1IQ3A

Solution structure of the eps15 homology domain of a human pob1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
110
structure length
110
Chain Sequence
GSLQDNSSYPDEPWRITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAAFHLIVARKNGYPLPEGLPPTLQPEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RALBP1-INTERACTING PROTEIN (PARTNER OF RALBP1)
publication title Solution structure of the Eps15 homology domain of a human POB1 (partner of RalBP1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 13
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2001-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1iq3A00
2O60A 3HCMA 1PSBA 4HRHA 4PDZA 1UHNA 1OZOA 3EVRA 3JTDC 3I5FB 3PALA 2NCOA 3FIAA 1CKKA 2OPOA 1TN4A 5FYXA 1BOCA 2K7DA 1KFUL 1JBAA 1MUXA 1SBJA 4OV2A 2KBIA 4A4BA 4FTGA 1KFUS 1XFYO 1C7VA 1YX8A 4UPGA 5IBWA 3AAKA 1NPQA 1BMOA 2IS9A 2KGRA 3CGAA 2F33A 2SCPA 3PN7C 1IWQA 1GJYA 1RROA 1Y1AA 4HREE 1B1GA 1EG3A 1CFDA 3SG5A 2F2OA 4D1EA 3DD4A 1UURA 4Q04A 3AAJA 2EGDA 5PALA 2LAPA 4PHNA 4PALA 3FS7A 1B8CA 1F70A 2FJUB 5AANA 4MZLA 3O4YA 2ZKMX 1AP4A 2K2FA 1JFJA 2KGBC 4NQGA 1SKTA 1AUIB 1K8UA 1WLZA 2ZNDA 4YI8A 1FPWA 1VRKA 2KFFA 3JVTB 3PSRA 1IKUA 1TOPA 1K9UA 4U8DA 1BU3A 2KAYA 5ER4X 1KK7Y 1XA5A 1F71A 5AFPA 2I7AA 2CCMA 5KU1A 1IJ6A 1DJYA 3BUXB 3I5GC 3FWBA 5AXIA 4MN0A 1MHOA 1ZOTB 4N5XA 2H61A 4MVFA 2LV7A 2BE4A 1PK0D 1CLLA 3CR4X 3AKAA 2L5XB 1M46A 1TNXA 2LVJA 3LLEA 2M29A 4C0JA 3TDUA 1KFXL 2JRFA 4USLA 4MEWA 1OOJA 1KFXS 2KAXA 4PE7A 2JXCA 4XJKA 1NCXA 3VRPA 3WNXB 4DRWA 1DT7B 1NX1A 3D0YB 3ICBA 4N1FA 1TCFA 3SG2A 4YI9A 1TNQA 2AUCA 2BL0B 2EC6B 1S6CA 2NZ0A 4CLNA 1OMVA 1SRAA 2HQ8A 1CMFA 4DS7A 2K61A 3EKHA 4HSZA 2Y1NA 1CTRA 2KI4C 1L7ZA 5AEQA 2JNFA 1WDCB 3BYAA 3BOWA 1J1DA 4GAOA 2GV5A 4ZCUA 2HF5A 3BUOB 4C0KA 1XFXO 2JT3A 5CSFA 1NWDA 2AMIA 3LK1A 4R1EA 1NP8A 3KHEA 4CPVA 5D69A 1TNWA 1YX7A 4OR9B 1SNLA 2HPSA 1B8LA 3BQ3A 3DVJA 2LMVA 1SL9A 2E6WA 2JU0A 1WY9A 2MLEC 3PFVA 5KSZA 2H61C 2ZN9A 3I5HC 2KAVA 2BCXA 1K9PA 1BT6A 3FWCA 1V1FA 4C0LA 2I2RE 2MRDA 1CLBA 3VROA 2LM5A 1U5IA 2OS8C 1TIZA 4DUQA 2OTGC 3O78A 1CMGA 2JULA 3ZNIA 5TNCA 1OZSA 1YTZC 1RTP1 1TNPA 4DIRA 1H4BA 2GGMA 1X02A 2KOTA 5CSJA 1SCVA 2M49B 1QX5B 1SR6B 2M8UA 3PM8A 2WCBA 5HKZA 2M1KB 1QASA 1OE9B 1A4PA 1FI6A 2NXQA 5I2LA 1J7PA 1LKJA 1YUUA 3CTNA 1SYMA 2JT8A 2M3WA 1FW4A 2M7LA 1QS7A 3I5IC 3SJSA 1NIWA 2D8NA 2QPTA 1CDNA 4JQ0D 4PCWA 1AHRA 1BR4B 2JWWA 1ZMZA 2BE6A 2CT9A 1DMOA 5I2OA 1KQVA 2LMUA 2M0RA 1RFJA 1DJGA 2MAZA 2L0PA 2LANA 2ZNEA 5CSNA 5G08A 4F0ZB 1BG1A 4MRXA 4ETOA 3TDZA 3OP0A 3QRXA 1C7WA 1F8HA 1A75B 4L9MA 1CFCA 1EXRA 3TS5B 2JXLA 1NX2A 1YR5A 2BKIB 4PE4A 2L98A 4OCIA 1QATA 3DVKA 3IQOA 1QX7A 1N65A 2LUCA 3KF9A 1DJHA 2KBMA 2KI6C 1NCZA 2F3ZA 3MSEB 1KCYA 4PE1A 2ZRTA 1OMDA 1J1EA 4WQ3A 1B7TZ 2LC5A 3CR2A 1DGUA 2K8MB 3ZWHA 1CFPA 1SCMB 5I8NA 1KQMB 1BLQA 2BBMA 1BF5A 2B1UA 1K95A 1K93D 4YGBB 2MHHA 3NSKA 4WRIA 5KTYA 1QVIZ 4NDCA 3NSIA 1SMGA 1B7TY 3IF7A 1NYAA 5D7FA 1J7RA 2ZFDA 1OQPA 1IH0A 1DVIA 3D0YA 2G2BA 1IQ5A 1PULA 2COLB 2LP2A 1F4OA 4MBEA 3TUYC 1G4YR 3KEVA 5CSIA 4YGAA 2E30A 3HX4A 1G8IA 2BBNA 2KI6D 4ORCB 4GUKA 3CLNA 1KWOB 2MBXA 1YURA 1A29A 1ZACA 3TZ1A 4A4CA 4I5NB 3EK7A 2PMYA 2VRGA 1S36A 2KQ6A 1QIWA 1C07A 3JVTC 1QIVA 1YRTB 3E3RA 2KFGA 1TTXA 3CWGA 2LVVA 2V53A 3F45A 4AQIA 3OB2B 3SIBA 4MZJA 3GOFA 1CNPA 5JOLA 1M45A 1TRFA 3CS1A 1MWNA 1LXFC 2JPTA 2P6BB 2G9BA 1SL7A 1JUOA 1CB1A 1KK8B 3GK1A 1N2DA 1B47A 1UWOA 4JWQA 4N1GA 2L51A 1Y1UA 2LLSA 4IL1A 1S5GZ 1V1GA 4BY4A 1N0YA 1WLMA 2KI4B 2MJWB 3EK4A 1UHHA 1RECA 1QTXA 4YRUA 1DTLA 1NCYA 1S3PA 4JPZB 1GGZA 4ORBB 4I5LB 1WRKA 2BCAA 1S5GY 2BL0C 1L2OB 2EC6C 5ER5A 4GBAA 2DOQA 1CDMA 1A2XA 3CR5X 1QV0A 1J7OA 5F6TA 3KO0A 3DF0B 1BJFA 2LVIA 1MXEA 1PRWA 4YGEB 1WDCC 2QACA 2K2AA 5HKWA 2Q91A 2MA2A 1E8AA 2ISDA 1XVJA 5HLVA 4GGNA 4GGFA 1RK9A 1SPYA 3EKJA 2RGIA 4WQ2A 1YVLA 3NSOA 2OTGB 1YUTA 3SG6A 2GGZA 1A75A 5B8IB 1YRUB 2NLNA 1WRZA 1B4CA 3GK2A 2KYCA 1DJZA 1AVSA 1LA3A 1QLSA 2Q4UA 1W7IB 2JTZA 3CZTX 1HQVA 4QJ3B 5CPVA 2PRUA 5HYDA 3AKBA 1OSAA 1K96A 4P5OE 1IGVA 2ZRSA 1EH2A 1JF2A 2M9GA 1JWDA 1Y0VH 2L2EA 1Q80A 1M31A 1Y1XA 5BPJA 1SR6C 1D1OA 3TDIA 2KDHA 2KQYA 2M7NA 2I94A 3JTDB 1MF8B 1F54A 4NDBA 4XYNA 2HQWA 2K7BA 1IG5A 2K0JA 2F2PA 3OX5A 4FQOA 4MSPA 3K21A 2A4JA 2JTTA 4E68A 2BKHB 3LK0A 2PASA 1A03A 3OHMB 1XFVO 1K9KA 2KFHA 3PN7B 1DF0B 4YGCB 4GGFC 5J3XA 4CIDA 1U5IB 3I5FC 1K94A 1S26D 1DJXA 2CBLA 2JOJA 2KNEA 1K90D 2PSRA 1WRLA 3A8RA 1XK4A 2LNKA 3O2PA 1HT9A 2WNDA 3TS5C 1ALWA 4TNCA 1JF0A 4ICBA 1H8BA 3GK4X 4ZCVA 2AAOA 3NXAA 4YBHB 4MLWA 2Y4QA 1J55A 2LE9B 1W7JB 2BECA 1S6IA 2JNXA 2JT0A 3VRQA 1MXLC 1NUBA 4GPLB 1ZFSA 2HETA 1MQ1A 1QX2A 2K7CA 3EVVA 3WXAA 4DCKA 1FBVA 1IQ3A 1QVIY 1QJTA 2MLFC 3TUYB 3BUNB 3PATA 3VRRA 1SCMC 1KQMC 1GGWA 1NSHA 1M63B 3O6BA 3H4SE 3I5GB 4AQJA 1B9AA 2CNPA 2Y1MA 2M1UA 1TCOB 1KK7Z 2JZIA 4OVNF 1M39A 4PHJA 1LVCD 2L50A 1XFWO 4CFRA 1AJ5A 2F8PA 5I2QA 1CM1A 2LCPA 4BY5A 1MR8A 1XYDA 3LCPC 3WHTB 1RJVA 1IRJA 1CDPA 1IJ5A 2O5GA 3EVUA 1AJ4A 2WCFA 3DF0A 1KWOC 1UHKA 3SG3A 2I18A 1QV1A 2WORA 1NX3A 1XK4C 1DJIA 1FF1A 1EL4A 2L4HA 3DVMA 2WOSA 1SL8A 1SY9A 1YUSA 1PVAA 2F3YA 4AOMA 2JC2A 2LUXA 1LA0A 1DGVA 1NX0A 2LHLA 5DKQA 1CM4A 1R2UA 3OX6A 2R2IA 2KYFA 1XFUO 4PHKA 4MZKA 1JSAA 3IQQA 1KK8C 4ORAB 1SK6D 2Y5IA 4MRYA 2PVBA 2JQ6A 2WCEA 1SW8A 5AERA 1FI5A 1YVHA 3NSLA 1RWYA 1G33A 3PLFB 4M2QA 2CXJA 2LLUA 3DVEA 3D10A 4NDDA 1PALA 4M2OA 1KSOA 5K89A 4I5JA 3I5HB 2LVKA 2PALA 3WHUB 1CFFA 2TN4A 3M0WA 4GFTA 1QXPA 4YGDB 3A4UB 1B8RA 2FCEA 4GNKB 5JJGA 4M2PA 1L2OC 2OS8B 3OB1B 1ZUZA 2EHBA 1S1EA 3SG7A 4HRGA 4QJ5B 2SASA 4XJKB 1KSMA 1ODBA 1S6JA 1GQMA 2NCPA 1R6PA 3BXKA 1OMRA 1DJWA 4OKHA 1BODA 1EJ3A 4QJ4B 2LMTA 2L4IA 3VRNA 1Y6WA 2H2KA 2BCBA 2WC8A 3C1VA 1J7QA 1DF0A 1UP5A 1EG4A 5DKNA 1CDLA 1UUSA 3BOWB 4P2YB 1F4QA 1PVBA 2K7OA 3I5IB 4CFQA 2M97A 2LP3A 4PHMA 4PE0A 1JC2A 3SIAA 1AK8A 2KHNA 5HKYA 1QLKA 1XO5A 2KSPA 3LL8B 5HLOA 1CLMA 1LINA 5DKRA 3RLZA 3BUMB 2FOTA 1K2HA 3KPXA 1UHIA 2LHIA 3RM1A 1XFZO 2CTNA 1JFKA 3EK8A 3VGOA 5GQQC 4I5KA 2LLTA 1UHJA 2ZN8A 1PSRA 3BUWB 2FCDA 1F55A 1BR1B 3SG4A 1ALVA
chains in the Genus database with same CATH superfamily
2O60A 3HCMA 1PSBA 4HRHA 4PDZA 1UHNA 1OZOA 2BNXA 3EVRA 3JTDC 3I5FB 3PALA 4IJ7A 3SS4A 2NCOA 3FIAA 1CKKA 2OPOA 1TN4A 5FYXA 1BOCA 2K7DA 1KFUL 1JBAA 1MUXA 1SBJA 4OV2A 2KBIA 4A4BA 4FTGA 1KFUS 1XFYO 1C7VA 1YX8A 4UPGA 5IBWA 3AAKA 1NPQA 1BMOA 2IS9A 2KGRA 3CGAA 2F33A 2SCPA 3PN7C 1IWQA 1GJYA 1RROA 1Y1AA 3K1EA 4HREE 1B1GA 1EG3A 1CFDA 3SG5A 2F2OA 4D1EA 3DD4A 2KLDA 1UURA 4Q04A 3AAJA 2EGDA 4KYNA 5PALA 2LAPA 4PHNA 4PALA 4F7FA 3FS7A 1B8CA 1F70A 5EL2A 2FJUB 5AANA 2WCJA 4MZLA 3O4YA 2ZKMX 1AP4A 2K2FA 1JFJA 2KGBC 4NQGA 1SKTA 1AUIB 1K8UA 1WLZA 2ZNDA 4YI8A 1FPWA 1VRKA 2KFFA 3JVTB 3PSRA 2WC5A 1IKUA 1TOPA 3B87A 1K9UA 4U8DA 1BU3A 2KAYA 5ER4X 1KK7Y 3CZ0A 1XA5A 1F71A 5AFPA 2I7AA 2CCMA 5KU1A 1IJ6A 3DY9A 3D75A 1DJYA 3BUXB 3I5GC 3FWBA 5FI7A 5AXIA 4MN0A 1MHOA 1ZOTB 3RZSA 4N5XA 2H61A 2QEHA 4MVFA 2LV7A 2BE4A 1PK0D 1CLLA 3CR4X 3AKAA 2L5XB 1M46A 1TNXA 2JPOA 2LVJA 3LLEA 2M29A 2QEOA 2WCLA 4C0JA 3TDUA 1KFXL 2JRFA 3DYEA 4USLA 1XFRA 4MEWA 1OOJA 2H8VA 1KFXS 2KAXA 4PE7A 2JXCA 4XJKA 1NCXA 3VRPA 3WNXB 4DRWA 1DT7B 1NX1A 3D0YB 3ICBA 4N1FA 1TCFA 3SG2A 4YI9A 1TNQA 2AUCA 2BL0B 2EC6B 1S6CA 2QEBA 3B6XA 2NZ0A 3CZ2A 4CLNA 1OMVA 1SRAA 2HQ8A 3D76A 3DXLA 4DS7A 1CMFA 2K61A 3EG5B 3EKHA 4HSZA 2Y1NA 1CTRA 2KI4C 1L7ZA 5AEQA 2JNFA 1WDCB 3BYAA 3BOWA 1J1DA 4GAOA 1OOIX 2GV5A 4ZCUA 2HF5A 3BUOB 1DELA 4C0KA 1XFXO 2JT3A 5CSFA 1NWDA 2AMIA 3LK1A 4R1EA 1NP8A 3V2LA 3KHEA 4CPVA 5D69A 1TNWA 1YX7A 4OR9B 1SNLA 2HPSA 3L4LA 1B8LA 3BQ3A 3DVJA 2LMVA 1SL9A 2E6WA 3D74A 2JU0A 1WY9A 2MLEC 3PFVA 5KSZA 2H61C 2ZN9A 2L5YA 2KAVA 3I5HC 2BCXA 1K9PA 5FI2A 1BT6A 1P28A 3FWCA 1V1FA 4C0LA 2I2RE 2MRDA 4OZDA 3VROA 1CLBA 2LM5A 1U5IA 2OS8C 1SSEB 1TIZA 4DUQA 2OTGC 3O78A 1CMGA 2JULA 3ZNIA 5TNCA 1OZSA 1YTZC 1RTP1 1TNPA 4DIRA 1H4BA 1T14A 2GGMA 1X02A 2KOTA 5CSJA 1SCVA 2M49B 1QX5B 1SR6B 2M8UA 3PM8A 1DC1A 2WCBA 5HKZA 2M1KB 1QASA 2WC6A 1OE9B 1A4PA 1FI6A 2NXQA 1TUJA 5I2LA 1LKJA 1YUUA 3CTNA 1J7PA 1SYMA 2GTEA 2JT8A 2M3WA 1FW4A 2M7LA 1QS7A 3I5IC 3SJSA 1NIWA 2D8NA 2QEVA 1OOHA 2QPTA 4JQ0D 1CDNA 4PCWA 1AHRA 1BR4B 2JWWA 1ZMZA 5I94A 2BE6A 2CT9A 1DMOA 5I2OA 1KQVA 2LMUA 2M0RA 1RFJA 1DJGA 2MAZA 2L0PA 2LANA 2ZNEA 5CSNA 5G08A 4F0ZB 1BG1A 4MRXA 4ETOA 3TDZA 3FE9A 3OP0A 3QRXA 1C7WA 1F8HA 1A75B 4L9MA 1CFCA 1EXRA 3TS5B 2JXLA 1NX2A 1YR5A 2BKIB 3SS3A 4PE4A 2L98A 2P71A 3S0AA 4OCIA 1QATA 3DVKA 3IQOA 1QX7A 4JD9A 1N65A 2LUCA 3KF9A 1DJHA 2KBMA 2KI6C 2ERBA 1NCZA 2F3ZA 3MSEB 1KCYA 4PE1A 2ZRTA 1OMDA 1J1EA 4WQ3A 1B7TZ 2LC5A 3CR2A 1DGUA 2K8MB 3FE8A 3ZWHA 1IIOA 3BJHA 4JKTA 1CFPA 1SCMB 5I8NA 1KQMB 1BLQA 3PM2A 2BBMA 1BF5A 2B1UA 1K95A 1K93D 4YGBB 2MHHA 3NSKA 4WRIA 3VB1A 1ORGA 5KTYA 1QVIZ 4NDCA 3NSIA 1SMGA 1B7TY 3IF7A 1NYAA 5D7FA 1J7RA 2ZFDA 1OQPA 1DQEA 1IH0A 1DVIA 4PT1A 3D0YA 2G2BA 1IQ5A 1PULA 2COLB 2LP2A 1F4OA 4MBEA 3TUYC 1G4YR 3KEVA 5CSIA 4YGAA 2E30A 3HX4A 1G8IA 2BBNA 2KI6D 4ORCB 4GUKA 3CLNA 1KWOB 2MBXA 1YURA 1A29A 1ZACA 2KPHA 3TZ1A 4I5NB 4A4CA 3EK7A 2PMYA 2VRGA 1S36A 2KQ6A 1QIWA 3D78A 1C07A 3JVTC 1QIVA 1LS8A 1YRTB 3FE6A 3E3RA 2KFGA 1TTXA 3CWGA 2LVVA 2V53A 3F45A 4AQIA 2L2CA 3OB2B 3SIBA 4MZJA 3GOFA 1CNPA 5JOLA 1M45A 1TRFA 3CS1A 1MWNA 1LXFC 2JPTA 2P6BB 2G9BA 1SL7A 1JUOA 1CB1A 1KK8B 3GK1A 1N2DA 1B47A 1UWOA 4JWQA 4N1GA 2L51A 1Y1UA 2LLSA 4IL1A 1S5GZ 1Z2CB 1V1GA 2QDIA 1N0YA 4BY4A 5D3OA 1WLMA 2KI4B 2MJWB 3EK4A 1UHHA 1RECA 1QTXA 4YRUA 1DTLA 1NCYA 1S3PA 4JPZB 1GGZA 3R1VA 4ORBB 2PQLA 4I5LB 1WRKA 2BCAA 1S5GY 2BL0C 1L2OB 2EC6C 3NHIA 5ER5A 4GBAA 2DOQA 1OOGA 1CDMA 1A2XA 1Z4HA 3CR5X 1QV0A 1J7OA 5F6TA 3KO0A 3DF0B 1BJFA 2LVIA 1MXEA 1PRWA 4YGEB 1WDCC 2PYQA 2QACA 2K2AA 5HKWA 2Q91A 2MA2A 1E8AA 2ISDA 1TWOA 1XVJA 4GGNA 5HLVA 4GGFA 1RK9A 1SPYA 3L4AA 3EKJA 3NHTA 2RGIA 3QMEA 4WQ2A 1YVLA 3BFBA 3NSOA 2OTGB 1YUTA 3SG6A 2GGZA 1A75A 3OBVA 5B8IB 1YRUB 1TUZA 1WRZA 2NLNA 3CZ1A 1B4CA 3GK2A 2KYCA 3NGVA 1DJZA 1AVSA 1LA3A 1QLSA 2Q4UA 4FQTA 1W9ZA 1W7IB 2JTZA 3CZTX 1HQVA 4QJ3B 5CPVA 2PRUA 5HYDA 3AKBA 1OSAA 1K96A 4P5OE 1IGVA 2ZRSA 1EH2A 1JF2A 2M9GA 1JWDA 1Y0VH 2L2EA 1Q80A 3L47A 1M31A 3R1OA 1Y1XA 5BPJA 1SR6C 1D1OA 3TDIA 2KDHA 2KQYA 2M7NA 2I94A 3JTDB 1MF8B 1F54A 4NDBA 4XYNA 2HQWA 2K7BA 1IG5A 2K0JA 2F2PA 3OX5A 4FQOA 4MSPA 3K21A 2A4JA 2JTTA 3DZTA 2BKHB 3LK0A 2PASA 4E68A 1A03A 3OHMB 1XFVO 1K9KA 2KFHA 2P70A 3PN7B 1DF0B 4YGCB 4GGFC 5DICA 5J3XA 3R1PA 4CIDA 1U5IB 3I5FC 1K94A 1S26D 1DJXA 2CBLA 2JOJA 4INWA 2KNEA 1K90D 2PSRA 1WRLA 3A8RA 1XK4A 2LNKA 2K60A 3O2PA 1HT9A 2WNDA 3TS5C 1ALWA 4TNCA 1JF0A 3UO9A 4ICBA 1H8BA 3D73A 2WCKA 3GK4X 4ZCVA 2AAOA 2YGUA 3NXAA 4YBHB 4MLWA 2Y4QA 1J55A 2LE9B 1W7JB 2BECA 1OW4A 1S6IA 2JNXA 2JT0A 3VRQA 1MXLC 1NUBA 4GPLB 1ZFSA 2WCHA 2HETA 1MQ1A 1QX2A 2K7CA 3EVVA 3IVTA 3WXAA 4DCKA 1FBVA 1IQ3A 1QVIY 1QJTA 2MLFC 3S0DA 3S0BA 3TUYB 3BUNB 3PATA 3VRRA 1SCMC 1KQMC 1GGWA 1NSHA 1M63B 3O6BA 3H4SE 2KLEA 3I5GB 4AQJA 1B9AA 2CNPA 2Y1MA 2M1UA 1TCOB 1KK7Z 2JZIA 4OVNF 1M39A 4PHJA 1LVCD 2L50A 1XFWO 3BFHA 1AJ5A 3B86A 3BFAA 4INXA 4CFRA 1DEKA 2F8PA 5I2QA 2BAPA 1CM1A 2LCPA 4BY5A 1MR8A 3OGNA 1XYDA 3LCPC 3WHTB 1RJVA 3CYZA 1GM0A 1IRJA 1CDPA 1IJ5A 2O5GA 5HL1A 3EVUA 1AJ4A 2WCFA 3DF0A 3O4XA 1KWOC 1UHKA 3SG3A 2I18A 1QV1A 2WORA 1NX3A 1XK4C 1DJIA 1FF1A 1EL4A 3D77A 2L4HA 3DVMA 2WOSA 1SL8A 1SY9A 1YUSA 1PVAA 2F3YA 4AOMA 2FJYA 2JC2A 2LUXA 1LA0A 3S0GA 1DGVA 1NX0A 2LHLA 5DKQA 1CM4A 3N7HA 1R2UA 3OX6A 2R2IA 2KYFA 1XFUO 4PHKA 4MZKA 1JSAA 3IQQA 1KK8C 4ORAB 1SK6D 2Y5IA 4MRYA 2PVBA 2JQ6A 2WCEA 1SW8A 5AERA 1FI5A 1YVHA 3NSLA 1RWYA 1G33A 3PLFB 4M2QA 2CXJA 2LLUA 3DVEA 1C3ZA 3D10A 4NDDA 1PALA 4M2OA 1KSOA 5K89A 4I5JA 3I5HB 2LVKA 2PALA 3WHUB 1CFFA 2TN4A 3M0WA 4GFTA 1QXPA 3S0FA 3CABA 3Q8IA 3R72A 4YGDB 3A4UB 1B8RA 2FCEA 4GNKB 5JJGA 4M2PA 1L2OC 1OOFA 2OS8B 3OB1B 1ZUZA 3S0EA 2EHBA 1S1EA 3SG7A 4HRGA 4QJ5B 2SASA 4XJKB 1KSMA 1ODBA 1S6JA 1GQMA 2NCPA 1R6PA 3UNWA 3BXKA 1OMRA 1DJWA 1QWVA 4OKHA 3PJIA 3B7AA 3SS5A 1EJ3A 1BODA 4QJ4B 2LMTA 2L4IA 3VRNA 1Y6WA 2H2KA 2BCBA 2WC8A 3C1VA 1J7QA 1DF0A 1UP5A 1EG4A 5DKNA 1CDLA 1UUSA 5FI6A 3BOWB 4P2YB 1F4QA 1PVBA 2K7OA 3I5IB 4CFQA 2M97A 2LP3A 4PHMA 4PE0A 1JC2A 3SIAA 1AK8A 2KHNA 5HKYA 1QLKA 3B88A 1XO5A 2KSPA 3CDNA 3LL8B 5HLOA 1CLMA 1LINA 5DKRA 3RLZA 3BUMB 2FOTA 2WCMA 1K2HA 3KPXA 1UHIA 2LHIA 3RM1A 1XFZO 2CTNA 1C3YA 1JFKA 3EK8A 3VGOA 5GQQC 4I5KA 2LLTA 1UHJA 2ZN8A 1PSRA 3BUWB 2FCDA 1F55A 1BR1B 3SG4A 1ALVA
chains in the Genus database with same CATH topology
2O60A 3HCMA 1PSBA 4HRHA 4PDZA 1UHNA 1OZOA 3EVRA 3JTDC 3I5FB 3PALA 2NCOA 3FIAA 1CKKA 2OPOA 1TN4A 5FYXA 1BOCA 2K7DA 1KFUL 1JBAA 1MUXA 1SBJA 4OV2A 2KBIA 4A4BA 4FTGA 1KFUS 1XFYO 1C7VA 1YX8A 4UPGA 5IBWA 3AAKA 1NPQA 1BMOA 2IS9A 2KGRA 3CGAA 2F33A 2SCPA 3PN7C 1IWQA 1GJYA 1RROA 1Y1AA 4HREE 1B1GA 1EG3A 1CFDA 3SG5A 2F2OA 4D1EA 3DD4A 1UURA 4Q04A 3AAJA 2EGDA 5PALA 2LAPA 4PHNA 4PALA 3FS7A 1B8CA 1F70A 2FJUB 5AANA 4MZLA 3O4YA 2ZKMX 1AP4A 2K2FA 1JFJA 2KGBC 4NQGA 1SKTA 1AUIB 1K8UA 1WLZA 2ZNDA 4YI8A 1FPWA 1VRKA 2KFFA 3JVTB 3PSRA 1IKUA 1TOPA 1K9UA 4U8DA 1BU3A 2KAYA 5ER4X 1KK7Y 1XA5A 1F71A 5AFPA 2I7AA 2CCMA 5KU1A 1IJ6A 1DJYA 3BUXB 3I5GC 3FWBA 5AXIA 4MN0A 1MHOA 1ZOTB 4N5XA 2H61A 4MVFA 2LV7A 2BE4A 1PK0D 1CLLA 3CR4X 3AKAA 2L5XB 1M46A 1TNXA 2LVJA 3LLEA 2M29A 4C0JA 3TDUA 1KFXL 2JRFA 4USLA 4MEWA 1OOJA 1KFXS 2KAXA 4PE7A 2JXCA 4XJKA 1NCXA 3VRPA 3WNXB 4DRWA 1DT7B 1NX1A 3D0YB 3ICBA 4N1FA 1TCFA 3SG2A 4YI9A 1TNQA 2AUCA 2BL0B 2EC6B 1S6CA 2NZ0A 4CLNA 1OMVA 1SRAA 2HQ8A 1CMFA 4DS7A 2K61A 3EKHA 4HSZA 2Y1NA 1CTRA 2KI4C 1L7ZA 5AEQA 2JNFA 1WDCB 3BYAA 3BOWA 1J1DA 4GAOA 2GV5A 4ZCUA 2HF5A 3BUOB 4C0KA 1XFXO 2JT3A 5CSFA 1NWDA 2AMIA 3LK1A 4R1EA 1NP8A 3KHEA 4CPVA 5D69A 1TNWA 1YX7A 4OR9B 1SNLA 2HPSA 1B8LA 3BQ3A 3DVJA 2LMVA 1SL9A 2E6WA 2JU0A 1WY9A 2MLEC 3PFVA 5KSZA 2H61C 2ZN9A 3I5HC 2KAVA 2BCXA 1K9PA 1BT6A 3FWCA 1V1FA 4C0LA 2I2RE 2MRDA 1CLBA 3VROA 2LM5A 1U5IA 2OS8C 1TIZA 4DUQA 2OTGC 3O78A 1CMGA 2JULA 3ZNIA 5TNCA 1OZSA 1YTZC 1RTP1 1TNPA 4DIRA 1H4BA 2GGMA 1X02A 2KOTA 5CSJA 1SCVA 2M49B 1QX5B 1SR6B 2M8UA 3PM8A 2WCBA 5HKZA 2M1KB 1QASA 1OE9B 1A4PA 1FI6A 2NXQA 5I2LA 1J7PA 1LKJA 1YUUA 3CTNA 1SYMA 2JT8A 2M3WA 1FW4A 2M7LA 1QS7A 3I5IC 3SJSA 1NIWA 2D8NA 2QPTA 1CDNA 4JQ0D 4PCWA 1AHRA 1BR4B 2JWWA 1ZMZA 2BE6A 2CT9A 1DMOA 5I2OA 1KQVA 2LMUA 2M0RA 1RFJA 1DJGA 2MAZA 2L0PA 2LANA 2ZNEA 5CSNA 5G08A 4F0ZB 1BG1A 4MRXA 4ETOA 3TDZA 3OP0A 3QRXA 1C7WA 1F8HA 1A75B 4L9MA 1CFCA 1EXRA 3TS5B 2JXLA 1NX2A 1YR5A 2BKIB 4PE4A 2L98A 4OCIA 1QATA 3DVKA 3IQOA 1QX7A 1N65A 2LUCA 3KF9A 1DJHA 2KBMA 2KI6C 1NCZA 2F3ZA 3MSEB 1KCYA 4PE1A 2ZRTA 1OMDA 1J1EA 4WQ3A 1B7TZ 2LC5A 3CR2A 1DGUA 2K8MB 3ZWHA 1CFPA 1SCMB 5I8NA 1KQMB 1BLQA 2BBMA 1BF5A 2B1UA 1K95A 1K93D 4YGBB 2MHHA 3NSKA 4WRIA 5KTYA 1QVIZ 4NDCA 3NSIA 1SMGA 1B7TY 3IF7A 1NYAA 5D7FA 1J7RA 2ZFDA 1OQPA 1IH0A 1DVIA 3D0YA 2G2BA 1IQ5A 1PULA 2COLB 2LP2A 1F4OA 4MBEA 3TUYC 1G4YR 3KEVA 5CSIA 4YGAA 2E30A 3HX4A 1G8IA 2BBNA 2KI6D 4ORCB 4GUKA 3CLNA 1KWOB 2MBXA 1YURA 1A29A 1ZACA 3TZ1A 4A4CA 4I5NB 3EK7A 2PMYA 2VRGA 1S36A 2KQ6A 1QIWA 1C07A 3JVTC 1QIVA 1YRTB 3E3RA 2KFGA 1TTXA 3CWGA 2LVVA 2V53A 3F45A 4AQIA 3OB2B 3SIBA 4MZJA 3GOFA 1CNPA 5JOLA 1M45A 1TRFA 3CS1A 1MWNA 1LXFC 2JPTA 2P6BB 2G9BA 1SL7A 1JUOA 1CB1A 1KK8B 3GK1A 1N2DA 1B47A 1UWOA 4JWQA 4N1GA 2L51A 1Y1UA 2LLSA 4IL1A 1S5GZ 1V1GA 4BY4A 1N0YA 1WLMA 2KI4B 2MJWB 3EK4A 1UHHA 1RECA 1QTXA 4YRUA 1DTLA 1NCYA 1S3PA 4JPZB 1GGZA 4ORBB 4I5LB 1WRKA 2BCAA 1S5GY 2BL0C 1L2OB 2EC6C 5ER5A 4GBAA 2DOQA 1CDMA 1A2XA 3CR5X 1QV0A 1J7OA 5F6TA 3KO0A 3DF0B 1BJFA 2LVIA 1MXEA 1PRWA 4YGEB 1WDCC 2QACA 2K2AA 5HKWA 2Q91A 2MA2A 1E8AA 2ISDA 1XVJA 5HLVA 4GGNA 4GGFA 1RK9A 1SPYA 3EKJA 2RGIA 4WQ2A 1YVLA 3NSOA 2OTGB 1YUTA 3SG6A 2GGZA 1A75A 5B8IB 1YRUB 2NLNA 1WRZA 1B4CA 3GK2A 2KYCA 1DJZA 1AVSA 1LA3A 1QLSA 2Q4UA 1W7IB 2JTZA 3CZTX 1HQVA 4QJ3B 5CPVA 2PRUA 5HYDA 3AKBA 1OSAA 1K96A 4P5OE 1IGVA 2ZRSA 1EH2A 1JF2A 2M9GA 1JWDA 1Y0VH 2L2EA 1Q80A 1M31A 1Y1XA 5BPJA 1SR6C 1D1OA 3TDIA 2KDHA 2KQYA 2M7NA 2I94A 3JTDB 1MF8B 1F54A 4NDBA 4XYNA 2HQWA 2K7BA 1IG5A 2K0JA 2F2PA 3OX5A 4FQOA 4MSPA 3K21A 2A4JA 2JTTA 4E68A 2BKHB 3LK0A 2PASA 1A03A 3OHMB 1XFVO 1K9KA 2KFHA 3PN7B 1DF0B 4YGCB 4GGFC 5J3XA 4CIDA 1U5IB 3I5FC 1K94A 1S26D 1DJXA 2CBLA 2JOJA 2KNEA 1K90D 2PSRA 1WRLA 3A8RA 1XK4A 2LNKA 3O2PA 1HT9A 2WNDA 3TS5C 1ALWA 4TNCA 1JF0A 4ICBA 1H8BA 3GK4X 4ZCVA 2AAOA 3NXAA 4YBHB 4MLWA 2Y4QA 1J55A 2LE9B 1W7JB 2BECA 1S6IA 2JNXA 2JT0A 3VRQA 1MXLC 1NUBA 4GPLB 1ZFSA 2HETA 1MQ1A 1QX2A 2K7CA 3EVVA 3WXAA 4DCKA 1FBVA 1IQ3A 1QVIY 1QJTA 2MLFC 3TUYB 3BUNB 3PATA 3VRRA 1SCMC 1KQMC 1GGWA 1NSHA 1M63B 3O6BA 3H4SE 3I5GB 4AQJA 1B9AA 2CNPA 2Y1MA 2M1UA 1TCOB 1KK7Z 2JZIA 4OVNF 1M39A 4PHJA 1LVCD 2L50A 1XFWO 4CFRA 1AJ5A 2F8PA 5I2QA 1CM1A 2LCPA 4BY5A 1MR8A 1XYDA 3LCPC 3WHTB 1RJVA 1IRJA 1CDPA 1IJ5A 2O5GA 3EVUA 1AJ4A 2WCFA 3DF0A 1KWOC 1UHKA 3SG3A 2I18A 1QV1A 2WORA 1NX3A 1XK4C 1DJIA 1FF1A 1EL4A 2L4HA 3DVMA 2WOSA 1SL8A 1SY9A 1YUSA 1PVAA 2F3YA 4AOMA 2JC2A 2LUXA 1LA0A 1DGVA 1NX0A 2LHLA 5DKQA 1CM4A 1R2UA 3OX6A 2R2IA 2KYFA 1XFUO 4PHKA 4MZKA 1JSAA 3IQQA 1KK8C 4ORAB 1SK6D 2Y5IA 4MRYA 2PVBA 2JQ6A 2WCEA 1SW8A 5AERA 1FI5A 1YVHA 3NSLA 1RWYA 1G33A 3PLFB 4M2QA 2CXJA 2LLUA 3DVEA 3D10A 4NDDA 1PALA 4M2OA 1KSOA 5K89A 4I5JA 3I5HB 2LVKA 2PALA 3WHUB 1CFFA 2TN4A 3M0WA 4GFTA 1QXPA 4YGDB 3A4UB 1B8RA 2FCEA 4GNKB 5JJGA 4M2PA 1L2OC 2OS8B 3OB1B 1ZUZA 2EHBA 1S1EA 3SG7A 4HRGA 4QJ5B 2SASA 4XJKB 1KSMA 1ODBA 1S6JA 1GQMA 2NCPA 1R6PA 3BXKA 1OMRA 1DJWA 4OKHA 1BODA 1EJ3A 4QJ4B 2LMTA 2L4IA 3VRNA 1Y6WA 2H2KA 2BCBA 2WC8A 3C1VA 1J7QA 1DF0A 1UP5A 1EG4A 5DKNA 1CDLA 1UUSA 3BOWB 4P2YB 1F4QA 1PVBA 2K7OA 3I5IB 4CFQA 2M97A 2LP3A 4PHMA 4PE0A 1JC2A 3SIAA 1AK8A 2KHNA 5HKYA 1QLKA 1XO5A 2KSPA 3LL8B 5HLOA 1CLMA 1LINA 5DKRA 3RLZA 3BUMB 2FOTA 1K2HA 3KPXA 1UHIA 2LHIA 3RM1A 1XFZO 2CTNA 1JFKA 3EK8A 3VGOA 5GQQC 4I5KA 2LLTA 1UHJA 2ZN8A 1PSRA 3BUWB 2FCDA 1F55A 1BR1B 3SG4A 1ALVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O60 A;  3HCM A;  1PSB A;  4HRH A;  4PDZ A;  1UHN A;  1OZO A;  3EVR A;  3JTD C;  3I5F B;  3PAL A;  2NCO A;  3FIA A;  1CKK A;  2OPO A;  1TN4 A;  5FYX A;  1BOC A;  2K7D A;  1KFU L;  1JBA A;  1MUX A;  1SBJ A;  4OV2 A;  2KBI A;  4A4B A;  4FTG A;  1KFU S;  1XFY O;  1C7V A;  1YX8 A;  4UPG A;  5IBW A;  3AAK A;  1NPQ A;  1BMO A;  2IS9 A;  2KGR A;  3CGA A;  2F33 A;  2SCP A;  3PN7 C;  1IWQ A;  1GJY A;  1RRO A;  1Y1A A;  4HRE E;  1B1G A;  1EG3 A;  1CFD A;  3SG5 A;  2F2O A;  4D1E A;  3DD4 A;  1UUR A;  4Q04 A;  3AAJ A;  2EGD A;  5PAL A;  2LAP A;  4PHN A;  4PAL A;  3FS7 A;  1B8C A;  1F70 A;  2FJU B;  5AAN A;  4MZL A;  3O4Y A;  2ZKM X;  1AP4 A;  2K2F A;  1JFJ A;  2KGB C;  4NQG A;  1SKT A;  1AUI B;  1K8U A;  1WLZ A;  2ZND A;  4YI8 A;  1FPW A;  1VRK A;  2KFF A;  3JVT B;  3PSR A;  1IKU A;  1TOP A;  1K9U A;  4U8D A;  1BU3 A;  2KAY A;  5ER4 X;  1KK7 Y;  1XA5 A;  1F71 A;  5AFP A;  2I7A A;  2CCM A;  5KU1 A;  1IJ6 A;  1DJY A;  3BUX B;  3I5G C;  3FWB A;  5AXI A;  4MN0 A;  1MHO A;  1ZOT B;  4N5X A;  2H61 A;  4MVF A;  2LV7 A;  2BE4 A;  1PK0 D;  1CLL A;  3CR4 X;  3AKA A;  2L5X B;  1M46 A;  1TNX A;  2LVJ A;  3LLE A;  2M29 A;  4C0J A;  3TDU A;  1KFX L;  2JRF A;  4USL A;  4MEW A;  1OOJ A;  1KFX S;  2KAX A;  4PE7 A;  2JXC A;  4XJK A;  1NCX A;  3VRP A;  3WNX B;  4DRW A;  1DT7 B;  1NX1 A;  3D0Y B;  3ICB A;  4N1F A;  1TCF A;  3SG2 A;  4YI9 A;  1TNQ A;  2AUC A;  2BL0 B;  2EC6 B;  1S6C A;  2NZ0 A;  4CLN A;  1OMV A;  1SRA A;  2HQ8 A;  1CMF A;  4DS7 A;  2K61 A;  3EKH A;  4HSZ A;  2Y1N A;  1CTR A;  2KI4 C;  1L7Z A;  5AEQ A;  2JNF A;  1WDC B;  3BYA A;  3BOW A;  1J1D A;  4GAO A;  2GV5 A;  4ZCU A;  2HF5 A;  3BUO B;  4C0K A;  1XFX O;  2JT3 A;  5CSF A;  1NWD A;  2AMI A;  3LK1 A;  4R1E A;  1NP8 A;  3KHE A;  4CPV A;  5D69 A;  1TNW A;  1YX7 A;  4OR9 B;  1SNL A;  2HPS A;  1B8L A;  3BQ3 A;  3DVJ A;  2LMV A;  1SL9 A;  2E6W A;  2JU0 A;  1WY9 A;  2MLE C;  3PFV A;  5KSZ A;  2H61 C;  2ZN9 A;  3I5H C;  2KAV A;  2BCX A;  1K9P A;  1BT6 A;  3FWC A;  1V1F A;  4C0L A;  2I2R E;  2MRD A;  1CLB A;  3VRO A;  2LM5 A;  1U5I A;  2OS8 C;  1TIZ A;  4DUQ A;  2OTG C;  3O78 A;  1CMG A;  2JUL A;  3ZNI A;  5TNC A;  1OZS A;  1YTZ C;  1RTP 1;  1TNP A;  4DIR A;  1H4B A;  2GGM A;  1X02 A;  2KOT A;  5CSJ A;  1SCV A;  2M49 B;  1QX5 B;  1SR6 B;  2M8U A;  3PM8 A;  2WCB A;  5HKZ A;  2M1K B;  1QAS A;  1OE9 B;  1A4P A;  1FI6 A;  2NXQ A;  5I2L A;  1J7P A;  1LKJ A;  1YUU A;  3CTN A;  1SYM A;  2JT8 A;  2M3W A;  1FW4 A;  2M7L A;  1QS7 A;  3I5I C;  3SJS A;  1NIW A;  2D8N A;  2QPT A;  1CDN A;  4JQ0 D;  4PCW A;  1AHR A;  1BR4 B;  2JWW A;  1ZMZ A;  2BE6 A;  2CT9 A;  1DMO A;  5I2O A;  1KQV A;  2LMU A;  2M0R A;  1RFJ A;  1DJG A;  2MAZ A;  2L0P A;  2LAN A;  2ZNE A;  5CSN A;  5G08 A;  4F0Z B;  1BG1 A;  4MRX A;  4ETO A;  3TDZ A;  3OP0 A;  3QRX A;  1C7W A;  1F8H A;  1A75 B;  4L9M A;  1CFC A;  1EXR A;  3TS5 B;  2JXL A;  1NX2 A;  1YR5 A;  2BKI B;  4PE4 A;  2L98 A;  4OCI A;  1QAT A;  3DVK A;  3IQO A;  1QX7 A;  1N65 A;  2LUC A;  3KF9 A;  1DJH A;  2KBM A;  2KI6 C;  1NCZ A;  2F3Z A;  3MSE B;  1KCY A;  4PE1 A;  2ZRT A;  1OMD A;  1J1E A;  4WQ3 A;  1B7T Z;  2LC5 A;  3CR2 A;  1DGU A;  2K8M B;  3ZWH A;  1CFP A;  1SCM B;  5I8N A;  1KQM B;  1BLQ A;  2BBM A;  1BF5 A;  2B1U A;  1K95 A;  1K93 D;  4YGB B;  2MHH A;  3NSK A;  4WRI A;  5KTY A;  1QVI Z;  4NDC A;  3NSI A;  1SMG A;  1B7T Y;  3IF7 A;  1NYA A;  5D7F A;  1J7R A;  2ZFD A;  1OQP A;  1IH0 A;  1DVI A;  3D0Y A;  2G2B A;  1IQ5 A;  1PUL A;  2COL B;  2LP2 A;  1F4O A;  4MBE A;  3TUY C;  1G4Y R;  3KEV A;  5CSI A;  4YGA A;  2E30 A;  3HX4 A;  1G8I A;  2BBN A;  2KI6 D;  4ORC B;  4GUK A;  3CLN A;  1KWO B;  2MBX A;  1YUR A;  1A29 A;  1ZAC A;  3TZ1 A;  4A4C A;  4I5N B;  3EK7 A;  2PMY A;  2VRG A;  1S36 A;  2KQ6 A;  1QIW A;  1C07 A;  3JVT C;  1QIV A;  1YRT B;  3E3R A;  2KFG A;  1TTX A;  3CWG A;  2LVV A;  2V53 A;  3F45 A;  4AQI A;  3OB2 B;  3SIB A;  4MZJ A;  3GOF A;  1CNP A;  5JOL A;  1M45 A;  1TRF A;  3CS1 A;  1MWN A;  1LXF C;  2JPT A;  2P6B B;  2G9B A;  1SL7 A;  1JUO A;  1CB1 A;  1KK8 B;  3GK1 A;  1N2D A;  1B47 A;  1UWO A;  4JWQ A;  4N1G A;  2L51 A;  1Y1U A;  2LLS A;  4IL1 A;  1S5G Z;  1V1G A;  4BY4 A;  1N0Y A;  1WLM A;  2KI4 B;  2MJW B;  3EK4 A;  1UHH A;  1REC A;  1QTX A;  4YRU A;  1DTL A;  1NCY A;  1S3P A;  4JPZ B;  1GGZ A;  4ORB B;  4I5L B;  1WRK A;  2BCA A;  1S5G Y;  2BL0 C;  1L2O B;  2EC6 C;  5ER5 A;  4GBA A;  2DOQ A;  1CDM A;  1A2X A;  3CR5 X;  1QV0 A;  1J7O A;  5F6T A;  3KO0 A;  3DF0 B;  1BJF A;  2LVI A;  1MXE A;  1PRW A;  4YGE B;  1WDC C;  2QAC A;  2K2A A;  5HKW A;  2Q91 A;  2MA2 A;  1E8A A;  2ISD A;  1XVJ A;  5HLV A;  4GGN A;  4GGF A;  1RK9 A;  1SPY A;  3EKJ A;  2RGI A;  4WQ2 A;  1YVL A;  3NSO A;  2OTG B;  1YUT A;  3SG6 A;  2GGZ A;  1A75 A;  5B8I B;  1YRU B;  2NLN A;  1WRZ A;  1B4C A;  3GK2 A;  2KYC A;  1DJZ A;  1AVS A;  1LA3 A;  1QLS A;  2Q4U A;  1W7I B;  2JTZ A;  3CZT X;  1HQV A;  4QJ3 B;  5CPV A;  2PRU A;  5HYD A;  3AKB A;  1OSA A;  1K96 A;  4P5O E;  1IGV A;  2ZRS A;  1EH2 A;  1JF2 A;  2M9G A;  1JWD A;  1Y0V H;  2L2E A;  1Q80 A;  1M31 A;  1Y1X A;  5BPJ A;  1SR6 C;  1D1O A;  3TDI A;  2KDH A;  2KQY A;  2M7N A;  2I94 A;  3JTD B;  1MF8 B;  1F54 A;  4NDB A;  4XYN A;  2HQW A;  2K7B A;  1IG5 A;  2K0J A;  2F2P A;  3OX5 A;  4FQO A;  4MSP A;  3K21 A;  2A4J A;  2JTT A;  4E68 A;  2BKH B;  3LK0 A;  2PAS A;  1A03 A;  3OHM B;  1XFV O;  1K9K A;  2KFH A;  3PN7 B;  1DF0 B;  4YGC B;  4GGF C;  5J3X A;  4CID A;  1U5I B;  3I5F C;  1K94 A;  1S26 D;  1DJX A;  2CBL A;  2JOJ A;  2KNE A;  1K90 D;  2PSR A;  1WRL A;  3A8R A;  1XK4 A;  2LNK A;  3O2P A;  1HT9 A;  2WND A;  3TS5 C;  1ALW A;  4TNC A;  1JF0 A;  4ICB A;  1H8B A;  3GK4 X;  4ZCV A;  2AAO A;  3NXA A;  4YBH B;  4MLW A;  2Y4Q A;  1J55 A;  2LE9 B;  1W7J B;  2BEC A;  1S6I A;  2JNX A;  2JT0 A;  3VRQ A;  1MXL C;  1NUB A;  4GPL B;  1ZFS A;  2HET A;  1MQ1 A;  1QX2 A;  2K7C A;  3EVV A;  3WXA A;  4DCK A;  1FBV A;  1IQ3 A;  1QVI Y;  1QJT A;  2MLF C;  3TUY B;  3BUN B;  3PAT A;  3VRR A;  1SCM C;  1KQM C;  1GGW A;  1NSH A;  1M63 B;  3O6B A;  3H4S E;  3I5G B;  4AQJ A;  1B9A A;  2CNP A;  2Y1M A;  2M1U A;  1TCO B;  1KK7 Z;  2JZI A;  4OVN F;  1M39 A;  4PHJ A;  1LVC D;  2L50 A;  1XFW O;  4CFR A;  1AJ5 A;  2F8P A;  5I2Q A;  1CM1 A;  2LCP A;  4BY5 A;  1MR8 A;  1XYD A;  3LCP C;  3WHT B;  1RJV A;  1IRJ A;  1CDP A;  1IJ5 A;  2O5G A;  3EVU A;  1AJ4 A;  2WCF A;  3DF0 A;  1KWO C;  1UHK A;  3SG3 A;  2I18 A;  1QV1 A;  2WOR A;  1NX3 A;  1XK4 C;  1DJI A;  1FF1 A;  1EL4 A;  2L4H A;  3DVM A;  2WOS A;  1SL8 A;  1SY9 A;  1YUS A;  1PVA A;  2F3Y A;  4AOM A;  2JC2 A;  2LUX A;  1LA0 A;  1DGV A;  1NX0 A;  2LHL A;  5DKQ A;  1CM4 A;  1R2U A;  3OX6 A;  2R2I A;  2KYF A;  1XFU O;  4PHK A;  4MZK A;  1JSA A;  3IQQ A;  1KK8 C;  4ORA B;  1SK6 D;  2Y5I A;  4MRY A;  2PVB A;  2JQ6 A;  2WCE A;  1SW8 A;  5AER A;  1FI5 A;  1YVH A;  3NSL A;  1RWY A;  1G33 A;  3PLF B;  4M2Q A;  2CXJ A;  2LLU A;  3DVE A;  3D10 A;  4NDD A;  1PAL A;  4M2O A;  1KSO A;  5K89 A;  4I5J A;  3I5H B;  2LVK A;  2PAL A;  3WHU B;  1CFF A;  2TN4 A;  3M0W A;  4GFT A;  1QXP A;  4YGD B;  3A4U B;  1B8R A;  2FCE A;  4GNK B;  5JJG A;  4M2P A;  1L2O C;  2OS8 B;  3OB1 B;  1ZUZ A;  2EHB A;  1S1E A;  3SG7 A;  4HRG A;  4QJ5 B;  2SAS A;  4XJK B;  1KSM A;  1ODB A;  1S6J A;  1GQM A;  2NCP A;  1R6P A;  3BXK A;  1OMR A;  1DJW A;  4OKH A;  1BOD A;  1EJ3 A;  4QJ4 B;  2LMT A;  2L4I A;  3VRN A;  1Y6W A;  2H2K A;  2BCB A;  2WC8 A;  3C1V A;  1J7Q A;  1DF0 A;  1UP5 A;  1EG4 A;  5DKN A;  1CDL A;  1UUS A;  3BOW B;  4P2Y B;  1F4Q A;  1PVB A;  2K7O A;  3I5I B;  4CFQ A;  2M97 A;  2LP3 A;  4PHM A;  4PE0 A;  1JC2 A;  3SIA A;  1AK8 A;  2KHN A;  5HKY A;  1QLK A;  1XO5 A;  2KSP A;  3LL8 B;  5HLO A;  1CLM A;  1LIN A;  5DKR A;  3RLZ A;  3BUM B;  2FOT A;  1K2H A;  3KPX A;  1UHI A;  2LHI A;  3RM1 A;  1XFZ O;  2CTN A;  1JFK A;  3EK8 A;  3VGO A;  5GQQ C;  4I5K A;  2LLT A;  1UHJ A;  2ZN8 A;  1PSR A;  3BUW B;  2FCD A;  1F55 A;  1BR1 B;  3SG4 A;  1ALV A; 
#chains in the Genus database with same CATH topology
 2O60 A;  3HCM A;  1PSB A;  4HRH A;  4PDZ A;  1UHN A;  1OZO A;  2BNX A;  3EVR A;  3JTD C;  3I5F B;  3PAL A;  4IJ7 A;  3SS4 A;  2NCO A;  3FIA A;  1CKK A;  2OPO A;  1TN4 A;  5FYX A;  1BOC A;  2K7D A;  1KFU L;  1JBA A;  1MUX A;  1SBJ A;  4OV2 A;  2KBI A;  4A4B A;  4FTG A;  1KFU S;  1XFY O;  1C7V A;  1YX8 A;  4UPG A;  5IBW A;  3AAK A;  1NPQ A;  1BMO A;  2IS9 A;  2KGR A;  3CGA A;  2F33 A;  2SCP A;  3PN7 C;  1IWQ A;  1GJY A;  1RRO A;  1Y1A A;  3K1E A;  4HRE E;  1B1G A;  1EG3 A;  1CFD A;  3SG5 A;  2F2O A;  4D1E A;  3DD4 A;  2KLD A;  1UUR A;  4Q04 A;  3AAJ A;  2EGD A;  4KYN A;  5PAL A;  2LAP A;  4PHN A;  4PAL A;  4F7F A;  3FS7 A;  1B8C A;  1F70 A;  5EL2 A;  2FJU B;  5AAN A;  2WCJ A;  4MZL A;  3O4Y A;  2ZKM X;  1AP4 A;  2K2F A;  1JFJ A;  2KGB C;  4NQG A;  1SKT A;  1AUI B;  1K8U A;  1WLZ A;  2ZND A;  4YI8 A;  1FPW A;  1VRK A;  2KFF A;  3JVT B;  3PSR A;  2WC5 A;  1IKU A;  1TOP A;  3B87 A;  1K9U A;  4U8D A;  1BU3 A;  2KAY A;  5ER4 X;  1KK7 Y;  3CZ0 A;  1XA5 A;  1F71 A;  5AFP A;  2I7A A;  2CCM A;  5KU1 A;  1IJ6 A;  3DY9 A;  3D75 A;  1DJY A;  3BUX B;  3I5G C;  3FWB A;  5FI7 A;  5AXI A;  4MN0 A;  1MHO A;  1ZOT B;  3RZS A;  4N5X A;  2H61 A;  2QEH A;  4MVF A;  2LV7 A;  2BE4 A;  1PK0 D;  1CLL A;  3CR4 X;  3AKA A;  2L5X B;  1M46 A;  1TNX A;  2JPO A;  2LVJ A;  3LLE A;  2M29 A;  2QEO A;  2WCL A;  4C0J A;  3TDU A;  1KFX L;  2JRF A;  3DYE A;  4USL A;  1XFR A;  4MEW A;  1OOJ A;  2H8V A;  1KFX S;  2KAX A;  4PE7 A;  2JXC A;  4XJK A;  1NCX A;  3VRP A;  3WNX B;  4DRW A;  1DT7 B;  1NX1 A;  3D0Y B;  3ICB A;  4N1F A;  1TCF A;  3SG2 A;  4YI9 A;  1TNQ A;  2AUC A;  2BL0 B;  2EC6 B;  1S6C A;  2QEB A;  3B6X A;  2NZ0 A;  3CZ2 A;  4CLN A;  1OMV A;  1SRA A;  2HQ8 A;  3D76 A;  3DXL A;  4DS7 A;  1CMF A;  2K61 A;  3EG5 B;  3EKH A;  4HSZ A;  2Y1N A;  1CTR A;  2KI4 C;  1L7Z A;  5AEQ A;  2JNF A;  1WDC B;  3BYA A;  3BOW A;  1J1D A;  4GAO A;  1OOI X;  2GV5 A;  4ZCU A;  2HF5 A;  3BUO B;  1DEL A;  4C0K A;  1XFX O;  2JT3 A;  5CSF A;  1NWD A;  2AMI A;  3LK1 A;  4R1E A;  1NP8 A;  3V2L A;  3KHE A;  4CPV A;  5D69 A;  1TNW A;  1YX7 A;  4OR9 B;  1SNL A;  2HPS A;  3L4L A;  1B8L A;  3BQ3 A;  3DVJ A;  2LMV A;  1SL9 A;  2E6W A;  3D74 A;  2JU0 A;  1WY9 A;  2MLE C;  3PFV A;  5KSZ A;  2H61 C;  2ZN9 A;  2L5Y A;  2KAV A;  3I5H C;  2BCX A;  1K9P A;  5FI2 A;  1BT6 A;  1P28 A;  3FWC A;  1V1F A;  4C0L A;  2I2R E;  2MRD A;  4OZD A;  3VRO A;  1CLB A;  2LM5 A;  1U5I A;  2OS8 C;  1SSE B;  1TIZ A;  4DUQ A;  2OTG C;  3O78 A;  1CMG A;  2JUL A;  3ZNI A;  5TNC A;  1OZS A;  1YTZ C;  1RTP 1;  1TNP A;  4DIR A;  1H4B A;  1T14 A;  2GGM A;  1X02 A;  2KOT A;  5CSJ A;  1SCV A;  2M49 B;  1QX5 B;  1SR6 B;  2M8U A;  3PM8 A;  1DC1 A;  2WCB A;  5HKZ A;  2M1K B;  1QAS A;  2WC6 A;  1OE9 B;  1A4P A;  1FI6 A;  2NXQ A;  1TUJ A;  5I2L A;  1LKJ A;  1YUU A;  3CTN A;  1J7P A;  1SYM A;  2GTE A;  2JT8 A;  2M3W A;  1FW4 A;  2M7L A;  1QS7 A;  3I5I C;  3SJS A;  1NIW A;  2D8N A;  2QEV A;  1OOH A;  2QPT A;  4JQ0 D;  1CDN A;  4PCW A;  1AHR A;  1BR4 B;  2JWW A;  1ZMZ A;  5I94 A;  2BE6 A;  2CT9 A;  1DMO A;  5I2O A;  1KQV A;  2LMU A;  2M0R A;  1RFJ A;  1DJG A;  2MAZ A;  2L0P A;  2LAN A;  2ZNE A;  5CSN A;  5G08 A;  4F0Z B;  1BG1 A;  4MRX A;  4ETO A;  3TDZ A;  3FE9 A;  3OP0 A;  3QRX A;  1C7W A;  1F8H A;  1A75 B;  4L9M A;  1CFC A;  1EXR A;  3TS5 B;  2JXL A;  1NX2 A;  1YR5 A;  2BKI B;  3SS3 A;  4PE4 A;  2L98 A;  2P71 A;  3S0A A;  4OCI A;  1QAT A;  3DVK A;  3IQO A;  1QX7 A;  4JD9 A;  1N65 A;  2LUC A;  3KF9 A;  1DJH A;  2KBM A;  2KI6 C;  2ERB A;  1NCZ A;  2F3Z A;  3MSE B;  1KCY A;  4PE1 A;  2ZRT A;  1OMD A;  1J1E A;  4WQ3 A;  1B7T Z;  2LC5 A;  3CR2 A;  1DGU A;  2K8M B;  3FE8 A;  3ZWH A;  1IIO A;  3BJH A;  4JKT A;  1CFP A;  1SCM B;  5I8N A;  1KQM B;  1BLQ A;  3PM2 A;  2BBM A;  1BF5 A;  2B1U A;  1K95 A;  1K93 D;  4YGB B;  2MHH A;  3NSK A;  4WRI A;  3VB1 A;  1ORG A;  5KTY A;  1QVI Z;  4NDC A;  3NSI A;  1SMG A;  1B7T Y;  3IF7 A;  1NYA A;  5D7F A;  1J7R A;  2ZFD A;  1OQP A;  1DQE A;  1IH0 A;  1DVI A;  4PT1 A;  3D0Y A;  2G2B A;  1IQ5 A;  1PUL A;  2COL B;  2LP2 A;  1F4O A;  4MBE A;  3TUY C;  1G4Y R;  3KEV A;  5CSI A;  4YGA A;  2E30 A;  3HX4 A;  1G8I A;  2BBN A;  2KI6 D;  4ORC B;  4GUK A;  3CLN A;  1KWO B;  2MBX A;  1YUR A;  1A29 A;  1ZAC A;  2KPH A;  3TZ1 A;  4I5N B;  4A4C A;  3EK7 A;  2PMY A;  2VRG A;  1S36 A;  2KQ6 A;  1QIW A;  3D78 A;  1C07 A;  3JVT C;  1QIV A;  1LS8 A;  1YRT B;  3FE6 A;  3E3R A;  2KFG A;  1TTX A;  3CWG A;  2LVV A;  2V53 A;  3F45 A;  4AQI A;  2L2C A;  3OB2 B;  3SIB A;  4MZJ A;  3GOF A;  1CNP A;  5JOL A;  1M45 A;  1TRF A;  3CS1 A;  1MWN A;  1LXF C;  2JPT A;  2P6B B;  2G9B A;  1SL7 A;  1JUO A;  1CB1 A;  1KK8 B;  3GK1 A;  1N2D A;  1B47 A;  1UWO A;  4JWQ A;  4N1G A;  2L51 A;  1Y1U A;  2LLS A;  4IL1 A;  1S5G Z;  1Z2C B;  1V1G A;  2QDI A;  1N0Y A;  4BY4 A;  5D3O A;  1WLM A;  2KI4 B;  2MJW B;  3EK4 A;  1UHH A;  1REC A;  1QTX A;  4YRU A;  1DTL A;  1NCY A;  1S3P A;  4JPZ B;  1GGZ A;  3R1V A;  4ORB B;  2PQL A;  4I5L B;  1WRK A;  2BCA A;  1S5G Y;  2BL0 C;  1L2O B;  2EC6 C;  3NHI A;  5ER5 A;  4GBA A;  2DOQ A;  1OOG A;  1CDM A;  1A2X A;  1Z4H A;  3CR5 X;  1QV0 A;  1J7O A;  5F6T A;  3KO0 A;  3DF0 B;  1BJF A;  2LVI A;  1MXE A;  1PRW A;  4YGE B;  1WDC C;  2PYQ A;  2QAC A;  2K2A A;  5HKW A;  2Q91 A;  2MA2 A;  1E8A A;  2ISD A;  1TWO A;  1XVJ A;  4GGN A;  5HLV A;  4GGF A;  1RK9 A;  1SPY A;  3L4A A;  3EKJ A;  3NHT A;  2RGI A;  3QME A;  4WQ2 A;  1YVL A;  3BFB A;  3NSO A;  2OTG B;  1YUT A;  3SG6 A;  2GGZ A;  1A75 A;  3OBV A;  5B8I B;  1YRU B;  1TUZ A;  1WRZ A;  2NLN A;  3CZ1 A;  1B4C A;  3GK2 A;  2KYC A;  3NGV A;  1DJZ A;  1AVS A;  1LA3 A;  1QLS A;  2Q4U A;  4FQT A;  1W9Z A;  1W7I B;  2JTZ A;  3CZT X;  1HQV A;  4QJ3 B;  5CPV A;  2PRU A;  5HYD A;  3AKB A;  1OSA A;  1K96 A;  4P5O E;  1IGV A;  2ZRS A;  1EH2 A;  1JF2 A;  2M9G A;  1JWD A;  1Y0V H;  2L2E A;  1Q80 A;  3L47 A;  1M31 A;  3R1O A;  1Y1X A;  5BPJ A;  1SR6 C;  1D1O A;  3TDI A;  2KDH A;  2KQY A;  2M7N A;  2I94 A;  3JTD B;  1MF8 B;  1F54 A;  4NDB A;  4XYN A;  2HQW A;  2K7B A;  1IG5 A;  2K0J A;  2F2P A;  3OX5 A;  4FQO A;  4MSP A;  3K21 A;  2A4J A;  2JTT A;  3DZT A;  2BKH B;  3LK0 A;  2PAS A;  4E68 A;  1A03 A;  3OHM B;  1XFV O;  1K9K A;  2KFH A;  2P70 A;  3PN7 B;  1DF0 B;  4YGC B;  4GGF C;  5DIC A;  5J3X A;  3R1P A;  4CID A;  1U5I B;  3I5F C;  1K94 A;  1S26 D;  1DJX A;  2CBL A;  2JOJ A;  4INW A;  2KNE A;  1K90 D;  2PSR A;  1WRL A;  3A8R A;  1XK4 A;  2LNK A;  2K60 A;  3O2P A;  1HT9 A;  2WND A;  3TS5 C;  1ALW A;  4TNC A;  1JF0 A;  3UO9 A;  4ICB A;  1H8B A;  3D73 A;  2WCK A;  3GK4 X;  4ZCV A;  2AAO A;  2YGU A;  3NXA A;  4YBH B;  4MLW A;  2Y4Q A;  1J55 A;  2LE9 B;  1W7J B;  2BEC A;  1OW4 A;  1S6I A;  2JNX A;  2JT0 A;  3VRQ A;  1MXL C;  1NUB A;  4GPL B;  1ZFS A;  2WCH A;  2HET A;  1MQ1 A;  1QX2 A;  2K7C A;  3EVV A;  3IVT A;  3WXA A;  4DCK A;  1FBV A;  1IQ3 A;  1QVI Y;  1QJT A;  2MLF C;  3S0D A;  3S0B A;  3TUY B;  3BUN B;  3PAT A;  3VRR A;  1SCM C;  1KQM C;  1GGW A;  1NSH A;  1M63 B;  3O6B A;  3H4S E;  2KLE A;  3I5G B;  4AQJ A;  1B9A A;  2CNP A;  2Y1M A;  2M1U A;  1TCO B;  1KK7 Z;  2JZI A;  4OVN F;  1M39 A;  4PHJ A;  1LVC D;  2L50 A;  1XFW O;  3BFH A;  1AJ5 A;  3B86 A;  3BFA A;  4INX A;  4CFR A;  1DEK A;  2F8P A;  5I2Q A;  2BAP A;  1CM1 A;  2LCP A;  4BY5 A;  1MR8 A;  3OGN A;  1XYD A;  3LCP C;  3WHT B;  1RJV A;  3CYZ A;  1GM0 A;  1IRJ A;  1CDP A;  1IJ5 A;  2O5G A;  5HL1 A;  3EVU A;  1AJ4 A;  2WCF A;  3DF0 A;  3O4X A;  1KWO C;  1UHK A;  3SG3 A;  2I18 A;  1QV1 A;  2WOR A;  1NX3 A;  1XK4 C;  1DJI A;  1FF1 A;  1EL4 A;  3D77 A;  2L4H A;  3DVM A;  2WOS A;  1SL8 A;  1SY9 A;  1YUS A;  1PVA A;  2F3Y A;  4AOM A;  2FJY A;  2JC2 A;  2LUX A;  1LA0 A;  3S0G A;  1DGV A;  1NX0 A;  2LHL A;  5DKQ A;  1CM4 A;  3N7H A;  1R2U A;  3OX6 A;  2R2I A;  2KYF A;  1XFU O;  4PHK A;  4MZK A;  1JSA A;  3IQQ A;  1KK8 C;  4ORA B;  1SK6 D;  2Y5I A;  4MRY A;  2PVB A;  2JQ6 A;  2WCE A;  1SW8 A;  5AER A;  1FI5 A;  1YVH A;  3NSL A;  1RWY A;  1G33 A;  3PLF B;  4M2Q A;  2CXJ A;  2LLU A;  3DVE A;  1C3Z A;  3D10 A;  4NDD A;  1PAL A;  4M2O A;  1KSO A;  5K89 A;  4I5J A;  3I5H B;  2LVK A;  2PAL A;  3WHU B;  1CFF A;  2TN4 A;  3M0W A;  4GFT A;  1QXP A;  3S0F A;  3CAB A;  3Q8I A;  3R72 A;  4YGD B;  3A4U B;  1B8R A;  2FCE A;  4GNK B;  5JJG A;  4M2P A;  1L2O C;  1OOF A;  2OS8 B;  3OB1 B;  1ZUZ A;  3S0E A;  2EHB A;  1S1E A;  3SG7 A;  4HRG A;  4QJ5 B;  2SAS A;  4XJK B;  1KSM A;  1ODB A;  1S6J A;  1GQM A;  2NCP A;  1R6P A;  3UNW A;  3BXK A;  1OMR A;  1DJW A;  1QWV A;  4OKH A;  3PJI A;  3B7A A;  3SS5 A;  1EJ3 A;  1BOD A;  4QJ4 B;  2LMT A;  2L4I A;  3VRN A;  1Y6W A;  2H2K A;  2BCB A;  2WC8 A;  3C1V A;  1J7Q A;  1DF0 A;  1UP5 A;  1EG4 A;  5DKN A;  1CDL A;  1UUS A;  5FI6 A;  3BOW B;  4P2Y B;  1F4Q A;  1PVB A;  2K7O A;  3I5I B;  4CFQ A;  2M97 A;  2LP3 A;  4PHM A;  4PE0 A;  1JC2 A;  3SIA A;  1AK8 A;  2KHN A;  5HKY A;  1QLK A;  3B88 A;  1XO5 A;  2KSP A;  3CDN A;  3LL8 B;  5HLO A;  1CLM A;  1LIN A;  5DKR A;  3RLZ A;  3BUM B;  2FOT A;  2WCM A;  1K2H A;  3KPX A;  1UHI A;  2LHI A;  3RM1 A;  1XFZ O;  2CTN A;  1C3Y A;  1JFK A;  3EK8 A;  3VGO A;  5GQQ C;  4I5K A;  2LLT A;  1UHJ A;  2ZN8 A;  1PSR A;  3BUW B;  2FCD A;  1F55 A;  1BR1 B;  3SG4 A;  1ALV A; 
#chains in the Genus database with same CATH homology
 2O60 A;  3HCM A;  1PSB A;  4HRH A;  4PDZ A;  1UHN A;  1OZO A;  3EVR A;  3JTD C;  3I5F B;  3PAL A;  2NCO A;  3FIA A;  1CKK A;  2OPO A;  1TN4 A;  5FYX A;  1BOC A;  2K7D A;  1KFU L;  1JBA A;  1MUX A;  1SBJ A;  4OV2 A;  2KBI A;  4A4B A;  4FTG A;  1KFU S;  1XFY O;  1C7V A;  1YX8 A;  4UPG A;  5IBW A;  3AAK A;  1NPQ A;  1BMO A;  2IS9 A;  2KGR A;  3CGA A;  2F33 A;  2SCP A;  3PN7 C;  1IWQ A;  1GJY A;  1RRO A;  1Y1A A;  4HRE E;  1B1G A;  1EG3 A;  1CFD A;  3SG5 A;  2F2O A;  4D1E A;  3DD4 A;  1UUR A;  4Q04 A;  3AAJ A;  2EGD A;  5PAL A;  2LAP A;  4PHN A;  4PAL A;  3FS7 A;  1B8C A;  1F70 A;  2FJU B;  5AAN A;  4MZL A;  3O4Y A;  2ZKM X;  1AP4 A;  2K2F A;  1JFJ A;  2KGB C;  4NQG A;  1SKT A;  1AUI B;  1K8U A;  1WLZ A;  2ZND A;  4YI8 A;  1FPW A;  1VRK A;  2KFF A;  3JVT B;  3PSR A;  1IKU A;  1TOP A;  1K9U A;  4U8D A;  1BU3 A;  2KAY A;  5ER4 X;  1KK7 Y;  1XA5 A;  1F71 A;  5AFP A;  2I7A A;  2CCM A;  5KU1 A;  1IJ6 A;  1DJY A;  3BUX B;  3I5G C;  3FWB A;  5AXI A;  4MN0 A;  1MHO A;  1ZOT B;  4N5X A;  2H61 A;  4MVF A;  2LV7 A;  2BE4 A;  1PK0 D;  1CLL A;  3CR4 X;  3AKA A;  2L5X B;  1M46 A;  1TNX A;  2LVJ A;  3LLE A;  2M29 A;  4C0J A;  3TDU A;  1KFX L;  2JRF A;  4USL A;  4MEW A;  1OOJ A;  1KFX S;  2KAX A;  4PE7 A;  2JXC A;  4XJK A;  1NCX A;  3VRP A;  3WNX B;  4DRW A;  1DT7 B;  1NX1 A;  3D0Y B;  3ICB A;  4N1F A;  1TCF A;  3SG2 A;  4YI9 A;  1TNQ A;  2AUC A;  2BL0 B;  2EC6 B;  1S6C A;  2NZ0 A;  4CLN A;  1OMV A;  1SRA A;  2HQ8 A;  1CMF A;  4DS7 A;  2K61 A;  3EKH A;  4HSZ A;  2Y1N A;  1CTR A;  2KI4 C;  1L7Z A;  5AEQ A;  2JNF A;  1WDC B;  3BYA A;  3BOW A;  1J1D A;  4GAO A;  2GV5 A;  4ZCU A;  2HF5 A;  3BUO B;  4C0K A;  1XFX O;  2JT3 A;  5CSF A;  1NWD A;  2AMI A;  3LK1 A;  4R1E A;  1NP8 A;  3KHE A;  4CPV A;  5D69 A;  1TNW A;  1YX7 A;  4OR9 B;  1SNL A;  2HPS A;  1B8L A;  3BQ3 A;  3DVJ A;  2LMV A;  1SL9 A;  2E6W A;  2JU0 A;  1WY9 A;  2MLE C;  3PFV A;  5KSZ A;  2H61 C;  2ZN9 A;  3I5H C;  2KAV A;  2BCX A;  1K9P A;  1BT6 A;  3FWC A;  1V1F A;  4C0L A;  2I2R E;  2MRD A;  1CLB A;  3VRO A;  2LM5 A;  1U5I A;  2OS8 C;  1TIZ A;  4DUQ A;  2OTG C;  3O78 A;  1CMG A;  2JUL A;  3ZNI A;  5TNC A;  1OZS A;  1YTZ C;  1RTP 1;  1TNP A;  4DIR A;  1H4B A;  2GGM A;  1X02 A;  2KOT A;  5CSJ A;  1SCV A;  2M49 B;  1QX5 B;  1SR6 B;  2M8U A;  3PM8 A;  2WCB A;  5HKZ A;  2M1K B;  1QAS A;  1OE9 B;  1A4P A;  1FI6 A;  2NXQ A;  5I2L A;  1J7P A;  1LKJ A;  1YUU A;  3CTN A;  1SYM A;  2JT8 A;  2M3W A;  1FW4 A;  2M7L A;  1QS7 A;  3I5I C;  3SJS A;  1NIW A;  2D8N A;  2QPT A;  1CDN A;  4JQ0 D;  4PCW A;  1AHR A;  1BR4 B;  2JWW A;  1ZMZ A;  2BE6 A;  2CT9 A;  1DMO A;  5I2O A;  1KQV A;  2LMU A;  2M0R A;  1RFJ A;  1DJG A;  2MAZ A;  2L0P A;  2LAN A;  2ZNE A;  5CSN A;  5G08 A;  4F0Z B;  1BG1 A;  4MRX A;  4ETO A;  3TDZ A;  3OP0 A;  3QRX A;  1C7W A;  1F8H A;  1A75 B;  4L9M A;  1CFC A;  1EXR A;  3TS5 B;  2JXL A;  1NX2 A;  1YR5 A;  2BKI B;  4PE4 A;  2L98 A;  4OCI A;  1QAT A;  3DVK A;  3IQO A;  1QX7 A;  1N65 A;  2LUC A;  3KF9 A;  1DJH A;  2KBM A;  2KI6 C;  1NCZ A;  2F3Z A;  3MSE B;  1KCY A;  4PE1 A;  2ZRT A;  1OMD A;  1J1E A;  4WQ3 A;  1B7T Z;  2LC5 A;  3CR2 A;  1DGU A;  2K8M B;  3ZWH A;  1CFP A;  1SCM B;  5I8N A;  1KQM B;  1BLQ A;  2BBM A;  1BF5 A;  2B1U A;  1K95 A;  1K93 D;  4YGB B;  2MHH A;  3NSK A;  4WRI A;  5KTY A;  1QVI Z;  4NDC A;  3NSI A;  1SMG A;  1B7T Y;  3IF7 A;  1NYA A;  5D7F A;  1J7R A;  2ZFD A;  1OQP A;  1IH0 A;  1DVI A;  3D0Y A;  2G2B A;  1IQ5 A;  1PUL A;  2COL B;  2LP2 A;  1F4O A;  4MBE A;  3TUY C;  1G4Y R;  3KEV A;  5CSI A;  4YGA A;  2E30 A;  3HX4 A;  1G8I A;  2BBN A;  2KI6 D;  4ORC B;  4GUK A;  3CLN A;  1KWO B;  2MBX A;  1YUR A;  1A29 A;  1ZAC A;  3TZ1 A;  4A4C A;  4I5N B;  3EK7 A;  2PMY A;  2VRG A;  1S36 A;  2KQ6 A;  1QIW A;  1C07 A;  3JVT C;  1QIV A;  1YRT B;  3E3R A;  2KFG A;  1TTX A;  3CWG A;  2LVV A;  2V53 A;  3F45 A;  4AQI A;  3OB2 B;  3SIB A;  4MZJ A;  3GOF A;  1CNP A;  5JOL A;  1M45 A;  1TRF A;  3CS1 A;  1MWN A;  1LXF C;  2JPT A;  2P6B B;  2G9B A;  1SL7 A;  1JUO A;  1CB1 A;  1KK8 B;  3GK1 A;  1N2D A;  1B47 A;  1UWO A;  4JWQ A;  4N1G A;  2L51 A;  1Y1U A;  2LLS A;  4IL1 A;  1S5G Z;  1V1G A;  4BY4 A;  1N0Y A;  1WLM A;  2KI4 B;  2MJW B;  3EK4 A;  1UHH A;  1REC A;  1QTX A;  4YRU A;  1DTL A;  1NCY A;  1S3P A;  4JPZ B;  1GGZ A;  4ORB B;  4I5L B;  1WRK A;  2BCA A;  1S5G Y;  2BL0 C;  1L2O B;  2EC6 C;  5ER5 A;  4GBA A;  2DOQ A;  1CDM A;  1A2X A;  3CR5 X;  1QV0 A;  1J7O A;  5F6T A;  3KO0 A;  3DF0 B;  1BJF A;  2LVI A;  1MXE A;  1PRW A;  4YGE B;  1WDC C;  2QAC A;  2K2A A;  5HKW A;  2Q91 A;  2MA2 A;  1E8A A;  2ISD A;  1XVJ A;  5HLV A;  4GGN A;  4GGF A;  1RK9 A;  1SPY A;  3EKJ A;  2RGI A;  4WQ2 A;  1YVL A;  3NSO A;  2OTG B;  1YUT A;  3SG6 A;  2GGZ A;  1A75 A;  5B8I B;  1YRU B;  2NLN A;  1WRZ A;  1B4C A;  3GK2 A;  2KYC A;  1DJZ A;  1AVS A;  1LA3 A;  1QLS A;  2Q4U A;  1W7I B;  2JTZ A;  3CZT X;  1HQV A;  4QJ3 B;  5CPV A;  2PRU A;  5HYD A;  3AKB A;  1OSA A;  1K96 A;  4P5O E;  1IGV A;  2ZRS A;  1EH2 A;  1JF2 A;  2M9G A;  1JWD A;  1Y0V H;  2L2E A;  1Q80 A;  1M31 A;  1Y1X A;  5BPJ A;  1SR6 C;  1D1O A;  3TDI A;  2KDH A;  2KQY A;  2M7N A;  2I94 A;  3JTD B;  1MF8 B;  1F54 A;  4NDB A;  4XYN A;  2HQW A;  2K7B A;  1IG5 A;  2K0J A;  2F2P A;  3OX5 A;  4FQO A;  4MSP A;  3K21 A;  2A4J A;  2JTT A;  4E68 A;  2BKH B;  3LK0 A;  2PAS A;  1A03 A;  3OHM B;  1XFV O;  1K9K A;  2KFH A;  3PN7 B;  1DF0 B;  4YGC B;  4GGF C;  5J3X A;  4CID A;  1U5I B;  3I5F C;  1K94 A;  1S26 D;  1DJX A;  2CBL A;  2JOJ A;  2KNE A;  1K90 D;  2PSR A;  1WRL A;  3A8R A;  1XK4 A;  2LNK A;  3O2P A;  1HT9 A;  2WND A;  3TS5 C;  1ALW A;  4TNC A;  1JF0 A;  4ICB A;  1H8B A;  3GK4 X;  4ZCV A;  2AAO A;  3NXA A;  4YBH B;  4MLW A;  2Y4Q A;  1J55 A;  2LE9 B;  1W7J B;  2BEC A;  1S6I A;  2JNX A;  2JT0 A;  3VRQ A;  1MXL C;  1NUB A;  4GPL B;  1ZFS A;  2HET A;  1MQ1 A;  1QX2 A;  2K7C A;  3EVV A;  3WXA A;  4DCK A;  1FBV A;  1IQ3 A;  1QVI Y;  1QJT A;  2MLF C;  3TUY B;  3BUN B;  3PAT A;  3VRR A;  1SCM C;  1KQM C;  1GGW A;  1NSH A;  1M63 B;  3O6B A;  3H4S E;  3I5G B;  4AQJ A;  1B9A A;  2CNP A;  2Y1M A;  2M1U A;  1TCO B;  1KK7 Z;  2JZI A;  4OVN F;  1M39 A;  4PHJ A;  1LVC D;  2L50 A;  1XFW O;  4CFR A;  1AJ5 A;  2F8P A;  5I2Q A;  1CM1 A;  2LCP A;  4BY5 A;  1MR8 A;  1XYD A;  3LCP C;  3WHT B;  1RJV A;  1IRJ A;  1CDP A;  1IJ5 A;  2O5G A;  3EVU A;  1AJ4 A;  2WCF A;  3DF0 A;  1KWO C;  1UHK A;  3SG3 A;  2I18 A;  1QV1 A;  2WOR A;  1NX3 A;  1XK4 C;  1DJI A;  1FF1 A;  1EL4 A;  2L4H A;  3DVM A;  2WOS A;  1SL8 A;  1SY9 A;  1YUS A;  1PVA A;  2F3Y A;  4AOM A;  2JC2 A;  2LUX A;  1LA0 A;  1DGV A;  1NX0 A;  2LHL A;  5DKQ A;  1CM4 A;  1R2U A;  3OX6 A;  2R2I A;  2KYF A;  1XFU O;  4PHK A;  4MZK A;  1JSA A;  3IQQ A;  1KK8 C;  4ORA B;  1SK6 D;  2Y5I A;  4MRY A;  2PVB A;  2JQ6 A;  2WCE A;  1SW8 A;  5AER A;  1FI5 A;  1YVH A;  3NSL A;  1RWY A;  1G33 A;  3PLF B;  4M2Q A;  2CXJ A;  2LLU A;  3DVE A;  3D10 A;  4NDD A;  1PAL A;  4M2O A;  1KSO A;  5K89 A;  4I5J A;  3I5H B;  2LVK A;  2PAL A;  3WHU B;  1CFF A;  2TN4 A;  3M0W A;  4GFT A;  1QXP A;  4YGD B;  3A4U B;  1B8R A;  2FCE A;  4GNK B;  5JJG A;  4M2P A;  1L2O C;  2OS8 B;  3OB1 B;  1ZUZ A;  2EHB A;  1S1E A;  3SG7 A;  4HRG A;  4QJ5 B;  2SAS A;  4XJK B;  1KSM A;  1ODB A;  1S6J A;  1GQM A;  2NCP A;  1R6P A;  3BXK A;  1OMR A;  1DJW A;  4OKH A;  1BOD A;  1EJ3 A;  4QJ4 B;  2LMT A;  2L4I A;  3VRN A;  1Y6W A;  2H2K A;  2BCB A;  2WC8 A;  3C1V A;  1J7Q A;  1DF0 A;  1UP5 A;  1EG4 A;  5DKN A;  1CDL A;  1UUS A;  3BOW B;  4P2Y B;  1F4Q A;  1PVB A;  2K7O A;  3I5I B;  4CFQ A;  2M97 A;  2LP3 A;  4PHM A;  4PE0 A;  1JC2 A;  3SIA A;  1AK8 A;  2KHN A;  5HKY A;  1QLK A;  1XO5 A;  2KSP A;  3LL8 B;  5HLO A;  1CLM A;  1LIN A;  5DKR A;  3RLZ A;  3BUM B;  2FOT A;  1K2H A;  3KPX A;  1UHI A;  2LHI A;  3RM1 A;  1XFZ O;  2CTN A;  1JFK A;  3EK8 A;  3VGO A;  5GQQ C;  4I5K A;  2LLT A;  1UHJ A;  2ZN8 A;  1PSR A;  3BUW B;  2FCD A;  1F55 A;  1BR1 B;  3SG4 A;  1ALV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...