK1A 2P6BB 1KFXL 5PALA 3CS1A 1SNLA 1WRZA 3DVJA 5FYXA 2F8PA 4GFTA 4JPZB 1B1GA 1CDMA 1CM1A 2SASA 1QASA 1Y0VH 1H8BA 1NX1A 1DJGA 2HETA 1CDLA 1DJZA 4JQ0D 3O2PA 3IQOA 4AOMA 3EK7A 1TCFA 2EHBA 1YUTA 3I5GC 2LNKA 1RECA 1QIVA 1U5IA 2G9BA 3HCMA 4WQ3A 3D10A 1L2OC 1N2DA 2NCOA 2F2PA 3A4UB 3JTDB 1MXEA 1ODBA 2M29A 3I5IC 3LLEA 4MRXA 1JF2A 1K9PA 3ZNIA 2JXCA 4DIRA 1MUXA 3TDIA 2WCEA 3ZWHA 3EK4A 2FCEA 3SIAA 3DD4A 1MR8A 1W7JB 4M2PA 1UHKA 4CPVA 1NCXA 1DGVA 2EC6B 1BU3A 1ALVA 5F6TA 1IJ6A 1AHRA 1FW4A 1XK4A 2LANA 5CSJA 3PSRA 1KQMB 3QRXA 4YRUA 3DVEA 3JTDC 5HKWA 2QPTA 3VRPA 1KK8C 4YI8A 4R1EA 3LCPC 2Q4UA 1PSRA 2QACA 1ZFSA 1YUUA 4GGFA 4DCKA 1S26D 2MJWB 1X02A 4NDCA 3PM8A 2BKHB 3SJSA 2Y9YA 4P5OE 1K9UA 1B8LA 4CFRA 1GQMA 2KI6C 2HPSA 1FBVA 2CTNA 4GPLB 1OE9B 2LMTA 2V53A 2WCBA 1Y1UA 2JC2A 3WHUB 1SL7A 1M31A 4PHNA 1KQVA 2LUCA 1KQMC 1BR4B 3NXAA 1A2XA 2L4HA 1SPYA 2BE6A 4GBAA 3BUOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JF0 A;  3CR4 X;  2JTZ A;  1DJI A;  4NQG A;  1F54 A;  2BBM A;  1J7P A;  1C7W A;  1YX7 A;  2LMV A;  1B7T Y;  1NP8 A;  1LIN A;  1EL4 A;  1M46 A;  2PSR A;  4MZL A;  4GGN A;  4HRE E;  4ORA B;  3KF9 A;  5J3X A;  2KOT A;  3OB2 B;  1WDC C;  2LVJ A;  2JT3 A;  4OKH A;  5DKR A;  1PVA A;  1LXF C;  1K90 D;  2IS9 A;  3H4S E;  1DGU A;  4I5N B;  5GQQ C;  2LP2 A;  4PE4 A;  2PRU A;  1IQ3 A;  1GJY A;  1ZMZ A;  5ER5 A;  4C0J A;  2WC8 A;  4MEW A;  1R2U A;  1G33 A;  2Y5I A;  3IF7 A;  2BL0 B;  1N0Y A;  4E68 A;  3CR2 A;  2HQ8 A;  2LP3 A;  2LVK A;  1G8I A;  1DJH A;  5JJG A;  3O78 A;  1KK8 B;  1UUS A;  1UWO A;  1XK4 C;  1RRO A;  4M2Q A;  4USL A;  1JWD A;  1DJW A;  3NSO A;  2MA2 A;  1K2H A;  3WHT B;  1JFK A;  1MHO A;  2FJU B;  1XO5 A;  2Q91 A;  1CLL A;  4PE1 A;  3OX5 A;  1B7T Z;  3BUW B;  3EKJ A;  1AVS A;  1Q80 A;  1QVI Y;  2ZND A;  5AEQ A;  1LA3 A;  3FWC A;  4N5X A;  5I2L A;  2PAS A;  5I2O A;  2LHL A;  1CMF A;  1RK9 A;  4GUK A;  4OR9 B;  4GAO A;  1IH0 A;  1SCM B;  1SRA A;  1RTP 1;  1WLZ A;  4NDB A;  5CPV A;  4GNK B;  1OSA A;  1MWN A;  4MSP A;  1J7Q A;  4YGC B;  1Y6W A;  2WCF A;  1CFF A;  1E8A A;  1XVJ A;  2KBI A;  2LC5 A;  1B47 A;  2Y9Z A;  2KFH A;  3CR5 X;  1OMD A;  4C0L A;  1HQV A;  1FF1 A;  1R6P A;  2JU0 A;  1DMO A;  1MXL C;  1EG3 A;  3TUY B;  3VRQ A;  4MZK A;  1WRL A;  1S36 A;  1OMR A;  3NSK A;  2JRF A;  1FI6 A;  3DF0 A;  1CDP A;  2LAP A;  3WNX B;  3BUM B;  1FPW A;  5JOL A;  2WND A;  3PFV A;  4YI9 A;  4XJK B;  2ZKM X;  3OB1 B;  1QIW A;  2KI4 C;  2NZ0 A;  2KYF A;  1EH2 A;  4YBH B;  5I2Q A;  1RJV A;  4ZCU A;  2I2R E;  2LLS A;  1C07 A;  1PAL A;  3AAJ A;  2D8N A;  2PMY A;  3PAT A;  2JT0 A;  4I5L B;  3VGO A;  4XJK A;  2JUL A;  2LVV A;  2H61 A;  2KGR A;  3BUX B;  1TNP A;  4A4B A;  2OS8 C;  1KFU L;  1SYM A;  2LVI A;  4QJ3 B;  1F71 A;  4QJ5 B;  2KBM A;  2WOR A;  1OMV A;  4AQJ A;  2K2A A;  2ZNE A;  3KHE A;  1XFX O;  3K21 A;  2F33 A;  1CLM A;  1NUB A;  1OZS A;  1S5G Z;  5G08 A;  5AFP A;  1K95 A;  2JXL A;  2JT8 A;  2EC6 C;  4OCI A;  2CXJ A;  1UHJ A;  5CSI A;  1QX7 A;  2KHN A;  1HT9 A;  4BY4 A;  1XFY O;  5HKY A;  2OPO A;  2BCX A;  3I5H C;  4DUQ A;  1F8H A;  1OQP A;  1D1O A;  4WQ2 A;  1NX2 A;  2I94 A;  4DS7 A;  1V1G A;  1BLQ A;  4PDZ A;  2BCA A;  3VRO A;  1BG1 A;  1QLS A;  4MZJ A;  1ZUZ A;  3SG4 A;  3BOW B;  2JPT A;  1CMG A;  2M7N A;  1QXP A;  5K89 A;  1VRK A;  4JWQ A;  1H4B A;  1J7R A;  3OHM B;  2F3Z A;  1SR6 B;  1B9A A;  4M2O A;  2Y1N A;  1SL9 A;  2K7B A;  1TCO B;  5AER A;  3I5H B;  4N1F A;  1BOC A;  1AJ4 A;  5DKQ A;  4A4C A;  5BPJ A;  1EJ3 A;  5HYD A;  2OTG C;  5CSF A;  5ER4 X;  2M49 B;  2M97 A;  3SG5 A;  1CFC A;  3GK2 A;  2DOQ A;  3CGA A;  1K94 A;  2PAL A;  1QVI Z;  1S6C A;  1S3P A;  4MVF A;  1KWO C;  4F0Z B;  2AMI A;  2PVB A;  2TN4 A;  4DRW A;  1IKU A;  2KI6 D;  2MRD A;  3FIA A;  2KYC A;  1EXR A;  1F4Q A;  1G4Y R;  2E6W A;  3EKH A;  5I8N A;  3KPX A;  2LV7 A;  1NYA A;  2M3W A;  2LLU A;  1F55 A;  1M45 A;  1YVL A;  3JVT C;  3PLF B;  1TIZ A;  1DJY A;  1CB1 A;  1MQ1 A;  2LUX A;  2GV5 A;  3EVU A;  4C0K A;  4U8D A;  1LVC D;  1YUS A;  2K7C A;  1N65 A;  2LCP A;  1SR6 C;  4PE0 A;  1BJF A;  1W7I B;  2KSP A;  1UHI A;  1K8U A;  2MLF C;  4P2Y B;  2MLE C;  3GK4 X;  1K96 A;  1TNQ A;  1Y1A A;  1S1E A;  2OTG B;  2FOT A;  2M1K B;  3TZ1 A;  1KFX S;  2MHH A;  5AAN A;  1AJ5 A;  4YGA A;  3SG2 A;  4ETO A;  1SK6 D;  3AKA A;  2L4I A;  1KK7 Y;  1YVH A;  2KNE A;  4WRI A;  1J7O A;  1CLB A;  2CT9 A;  2JWW A;  1NCY A;  3RLZ A;  2L50 A;  1ALW A;  2F3Y A;  4YGE B;  2M0R A;  1KCY A;  3TS5 C;  1SL8 A;  1YX8 A;  3O4Y A;  2I18 A;  2CBL A;  3BOW A;  3ICB A;  1TNX A;  3F45 A;  4UPG A;  1CTR A;  1CNP A;  4TNC A;  1IRJ A;  2FCD A;  2L5X B;  3D0Y A;  1DF0 B;  3VRR A;  3I5F B;  1PUL A;  1S6J A;  3FWB A;  2A4J A;  1KWO B;  3RM1 A;  1PVB A;  2R2I A;  3E3R A;  1OFC X;  4CLN A;  1S6I A;  5AXI A;  1IG5 A;  2L2E A;  1SKT A;  4HSZ A;  2ZRS A;  1OOJ A;  1OZO A;  1PK0 D;  4CID A;  1A75 B;  1QLK A;  1F70 A;  1DF0 A;  1XFU O;  2Y1M A;  1TN4 A;  4PHM A;  1DTL A;  4MBE A;  1A75 A;  4PHK A;  1CM4 A;  4HRG A;  2BCB A;  1JSA A;  1A4P A;  2CCM A;  1J1E A;  3EVR A;  3SG7 A;  4CFQ A;  1WRK A;  1V1F A;  2H2K A;  5HLO A;  3GOF A;  2K0J A;  3I5F C;  1M39 A;  3M0W A;  2ZRT A;  3LK0 A;  1XFZ O;  1YR5 A;  5KTY A;  3I5G B;  3NSL A;  5KU1 A;  5IBW A;  1NX3 A;  2AAO A;  3FS7 A;  2GGZ A;  1SCV A;  4OVN F;  1IWQ A;  2M7L A;  3DF0 B;  1B8C A;  2BBN A;  1DJX A;  1SY9 A;  3EVV A;  1QJT A;  1IQ5 A;  1NPQ A;  1YRT B;  3AAK A;  4ZCV A;  1AUI B;  1NX0 A;  3LL8 B;  2KQ6 A;  1BR1 B;  3HX4 A;  2NLN A;  1BF5 A;  2O5G A;  2Y4Q A;  1QTX A;  1LA0 A;  1L7Z A;  5B8I B;  4QJ4 B;  1QAT A;  4MLW A;  3BQ3 A;  5D7F A;  1TRF A;  4ICB A;  3PN7 C;  1J55 A;  5HKZ A;  1UUR A;  4Q04 A;  1XA5 A;  3NSI A;  4L9M A;  1F4O A;  2AUC A;  3CWG A;  1SBJ A;  1CKK A;  2BE4 A;  1SMG A;  2M8U A;  1NWD A;  1ZOT B;  2ZFD A;  2ZN8 A;  1CDN A;  4YGD B;  3OX6 A;  4XYN A;  1U5I B;  2BL0 C;  4ORB B;  1GGW A;  3BXK A;  1L2O B;  1AK8 A;  1TOP A;  1NSH A;  4OV2 A;  1B4C A;  5KSZ A;  2ZN9 A;  1M63 B;  3EK8 A;  3SG3 A;  1WY9 A;  4PCW A;  4ORC B;  4IL1 A;  1S5G Y;  2MAZ A;  3OP0 A;  3VRN A;  1UP5 A;  1Y1X A;  1K93 D;  1J1D A;  2M1U A;  4FQO A;  4FTG A;  1RFJ A;  2BEC A;  2KI4 B;  1IJ5 A;  1XYD A;  2KAV A;  2KFG A;  2VRG A;  3DVM A;  3CTN A;  3JVT B;  5HLV A;  2K7D A;  1CFP A;  1DVI A;  2L98 A;  1LKJ A;  1UHN A;  4NDD A;  1MF8 B;  4PHJ A;  2NCP A;  1QX2 A;  1NIW A;  2LMU A;  5D69 A;  1KK7 Z;  1PRW A;  2KGB C;  2ISD A;  3TS5 B;  1TNW A;  1JFJ A;  1AP4 A;  4D1E A;  3C1V A;  2O60 A;  2L0P A;  4YGB B;  1EG4 A;  3TDU A;  2KAY A;  3DVK A;  3CLN A;  1QV0 A;  4MRY A;  3PN7 B;  2KAX A;  1XFW O;  3GK1 A;  2F2O A;  1FI5 A;  2COL B;  1YRU B;  1YTZ C;  3MSE B;  2JZI A;  2HQW A;  2MBX A;  1DT7 B;  1JBA A;  3SIB A;  4GGF C;  4PE7 A;  1RWY A;  2BKI B;  2LHI A;  3KEV A;  1JUO A;  4AQI A;  2EGD A;  1KSM A;  2KQY A;  2G2B A;  4MN0 A;  1IGV A;  2RGI A;  3BYA A;  3I5I B;  2LLT A;  3TDZ A;  1JC2 A;  1A29 A;  2JTT A;  2K7O A;  1QX5 B;  4N1G A;  2GGM A;  2K2F A;  1KSO A;  3KO0 A;  2SCP A;  3D0Y B;  3AKB A;  2B1U A;  1SW8 A;  1WLM A;  1CFD A;  1QS7 A;  2JNF A;  2M9G A;  2K61 A;  1NCZ A;  5TNC A;  3TUY C;  2E30 A;  2JNX A;  3BUN B;  4PAL A;  2JOJ A;  1XFV O;  1ZAC A;  1KFU S;  3PAL A;  2L51 A;  2LM5 A;  1TTX A;  4I5K A;  4HRH A;  3A8R A;  1K9K A;  1QV1 A;  2K8M B;  2CNP A;  2KFF A;  1WDC B;  5CSN A;  1BOD A;  2NXQ A;  1SCM C;  2JQ6 A;  1BT6 A;  2I7A A;  3CZT X;  2KDH A;  3SG6 A;  2H61 C;  4BY5 A;  3WXA A;  2LE9 B;  1BMO A;  3O6B A;  1GGZ A;  4I5J A;  5DKN A;  1PSB A;  2WOS A;  2HF5 A;  1B8R A;  1A03 A;  3IQQ A;  1YUR A;  1UHH A;  2OS8 B;  1C7V A;  3LK1 A;  2P6B B;  1KFX L;  5PAL A;  3CS1 A;  1SNL A;  1WRZ A;  3DVJ A;  5FYX A;  2F8P A;  4GFT A;  4JPZ B;  1B1G A;  1CDM A;  1CM1 A;  2SAS A;  1QAS A;  1Y0V H;  1H8B A;  1NX1 A;  1DJG A;  2HET A;  1CDL A;  1DJZ A;  4JQ0 D;  3O2P A;  3IQO A;  4AOM A;  3EK7 A;  1TCF A;  2EHB A;  1YUT A;  3I5G C;  2LNK A;  1REC A;  1QIV A;  1U5I A;  2G9B A;  3HCM A;  4WQ3 A;  3D10 A;  1L2O C;  1N2D A;  2NCO A;  2F2P A;  3A4U B;  3JTD B;  1MXE A;  1ODB A;  2M29 A;  3I5I C;  3LLE A;  4MRX A;  1JF2 A;  1K9P A;  3ZNI A;  2JXC A;  4DIR A;  1MUX A;  3TDI A;  2WCE A;  3ZWH A;  3EK4 A;  2FCE A;  3SIA A;  3DD4 A;  1MR8 A;  1W7J B;  4M2P A;  1UHK A;  4CPV A;  1NCX A;  1DGV A;  2EC6 B;  1BU3 A;  1ALV A;  5F6T A;  1IJ6 A;  1AHR A;  1FW4 A;  1XK4 A;  2LAN A;  5CSJ A;  3PSR A;  1KQM B;  3QRX A;  4YRU A;  3DVE A;  3JTD C;  5HKW A;  2QPT A;  3VRP A;  1KK8 C;  4YI8 A;  4R1E A;  3LCP C;  2Q4U A;  1PSR A;  2QAC A;  1ZFS A;  1YUU A;  4GGF A;  4DCK A;  1S26 D;  2MJW B;  1X02 A;  4NDC A;  3PM8 A;  2BKH B;  3SJS A;  2Y9Y A;  4P5O E;  1K9U A;  1B8L A;  4CFR A;  1GQM A;  2KI6 C;  2HPS A;  1FBV A;  2CTN A;  4GPL B;  1OE9 B;  2LMT A;  2V53 A;  2WCB A;  1Y1U A;  2JC2 A;  3WHU B;  1SL7 A;  1M31 A;  4PHN A;  1KQV A;  2LUC A;  1KQM C;  1BR4 B;  3NXA A;  1A2X A;  2L4H A;  1SPY A;  2BE6 A;  4GBA A;  3BUO B; 
#chains in the Genus database with same CATH topology
 2V4H A;  3CR4 X;  2JTZ A;  1DJI A;  2WMM A;  2E74 B;  1J7P A;  3V4W A;  5B5E H;  2LMV A;  1K73 Q;  1B7T Y;  2PSR A;  1N73 B;  1L0L K;  5B66 E;  1NTM G;  1SQQ E;  2J58 A;  2QEX P;  1Q81 Q;  1NU1 K;  1IQ3 A;  1KB9 E;  3CCU P;  5KLV J;  2WC8 A;  3S0E A;  1CW5 A;  1N0Y A;  4E68 A;  1G1I A;  2C9L Y;  2HQ8 A;  4JD9 A;  3O78 A;  1YJN P;  1GL2 A;  1XK4 C;  1GL2 C;  1SFC C;  3CI9 A;  2WIT A;  3SSU A;  1FZG A;  3VMX A;  2GM4 A;  1DJW A;  3F5H A;  3GMA A;  2A06 G;  1M1J A;  2IBZ G;  2Q91 A;  4PE1 A;  1B7T Z;  3EKJ A;  4R4L A;  4JYC A;  4Y99 B;  1Q80 A;  1X9V A;  2PAS A;  3EFF K;  2OYH B;  2Y0D A;  4WY4 B;  1CMF A;  4GUK A;  1SQX G;  3GW6 A;  4GAO A;  4NDB A;  5KAI E;  3PH0 A;  1Y6W A;  1G2C B;  2Y9Z A;  4C0L A;  1OMD A;  2Q5U A;  1FF1 A;  1N7S D;  1AVO A;  3DXL A;  1FZB A;  4KHX A;  3AE3 C;  2IPP A;  3RK3 E;  1MXL C;  1EG3 A;  3VRQ A;  4C7N A;  1WRL A;  2AEM A;  3L73 E;  1XTC C;  4IL6 E;  1ZLL A;  1KIL E;  3WNX B;  3GHG C;  3BUM B;  5JOL A;  2WND A;  4YI9 A;  1TUJ A;  4XJK B;  2ZKM X;  3OB1 B;  1QIW A;  3P8M C;  1RJV A;  1C07 A;  2I2R E;  3AAJ A;  1T3U A;  1TWO A;  5CHX A;  3WU2 H;  2D8N A;  2YO3 A;  1ZW0 A;  1FDO A;  2PMY A;  3D71 A;  3PAT A;  4IJ7 A;  3CXH H;  4XJK A;  2JUL A;  1TNP A;  2OS8 C;  2WSC J;  1F71 A;  1LTJ B;  2WOR A;  1RQV A;  1GU5 A;  1BE3 E;  4WY4 D;  1XFX O;  1EZV I;  2NPS C;  1CLM A;  1U57 A;  1VL2 A;  2QG4 A;  1K95 A;  3H1I J;  2EC6 C;  1NKN A;  1XFY O;  5HKY A;  1KMI Z;  1MFZ A;  3AEC C;  1OQP A;  1NTZ G;  3IVT A;  3S1K A;  2IBZ E;  2W83 C;  2D2C C;  1S5L X;  2GUV A;  3BFH A;  1KQG B;  2JPT A;  5K89 A;  4JWQ A;  1N86 A;  1SR6 B;  2N1T A;  3WMM 0;  1X0T A;  2Y1N A;  5AER A;  1AJ4 A;  3R4Y A;  5GTI H;  1EJ3 A;  4OGQ B;  5HL1 A;  5ER4 X;  3AE6 C;  2M49 B;  3SG5 A;  4IOI H;  3CGA A;  1KOR A;  1QVI Z;  3HTK A;  4MVF A;  4F0Z B;  3R1O A;  2KI6 D;  2MRD A;  3CX5 E;  3FIA A;  2QRX A;  1JNM A;  1EXR A;  3L71 E;  1G4Y R;  4WBA A;  3KPX A;  4BRY A;  3CCS P;  2IBZ D;  1F55 A;  3L71 J;  1OW6 A;  1LT9 B;  1NWQ A;  3VTP C;  1MQ1 A;  1N7S C;  1OVV A;  4U8D A;  2B89 A;  3CX5 D;  2WTY A;  3B7A A;  1VDF A;  1BJF A;  1W7I B;  2WCH A;  4W80 A;  2MLE C;  3GK4 X;  1TNQ A;  1Y1A A;  2HFE D;  2K60 A;  2K9Y A;  2MHH A;  1IK9 A;  5AAN A;  4YGA A;  2LR2 A;  3M0D C;  4ETO A;  1XTG B;  4PD4 D;  4H44 D;  3DYE A;  4WRI A;  2BAP A;  2N9B A;  3L37 A;  1SQV D;  1GW3 A;  3RLZ A;  3H1J J;  2L50 A;  1DH3 A;  1RE3 A;  3RGU A;  2OYO A;  1HF9 A;  2CBL A;  1CI6 A;  1VF5 D;  2XNX A;  3H1L G;  2FXO A;  3L74 D;  3VRR A;  4Y99 C;  1PUL A;  1S6J A;  2KZJ A;  2A4J A;  2YIU B;  5TJH A;  2L2E A;  2ZRS A;  2GUS A;  2M3B A;  4KYN A;  1F70 A;  4ASV A;  1L0N J;  1DF0 A;  5TIS H;  4L75 A;  1DTL A;  3F89 A;  1JSA A;  1SQV E;  3EVR A;  3SG7 A;  4CFQ A;  2L91 A;  2ZXX A;  2H2K A;  5HLO A;  1FZF A;  5EL2 A;  3I5F C;  1GZL A;  2BCC J;  2ZRT A;  3CAB A;  1YR5 A;  2FKW B;  3H1I E;  5AW1 B;  1HJB A;  1W2E A;  3G9R A;  3NSL A;  4GOF A;  3H6P A;  1KQS O;  4H13 D;  2K37 A;  2M7L A;  3DF0 B;  3EVV A;  3CCL P;  1NPQ A;  1YRT B;  3KXD A;  2WSC H;  3B8E B;  1AUI B;  1IC2 A;  3G4S P;  1BF5 A;  2O5G A;  2QJP C;  2KUB A;  3BQ3 A;  3RK2 D;  1TRF A;  4ICB A;  3CX5 I;  5APS A;  1J55 A;  5HKZ A;  1XA5 A;  1NHL A;  1HTL C;  3N7N A;  1LT9 A;  1SMG A;  2M8U A;  2KPH A;  3HRN A;  2ZN8 A;  4XYN A;  1SQB G;  2BL0 C;  1GGW A;  3BXK A;  1R5L A;  4IL6 X;  1B4C A;  3Q2Y A;  2H89 C;  2YKO A;  5AVZ B;  1HH0 A;  3SG3 A;  2OTJ P;  3GHG B;  3JSV C;  2WSF J;  3S9O A;  2UWJ E;  2MAZ A;  3OP0 A;  2VRS A;  3A5T A;  2KNC B;  1Y1X A;  3B5N D;  3Q5P A;  1RFJ A;  5GTH H;  2KAV A;  4DT0 A;  2VRG A;  1GM0 A;  4WWI A;  5HLV A;  1H0T B;  2L98 A;  1RQU A;  2K88 A;  2LMU A;  2O01 H;  2P1J A;  1ZME C;  4YGB B;  5E79 E;  3TDU A;  4WVZ A;  1OOH A;  4W7Z A;  1KB9 I;  2C0W A;  3CL3 D;  3QH9 A;  3PN7 B;  1X22 A;  1FI5 A;  2XND H;  1IFI A;  1J1D B;  2FBW C;  1DT7 B;  1JBA A;  1Q7Y Q;  2WT7 B;  3B6X A;  4AQI A;  2G2B A;  2ZFC A;  2A06 E;  3I5I B;  3TDZ A;  5AVY B;  1A29 A;  2K7O A;  4N1G A;  2N1T C;  3L75 J;  1KSO A;  1NTK D;  2O01 N;  5KLI C;  3AKB A;  2JDI H;  2B1U A;  1SW8 A;  1WLM A;  2JPO A;  1SFC A;  1T3J A;  3L75 E;  3LID A;  1LTJ A;  2E30 A;  3BUN B;  5H2F H;  3AEG C;  3KPE A;  1URQ A;  2L51 A;  4I5K A;  4HRH A;  1NTK J;  1K9K A;  1QV1 A;  1PPJ D;  2CNP A;  3USS A;  1WDC B;  5CSN A;  1BOD A;  1JM0 A;  5AVT B;  1FJK A;  5AVU B;  5APX A;  2I7A A;  3H1L E;  2RN0 A;  2KDH A;  3P32 A;  1AFO A;  1ZP0 C;  3A3Y B;  3AE8 C;  1BMO A;  1JY3 P;  2L5G B;  2W27 A;  1U7M A;  1FU1 A;  2KXP B;  1B8R A;  1A03 A;  3IQQ A;  1YUR A;  2WZ7 A;  1UHH A;  2OS8 B;  1L2P A;  3LK1 A;  1KFX L;  2QVA A;  3L70 J;  1WRZ A;  5L8R J;  1LWU B;  1DD4 A;  1KIL C;  2FXM A;  3I56 P;  2O01 J;  3KQG A;  3U1C A;  1Q90 D;  3NHT A;  3H1J G;  5AVV B;  3IQO A;  3L72 G;  1YIJ P;  1NTK E;  2HLO A;  5KLI B;  2LNK A;  1REC A;  3HCM A;  3L47 A;  4WQ3 A;  3D10 A;  1N2D A;  2F2P A;  4MRX A;  3I5I C;  3LLE A;  3ZDM A;  4DIR A;  3H1L J;  1BSH A;  4PV1 D;  3TDI A;  4I7Z B;  3KZI H;  1KB9 H;  3VMY A;  1MR8 A;  4TLF A;  5AVR B;  1NYH A;  2HOD B;  1W7J B;  1KZU B;  3H1L D;  2IYP A;  2EC6 B;  1S1C X;  3V2Q A;  1BU3 A;  1YI2 P;  4XA4 A;  3TGU G;  1OW7 A;  1NH4 A;  2WVR A;  2FXP A;  4H0L B;  3RZS A;  1CSB A;  3GHG A;  1KQM B;  2W6B A;  1PP9 D;  2YMK A;  3DVE A;  3VRP A;  2IX7 C;  1VQO P;  1L4A C;  1KYO E;  4DCK A;  4NDC A;  1IFM A;  1LTI C;  1B8L A;  1FBV A;  2HPS A;  4GPL B;  1OE9 B;  2WCB A;  1BCC E;  5AW5 B;  5TIS E;  1NJI Q;  1A2X A;  4YPC A;  1JF0 A;  2ERB A;  2KS1 B;  4U3F G;  2KOG A;  1C7W A;  1URQ C;  3H1K G;  5AW9 B;  1M46 A;  2DW3 A;  3KF9 A;  2B87 B;  3OB2 B;  1HGZ A;  3OJA B;  2LVJ A;  3AEF C;  3WUU A;  2XZR A;  5GQQ C;  3H4S E;  4I5N B;  1DGU A;  2PRU A;  1GJY A;  2QJY C;  4C0J A;  4JF7 A;  4ASW A;  1FZE A;  1R2U A;  2OYH C;  4D6T J;  1LTA C;  2LP3 A;  1JY2 N;  5JJG A;  1LTJ C;  2E42 A;  1UUS A;  1UWO A;  1FZC A;  1KIL B;  1KC8 Q;  1L0N E;  2WWW A;  3S0F A;  4N78 D;  1QVI Y;  2QEB A;  5AEQ A;  1LA3 A;  3FWC A;  1IO4 A;  3VMZ A;  2IZ0 A;  4OR9 B;  5KLV K;  1RTP 1;  3L73 G;  5CPV A;  1MWN A;  4MSP A;  1J7Q A;  3PHL A;  4C7R A;  1JMM A;  5FI2 A;  2JU0 A;  4U3F J;  2M0B A;  3DY9 A;  2KIK A;  2RH0 A;  1S36 A;  1OMR A;  2QEO A;  1DEB A;  1LWU C;  2I1J A;  1FI6 A;  1CDP A;  3Q3D A;  3H1H E;  1P28 A;  3PFV A;  3N7H A;  3SFD C;  3PLN A;  2ITA A;  2NZ0 A;  2KYF A;  4PJ0 E;  3CPW O;  2LLS A;  3N4X A;  2ZYD A;  3VGO A;  1SFC B;  3CCQ P;  1WRG A;  1PPJ G;  1W9Z A;  2LVI A;  4QJ3 B;  4QJ5 B;  3CX5 H;  1OMV A;  5AW3 B;  2K2A A;  2AXT H;  2IDB A;  2WC6 A;  2F33 A;  1LT9 C;  1S5G Z;  2B87 A;  2YMY A;  1EZV D;  5FI7 A;  1PZQ A;  1DD3 A;  1UHJ A;  3CCR P;  4FQT A;  3I5H C;  2FYU J;  5CCH A;  1F8H A;  3A0H H;  2L5Y A;  1KN7 A;  1SQB E;  5APQ A;  4IFD K;  4DS7 A;  1FZA A;  3EFG A;  1USD A;  1BG1 A;  1NU1 G;  2XKM A;  1ZUZ A;  5AW4 B;  2M7N A;  2KSE A;  1YTZ I;  2P67 A;  3HD7 B;  2FYU D;  1J7R A;  2WPR A;  2F3Z A;  1FE6 A;  1L0L D;  1S5L E;  2WPS A;  1RH5 B;  1OVR A;  2BAS A;  1BOC A;  4A4C A;  5DKQ A;  2E74 D;  3CWB G;  1N73 C;  5HYD A;  1MFT A;  1GW4 A;  4QMA A;  1NU1 D;  1YQ4 C;  1S6C A;  3MUD C;  5DJT B;  2IFM A;  1S3P A;  1KWO C;  4AQR D;  2AMI A;  2TN4 A;  1H89 A;  3D6Z A;  2KYC A;  3EKH A;  2E6W A;  5I8N A;  2LV7 A;  1QGK B;  2A45 I;  2KYV A;  2O3J A;  2LLU A;  2KK7 A;  2P7J A;  2CK3 H;  2W6A A;  1YVL A;  3JVT C;  4DOJ A;  4INW A;  3PLF B;  1VQ9 P;  1TIZ A;  3H1K E;  2GV5 A;  1X8Y A;  4RJT A;  1G2C A;  1N65 A;  2KLD A;  4JKT A;  4PE0 A;  1PGP A;  1E79 H;  3V5B A;  2MLF C;  5AW7 B;  4MN4 C;  1K96 A;  2OTG B;  3PJS K;  1DX7 A;  2D2C B;  1KFX S;  3H1K D;  1K04 A;  2JKV A;  1AJ5 A;  3SG2 A;  1L4A D;  1YVH A;  2KNE A;  4IFF A;  3UO9 A;  2H43 A;  4YGE B;  2H88 C;  1SS1 A;  4C7N B;  3O4Y A;  2CPS A;  3BOW A;  1JY2 P;  1TNX A;  4UPG A;  1CTR A;  1CNP A;  1KV4 A;  2FCD A;  3D0Y A;  1DF0 B;  2NPS A;  1QL2 A;  4CPG A;  1KWO B;  3E3R A;  4CLN A;  1S6I A;  4HH2 A;  1VQ5 P;  4Y28 J;  3MHV A;  1NAF A;  4PD4 H;  1OZO A;  1PK0 D;  5KLV D;  1SQQ J;  4PHM A;  1TU3 F;  1A75 A;  1CM4 A;  3MIW A;  3WUV A;  3H1I G;  1V1F A;  3L72 E;  3L74 J;  3CD6 P;  3GOF A;  4BRY B;  3W67 A;  2K0J A;  2NPS B;  5KTY A;  1T6A A;  3T97 B;  3I5G B;  1PGJ A;  2PYQ A;  3S0B A;  3HD7 A;  2QIW A;  3FS7 A;  2Z5H A;  3TF5 A;  2Q3E A;  3D70 A;  3AEA C;  3H1J D;  2BBN A;  2M3E A;  3HUS B;  1NTM K;  1OOF A;  1NX0 A;  2HOD A;  3NHI A;  2Y4Q A;  1MZ9 A;  1L7Z A;  4MLW A;  3A0H E;  3PN7 C;  5KLV E;  3NSI A;  1DEL A;  1A02 F;  3B5N C;  1GK4 A;  2BNX A;  1ZOT B;  2ZFD A;  3OX6 A;  4ORB B;  5KJ7 D;  2WPQ A;  3HTK B;  2YKP A;  1P84 E;  3DZT A;  3BRT B;  4K35 A;  2K9J A;  2QE7 H;  2MJZ A;  1WY9 A;  3VRN A;  1UP5 A;  1RE3 C;  1Q82 Q;  4IL6 H;  3CTN A;  3JVT B;  3ABV C;  1DEE G;  1IK7 A;  1DVI A;  1UHN A;  2FYU K;  1SP4 A;  1NIW A;  1HJ0 A;  1YYC A;  1KK7 Z;  2KGB C;  4PT1 A;  2PFX A;  1AP4 A;  3AE5 C;  4D1E A;  1SQV G;  2L0P A;  1VQ8 P;  1EG4 A;  2AEF A;  2HPC B;  2KAY A;  2N1T D;  3CLN A;  1QV0 A;  4MRY A;  1EDJ A;  3FE6 A;  4Z1M H;  1LT1 A;  3PJI A;  3MSE B;  3SIB A;  1VQK P;  2BKI B;  3CZ0 A;  1D7M A;  2FYN C;  4RES B;  1KSM A;  4NPD A;  3BYA A;  3D74 A;  2E76 C;  3VN0 A;  3A0B H;  5APT A;  1R8E A;  1SQV J;  1ZXG A;  1M1K Q;  5DIC A;  3D0Y B;  3AEE C;  4BXL A;  3CME P;  1CFD A;  2M9G A;  1NCZ A;  2JNX A;  2JOJ A;  1ZAC A;  3D75 A;  1H8A A;  1YQ3 C;  3PAL A;  2FFD C;  3HD7 C;  5AW8 B;  2WCK A;  2P2U A;  4EDF A;  2JQ6 A;  2E5Y A;  2I8D A;  4ZKU A;  1JY3 O;  1NTZ K;  1S2E A;  2R5D A;  4HYT B;  3VP8 A;  1GGZ A;  4HB1 A;  4KJM A;  1BGY G;  4I5J A;  5DKN A;  1PSB A;  1Y47 A;  5KAF E;  2WOS A;  1NAY A;  1H0T A;  1PGO A;  2QJK B;  1OX3 A;  3T97 A;  2WSS H;  2F8P A;  4JPZ B;  1CDM A;  1EQ7 A;  1Y0V H;  2R32 A;  2QM7 A;  3RK2 C;  3BJH A;  2IFN A;  3RBZ A;  2KS1 A;  4YXD C;  4AOM A;  3EK7 A;  1TCF A;  2EHB A;  2P71 A;  1DIP A;  1YUT A;  3V6I A;  1URQ D;  3RL0 D;  3A4U B;  1RF1 B;  2E76 B;  4D6T E;  2R44 A;  4EYY Q;  1MUU A;  3BVH A;  2JXC A;  2V7Q J;  2WT7 A;  3CWB D;  3EK4 A;  2FCE A;  3SIA A;  4PV1 B;  1SQX E;  2Z5I A;  1WMK A;  3DD4 A;  2HG5 D;  2ZYG A;  1NVO A;  1AJY A;  2QJP B;  2QEH A;  1WT6 A;  1KQL A;  1DGV A;  1ALV A;  5F6T A;  2W8Z A;  1AHR A;  1FW4 A;  3TSI A;  1XK4 A;  5CSJ A;  3PSR A;  1S9K D;  3B88 A;  2P10 A;  5CCG D;  1RE4 A;  3JTD C;  5HKW A;  2V7Q H;  3RL0 g;  3LCP C;  4GGF A;  1C3Z A;  1S26 D;  2Y9Y A;  1R5S A;  3PM8 A;  4P5O E;  1HWT C;  1K9U A;  2KI6 C;  3D77 A;  2CTN A;  2LMT A;  2JC2 A;  2E75 C;  2LUC A;  3NXA A;  1N8R Q;  2BE6 A;  3BUO B;  3MD0 A;  5D3O A;  3D6Y A;  2QDI A;  2BBM A;  2MKV A;  3TNU A;  2OQQ A;  1NP8 A;  1LIN A;  1EL4 A;  5J3X A;  4MZL A;  3RL0 C;  4GGN A;  1Z2C B;  4HRE E;  4DZO A;  2KOT A;  3MZW B;  1WDC C;  4F7F A;  4L74 A;  2JT3 A;  5KKZ B;  1LXF C;  1K90 D;  2IS9 A;  5CCH C;  2LP2 A;  1SQQ K;  2ZT9 C;  1ZMZ A;  2POH A;  4MEW A;  1G33 A;  2QSI A;  3VMA A;  1MKM A;  2O1J A;  3CR2 A;  1PIX A;  2WSE H;  3QME A;  2LVK A;  4BWN A;  1DJH A;  4N6J A;  1URQ B;  4USL A;  4M2Q A;  1RRO A;  1JWD A;  1SQP J;  3SWF A;  4UB8 E;  5CCH D;  3NSO A;  2MA2 A;  1EZV E;  5KJ7 C;  1KIL D;  3CZ2 A;  3FWN A;  3IAO A;  2FJU B;  1XO5 A;  1CLL A;  3OX5 A;  3BUW B;  2BEQ D;  2OTK E;  1EDI A;  4XFJ A;  2LHL A;  2ZVO B;  3TYY A;  1SCM B;  2B9B A;  1BDC A;  5KTB A;  1OSA A;  3GG2 A;  2WCF A;  1T2K C;  3JCU H;  3CWB E;  1E8A A;  2LC5 A;  3M9Q A;  1B47 A;  2KFH A;  3CR5 X;  1HQV A;  5K5G B;  1OWA A;  3L70 D;  1DMO A;  2RKL A;  1ZR2 A;  3KZI E;  2G8Y A;  3NSK A;  2JRF A;  2H8P D;  3DF0 A;  3CCE P;  1NOH A;  2BCC G;  1FZC C;  1VPC A;  2J5U A;  1AA0 A;  1T2K D;  3FE9 A;  3AE4 C;  2KI4 C;  4YBH B;  4ZCU A;  2ZT9 D;  1PAL A;  3LW5 H;  2XDJ A;  1VQ6 P;  1NTZ D;  3SFE C;  2H7H A;  2JT0 A;  4I5L B;  2LVV A;  2K9J B;  3O8Z A;  2KGR A;  5GTI E;  3BUX B;  3TDK A;  4A4B A;  1BSN A;  1QX8 A;  1KFU L;  1SYM A;  1KYO H;  5E79 H;  3UIA A;  4L73 A;  2KNC A;  1ZR4 A;  2FJY A;  1LGH B;  1M90 Q;  3K21 A;  2QEV A;  5AFP A;  3IFM A;  5G08 A;  3V2P A;  2JXL A;  3CDN A;  3KDP B;  4H0L D;  1N73 A;  3BRV B;  2WSF H;  1YHQ P;  2KHN A;  1GL2 D;  4BY4 A;  4DJG A;  3OW2 O;  1YJW P;  1RF1 A;  1M1J B;  4DUQ A;  1D1O A;  4WQ2 A;  3QWO C;  3M9H A;  2I94 A;  1A02 J;  1NTM J;  1FAV A;  3HUS A;  3L74 G;  1BLQ A;  1AVY A;  5H2F E;  1QLS A;  3SG4 A;  2E76 D;  1SQP D;  1QXP A;  2HPC A;  1VQ7 P;  1VRK A;  1PP9 J;  3S0G A;  1H4B A;  1JCD A;  2KLE A;  3C8V A;  5APV A;  2K7B A;  3H25 A;  3BCC J;  5BPJ A;  4YTP C;  2OTG C;  5CSF A;  2M97 A;  1CFC A;  2DOQ A;  3AE7 C;  3NGV A;  1RE4 C;  3D78 A;  3EQ2 A;  2PVB A;  1IKU A;  2FYU G;  1F4Q A;  1NYA A;  2M3W A;  1BE3 J;  1DC1 A;  1L0N G;  1M45 A;  2G3A A;  1DJY A;  1CB1 A;  3K5B A;  1N7S A;  1E5W A;  1LVC D;  2K7C A;  1BGY J;  1EDK A;  3VB1 A;  2KSP A;  2JJL A;  4I1L A;  1UHI A;  2PRR A;  2JP3 A;  4P2Y B;  1OMI A;  3D76 A;  2FOT A;  2M1K B;  1AQT A;  1SK6 D;  3AKA A;  2L4I A;  3EG5 B;  3L73 D;  3L4A A;  1YBK A;  3B86 A;  5AW2 B;  1P84 H;  1UIX A;  2CT9 A;  1KFM A;  4ZKP A;  3KYQ A;  2H8V A;  1EZV G;  3L72 J;  1SL8 A;  2PQL A;  3B71 A;  2Q6Q A;  3Q1M A;  4I6M C;  1LNQ A;  1SQQ G;  3ICB A;  1C3Y A;  1KB9 D;  3F45 A;  1RF0 C;  1IRJ A;  4U7J A;  1PVB A;  1FJP A;  2R3C A;  1LJ2 A;  1SKT A;  3RK3 D;  3V4Q A;  3TK1 A;  3E1I A;  3L75 D;  4CID A;  1A75 B;  1QLK A;  1BDD A;  1USE A;  1TN4 A;  2Z4E A;  4MBE A;  4PHK A;  4HRG A;  1G1J A;  2BCB A;  3A0B E;  2M5A A;  5CCG A;  2CCM A;  2WC5 A;  3IN6 A;  1WRK A;  3R1P A;  1FOS E;  3E7K A;  4PV1 C;  1ZRT E;  1M39 A;  1SQX J;  1JTH A;  5KU1 A;  1M8O B;  1S5L H;  1SCV A;  1AQ5 A;  1IWQ A;  1RY3 A;  1DJX A;  1SY9 A;  1M1J C;  1PPJ E;  1JY2 O;  1QJT A;  1ZRT D;  3P8C E;  2QM8 A;  1EXJ A;  3AAK A;  1EC5 A;  3D73 A;  5KAF H;  4ZCV A;  2KB7 P;  3LL8 B;  3HX4 A;  3H1K J;  2NLN A;  1IFD A;  1L4A A;  2R5B A;  4QJ4 B;  1JEK A;  5D7F A;  1RF0 A;  3WU2 E;  4L76 A;  1L0L J;  2QA4 P;  3UNW A;  2KLU A;  3CWG A;  1SBJ A;  1CKK A;  1JY3 N;  2QJY B;  2BE4 A;  3H32 A;  4H13 B;  3L71 D;  4YGD B;  1S72 P;  1CI6 B;  1K05 A;  4OV2 A;  2PAJ A;  2W6J H;  3HD7 D;  3R2P A;  1PV3 A;  4ORC B;  4IL1 A;  1S5G Y;  1LP1 A;  1TUZ A;  1K93 D;  1J1D A;  2M1U A;  4FQO A;  1OOI X;  2BEC A;  1VQ4 P;  2KI4 B;  1IJ5 A;  1XYD A;  2KFG A;  4WY4 C;  1NTM E;  3B5N A;  1CFP A;  1FZC B;  3HE4 A;  3B4S A;  3G71 P;  4NDD A;  4N78 E;  2Q7C A;  4PHJ A;  2NCP A;  4GOD A;  1QX2 A;  4PJ0 H;  5D69 A;  3TS5 B;  2ISD A;  1TNW A;  1JFJ A;  1IFP A;  3C1V A;  2YXQ B;  5GTH E;  3DVK A;  2FFD B;  3CC4 P;  2E5T A;  5CBO A;  1XFW O;  3GF3 A;  2F2O A;  2COL B;  4H13 C;  1YTZ C;  5I94 A;  2JZI A;  2HQW A;  4RO0 A;  1SQB D;  3G6E P;  2OAR A;  4PE7 A;  2LHI A;  2EGD A;  4MN0 A;  1IGV A;  2RGI A;  3S0D A;  2LLT A;  1UII A;  1JC2 A;  2JTT A;  1QX5 B;  2K2F A;  1KFN A;  1KIL A;  2SCP A;  1H88 A;  2JNF A;  2K61 A;  5TNC A;  1JO5 A;  2E74 C;  1GL2 B;  1KFU S;  2LM5 A;  1TTX A;  1Y8A A;  2KFF A;  5KLV G;  3OA7 A;  1SCM C;  1BT6 A;  4K3A A;  2YIU C;  1ZOY C;  3CZT X;  4HKZ H;  2FYZ A;  2LE9 B;  3O6B A;  1VF5 C;  2HF5 A;  1JCC A;  2P6B B;  2SPZ A;  5PAL A;  1IIO A;  1SNL A;  1VQN P;  3DVJ A;  2PP6 A;  3FWL A;  1B1G A;  1BCC J;  1CM1 A;  1VQL P;  1U7J A;  2SAS A;  2ZXE B;  1GD2 E;  4PD4 I;  2P70 A;  1DJZ A;  2E43 A;  4JQ0 D;  3NMD A;  5BVZ A;  2C9N Y;  1QIV A;  1U5I A;  3TGU J;  1QVF O;  1L2O C;  4A7P A;  4OCI A;  3JTD B;  1MXE A;  3ZNI A;  1IFN A;  3JCU E;  1ZN5 A;  1MUX A;  2J59 M;  4UB6 E;  1NO4 A;  2BCC D;  1KD1 Q;  2PGD A;  1NTZ E;  2JR8 A;  4M2P A;  2N9Y B;  1L0L E;  4CPV A;  1NCX A;  3PP5 A;  3JC2 2;  3CC7 P;  4W7Y A;  3H1I D;  3L73 J;  4UB6 H;  3CXH D;  5BU5 A;  3QRX A;  3FE8 A;  4YRU A;  1KQF B;  3G3Z A;  3GF7 A;  1T8Z A;  2A45 G;  3MUD A;  5CBN A;  3TGU E;  4U3F D;  4YI8 A;  4R1E A;  2WPV B;  1ZFS A;  1YUU A;  2BKH B;  2BCC E;  4CFR A;  4EI2 A;  3O6Q A;  3L70 E;  5KAI H;  1Y1U A;  3E1R A;  1SL7 A;  4PHN A;  4R4M A;  1KQV A;  1KQM C;  1BR4 B;  2L4H A;  1P84 I;  4NQG A;  5FI6 A;  1YJ9 P;  1F54 A;  1BGY E;  1YX7 A;  1JOC A;  4RKU J;  4ORA B;  3CCM P;  1HGV A;  1PP9 E;  1GMJ A;  4OKH A;  2KLV A;  5DKR A;  1PVA A;  1OIP A;  1J1D C;  4PE4 A;  1FBM A;  4IFM A;  3TGU D;  3U59 A;  4I2L C;  3A2A A;  2E75 B;  3HE4 B;  5ER5 A;  3M06 A;  2Y5I A;  3IF7 A;  3ITK A;  2BL0 B;  4INX A;  1SQQ D;  2C0X A;  1MV8 A;  2O1K A;  3RK3 B;  2YO2 A;  4NPF X;  1G8I A;  5CJ4 A;  1KK8 B;  2B88 A;  2IBZ I;  3OBV A;  1S4X A;  3GLM A;  2FYU E;  3BFB A;  3CWB J;  1J2J B;  3PTZ A;  1K2H A;  3WHT B;  3S0A A;  1JFK A;  1MHO A;  2WCM A;  2HR3 A;  2YKQ A;  3MGN A;  1AVS A;  2ZND A;  1SSE B;  4N5X A;  1Q2N A;  3L72 D;  5I2L A;  5I2O A;  1RK9 A;  3CCV P;  1PFI A;  1IH0 A;  1SRA A;  3Q5R A;  1WLZ A;  1JUN A;  4WY4 A;  4GNK B;  3O4X A;  4YGC B;  2KZI A;  1CFF A;  1XVJ A;  2KBI A;  2A06 D;  4C46 A;  3L35 A;  1FDM A;  1R6P A;  3C9I A;  3BCC E;  1OXZ A;  3RL0 B;  3TUY B;  4MZK A;  3P8C D;  1QWV A;  1SVF A;  2LAP A;  2GTE A;  1FPW A;  1GTW A;  5AVS B;  1EH2 A;  4JYB A;  5I2Q A;  2AXT E;  3AE2 C;  5EFW B;  5APW A;  3NXS A;  1M57 D;  5DJU B;  3M0D A;  4U3F E;  2BEZ F;  2WQY C;  2H61 A;  4NPE A;  2KP8 A;  1PP9 G;  1Z4H A;  4UB8 H;  2KBM A;  3BFA A;  1NTK G;  4AQJ A;  1PGQ A;  3EWK A;  2ZNE A;  3H1J E;  2M5A B;  3KHE A;  1SQP G;  3S4R A;  1NUB A;  1LTG C;  1OZS A;  1OW8 A;  2JT8 A;  2JWA A;  3FXE A;  1ORG A;  1BGY D;  2CXJ A;  3M9B A;  5CSI A;  1QX7 A;  1HT9 A;  2OPO A;  3AEB C;  2BCX A;  1SQB K;  1BCC D;  1Z56 A;  2KSJ A;  1NX2 A;  1VQM P;  5CJ0 A;  1V1G A;  4PDZ A;  4OH8 B;  2BCA A;  3VRO A;  1DEK A;  5APU A;  4OWF A;  4MZJ A;  2WSE J;  3OGN A;  1Y9B A;  3V2R A;  3BOW B;  1CMG A;  3R1V A;  2K1A A;  1W5C E;  2HYN A;  2GA1 A;  4O9B A;  3AED C;  3OHM B;  1SQX K;  4N3Y B;  1B9A A;  4M2O A;  1SL9 A;  1TCO B;  1HUC A;  3I5H B;  4N1F A;  1L0N D;  2N1T B;  4ZNC A;  3SS3 A;  1IZN B;  3GK2 A;  2Q3I A;  1K94 A;  2PAL A;  1PL5 A;  1JTH B;  4OZD A;  2ZAE B;  1J1E B;  2FY8 A;  4DRW A;  2ZYA A;  4YXW H;  3TNU B;  5AW0 B;  1HBW A;  3SS4 A;  1OVU A;  2ZT9 B;  2LUX A;  1SQB J;  3EVU A;  4C0K A;  2IZ1 A;  3AE1 C;  1YUS A;  3L36 A;  1GU4 A;  2LCP A;  1SR6 C;  4LGD E;  1KYO D;  1K8U A;  1IFJ A;  3RBX A;  3C1L A;  3IR9 A;  1BE3 G;  1S1E A;  1QLE D;  3MP7 B;  1IJD B;  3TZ1 A;  3W68 A;  3A7O A;  1SQV K;  2RMZ A;  2FFD A;  2Y0E A;  3I55 P;  4AUW A;  2P58 A;  1KK7 Y;  2FYN B;  3FX0 A;  1J7O A;  3M0A A;  1CLB A;  2JWW A;  1NCY A;  1M7L A;  1ALW A;  2F3Y A;  2M0R A;  1KCY A;  3TS5 C;  2NZ2 A;  3RK3 C;  1YX8 A;  2I18 A;  3SWK A;  4PD4 E;  1JMB A;  4GDO A;  3SWY A;  3VOP A;  4TNC A;  1SQP K;  1NU1 J;  2L5X B;  1NTK K;  5M1B A;  3I5F B;  1K9M Q;  3RM1 A;  3FWB A;  4OGQ D;  2JWD A;  2R2I A;  1OFC X;  1QVG O;  5AXI A;  1IG5 A;  1YTZ T;  4HSZ A;  2NPS D;  3CMA P;  1OOJ A;  2XU6 A;  2OYI B;  1XFU O;  4D6T D;  2Y1M A;  3O6Q B;  5CCG C;  4H0L C;  4XE5 B;  2IYO A;  2QJK C;  3SS5 A;  1A4P A;  3U1A A;  1J1E A;  2OYI A;  1VQP P;  3HUS C;  3CYZ A;  3R72 A;  1L4A B;  1KTM A;  1FS0 E;  3MTU E;  3M0W A;  3LK0 A;  2I1K A;  1XFZ O;  4D6T G;  2D2C D;  1NU1 E;  5IBW A;  1NX3 A;  2AAO A;  2GGZ A;  4OVN F;  3H1H D;  3CCJ P;  3L70 G;  1B8C A;  1SQX D;  1HVV A;  2KI7 B;  2ZVN B;  1IQ5 A;  5CMZ A;  1YIT P;  1Q86 Q;  2K3R A;  2LKM A;  2KQ6 A;  1BR1 B;  3CZ1 A;  1K8A Q;  3B87 A;  4I7Z C;  1QTX A;  1LA0 A;  5B8I B;  5KKZ C;  1QAT A;  2Q9I A;  1UUR A;  4Q04 A;  1DQE A;  4L9M A;  1F4O A;  1LTT C;  3H1H J;  2AUC A;  5B66 H;  2LXB A;  1NWD A;  2WCJ A;  1LS8 A;  1CDN A;  1U5I B;  4GOE A;  2LXC B;  3L74 E;  1L2O B;  1AK8 A;  1TOP A;  1N2D C;  3M91 A;  5AVQ B;  1NGM B;  1NSH A;  3WUT A;  1BE3 D;  1RHZ B;  5KSZ A;  1S3J A;  2ZN9 A;  1M63 B;  3EK8 A;  1NTM D;  2A45 H;  4PCW A;  2ZJS E;  4FTG A;  3B5N B;  3P7K A;  3DVM A;  1GK6 A;  3V2N A;  3K1E A;  2K7D A;  1S9K E;  1FC2 C;  1LKJ A;  1MF8 B;  1EDL A;  2YNY A;  5AW6 B;  1PRW A;  3AE9 C;  1L0N K;  3L71 G;  5APY A;  5BU8 B;  2O60 A;  1FDI A;  4JBZ A;  4GIF A;  5KJ7 A;  1VF5 B;  1P84 D;  2KAX A;  3GK1 A;  4M3L A;  1X79 B;  3CC2 P;  5AVX B;  4GT1 A;  5AVW B;  1YRU B;  4KT0 J;  2MBX A;  2JEE A;  2OYI C;  4GGF C;  1NTZ J;  1RWY A;  3KEV A;  2OYH A;  4GKG A;  1JUO A;  3CLQ A;  1JB0 J;  3NTN A;  2KQY A;  1SFC D;  2E75 D;  4H44 B;  2GGM A;  3KO0 A;  1N7L A;  2YXR B;  3LIE A;  1NKZ B;  1QS7 A;  3TUY C;  1EXI A;  4PAL A;  3BAS A;  1XFV O;  3CXH I;  4LC1 A;  2XV5 A;  3CXH E;  1KYO I;  3A8R A;  3BCC G;  2CPB A;  2K8M B;  2OTL P;  3Q5S A;  3OAK A;  2YGU A;  2NXQ A;  3L75 G;  3NFQ A;  2Y0C A;  3RK2 B;  1SLQ A;  2W90 A;  1BCC G;  1RF1 C;  4OGQ C;  2JO1 A;  3SG6 A;  1QL1 A;  2H61 C;  1OOG A;  4BY5 A;  3WXA A;  4B86 A;  1M56 D;  1XFR A;  1LP1 B;  1J1E C;  1ZV8 A;  1C7V A;  1GDT A;  3CS1 A;  4ZMD A;  5FYX A;  3V2L A;  4GFT A;  2WCL A;  2Q1K A;  3HE5 B;  1QAS A;  4WB4 A;  1H8B A;  1NX1 A;  1DJG A;  2HET A;  1CDL A;  3BAT A;  3L4L A;  3O2P A;  3H32 B;  3BCC D;  2AEJ A;  3I5G C;  5C39 A;  2G9B A;  4EOT A;  4H44 C;  3FXD A;  2NCO A;  2M29 A;  1ODB A;  1JF2 A;  1K9P A;  1N7S B;  1L0L G;  1LTB C;  1CZQ A;  4HJG H;  3II6 A;  1FOS F;  2AXC A;  2WCE A;  3ZWH A;  3PM2 A;  1LWU A;  3PRJ A;  1OZH A;  4TT3 H;  1W2B O;  1UHK A;  3Q8I A;  3IF4 A;  3LW5 J;  1IJ6 A;  4EIJ A;  2LAN A;  2NRG A;  3KHU A;  2R3S A;  3VP9 A;  3I5C A;  1SQP E;  3FGA D;  2QPT A;  2M8R A;  1KK8 C;  2Q4U A;  1PSR A;  2QAC A;  1T14 A;  2MJW B;  1X02 A;  5B5E E;  1LTS C;  3SJS A;  1GQM A;  1QEX A;  3L4F A;  3H1H G;  2V53 A;  1AV1 A;  3WHU B;  1M31 A;  4AYC A;  3HE5 A;  4LLH A;  2OGU A;  2L2C A;  1SPY A;  4GBA A;  1OW4 A;  3VYI A; 
#chains in the Genus database with same CATH homology
 1JF0 A;  3CR4 X;  2JTZ A;  1DJI A;  4NQG A;  1F54 A;  2BBM A;  1J7P A;  1C7W A;  1YX7 A;  2LMV A;  1B7T Y;  1NP8 A;  1LIN A;  1EL4 A;  1M46 A;  2PSR A;  4MZL A;  4GGN A;  4HRE E;  4ORA B;  3KF9 A;  5J3X A;  2KOT A;  3OB2 B;  1WDC C;  2LVJ A;  2JT3 A;  4OKH A;  5DKR A;  1PVA A;  1LXF C;  1K90 D;  2IS9 A;  3H4S E;  1DGU A;  4I5N B;  5GQQ C;  2LP2 A;  4PE4 A;  2PRU A;  1IQ3 A;  1GJY A;  1ZMZ A;  5ER5 A;  4C0J A;  2WC8 A;  4MEW A;  1R2U A;  1G33 A;  2Y5I A;  3IF7 A;  2BL0 B;  1N0Y A;  4E68 A;  3CR2 A;  2HQ8 A;  2LP3 A;  2LVK A;  1G8I A;  1DJH A;  5JJG A;  3O78 A;  1KK8 B;  1UUS A;  1UWO A;  1XK4 C;  1RRO A;  4M2Q A;  4USL A;  1JWD A;  1DJW A;  3NSO A;  2MA2 A;  1K2H A;  3WHT B;  1JFK A;  1MHO A;  2FJU B;  1XO5 A;  2Q91 A;  1CLL A;  4PE1 A;  3OX5 A;  1B7T Z;  3BUW B;  3EKJ A;  1AVS A;  1Q80 A;  1QVI Y;  2ZND A;  5AEQ A;  1LA3 A;  3FWC A;  4N5X A;  5I2L A;  2PAS A;  5I2O A;  2LHL A;  1CMF A;  1RK9 A;  4GUK A;  4OR9 B;  4GAO A;  1IH0 A;  1SCM B;  1SRA A;  1RTP 1;  1WLZ A;  4NDB A;  5CPV A;  4GNK B;  1OSA A;  1MWN A;  4MSP A;  1J7Q A;  4YGC B;  1Y6W A;  2WCF A;  1CFF A;  1E8A A;  1XVJ A;  2KBI A;  2LC5 A;  1B47 A;  2Y9Z A;  2KFH A;  3CR5 X;  1OMD A;  4C0L A;  1HQV A;  1FF1 A;  1R6P A;  2JU0 A;  1DMO A;  1MXL C;  1EG3 A;  3TUY B;  3VRQ A;  4MZK A;  1WRL A;  1S36 A;  1OMR A;  3NSK A;  2JRF A;  1FI6 A;  3DF0 A;  1CDP A;  2LAP A;  3WNX B;  3BUM B;  1FPW A;  5JOL A;  2WND A;  3PFV A;  4YI9 A;  4XJK B;  2ZKM X;  3OB1 B;  1QIW A;  2KI4 C;  2NZ0 A;  2KYF A;  1EH2 A;  4YBH B;  5I2Q A;  1RJV A;  4ZCU A;  2I2R E;  2LLS A;  1C07 A;  1PAL A;  3AAJ A;  2D8N A;  2PMY A;  3PAT A;  2JT0 A;  4I5L B;  3VGO A;  4XJK A;  2JUL A;  2LVV A;  2H61 A;  2KGR A;  3BUX B;  1TNP A;  4A4B A;  2OS8 C;  1KFU L;  1SYM A;  2LVI A;  4QJ3 B;  1F71 A;  4QJ5 B;  2KBM A;  2WOR A;  1OMV A;  4AQJ A;  2K2A A;  2ZNE A;  3KHE A;  1XFX O;  3K21 A;  2F33 A;  1CLM A;  1NUB A;  1OZS A;  1S5G Z;  5G08 A;  5AFP A;  1K95 A;  2JXL A;  2JT8 A;  2EC6 C;  4OCI A;  2CXJ A;  1UHJ A;  5CSI A;  1QX7 A;  2KHN A;  1HT9 A;  4BY4 A;  1XFY O;  5HKY A;  2OPO A;  2BCX A;  3I5H C;  4DUQ A;  1F8H A;  1OQP A;  1D1O A;  4WQ2 A;  1NX2 A;  2I94 A;  4DS7 A;  1V1G A;  1BLQ A;  4PDZ A;  2BCA A;  3VRO A;  1BG1 A;  1QLS A;  4MZJ A;  1ZUZ A;  3SG4 A;  3BOW B;  2JPT A;  1CMG A;  2M7N A;  1QXP A;  5K89 A;  1VRK A;  4JWQ A;  1H4B A;  1J7R A;  3OHM B;  2F3Z A;  1SR6 B;  1B9A A;  4M2O A;  2Y1N A;  1SL9 A;  2K7B A;  1TCO B;  5AER A;  3I5H B;  4N1F A;  1BOC A;  1AJ4 A;  5DKQ A;  4A4C A;  5BPJ A;  1EJ3 A;  5HYD A;  2OTG C;  5CSF A;  5ER4 X;  2M49 B;  2M97 A;  3SG5 A;  1CFC A;  3GK2 A;  2DOQ A;  3CGA A;  1K94 A;  2PAL A;  1QVI Z;  1S6C A;  1S3P A;  4MVF A;  1KWO C;  4F0Z B;  2AMI A;  2PVB A;  2TN4 A;  4DRW A;  1IKU A;  2KI6 D;  2MRD A;  3FIA A;  2KYC A;  1EXR A;  1F4Q A;  1G4Y R;  2E6W A;  3EKH A;  5I8N A;  3KPX A;  2LV7 A;  1NYA A;  2M3W A;  2LLU A;  1F55 A;  1M45 A;  1YVL A;  3JVT C;  3PLF B;  1TIZ A;  1DJY A;  1CB1 A;  1MQ1 A;  2LUX A;  2GV5 A;  3EVU A;  4C0K A;  4U8D A;  1LVC D;  1YUS A;  2K7C A;  1N65 A;  2LCP A;  1SR6 C;  4PE0 A;  1BJF A;  1W7I B;  2KSP A;  1UHI A;  1K8U A;  2MLF C;  4P2Y B;  2MLE C;  3GK4 X;  1K96 A;  1TNQ A;  1Y1A A;  1S1E A;  2OTG B;  2FOT A;  2M1K B;  3TZ1 A;  1KFX S;  2MHH A;  5AAN A;  1AJ5 A;  4YGA A;  3SG2 A;  4ETO A;  1SK6 D;  3AKA A;  2L4I A;  1KK7 Y;  1YVH A;  2KNE A;  4WRI A;  1J7O A;  1CLB A;  2CT9 A;  2JWW A;  1NCY A;  3RLZ A;  2L50 A;  1ALW A;  2F3Y A;  4YGE B;  2M0R A;  1KCY A;  3TS5 C;  1SL8 A;  1YX8 A;  3O4Y A;  2I18 A;  2CBL A;  3BOW A;  3ICB A;  1TNX A;  3F45 A;  4UPG A;  1CTR A;  1CNP A;  4TNC A;  1IRJ A;  2FCD A;  2L5X B;  3D0Y A;  1DF0 B;  3VRR A;  3I5F B;  1PUL A;  1S6J A;  3FWB A;  2A4J A;  1KWO B;  3RM1 A;  1PVB A;  2R2I A;  3E3R A;  1OFC X;  4CLN A;  1S6I A;  5AXI A;  1IG5 A;  2L2E A;  1SKT A;  4HSZ A;  2ZRS A;  1OOJ A;  1OZO A;  1PK0 D;  4CID A;  1A75 B;  1QLK A;  1F70 A;  1DF0 A;  1XFU O;  2Y1M A;  1TN4 A;  4PHM A;  1DTL A;  4MBE A;  1A75 A;  4PHK A;  1CM4 A;  4HRG A;  2BCB A;  1JSA A;  1A4P A;  2CCM A;  1J1E A;  3EVR A;  3SG7 A;  4CFQ A;  1WRK A;  1V1F A;  2H2K A;  5HLO A;  3GOF A;  2K0J A;  3I5F C;  1M39 A;  3M0W A;  2ZRT A;  3LK0 A;  1XFZ O;  1YR5 A;  5KTY A;  3I5G B;  3NSL A;  5KU1 A;  5IBW A;  1NX3 A;  2AAO A;  3FS7 A;  2GGZ A;  1SCV A;  4OVN F;  1IWQ A;  2M7L A;  3DF0 B;  1B8C A;  2BBN A;  1DJX A;  1SY9 A;  3EVV A;  1QJT A;  1IQ5 A;  1NPQ A;  1YRT B;  3AAK A;  4ZCV A;  1AUI B;  1NX0 A;  3LL8 B;  2KQ6 A;  1BR1 B;  3HX4 A;  2NLN A;  1BF5 A;  2O5G A;  2Y4Q A;  1QTX A;  1LA0 A;  1L7Z A;  5B8I B;  4QJ4 B;  1QAT A;  4MLW A;  3BQ3 A;  5D7F A;  1TRF A;  4ICB A;  3PN7 C;  1J55 A;  5HKZ A;  1UUR A;  4Q04 A;  1XA5 A;  3NSI A;  4L9M A;  1F4O A;  2AUC A;  3CWG A;  1SBJ A;  1CKK A;  2BE4 A;  1SMG A;  2M8U A;  1NWD A;  1ZOT B;  2ZFD A;  2ZN8 A;  1CDN A;  4YGD B;  3OX6 A;  4XYN A;  1U5I B;  2BL0 C;  4ORB B;  1GGW A;  3BXK A;  1L2O B;  1AK8 A;  1TOP A;  1NSH A;  4OV2 A;  1B4C A;  5KSZ A;  2ZN9 A;  1M63 B;  3EK8 A;  3SG3 A;  1WY9 A;  4PCW A;  4ORC B;  4IL1 A;  1S5G Y;  2MAZ A;  3OP0 A;  3VRN A;  1UP5 A;  1Y1X A;  1K93 D;  1J1D A;  2M1U A;  4FQO A;  4FTG A;  1RFJ A;  2BEC A;  2KI4 B;  1IJ5 A;  1XYD A;  2KAV A;  2KFG A;  2VRG A;  3DVM A;  3CTN A;  3JVT B;  5HLV A;  2K7D A;  1CFP A;  1DVI A;  2L98 A;  1LKJ A;  1UHN A;  4NDD A;  1MF8 B;  4PHJ A;  2NCP A;  1QX2 A;  1NIW A;  2LMU A;  5D69 A;  1KK7 Z;  1PRW A;  2KGB C;  2ISD A;  3TS5 B;  1TNW A;  1JFJ A;  1AP4 A;  4D1E A;  3C1V A;  2O60 A;  2L0P A;  4YGB B;  1EG4 A;  3TDU A;  2KAY A;  3DVK A;  3CLN A;  1QV0 A;  4MRY A;  3PN7 B;  2KAX A;  1XFW O;  3GK1 A;  2F2O A;  1FI5 A;  2COL B;  1YRU B;  1YTZ C;  3MSE B;  2JZI A;  2HQW A;  2MBX A;  1DT7 B;  1JBA A;  3SIB A;  4GGF C;  4PE7 A;  1RWY A;  2BKI B;  2LHI A;  3KEV A;  1JUO A;  4AQI A;  2EGD A;  1KSM A;  2KQY A;  2G2B A;  4MN0 A;  1IGV A;  2RGI A;  3BYA A;  3I5I B;  2LLT A;  3TDZ A;  1JC2 A;  1A29 A;  2JTT A;  2K7O A;  1QX5 B;  4N1G A;  2GGM A;  2K2F A;  1KSO A;  3KO0 A;  2SCP A;  3D0Y B;  3AKB A;  2B1U A;  1SW8 A;  1WLM A;  1CFD A;  1QS7 A;  2JNF A;  2M9G A;  2K61 A;  1NCZ A;  5TNC A;  3TUY C;  2E30 A;  2JNX A;  3BUN B;  4PAL A;  2JOJ A;  1XFV O;  1ZAC A;  1KFU S;  3PAL A;  2L51 A;  2LM5 A;  1TTX A;  4I5K A;  4HRH A;  3A8R A;  1K9K A;  1QV1 A;  2K8M B;  2CNP A;  2KFF A;  1WDC B;  5CSN A;  1BOD A;  2NXQ A;  1SCM C;  2JQ6 A;  1BT6 A;  2I7A A;  3CZT X;  2KDH A;  3SG6 A;  2H61 C;  4BY5 A;  3WXA A;  2LE9 B;  1BMO A;  3O6B A;  1GGZ A;  4I5J A;  5DKN A;  1PSB A;  2WOS A;  2HF5 A;  1B8R A;  1A03 A;  3IQQ A;  1YUR A;  1UHH A;  2OS8 B;  1C7V A;  3LK1 A;  2P6B B;  1KFX L;  5PAL A;  3CS1 A;  1SNL A;  1WRZ A;  3DVJ A;  5FYX A;  2F8P A;  4GFT A;  4JPZ B;  1B1G A;  1CDM A;  1CM1 A;  2SAS A;  1QAS A;  1Y0V H;  1H8B A;  1NX1 A;  1DJG A;  2HET A;  1CDL A;  1DJZ A;  4JQ0 D;  3O2P A;  3IQO A;  4AOM A;  3EK7 A;  1TCF A;  2EHB A;  1YUT A;  3I5G C;  2LNK A;  1REC A;  1QIV A;  1U5I A;  2G9B A;  3HCM A;  4WQ3 A;  3D10 A;  1L2O C;  1N2D A;  2NCO A;  2F2P A;  3A4U B;  3JTD B;  1MXE A;  1ODB A;  2M29 A;  3I5I C;  3LLE A;  4MRX A;  1JF2 A;  1K9P A;  3ZNI A;  2JXC A;  4DIR A;  1MUX A;  3TDI A;  2WCE A;  3ZWH A;  3EK4 A;  2FCE A;  3SIA A;  3DD4 A;  1MR8 A;  1W7J B;  4M2P A;  1UHK A;  4CPV A;  1NCX A;  1DGV A;  2EC6 B;  1BU3 A;  1ALV A;  5F6T A;  1IJ6 A;  1AHR A;  1FW4 A;  1XK4 A;  2LAN A;  5CSJ A;  3PSR A;  1KQM B;  3QRX A;  4YRU A;  3DVE A;  3JTD C;  5HKW A;  2QPT A;  3VRP A;  1KK8 C;  4YI8 A;  4R1E A;  3LCP C;  2Q4U A;  1PSR A;  2QAC A;  1ZFS A;  1YUU A;  4GGF A;  4DCK A;  1S26 D;  2MJW B;  1X02 A;  4NDC A;  3PM8 A;  2BKH B;  3SJS A;  2Y9Y A;  4P5O E;  1K9U A;  1B8L A;  4CFR A;  1GQM A;  2KI6 C;  2HPS A;  1FBV A;  2CTN A;  4GPL B;  1OE9 B;  2LMT A;  2V53 A;  2WCB A;  1Y1U A;  2JC2 A;  3WHU B;  1SL7 A;  1M31 A;  4PHN A;  1KQV A;  2LUC A;  1KQM C;  1BR4 B;  3NXA A;  1A2X A;  2L4H A;  1SPY A;  2BE6 A;  4GBA A;  3BUO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...