1IQ3A

Solution structure of the eps15 homology domain of a human pob1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
110
structure length
110
Chain Sequence
b'GSLQDNSSYPDEPWRITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAAFHLIVARKNGYPLPEGLPPTLQPEFIVTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RALBP1-INTERACTING PROTEIN (PARTNER OF RALBP1)
publication title Solution structure of the Eps15 homology domain of a human POB1 (partner of RalBP1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 13
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2001-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1iq3A00
3SG3A 2KI4C 1QXPA 1TNQA 4DUQA 2I18A 2PVBA 3KHEA 3I5FC 1KK8C 3BQ3A 2M0RA 2CCMA 1PK0D 2L4IA 2OS8B 1KCYA 1ZACA 1Y0VH 1F54A 1SW8A 1XA5A 2KHNA 4L9MA 1AP4A 3D0YB 3D0YA 2M7LA 1OMRA 4QJ5B 1ZMZA 2D8NA 2PASA 1XFVO 1B8CA 1ZUZA 3GOFA 5I2OA 3ZNIA 3I5GB 3FWCA 2BL0B 2A4JA 3ZWHA 4PHMA 4HRHA 1K9KA 4AQIA 3DVJA 3PALA 1NSHA 1RROA 2FOTA 2Y1MA 4R1EA 2KNEA 3SG4A 2CTNA 2K2FA 2VRGA 2WC8A 3TUYB 1CFCA 1DJWA 1NX2A 1RK9A 1XFXO 4GPLB 1UWOA 2JTZA 2HPSA 3ICBA 2MHHA 3LCPC 2LCPA 1CLBA 3MSEB 1TTXA 1XFZO 2AUCA 2H61C 1WDCB 4WQ2A 1BR4B 1S5GY 2H2KA 2MRDA 4P2YB 5DKQA 1JFJA 1KFUL 3I5HB 1JC2A 1DT7B 1A2XA 1IRJA 1HQVA 1XO5A 2GGZA 1QLKA 4BY4A 3VRPA 1CTRA 3LK0A 1ALVA 2HF5A 1A75B 1ZFSA 1A75A 4I5LB 4QJ4B 1J7RA 2LP2A 1DJXA 3CZTX 2BKIB 2K7CA 3H4SE 2F33A 2LMUA 2BCXA 1CDPA 2KI6C 3RM1A 1M46A 1SCMC 2G9BA 3DVKA 1F70A 3SG2A 1UHNA 3PATA 3JTDB 1PRWA 1R6PA 1OMVA 2M9GA 2KBMA 1YVHA 3KF9A 1NPQA 1XFUO 2JXCA 4YGDB 2JNFA 2B1UA 2KFHA 5DKRA 1MR8A 1MF8B 5I8NA 2Q91A 2F8PA 3EKJA 2LHLA 2KQ6A 1MWNA 3DVEA 3LL8B 1CDNA 1CB1A 2L50A 1B8RA 1JFKA 1KK7Y 1AUIB 2MLEC 3CLNA 3FWBA 1V1GA 1SRAA 1QASA 3M0WA 2F2OA 1SKTA 2KYCA 4NDCA 1KQMB 2WCFA 3IQQA 1RJVA 4HREE 1JSAA 3CGAA 1M31A 2QACA 4MSPA 1CNPA 2MLFC 1QATA 4JPZB 3TS5C 1S26D 5KTYA 4YGEB 4M2OA 1NP8A 3OHMB 5CSIA 1QTXA 3PN7B 1FI6A 2JNXA 1J7OA 1FPWA 1IJ6A 1GGWA 1NX1A 1K96A 2JT3A 1J1EA 1F4QA 2CXJA 2OTGB 3PM8A 1S1EA 2LP3A 3OX6A 4FQOA 1NUBA 1CM1A 1W7IB 1JWDA 4JQ0D 1CDLA 1LA3A 1KWOB 4USLA 5CSFA 3O6BA 1QVIZ 1DJGA 3OB1B 1S6CA 3SIBA 3O4YA 2BCBA 4MZKA 1CLMA 1UHHA 2ZNDA 1FBVA 4MVFA 3CR2A 3JVTC 2EGDA 1JUOA 2K7OA 2BBMA 3TDIA 4N1GA 4YGCB 3C1VA 1UHJA 1XYDA 2JXLA 1L2OC 1C07A 1HT9A 3RLZA 1DJZA 2LC5A 2JTTA 1C7WA 1K90D 2ZN9A 1A03A 2EC6C 1KSOA 1RWYA 3EVVA 1J55A 1M63B 1UP5A 1A4PA 2KQYA 2KAYA 1JBAA 4PHKA 1XFWO 1B4CA 4ZCVA 1TN4A 1XK4C 3PLFB 4Q04A 2E30A 1UUSA 1SBJA 4OVNF 4CLNA 2AMIA 2MJWB 2ZRSA 2Q4UA 1CFDA 1OOJA 4MBEA 1RTP1 1IGVA 1SR6B 3KO0A 2I7AA 3DD4A 1EG4A 1FF1A 4NDDA 1FI5A 4MN0A 2P6BB 2LLUA 4PE7A 1CMFA 2KFGA 3O78A 1CFPA 4DIRA 2HQWA 1R2UA 4WRIA 1UHIA 1U5IB 3VRQA 1U5IA 1IQ5A 5CSJA 4OKHA 1BOCA 4BY5A 1DJIA 1G33A 2LUCA 5D7FA 2PRUA 1B7TY 1QIWA 2NCOA 5TNCA 1YX7A 2IS9A 4MEWA 2M1KB 3PSRA 4YGBB 1BT6A 1SL8A 3GK1A 5D69A 1LKJA 2CT9A 2K8MB 1YRUB 2OS8C 3TDZA 4GBAA 3SJSA 1TNWA 4DS7A 3VROA 1IWQA 2PMYA 3SG5A 1AJ5A 2MAZA 3OP0A 4ORAB 3I5GC 2JULA 2BL0C 3TDUA 1IQ3A 1K93D 4E68A 5DKNA 2GGMA 2K7DA 3SIAA 2CNPA 2I2RE 1LVCD 3PFVA 4MRYA 4U8DA 1K8UA 4GGNA 2TN4A 4PHJA 3VRNA 3AAKA 1Y1XA 3OB2B 1SPYA 1SNLA 3TUYC 3WXAA 2BKHB 4N5XA 3IF7A 1YX8A 4PALA 1G4YR 1QIVA 1H4BA 2I94A 1WRLA 1KFXS 4CFQA 5BPJA 5FYXA 1B9AA 2LNKA 4NDBA 1BR1B 2JT8A 1QVIY 2WCBA 2O5GA 2LUXA 1WDCC 1AHRA 3WNXB 3I5HC 2MBXA 1JF2A 1K2HA 2M29A 1CFFA 3NXAA 2F3YA 5ER4X 3EKHA 1DMOA 2SCPA 1OMDA 2NZ0A 2QPTA 3BUNB 2F3ZA 1FW4A 1M45A 2LMTA 1EG3A 1F55A 4PE0A 1PSRA 2BBNA 2ZKMX 2Y5IA 1WY9A 2Y4QA 3JTDC 3NSKA 5PALA 3TZ1A 1F8HA 1F71A 4PE4A 3LLEA 4AQJA 1QX5B 1NIWA 4YBHB 4OCIA 5HKWA 1IG5A 3BOWB 3BOWA 4ETOA 2NLNA 1QS7A 2L4HA 4PCWA 1KQMC 2ZRTA 3HCMA 1N0YA 3DF0B 5HLOA 2JOJA 3AAJA 5AXIA 4YRUA 2LLTA 2KFFA 4P5OE 2E6WA 2HQ8A 1YURA 3KPXA 5I2QA 1NX3A 1SMGA 1NWDA 1S5GZ 2NCPA 3EK4A 5KSZA 1LINA 3PN7C 1TNXA 1VRKA 1PSBA 1Y1AA 1J7QA 1MXEA 3KEVA 1DVIA 2R2IA 2ISDA 1MUXA 4ICBA 1TIZA 1YUSA 2ZFDA 3SG7A 2OTGC 1Y1UA 2L0PA 2F2PA 2K2AA 1BG1A 1D1OA 1DJHA 4GGFA 4ORCB 2FCDA 4FTGA 1G8IA 2KAVA 4GNKB 1KWOC 1YVLA 5G08A 2LM5A 2KAXA 1X02A 3A8RA 2JZIA 3BUXB 2FCEA 2KDHA 1CKKA 2DOQA 5HYDA 1XFYO 4ORBB 3BXKA 3I5IB 3CR5X 2COLB 4C0LA 1Q80A 1OE9B 1BJFA 2JRFA 1AVSA 3SG6A 1TCOB 4DCKA 2KI4B 4MZLA 2WORA 4MLWA 5JJGA 1B1GA 1YR5A 1QV0A 2JC2A 1KK7Z 2Y1NA 1K94A 3I5FB 1KK8B 2K61A 2SASA 4ZCUA 1PVAA 1DF0B 1DF0A 3CWGA 1B8LA 3BYAA 1NYAA 2KYFA 1KFUS 4TNCA 3HX4A 1KQVA 3GK2A 2AAOA 2NXQA 2LANA 4I5KA 4D1EA 1OQPA 1YUUA 2M7NA 3A4UB 2LAPA 2LVIA 5HKYA 5GQQC 4C0JA 1E8AA 3NSLA 1QJTA 1WLZA 4OR9B 4PE1A 1SR6C 3GK4X 4GFTA 4WQ3A 2JPTA 1SL9A 1NX0A 3FS7A 1EJ3A 4HRGA 1BMOA 2KGBC 2O60A 4IL1A 4A4BA 2KI6D 1YUTA 1C7VA 4XYNA 1CMGA 3CS1A 5HKZA 4AOMA 3EVUA 2MA2A 4CFRA 1UURA 1GGZA 2H61A 2ZNEA 5I2LA 3CTNA 2M49B 2CBLA 3VRRA 2PSRA 1PULA 4YGAA 1SK6D 3BUOB 2LVKA 4NQGA 3K21A 1GQMA 5CPVA 2WNDA 2PALA 2M97A 2V53A 5AEQA 3IQOA 2KGRA 2BE6A 4A4CA 1YTZC 2GV5A 4HSZA 1Y6WA 3E3RA 5CSNA 1YRTB 1MQ1A 2JT0A 1K9PA 1SCMB 1CLLA 1K9UA 1W7JB 3CR4X 1WRKA 3VGOA 2HETA 1WLMA 1UHKA 3AKBA 5AFPA 1ALWA 2K0JA 1DGUA 1S3PA 1SYMA 1TOPA 2KSPA 4JWQA 1QX7A 1F4OA 2LVVA 2G2BA 3EK8A 1SCVA 1NCYA 2BCAA 1AJ4A 1PVBA 1BU3A 4M2QA 1AK8A 1KSMA 1S6JA 3O2PA 1B47A 1DJYA 1S36A 1ZOTB 2M3WA 1EL4A 2KBIA 3WHUB 2L5XB 2JWWA 4QJ3B 1OZSA 1S6IA 1B7TZ 3TS5B 2FJUB 1EXRA 1QLSA 2LVJA 4GAOA 4F0ZB 5IBWA 2LHIA 4MZJA 2ZN8A 1J1DA 1TCFA 1ODBA 4N1FA 5B8IB 1DTLA 1PALA 1NCXA 1IJ5A 1GJYA 1WRZA 2M8UA 3OX5A 1H8BA 1MHOA 1OSAA 1IH0A 3DF0A 1BF5A 1V1FA 4YI9A 4GUKA 3BUMB 4OV2A 2WCEA 2EHBA 1MXLC 5JOLA 2K7BA 1KFXL 5AERA 1N2DA 3F45A 1LA0A 1BLQA 3JVTB 5K89A 1QV1A 3WHTB 2M1UA 3EVRA 3DVMA 1L2OB 5J3XA 1K95A 1N65A 4PDZA 1LXFC 5AANA 1RECA 2JU0A 1DGVA 2OPOA 2EC6B 3FIAA 4DRWA 4C0KA 1CM4A 1JF0A 2LV7A 1RFJA 2LLSA 3QRXA 4PHNA 1TNPA 1QX2A 1XK4A 1OZOA 2JQ6A 4I5JA 1A29A 2RGIA 3NSOA 4CIDA 3LK1A 1M39A 4CPVA 3NSIA 4MRXA 1EH2A 4XJKB 4XJKA 1XVJA 2BE4A 1CDMA 5F6TA 5HLVA 4GGFC 4YI8A 1SL7A 1TRFA 3BUWB 1IKUA 1L7ZA 1BODA 1SY9A 3AKAA 3D10A 2KOTA 2WOSA 4UPGA 1J7PA 5ER5A 2LMVA 3I5IC 2L51A 2L2EA 2L98A 2LE9B 4I5NB 4M2PA 3EK7A 5KU1A 2BECA 1NCZA
chains in the Genus database with same CATH superfamily
3SG3A 2KI4C 1QXPA 1TNQA 4DUQA 2I18A 2PVBA 3KHEA 3I5FC 1KK8C 3DY9A 3BQ3A 2M0RA 2CCMA 3S0EA 1PK0D 2L4IA 2OS8B 4PT1A 1KCYA 1ZACA 1Y0VH 1F54A 1SW8A 1XA5A 2KHNA 4L9MA 1AP4A 3D0YB 3D0YA 2M7LA 1OMRA 1QWVA 4QJ5B 1ZMZA 2D8NA 2PASA 1XFVO 1B8CA 1ZUZA 3GOFA 5I2OA 3ZNIA 3I5GB 3FWCA 3PJIA 2BL0B 2A4JA 3ZWHA 4PHMA 4HRHA 1K9KA 4AQIA 3DVJA 3PALA 1NSHA 1RROA 2FOTA 2Y1MA 3CZ1A 2KNEA 4R1EA 3SG4A 2CTNA 2K2FA 2VRGA 2WC8A 5FI2A 3TUYB 1CFCA 1DJWA 1NX2A 1RK9A 1XFXO 3S0BA 4GPLB 1UWOA 2L5YA 2JTZA 2HPSA 3ICBA 3UNWA 2MHHA 3LCPC 2LCPA 1CLBA 3MSEB 1TTXA 1XFZO 2AUCA 1C3YA 2H61C 1WDCB 4WQ2A 1BR4B 1S5GY 2H2KA 2MRDA 4P2YB 5DKQA 1JFJA 1IIOA 1KFUL 3I5HB 1JC2A 1ORGA 1DT7B 1GM0A 1A2XA 1IRJA 1HQVA 1XO5A 2GGZA 1QLKA 4BY4A 3VRPA 2KLEA 1CTRA 3LK0A 1ALVA 2HF5A 1A75B 1ZFSA 1A75A 4I5LB 4QJ4B 1J7RA 2LP2A 1DJXA 3CZTX 2BKIB 2K7CA 3H4SE 2F33A 2LMUA 2BCXA 1CDPA 3S0DA 2KI6C 3RM1A 1M46A 1SCMC 2G9BA 3DVKA 1F70A 3SG2A 1UHNA 3PATA 3JTDB 3R72A 1PRWA 1TWOA 1R6PA 1OMVA 2M9GA 2KBMA 1YVHA 3CZ0A 1NPQA 1XFUO 2JXCA 3KF9A 4YGDB 2JNFA 2B1UA 2KFHA 5DKRA 1MR8A 1MF8B 5I8NA 3CABA 2Q91A 2F8PA 3EKJA 1P28A 2LHLA 2KQ6A 1MWNA 3DVEA 3LL8B 1CDNA 1CB1A 2L2CA 2L50A 1B8RA 1JFKA 1KK7Y 1AUIB 2MLEC 3CLNA 3FWBA 1V1GA 3RZSA 1SRAA 1QASA 3M0WA 2F2OA 1SKTA 4JD9A 2KYCA 4NDCA 1KQMB 2WCFA 3IQQA 1RJVA 4HREE 1JSAA 3CGAA 2FJYA 2WC5A 1M31A 2QACA 4MSPA 4F7FA 1OOIX 3B6XA 1CNPA 1DC1A 5D3OA 3D76A 2MLFC 1QATA 4JPZB 3TS5C 1S26D 5KTYA 4YGEB 4M2OA 1NP8A 3OHMB 5CSIA 1QTXA 3PN7B 1FI6A 2JNXA 2WCKA 1J7OA 1IJ6A 1FPWA 1GGWA 1NX1A 1K96A 2JT3A 1J1EA 1F4QA 2CXJA 2OTGB 3PM8A 1S1EA 2LP3A 3OX6A 4FQOA 1NUBA 1CM1A 1W7IB 1JWDA 4JQ0D 1CDLA 1LA3A 1KWOB 4USLA 5CSFA 3O6BA 1QVIZ 1DJGA 4IJ7A 3OB1B 3Q8IA 1S6CA 3SIBA 2BAPA 3O4YA 2BCBA 4MZKA 3R1PA 1CLMA 1UHHA 2ZNDA 1FBVA 4MVFA 3CR2A 3JVTC 2EGDA 3K1EA 1JUOA 2K7OA 2BBMA 5FI7A 3TDIA 4N1GA 4YGCB 3C1VA 1UHJA 1XYDA 1DEKA 1L2OC 2JXLA 2KLDA 1C07A 1HT9A 3NGVA 3RLZA 1DJZA 2LC5A 2JTTA 1C7WA 1K90D 2ZN9A 1A03A 2EC6C 1KSOA 1RWYA 3EVVA 1J55A 1M63B 1UP5A 1A4PA 2KQYA 2KAYA 1JBAA 4PHKA 1XFWO 1B4CA 3FE6A 4ZCVA 1TN4A 1XK4C 3PLFB 4Q04A 3S0FA 2E30A 1UUSA 1SBJA 4OVNF 1OOFA 4CLNA 2AMIA 2MJWB 2ZRSA 2Q4UA 3D77A 1CFDA 1OOJA 4MBEA 1RTP1 1IGVA 1SR6B 3KO0A 2I7AA 3DD4A 1EG4A 2QDIA 1FF1A 4NDDA 1FI5A 4MN0A 2P6BB 2LLUA 4PE7A 1CMFA 3B87A 2KFGA 3O78A 1CFPA 4DIRA 2HQWA 1R2UA 4WRIA 1UHIA 1U5IB 3VRQA 1C3ZA 1IQ5A 1U5IA 3DZTA 2WCLA 1Z4HA 4OKHA 5CSJA 3S0AA 1BOCA 4BY5A 1TUZA 1DJIA 1G33A 2LUCA 4INXA 5D7FA 2PRUA 1B7TY 1QIWA 2NCOA 5TNCA 1YX7A 2IS9A 4MEWA 3BFAA 2M1KB 3PSRA 4YGBB 1BT6A 1SL8A 3GK1A 2QEBA 5D69A 1LKJA 2CT9A 2K8MB 2YGUA 1YRUB 2OS8C 3TDZA 4GBAA 3SJSA 1TNWA 4DS7A 3VROA 1IWQA 2PMYA 3SG5A 1AJ5A 2MAZA 3OP0A 4ORAB 3I5GC 2JULA 5HL1A 2BL0C 3TDUA 1IQ3A 1K93D 4E68A 3OBVA 1W9ZA 5DKNA 2GGMA 2K7DA 3SIAA 3R1OA 2CNPA 2I2RE 1LVCD 3PFVA 4MRYA 4U8DA 1K8UA 4GGNA 2TN4A 4PHJA 3VRNA 3AAKA 1Y1XA 3OB2B 1SPYA 1SNLA 5FI6A 3WXAA 2BKHB 3TUYC 4N5XA 2WCMA 3IF7A 1YX8A 4PALA 1G4YR 1QIVA 1H4BA 2WCJA 2I94A 1WRLA 1KFXS 4CFQA 5BPJA 5FYXA 1B9AA 2LNKA 4NDBA 1BR1B 2JT8A 1QVIY 2WCBA 2O5GA 2LUXA 1WDCC 1AHRA 2WCHA 4INWA 3WNXB 3I5HC 2MBXA 1JF2A 3DYEA 1K2HA 2M29A 1CFFA 1DQEA 2F3YA 3NXAA 5ER4X 3EKHA 1DMOA 2SCPA 1OMDA 2NZ0A 3D75A 2QPTA 3BUNB 2F3ZA 1FW4A 1M45A 3NHTA 2LMTA 1EG3A 1F55A 4PE0A 2GTEA 1PSRA 4JKTA 2BBNA 2ZKMX 2Y5IA 1WY9A 2Y4QA 3JTDC 3NSKA 5PALA 3TZ1A 1XFRA 1F8HA 1F71A 4PE4A 3LLEA 2K60A 4AQJA 1QX5B 2KPHA 1NIWA 4YBHB 4OCIA 5HKWA 1IG5A 3BOWB 3BOWA 4ETOA 2NLNA 1QS7A 3S0GA 2L4HA 4PCWA 1KQMC 2ZRTA 3HCMA 1N0YA 3DF0B 5HLOA 2JOJA 3AAJA 5AXIA 4YRUA 2LLTA 2KFFA 4P5OE 1LS8A 2E6WA 2HQ8A 1YURA 2P70A 3KPXA 1NX3A 5I2QA 1SMGA 1NWDA 1S5GZ 2NCPA 3R1VA 3EK4A 5KSZA 1LINA 3CDNA 3PN7C 1TNXA 1VRKA 1PSBA 1Y1AA 1J7QA 1MXEA 3KEVA 4KYNA 1DVIA 2R2IA 2ISDA 1MUXA 4ICBA 1TIZA 1YUSA 2ZFDA 3EG5B 3SG7A 2OTGC 1Y1UA 3N7HA 2L0PA 2F2PA 2K2AA 1BG1A 1OW4A 1D1OA 1DJHA 4GGFA 4ORCB 2FCDA 4FTGA 1G8IA 1TUJA 2BNXA 2KAVA 4GNKB 1KWOC 1YVLA 5G08A 2LM5A 2KAXA 1X02A 3A8RA 2JZIA 3BUXB 2FCEA 2ERBA 2KDHA 1CKKA 2DOQA 5HYDA 1XFYO 4ORBB 3BXKA 3I5IB 3CR5X 2COLB 4C0LA 1Q80A 1OE9B 1BJFA 2JRFA 2QEOA 1AVSA 3SG6A 1TCOB 4DCKA 2KI4B 4MZLA 2WORA 4MLWA 5JJGA 1B1GA 1YR5A 1QV0A 2JC2A 1KK7Z 3L47A 2QEVA 1K94A 2Y1NA 3I5FB 1KK8B 3B7AA 2K61A 2SASA 4ZCUA 1PVAA 1DF0B 1DF0A 3CWGA 1B8LA 3BYAA 3O4XA 1NYAA 3VB1A 2KYFA 1KFUS 4TNCA 3HX4A 1KQVA 3GK2A 2AAOA 2NXQA 2LANA 4I5KA 4D1EA 3B88A 1OQPA 1YUUA 2M7NA 3A4UB 2LAPA 2LVIA 5HKYA 5GQQC 4C0JA 1E8AA 3NSLA 1QJTA 1WLZA 4OR9B 4PE1A 1SR6C 3GK4X 4GFTA 4WQ3A 2JPTA 1SL9A 1NX0A 3FS7A 1EJ3A 4HRGA 1BMOA 2KGBC 2O60A 4IL1A 3PM2A 4A4BA 2PYQA 2KI6D 2WC6A 1T14A 1YUTA 1Z2CB 1C7VA 4XYNA 1CMGA 3CS1A 3D74A 5HKZA 5EL2A 4AOMA 3EVUA 2MA2A 4CFRA 1UURA 1GGZA 2JPOA 2H61A 2ZNEA 5I2LA 3CTNA 2M49B 3D73A 2CBLA 3VRRA 2PSRA 1PULA 4YGAA 1SK6D 3BUOB 2LVKA 4NQGA 5I94A 3K21A 1GQMA 5CPVA 2WNDA 2PALA 2M97A 2V53A 5AEQA 3IQOA 2KGRA 2BE6A 4A4CA 1YTZC 2GV5A 4HSZA 1Y6WA 3E3RA 5CSNA 1YRTB 1MQ1A 2JT0A 1K9PA 4FQTA 1SCMB 1CLLA 1K9UA 1W7JB 3CR4X 1WRKA 3VGOA 2PQLA 2HETA 1WLMA 1UHKA 3AKBA 5AFPA 1ALWA 2K0JA 5DICA 1DGUA 1S3PA 1SYMA 1TOPA 2KSPA 3B86A 1QX7A 1F4OA 2LVVA 4JWQA 2G2BA 3EK8A 1SCVA 1NCYA 2BCAA 1AJ4A 1PVBA 1BU3A 3BJHA 4M2QA 1AK8A 1KSMA 1S6JA 3O2PA 1B47A 1DJYA 1S36A 1ZOTB 2M3WA 1EL4A 2KBIA 3WHUB 3CYZA 3NHIA 2L5XB 2JWWA 4QJ3B 1OZSA 1S6IA 1B7TZ 2H8VA 3TS5B 2FJUB 1DELA 1EXRA 3V2LA 1QLSA 2LVJA 4GAOA 2P71A 4F0ZB 2LHIA 5IBWA 4MZJA 2ZN8A 1J1DA 1TCFA 1ODBA 4N1FA 3OGNA 5B8IB 1DTLA 1OOHA 1PALA 3SS4A 1NCXA 1IJ5A 3FE9A 1OOGA 1GJYA 1WRZA 2M8UA 3OX5A 1H8BA 1MHOA 1OSAA 1IH0A 3DF0A 1BF5A 1V1FA 4YI9A 4GUKA 3BUMB 4OV2A 2WCEA 2EHBA 1MXLC 5JOLA 2K7BA 1KFXL 5AERA 1N2DA 3F45A 1LA0A 1BLQA 3JVTB 5K89A 1QV1A 3WHTB 2M1UA 3EVRA 3DVMA 1L2OB 5J3XA 1K95A 3BFHA 1N65A 4PDZA 1LXFC 5AANA 1RECA 2JU0A 4OZDA 1DGVA 3FE8A 2OPOA 2EC6B 3FIAA 3QMEA 4C0KA 4DRWA 1CM4A 1JF0A 2QEHA 3SS3A 2LV7A 3IVTA 1RFJA 2LLSA 3QRXA 4PHNA 1TNPA 3UO9A 1QX2A 1XK4A 1OZOA 2JQ6A 4I5JA 1A29A 2RGIA 3NSOA 4CIDA 3LK1A 1M39A 4CPVA 3NSIA 4MRXA 1EH2A 4XJKB 4XJKA 1XVJA 3CZ2A 2BE4A 1CDMA 5F6TA 5HLVA 4GGFC 4YI8A 1SL7A 1TRFA 3BUWB 1IKUA 1L7ZA 1BODA 1SY9A 3L4LA 1SSEB 3AKAA 3BFBA 3D10A 2KOTA 2WOSA 3L4AA 4UPGA 3DXLA 1J7PA 5ER5A 2LMVA 3D78A 3I5IC 2L51A 2L2EA 2L98A 2LE9B 4I5NB 4M2PA 3SS5A 3EK7A 5KU1A 2BECA 1NCZA
chains in the Genus database with same CATH topology
3SG3A 2KI4C 1QXPA 1TNQA 4DUQA 2I18A 2PVBA 3KHEA 3I5FC 1KK8C 3BQ3A 2M0RA 2CCMA 1PK0D 2L4IA 2OS8B 1KCYA 1ZACA 1Y0VH 1F54A 1SW8A 1XA5A 2KHNA 4L9MA 1AP4A 3D0YB 3D0YA 2M7LA 1OMRA 4QJ5B 1ZMZA 2D8NA 2PASA 1XFVO 1B8CA 1ZUZA 3GOFA 5I2OA 3ZNIA 3I5GB 3FWCA 2BL0B 2A4JA 3ZWHA 4PHMA 4HRHA 1K9KA 4AQIA 3DVJA 3PALA 1NSHA 1RROA 2FOTA 2Y1MA 4R1EA 2KNEA 3SG4A 2CTNA 2K2FA 2VRGA 2WC8A 3TUYB 1CFCA 1DJWA 1NX2A 1RK9A 1XFXO 4GPLB 1UWOA 2JTZA 2HPSA 3ICBA 2MHHA 3LCPC 2LCPA 1CLBA 3MSEB 1TTXA 1XFZO 2AUCA 2H61C 1WDCB 4WQ2A 1BR4B 1S5GY 2H2KA 2MRDA 4P2YB 5DKQA 1JFJA 1KFUL 3I5HB 1JC2A 1DT7B 1A2XA 1IRJA 1HQVA 1XO5A 2GGZA 1QLKA 4BY4A 3VRPA 1CTRA 3LK0A 1ALVA 2HF5A 1A75B 1ZFSA 1A75A 4I5LB 4QJ4B 1J7RA 2LP2A 1DJXA 3CZTX 2BKIB 2K7CA 3H4SE 2F33A 2LMUA 2BCXA 1CDPA 2KI6C 3RM1A 1M46A 1SCMC 2G9BA 3DVKA 1F70A 3SG2A 1UHNA 3PATA 3JTDB 1PRWA 1R6PA 1OMVA 2M9GA 2KBMA 1YVHA 3KF9A 1NPQA 1XFUO 2JXCA 4YGDB 2JNFA 2B1UA 2KFHA 5DKRA 1MR8A 1MF8B 5I8NA 2Q91A 2F8PA 3EKJA 2LHLA 2KQ6A 1MWNA 3DVEA 3LL8B 1CDNA 1CB1A 2L50A 1B8RA 1JFKA 1KK7Y 1AUIB 2MLEC 3CLNA 3FWBA 1V1GA 1SRAA 1QASA 3M0WA 2F2OA 1SKTA 2KYCA 4NDCA 1KQMB 2WCFA 3IQQA 1RJVA 4HREE 1JSAA 3CGAA 1M31A 2QACA 4MSPA 1CNPA 2MLFC 1QATA 4JPZB 3TS5C 1S26D 5KTYA 4YGEB 4M2OA 1NP8A 3OHMB 5CSIA 1QTXA 3PN7B 1FI6A 2JNXA 1J7OA 1FPWA 1IJ6A 1GGWA 1NX1A 1K96A 2JT3A 1J1EA 1F4QA 2CXJA 2OTGB 3PM8A 1S1EA 2LP3A 3OX6A 4FQOA 1NUBA 1CM1A 1W7IB 1JWDA 4JQ0D 1CDLA 1LA3A 1KWOB 4USLA 5CSFA 3O6BA 1QVIZ 1DJGA 3OB1B 1S6CA 3SIBA 3O4YA 2BCBA 4MZKA 1CLMA 1UHHA 2ZNDA 1FBVA 4MVFA 3CR2A 3JVTC 2EGDA 1JUOA 2K7OA 2BBMA 3TDIA 4N1GA 4YGCB 3C1VA 1UHJA 1XYDA 2JXLA 1L2OC 1C07A 1HT9A 3RLZA 1DJZA 2LC5A 2JTTA 1C7WA 1K90D 2ZN9A 1A03A 2EC6C 1KSOA 1RWYA 3EVVA 1J55A 1M63B 1UP5A 1A4PA 2KQYA 2KAYA 1JBAA 4PHKA 1XFWO 1B4CA 4ZCVA 1TN4A 1XK4C 3PLFB 4Q04A 2E30A 1UUSA 1SBJA 4OVNF 4CLNA 2AMIA 2MJWB 2ZRSA 2Q4UA 1CFDA 1OOJA 4MBEA 1RTP1 1IGVA 1SR6B 3KO0A 2I7AA 3DD4A 1EG4A 1FF1A 4NDDA 1FI5A 4MN0A 2P6BB 2LLUA 4PE7A 1CMFA 2KFGA 3O78A 1CFPA 4DIRA 2HQWA 1R2UA 4WRIA 1UHIA 1U5IB 3VRQA 1U5IA 1IQ5A 5CSJA 4OKHA 1BOCA 4BY5A 1DJIA 1G33A 2LUCA 5D7FA 2PRUA 1B7TY 1QIWA 2NCOA 5TNCA 1YX7A 2IS9A 4MEWA 2M1KB 3PSRA 4YGBB 1BT6A 1SL8A 3GK1A 5D69A 1LKJA 2CT9A 2K8MB 1YRUB 2OS8C 3TDZA 4GBAA 3SJSA 1TNWA 4DS7A 3VROA 1IWQA 2PMYA 3SG5A 1AJ5A 2MAZA 3OP0A 4ORAB 3I5GC 2JULA 2BL0C 3TDUA 1IQ3A 1K93D 4E68A 5DKNA 2GGMA 2K7DA 3SIAA 2CNPA 2I2RE 1LVCD 3PFVA 4MRYA 4U8DA 1K8UA 4GGNA 2TN4A 4PHJA 3VRNA 3AAKA 1Y1XA 3OB2B 1SPYA 1SNLA 3TUYC 3WXAA 2BKHB 4N5XA 3IF7A 1YX8A 4PALA 1G4YR 1QIVA 1H4BA 2I94A 1WRLA 1KFXS 4CFQA 5BPJA 5FYXA 1B9AA 2LNKA 4NDBA 1BR1B 2JT8A 1QVIY 2WCBA 2O5GA 2LUXA 1WDCC 1AHRA 3WNXB 3I5HC 2MBXA 1JF2A 1K2HA 2M29A 1CFFA 3NXAA 2F3YA 5ER4X 3EKHA 1DMOA 2SCPA 1OMDA 2NZ0A 2QPTA 3BUNB 2F3ZA 1FW4A 1M45A 2LMTA 1EG3A 1F55A 4PE0A 1PSRA 2BBNA 2ZKMX 2Y5IA 1WY9A 2Y4QA 3JTDC 3NSKA 5PALA 3TZ1A 1F8HA 1F71A 4PE4A 3LLEA 4AQJA 1QX5B 1NIWA 4YBHB 4OCIA 5HKWA 1IG5A 3BOWB 3BOWA 4ETOA 2NLNA 1QS7A 2L4HA 4PCWA 1KQMC 2ZRTA 3HCMA 1N0YA 3DF0B 5HLOA 2JOJA 3AAJA 5AXIA 4YRUA 2LLTA 2KFFA 4P5OE 2E6WA 2HQ8A 1YURA 3KPXA 5I2QA 1NX3A 1SMGA 1NWDA 1S5GZ 2NCPA 3EK4A 5KSZA 1LINA 3PN7C 1TNXA 1VRKA 1PSBA 1Y1AA 1J7QA 1MXEA 3KEVA 1DVIA 2R2IA 2ISDA 1MUXA 4ICBA 1TIZA 1YUSA 2ZFDA 3SG7A 2OTGC 1Y1UA 2L0PA 2F2PA 2K2AA 1BG1A 1D1OA 1DJHA 4GGFA 4ORCB 2FCDA 4FTGA 1G8IA 2KAVA 4GNKB 1KWOC 1YVLA 5G08A 2LM5A 2KAXA 1X02A 3A8RA 2JZIA 3BUXB 2FCEA 2KDHA 1CKKA 2DOQA 5HYDA 1XFYO 4ORBB 3BXKA 3I5IB 3CR5X 2COLB 4C0LA 1Q80A 1OE9B 1BJFA 2JRFA 1AVSA 3SG6A 1TCOB 4DCKA 2KI4B 4MZLA 2WORA 4MLWA 5JJGA 1B1GA 1YR5A 1QV0A 2JC2A 1KK7Z 2Y1NA 1K94A 3I5FB 1KK8B 2K61A 2SASA 4ZCUA 1PVAA 1DF0B 1DF0A 3CWGA 1B8LA 3BYAA 1NYAA 2KYFA 1KFUS 4TNCA 3HX4A 1KQVA 3GK2A 2AAOA 2NXQA 2LANA 4I5KA 4D1EA 1OQPA 1YUUA 2M7NA 3A4UB 2LAPA 2LVIA 5HKYA 5GQQC 4C0JA 1E8AA 3NSLA 1QJTA 1WLZA 4OR9B 4PE1A 1SR6C 3GK4X 4GFTA 4WQ3A 2JPTA 1SL9A 1NX0A 3FS7A 1EJ3A 4HRGA 1BMOA 2KGBC 2O60A 4IL1A 4A4BA 2KI6D 1YUTA 1C7VA 4XYNA 1CMGA 3CS1A 5HKZA 4AOMA 3EVUA 2MA2A 4CFRA 1UURA 1GGZA 2H61A 2ZNEA 5I2LA 3CTNA 2M49B 2CBLA 3VRRA 2PSRA 1PULA 4YGAA 1SK6D 3BUOB 2LVKA 4NQGA 3K21A 1GQMA 5CPVA 2WNDA 2PALA 2M97A 2V53A 5AEQA 3IQOA 2KGRA 2BE6A 4A4CA 1YTZC 2GV5A 4HSZA 1Y6WA 3E3RA 5CSNA 1YRTB 1MQ1A 2JT0A 1K9PA 1SCMB 1CLLA 1K9UA 1W7JB 3CR4X 1WRKA 3VGOA 2HETA 1WLMA 1UHKA 3AKBA 5AFPA 1ALWA 2K0JA 1DGUA 1S3PA 1SYMA 1TOPA 2KSPA 4JWQA 1QX7A 1F4OA 2LVVA 2G2BA 3EK8A 1SCVA 1NCYA 2BCAA 1AJ4A 1PVBA 1BU3A 4M2QA 1AK8A 1KSMA 1S6JA 3O2PA 1B47A 1DJYA 1S36A 1ZOTB 2M3WA 1EL4A 2KBIA 3WHUB 2L5XB 2JWWA 4QJ3B 1OZSA 1S6IA 1B7TZ 3TS5B 2FJUB 1EXRA 1QLSA 2LVJA 4GAOA 4F0ZB 5IBWA 2LHIA 4MZJA 2ZN8A 1J1DA 1TCFA 1ODBA 4N1FA 5B8IB 1DTLA 1PALA 1NCXA 1IJ5A 1GJYA 1WRZA 2M8UA 3OX5A 1H8BA 1MHOA 1OSAA 1IH0A 3DF0A 1BF5A 1V1FA 4YI9A 4GUKA 3BUMB 4OV2A 2WCEA 2EHBA 1MXLC 5JOLA 2K7BA 1KFXL 5AERA 1N2DA 3F45A 1LA0A 1BLQA 3JVTB 5K89A 1QV1A 3WHTB 2M1UA 3EVRA 3DVMA 1L2OB 5J3XA 1K95A 1N65A 4PDZA 1LXFC 5AANA 1RECA 2JU0A 1DGVA 2OPOA 2EC6B 3FIAA 4DRWA 4C0KA 1CM4A 1JF0A 2LV7A 1RFJA 2LLSA 3QRXA 4PHNA 1TNPA 1QX2A 1XK4A 1OZOA 2JQ6A 4I5JA 1A29A 2RGIA 3NSOA 4CIDA 3LK1A 1M39A 4CPVA 3NSIA 4MRXA 1EH2A 4XJKB 4XJKA 1XVJA 2BE4A 1CDMA 5F6TA 5HLVA 4GGFC 4YI8A 1SL7A 1TRFA 3BUWB 1IKUA 1L7ZA 1BODA 1SY9A 3AKAA 3D10A 2KOTA 2WOSA 4UPGA 1J7PA 5ER5A 2LMVA 3I5IC 2L51A 2L2EA 2L98A 2LE9B 4I5NB 4M2PA 3EK7A 5KU1A 2BECA 1NCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SG3 A;  2KI4 C;  1QXP A;  1TNQ A;  4DUQ A;  2I18 A;  2PVB A;  3KHE A;  3I5F C;  1KK8 C;  3BQ3 A;  2M0R A;  2CCM A;  1PK0 D;  2L4I A;  2OS8 B;  1KCY A;  1ZAC A;  1Y0V H;  1F54 A;  1SW8 A;  1XA5 A;  2KHN A;  4L9M A;  1AP4 A;  3D0Y B;  3D0Y A;  2M7L A;  1OMR A;  4QJ5 B;  1ZMZ A;  2D8N A;  2PAS A;  1XFV O;  1B8C A;  1ZUZ A;  3GOF A;  5I2O A;  3ZNI A;  3I5G B;  3FWC A;  2BL0 B;  2A4J A;  3ZWH A;  4PHM A;  4HRH A;  1K9K A;  4AQI A;  3DVJ A;  3PAL A;  1NSH A;  1RRO A;  2FOT A;  2Y1M A;  4R1E A;  2KNE A;  3SG4 A;  2CTN A;  2K2F A;  2VRG A;  2WC8 A;  3TUY B;  1CFC A;  1DJW A;  1NX2 A;  1RK9 A;  1XFX O;  4GPL B;  1UWO A;  2JTZ A;  2HPS A;  3ICB A;  2MHH A;  3LCP C;  2LCP A;  1CLB A;  3MSE B;  1TTX A;  1XFZ O;  2AUC A;  2H61 C;  1WDC B;  4WQ2 A;  1BR4 B;  1S5G Y;  2H2K A;  2MRD A;  4P2Y B;  5DKQ A;  1JFJ A;  1KFU L;  3I5H B;  1JC2 A;  1DT7 B;  1A2X A;  1IRJ A;  1HQV A;  1XO5 A;  2GGZ A;  1QLK A;  4BY4 A;  3VRP A;  1CTR A;  3LK0 A;  1ALV A;  2HF5 A;  1A75 B;  1ZFS A;  1A75 A;  4I5L B;  4QJ4 B;  1J7R A;  2LP2 A;  1DJX A;  3CZT X;  2BKI B;  2K7C A;  3H4S E;  2F33 A;  2LMU A;  2BCX A;  1CDP A;  2KI6 C;  3RM1 A;  1M46 A;  1SCM C;  2G9B A;  3DVK A;  1F70 A;  3SG2 A;  1UHN A;  3PAT A;  3JTD B;  1PRW A;  1R6P A;  1OMV A;  2M9G A;  2KBM A;  1YVH A;  3KF9 A;  1NPQ A;  1XFU O;  2JXC A;  4YGD B;  2JNF A;  2B1U A;  2KFH A;  5DKR A;  1MR8 A;  1MF8 B;  5I8N A;  2Q91 A;  2F8P A;  3EKJ A;  2LHL A;  2KQ6 A;  1MWN A;  3DVE A;  3LL8 B;  1CDN A;  1CB1 A;  2L50 A;  1B8R A;  1JFK A;  1KK7 Y;  1AUI B;  2MLE C;  3CLN A;  3FWB A;  1V1G A;  1SRA A;  1QAS A;  3M0W A;  2F2O A;  1SKT A;  2KYC A;  4NDC A;  1KQM B;  2WCF A;  3IQQ A;  1RJV A;  4HRE E;  1JSA A;  3CGA A;  1M31 A;  2QAC A;  4MSP A;  1CNP A;  2MLF C;  1QAT A;  4JPZ B;  3TS5 C;  1S26 D;  5KTY A;  4YGE B;  4M2O A;  1NP8 A;  3OHM B;  5CSI A;  1QTX A;  3PN7 B;  1FI6 A;  2JNX A;  1J7O A;  1FPW A;  1IJ6 A;  1GGW A;  1NX1 A;  1K96 A;  2JT3 A;  1J1E A;  1F4Q A;  2CXJ A;  2OTG B;  3PM8 A;  1S1E A;  2LP3 A;  3OX6 A;  4FQO A;  1NUB A;  1CM1 A;  1W7I B;  1JWD A;  4JQ0 D;  1CDL A;  1LA3 A;  1KWO B;  4USL A;  5CSF A;  3O6B A;  1QVI Z;  1DJG A;  3OB1 B;  1S6C A;  3SIB A;  3O4Y A;  2BCB A;  4MZK A;  1CLM A;  1UHH A;  2ZND A;  1FBV A;  4MVF A;  3CR2 A;  3JVT C;  2EGD A;  1JUO A;  2K7O A;  2BBM A;  3TDI A;  4N1G A;  4YGC B;  3C1V A;  1UHJ A;  1XYD A;  2JXL A;  1L2O C;  1C07 A;  1HT9 A;  3RLZ A;  1DJZ A;  2LC5 A;  2JTT A;  1C7W A;  1K90 D;  2ZN9 A;  1A03 A;  2EC6 C;  1KSO A;  1RWY A;  3EVV A;  1J55 A;  1M63 B;  1UP5 A;  1A4P A;  2KQY A;  2KAY A;  1JBA A;  4PHK A;  1XFW O;  1B4C A;  4ZCV A;  1TN4 A;  1XK4 C;  3PLF B;  4Q04 A;  2E30 A;  1UUS A;  1SBJ A;  4OVN F;  4CLN A;  2AMI A;  2MJW B;  2ZRS A;  2Q4U A;  1CFD A;  1OOJ A;  4MBE A;  1RTP 1;  1IGV A;  1SR6 B;  3KO0 A;  2I7A A;  3DD4 A;  1EG4 A;  1FF1 A;  4NDD A;  1FI5 A;  4MN0 A;  2P6B B;  2LLU A;  4PE7 A;  1CMF A;  2KFG A;  3O78 A;  1CFP A;  4DIR A;  2HQW A;  1R2U A;  4WRI A;  1UHI A;  1U5I B;  3VRQ A;  1U5I A;  1IQ5 A;  5CSJ A;  4OKH A;  1BOC A;  4BY5 A;  1DJI A;  1G33 A;  2LUC A;  5D7F A;  2PRU A;  1B7T Y;  1QIW A;  2NCO A;  5TNC A;  1YX7 A;  2IS9 A;  4MEW A;  2M1K B;  3PSR A;  4YGB B;  1BT6 A;  1SL8 A;  3GK1 A;  5D69 A;  1LKJ A;  2CT9 A;  2K8M B;  1YRU B;  2OS8 C;  3TDZ A;  4GBA A;  3SJS A;  1TNW A;  4DS7 A;  3VRO A;  1IWQ A;  2PMY A;  3SG5 A;  1AJ5 A;  2MAZ A;  3OP0 A;  4ORA B;  3I5G C;  2JUL A;  2BL0 C;  3TDU A;  1IQ3 A;  1K93 D;  4E68 A;  5DKN A;  2GGM A;  2K7D A;  3SIA A;  2CNP A;  2I2R E;  1LVC D;  3PFV A;  4MRY A;  4U8D A;  1K8U A;  4GGN A;  2TN4 A;  4PHJ A;  3VRN A;  3AAK A;  1Y1X A;  3OB2 B;  1SPY A;  1SNL A;  3TUY C;  3WXA A;  2BKH B;  4N5X A;  3IF7 A;  1YX8 A;  4PAL A;  1G4Y R;  1QIV A;  1H4B A;  2I94 A;  1WRL A;  1KFX S;  4CFQ A;  5BPJ A;  5FYX A;  1B9A A;  2LNK A;  4NDB A;  1BR1 B;  2JT8 A;  1QVI Y;  2WCB A;  2O5G A;  2LUX A;  1WDC C;  1AHR A;  3WNX B;  3I5H C;  2MBX A;  1JF2 A;  1K2H A;  2M29 A;  1CFF A;  3NXA A;  2F3Y A;  5ER4 X;  3EKH A;  1DMO A;  2SCP A;  1OMD A;  2NZ0 A;  2QPT A;  3BUN B;  2F3Z A;  1FW4 A;  1M45 A;  2LMT A;  1EG3 A;  1F55 A;  4PE0 A;  1PSR A;  2BBN A;  2ZKM X;  2Y5I A;  1WY9 A;  2Y4Q A;  3JTD C;  3NSK A;  5PAL A;  3TZ1 A;  1F8H A;  1F71 A;  4PE4 A;  3LLE A;  4AQJ A;  1QX5 B;  1NIW A;  4YBH B;  4OCI A;  5HKW A;  1IG5 A;  3BOW B;  3BOW A;  4ETO A;  2NLN A;  1QS7 A;  2L4H A;  4PCW A;  1KQM C;  2ZRT A;  3HCM A;  1N0Y A;  3DF0 B;  5HLO A;  2JOJ A;  3AAJ A;  5AXI A;  4YRU A;  2LLT A;  2KFF A;  4P5O E;  2E6W A;  2HQ8 A;  1YUR A;  3KPX A;  5I2Q A;  1NX3 A;  1SMG A;  1NWD A;  1S5G Z;  2NCP A;  3EK4 A;  5KSZ A;  1LIN A;  3PN7 C;  1TNX A;  1VRK A;  1PSB A;  1Y1A A;  1J7Q A;  1MXE A;  3KEV A;  1DVI A;  2R2I A;  2ISD A;  1MUX A;  4ICB A;  1TIZ A;  1YUS A;  2ZFD A;  3SG7 A;  2OTG C;  1Y1U A;  2L0P A;  2F2P A;  2K2A A;  1BG1 A;  1D1O A;  1DJH A;  4GGF A;  4ORC B;  2FCD A;  4FTG A;  1G8I A;  2KAV A;  4GNK B;  1KWO C;  1YVL A;  5G08 A;  2LM5 A;  2KAX A;  1X02 A;  3A8R A;  2JZI A;  3BUX B;  2FCE A;  2KDH A;  1CKK A;  2DOQ A;  5HYD A;  1XFY O;  4ORB B;  3BXK A;  3I5I B;  3CR5 X;  2COL B;  4C0L A;  1Q80 A;  1OE9 B;  1BJF A;  2JRF A;  1AVS A;  3SG6 A;  1TCO B;  4DCK A;  2KI4 B;  4MZL A;  2WOR A;  4MLW A;  5JJG A;  1B1G A;  1YR5 A;  1QV0 A;  2JC2 A;  1KK7 Z;  2Y1N A;  1K94 A;  3I5F B;  1KK8 B;  2K61 A;  2SAS A;  4ZCU A;  1PVA A;  1DF0 B;  1DF0 A;  3CWG A;  1B8L A;  3BYA A;  1NYA A;  2KYF A;  1KFU S;  4TNC A;  3HX4 A;  1KQV A;  3GK2 A;  2AAO A;  2NXQ A;  2LAN A;  4I5K A;  4D1E A;  1OQP A;  1YUU A;  2M7N A;  3A4U B;  2LAP A;  2LVI A;  5HKY A;  5GQQ C;  4C0J A;  1E8A A;  3NSL A;  1QJT A;  1WLZ A;  4OR9 B;  4PE1 A;  1SR6 C;  3GK4 X;  4GFT A;  4WQ3 A;  2JPT A;  1SL9 A;  1NX0 A;  3FS7 A;  1EJ3 A;  4HRG A;  1BMO A;  2KGB C;  2O60 A;  4IL1 A;  4A4B A;  2KI6 D;  1YUT A;  1C7V A;  4XYN A;  1CMG A;  3CS1 A;  5HKZ A;  4AOM A;  3EVU A;  2MA2 A;  4CFR A;  1UUR A;  1GGZ A;  2H61 A;  2ZNE A;  5I2L A;  3CTN A;  2M49 B;  2CBL A;  3VRR A;  2PSR A;  1PUL A;  4YGA A;  1SK6 D;  3BUO B;  2LVK A;  4NQG A;  3K21 A;  1GQM A;  5CPV A;  2WND A;  2PAL A;  2M97 A;  2V53 A;  5AEQ A;  3IQO A;  2KGR A;  2BE6 A;  4A4C A;  1YTZ C;  2GV5 A;  4HSZ A;  1Y6W A;  3E3R A;  5CSN A;  1YRT B;  1MQ1 A;  2JT0 A;  1K9P A;  1SCM B;  1CLL A;  1K9U A;  1W7J B;  3CR4 X;  1WRK A;  3VGO A;  2HET A;  1WLM A;  1UHK A;  3AKB A;  5AFP A;  1ALW A;  2K0J A;  1DGU A;  1S3P A;  1SYM A;  1TOP A;  2KSP A;  4JWQ A;  1QX7 A;  1F4O A;  2LVV A;  2G2B A;  3EK8 A;  1SCV A;  1NCY A;  2BCA A;  1AJ4 A;  1PVB A;  1BU3 A;  4M2Q A;  1AK8 A;  1KSM A;  1S6J A;  3O2P A;  1B47 A;  1DJY A;  1S36 A;  1ZOT B;  2M3W A;  1EL4 A;  2KBI A;  3WHU B;  2L5X B;  2JWW A;  4QJ3 B;  1OZS A;  1S6I A;  1B7T Z;  3TS5 B;  2FJU B;  1EXR A;  1QLS A;  2LVJ A;  4GAO A;  4F0Z B;  5IBW A;  2LHI A;  4MZJ A;  2ZN8 A;  1J1D A;  1TCF A;  1ODB A;  4N1F A;  5B8I B;  1DTL A;  1PAL A;  1NCX A;  1IJ5 A;  1GJY A;  1WRZ A;  2M8U A;  3OX5 A;  1H8B A;  1MHO A;  1OSA A;  1IH0 A;  3DF0 A;  1BF5 A;  1V1F A;  4YI9 A;  4GUK A;  3BUM B;  4OV2 A;  2WCE A;  2EHB A;  1MXL C;  5JOL A;  2K7B A;  1KFX L;  5AER A;  1N2D A;  3F45 A;  1LA0 A;  1BLQ A;  3JVT B;  5K89 A;  1QV1 A;  3WHT B;  2M1U A;  3EVR A;  3DVM A;  1L2O B;  5J3X A;  1K95 A;  1N65 A;  4PDZ A;  1LXF C;  5AAN A;  1REC A;  2JU0 A;  1DGV A;  2OPO A;  2EC6 B;  3FIA A;  4DRW A;  4C0K A;  1CM4 A;  1JF0 A;  2LV7 A;  1RFJ A;  2LLS A;  3QRX A;  4PHN A;  1TNP A;  1QX2 A;  1XK4 A;  1OZO A;  2JQ6 A;  4I5J A;  1A29 A;  2RGI A;  3NSO A;  4CID A;  3LK1 A;  1M39 A;  4CPV A;  3NSI A;  4MRX A;  1EH2 A;  4XJK B;  4XJK A;  1XVJ A;  2BE4 A;  1CDM A;  5F6T A;  5HLV A;  4GGF C;  4YI8 A;  1SL7 A;  1TRF A;  3BUW B;  1IKU A;  1L7Z A;  1BOD A;  1SY9 A;  3AKA A;  3D10 A;  2KOT A;  2WOS A;  4UPG A;  1J7P A;  5ER5 A;  2LMV A;  3I5I C;  2L51 A;  2L2E A;  2L98 A;  2LE9 B;  4I5N B;  4M2P A;  3EK7 A;  5KU1 A;  2BEC A;  1NCZ A; 
#chains in the Genus database with same CATH topology
 3SG3 A;  2KI4 C;  1QXP A;  1TNQ A;  4DUQ A;  2I18 A;  2PVB A;  3KHE A;  3I5F C;  1KK8 C;  3DY9 A;  3BQ3 A;  2M0R A;  2CCM A;  3S0E A;  1PK0 D;  2L4I A;  2OS8 B;  4PT1 A;  1KCY A;  1ZAC A;  1Y0V H;  1F54 A;  1SW8 A;  1XA5 A;  2KHN A;  4L9M A;  1AP4 A;  3D0Y B;  3D0Y A;  2M7L A;  1OMR A;  1QWV A;  4QJ5 B;  1ZMZ A;  2D8N A;  2PAS A;  1XFV O;  1B8C A;  1ZUZ A;  3GOF A;  5I2O A;  3ZNI A;  3I5G B;  3FWC A;  3PJI A;  2BL0 B;  2A4J A;  3ZWH A;  4PHM A;  4HRH A;  1K9K A;  4AQI A;  3DVJ A;  3PAL A;  1NSH A;  1RRO A;  2FOT A;  2Y1M A;  3CZ1 A;  2KNE A;  4R1E A;  3SG4 A;  2CTN A;  2K2F A;  2VRG A;  2WC8 A;  5FI2 A;  3TUY B;  1CFC A;  1DJW A;  1NX2 A;  1RK9 A;  1XFX O;  3S0B A;  4GPL B;  1UWO A;  2L5Y A;  2JTZ A;  2HPS A;  3ICB A;  3UNW A;  2MHH A;  3LCP C;  2LCP A;  1CLB A;  3MSE B;  1TTX A;  1XFZ O;  2AUC A;  1C3Y A;  2H61 C;  1WDC B;  4WQ2 A;  1BR4 B;  1S5G Y;  2H2K A;  2MRD A;  4P2Y B;  5DKQ A;  1JFJ A;  1IIO A;  1KFU L;  3I5H B;  1JC2 A;  1ORG A;  1DT7 B;  1GM0 A;  1A2X A;  1IRJ A;  1HQV A;  1XO5 A;  2GGZ A;  1QLK A;  4BY4 A;  3VRP A;  2KLE A;  1CTR A;  3LK0 A;  1ALV A;  2HF5 A;  1A75 B;  1ZFS A;  1A75 A;  4I5L B;  4QJ4 B;  1J7R A;  2LP2 A;  1DJX A;  3CZT X;  2BKI B;  2K7C A;  3H4S E;  2F33 A;  2LMU A;  2BCX A;  1CDP A;  3S0D A;  2KI6 C;  3RM1 A;  1M46 A;  1SCM C;  2G9B A;  3DVK A;  1F70 A;  3SG2 A;  1UHN A;  3PAT A;  3JTD B;  3R72 A;  1PRW A;  1TWO A;  1R6P A;  1OMV A;  2M9G A;  2KBM A;  1YVH A;  3CZ0 A;  1NPQ A;  1XFU O;  2JXC A;  3KF9 A;  4YGD B;  2JNF A;  2B1U A;  2KFH A;  5DKR A;  1MR8 A;  1MF8 B;  5I8N A;  3CAB A;  2Q91 A;  2F8P A;  3EKJ A;  1P28 A;  2LHL A;  2KQ6 A;  1MWN A;  3DVE A;  3LL8 B;  1CDN A;  1CB1 A;  2L2C A;  2L50 A;  1B8R A;  1JFK A;  1KK7 Y;  1AUI B;  2MLE C;  3CLN A;  3FWB A;  1V1G A;  3RZS A;  1SRA A;  1QAS A;  3M0W A;  2F2O A;  1SKT A;  4JD9 A;  2KYC A;  4NDC A;  1KQM B;  2WCF A;  3IQQ A;  1RJV A;  4HRE E;  1JSA A;  3CGA A;  2FJY A;  2WC5 A;  1M31 A;  2QAC A;  4MSP A;  4F7F A;  1OOI X;  3B6X A;  1CNP A;  1DC1 A;  5D3O A;  3D76 A;  2MLF C;  1QAT A;  4JPZ B;  3TS5 C;  1S26 D;  5KTY A;  4YGE B;  4M2O A;  1NP8 A;  3OHM B;  5CSI A;  1QTX A;  3PN7 B;  1FI6 A;  2JNX A;  2WCK A;  1J7O A;  1IJ6 A;  1FPW A;  1GGW A;  1NX1 A;  1K96 A;  2JT3 A;  1J1E A;  1F4Q A;  2CXJ A;  2OTG B;  3PM8 A;  1S1E A;  2LP3 A;  3OX6 A;  4FQO A;  1NUB A;  1CM1 A;  1W7I B;  1JWD A;  4JQ0 D;  1CDL A;  1LA3 A;  1KWO B;  4USL A;  5CSF A;  3O6B A;  1QVI Z;  1DJG A;  4IJ7 A;  3OB1 B;  3Q8I A;  1S6C A;  3SIB A;  2BAP A;  3O4Y A;  2BCB A;  4MZK A;  3R1P A;  1CLM A;  1UHH A;  2ZND A;  1FBV A;  4MVF A;  3CR2 A;  3JVT C;  2EGD A;  3K1E A;  1JUO A;  2K7O A;  2BBM A;  5FI7 A;  3TDI A;  4N1G A;  4YGC B;  3C1V A;  1UHJ A;  1XYD A;  1DEK A;  1L2O C;  2JXL A;  2KLD A;  1C07 A;  1HT9 A;  3NGV A;  3RLZ A;  1DJZ A;  2LC5 A;  2JTT A;  1C7W A;  1K90 D;  2ZN9 A;  1A03 A;  2EC6 C;  1KSO A;  1RWY A;  3EVV A;  1J55 A;  1M63 B;  1UP5 A;  1A4P A;  2KQY A;  2KAY A;  1JBA A;  4PHK A;  1XFW O;  1B4C A;  3FE6 A;  4ZCV A;  1TN4 A;  1XK4 C;  3PLF B;  4Q04 A;  3S0F A;  2E30 A;  1UUS A;  1SBJ A;  4OVN F;  1OOF A;  4CLN A;  2AMI A;  2MJW B;  2ZRS A;  2Q4U A;  3D77 A;  1CFD A;  1OOJ A;  4MBE A;  1RTP 1;  1IGV A;  1SR6 B;  3KO0 A;  2I7A A;  3DD4 A;  1EG4 A;  2QDI A;  1FF1 A;  4NDD A;  1FI5 A;  4MN0 A;  2P6B B;  2LLU A;  4PE7 A;  1CMF A;  3B87 A;  2KFG A;  3O78 A;  1CFP A;  4DIR A;  2HQW A;  1R2U A;  4WRI A;  1UHI A;  1U5I B;  3VRQ A;  1C3Z A;  1IQ5 A;  1U5I A;  3DZT A;  2WCL A;  1Z4H A;  4OKH A;  5CSJ A;  3S0A A;  1BOC A;  4BY5 A;  1TUZ A;  1DJI A;  1G33 A;  2LUC A;  4INX A;  5D7F A;  2PRU A;  1B7T Y;  1QIW A;  2NCO A;  5TNC A;  1YX7 A;  2IS9 A;  4MEW A;  3BFA A;  2M1K B;  3PSR A;  4YGB B;  1BT6 A;  1SL8 A;  3GK1 A;  2QEB A;  5D69 A;  1LKJ A;  2CT9 A;  2K8M B;  2YGU A;  1YRU B;  2OS8 C;  3TDZ A;  4GBA A;  3SJS A;  1TNW A;  4DS7 A;  3VRO A;  1IWQ A;  2PMY A;  3SG5 A;  1AJ5 A;  2MAZ A;  3OP0 A;  4ORA B;  3I5G C;  2JUL A;  5HL1 A;  2BL0 C;  3TDU A;  1IQ3 A;  1K93 D;  4E68 A;  3OBV A;  1W9Z A;  5DKN A;  2GGM A;  2K7D A;  3SIA A;  3R1O A;  2CNP A;  2I2R E;  1LVC D;  3PFV A;  4MRY A;  4U8D A;  1K8U A;  4GGN A;  2TN4 A;  4PHJ A;  3VRN A;  3AAK A;  1Y1X A;  3OB2 B;  1SPY A;  1SNL A;  5FI6 A;  3WXA A;  2BKH B;  3TUY C;  4N5X A;  2WCM A;  3IF7 A;  1YX8 A;  4PAL A;  1G4Y R;  1QIV A;  1H4B A;  2WCJ A;  2I94 A;  1WRL A;  1KFX S;  4CFQ A;  5BPJ A;  5FYX A;  1B9A A;  2LNK A;  4NDB A;  1BR1 B;  2JT8 A;  1QVI Y;  2WCB A;  2O5G A;  2LUX A;  1WDC C;  1AHR A;  2WCH A;  4INW A;  3WNX B;  3I5H C;  2MBX A;  1JF2 A;  3DYE A;  1K2H A;  2M29 A;  1CFF A;  1DQE A;  2F3Y A;  3NXA A;  5ER4 X;  3EKH A;  1DMO A;  2SCP A;  1OMD A;  2NZ0 A;  3D75 A;  2QPT A;  3BUN B;  2F3Z A;  1FW4 A;  1M45 A;  3NHT A;  2LMT A;  1EG3 A;  1F55 A;  4PE0 A;  2GTE A;  1PSR A;  4JKT A;  2BBN A;  2ZKM X;  2Y5I A;  1WY9 A;  2Y4Q A;  3JTD C;  3NSK A;  5PAL A;  3TZ1 A;  1XFR A;  1F8H A;  1F71 A;  4PE4 A;  3LLE A;  2K60 A;  4AQJ A;  1QX5 B;  2KPH A;  1NIW A;  4YBH B;  4OCI A;  5HKW A;  1IG5 A;  3BOW B;  3BOW A;  4ETO A;  2NLN A;  1QS7 A;  3S0G A;  2L4H A;  4PCW A;  1KQM C;  2ZRT A;  3HCM A;  1N0Y A;  3DF0 B;  5HLO A;  2JOJ A;  3AAJ A;  5AXI A;  4YRU A;  2LLT A;  2KFF A;  4P5O E;  1LS8 A;  2E6W A;  2HQ8 A;  1YUR A;  2P70 A;  3KPX A;  1NX3 A;  5I2Q A;  1SMG A;  1NWD A;  1S5G Z;  2NCP A;  3R1V A;  3EK4 A;  5KSZ A;  1LIN A;  3CDN A;  3PN7 C;  1TNX A;  1VRK A;  1PSB A;  1Y1A A;  1J7Q A;  1MXE A;  3KEV A;  4KYN A;  1DVI A;  2R2I A;  2ISD A;  1MUX A;  4ICB A;  1TIZ A;  1YUS A;  2ZFD A;  3EG5 B;  3SG7 A;  2OTG C;  1Y1U A;  3N7H A;  2L0P A;  2F2P A;  2K2A A;  1BG1 A;  1OW4 A;  1D1O A;  1DJH A;  4GGF A;  4ORC B;  2FCD A;  4FTG A;  1G8I A;  1TUJ A;  2BNX A;  2KAV A;  4GNK B;  1KWO C;  1YVL A;  5G08 A;  2LM5 A;  2KAX A;  1X02 A;  3A8R A;  2JZI A;  3BUX B;  2FCE A;  2ERB A;  2KDH A;  1CKK A;  2DOQ A;  5HYD A;  1XFY O;  4ORB B;  3BXK A;  3I5I B;  3CR5 X;  2COL B;  4C0L A;  1Q80 A;  1OE9 B;  1BJF A;  2JRF A;  2QEO A;  1AVS A;  3SG6 A;  1TCO B;  4DCK A;  2KI4 B;  4MZL A;  2WOR A;  4MLW A;  5JJG A;  1B1G A;  1YR5 A;  1QV0 A;  2JC2 A;  1KK7 Z;  3L47 A;  2QEV A;  1K94 A;  2Y1N A;  3I5F B;  1KK8 B;  3B7A A;  2K61 A;  2SAS A;  4ZCU A;  1PVA A;  1DF0 B;  1DF0 A;  3CWG A;  1B8L A;  3BYA A;  3O4X A;  1NYA A;  3VB1 A;  2KYF A;  1KFU S;  4TNC A;  3HX4 A;  1KQV A;  3GK2 A;  2AAO A;  2NXQ A;  2LAN A;  4I5K A;  4D1E A;  3B88 A;  1OQP A;  1YUU A;  2M7N A;  3A4U B;  2LAP A;  2LVI A;  5HKY A;  5GQQ C;  4C0J A;  1E8A A;  3NSL A;  1QJT A;  1WLZ A;  4OR9 B;  4PE1 A;  1SR6 C;  3GK4 X;  4GFT A;  4WQ3 A;  2JPT A;  1SL9 A;  1NX0 A;  3FS7 A;  1EJ3 A;  4HRG A;  1BMO A;  2KGB C;  2O60 A;  4IL1 A;  3PM2 A;  4A4B A;  2PYQ A;  2KI6 D;  2WC6 A;  1T14 A;  1YUT A;  1Z2C B;  1C7V A;  4XYN A;  1CMG A;  3CS1 A;  3D74 A;  5HKZ A;  5EL2 A;  4AOM A;  3EVU A;  2MA2 A;  4CFR A;  1UUR A;  1GGZ A;  2JPO A;  2H61 A;  2ZNE A;  5I2L A;  3CTN A;  2M49 B;  3D73 A;  2CBL A;  3VRR A;  2PSR A;  1PUL A;  4YGA A;  1SK6 D;  3BUO B;  2LVK A;  4NQG A;  5I94 A;  3K21 A;  1GQM A;  5CPV A;  2WND A;  2PAL A;  2M97 A;  2V53 A;  5AEQ A;  3IQO A;  2KGR A;  2BE6 A;  4A4C A;  1YTZ C;  2GV5 A;  4HSZ A;  1Y6W A;  3E3R A;  5CSN A;  1YRT B;  1MQ1 A;  2JT0 A;  1K9P A;  4FQT A;  1SCM B;  1CLL A;  1K9U A;  1W7J B;  3CR4 X;  1WRK A;  3VGO A;  2PQL A;  2HET A;  1WLM A;  1UHK A;  3AKB A;  5AFP A;  1ALW A;  2K0J A;  5DIC A;  1DGU A;  1S3P A;  1SYM A;  1TOP A;  2KSP A;  3B86 A;  1QX7 A;  1F4O A;  2LVV A;  4JWQ A;  2G2B A;  3EK8 A;  1SCV A;  1NCY A;  2BCA A;  1AJ4 A;  1PVB A;  1BU3 A;  3BJH A;  4M2Q A;  1AK8 A;  1KSM A;  1S6J A;  3O2P A;  1B47 A;  1DJY A;  1S36 A;  1ZOT B;  2M3W A;  1EL4 A;  2KBI A;  3WHU B;  3CYZ A;  3NHI A;  2L5X B;  2JWW A;  4QJ3 B;  1OZS A;  1S6I A;  1B7T Z;  2H8V A;  3TS5 B;  2FJU B;  1DEL A;  1EXR A;  3V2L A;  1QLS A;  2LVJ A;  4GAO A;  2P71 A;  4F0Z B;  2LHI A;  5IBW A;  4MZJ A;  2ZN8 A;  1J1D A;  1TCF A;  1ODB A;  4N1F A;  3OGN A;  5B8I B;  1DTL A;  1OOH A;  1PAL A;  3SS4 A;  1NCX A;  1IJ5 A;  3FE9 A;  1OOG A;  1GJY A;  1WRZ A;  2M8U A;  3OX5 A;  1H8B A;  1MHO A;  1OSA A;  1IH0 A;  3DF0 A;  1BF5 A;  1V1F A;  4YI9 A;  4GUK A;  3BUM B;  4OV2 A;  2WCE A;  2EHB A;  1MXL C;  5JOL A;  2K7B A;  1KFX L;  5AER A;  1N2D A;  3F45 A;  1LA0 A;  1BLQ A;  3JVT B;  5K89 A;  1QV1 A;  3WHT B;  2M1U A;  3EVR A;  3DVM A;  1L2O B;  5J3X A;  1K95 A;  3BFH A;  1N65 A;  4PDZ A;  1LXF C;  5AAN A;  1REC A;  2JU0 A;  4OZD A;  1DGV A;  3FE8 A;  2OPO A;  2EC6 B;  3FIA A;  3QME A;  4C0K A;  4DRW A;  1CM4 A;  1JF0 A;  2QEH A;  3SS3 A;  2LV7 A;  3IVT A;  1RFJ A;  2LLS A;  3QRX A;  4PHN A;  1TNP A;  3UO9 A;  1QX2 A;  1XK4 A;  1OZO A;  2JQ6 A;  4I5J A;  1A29 A;  2RGI A;  3NSO A;  4CID A;  3LK1 A;  1M39 A;  4CPV A;  3NSI A;  4MRX A;  1EH2 A;  4XJK B;  4XJK A;  1XVJ A;  3CZ2 A;  2BE4 A;  1CDM A;  5F6T A;  5HLV A;  4GGF C;  4YI8 A;  1SL7 A;  1TRF A;  3BUW B;  1IKU A;  1L7Z A;  1BOD A;  1SY9 A;  3L4L A;  1SSE B;  3AKA A;  3BFB A;  3D10 A;  2KOT A;  2WOS A;  3L4A A;  4UPG A;  3DXL A;  1J7P A;  5ER5 A;  2LMV A;  3D78 A;  3I5I C;  2L51 A;  2L2E A;  2L98 A;  2LE9 B;  4I5N B;  4M2P A;  3SS5 A;  3EK7 A;  5KU1 A;  2BEC A;  1NCZ A; 
#chains in the Genus database with same CATH homology
 3SG3 A;  2KI4 C;  1QXP A;  1TNQ A;  4DUQ A;  2I18 A;  2PVB A;  3KHE A;  3I5F C;  1KK8 C;  3BQ3 A;  2M0R A;  2CCM A;  1PK0 D;  2L4I A;  2OS8 B;  1KCY A;  1ZAC A;  1Y0V H;  1F54 A;  1SW8 A;  1XA5 A;  2KHN A;  4L9M A;  1AP4 A;  3D0Y B;  3D0Y A;  2M7L A;  1OMR A;  4QJ5 B;  1ZMZ A;  2D8N A;  2PAS A;  1XFV O;  1B8C A;  1ZUZ A;  3GOF A;  5I2O A;  3ZNI A;  3I5G B;  3FWC A;  2BL0 B;  2A4J A;  3ZWH A;  4PHM A;  4HRH A;  1K9K A;  4AQI A;  3DVJ A;  3PAL A;  1NSH A;  1RRO A;  2FOT A;  2Y1M A;  4R1E A;  2KNE A;  3SG4 A;  2CTN A;  2K2F A;  2VRG A;  2WC8 A;  3TUY B;  1CFC A;  1DJW A;  1NX2 A;  1RK9 A;  1XFX O;  4GPL B;  1UWO A;  2JTZ A;  2HPS A;  3ICB A;  2MHH A;  3LCP C;  2LCP A;  1CLB A;  3MSE B;  1TTX A;  1XFZ O;  2AUC A;  2H61 C;  1WDC B;  4WQ2 A;  1BR4 B;  1S5G Y;  2H2K A;  2MRD A;  4P2Y B;  5DKQ A;  1JFJ A;  1KFU L;  3I5H B;  1JC2 A;  1DT7 B;  1A2X A;  1IRJ A;  1HQV A;  1XO5 A;  2GGZ A;  1QLK A;  4BY4 A;  3VRP A;  1CTR A;  3LK0 A;  1ALV A;  2HF5 A;  1A75 B;  1ZFS A;  1A75 A;  4I5L B;  4QJ4 B;  1J7R A;  2LP2 A;  1DJX A;  3CZT X;  2BKI B;  2K7C A;  3H4S E;  2F33 A;  2LMU A;  2BCX A;  1CDP A;  2KI6 C;  3RM1 A;  1M46 A;  1SCM C;  2G9B A;  3DVK A;  1F70 A;  3SG2 A;  1UHN A;  3PAT A;  3JTD B;  1PRW A;  1R6P A;  1OMV A;  2M9G A;  2KBM A;  1YVH A;  3KF9 A;  1NPQ A;  1XFU O;  2JXC A;  4YGD B;  2JNF A;  2B1U A;  2KFH A;  5DKR A;  1MR8 A;  1MF8 B;  5I8N A;  2Q91 A;  2F8P A;  3EKJ A;  2LHL A;  2KQ6 A;  1MWN A;  3DVE A;  3LL8 B;  1CDN A;  1CB1 A;  2L50 A;  1B8R A;  1JFK A;  1KK7 Y;  1AUI B;  2MLE C;  3CLN A;  3FWB A;  1V1G A;  1SRA A;  1QAS A;  3M0W A;  2F2O A;  1SKT A;  2KYC A;  4NDC A;  1KQM B;  2WCF A;  3IQQ A;  1RJV A;  4HRE E;  1JSA A;  3CGA A;  1M31 A;  2QAC A;  4MSP A;  1CNP A;  2MLF C;  1QAT A;  4JPZ B;  3TS5 C;  1S26 D;  5KTY A;  4YGE B;  4M2O A;  1NP8 A;  3OHM B;  5CSI A;  1QTX A;  3PN7 B;  1FI6 A;  2JNX A;  1J7O A;  1FPW A;  1IJ6 A;  1GGW A;  1NX1 A;  1K96 A;  2JT3 A;  1J1E A;  1F4Q A;  2CXJ A;  2OTG B;  3PM8 A;  1S1E A;  2LP3 A;  3OX6 A;  4FQO A;  1NUB A;  1CM1 A;  1W7I B;  1JWD A;  4JQ0 D;  1CDL A;  1LA3 A;  1KWO B;  4USL A;  5CSF A;  3O6B A;  1QVI Z;  1DJG A;  3OB1 B;  1S6C A;  3SIB A;  3O4Y A;  2BCB A;  4MZK A;  1CLM A;  1UHH A;  2ZND A;  1FBV A;  4MVF A;  3CR2 A;  3JVT C;  2EGD A;  1JUO A;  2K7O A;  2BBM A;  3TDI A;  4N1G A;  4YGC B;  3C1V A;  1UHJ A;  1XYD A;  2JXL A;  1L2O C;  1C07 A;  1HT9 A;  3RLZ A;  1DJZ A;  2LC5 A;  2JTT A;  1C7W A;  1K90 D;  2ZN9 A;  1A03 A;  2EC6 C;  1KSO A;  1RWY A;  3EVV A;  1J55 A;  1M63 B;  1UP5 A;  1A4P A;  2KQY A;  2KAY A;  1JBA A;  4PHK A;  1XFW O;  1B4C A;  4ZCV A;  1TN4 A;  1XK4 C;  3PLF B;  4Q04 A;  2E30 A;  1UUS A;  1SBJ A;  4OVN F;  4CLN A;  2AMI A;  2MJW B;  2ZRS A;  2Q4U A;  1CFD A;  1OOJ A;  4MBE A;  1RTP 1;  1IGV A;  1SR6 B;  3KO0 A;  2I7A A;  3DD4 A;  1EG4 A;  1FF1 A;  4NDD A;  1FI5 A;  4MN0 A;  2P6B B;  2LLU A;  4PE7 A;  1CMF A;  2KFG A;  3O78 A;  1CFP A;  4DIR A;  2HQW A;  1R2U A;  4WRI A;  1UHI A;  1U5I B;  3VRQ A;  1U5I A;  1IQ5 A;  5CSJ A;  4OKH A;  1BOC A;  4BY5 A;  1DJI A;  1G33 A;  2LUC A;  5D7F A;  2PRU A;  1B7T Y;  1QIW A;  2NCO A;  5TNC A;  1YX7 A;  2IS9 A;  4MEW A;  2M1K B;  3PSR A;  4YGB B;  1BT6 A;  1SL8 A;  3GK1 A;  5D69 A;  1LKJ A;  2CT9 A;  2K8M B;  1YRU B;  2OS8 C;  3TDZ A;  4GBA A;  3SJS A;  1TNW A;  4DS7 A;  3VRO A;  1IWQ A;  2PMY A;  3SG5 A;  1AJ5 A;  2MAZ A;  3OP0 A;  4ORA B;  3I5G C;  2JUL A;  2BL0 C;  3TDU A;  1IQ3 A;  1K93 D;  4E68 A;  5DKN A;  2GGM A;  2K7D A;  3SIA A;  2CNP A;  2I2R E;  1LVC D;  3PFV A;  4MRY A;  4U8D A;  1K8U A;  4GGN A;  2TN4 A;  4PHJ A;  3VRN A;  3AAK A;  1Y1X A;  3OB2 B;  1SPY A;  1SNL A;  3TUY C;  3WXA A;  2BKH B;  4N5X A;  3IF7 A;  1YX8 A;  4PAL A;  1G4Y R;  1QIV A;  1H4B A;  2I94 A;  1WRL A;  1KFX S;  4CFQ A;  5BPJ A;  5FYX A;  1B9A A;  2LNK A;  4NDB A;  1BR1 B;  2JT8 A;  1QVI Y;  2WCB A;  2O5G A;  2LUX A;  1WDC C;  1AHR A;  3WNX B;  3I5H C;  2MBX A;  1JF2 A;  1K2H A;  2M29 A;  1CFF A;  3NXA A;  2F3Y A;  5ER4 X;  3EKH A;  1DMO A;  2SCP A;  1OMD A;  2NZ0 A;  2QPT A;  3BUN B;  2F3Z A;  1FW4 A;  1M45 A;  2LMT A;  1EG3 A;  1F55 A;  4PE0 A;  1PSR A;  2BBN A;  2ZKM X;  2Y5I A;  1WY9 A;  2Y4Q A;  3JTD C;  3NSK A;  5PAL A;  3TZ1 A;  1F8H A;  1F71 A;  4PE4 A;  3LLE A;  4AQJ A;  1QX5 B;  1NIW A;  4YBH B;  4OCI A;  5HKW A;  1IG5 A;  3BOW B;  3BOW A;  4ETO A;  2NLN A;  1QS7 A;  2L4H A;  4PCW A;  1KQM C;  2ZRT A;  3HCM A;  1N0Y A;  3DF0 B;  5HLO A;  2JOJ A;  3AAJ A;  5AXI A;  4YRU A;  2LLT A;  2KFF A;  4P5O E;  2E6W A;  2HQ8 A;  1YUR A;  3KPX A;  5I2Q A;  1NX3 A;  1SMG A;  1NWD A;  1S5G Z;  2NCP A;  3EK4 A;  5KSZ A;  1LIN A;  3PN7 C;  1TNX A;  1VRK A;  1PSB A;  1Y1A A;  1J7Q A;  1MXE A;  3KEV A;  1DVI A;  2R2I A;  2ISD A;  1MUX A;  4ICB A;  1TIZ A;  1YUS A;  2ZFD A;  3SG7 A;  2OTG C;  1Y1U A;  2L0P A;  2F2P A;  2K2A A;  1BG1 A;  1D1O A;  1DJH A;  4GGF A;  4ORC B;  2FCD A;  4FTG A;  1G8I A;  2KAV A;  4GNK B;  1KWO C;  1YVL A;  5G08 A;  2LM5 A;  2KAX A;  1X02 A;  3A8R A;  2JZI A;  3BUX B;  2FCE A;  2KDH A;  1CKK A;  2DOQ A;  5HYD A;  1XFY O;  4ORB B;  3BXK A;  3I5I B;  3CR5 X;  2COL B;  4C0L A;  1Q80 A;  1OE9 B;  1BJF A;  2JRF A;  1AVS A;  3SG6 A;  1TCO B;  4DCK A;  2KI4 B;  4MZL A;  2WOR A;  4MLW A;  5JJG A;  1B1G A;  1YR5 A;  1QV0 A;  2JC2 A;  1KK7 Z;  2Y1N A;  1K94 A;  3I5F B;  1KK8 B;  2K61 A;  2SAS A;  4ZCU A;  1PVA A;  1DF0 B;  1DF0 A;  3CWG A;  1B8L A;  3BYA A;  1NYA A;  2KYF A;  1KFU S;  4TNC A;  3HX4 A;  1KQV A;  3GK2 A;  2AAO A;  2NXQ A;  2LAN A;  4I5K A;  4D1E A;  1OQP A;  1YUU A;  2M7N A;  3A4U B;  2LAP A;  2LVI A;  5HKY A;  5GQQ C;  4C0J A;  1E8A A;  3NSL A;  1QJT A;  1WLZ A;  4OR9 B;  4PE1 A;  1SR6 C;  3GK4 X;  4GFT A;  4WQ3 A;  2JPT A;  1SL9 A;  1NX0 A;  3FS7 A;  1EJ3 A;  4HRG A;  1BMO A;  2KGB C;  2O60 A;  4IL1 A;  4A4B A;  2KI6 D;  1YUT A;  1C7V A;  4XYN A;  1CMG A;  3CS1 A;  5HKZ A;  4AOM A;  3EVU A;  2MA2 A;  4CFR A;  1UUR A;  1GGZ A;  2H61 A;  2ZNE A;  5I2L A;  3CTN A;  2M49 B;  2CBL A;  3VRR A;  2PSR A;  1PUL A;  4YGA A;  1SK6 D;  3BUO B;  2LVK A;  4NQG A;  3K21 A;  1GQM A;  5CPV A;  2WND A;  2PAL A;  2M97 A;  2V53 A;  5AEQ A;  3IQO A;  2KGR A;  2BE6 A;  4A4C A;  1YTZ C;  2GV5 A;  4HSZ A;  1Y6W A;  3E3R A;  5CSN A;  1YRT B;  1MQ1 A;  2JT0 A;  1K9P A;  1SCM B;  1CLL A;  1K9U A;  1W7J B;  3CR4 X;  1WRK A;  3VGO A;  2HET A;  1WLM A;  1UHK A;  3AKB A;  5AFP A;  1ALW A;  2K0J A;  1DGU A;  1S3P A;  1SYM A;  1TOP A;  2KSP A;  4JWQ A;  1QX7 A;  1F4O A;  2LVV A;  2G2B A;  3EK8 A;  1SCV A;  1NCY A;  2BCA A;  1AJ4 A;  1PVB A;  1BU3 A;  4M2Q A;  1AK8 A;  1KSM A;  1S6J A;  3O2P A;  1B47 A;  1DJY A;  1S36 A;  1ZOT B;  2M3W A;  1EL4 A;  2KBI A;  3WHU B;  2L5X B;  2JWW A;  4QJ3 B;  1OZS A;  1S6I A;  1B7T Z;  3TS5 B;  2FJU B;  1EXR A;  1QLS A;  2LVJ A;  4GAO A;  4F0Z B;  5IBW A;  2LHI A;  4MZJ A;  2ZN8 A;  1J1D A;  1TCF A;  1ODB A;  4N1F A;  5B8I B;  1DTL A;  1PAL A;  1NCX A;  1IJ5 A;  1GJY A;  1WRZ A;  2M8U A;  3OX5 A;  1H8B A;  1MHO A;  1OSA A;  1IH0 A;  3DF0 A;  1BF5 A;  1V1F A;  4YI9 A;  4GUK A;  3BUM B;  4OV2 A;  2WCE A;  2EHB A;  1MXL C;  5JOL A;  2K7B A;  1KFX L;  5AER A;  1N2D A;  3F45 A;  1LA0 A;  1BLQ A;  3JVT B;  5K89 A;  1QV1 A;  3WHT B;  2M1U A;  3EVR A;  3DVM A;  1L2O B;  5J3X A;  1K95 A;  1N65 A;  4PDZ A;  1LXF C;  5AAN A;  1REC A;  2JU0 A;  1DGV A;  2OPO A;  2EC6 B;  3FIA A;  4DRW A;  4C0K A;  1CM4 A;  1JF0 A;  2LV7 A;  1RFJ A;  2LLS A;  3QRX A;  4PHN A;  1TNP A;  1QX2 A;  1XK4 A;  1OZO A;  2JQ6 A;  4I5J A;  1A29 A;  2RGI A;  3NSO A;  4CID A;  3LK1 A;  1M39 A;  4CPV A;  3NSI A;  4MRX A;  1EH2 A;  4XJK B;  4XJK A;  1XVJ A;  2BE4 A;  1CDM A;  5F6T A;  5HLV A;  4GGF C;  4YI8 A;  1SL7 A;  1TRF A;  3BUW B;  1IKU A;  1L7Z A;  1BOD A;  1SY9 A;  3AKA A;  3D10 A;  2KOT A;  2WOS A;  4UPG A;  1J7P A;  5ER5 A;  2LMV A;  3I5I C;  2L51 A;  2L2E A;  2L98 A;  2LE9 B;  4I5N B;  4M2P A;  3EK7 A;  5KU1 A;  2BEC A;  1NCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...