1IQ3A

Solution structure of the eps15 homology domain of a human pob1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
110
structure length
110
Chain Sequence
GSLQDNSSYPDEPWRITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAAFHLIVARKNGYPLPEGLPPTLQPEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Eps15 homology domain of a human POB1 (partner of RalBP1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
molecule keywords RALBP1-INTERACTING PROTEIN (PARTNER OF RALBP1)
total genus 13
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2001-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1iq3A00
3LLEA 1JFJA 1LA0A 2NZ0A 1B8LA 2LE9B 1M31A 2M0RA 3GK2A 5TNCA 3TZ1A 5B8IB 5BPJA 5ER5A 3BYAA 1F4QA 4P5OE 4JWQA 2WCBA 4PCWA 3SG6A 4XJKB 5CSFA 2JT3A 1F8HA 1XFXO 2MLEC 1UHKA 2M7LA 3CLNA 1CFPA 1SCVA 1X02A 4M2PA 1L2OC 4I5JA 1CLMA 1A03A 3M0WA 4WQ2A 2KFGA 1SL9A 1F71A 1BR4B 2JWWA 1PK0D 1CFDA 1OOJA 4OKHA 2JNXA 2SCPA 2KHNA 4YRUA 2KDHA 2H61A 2WORA 4E68A 2O60A 1TNQA 1V1FA 2LV7A 3PSRA 4GFTA 1TN4A 5HLOA 4PDZA 2BBNA 3QRXA 4P2YB 1S26D 1K90D 1YUTA 1GGZA 3CGAA 1NP8A 1DJYA 4GNKB 1B7TZ 2G2BA 1QATA 1XA5A 1OMRA 1S36A 1K9KA 1KQMC 3OP0A 2K2FA 1DTLA 5HLVA 4ORCB 1RECA 2WCEA 1M63B 2A4JA 2CXJA 2MRDA 3KHEA 2L51A 1CM1A 2K8MB 2BKHB 1TCFA 1RJVA 2NCPA 2KBMA 4PE1A 1NSHA 1H4BA 4GAOA 2Q4UA 4DUQA 2LMVA 5AANA 1KFUL 2LCPA 2L50A 1TRFA 1LINA 2ZN9A 1OSAA 1DF0A 1S6JA 2M49B 4YGEB 5KU1A 4U8DA 4MBEA 3AKAA 2MBXA 5I2QA 3RM1A 4PHKA 1KWOC 1OZOA 2KNEA 4I5LB 2MLFC 2PALA 1YX7A 4I5KA 2ZNDA 4USLA 1LA3A 1M46A 1WDCB 2JULA 3D0YA 2BCBA 2M8UA 1L2OB 2HPSA 1EJ3A 1GGWA 1PVAA 3SIAA 5I8NA 5I2LA 3JTDC 3BOWB 5HKWA 2EC6B 2K2AA 2ZRSA 2IS9A 1B8CA 2G9BA 2JTZA 1GJYA 2KI4B 1S6CA 1TNXA 1B8RA 1NPQA 1SR6C 2LLSA 1QVIZ 2O5GA 1IKUA 4QJ3B 1Y0VH 1IH0A 2QPTA 1K94A 1D1OA 2JT0A 3I5HB 2GGZA 4QJ4B 1SL7A 2KAYA 4CPVA 1S1EA 1J7PA 3BOWA 1AJ5A 1UHHA 3IQQA 1QX7A 1VRKA 4C0LA 2KI6D 1YURA 2CCMA 4MLWA 1KQMB 1M39A 1UHNA 3AAKA 1YRTB 2L98A 2LVVA 2I7AA 1MHOA 2AUCA 2KYCA 2FCDA 2LLUA 1SRAA 5D7FA 2I18A 1WLMA 1NCYA 4MVFA 4F0ZB 1ODBA 1CLBA 4GGFA 1QXPA 1RROA 4A4BA 1LVCD 2ZFDA 2M1KB 3SG7A 3DF0A 1IQ5A 4TNCA 2ZRTA 1Y1UA 2V53A 4I5NB 3PFVA 1YUUA 3I5GC 2JOJA 4MZLA 4DRWA 2QACA 2WOSA 3EVRA 2FCEA 3JVTC 1CMGA 2OS8C 3TDUA 5AFPA 3VRNA 1N65A 1TNWA 4OR9B 1DJXA 4DIRA 1NX0A 1U5IB 1IRJA 2LHLA 4MN0A 1AJ4A 3DVEA 1K95A 2JXCA 2BBMA 2E6WA 3OX6A 1S6IA 2Y5IA 1OE9B 1CKKA 1RFJA 4PE7A 3SG4A 2ISDA 1AVSA 1MXLC 2ZNEA 1V1GA 3O78A 3SG5A 2LVKA 3CTNA 3I5IC 2OPOA 3BXKA 3H4SE 1B47A 2PRUA 2LNKA 4YGAA 1YRUB 2LP2A 1QTXA 3HCMA 2BECA 2F2OA 2KFFA 4YI8A 1JSAA 1CDLA 4PE4A 2F3YA 4YBHB 4YGCB 1FBVA 3WHTB 1S5GZ 1QJTA 1WDCC 2KBIA 4PHNA 1K96A 4XJKA 1QIWA 1QVIY 5AERA 3IF7A 3BUXB 3TDIA 1KWOB 1UP5A 2JNFA 3CR2A 4PHJA 2ZN8A 1AUIB 2OTGC 1PSBA 5K89A 3KEVA 1QV1A 2HQ8A 3NSOA 2K7CA 2LM5A 1K9UA 2NCOA 1XYDA 3VROA 1CFFA 1F70A 1NUBA 5J3XA 1J1DA 5FYXA 1Q80A 1FF1A 1TCOB 3FIAA 4GPLB 1W7JB 4JQ0D 3WNXB 2L4IA 1NIWA 1B1GA 2K7BA 2LHIA 2MAZA 1AP4A 3MSEB 3FS7A 1S3PA 2LC5A 5PALA 2ZKMX 1XO5A 4GGNA 1QLSA 3SJSA 2H2KA 1FW4A 5DKNA 2KGRA 2HF5A 5AEQA 4AQIA 1SYMA 1EH2A 4N5XA 2R2IA 3ZNIA 2EGDA 2M97A 3DVJA 3FWCA 2KYFA 3EK7A 1UUSA 4DS7A 3CS1A 4OVNF 1HQVA 3WHUB 3LL8B 2SASA 2KAVA 3PATA 2M29A 1ZOTB 4BY5A 1KK8C 1JC2A 1MQ1A 4YGDB 1QV0A 1SCMB 2K61A 4OCIA 4CIDA 3VGOA 1RK9A 4CFQA 1B9AA 3NSLA 2L5XB 1DT7B 2AMIA 5DKQA 1EL4A 1EXRA 4MZJA 4R1EA 1KFXL 5D69A 1LKJA 2PMYA 1CB1A 1BG1A 3BUNB 3CR5X 4NDBA 3LK0A 2EC6C 3KO0A 4WQ3A 1DJWA 4MSPA 4PHMA 1EG3A 1PRWA 2KSPA 3A4UB 2LP3A 1N0YA 1PULA 4HSZA 2M1UA 3DF0B 5JOLA 1R2UA 2WCFA 1MF8B 3I5HC 2BL0B 2CNPA 3A8RA 2LAPA 2Y1NA 1QX2A 2JT8A 2VRGA 1SY9A 2LVJA 4WRIA 1K2HA 1IG5A 1CNPA 3O4YA 2B1UA 4FTGA 1SW8A 4NQGA 1BJFA 4MEWA 3C1VA 1PALA 3AAJA 1JBAA 2BE6A 1J1EA 1QASA 1TIZA 4HRHA 5JJGA 5HKZA 3BQ3A 3D10A 1J7QA 2P6BB 2E30A 2BE4A 1YVLA 4PE0A 1OQPA 1R6PA 2F33A 1XFYO 4D1EA 1BR1B 2BCXA 2LMTA 1BF5A 2KI4C 1SMGA 3ICBA 5CSJA 3HX4A 3DD4A 1TTXA 2F2PA 3EKHA 1UWOA 2K0JA 3GK4X 4ETOA 4DCKA 1C7WA 1C7VA 3KPXA 1KSMA 1IJ6A 3PLFB 3PN7C 1JWDA 4PALA 1K8UA 1DGUA 1AK8A 5KTYA 1SPYA 1M45A 1JFKA 2L2EA 2JRFA 5IBWA 1GQMA 1ALVA 1WRKA 2KAXA 1BU3A 1S5GY 1Y1AA 3ZWHA 1H8BA 2AAOA 2F8PA 4C0JA 5DKRA 4N1FA 1SL8A 4CFRA 1NCXA 3LCPC 1SKTA 1ALWA 4IL1A 4ZCVA 2GGMA 3TS5C 1XVJA 1KFUS 4AOMA 1FI6A 2RGIA 1DMOA 1F54A 1JF2A 2LMUA 1QX5B 2CT9A 1CDNA 1L7ZA 1CMFA 2BCAA 3PN7B 4JPZB 1BODA 3WXAA 1DJHA 4UPGA 1B4CA 2WC8A 1ZFSA 2KQYA 1NWDA 1WY9A 3LK1A 1UHJA 1ZUZA 4ICBA 4N1GA 3VRRA 4BY4A 2JTTA 3I5FC 3DVKA 2M9GA 1TNPA 2D8NA 4A4CA 1CTRA 1F4OA 1NYAA 2K7DA 3OB1B 1ZMZA 1RWYA 4MRXA 1KQVA 1K9PA 3PM8A 3I5FB 2M7NA 3KF9A 1MXEA 4NDCA 2H61C 1C07A 1E8AA 1TOPA 3TUYC 3DVMA 1DVIA 1KSOA 1XFZO 1U5IA 1QIVA 5HYDA 2KGBC 1LXFC 2JQ6A 2LLTA 2WNDA 3GOFA 1IWQA 4GBAA 1FI5A 1AHRA 3D0YB 4M2OA 1NX1A 1CLLA 3RLZA 3EVVA 3K21A 1KFXS 1WLZA 2KOTA 2Y4QA 3EK8A 4L9MA 2LUXA 1G8IA 1KK7Z 1YTZC 1NCZA 1G33A 1WRZA 4MZKA 2OTGB 3BUMB 2LANA 1A4PA 3IQOA 2DOQA 1OMVA 1J7RA 1A2XA 1JUOA 3O2PA 5I2OA 2BL0C 2CBLA 5AXIA 1ZACA 1XK4A 1UHIA 1W7IB 1YVHA 2JPTA 4MRYA 1IGVA 2MJWB 4C0KA 1SCMC 2GV5A 2K7OA 3TUYB 3TDZA 2FJUB 4YI9A 1MR8A 2Y1MA 2NLNA 3F45A 2JC2A 2LVIA 2PVBA 4ORBB 2HQWA 2L0PA 4YGBB 3BUOB 1SK6D 3VRPA 3GK1A 3EVUA 1K93D 4ZCUA 1PVBA 1J55A 1A75B 4XYNA 4GGFC 3VRQA 1XFVO 1YUSA 1KK8B 2MHHA 2Q91A 2HETA 3PALA 1QS7A 1WRLA 1RTP1 5G08A 1BT6A 1XFUO 2KI6C 3I5IB 1YX8A 2L4HA 4HRGA 1JF0A 1G4YR 1IJ5A 2M3WA 3I5GB 1SR6B 2PSRA 1CDPA 1PSRA 2BKIB 3AKBA 1KK7Y 3BUWB 3O6BA 3SIBA 1BOCA 2OS8B 3NXAA 5CSIA 2MA2A 2NXQA 1UURA 1DGVA 1DF0B 2PASA 2I2RE 4HREE 1MUXA 1HT9A 3E3RA 1B7TY 1SNLA 2TN4A 5ER4X 1N2DA 1OMDA 5HKYA 3EK4A 1NX3A 1XK4C 1Y6WA 1YR5A 3TS5B 1CFCA 1IQ3A 3JVTB 2EHBA 1BLQA 2KFHA 4QJ5B 5CPVA 4FQOA 2F3ZA 5KSZA 1DJGA 1SBJA 3NSIA 1DJIA 4OV2A 1DJZA 5GQQC 2KQ6A 1QLKA 3OHMB 3JTDB 1XFWO 3NSKA 5F6TA 1J7OA 2JU0A 4AQJA 1FPWA 1A75A 4M2QA 3EKJA 1CM4A 4ORAB 2I94A 3SG3A 2JXLA 1CDMA 3CWGA 1BMOA 4CLNA 4Q04A 2LUCA 2JZIA 1MWNA 2FOTA 3CZTX 1OZSA 1F55A 1Y1XA 3FWBA 5CSNA 1NX2A 2CTNA 1EG4A 3OX5A 3SG2A 2COLB 3OB2B 4NDDA 4GUKA 1A29A 1KCYA 3CR4X
chains in the Genus database with same CATH superfamily
3LLEA 1JFJA 1LA0A 2NZ0A 1B8LA 2LE9B 1M31A 2M0RA 3GK2A 5TNCA 3TZ1A 5B8IB 5BPJA 5ER5A 3BYAA 2P70A 1F4QA 4P5OE 3L47A 4JWQA 2WCBA 4PCWA 3SG6A 4XJKB 5CSFA 2JT3A 1F8HA 1XFXO 2MLEC 1UHKA 2M7LA 3CLNA 1CFPA 1SCVA 1X02A 3R1OA 4M2PA 2PQLA 1L2OC 3FE8A 4I5JA 1CLMA 1A03A 3D75A 3M0WA 4WQ2A 2KFGA 1SL9A 3QMEA 1F71A 1BR4B 2JWWA 1PK0D 1CFDA 1OOJA 4OKHA 2JNXA 2SCPA 3IVTA 2KHNA 1IIOA 4YRUA 2KDHA 2H61A 2WORA 4E68A 2O60A 1TNQA 1V1FA 2LV7A 3PSRA 4GFTA 2JPOA 4INXA 1OOGA 1TN4A 5HLOA 2GTEA 4PDZA 2BBNA 3QRXA 4P2YB 1S26D 1K90D 1YUTA 1GGZA 3CGAA 1GM0A 1NP8A 1DJYA 3CZ1A 4GNKB 2WC5A 1B7TZ 2G2BA 1QATA 1XA5A 1OMRA 1S36A 1K9KA 1KQMC 3OP0A 2K2FA 1DTLA 5HLVA 4ORCB 1RECA 2WCEA 1M63B 2A4JA 2CXJA 2MRDA 3KHEA 2L51A 2PYQA 1CM1A 2K8MB 2BKHB 1TCFA 1RJVA 2NCPA 2KBMA 4PE1A 1NSHA 1H4BA 4GAOA 2Q4UA 2WC6A 3VB1A 4DUQA 1C3ZA 2LMVA 5AANA 1KFUL 2LCPA 2L50A 4IJ7A 1TRFA 1LINA 2ZN9A 1OSAA 1DF0A 1S6JA 2M49B 4YGEB 3DXLA 5KU1A 4U8DA 4MBEA 1XFRA 3AKAA 2MBXA 5I2QA 3RM1A 4PHKA 1KWOC 1OZOA 2KNEA 4I5LB 2MLFC 2PALA 1YX7A 4I5KA 2ZNDA 4USLA 1LA3A 1M46A 1WDCB 2JULA 3D0YA 2BCBA 2M8UA 1L2OB 2HPSA 1EJ3A 1GGWA 1PVAA 3SIAA 5I8NA 5I2LA 3JTDC 3BOWB 5HKWA 2EC6B 3D77A 1DEKA 2K2AA 3DZTA 2ZRSA 2IS9A 1B8CA 2G9BA 2JTZA 1GJYA 2KI4B 1S6CA 3CZ2A 1TNXA 1B8RA 1NPQA 1SR6C 2LLSA 1QVIZ 2O5GA 1IKUA 4QJ3B 1Y0VH 1IH0A 3S0GA 3RZSA 2QPTA 1K94A 2WCJA 1D1OA 2JT0A 3I5HB 2GGZA 3CYZA 1SL7A 4QJ4B 2KAYA 4CPVA 1S1EA 1J7PA 3BOWA 1AJ5A 1UHHA 3IQQA 3Q8IA 1QX7A 2KLEA 1VRKA 4C0LA 2KI6D 1YURA 2CCMA 4MLWA 1W9ZA 1KQMB 1M39A 1UHNA 3AAKA 1YRTB 2L98A 2LVVA 2I7AA 1MHOA 2AUCA 2KYCA 2FCDA 2LLUA 1SRAA 2QEHA 2I18A 1WLMA 1NCYA 4MVFA 5D7FA 1ODBA 3SS4A 1CLBA 4GGFA 1QXPA 1RROA 3DY9A 4A4BA 1LVCD 2ZFDA 1OOIX 1QWVA 2M1KB 4JD9A 3SG7A 3DF0A 1IQ5A 4TNCA 2ZRTA 1Y1UA 2V53A 4I5NB 3PFVA 1YUUA 3I5GC 2JOJA 2QEOA 4MZLA 4DRWA 2QACA 2WOSA 3EVRA 2FCEA 3JVTC 1CMGA 2OS8C 3TDUA 5AFPA 3BFBA 3VRNA 1N65A 1TNWA 4OR9B 1DJXA 4DIRA 1NX0A 1OOFA 1U5IB 1IRJA 2LHLA 3L4AA 4MN0A 1AJ4A 3DVEA 1K95A 1SSEB 2JXCA 2BBMA 2E6WA 3OX6A 1S6IA 2Y5IA 1OE9B 1CKKA 1RFJA 4PE7A 3SG4A 2ISDA 1AVSA 1MXLC 2ZNEA 1V1GA 3O78A 3SG5A 2LVKA 3CTNA 3I5IC 2OPOA 3BXKA 3H4SE 1B47A 2PRUA 2LNKA 4YGAA 1YRUB 4JKTA 2LP2A 1QTXA 3HCMA 2BECA 2F2OA 2KFFA 3D74A 4YI8A 1JSAA 5HL1A 1CDLA 4PE4A 2F3YA 4YBHB 4YGCB 1FBVA 3WHTB 1S5GZ 1QJTA 1WDCC 2KBIA 4PHNA 2BNXA 1K96A 1QIWA 1QVIY 3R1VA 4XJKA 5AERA 1C3YA 3IF7A 2BAPA 3BUXB 3TDIA 1KWOB 1UP5A 2JNFA 3CR2A 4PHJA 2ZN8A 1AUIB 2OTGC 1PSBA 5K89A 3KEVA 1QV1A 2HQ8A 3FE9A 3NSOA 2K7CA 2LM5A 1K9UA 2NCOA 1XYDA 3VROA 1CFFA 1F70A 2WCMA 1NUBA 5J3XA 1J1DA 5FYXA 1Q80A 1FF1A 1TCOB 3FIAA 4GPLB 1DQEA 1W7JB 4JQ0D 3WNXB 2L4IA 1NIWA 2KPHA 1B1GA 4KYNA 2K7BA 2LHIA 2MAZA 1AP4A 3MSEB 3FS7A 1S3PA 2LC5A 5PALA 2KLDA 2ZKMX 1XO5A 4GGNA 1QLSA 3SJSA 2H2KA 1FW4A 5DKNA 4F0ZB 2KGRA 2HF5A 3BFAA 5AEQA 4AQIA 1SYMA 3CABA 2WCKA 1T14A 4N5XA 2R2IA 1EH2A 3OBVA 2EGDA 2M97A 3DVJA 3FWCA 3ZNIA 2K60A 2KYFA 3EK7A 1UUSA 4DS7A 3CS1A 1LS8A 1HQVA 1Z2CB 3LL8B 4OVNF 2SASA 2KAVA 3PATA 2M29A 2WCHA 3WHUB 4F7FA 1ZOTB 4BY5A 1KK8C 3S0BA 1JC2A 1MQ1A 4YGDB 1QV0A 1DC1A 1SCMB 2K61A 4OCIA 4CIDA 3VGOA 1RK9A 3D73A 4CFQA 1B9AA 3NSLA 2L5XB 1DT7B 2AMIA 5DKQA 1EL4A 1EXRA 4MZJA 4R1EA 1KFXL 5D69A 1LKJA 2PMYA 1CB1A 1BG1A 3BUNB 3CR5X 4NDBA 3LK0A 2EC6C 3CZ0A 3KO0A 4WQ3A 1DJWA 2ERBA 4MSPA 4PHMA 1EG3A 1PRWA 2KSPA 3A4UB 2LP3A 1N0YA 1PULA 3B6XA 3K1EA 4HSZA 2M1UA 3DF0B 5JOLA 1R2UA 2WCFA 1MF8B 3I5HC 2BL0B 2CNPA 2H8VA 3A8RA 2LAPA 2Y1NA 3DYEA 1QX2A 2JT8A 2VRGA 1SY9A 2LVJA 4WRIA 1DELA 3R72A 1K2HA 1IG5A 1CNPA 3O4YA 2B1UA 3D76A 4FTGA 3SS3A 1SW8A 4NQGA 1BJFA 4MEWA 3C1VA 1TUZA 1PALA 3AAJA 1JBAA 2BE6A 1J1EA 1QASA 1TIZA 4HRHA 5JJGA 5HKZA 3UO9A 3BQ3A 3D10A 1J7QA 2P6BB 2E30A 2BE4A 1YVLA 5DICA 4PE0A 3S0AA 3S0FA 1OQPA 1R6PA 2F33A 1XFYO 4D1EA 1BR1B 2BCXA 2LMTA 3UNWA 2KI4C 1BF5A 1SMGA 1TUJA 3ICBA 2L5YA 3HX4A 5CSJA 3DD4A 1TTXA 2F2PA 2YGUA 1UWOA 2K0JA 3EKHA 3GK4X 3S0EA 4DCKA 1C7WA 4ETOA 1C7VA 3KPXA 3PJIA 1KSMA 1IJ6A 3PLFB 3PN7C 1JWDA 4PALA 1K8UA 1DGUA 1AK8A 5KTYA 1SPYA 3B7AA 1M45A 1JFKA 2L2EA 2JRFA 5IBWA 1GQMA 5FI6A 1ALVA 1WRKA 2KAXA 5D3OA 1BU3A 3R1PA 1S5GY 1Y1AA 3ZWHA 1H8BA 2AAOA 2F8PA 4C0JA 5DKRA 4N1FA 1SL8A 4CFRA 1NCXA 1Z4HA 3LCPC 1SKTA 1ALWA 4IL1A 4ZCVA 2GGMA 3TS5C 1XVJA 1KFUS 4OZDA 4AOMA 1FI6A 2RGIA 1DMOA 1F54A 1JF2A 2LMUA 1QX5B 2CT9A 1CDNA 1L7ZA 1CMFA 2BCAA 3PN7B 4JPZB 1BODA 3WXAA 3B87A 1DJHA 3V2LA 4UPGA 1B4CA 2WC8A 1ZFSA 2KQYA 1NWDA 1WY9A 3LK1A 1UHJA 1ZUZA 4ICBA 4N1GA 3VRRA 4BY4A 2JTTA 3I5FC 3DVKA 2M9GA 1TNPA 2D8NA 4A4CA 1CTRA 1F4OA 1NYAA 2K7DA 3OB1B 1ZMZA 4INWA 1RWYA 3B86A 4MRXA 1BOCA 1KQVA 1K9PA 3PM8A 3I5FB 2M7NA 3KF9A 1MXEA 4NDCA 2H61C 1C07A 1E8AA 1TOPA 3TUYC 3DVMA 1XFZO 1DVIA 1KSOA 1U5IA 2FJYA 1QIVA 5HYDA 2KGBC 3NHTA 1LXFC 2JQ6A 2LLTA 2WNDA 3GOFA 1IWQA 4GBAA 1FI5A 1AHRA 3D0YB 4M2OA 1NX1A 1CLLA 1ORGA 3RLZA 3EVVA 3K21A 1KFXS 1WLZA 2KOTA 2Y4QA 3EK8A 4L9MA 2LUXA 1G8IA 1KK7Z 1YTZC 1NCZA 1G33A 1WRZA 4MZKA 2OTGB 3BUMB 2LANA 1A4PA 3IQOA 2DOQA 1OMVA 1J7RA 1A2XA 1JUOA 3O2PA 5I2OA 2BL0C 3FE6A 1TWOA 2CBLA 5AXIA 1ZACA 4FQTA 1XK4A 1UHIA 1W7IB 3B88A 3D78A 1YVHA 2JPTA 4MRYA 1IGVA 2MJWB 4C0KA 1SCMC 3S0DA 2GV5A 2K7OA 3TUYB 3TDZA 2FJUB 4YI9A 1MR8A 2Y1MA 2NLNA 3F45A 2JC2A 2LVIA 1OOHA 2PVBA 4ORBB 2HQWA 2L0PA 2QEVA 3BUOB 1OW4A 4YGBB 1SK6D 3VRPA 3GK1A 3EVUA 1K93D 4ZCUA 1PVBA 1J55A 1A75B 4XYNA 4GGFC 3VRQA 1XFVO 1YUSA 1KK8B 2MHHA 2Q91A 2HETA 3PALA 1QS7A 1WRLA 1RTP1 2L2CA 3CDNA 5G08A 1BT6A 1XFUO 2KI6C 3I5IB 1YX8A 2L4HA 2QDIA 5EL2A 4HRGA 1JF0A 1G4YR 1IJ5A 2M3WA 3NHIA 3I5GB 1SR6B 2WCLA 2PSRA 1CDPA 1PSRA 2BKIB 3AKBA 1KK7Y 3BUWB 3O6BA 4PT1A 3SIBA 2OS8B 3NXAA 3BFHA 5CSIA 3PM2A 2MA2A 2NXQA 3NGVA 1UURA 1DGVA 1DF0B 2PASA 3L4LA 2I2RE 4HREE 1MUXA 1HT9A 3BJHA 3E3RA 1B7TY 1SNLA 2TN4A 5ER4X 1N2DA 1OMDA 5HKYA 5FI2A 5I94A 3EK4A 1NX3A 1XK4C 1Y6WA 1YR5A 3TS5B 1CFCA 1IQ3A 3JVTB 3OGNA 2EHBA 1BLQA 3O4XA 2KFHA 4QJ5B 5CPVA 4FQOA 5FI7A 2F3ZA 5KSZA 1DJGA 1SBJA 3NSIA 1DJIA 4OV2A 1DJZA 5GQQC 2KQ6A 1QLKA 3OHMB 3JTDB 1XFWO 1P28A 3EG5B 3NSKA 5F6TA 3N7HA 1J7OA 2JU0A 4AQJA 1FPWA 3SS5A 1A75A 4M2QA 3EKJA 1CM4A 4ORAB 2I94A 3SG3A 2JXLA 1CDMA 3CWGA 1BMOA 4CLNA 4Q04A 2LUCA 2JZIA 1MWNA 2FOTA 3CZTX 1OZSA 1F55A 1Y1XA 3FWBA 5CSNA 1NX2A 2QEBA 2CTNA 1EG4A 3OX5A 3SG2A 2COLB 3OB2B 4NDDA 4GUKA 1A29A 1KCYA 2P71A 3CR4X
chains in the Genus database with same CATH topology
3LLEA 1JFJA 1LA0A 2NZ0A 1B8LA 2LE9B 1M31A 2M0RA 3GK2A 5TNCA 3TZ1A 5B8IB 5BPJA 5ER5A 3BYAA 1F4QA 4P5OE 4JWQA 2WCBA 4PCWA 3SG6A 4XJKB 5CSFA 2JT3A 1F8HA 1XFXO 2MLEC 1UHKA 2M7LA 3CLNA 1CFPA 1SCVA 1X02A 4M2PA 1L2OC 4I5JA 1CLMA 1A03A 3M0WA 4WQ2A 2KFGA 1SL9A 1F71A 1BR4B 2JWWA 1PK0D 1CFDA 1OOJA 4OKHA 2JNXA 2SCPA 2KHNA 4YRUA 2KDHA 2H61A 2WORA 4E68A 2O60A 1TNQA 1V1FA 2LV7A 3PSRA 4GFTA 1TN4A 5HLOA 4PDZA 2BBNA 3QRXA 4P2YB 1S26D 1K90D 1YUTA 1GGZA 3CGAA 1NP8A 1DJYA 4GNKB 1B7TZ 2G2BA 1QATA 1XA5A 1OMRA 1S36A 1K9KA 1KQMC 3OP0A 2K2FA 1DTLA 5HLVA 4ORCB 1RECA 2WCEA 1M63B 2A4JA 2CXJA 2MRDA 3KHEA 2L51A 1CM1A 2K8MB 2BKHB 1TCFA 1RJVA 2NCPA 2KBMA 4PE1A 1NSHA 1H4BA 4GAOA 2Q4UA 4DUQA 2LMVA 5AANA 1KFUL 2LCPA 2L50A 1TRFA 1LINA 2ZN9A 1OSAA 1DF0A 1S6JA 2M49B 4YGEB 5KU1A 4U8DA 4MBEA 3AKAA 2MBXA 5I2QA 3RM1A 4PHKA 1KWOC 1OZOA 2KNEA 4I5LB 2MLFC 2PALA 1YX7A 4I5KA 2ZNDA 4USLA 1LA3A 1M46A 1WDCB 2JULA 3D0YA 2BCBA 2M8UA 1L2OB 2HPSA 1EJ3A 1GGWA 1PVAA 3SIAA 5I8NA 5I2LA 3JTDC 3BOWB 5HKWA 2EC6B 2K2AA 2ZRSA 2IS9A 1B8CA 2G9BA 2JTZA 1GJYA 2KI4B 1S6CA 1TNXA 1B8RA 1NPQA 1SR6C 2LLSA 1QVIZ 2O5GA 1IKUA 4QJ3B 1Y0VH 1IH0A 2QPTA 1K94A 1D1OA 2JT0A 3I5HB 2GGZA 4QJ4B 1SL7A 2KAYA 4CPVA 1S1EA 1J7PA 3BOWA 1AJ5A 1UHHA 3IQQA 1QX7A 1VRKA 4C0LA 2KI6D 1YURA 2CCMA 4MLWA 1KQMB 1M39A 1UHNA 3AAKA 1YRTB 2L98A 2LVVA 2I7AA 1MHOA 2AUCA 2KYCA 2FCDA 2LLUA 1SRAA 5D7FA 2I18A 1WLMA 1NCYA 4MVFA 4F0ZB 1ODBA 1CLBA 4GGFA 1QXPA 1RROA 4A4BA 1LVCD 2ZFDA 2M1KB 3SG7A 3DF0A 1IQ5A 4TNCA 2ZRTA 1Y1UA 2V53A 4I5NB 3PFVA 1YUUA 3I5GC 2JOJA 4MZLA 4DRWA 2QACA 2WOSA 3EVRA 2FCEA 3JVTC 1CMGA 2OS8C 3TDUA 5AFPA 3VRNA 1N65A 1TNWA 4OR9B 1DJXA 4DIRA 1NX0A 1U5IB 1IRJA 2LHLA 4MN0A 1AJ4A 3DVEA 1K95A 2JXCA 2BBMA 2E6WA 3OX6A 1S6IA 2Y5IA 1OE9B 1CKKA 1RFJA 4PE7A 3SG4A 2ISDA 1AVSA 1MXLC 2ZNEA 1V1GA 3O78A 3SG5A 2LVKA 3CTNA 3I5IC 2OPOA 3BXKA 3H4SE 1B47A 2PRUA 2LNKA 4YGAA 1YRUB 2LP2A 1QTXA 3HCMA 2BECA 2F2OA 2KFFA 4YI8A 1JSAA 1CDLA 4PE4A 2F3YA 4YBHB 4YGCB 1FBVA 3WHTB 1S5GZ 1QJTA 1WDCC 2KBIA 4PHNA 1K96A 4XJKA 1QIWA 1QVIY 5AERA 3IF7A 3BUXB 3TDIA 1KWOB 1UP5A 2JNFA 3CR2A 4PHJA 2ZN8A 1AUIB 2OTGC 1PSBA 5K89A 3KEVA 1QV1A 2HQ8A 3NSOA 2K7CA 2LM5A 1K9UA 2NCOA 1XYDA 3VROA 1CFFA 1F70A 1NUBA 5J3XA 1J1DA 5FYXA 1Q80A 1FF1A 1TCOB 3FIAA 4GPLB 1W7JB 4JQ0D 3WNXB 2L4IA 1NIWA 1B1GA 2K7BA 2LHIA 2MAZA 1AP4A 3MSEB 3FS7A 1S3PA 2LC5A 5PALA 2ZKMX 1XO5A 4GGNA 1QLSA 3SJSA 2H2KA 1FW4A 5DKNA 2KGRA 2HF5A 5AEQA 4AQIA 1SYMA 1EH2A 4N5XA 2R2IA 3ZNIA 2EGDA 2M97A 3DVJA 3FWCA 2KYFA 3EK7A 1UUSA 4DS7A 3CS1A 4OVNF 1HQVA 3WHUB 3LL8B 2SASA 2KAVA 3PATA 2M29A 1ZOTB 4BY5A 1KK8C 1JC2A 1MQ1A 4YGDB 1QV0A 1SCMB 2K61A 4OCIA 4CIDA 3VGOA 1RK9A 4CFQA 1B9AA 3NSLA 2L5XB 1DT7B 2AMIA 5DKQA 1EL4A 1EXRA 4MZJA 4R1EA 1KFXL 5D69A 1LKJA 2PMYA 1CB1A 1BG1A 3BUNB 3CR5X 4NDBA 3LK0A 2EC6C 3KO0A 4WQ3A 1DJWA 4MSPA 4PHMA 1EG3A 1PRWA 2KSPA 3A4UB 2LP3A 1N0YA 1PULA 4HSZA 2M1UA 3DF0B 5JOLA 1R2UA 2WCFA 1MF8B 3I5HC 2BL0B 2CNPA 3A8RA 2LAPA 2Y1NA 1QX2A 2JT8A 2VRGA 1SY9A 2LVJA 4WRIA 1K2HA 1IG5A 1CNPA 3O4YA 2B1UA 4FTGA 1SW8A 4NQGA 1BJFA 4MEWA 3C1VA 1PALA 3AAJA 1JBAA 2BE6A 1J1EA 1QASA 1TIZA 4HRHA 5JJGA 5HKZA 3BQ3A 3D10A 1J7QA 2P6BB 2E30A 2BE4A 1YVLA 4PE0A 1OQPA 1R6PA 2F33A 1XFYO 4D1EA 1BR1B 2BCXA 2LMTA 1BF5A 2KI4C 1SMGA 3ICBA 5CSJA 3HX4A 3DD4A 1TTXA 2F2PA 3EKHA 1UWOA 2K0JA 3GK4X 4ETOA 4DCKA 1C7WA 1C7VA 3KPXA 1KSMA 1IJ6A 3PLFB 3PN7C 1JWDA 4PALA 1K8UA 1DGUA 1AK8A 5KTYA 1SPYA 1M45A 1JFKA 2L2EA 2JRFA 5IBWA 1GQMA 1ALVA 1WRKA 2KAXA 1BU3A 1S5GY 1Y1AA 3ZWHA 1H8BA 2AAOA 2F8PA 4C0JA 5DKRA 4N1FA 1SL8A 4CFRA 1NCXA 3LCPC 1SKTA 1ALWA 4IL1A 4ZCVA 2GGMA 3TS5C 1XVJA 1KFUS 4AOMA 1FI6A 2RGIA 1DMOA 1F54A 1JF2A 2LMUA 1QX5B 2CT9A 1CDNA 1L7ZA 1CMFA 2BCAA 3PN7B 4JPZB 1BODA 3WXAA 1DJHA 4UPGA 1B4CA 2WC8A 1ZFSA 2KQYA 1NWDA 1WY9A 3LK1A 1UHJA 1ZUZA 4ICBA 4N1GA 3VRRA 4BY4A 2JTTA 3I5FC 3DVKA 2M9GA 1TNPA 2D8NA 4A4CA 1CTRA 1F4OA 1NYAA 2K7DA 3OB1B 1ZMZA 1RWYA 4MRXA 1KQVA 1K9PA 3PM8A 3I5FB 2M7NA 3KF9A 1MXEA 4NDCA 2H61C 1C07A 1E8AA 1TOPA 3TUYC 3DVMA 1DVIA 1KSOA 1XFZO 1U5IA 1QIVA 5HYDA 2KGBC 1LXFC 2JQ6A 2LLTA 2WNDA 3GOFA 1IWQA 4GBAA 1FI5A 1AHRA 3D0YB 4M2OA 1NX1A 1CLLA 3RLZA 3EVVA 3K21A 1KFXS 1WLZA 2KOTA 2Y4QA 3EK8A 4L9MA 2LUXA 1G8IA 1KK7Z 1YTZC 1NCZA 1G33A 1WRZA 4MZKA 2OTGB 3BUMB 2LANA 1A4PA 3IQOA 2DOQA 1OMVA 1J7RA 1A2XA 1JUOA 3O2PA 5I2OA 2BL0C 2CBLA 5AXIA 1ZACA 1XK4A 1UHIA 1W7IB 1YVHA 2JPTA 4MRYA 1IGVA 2MJWB 4C0KA 1SCMC 2GV5A 2K7OA 3TUYB 3TDZA 2FJUB 4YI9A 1MR8A 2Y1MA 2NLNA 3F45A 2JC2A 2LVIA 2PVBA 4ORBB 2HQWA 2L0PA 4YGBB 3BUOB 1SK6D 3VRPA 3GK1A 3EVUA 1K93D 4ZCUA 1PVBA 1J55A 1A75B 4XYNA 4GGFC 3VRQA 1XFVO 1YUSA 1KK8B 2MHHA 2Q91A 2HETA 3PALA 1QS7A 1WRLA 1RTP1 5G08A 1BT6A 1XFUO 2KI6C 3I5IB 1YX8A 2L4HA 4HRGA 1JF0A 1G4YR 1IJ5A 2M3WA 3I5GB 1SR6B 2PSRA 1CDPA 1PSRA 2BKIB 3AKBA 1KK7Y 3BUWB 3O6BA 3SIBA 1BOCA 2OS8B 3NXAA 5CSIA 2MA2A 2NXQA 1UURA 1DGVA 1DF0B 2PASA 2I2RE 4HREE 1MUXA 1HT9A 3E3RA 1B7TY 1SNLA 2TN4A 5ER4X 1N2DA 1OMDA 5HKYA 3EK4A 1NX3A 1XK4C 1Y6WA 1YR5A 3TS5B 1CFCA 1IQ3A 3JVTB 2EHBA 1BLQA 2KFHA 4QJ5B 5CPVA 4FQOA 2F3ZA 5KSZA 1DJGA 1SBJA 3NSIA 1DJIA 4OV2A 1DJZA 5GQQC 2KQ6A 1QLKA 3OHMB 3JTDB 1XFWO 3NSKA 5F6TA 1J7OA 2JU0A 4AQJA 1FPWA 1A75A 4M2QA 3EKJA 1CM4A 4ORAB 2I94A 3SG3A 2JXLA 1CDMA 3CWGA 1BMOA 4CLNA 4Q04A 2LUCA 2JZIA 1MWNA 2FOTA 3CZTX 1OZSA 1F55A 1Y1XA 3FWBA 5CSNA 1NX2A 2CTNA 1EG4A 3OX5A 3SG2A 2COLB 3OB2B 4NDDA 4GUKA 1A29A 1KCYA 3CR4X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LLE A;  1JFJ A;  1LA0 A;  2NZ0 A;  1B8L A;  2LE9 B;  1M31 A;  2M0R A;  3GK2 A;  5TNC A;  3TZ1 A;  5B8I B;  5BPJ A;  5ER5 A;  3BYA A;  1F4Q A;  4P5O E;  4JWQ A;  2WCB A;  4PCW A;  3SG6 A;  4XJK B;  5CSF A;  2JT3 A;  1F8H A;  1XFX O;  2MLE C;  1UHK A;  2M7L A;  3CLN A;  1CFP A;  1SCV A;  1X02 A;  4M2P A;  1L2O C;  4I5J A;  1CLM A;  1A03 A;  3M0W A;  4WQ2 A;  2KFG A;  1SL9 A;  1F71 A;  1BR4 B;  2JWW A;  1PK0 D;  1CFD A;  1OOJ A;  4OKH A;  2JNX A;  2SCP A;  2KHN A;  4YRU A;  2KDH A;  2H61 A;  2WOR A;  4E68 A;  2O60 A;  1TNQ A;  1V1F A;  2LV7 A;  3PSR A;  4GFT A;  1TN4 A;  5HLO A;  4PDZ A;  2BBN A;  3QRX A;  4P2Y B;  1S26 D;  1K90 D;  1YUT A;  1GGZ A;  3CGA A;  1NP8 A;  1DJY A;  4GNK B;  1B7T Z;  2G2B A;  1QAT A;  1XA5 A;  1OMR A;  1S36 A;  1K9K A;  1KQM C;  3OP0 A;  2K2F A;  1DTL A;  5HLV A;  4ORC B;  1REC A;  2WCE A;  1M63 B;  2A4J A;  2CXJ A;  2MRD A;  3KHE A;  2L51 A;  1CM1 A;  2K8M B;  2BKH B;  1TCF A;  1RJV A;  2NCP A;  2KBM A;  4PE1 A;  1NSH A;  1H4B A;  4GAO A;  2Q4U A;  4DUQ A;  2LMV A;  5AAN A;  1KFU L;  2LCP A;  2L50 A;  1TRF A;  1LIN A;  2ZN9 A;  1OSA A;  1DF0 A;  1S6J A;  2M49 B;  4YGE B;  5KU1 A;  4U8D A;  4MBE A;  3AKA A;  2MBX A;  5I2Q A;  3RM1 A;  4PHK A;  1KWO C;  1OZO A;  2KNE A;  4I5L B;  2MLF C;  2PAL A;  1YX7 A;  4I5K A;  2ZND A;  4USL A;  1LA3 A;  1M46 A;  1WDC B;  2JUL A;  3D0Y A;  2BCB A;  2M8U A;  1L2O B;  2HPS A;  1EJ3 A;  1GGW A;  1PVA A;  3SIA A;  5I8N A;  5I2L A;  3JTD C;  3BOW B;  5HKW A;  2EC6 B;  2K2A A;  2ZRS A;  2IS9 A;  1B8C A;  2G9B A;  2JTZ A;  1GJY A;  2KI4 B;  1S6C A;  1TNX A;  1B8R A;  1NPQ A;  1SR6 C;  2LLS A;  1QVI Z;  2O5G A;  1IKU A;  4QJ3 B;  1Y0V H;  1IH0 A;  2QPT A;  1K94 A;  1D1O A;  2JT0 A;  3I5H B;  2GGZ A;  4QJ4 B;  1SL7 A;  2KAY A;  4CPV A;  1S1E A;  1J7P A;  3BOW A;  1AJ5 A;  1UHH A;  3IQQ A;  1QX7 A;  1VRK A;  4C0L A;  2KI6 D;  1YUR A;  2CCM A;  4MLW A;  1KQM B;  1M39 A;  1UHN A;  3AAK A;  1YRT B;  2L98 A;  2LVV A;  2I7A A;  1MHO A;  2AUC A;  2KYC A;  2FCD A;  2LLU A;  1SRA A;  5D7F A;  2I18 A;  1WLM A;  1NCY A;  4MVF A;  4F0Z B;  1ODB A;  1CLB A;  4GGF A;  1QXP A;  1RRO A;  4A4B A;  1LVC D;  2ZFD A;  2M1K B;  3SG7 A;  3DF0 A;  1IQ5 A;  4TNC A;  2ZRT A;  1Y1U A;  2V53 A;  4I5N B;  3PFV A;  1YUU A;  3I5G C;  2JOJ A;  4MZL A;  4DRW A;  2QAC A;  2WOS A;  3EVR A;  2FCE A;  3JVT C;  1CMG A;  2OS8 C;  3TDU A;  5AFP A;  3VRN A;  1N65 A;  1TNW A;  4OR9 B;  1DJX A;  4DIR A;  1NX0 A;  1U5I B;  1IRJ A;  2LHL A;  4MN0 A;  1AJ4 A;  3DVE A;  1K95 A;  2JXC A;  2BBM A;  2E6W A;  3OX6 A;  1S6I A;  2Y5I A;  1OE9 B;  1CKK A;  1RFJ A;  4PE7 A;  3SG4 A;  2ISD A;  1AVS A;  1MXL C;  2ZNE A;  1V1G A;  3O78 A;  3SG5 A;  2LVK A;  3CTN A;  3I5I C;  2OPO A;  3BXK A;  3H4S E;  1B47 A;  2PRU A;  2LNK A;  4YGA A;  1YRU B;  2LP2 A;  1QTX A;  3HCM A;  2BEC A;  2F2O A;  2KFF A;  4YI8 A;  1JSA A;  1CDL A;  4PE4 A;  2F3Y A;  4YBH B;  4YGC B;  1FBV A;  3WHT B;  1S5G Z;  1QJT A;  1WDC C;  2KBI A;  4PHN A;  1K96 A;  4XJK A;  1QIW A;  1QVI Y;  5AER A;  3IF7 A;  3BUX B;  3TDI A;  1KWO B;  1UP5 A;  2JNF A;  3CR2 A;  4PHJ A;  2ZN8 A;  1AUI B;  2OTG C;  1PSB A;  5K89 A;  3KEV A;  1QV1 A;  2HQ8 A;  3NSO A;  2K7C A;  2LM5 A;  1K9U A;  2NCO A;  1XYD A;  3VRO A;  1CFF A;  1F70 A;  1NUB A;  5J3X A;  1J1D A;  5FYX A;  1Q80 A;  1FF1 A;  1TCO B;  3FIA A;  4GPL B;  1W7J B;  4JQ0 D;  3WNX B;  2L4I A;  1NIW A;  1B1G A;  2K7B A;  2LHI A;  2MAZ A;  1AP4 A;  3MSE B;  3FS7 A;  1S3P A;  2LC5 A;  5PAL A;  2ZKM X;  1XO5 A;  4GGN A;  1QLS A;  3SJS A;  2H2K A;  1FW4 A;  5DKN A;  2KGR A;  2HF5 A;  5AEQ A;  4AQI A;  1SYM A;  1EH2 A;  4N5X A;  2R2I A;  3ZNI A;  2EGD A;  2M97 A;  3DVJ A;  3FWC A;  2KYF A;  3EK7 A;  1UUS A;  4DS7 A;  3CS1 A;  4OVN F;  1HQV A;  3WHU B;  3LL8 B;  2SAS A;  2KAV A;  3PAT A;  2M29 A;  1ZOT B;  4BY5 A;  1KK8 C;  1JC2 A;  1MQ1 A;  4YGD B;  1QV0 A;  1SCM B;  2K61 A;  4OCI A;  4CID A;  3VGO A;  1RK9 A;  4CFQ A;  1B9A A;  3NSL A;  2L5X B;  1DT7 B;  2AMI A;  5DKQ A;  1EL4 A;  1EXR A;  4MZJ A;  4R1E A;  1KFX L;  5D69 A;  1LKJ A;  2PMY A;  1CB1 A;  1BG1 A;  3BUN B;  3CR5 X;  4NDB A;  3LK0 A;  2EC6 C;  3KO0 A;  4WQ3 A;  1DJW A;  4MSP A;  4PHM A;  1EG3 A;  1PRW A;  2KSP A;  3A4U B;  2LP3 A;  1N0Y A;  1PUL A;  4HSZ A;  2M1U A;  3DF0 B;  5JOL A;  1R2U A;  2WCF A;  1MF8 B;  3I5H C;  2BL0 B;  2CNP A;  3A8R A;  2LAP A;  2Y1N A;  1QX2 A;  2JT8 A;  2VRG A;  1SY9 A;  2LVJ A;  4WRI A;  1K2H A;  1IG5 A;  1CNP A;  3O4Y A;  2B1U A;  4FTG A;  1SW8 A;  4NQG A;  1BJF A;  4MEW A;  3C1V A;  1PAL A;  3AAJ A;  1JBA A;  2BE6 A;  1J1E A;  1QAS A;  1TIZ A;  4HRH A;  5JJG A;  5HKZ A;  3BQ3 A;  3D10 A;  1J7Q A;  2P6B B;  2E30 A;  2BE4 A;  1YVL A;  4PE0 A;  1OQP A;  1R6P A;  2F33 A;  1XFY O;  4D1E A;  1BR1 B;  2BCX A;  2LMT A;  1BF5 A;  2KI4 C;  1SMG A;  3ICB A;  5CSJ A;  3HX4 A;  3DD4 A;  1TTX A;  2F2P A;  3EKH A;  1UWO A;  2K0J A;  3GK4 X;  4ETO A;  4DCK A;  1C7W A;  1C7V A;  3KPX A;  1KSM A;  1IJ6 A;  3PLF B;  3PN7 C;  1JWD A;  4PAL A;  1K8U A;  1DGU A;  1AK8 A;  5KTY A;  1SPY A;  1M45 A;  1JFK A;  2L2E A;  2JRF A;  5IBW A;  1GQM A;  1ALV A;  1WRK A;  2KAX A;  1BU3 A;  1S5G Y;  1Y1A A;  3ZWH A;  1H8B A;  2AAO A;  2F8P A;  4C0J A;  5DKR A;  4N1F A;  1SL8 A;  4CFR A;  1NCX A;  3LCP C;  1SKT A;  1ALW A;  4IL1 A;  4ZCV A;  2GGM A;  3TS5 C;  1XVJ A;  1KFU S;  4AOM A;  1FI6 A;  2RGI A;  1DMO A;  1F54 A;  1JF2 A;  2LMU A;  1QX5 B;  2CT9 A;  1CDN A;  1L7Z A;  1CMF A;  2BCA A;  3PN7 B;  4JPZ B;  1BOD A;  3WXA A;  1DJH A;  4UPG A;  1B4C A;  2WC8 A;  1ZFS A;  2KQY A;  1NWD A;  1WY9 A;  3LK1 A;  1UHJ A;  1ZUZ A;  4ICB A;  4N1G A;  3VRR A;  4BY4 A;  2JTT A;  3I5F C;  3DVK A;  2M9G A;  1TNP A;  2D8N A;  4A4C A;  1CTR A;  1F4O A;  1NYA A;  2K7D A;  3OB1 B;  1ZMZ A;  1RWY A;  4MRX A;  1KQV A;  1K9P A;  3PM8 A;  3I5F B;  2M7N A;  3KF9 A;  1MXE A;  4NDC A;  2H61 C;  1C07 A;  1E8A A;  1TOP A;  3TUY C;  3DVM A;  1DVI A;  1KSO A;  1XFZ O;  1U5I A;  1QIV A;  5HYD A;  2KGB C;  1LXF C;  2JQ6 A;  2LLT A;  2WND A;  3GOF A;  1IWQ A;  4GBA A;  1FI5 A;  1AHR A;  3D0Y B;  4M2O A;  1NX1 A;  1CLL A;  3RLZ A;  3EVV A;  3K21 A;  1KFX S;  1WLZ A;  2KOT A;  2Y4Q A;  3EK8 A;  4L9M A;  2LUX A;  1G8I A;  1KK7 Z;  1YTZ C;  1NCZ A;  1G33 A;  1WRZ A;  4MZK A;  2OTG B;  3BUM B;  2LAN A;  1A4P A;  3IQO A;  2DOQ A;  1OMV A;  1J7R A;  1A2X A;  1JUO A;  3O2P A;  5I2O A;  2BL0 C;  2CBL A;  5AXI A;  1ZAC A;  1XK4 A;  1UHI A;  1W7I B;  1YVH A;  2JPT A;  4MRY A;  1IGV A;  2MJW B;  4C0K A;  1SCM C;  2GV5 A;  2K7O A;  3TUY B;  3TDZ A;  2FJU B;  4YI9 A;  1MR8 A;  2Y1M A;  2NLN A;  3F45 A;  2JC2 A;  2LVI A;  2PVB A;  4ORB B;  2HQW A;  2L0P A;  4YGB B;  3BUO B;  1SK6 D;  3VRP A;  3GK1 A;  3EVU A;  1K93 D;  4ZCU A;  1PVB A;  1J55 A;  1A75 B;  4XYN A;  4GGF C;  3VRQ A;  1XFV O;  1YUS A;  1KK8 B;  2MHH A;  2Q91 A;  2HET A;  3PAL A;  1QS7 A;  1WRL A;  1RTP 1;  5G08 A;  1BT6 A;  1XFU O;  2KI6 C;  3I5I B;  1YX8 A;  2L4H A;  4HRG A;  1JF0 A;  1G4Y R;  1IJ5 A;  2M3W A;  3I5G B;  1SR6 B;  2PSR A;  1CDP A;  1PSR A;  2BKI B;  3AKB A;  1KK7 Y;  3BUW B;  3O6B A;  3SIB A;  1BOC A;  2OS8 B;  3NXA A;  5CSI A;  2MA2 A;  2NXQ A;  1UUR A;  1DGV A;  1DF0 B;  2PAS A;  2I2R E;  4HRE E;  1MUX A;  1HT9 A;  3E3R A;  1B7T Y;  1SNL A;  2TN4 A;  5ER4 X;  1N2D A;  1OMD A;  5HKY A;  3EK4 A;  1NX3 A;  1XK4 C;  1Y6W A;  1YR5 A;  3TS5 B;  1CFC A;  1IQ3 A;  3JVT B;  2EHB A;  1BLQ A;  2KFH A;  4QJ5 B;  5CPV A;  4FQO A;  2F3Z A;  5KSZ A;  1DJG A;  1SBJ A;  3NSI A;  1DJI A;  4OV2 A;  1DJZ A;  5GQQ C;  2KQ6 A;  1QLK A;  3OHM B;  3JTD B;  1XFW O;  3NSK A;  5F6T A;  1J7O A;  2JU0 A;  4AQJ A;  1FPW A;  1A75 A;  4M2Q A;  3EKJ A;  1CM4 A;  4ORA B;  2I94 A;  3SG3 A;  2JXL A;  1CDM A;  3CWG A;  1BMO A;  4CLN A;  4Q04 A;  2LUC A;  2JZI A;  1MWN A;  2FOT A;  3CZT X;  1OZS A;  1F55 A;  1Y1X A;  3FWB A;  5CSN A;  1NX2 A;  2CTN A;  1EG4 A;  3OX5 A;  3SG2 A;  2COL B;  3OB2 B;  4NDD A;  4GUK A;  1A29 A;  1KCY A;  3CR4 X; 
#chains in the Genus database with same CATH topology
 3LLE A;  1JFJ A;  1LA0 A;  2NZ0 A;  1B8L A;  2LE9 B;  1M31 A;  2M0R A;  3GK2 A;  5TNC A;  3TZ1 A;  5B8I B;  5BPJ A;  5ER5 A;  3BYA A;  2P70 A;  1F4Q A;  4P5O E;  3L47 A;  4JWQ A;  2WCB A;  4PCW A;  3SG6 A;  4XJK B;  5CSF A;  2JT3 A;  1F8H A;  1XFX O;  2MLE C;  1UHK A;  2M7L A;  3CLN A;  1CFP A;  1SCV A;  1X02 A;  3R1O A;  4M2P A;  2PQL A;  1L2O C;  3FE8 A;  4I5J A;  1CLM A;  1A03 A;  3D75 A;  3M0W A;  4WQ2 A;  2KFG A;  1SL9 A;  3QME A;  1F71 A;  1BR4 B;  2JWW A;  1PK0 D;  1CFD A;  1OOJ A;  4OKH A;  2JNX A;  2SCP A;  3IVT A;  2KHN A;  1IIO A;  4YRU A;  2KDH A;  2H61 A;  2WOR A;  4E68 A;  2O60 A;  1TNQ A;  1V1F A;  2LV7 A;  3PSR A;  4GFT A;  2JPO A;  4INX A;  1OOG A;  1TN4 A;  5HLO A;  2GTE A;  4PDZ A;  2BBN A;  3QRX A;  4P2Y B;  1S26 D;  1K90 D;  1YUT A;  1GGZ A;  3CGA A;  1GM0 A;  1NP8 A;  1DJY A;  3CZ1 A;  4GNK B;  2WC5 A;  1B7T Z;  2G2B A;  1QAT A;  1XA5 A;  1OMR A;  1S36 A;  1K9K A;  1KQM C;  3OP0 A;  2K2F A;  1DTL A;  5HLV A;  4ORC B;  1REC A;  2WCE A;  1M63 B;  2A4J A;  2CXJ A;  2MRD A;  3KHE A;  2L51 A;  2PYQ A;  1CM1 A;  2K8M B;  2BKH B;  1TCF A;  1RJV A;  2NCP A;  2KBM A;  4PE1 A;  1NSH A;  1H4B A;  4GAO A;  2Q4U A;  2WC6 A;  3VB1 A;  4DUQ A;  1C3Z A;  2LMV A;  5AAN A;  1KFU L;  2LCP A;  2L50 A;  4IJ7 A;  1TRF A;  1LIN A;  2ZN9 A;  1OSA A;  1DF0 A;  1S6J A;  2M49 B;  4YGE B;  3DXL A;  5KU1 A;  4U8D A;  4MBE A;  1XFR A;  3AKA A;  2MBX A;  5I2Q A;  3RM1 A;  4PHK A;  1KWO C;  1OZO A;  2KNE A;  4I5L B;  2MLF C;  2PAL A;  1YX7 A;  4I5K A;  2ZND A;  4USL A;  1LA3 A;  1M46 A;  1WDC B;  2JUL A;  3D0Y A;  2BCB A;  2M8U A;  1L2O B;  2HPS A;  1EJ3 A;  1GGW A;  1PVA A;  3SIA A;  5I8N A;  5I2L A;  3JTD C;  3BOW B;  5HKW A;  2EC6 B;  3D77 A;  1DEK A;  2K2A A;  3DZT A;  2ZRS A;  2IS9 A;  1B8C A;  2G9B A;  2JTZ A;  1GJY A;  2KI4 B;  1S6C A;  3CZ2 A;  1TNX A;  1B8R A;  1NPQ A;  1SR6 C;  2LLS A;  1QVI Z;  2O5G A;  1IKU A;  4QJ3 B;  1Y0V H;  1IH0 A;  3S0G A;  3RZS A;  2QPT A;  1K94 A;  2WCJ A;  1D1O A;  2JT0 A;  3I5H B;  2GGZ A;  3CYZ A;  1SL7 A;  4QJ4 B;  2KAY A;  4CPV A;  1S1E A;  1J7P A;  3BOW A;  1AJ5 A;  1UHH A;  3IQQ A;  3Q8I A;  1QX7 A;  2KLE A;  1VRK A;  4C0L A;  2KI6 D;  1YUR A;  2CCM A;  4MLW A;  1W9Z A;  1KQM B;  1M39 A;  1UHN A;  3AAK A;  1YRT B;  2L98 A;  2LVV A;  2I7A A;  1MHO A;  2AUC A;  2KYC A;  2FCD A;  2LLU A;  1SRA A;  2QEH A;  2I18 A;  1WLM A;  1NCY A;  4MVF A;  5D7F A;  1ODB A;  3SS4 A;  1CLB A;  4GGF A;  1QXP A;  1RRO A;  3DY9 A;  4A4B A;  1LVC D;  2ZFD A;  1OOI X;  1QWV A;  2M1K B;  4JD9 A;  3SG7 A;  3DF0 A;  1IQ5 A;  4TNC A;  2ZRT A;  1Y1U A;  2V53 A;  4I5N B;  3PFV A;  1YUU A;  3I5G C;  2JOJ A;  2QEO A;  4MZL A;  4DRW A;  2QAC A;  2WOS A;  3EVR A;  2FCE A;  3JVT C;  1CMG A;  2OS8 C;  3TDU A;  5AFP A;  3BFB A;  3VRN A;  1N65 A;  1TNW A;  4OR9 B;  1DJX A;  4DIR A;  1NX0 A;  1OOF A;  1U5I B;  1IRJ A;  2LHL A;  3L4A A;  4MN0 A;  1AJ4 A;  3DVE A;  1K95 A;  1SSE B;  2JXC A;  2BBM A;  2E6W A;  3OX6 A;  1S6I A;  2Y5I A;  1OE9 B;  1CKK A;  1RFJ A;  4PE7 A;  3SG4 A;  2ISD A;  1AVS A;  1MXL C;  2ZNE A;  1V1G A;  3O78 A;  3SG5 A;  2LVK A;  3CTN A;  3I5I C;  2OPO A;  3BXK A;  3H4S E;  1B47 A;  2PRU A;  2LNK A;  4YGA A;  1YRU B;  4JKT A;  2LP2 A;  1QTX A;  3HCM A;  2BEC A;  2F2O A;  2KFF A;  3D74 A;  4YI8 A;  1JSA A;  5HL1 A;  1CDL A;  4PE4 A;  2F3Y A;  4YBH B;  4YGC B;  1FBV A;  3WHT B;  1S5G Z;  1QJT A;  1WDC C;  2KBI A;  4PHN A;  2BNX A;  1K96 A;  1QIW A;  1QVI Y;  3R1V A;  4XJK A;  5AER A;  1C3Y A;  3IF7 A;  2BAP A;  3BUX B;  3TDI A;  1KWO B;  1UP5 A;  2JNF A;  3CR2 A;  4PHJ A;  2ZN8 A;  1AUI B;  2OTG C;  1PSB A;  5K89 A;  3KEV A;  1QV1 A;  2HQ8 A;  3FE9 A;  3NSO A;  2K7C A;  2LM5 A;  1K9U A;  2NCO A;  1XYD A;  3VRO A;  1CFF A;  1F70 A;  2WCM A;  1NUB A;  5J3X A;  1J1D A;  5FYX A;  1Q80 A;  1FF1 A;  1TCO B;  3FIA A;  4GPL B;  1DQE A;  1W7J B;  4JQ0 D;  3WNX B;  2L4I A;  1NIW A;  2KPH A;  1B1G A;  4KYN A;  2K7B A;  2LHI A;  2MAZ A;  1AP4 A;  3MSE B;  3FS7 A;  1S3P A;  2LC5 A;  5PAL A;  2KLD A;  2ZKM X;  1XO5 A;  4GGN A;  1QLS A;  3SJS A;  2H2K A;  1FW4 A;  5DKN A;  4F0Z B;  2KGR A;  2HF5 A;  3BFA A;  5AEQ A;  4AQI A;  1SYM A;  3CAB A;  2WCK A;  1T14 A;  4N5X A;  2R2I A;  1EH2 A;  3OBV A;  2EGD A;  2M97 A;  3DVJ A;  3FWC A;  3ZNI A;  2K60 A;  2KYF A;  3EK7 A;  1UUS A;  4DS7 A;  3CS1 A;  1LS8 A;  1HQV A;  1Z2C B;  3LL8 B;  4OVN F;  2SAS A;  2KAV A;  3PAT A;  2M29 A;  2WCH A;  3WHU B;  4F7F A;  1ZOT B;  4BY5 A;  1KK8 C;  3S0B A;  1JC2 A;  1MQ1 A;  4YGD B;  1QV0 A;  1DC1 A;  1SCM B;  2K61 A;  4OCI A;  4CID A;  3VGO A;  1RK9 A;  3D73 A;  4CFQ A;  1B9A A;  3NSL A;  2L5X B;  1DT7 B;  2AMI A;  5DKQ A;  1EL4 A;  1EXR A;  4MZJ A;  4R1E A;  1KFX L;  5D69 A;  1LKJ A;  2PMY A;  1CB1 A;  1BG1 A;  3BUN B;  3CR5 X;  4NDB A;  3LK0 A;  2EC6 C;  3CZ0 A;  3KO0 A;  4WQ3 A;  1DJW A;  2ERB A;  4MSP A;  4PHM A;  1EG3 A;  1PRW A;  2KSP A;  3A4U B;  2LP3 A;  1N0Y A;  1PUL A;  3B6X A;  3K1E A;  4HSZ A;  2M1U A;  3DF0 B;  5JOL A;  1R2U A;  2WCF A;  1MF8 B;  3I5H C;  2BL0 B;  2CNP A;  2H8V A;  3A8R A;  2LAP A;  2Y1N A;  3DYE A;  1QX2 A;  2JT8 A;  2VRG A;  1SY9 A;  2LVJ A;  4WRI A;  1DEL A;  3R72 A;  1K2H A;  1IG5 A;  1CNP A;  3O4Y A;  2B1U A;  3D76 A;  4FTG A;  3SS3 A;  1SW8 A;  4NQG A;  1BJF A;  4MEW A;  3C1V A;  1TUZ A;  1PAL A;  3AAJ A;  1JBA A;  2BE6 A;  1J1E A;  1QAS A;  1TIZ A;  4HRH A;  5JJG A;  5HKZ A;  3UO9 A;  3BQ3 A;  3D10 A;  1J7Q A;  2P6B B;  2E30 A;  2BE4 A;  1YVL A;  5DIC A;  4PE0 A;  3S0A A;  3S0F A;  1OQP A;  1R6P A;  2F33 A;  1XFY O;  4D1E A;  1BR1 B;  2BCX A;  2LMT A;  3UNW A;  2KI4 C;  1BF5 A;  1SMG A;  1TUJ A;  3ICB A;  2L5Y A;  3HX4 A;  5CSJ A;  3DD4 A;  1TTX A;  2F2P A;  2YGU A;  1UWO A;  2K0J A;  3EKH A;  3GK4 X;  3S0E A;  4DCK A;  1C7W A;  4ETO A;  1C7V A;  3KPX A;  3PJI A;  1KSM A;  1IJ6 A;  3PLF B;  3PN7 C;  1JWD A;  4PAL A;  1K8U A;  1DGU A;  1AK8 A;  5KTY A;  1SPY A;  3B7A A;  1M45 A;  1JFK A;  2L2E A;  2JRF A;  5IBW A;  1GQM A;  5FI6 A;  1ALV A;  1WRK A;  2KAX A;  5D3O A;  1BU3 A;  3R1P A;  1S5G Y;  1Y1A A;  3ZWH A;  1H8B A;  2AAO A;  2F8P A;  4C0J A;  5DKR A;  4N1F A;  1SL8 A;  4CFR A;  1NCX A;  1Z4H A;  3LCP C;  1SKT A;  1ALW A;  4IL1 A;  4ZCV A;  2GGM A;  3TS5 C;  1XVJ A;  1KFU S;  4OZD A;  4AOM A;  1FI6 A;  2RGI A;  1DMO A;  1F54 A;  1JF2 A;  2LMU A;  1QX5 B;  2CT9 A;  1CDN A;  1L7Z A;  1CMF A;  2BCA A;  3PN7 B;  4JPZ B;  1BOD A;  3WXA A;  3B87 A;  1DJH A;  3V2L A;  4UPG A;  1B4C A;  2WC8 A;  1ZFS A;  2KQY A;  1NWD A;  1WY9 A;  3LK1 A;  1UHJ A;  1ZUZ A;  4ICB A;  4N1G A;  3VRR A;  4BY4 A;  2JTT A;  3I5F C;  3DVK A;  2M9G A;  1TNP A;  2D8N A;  4A4C A;  1CTR A;  1F4O A;  1NYA A;  2K7D A;  3OB1 B;  1ZMZ A;  4INW A;  1RWY A;  3B86 A;  4MRX A;  1BOC A;  1KQV A;  1K9P A;  3PM8 A;  3I5F B;  2M7N A;  3KF9 A;  1MXE A;  4NDC A;  2H61 C;  1C07 A;  1E8A A;  1TOP A;  3TUY C;  3DVM A;  1XFZ O;  1DVI A;  1KSO A;  1U5I A;  2FJY A;  1QIV A;  5HYD A;  2KGB C;  3NHT A;  1LXF C;  2JQ6 A;  2LLT A;  2WND A;  3GOF A;  1IWQ A;  4GBA A;  1FI5 A;  1AHR A;  3D0Y B;  4M2O A;  1NX1 A;  1CLL A;  1ORG A;  3RLZ A;  3EVV A;  3K21 A;  1KFX S;  1WLZ A;  2KOT A;  2Y4Q A;  3EK8 A;  4L9M A;  2LUX A;  1G8I A;  1KK7 Z;  1YTZ C;  1NCZ A;  1G33 A;  1WRZ A;  4MZK A;  2OTG B;  3BUM B;  2LAN A;  1A4P A;  3IQO A;  2DOQ A;  1OMV A;  1J7R A;  1A2X A;  1JUO A;  3O2P A;  5I2O A;  2BL0 C;  3FE6 A;  1TWO A;  2CBL A;  5AXI A;  1ZAC A;  4FQT A;  1XK4 A;  1UHI A;  1W7I B;  3B88 A;  3D78 A;  1YVH A;  2JPT A;  4MRY A;  1IGV A;  2MJW B;  4C0K A;  1SCM C;  3S0D A;  2GV5 A;  2K7O A;  3TUY B;  3TDZ A;  2FJU B;  4YI9 A;  1MR8 A;  2Y1M A;  2NLN A;  3F45 A;  2JC2 A;  2LVI A;  1OOH A;  2PVB A;  4ORB B;  2HQW A;  2L0P A;  2QEV A;  3BUO B;  1OW4 A;  4YGB B;  1SK6 D;  3VRP A;  3GK1 A;  3EVU A;  1K93 D;  4ZCU A;  1PVB A;  1J55 A;  1A75 B;  4XYN A;  4GGF C;  3VRQ A;  1XFV O;  1YUS A;  1KK8 B;  2MHH A;  2Q91 A;  2HET A;  3PAL A;  1QS7 A;  1WRL A;  1RTP 1;  2L2C A;  3CDN A;  5G08 A;  1BT6 A;  1XFU O;  2KI6 C;  3I5I B;  1YX8 A;  2L4H A;  2QDI A;  5EL2 A;  4HRG A;  1JF0 A;  1G4Y R;  1IJ5 A;  2M3W A;  3NHI A;  3I5G B;  1SR6 B;  2WCL A;  2PSR A;  1CDP A;  1PSR A;  2BKI B;  3AKB A;  1KK7 Y;  3BUW B;  3O6B A;  4PT1 A;  3SIB A;  2OS8 B;  3NXA A;  3BFH A;  5CSI A;  3PM2 A;  2MA2 A;  2NXQ A;  3NGV A;  1UUR A;  1DGV A;  1DF0 B;  2PAS A;  3L4L A;  2I2R E;  4HRE E;  1MUX A;  1HT9 A;  3BJH A;  3E3R A;  1B7T Y;  1SNL A;  2TN4 A;  5ER4 X;  1N2D A;  1OMD A;  5HKY A;  5FI2 A;  5I94 A;  3EK4 A;  1NX3 A;  1XK4 C;  1Y6W A;  1YR5 A;  3TS5 B;  1CFC A;  1IQ3 A;  3JVT B;  3OGN A;  2EHB A;  1BLQ A;  3O4X A;  2KFH A;  4QJ5 B;  5CPV A;  4FQO A;  5FI7 A;  2F3Z A;  5KSZ A;  1DJG A;  1SBJ A;  3NSI A;  1DJI A;  4OV2 A;  1DJZ A;  5GQQ C;  2KQ6 A;  1QLK A;  3OHM B;  3JTD B;  1XFW O;  1P28 A;  3EG5 B;  3NSK A;  5F6T A;  3N7H A;  1J7O A;  2JU0 A;  4AQJ A;  1FPW A;  3SS5 A;  1A75 A;  4M2Q A;  3EKJ A;  1CM4 A;  4ORA B;  2I94 A;  3SG3 A;  2JXL A;  1CDM A;  3CWG A;  1BMO A;  4CLN A;  4Q04 A;  2LUC A;  2JZI A;  1MWN A;  2FOT A;  3CZT X;  1OZS A;  1F55 A;  1Y1X A;  3FWB A;  5CSN A;  1NX2 A;  2QEB A;  2CTN A;  1EG4 A;  3OX5 A;  3SG2 A;  2COL B;  3OB2 B;  4NDD A;  4GUK A;  1A29 A;  1KCY A;  2P71 A;  3CR4 X; 
#chains in the Genus database with same CATH homology
 3LLE A;  1JFJ A;  1LA0 A;  2NZ0 A;  1B8L A;  2LE9 B;  1M31 A;  2M0R A;  3GK2 A;  5TNC A;  3TZ1 A;  5B8I B;  5BPJ A;  5ER5 A;  3BYA A;  1F4Q A;  4P5O E;  4JWQ A;  2WCB A;  4PCW A;  3SG6 A;  4XJK B;  5CSF A;  2JT3 A;  1F8H A;  1XFX O;  2MLE C;  1UHK A;  2M7L A;  3CLN A;  1CFP A;  1SCV A;  1X02 A;  4M2P A;  1L2O C;  4I5J A;  1CLM A;  1A03 A;  3M0W A;  4WQ2 A;  2KFG A;  1SL9 A;  1F71 A;  1BR4 B;  2JWW A;  1PK0 D;  1CFD A;  1OOJ A;  4OKH A;  2JNX A;  2SCP A;  2KHN A;  4YRU A;  2KDH A;  2H61 A;  2WOR A;  4E68 A;  2O60 A;  1TNQ A;  1V1F A;  2LV7 A;  3PSR A;  4GFT A;  1TN4 A;  5HLO A;  4PDZ A;  2BBN A;  3QRX A;  4P2Y B;  1S26 D;  1K90 D;  1YUT A;  1GGZ A;  3CGA A;  1NP8 A;  1DJY A;  4GNK B;  1B7T Z;  2G2B A;  1QAT A;  1XA5 A;  1OMR A;  1S36 A;  1K9K A;  1KQM C;  3OP0 A;  2K2F A;  1DTL A;  5HLV A;  4ORC B;  1REC A;  2WCE A;  1M63 B;  2A4J A;  2CXJ A;  2MRD A;  3KHE A;  2L51 A;  1CM1 A;  2K8M B;  2BKH B;  1TCF A;  1RJV A;  2NCP A;  2KBM A;  4PE1 A;  1NSH A;  1H4B A;  4GAO A;  2Q4U A;  4DUQ A;  2LMV A;  5AAN A;  1KFU L;  2LCP A;  2L50 A;  1TRF A;  1LIN A;  2ZN9 A;  1OSA A;  1DF0 A;  1S6J A;  2M49 B;  4YGE B;  5KU1 A;  4U8D A;  4MBE A;  3AKA A;  2MBX A;  5I2Q A;  3RM1 A;  4PHK A;  1KWO C;  1OZO A;  2KNE A;  4I5L B;  2MLF C;  2PAL A;  1YX7 A;  4I5K A;  2ZND A;  4USL A;  1LA3 A;  1M46 A;  1WDC B;  2JUL A;  3D0Y A;  2BCB A;  2M8U A;  1L2O B;  2HPS A;  1EJ3 A;  1GGW A;  1PVA A;  3SIA A;  5I8N A;  5I2L A;  3JTD C;  3BOW B;  5HKW A;  2EC6 B;  2K2A A;  2ZRS A;  2IS9 A;  1B8C A;  2G9B A;  2JTZ A;  1GJY A;  2KI4 B;  1S6C A;  1TNX A;  1B8R A;  1NPQ A;  1SR6 C;  2LLS A;  1QVI Z;  2O5G A;  1IKU A;  4QJ3 B;  1Y0V H;  1IH0 A;  2QPT A;  1K94 A;  1D1O A;  2JT0 A;  3I5H B;  2GGZ A;  4QJ4 B;  1SL7 A;  2KAY A;  4CPV A;  1S1E A;  1J7P A;  3BOW A;  1AJ5 A;  1UHH A;  3IQQ A;  1QX7 A;  1VRK A;  4C0L A;  2KI6 D;  1YUR A;  2CCM A;  4MLW A;  1KQM B;  1M39 A;  1UHN A;  3AAK A;  1YRT B;  2L98 A;  2LVV A;  2I7A A;  1MHO A;  2AUC A;  2KYC A;  2FCD A;  2LLU A;  1SRA A;  5D7F A;  2I18 A;  1WLM A;  1NCY A;  4MVF A;  4F0Z B;  1ODB A;  1CLB A;  4GGF A;  1QXP A;  1RRO A;  4A4B A;  1LVC D;  2ZFD A;  2M1K B;  3SG7 A;  3DF0 A;  1IQ5 A;  4TNC A;  2ZRT A;  1Y1U A;  2V53 A;  4I5N B;  3PFV A;  1YUU A;  3I5G C;  2JOJ A;  4MZL A;  4DRW A;  2QAC A;  2WOS A;  3EVR A;  2FCE A;  3JVT C;  1CMG A;  2OS8 C;  3TDU A;  5AFP A;  3VRN A;  1N65 A;  1TNW A;  4OR9 B;  1DJX A;  4DIR A;  1NX0 A;  1U5I B;  1IRJ A;  2LHL A;  4MN0 A;  1AJ4 A;  3DVE A;  1K95 A;  2JXC A;  2BBM A;  2E6W A;  3OX6 A;  1S6I A;  2Y5I A;  1OE9 B;  1CKK A;  1RFJ A;  4PE7 A;  3SG4 A;  2ISD A;  1AVS A;  1MXL C;  2ZNE A;  1V1G A;  3O78 A;  3SG5 A;  2LVK A;  3CTN A;  3I5I C;  2OPO A;  3BXK A;  3H4S E;  1B47 A;  2PRU A;  2LNK A;  4YGA A;  1YRU B;  2LP2 A;  1QTX A;  3HCM A;  2BEC A;  2F2O A;  2KFF A;  4YI8 A;  1JSA A;  1CDL A;  4PE4 A;  2F3Y A;  4YBH B;  4YGC B;  1FBV A;  3WHT B;  1S5G Z;  1QJT A;  1WDC C;  2KBI A;  4PHN A;  1K96 A;  4XJK A;  1QIW A;  1QVI Y;  5AER A;  3IF7 A;  3BUX B;  3TDI A;  1KWO B;  1UP5 A;  2JNF A;  3CR2 A;  4PHJ A;  2ZN8 A;  1AUI B;  2OTG C;  1PSB A;  5K89 A;  3KEV A;  1QV1 A;  2HQ8 A;  3NSO A;  2K7C A;  2LM5 A;  1K9U A;  2NCO A;  1XYD A;  3VRO A;  1CFF A;  1F70 A;  1NUB A;  5J3X A;  1J1D A;  5FYX A;  1Q80 A;  1FF1 A;  1TCO B;  3FIA A;  4GPL B;  1W7J B;  4JQ0 D;  3WNX B;  2L4I A;  1NIW A;  1B1G A;  2K7B A;  2LHI A;  2MAZ A;  1AP4 A;  3MSE B;  3FS7 A;  1S3P A;  2LC5 A;  5PAL A;  2ZKM X;  1XO5 A;  4GGN A;  1QLS A;  3SJS A;  2H2K A;  1FW4 A;  5DKN A;  2KGR A;  2HF5 A;  5AEQ A;  4AQI A;  1SYM A;  1EH2 A;  4N5X A;  2R2I A;  3ZNI A;  2EGD A;  2M97 A;  3DVJ A;  3FWC A;  2KYF A;  3EK7 A;  1UUS A;  4DS7 A;  3CS1 A;  4OVN F;  1HQV A;  3WHU B;  3LL8 B;  2SAS A;  2KAV A;  3PAT A;  2M29 A;  1ZOT B;  4BY5 A;  1KK8 C;  1JC2 A;  1MQ1 A;  4YGD B;  1QV0 A;  1SCM B;  2K61 A;  4OCI A;  4CID A;  3VGO A;  1RK9 A;  4CFQ A;  1B9A A;  3NSL A;  2L5X B;  1DT7 B;  2AMI A;  5DKQ A;  1EL4 A;  1EXR A;  4MZJ A;  4R1E A;  1KFX L;  5D69 A;  1LKJ A;  2PMY A;  1CB1 A;  1BG1 A;  3BUN B;  3CR5 X;  4NDB A;  3LK0 A;  2EC6 C;  3KO0 A;  4WQ3 A;  1DJW A;  4MSP A;  4PHM A;  1EG3 A;  1PRW A;  2KSP A;  3A4U B;  2LP3 A;  1N0Y A;  1PUL A;  4HSZ A;  2M1U A;  3DF0 B;  5JOL A;  1R2U A;  2WCF A;  1MF8 B;  3I5H C;  2BL0 B;  2CNP A;  3A8R A;  2LAP A;  2Y1N A;  1QX2 A;  2JT8 A;  2VRG A;  1SY9 A;  2LVJ A;  4WRI A;  1K2H A;  1IG5 A;  1CNP A;  3O4Y A;  2B1U A;  4FTG A;  1SW8 A;  4NQG A;  1BJF A;  4MEW A;  3C1V A;  1PAL A;  3AAJ A;  1JBA A;  2BE6 A;  1J1E A;  1QAS A;  1TIZ A;  4HRH A;  5JJG A;  5HKZ A;  3BQ3 A;  3D10 A;  1J7Q A;  2P6B B;  2E30 A;  2BE4 A;  1YVL A;  4PE0 A;  1OQP A;  1R6P A;  2F33 A;  1XFY O;  4D1E A;  1BR1 B;  2BCX A;  2LMT A;  1BF5 A;  2KI4 C;  1SMG A;  3ICB A;  5CSJ A;  3HX4 A;  3DD4 A;  1TTX A;  2F2P A;  3EKH A;  1UWO A;  2K0J A;  3GK4 X;  4ETO A;  4DCK A;  1C7W A;  1C7V A;  3KPX A;  1KSM A;  1IJ6 A;  3PLF B;  3PN7 C;  1JWD A;  4PAL A;  1K8U A;  1DGU A;  1AK8 A;  5KTY A;  1SPY A;  1M45 A;  1JFK A;  2L2E A;  2JRF A;  5IBW A;  1GQM A;  1ALV A;  1WRK A;  2KAX A;  1BU3 A;  1S5G Y;  1Y1A A;  3ZWH A;  1H8B A;  2AAO A;  2F8P A;  4C0J A;  5DKR A;  4N1F A;  1SL8 A;  4CFR A;  1NCX A;  3LCP C;  1SKT A;  1ALW A;  4IL1 A;  4ZCV A;  2GGM A;  3TS5 C;  1XVJ A;  1KFU S;  4AOM A;  1FI6 A;  2RGI A;  1DMO A;  1F54 A;  1JF2 A;  2LMU A;  1QX5 B;  2CT9 A;  1CDN A;  1L7Z A;  1CMF A;  2BCA A;  3PN7 B;  4JPZ B;  1BOD A;  3WXA A;  1DJH A;  4UPG A;  1B4C A;  2WC8 A;  1ZFS A;  2KQY A;  1NWD A;  1WY9 A;  3LK1 A;  1UHJ A;  1ZUZ A;  4ICB A;  4N1G A;  3VRR A;  4BY4 A;  2JTT A;  3I5F C;  3DVK A;  2M9G A;  1TNP A;  2D8N A;  4A4C A;  1CTR A;  1F4O A;  1NYA A;  2K7D A;  3OB1 B;  1ZMZ A;  1RWY A;  4MRX A;  1KQV A;  1K9P A;  3PM8 A;  3I5F B;  2M7N A;  3KF9 A;  1MXE A;  4NDC A;  2H61 C;  1C07 A;  1E8A A;  1TOP A;  3TUY C;  3DVM A;  1DVI A;  1KSO A;  1XFZ O;  1U5I A;  1QIV A;  5HYD A;  2KGB C;  1LXF C;  2JQ6 A;  2LLT A;  2WND A;  3GOF A;  1IWQ A;  4GBA A;  1FI5 A;  1AHR A;  3D0Y B;  4M2O A;  1NX1 A;  1CLL A;  3RLZ A;  3EVV A;  3K21 A;  1KFX S;  1WLZ A;  2KOT A;  2Y4Q A;  3EK8 A;  4L9M A;  2LUX A;  1G8I A;  1KK7 Z;  1YTZ C;  1NCZ A;  1G33 A;  1WRZ A;  4MZK A;  2OTG B;  3BUM B;  2LAN A;  1A4P A;  3IQO A;  2DOQ A;  1OMV A;  1J7R A;  1A2X A;  1JUO A;  3O2P A;  5I2O A;  2BL0 C;  2CBL A;  5AXI A;  1ZAC A;  1XK4 A;  1UHI A;  1W7I B;  1YVH A;  2JPT A;  4MRY A;  1IGV A;  2MJW B;  4C0K A;  1SCM C;  2GV5 A;  2K7O A;  3TUY B;  3TDZ A;  2FJU B;  4YI9 A;  1MR8 A;  2Y1M A;  2NLN A;  3F45 A;  2JC2 A;  2LVI A;  2PVB A;  4ORB B;  2HQW A;  2L0P A;  4YGB B;  3BUO B;  1SK6 D;  3VRP A;  3GK1 A;  3EVU A;  1K93 D;  4ZCU A;  1PVB A;  1J55 A;  1A75 B;  4XYN A;  4GGF C;  3VRQ A;  1XFV O;  1YUS A;  1KK8 B;  2MHH A;  2Q91 A;  2HET A;  3PAL A;  1QS7 A;  1WRL A;  1RTP 1;  5G08 A;  1BT6 A;  1XFU O;  2KI6 C;  3I5I B;  1YX8 A;  2L4H A;  4HRG A;  1JF0 A;  1G4Y R;  1IJ5 A;  2M3W A;  3I5G B;  1SR6 B;  2PSR A;  1CDP A;  1PSR A;  2BKI B;  3AKB A;  1KK7 Y;  3BUW B;  3O6B A;  3SIB A;  1BOC A;  2OS8 B;  3NXA A;  5CSI A;  2MA2 A;  2NXQ A;  1UUR A;  1DGV A;  1DF0 B;  2PAS A;  2I2R E;  4HRE E;  1MUX A;  1HT9 A;  3E3R A;  1B7T Y;  1SNL A;  2TN4 A;  5ER4 X;  1N2D A;  1OMD A;  5HKY A;  3EK4 A;  1NX3 A;  1XK4 C;  1Y6W A;  1YR5 A;  3TS5 B;  1CFC A;  1IQ3 A;  3JVT B;  2EHB A;  1BLQ A;  2KFH A;  4QJ5 B;  5CPV A;  4FQO A;  2F3Z A;  5KSZ A;  1DJG A;  1SBJ A;  3NSI A;  1DJI A;  4OV2 A;  1DJZ A;  5GQQ C;  2KQ6 A;  1QLK A;  3OHM B;  3JTD B;  1XFW O;  3NSK A;  5F6T A;  1J7O A;  2JU0 A;  4AQJ A;  1FPW A;  1A75 A;  4M2Q A;  3EKJ A;  1CM4 A;  4ORA B;  2I94 A;  3SG3 A;  2JXL A;  1CDM A;  3CWG A;  1BMO A;  4CLN A;  4Q04 A;  2LUC A;  2JZI A;  1MWN A;  2FOT A;  3CZT X;  1OZS A;  1F55 A;  1Y1X A;  3FWB A;  5CSN A;  1NX2 A;  2CTN A;  1EG4 A;  3OX5 A;  3SG2 A;  2COL B;  3OB2 B;  4NDD A;  4GUK A;  1A29 A;  1KCY A;  3CR4 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...