4M2OA

Crystal structure of a non-myristoylated c39a recoverin mutant with one calcium ion bound to ef-hand 3
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
191
structure length
191
Chain Sequence
GALSKEILEELQLNTKFTEEELSSWYQSFLKEAPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recoverin
publication title A Highly Conserved Cysteine of Neuronal Calcium-sensing Proteins Controls Cooperative Binding of Ca2+ to Recoverin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 78
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2oA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2oA01
3PN7B 1PVBA 3KO0A 1C07A 2OPOA 1R6PA 4DIRA 1S36A 4GBAA 3CZTX 2JC2A 4ORCB 1M46A 5HKZA 3RM1A 1XFVO 1AUIB 1XK4C 1BG1A 3SG2A 5KSZA 2NCPA 1KQMC 4OKHA 2KFFA 2L4HA 3DF0A 3KF9A 4DCKA 1LXFC 2P6BB 1DTLA 4JPZB 4ZCUA 2BKIB 5AXIA 1S6IA 4JWQA 3BUOB 1S6CA 3I5IC 3VRNA 4XJKA 3CR5X 4GNKB 2L5XB 2CNPA 4HSZA 3MSEB 2HETA 2LMTA 3AAJA 1YURA 1IJ5A 3C1VA 4GGNA 3VRRA 2KYCA 2OTGB 1JF0A 4L9MA 2HQWA 1ZMZA 1HQVA 1K9UA 2BL0B 4PHKA 1S5GY 3EK8A 2MHHA 2O5GA 3EKJA 4QJ5B 1ZFSA 1N2DA 1QXPA 2KBMA 3LK1A 3SG4A 4MLWA 1KFUS 4ZCVA 2KOTA 3KHEA 1B4CA 2CCMA 1Y1UA 1J7OA 1OZSA 3TUYB 2K61A 4CIDA 1J7PA 2HF5A 2JTTA 2ZKMX 1LINA 5B8IB 2H2KA 1F4QA 1QX7A 2EC6B 1RROA 4PDZA 1L2OB 3NSIA 1YRUB 1ALWA 1DJGA 5HKYA 2LVIA 2A4JA 1UHHA 5ER4X 1PRWA 2K7OA 5PALA 1OSAA 4PHJA 1GGZA 3DVJA 2JT0A 1A03A 4C0JA 1OQPA 1YUTA 3EVRA 1IWQA 3PM8A 2FCDA 3BOWB 1TN4A 1NPQA 2BBMA 2K0JA 4YGCB 1MXLC 2KYFA 1N65A 5IBWA 1NX0A 1S6JA 2H61A 2KI4B 4YGBB 1Y1AA 1UUSA 3EK4A 1K9PA 1UHJA 2M1KB 2K7BA 1IQ3A 1RJVA 3OB1B 4OR9B 4I5NB 1KFXL 4QJ4B 4AQJA 2LC5A 2LAPA 1CNPA 2KNEA 1A2XA 1QS7A 2NXQA 2ISDA 1KSMA 2I18A 4HREE 4PE1A 4CFQA 2JXLA 1X02A 1FBVA 5KU1A 1AK8A 4GFTA 3TS5B 5I2QA 1QVIZ 2Y5IA 2PASA 5AEQA 3TDZA 5HYDA 2JXCA 1IQ5A 1KSOA 1CFPA 2E30A 2F2PA 2QPTA 4DS7A 1QIWA 3I5HB 4GUKA 2PMYA 5HLVA 1CMGA 1XFYO 1QX5B 3EKHA 1WDCB 4I5JA 1SL8A 1XFXO 2COLB 3BQ3A 1JF2A 1M39A 1SMGA 1AVSA 1DT7B 2L2EA 1NCYA 4GAOA 1MF8B 1KK8C 2JNFA 3GK4X 2LHIA 1CKKA 1KK7Z 1J55A 2KFGA 4PALA 1K2HA 4YBHB 3SG7A 3PALA 1C7WA 2LANA 2WCFA 1YUSA 2GGMA 1TIZA 2CXJA 2RGIA 4NDBA 1JSAA 1IG5A 1K9KA 2M49B 3LL8B 1UHNA 1OOJA 3PFVA 4A4BA 4YI9A 3DVKA 4U8DA 1AJ4A 1BJFA 5AERA 5JOLA 2KQYA 3DVMA 2M8UA 3BOWA 4PHNA 1IRJA 2LP2A 1UHIA 1ZACA 1SCMB 5I2LA 1DJYA 2KI6C 1XFUO 3DD4A 2H61C 1AHRA 1AJ5A 2ZFDA 1CTRA 3SIAA 2LV7A 2JOJA 5G08A 2KI6D 4PCWA 2FJUB 2PSRA 5AANA 4ETOA 1F70A 5AFPA 1TCFA 1K95A 2K8MB 2Y1MA 5J3XA 1UP5A 4NDCA 1QJTA 3GOFA 1NIWA 2KAYA 1SK6D 3O6BA 1DF0A 3JTDB 2OTGC 2LMUA 1B7TY 2G2BA 4UPGA 4PE7A 4OVNF 5HKWA 1SYMA 1WRKA 1IH0A 1MR8A 5I2OA 2MLFC 1EG4A 1G4YR 1K94A 2BL0C 2M9GA 1BR4B 1XVJA 1YUUA 2MLEC 2BE6A 2JNXA 1CDPA 2CTNA 3NSLA 1PSBA 5K89A 3WNXB 2F2OA 5FYXA 4MSPA 4YGEB 1KFUL 1JFKA 2LVKA 1YR5A 3CR4X 3OX5A 3CTNA 4MZKA 3TUYC 4MZLA 2LM5A 2PVBA 2JZIA 1EL4A 2E6WA 4DRWA 2Q4UA 1SPYA 2EC6C 1M31A 4JQ0D 1L2OC 2F33A 1UURA 2JWWA 1TTXA 3AAKA 1A75B 1QVIY 3BYAA 3JVTB 4N5XA 1CB1A 2B1UA 1GJYA 3IF7A 2MAZA 1UWOA 4C0KA 1TNWA 5HLOA 2L51A 1PULA 1U5IB 2FCEA 3D10A 3CGAA 3LK0A 2LLTA 1IKUA 2SCPA 3BUMB 2CT9A 4MN0A 5CSJA 3I5FB 2KSPA 4MVFA 1B7TZ 2K7DA 4I5LB 1KK7Y 4WQ3A 3CS1A 3DVEA 2GGZA 3A4UB 4MBEA 2M97A 1KCYA 1B47A 1CDNA 1RECA 4ICBA 1ODBA 3TS5C 1MUXA 2KGBC 4OV2A 1FPWA 2F3YA 2MA2A 5I8NA 1TNXA 1RFJA 3D0YB 2BE4A 3I5HC 2LVJA 1DJIA 3SIBA 1EJ3A 2PRUA 2DOQA 4D1EA 1WDCC 1YVHA 1Q80A 2ZRSA 3EK7A 2LUXA 4PHMA 2WCBA 3SG6A 2LE9B 1NX1A 3VROA 2M7NA 2O60A 2G9BA 2LLSA 4TNCA 1MWNA 5CPVA 1XYDA 1XFZO 4M2OA 5KTYA 4N1GA 1JWDA 1F54A 2WOSA 1R2UA 1J1DA 1A75A 2BCBA 4MEWA 3FWCA 1D1OA 2BCXA 1C7VA 1JFJA 3SJSA 1QTXA 1QV0A 2JQ6A 3CLNA 1NX2A 2ZNEA 1LVCD 1U5IA 4DUQA 1A29A 1SCMC 2QACA 1J1EA 3PN7C 2KAVA 2R2IA 3NSOA 1WLMA 4M2PA 4XJKB 2LMVA 1IJ6A 1H8BA 2NZ0A 2SASA 3GK2A 2WC8A 4QJ3B 5CSNA 1EXRA 3BUXB 3WXAA 2M3WA 2M7LA 2PALA 4CFRA 1CFFA 3ZNIA 1ALVA 1PK0D 3PLFB 3FIAA 2ZRTA 1LKJA 1KWOB 2CBLA 4IL1A 4PE0A 2EHBA 2LNKA 4CLNA 4P5OE 1CFCA 2ZN9A 1PALA 4MRXA 2V53A 3D0YA 1S1EA 4I5KA 1QATA 1NSHA 3I5GB 1SL9A 4CPVA 1OE9B 5BPJA 2KBIA 1B8RA 1QLSA 5F6TA 1LA3A 1EH2A 1V1FA 4NDDA 2AUCA 1NWDA 3PSRA 1DJWA 4WQ2A 2L50A 2FOTA 2JRFA 3F45A 2K2AA 2Y4QA 1CDLA 2JT8A 4BY5A 1Y6WA 1DGUA 2F3ZA 5TNCA 1CMFA 1GQMA 1K8UA 2MJWB 2KGRA 2GV5A 1SKTA 4BY4A 2LUCA 1SL7A 4OCIA 2I94A 4AQIA 3JVTC 2M0RA 1V1GA 1J7QA 2L98A 1OMDA 2KDHA 2AMIA 3CWGA 1BLQA 2K2FA 1GGWA 1W7IB 1RTP1 3WHUB 1CDMA 2OS8B 5DKQA 1QIVA 1YRTB 3ICBA 1CFDA 1J7RA 1JUOA 1SR6B 5ER5A 4GGFA 4N1FA 1HT9A 3EVUA 2Q91A 1EG3A 3AKBA 3BUWB 3I5FC 2ZNDA 1SY9A 1S26D 2NLNA 2MRDA 5JJGA 1RWYA 1M45A 1TCOB 1DJXA 3EVVA 2WNDA 1NUBA 1CLMA 1KQMB 2M29A 1CM1A 1BF5A 3TZ1A 1FI6A 4C0LA 3OB2B 4M2QA 5CSIA 3QRXA 1NYAA 1G33A 2K7CA 3HX4A 1SCVA 3I5IB 1QLKA 3BXKA 2KI4C 3NXAA 2L0PA 3CR2A 1YVLA 4GPLB 1ZOTB 3FS7A 1PSRA 1BMOA 1SBJA 1DMOA 2VRGA 1JBAA 4MRYA 4PE4A 1VRKA 1MQ1A 1FW4A 2D8NA 2M1UA 1JC2A 4HRGA 2WCEA 1LA0A 1F55A 1B8LA 5D69A 1YTZC 2BKHB 1A4PA 1OMRA 2KQ6A 1TOPA 4FQOA 4Q04A 1NCZA 4MZJA 2WORA 1G8IA 1L7ZA 3LCPC 4XYNA 3PATA 2LCPA 1XA5A 3K21A 3A8RA 1B8CA 2KHNA 1BT6A 3O78A 2LHLA 2EGDA 1K90D 2KFHA 1CLLA 2BECA 1AP4A 2KAXA 2F8PA 5DKNA 4GGFC 1QV1A 4ORAB 3BUNB 3SG3A 2TN4A 1DVIA 3IQOA 1TNPA 3NSKA 1OMVA 1SNLA 5D7FA 1F8HA 1XFWO 3OP0A 2LVVA 2JT3A 3FWBA 3AKAA 3OX6A 1CM4A 1BU3A 2NCOA 1B9AA 5CSFA 1B1GA 2AAOA 1BOCA 3VRQA 3RLZA 1XO5A 5GQQC 1XK4A 1DF0B 3TDIA 1S5GZ 1FF1A 1WRLA 4R1EA 3DF0B 3O2PA 4ORBB 1KWOC 1OZOA 3IQQA 2HPSA 1WY9A 1IGVA 4YGDB 2IS9A 1DGVA 3E3RA 1UHKA 3ZWHA 4YRUA 1W7JB 1CLBA 1TRFA 2LP3A 1H4BA 4FTGA 1QX2A 1WLZA 3I5GC 1TNQA 1KQVA 1BR1B 3HCMA 3SG5A 1YX8A 3KEVA 4NQGA 4YI8A 1KFXS 1SRAA 2BCAA 2Y1NA 2I7AA 5DKRA 2ZN8A 3JTDC 3OHMB 4A4CA 1ZUZA 1NP8A 2JTZA 4HRHA 2LLUA 3TDUA 1M63B 4F0ZB 1PVAA 1BODA 1K96A 1RK9A 1S3PA 2BBNA 2JULA 3KPXA 3O4YA 1F71A 1K93D 1F4OA 1SW8A 1Y0VH 3GK1A 4YGAA 4P2YB 3VGOA 1DJHA 1MHOA 3LLEA 1NCXA 2L4IA 3H4SE 1YX7A 4E68A 1N0YA 2OS8C 1QASA 1DJZA 2HQ8A 2MBXA 4WRIA 1FI5A 2JU0A 4USLA 3WHTB 1KK8B 1MXEA 1NX3A 1SR6C 4AOMA 3VRPA 3M0WA 1E8AA 2JPTA 1Y1XA 2I2RE 1WRZA
chains in the Genus database with same CATH superfamily
3PN7B 1PVBA 3KO0A 1C07A 2OPOA 3EG5B 1R6PA 4DIRA 1S36A 4GBAA 3CZTX 3DXLA 2JC2A 2KPHA 1M46A 4ORCB 5HKZA 3SS3A 3RM1A 1XFVO 3VB1A 1AUIB 1XK4C 1BG1A 3SG2A 5KSZA 2NCPA 1KQMC 4JKTA 4OKHA 2KFFA 2L4HA 3DF0A 3KF9A 4DCKA 1LXFC 2P6BB 1DTLA 4JPZB 4ZCUA 2BKIB 5AXIA 1S6IA 4JWQA 3BUOB 1S6CA 3I5IC 3VRNA 4XJKA 3CR5X 4GNKB 2L5XB 2CNPA 4HSZA 3MSEB 2HETA 2LMTA 3AAJA 1YURA 1IJ5A 3C1VA 3D77A 4GGNA 2BAPA 3VRRA 4F7FA 4INXA 2KYCA 3CYZA 2OTGB 5EL2A 1JF0A 4L9MA 2HQWA 1ZMZA 1HQVA 1K9UA 2BL0B 2WCJA 4PHKA 1S5GY 3EK8A 2MHHA 2O5GA 3EKJA 3S0AA 4QJ5B 1ZFSA 1N2DA 3S0GA 1QXPA 2KBMA 3LK1A 3SG4A 4MLWA 1KFUS 4ZCVA 2KOTA 2WCKA 3KHEA 1B4CA 2CCMA 1Y1UA 1J7OA 1OZSA 3TUYB 3PJIA 2K61A 4CIDA 1J7PA 1OOFA 2HF5A 3CZ1A 2JTTA 2ZKMX 1LINA 5B8IB 2H2KA 1F4QA 1QX7A 2EC6B 5FI2A 1RROA 1P28A 4PDZA 1F70A 1L2OB 3NSIA 1YRUB 1C3ZA 1ALWA 1DJGA 5HKYA 3R1PA 2LVIA 2BNXA 2A4JA 1UHHA 5ER4X 1PRWA 4IJ7A 3B88A 2K7OA 5PALA 1OSAA 4PHJA 1GGZA 3DVJA 2JT0A 1A03A 4C0JA 1OQPA 1YUTA 3EVRA 3FE8A 1Z2CB 1IWQA 3PM8A 2FCDA 3BOWB 1TN4A 1NPQA 2BBMA 2K0JA 3NHTA 4YGCB 1MXLC 2KYFA 1N65A 5IBWA 1NX0A 1S6JA 2H61A 2KI4B 4YGBB 1Y1AA 1UUSA 3EK4A 1K9PA 1UHJA 2M1KB 2K7BA 3S0DA 1IQ3A 1RJVA 3S0BA 3OB1B 4OR9B 4I5NB 1KFXL 4QJ4B 4AQJA 2LC5A 2LAPA 1CNPA 2KNEA 1A2XA 1QS7A 2NXQA 2ISDA 1KSMA 2I18A 4HREE 4PE1A 4CFQA 2JXLA 1X02A 1C3YA 3R1VA 1FBVA 5KU1A 1AK8A 4GFTA 3TS5B 5I2QA 1QVIZ 2Y5IA 3DY9A 2PASA 5AEQA 3TDZA 5HYDA 2JXCA 1IQ5A 1KSOA 1CFPA 2E30A 2F2PA 2QPTA 4DS7A 1QIWA 3I5HB 4GUKA 2PMYA 5HLVA 1CMGA 1XFYO 1QX5B 3EKHA 1WDCB 2P70A 4I5JA 1SL8A 1XFXO 2COLB 3BQ3A 1JF2A 1M39A 1SMGA 1AVSA 1DT7B 2L2EA 1NCYA 4GAOA 1MF8B 1KK8C 2JNFA 3GK4X 2LHIA 1CKKA 1KK7Z 3OBVA 1J55A 2KFGA 4PALA 1K2HA 4YBHB 3SG7A 3PALA 1C7WA 2LANA 2WCFA 1YUSA 2GGMA 1TIZA 2CXJA 2RGIA 4NDBA 1JSAA 1IG5A 1Z4HA 1K9KA 2M49B 3LL8B 5DICA 1XFRA 1UHNA 1OOJA 3PFVA 3SS5A 4A4BA 4YI9A 2QEBA 3DVKA 1AJ4A 1BJFA 4U8DA 5AERA 5JOLA 2KQYA 3DVMA 2M8UA 3BOWA 4PHNA 1IRJA 2LP2A 1UHIA 1ZACA 1SCMB 5I2LA 1DJYA 3BJHA 2KI6C 3V2LA 1XFUO 3DD4A 2H61C 1AHRA 1AJ5A 1TUZA 1CTRA 2ZFDA 3SIAA 2LV7A 2JOJA 5G08A 2KI6D 4PCWA 3CDNA 2FJUB 2PQLA 2PSRA 5AANA 2KLEA 4ETOA 1TCFA 1K95A 2K8MB 2Y1MA 5J3XA 5AFPA 1UP5A 4NDCA 1QJTA 3GOFA 1NIWA 2KAYA 1SK6D 3K1EA 1DF0A 3JTDB 3O6BA 2OTGC 2LMUA 1B7TY 2G2BA 4UPGA 4PE7A 4OVNF 5HKWA 1SYMA 1WRKA 1IH0A 1MR8A 5I2OA 2MLFC 1EG4A 1G4YR 1K94A 2BL0C 2M9GA 1BR4B 1XVJA 1YUUA 2MLEC 2BE6A 2JNXA 1CDPA 2CTNA 3NSLA 1PSBA 5K89A 1SSEB 2F2OA 3WNXB 2WC6A 3S0FA 5FYXA 3PM2A 4MSPA 1GM0A 4YGEB 1KFUL 1JFKA 2LVKA 1YR5A 3R72A 3UO9A 3CR4X 3OX5A 3CTNA 4MZKA 3TUYC 4MZLA 2LM5A 2PVBA 2JZIA 1EL4A 2E6WA 4DRWA 2Q4UA 1T14A 1SPYA 1TWOA 1M31A 2EC6C 4JQ0D 1DC1A 1L2OC 2F33A 1UURA 2JWWA 1TTXA 3AAKA 1A75B 1QVIY 3BYAA 3QMEA 3JVTB 4N5XA 4PT1A 1CB1A 2B1UA 1GJYA 3IF7A 2MAZA 1UWOA 2FJYA 2QDIA 4C0KA 1TNWA 5HLOA 2L51A 1PULA 1U5IB 2FCEA 3D10A 3CGAA 3LK0A 2LLTA 1IKUA 2SCPA 3BUMB 2CT9A 4MN0A 5CSJA 3I5FB 2KSPA 4MVFA 1B7TZ 2K7DA 4I5LB 1KK7Y 4WQ3A 3CS1A 3DVEA 2GGZA 3A4UB 4MBEA 2M97A 1KCYA 1B47A 1CDNA 1RECA 2QEHA 4ICBA 1ODBA 3TS5C 1MUXA 2KGBC 4OV2A 1FPWA 2F3YA 2MA2A 5I8NA 1TNXA 1RFJA 2L5YA 1OOIX 3D0YB 3S0EA 2BE4A 3I5HC 2LVJA 1DJIA 2ERBA 1EJ3A 3SIBA 2PRUA 2DOQA 4D1EA 1WDCC 1YVHA 3DZTA 1Q80A 2ZRSA 3EK7A 2LUXA 4PHMA 2WCBA 2PYQA 3DYEA 3SG6A 3RZSA 2LE9B 1NX1A 3VROA 3L4AA 2M7NA 2O60A 2G9BA 2LLSA 4TNCA 1MWNA 5CPVA 1DELA 1XYDA 1XFZO 4M2OA 5KTYA 4N1GA 1JWDA 1F54A 2WOSA 1R2UA 1J1DA 1A75A 2BCBA 4MEWA 3FWCA 1D1OA 2BCXA 3O4XA 3SS4A 1C7VA 1JFJA 3SJSA 1QTXA 1QV0A 2JQ6A 3CLNA 1NX2A 2ZNEA 2WCLA 1LVCD 1U5IA 4DUQA 1A29A 1OW4A 3FE6A 1SCMC 2QACA 1J1EA 3PN7C 2KAVA 2R2IA 3NSOA 1WLMA 4M2PA 4XJKB 2LMVA 1IJ6A 1H8BA 2NZ0A 2SASA 3GK2A 2WC8A 4QJ3B 5CSNA 1EXRA 3BUXB 3WXAA 2M3WA 2M7LA 2PALA 4CFRA 1CFFA 3ZNIA 1ALVA 1PK0D 3CZ2A 3PLFB 3FIAA 2ZRTA 1LKJA 4KYNA 1KWOB 2CBLA 4IL1A 4PE0A 2EHBA 2LNKA 4CLNA 4P5OE 5FI6A 2ZN9A 1PALA 1CFCA 4MRXA 2V53A 3D0YA 2WCHA 1S1EA 4I5KA 1QATA 1NSHA 3I5GB 1SL9A 2K60A 1OE9B 4CPVA 5BPJA 3L47A 2KBIA 1B8RA 1QLSA 5F6TA 1LA3A 1EH2A 1V1FA 4NDDA 2AUCA 2QEVA 3D76A 1NWDA 3PSRA 1DJWA 4WQ2A 2L50A 2FOTA 2JRFA 3F45A 2K2AA 2Y4QA 1CDLA 2JT8A 4BY5A 1Y6WA 1DGUA 2F3ZA 5TNCA 1CMFA 1GQMA 1K8UA 2MJWB 2KGRA 2GV5A 2GTEA 1SKTA 4BY4A 2LUCA 1SL7A 4OCIA 2I94A 4AQIA 3JVTC 2M0RA 1V1GA 1J7QA 2L98A 1OMDA 2KDHA 2AMIA 3CWGA 1FI5A 1BLQA 2K2FA 1GGWA 1W7IB 1RTP1 3WHUB 1CDMA 2OS8B 5DKQA 1QIVA 1YRTB 3ICBA 1CFDA 1J7RA 1JUOA 1SR6B 5ER5A 4GGFA 5D3OA 4N1FA 1HT9A 3EVUA 5HL1A 2Q91A 1EG3A 3AKBA 3BUWB 2P71A 3I5FC 1OOGA 2ZNDA 1SY9A 1S26D 2NLNA 2MRDA 3D78A 5JJGA 1RWYA 1M45A 1TCOB 1DJXA 3EVVA 2WNDA 1NUBA 1CLMA 1KQMB 2M29A 1CM1A 1BF5A 3TZ1A 1FI6A 4C0LA 1OOHA 3OB2B 4M2QA 3BFHA 5CSIA 3QRXA 1NYAA 1G33A 2K7CA 3HX4A 1SCVA 3I5IB 1QLKA 3BXKA 2KI4C 3NXAA 2L0PA 3CR2A 1YVLA 4GPLB 1ZOTB 3FS7A 1PSRA 3D73A 1QWVA 1BMOA 1SBJA 1DMOA 1W9ZA 2L2CA 2VRGA 3OGNA 1VRKA 4MRYA 4PE4A 1JBAA 3B7AA 1MQ1A 1FW4A 2D8NA 2M1UA 3B86A 4HRGA 5FI7A 1JC2A 2WCEA 1LA0A 1F55A 1B8LA 5D69A 1IIOA 1YTZC 2BKHB 1A4PA 1OMRA 2KQ6A 1TOPA 3N7HA 4FQOA 4Q04A 1NCZA 4MZJA 2WORA 3NHIA 1G8IA 1DQEA 1L7ZA 3LCPC 3PATA 3R1OA 4OZDA 2LCPA 4XYNA 3B6XA 1XA5A 3K21A 3A8RA 1DEKA 1B8CA 2KHNA 1BT6A 3O78A 2LHLA 2EGDA 1K90D 2KFHA 1CLLA 2BECA 1AP4A 2KAXA 3CZ0A 2F8PA 2QEOA 5DKNA 2KLDA 4GGFC 1QV1A 4ORAB 3BUNB 3SG3A 2TN4A 1DVIA 3IQOA 1TNPA 3NSKA 3FE9A 3L4LA 1OMVA 1SNLA 5D7FA 1F8HA 1XFWO 3OP0A 2LVVA 2JT3A 3FWBA 3AKAA 3OX6A 1CM4A 1BU3A 2NCOA 1B9AA 3CABA 5CSFA 2AAOA 1B1GA 1BOCA 3BFBA 3VRQA 3RLZA 1XO5A 5GQQC 1XK4A 4INWA 1DF0B 3TDIA 1S5GZ 1FF1A 1WRLA 4R1EA 3DF0B 3O2PA 4ORBB 1KWOC 1OZOA 3IQQA 2HPSA 1WY9A 1IGVA 3B87A 4YGDB 2IS9A 1DGVA 3E3RA 1UHKA 3ZWHA 4YRUA 1W7JB 1CLBA 1TRFA 2LP3A 1H4BA 3NGVA 4FTGA 1QX2A 1WLZA 3I5GC 1TNQA 1KQVA 1BR1B 3HCMA 3SG5A 1YX8A 3KEVA 4NQGA 4YI8A 1KFXS 1SRAA 2BCAA 2JPOA 2I7AA 2Y1NA 2YGUA 5DKRA 2ZN8A 3JTDC 3OHMB 3D74A 4A4CA 1ZUZA 1NP8A 2JTZA 1ORGA 3UNWA 4HRHA 2LLUA 3TDUA 1M63B 4F0ZB 1PVAA 1BODA 1K96A 1RK9A 1S3PA 5I94A 1TUJA 2BBNA 2JULA 3KPXA 3O4YA 1F71A 1K93D 1F4OA 3BFAA 1SW8A 1Y0VH 3GK1A 1LS8A 4YGAA 4P2YB 3VGOA 1DJHA 1MHOA 3D75A 3IVTA 3LLEA 1NCXA 2L4IA 3H4SE 1YX7A 2H8VA 4E68A 1N0YA 2OS8C 1QASA 1DJZA 2HQ8A 2WC5A 2WCMA 4FQTA 2JU0A 4JD9A 4USLA 4WRIA 2MBXA 3WHTB 1KK8B 1MXEA 1NX3A 1SR6C 4AOMA 3VRPA 3M0WA 3Q8IA 1E8AA 2JPTA 1Y1XA 2I2RE 1WRZA
chains in the Genus database with same CATH topology
3PN7B 1PVBA 3KO0A 1C07A 2OPOA 1R6PA 4DIRA 1S36A 4GBAA 3CZTX 2JC2A 4ORCB 1M46A 5HKZA 3RM1A 1XFVO 1AUIB 1XK4C 1BG1A 3SG2A 5KSZA 2NCPA 1KQMC 4OKHA 2KFFA 2L4HA 3DF0A 3KF9A 4DCKA 1LXFC 2P6BB 1DTLA 4JPZB 4ZCUA 2BKIB 5AXIA 1S6IA 4JWQA 3BUOB 1S6CA 3I5IC 3VRNA 4XJKA 3CR5X 4GNKB 2L5XB 2CNPA 4HSZA 3MSEB 2HETA 2LMTA 3AAJA 1YURA 1IJ5A 3C1VA 4GGNA 3VRRA 2KYCA 2OTGB 1JF0A 4L9MA 2HQWA 1ZMZA 1HQVA 1K9UA 2BL0B 4PHKA 1S5GY 3EK8A 2MHHA 2O5GA 3EKJA 4QJ5B 1ZFSA 1N2DA 1QXPA 2KBMA 3LK1A 3SG4A 4MLWA 1KFUS 4ZCVA 2KOTA 3KHEA 1B4CA 2CCMA 1Y1UA 1J7OA 1OZSA 3TUYB 2K61A 4CIDA 1J7PA 2HF5A 2JTTA 2ZKMX 1LINA 5B8IB 2H2KA 1F4QA 1QX7A 2EC6B 1RROA 4PDZA 1L2OB 3NSIA 1YRUB 1ALWA 1DJGA 5HKYA 2LVIA 2A4JA 1UHHA 5ER4X 1PRWA 2K7OA 5PALA 1OSAA 4PHJA 1GGZA 3DVJA 2JT0A 1A03A 4C0JA 1OQPA 1YUTA 3EVRA 1IWQA 3PM8A 2FCDA 3BOWB 1TN4A 1NPQA 2BBMA 2K0JA 4YGCB 1MXLC 2KYFA 1N65A 5IBWA 1NX0A 1S6JA 2H61A 2KI4B 4YGBB 1Y1AA 1UUSA 3EK4A 1K9PA 1UHJA 2M1KB 2K7BA 1IQ3A 1RJVA 3OB1B 4OR9B 4I5NB 1KFXL 4QJ4B 4AQJA 2LC5A 2LAPA 1CNPA 2KNEA 1A2XA 1QS7A 2NXQA 2ISDA 1KSMA 2I18A 4HREE 4PE1A 4CFQA 2JXLA 1X02A 1FBVA 5KU1A 1AK8A 4GFTA 3TS5B 5I2QA 1QVIZ 2Y5IA 2PASA 5AEQA 3TDZA 5HYDA 2JXCA 1IQ5A 1KSOA 1CFPA 2E30A 2F2PA 2QPTA 4DS7A 1QIWA 3I5HB 4GUKA 2PMYA 5HLVA 1CMGA 1XFYO 1QX5B 3EKHA 1WDCB 4I5JA 1SL8A 1XFXO 2COLB 3BQ3A 1JF2A 1M39A 1SMGA 1AVSA 1DT7B 2L2EA 1NCYA 4GAOA 1MF8B 1KK8C 2JNFA 3GK4X 2LHIA 1CKKA 1KK7Z 1J55A 2KFGA 4PALA 1K2HA 4YBHB 3SG7A 3PALA 1C7WA 2LANA 2WCFA 1YUSA 2GGMA 1TIZA 2CXJA 2RGIA 4NDBA 1JSAA 1IG5A 1K9KA 2M49B 3LL8B 1UHNA 1OOJA 3PFVA 4A4BA 4YI9A 3DVKA 4U8DA 1AJ4A 1BJFA 5AERA 5JOLA 2KQYA 3DVMA 2M8UA 3BOWA 4PHNA 1IRJA 2LP2A 1UHIA 1ZACA 1SCMB 5I2LA 1DJYA 2KI6C 1XFUO 3DD4A 2H61C 1AHRA 1AJ5A 2ZFDA 1CTRA 3SIAA 2LV7A 2JOJA 5G08A 2KI6D 4PCWA 2FJUB 2PSRA 5AANA 4ETOA 1F70A 5AFPA 1TCFA 1K95A 2K8MB 2Y1MA 5J3XA 1UP5A 4NDCA 1QJTA 3GOFA 1NIWA 2KAYA 1SK6D 3O6BA 1DF0A 3JTDB 2OTGC 2LMUA 1B7TY 2G2BA 4UPGA 4PE7A 4OVNF 5HKWA 1SYMA 1WRKA 1IH0A 1MR8A 5I2OA 2MLFC 1EG4A 1G4YR 1K94A 2BL0C 2M9GA 1BR4B 1XVJA 1YUUA 2MLEC 2BE6A 2JNXA 1CDPA 2CTNA 3NSLA 1PSBA 5K89A 3WNXB 2F2OA 5FYXA 4MSPA 4YGEB 1KFUL 1JFKA 2LVKA 1YR5A 3CR4X 3OX5A 3CTNA 4MZKA 3TUYC 4MZLA 2LM5A 2PVBA 2JZIA 1EL4A 2E6WA 4DRWA 2Q4UA 1SPYA 2EC6C 1M31A 4JQ0D 1L2OC 2F33A 1UURA 2JWWA 1TTXA 3AAKA 1A75B 1QVIY 3BYAA 3JVTB 4N5XA 1CB1A 2B1UA 1GJYA 3IF7A 2MAZA 1UWOA 4C0KA 1TNWA 5HLOA 2L51A 1PULA 1U5IB 2FCEA 3D10A 3CGAA 3LK0A 2LLTA 1IKUA 2SCPA 3BUMB 2CT9A 4MN0A 5CSJA 3I5FB 2KSPA 4MVFA 1B7TZ 2K7DA 4I5LB 1KK7Y 4WQ3A 3CS1A 3DVEA 2GGZA 3A4UB 4MBEA 2M97A 1KCYA 1B47A 1CDNA 1RECA 4ICBA 1ODBA 3TS5C 1MUXA 2KGBC 4OV2A 1FPWA 2F3YA 2MA2A 5I8NA 1TNXA 1RFJA 3D0YB 2BE4A 3I5HC 2LVJA 1DJIA 3SIBA 1EJ3A 2PRUA 2DOQA 4D1EA 1WDCC 1YVHA 1Q80A 2ZRSA 3EK7A 2LUXA 4PHMA 2WCBA 3SG6A 2LE9B 1NX1A 3VROA 2M7NA 2O60A 2G9BA 2LLSA 4TNCA 1MWNA 5CPVA 1XYDA 1XFZO 4M2OA 5KTYA 4N1GA 1JWDA 1F54A 2WOSA 1R2UA 1J1DA 1A75A 2BCBA 4MEWA 3FWCA 1D1OA 2BCXA 1C7VA 1JFJA 3SJSA 1QTXA 1QV0A 2JQ6A 3CLNA 1NX2A 2ZNEA 1LVCD 1U5IA 4DUQA 1A29A 1SCMC 2QACA 1J1EA 3PN7C 2KAVA 2R2IA 3NSOA 1WLMA 4M2PA 4XJKB 2LMVA 1IJ6A 1H8BA 2NZ0A 2SASA 3GK2A 2WC8A 4QJ3B 5CSNA 1EXRA 3BUXB 3WXAA 2M3WA 2M7LA 2PALA 4CFRA 1CFFA 3ZNIA 1ALVA 1PK0D 3PLFB 3FIAA 2ZRTA 1LKJA 1KWOB 2CBLA 4IL1A 4PE0A 2EHBA 2LNKA 4CLNA 4P5OE 1CFCA 2ZN9A 1PALA 4MRXA 2V53A 3D0YA 1S1EA 4I5KA 1QATA 1NSHA 3I5GB 1SL9A 4CPVA 1OE9B 5BPJA 2KBIA 1B8RA 1QLSA 5F6TA 1LA3A 1EH2A 1V1FA 4NDDA 2AUCA 1NWDA 3PSRA 1DJWA 4WQ2A 2L50A 2FOTA 2JRFA 3F45A 2K2AA 2Y4QA 1CDLA 2JT8A 4BY5A 1Y6WA 1DGUA 2F3ZA 5TNCA 1CMFA 1GQMA 1K8UA 2MJWB 2KGRA 2GV5A 1SKTA 4BY4A 2LUCA 1SL7A 4OCIA 2I94A 4AQIA 3JVTC 2M0RA 1V1GA 1J7QA 2L98A 1OMDA 2KDHA 2AMIA 3CWGA 1BLQA 2K2FA 1GGWA 1W7IB 1RTP1 3WHUB 1CDMA 2OS8B 5DKQA 1QIVA 1YRTB 3ICBA 1CFDA 1J7RA 1JUOA 1SR6B 5ER5A 4GGFA 4N1FA 1HT9A 3EVUA 2Q91A 1EG3A 3AKBA 3BUWB 3I5FC 2ZNDA 1SY9A 1S26D 2NLNA 2MRDA 5JJGA 1RWYA 1M45A 1TCOB 1DJXA 3EVVA 2WNDA 1NUBA 1CLMA 1KQMB 2M29A 1CM1A 1BF5A 3TZ1A 1FI6A 4C0LA 3OB2B 4M2QA 5CSIA 3QRXA 1NYAA 1G33A 2K7CA 3HX4A 1SCVA 3I5IB 1QLKA 3BXKA 2KI4C 3NXAA 2L0PA 3CR2A 1YVLA 4GPLB 1ZOTB 3FS7A 1PSRA 1BMOA 1SBJA 1DMOA 2VRGA 1JBAA 4MRYA 4PE4A 1VRKA 1MQ1A 1FW4A 2D8NA 2M1UA 1JC2A 4HRGA 2WCEA 1LA0A 1F55A 1B8LA 5D69A 1YTZC 2BKHB 1A4PA 1OMRA 2KQ6A 1TOPA 4FQOA 4Q04A 1NCZA 4MZJA 2WORA 1G8IA 1L7ZA 3LCPC 4XYNA 3PATA 2LCPA 1XA5A 3K21A 3A8RA 1B8CA 2KHNA 1BT6A 3O78A 2LHLA 2EGDA 1K90D 2KFHA 1CLLA 2BECA 1AP4A 2KAXA 2F8PA 5DKNA 4GGFC 1QV1A 4ORAB 3BUNB 3SG3A 2TN4A 1DVIA 3IQOA 1TNPA 3NSKA 1OMVA 1SNLA 5D7FA 1F8HA 1XFWO 3OP0A 2LVVA 2JT3A 3FWBA 3AKAA 3OX6A 1CM4A 1BU3A 2NCOA 1B9AA 5CSFA 1B1GA 2AAOA 1BOCA 3VRQA 3RLZA 1XO5A 5GQQC 1XK4A 1DF0B 3TDIA 1S5GZ 1FF1A 1WRLA 4R1EA 3DF0B 3O2PA 4ORBB 1KWOC 1OZOA 3IQQA 2HPSA 1WY9A 1IGVA 4YGDB 2IS9A 1DGVA 3E3RA 1UHKA 3ZWHA 4YRUA 1W7JB 1CLBA 1TRFA 2LP3A 1H4BA 4FTGA 1QX2A 1WLZA 3I5GC 1TNQA 1KQVA 1BR1B 3HCMA 3SG5A 1YX8A 3KEVA 4NQGA 4YI8A 1KFXS 1SRAA 2BCAA 2Y1NA 2I7AA 5DKRA 2ZN8A 3JTDC 3OHMB 4A4CA 1ZUZA 1NP8A 2JTZA 4HRHA 2LLUA 3TDUA 1M63B 4F0ZB 1PVAA 1BODA 1K96A 1RK9A 1S3PA 2BBNA 2JULA 3KPXA 3O4YA 1F71A 1K93D 1F4OA 1SW8A 1Y0VH 3GK1A 4YGAA 4P2YB 3VGOA 1DJHA 1MHOA 3LLEA 1NCXA 2L4IA 3H4SE 1YX7A 4E68A 1N0YA 2OS8C 1QASA 1DJZA 2HQ8A 2MBXA 4WRIA 1FI5A 2JU0A 4USLA 3WHTB 1KK8B 1MXEA 1NX3A 1SR6C 4AOMA 3VRPA 3M0WA 1E8AA 2JPTA 1Y1XA 2I2RE 1WRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PN7 B;  1PVB A;  3KO0 A;  1C07 A;  2OPO A;  1R6P A;  4DIR A;  1S36 A;  4GBA A;  3CZT X;  2JC2 A;  4ORC B;  1M46 A;  5HKZ A;  3RM1 A;  1XFV O;  1AUI B;  1XK4 C;  1BG1 A;  3SG2 A;  5KSZ A;  2NCP A;  1KQM C;  4OKH A;  2KFF A;  2L4H A;  3DF0 A;  3KF9 A;  4DCK A;  1LXF C;  2P6B B;  1DTL A;  4JPZ B;  4ZCU A;  2BKI B;  5AXI A;  1S6I A;  4JWQ A;  3BUO B;  1S6C A;  3I5I C;  3VRN A;  4XJK A;  3CR5 X;  4GNK B;  2L5X B;  2CNP A;  4HSZ A;  3MSE B;  2HET A;  2LMT A;  3AAJ A;  1YUR A;  1IJ5 A;  3C1V A;  4GGN A;  3VRR A;  2KYC A;  2OTG B;  1JF0 A;  4L9M A;  2HQW A;  1ZMZ A;  1HQV A;  1K9U A;  2BL0 B;  4PHK A;  1S5G Y;  3EK8 A;  2MHH A;  2O5G A;  3EKJ A;  4QJ5 B;  1ZFS A;  1N2D A;  1QXP A;  2KBM A;  3LK1 A;  3SG4 A;  4MLW A;  1KFU S;  4ZCV A;  2KOT A;  3KHE A;  1B4C A;  2CCM A;  1Y1U A;  1J7O A;  1OZS A;  3TUY B;  2K61 A;  4CID A;  1J7P A;  2HF5 A;  2JTT A;  2ZKM X;  1LIN A;  5B8I B;  2H2K A;  1F4Q A;  1QX7 A;  2EC6 B;  1RRO A;  4PDZ A;  1L2O B;  3NSI A;  1YRU B;  1ALW A;  1DJG A;  5HKY A;  2LVI A;  2A4J A;  1UHH A;  5ER4 X;  1PRW A;  2K7O A;  5PAL A;  1OSA A;  4PHJ A;  1GGZ A;  3DVJ A;  2JT0 A;  1A03 A;  4C0J A;  1OQP A;  1YUT A;  3EVR A;  1IWQ A;  3PM8 A;  2FCD A;  3BOW B;  1TN4 A;  1NPQ A;  2BBM A;  2K0J A;  4YGC B;  1MXL C;  2KYF A;  1N65 A;  5IBW A;  1NX0 A;  1S6J A;  2H61 A;  2KI4 B;  4YGB B;  1Y1A A;  1UUS A;  3EK4 A;  1K9P A;  1UHJ A;  2M1K B;  2K7B A;  1IQ3 A;  1RJV A;  3OB1 B;  4OR9 B;  4I5N B;  1KFX L;  4QJ4 B;  4AQJ A;  2LC5 A;  2LAP A;  1CNP A;  2KNE A;  1A2X A;  1QS7 A;  2NXQ A;  2ISD A;  1KSM A;  2I18 A;  4HRE E;  4PE1 A;  4CFQ A;  2JXL A;  1X02 A;  1FBV A;  5KU1 A;  1AK8 A;  4GFT A;  3TS5 B;  5I2Q A;  1QVI Z;  2Y5I A;  2PAS A;  5AEQ A;  3TDZ A;  5HYD A;  2JXC A;  1IQ5 A;  1KSO A;  1CFP A;  2E30 A;  2F2P A;  2QPT A;  4DS7 A;  1QIW A;  3I5H B;  4GUK A;  2PMY A;  5HLV A;  1CMG A;  1XFY O;  1QX5 B;  3EKH A;  1WDC B;  4I5J A;  1SL8 A;  1XFX O;  2COL B;  3BQ3 A;  1JF2 A;  1M39 A;  1SMG A;  1AVS A;  1DT7 B;  2L2E A;  1NCY A;  4GAO A;  1MF8 B;  1KK8 C;  2JNF A;  3GK4 X;  2LHI A;  1CKK A;  1KK7 Z;  1J55 A;  2KFG A;  4PAL A;  1K2H A;  4YBH B;  3SG7 A;  3PAL A;  1C7W A;  2LAN A;  2WCF A;  1YUS A;  2GGM A;  1TIZ A;  2CXJ A;  2RGI A;  4NDB A;  1JSA A;  1IG5 A;  1K9K A;  2M49 B;  3LL8 B;  1UHN A;  1OOJ A;  3PFV A;  4A4B A;  4YI9 A;  3DVK A;  4U8D A;  1AJ4 A;  1BJF A;  5AER A;  5JOL A;  2KQY A;  3DVM A;  2M8U A;  3BOW A;  4PHN A;  1IRJ A;  2LP2 A;  1UHI A;  1ZAC A;  1SCM B;  5I2L A;  1DJY A;  2KI6 C;  1XFU O;  3DD4 A;  2H61 C;  1AHR A;  1AJ5 A;  2ZFD A;  1CTR A;  3SIA A;  2LV7 A;  2JOJ A;  5G08 A;  2KI6 D;  4PCW A;  2FJU B;  2PSR A;  5AAN A;  4ETO A;  1F70 A;  5AFP A;  1TCF A;  1K95 A;  2K8M B;  2Y1M A;  5J3X A;  1UP5 A;  4NDC A;  1QJT A;  3GOF A;  1NIW A;  2KAY A;  1SK6 D;  3O6B A;  1DF0 A;  3JTD B;  2OTG C;  2LMU A;  1B7T Y;  2G2B A;  4UPG A;  4PE7 A;  4OVN F;  5HKW A;  1SYM A;  1WRK A;  1IH0 A;  1MR8 A;  5I2O A;  2MLF C;  1EG4 A;  1G4Y R;  1K94 A;  2BL0 C;  2M9G A;  1BR4 B;  1XVJ A;  1YUU A;  2MLE C;  2BE6 A;  2JNX A;  1CDP A;  2CTN A;  3NSL A;  1PSB A;  5K89 A;  3WNX B;  2F2O A;  5FYX A;  4MSP A;  4YGE B;  1KFU L;  1JFK A;  2LVK A;  1YR5 A;  3CR4 X;  3OX5 A;  3CTN A;  4MZK A;  3TUY C;  4MZL A;  2LM5 A;  2PVB A;  2JZI A;  1EL4 A;  2E6W A;  4DRW A;  2Q4U A;  1SPY A;  2EC6 C;  1M31 A;  4JQ0 D;  1L2O C;  2F33 A;  1UUR A;  2JWW A;  1TTX A;  3AAK A;  1A75 B;  1QVI Y;  3BYA A;  3JVT B;  4N5X A;  1CB1 A;  2B1U A;  1GJY A;  3IF7 A;  2MAZ A;  1UWO A;  4C0K A;  1TNW A;  5HLO A;  2L51 A;  1PUL A;  1U5I B;  2FCE A;  3D10 A;  3CGA A;  3LK0 A;  2LLT A;  1IKU A;  2SCP A;  3BUM B;  2CT9 A;  4MN0 A;  5CSJ A;  3I5F B;  2KSP A;  4MVF A;  1B7T Z;  2K7D A;  4I5L B;  1KK7 Y;  4WQ3 A;  3CS1 A;  3DVE A;  2GGZ A;  3A4U B;  4MBE A;  2M97 A;  1KCY A;  1B47 A;  1CDN A;  1REC A;  4ICB A;  1ODB A;  3TS5 C;  1MUX A;  2KGB C;  4OV2 A;  1FPW A;  2F3Y A;  2MA2 A;  5I8N A;  1TNX A;  1RFJ A;  3D0Y B;  2BE4 A;  3I5H C;  2LVJ A;  1DJI A;  3SIB A;  1EJ3 A;  2PRU A;  2DOQ A;  4D1E A;  1WDC C;  1YVH A;  1Q80 A;  2ZRS A;  3EK7 A;  2LUX A;  4PHM A;  2WCB A;  3SG6 A;  2LE9 B;  1NX1 A;  3VRO A;  2M7N A;  2O60 A;  2G9B A;  2LLS A;  4TNC A;  1MWN A;  5CPV A;  1XYD A;  1XFZ O;  4M2O A;  5KTY A;  4N1G A;  1JWD A;  1F54 A;  2WOS A;  1R2U A;  1J1D A;  1A75 A;  2BCB A;  4MEW A;  3FWC A;  1D1O A;  2BCX A;  1C7V A;  1JFJ A;  3SJS A;  1QTX A;  1QV0 A;  2JQ6 A;  3CLN A;  1NX2 A;  2ZNE A;  1LVC D;  1U5I A;  4DUQ A;  1A29 A;  1SCM C;  2QAC A;  1J1E A;  3PN7 C;  2KAV A;  2R2I A;  3NSO A;  1WLM A;  4M2P A;  4XJK B;  2LMV A;  1IJ6 A;  1H8B A;  2NZ0 A;  2SAS A;  3GK2 A;  2WC8 A;  4QJ3 B;  5CSN A;  1EXR A;  3BUX B;  3WXA A;  2M3W A;  2M7L A;  2PAL A;  4CFR A;  1CFF A;  3ZNI A;  1ALV A;  1PK0 D;  3PLF B;  3FIA A;  2ZRT A;  1LKJ A;  1KWO B;  2CBL A;  4IL1 A;  4PE0 A;  2EHB A;  2LNK A;  4CLN A;  4P5O E;  1CFC A;  2ZN9 A;  1PAL A;  4MRX A;  2V53 A;  3D0Y A;  1S1E A;  4I5K A;  1QAT A;  1NSH A;  3I5G B;  1SL9 A;  4CPV A;  1OE9 B;  5BPJ A;  2KBI A;  1B8R A;  1QLS A;  5F6T A;  1LA3 A;  1EH2 A;  1V1F A;  4NDD A;  2AUC A;  1NWD A;  3PSR A;  1DJW A;  4WQ2 A;  2L50 A;  2FOT A;  2JRF A;  3F45 A;  2K2A A;  2Y4Q A;  1CDL A;  2JT8 A;  4BY5 A;  1Y6W A;  1DGU A;  2F3Z A;  5TNC A;  1CMF A;  1GQM A;  1K8U A;  2MJW B;  2KGR A;  2GV5 A;  1SKT A;  4BY4 A;  2LUC A;  1SL7 A;  4OCI A;  2I94 A;  4AQI A;  3JVT C;  2M0R A;  1V1G A;  1J7Q A;  2L98 A;  1OMD A;  2KDH A;  2AMI A;  3CWG A;  1BLQ A;  2K2F A;  1GGW A;  1W7I B;  1RTP 1;  3WHU B;  1CDM A;  2OS8 B;  5DKQ A;  1QIV A;  1YRT B;  3ICB A;  1CFD A;  1J7R A;  1JUO A;  1SR6 B;  5ER5 A;  4GGF A;  4N1F A;  1HT9 A;  3EVU A;  2Q91 A;  1EG3 A;  3AKB A;  3BUW B;  3I5F C;  2ZND A;  1SY9 A;  1S26 D;  2NLN A;  2MRD A;  5JJG A;  1RWY A;  1M45 A;  1TCO B;  1DJX A;  3EVV A;  2WND A;  1NUB A;  1CLM A;  1KQM B;  2M29 A;  1CM1 A;  1BF5 A;  3TZ1 A;  1FI6 A;  4C0L A;  3OB2 B;  4M2Q A;  5CSI A;  3QRX A;  1NYA A;  1G33 A;  2K7C A;  3HX4 A;  1SCV A;  3I5I B;  1QLK A;  3BXK A;  2KI4 C;  3NXA A;  2L0P A;  3CR2 A;  1YVL A;  4GPL B;  1ZOT B;  3FS7 A;  1PSR A;  1BMO A;  1SBJ A;  1DMO A;  2VRG A;  1JBA A;  4MRY A;  4PE4 A;  1VRK A;  1MQ1 A;  1FW4 A;  2D8N A;  2M1U A;  1JC2 A;  4HRG A;  2WCE A;  1LA0 A;  1F55 A;  1B8L A;  5D69 A;  1YTZ C;  2BKH B;  1A4P A;  1OMR A;  2KQ6 A;  1TOP A;  4FQO A;  4Q04 A;  1NCZ A;  4MZJ A;  2WOR A;  1G8I A;  1L7Z A;  3LCP C;  4XYN A;  3PAT A;  2LCP A;  1XA5 A;  3K21 A;  3A8R A;  1B8C A;  2KHN A;  1BT6 A;  3O78 A;  2LHL A;  2EGD A;  1K90 D;  2KFH A;  1CLL A;  2BEC A;  1AP4 A;  2KAX A;  2F8P A;  5DKN A;  4GGF C;  1QV1 A;  4ORA B;  3BUN B;  3SG3 A;  2TN4 A;  1DVI A;  3IQO A;  1TNP A;  3NSK A;  1OMV A;  1SNL A;  5D7F A;  1F8H A;  1XFW O;  3OP0 A;  2LVV A;  2JT3 A;  3FWB A;  3AKA A;  3OX6 A;  1CM4 A;  1BU3 A;  2NCO A;  1B9A A;  5CSF A;  1B1G A;  2AAO A;  1BOC A;  3VRQ A;  3RLZ A;  1XO5 A;  5GQQ C;  1XK4 A;  1DF0 B;  3TDI A;  1S5G Z;  1FF1 A;  1WRL A;  4R1E A;  3DF0 B;  3O2P A;  4ORB B;  1KWO C;  1OZO A;  3IQQ A;  2HPS A;  1WY9 A;  1IGV A;  4YGD B;  2IS9 A;  1DGV A;  3E3R A;  1UHK A;  3ZWH A;  4YRU A;  1W7J B;  1CLB A;  1TRF A;  2LP3 A;  1H4B A;  4FTG A;  1QX2 A;  1WLZ A;  3I5G C;  1TNQ A;  1KQV A;  1BR1 B;  3HCM A;  3SG5 A;  1YX8 A;  3KEV A;  4NQG A;  4YI8 A;  1KFX S;  1SRA A;  2BCA A;  2Y1N A;  2I7A A;  5DKR A;  2ZN8 A;  3JTD C;  3OHM B;  4A4C A;  1ZUZ A;  1NP8 A;  2JTZ A;  4HRH A;  2LLU A;  3TDU A;  1M63 B;  4F0Z B;  1PVA A;  1BOD A;  1K96 A;  1RK9 A;  1S3P A;  2BBN A;  2JUL A;  3KPX A;  3O4Y A;  1F71 A;  1K93 D;  1F4O A;  1SW8 A;  1Y0V H;  3GK1 A;  4YGA A;  4P2Y B;  3VGO A;  1DJH A;  1MHO A;  3LLE A;  1NCX A;  2L4I A;  3H4S E;  1YX7 A;  4E68 A;  1N0Y A;  2OS8 C;  1QAS A;  1DJZ A;  2HQ8 A;  2MBX A;  4WRI A;  1FI5 A;  2JU0 A;  4USL A;  3WHT B;  1KK8 B;  1MXE A;  1NX3 A;  1SR6 C;  4AOM A;  3VRP A;  3M0W A;  1E8A A;  2JPT A;  1Y1X A;  2I2R E;  1WRZ A; 
#chains in the Genus database with same CATH topology
 3PN7 B;  1PVB A;  3KO0 A;  1C07 A;  2OPO A;  3EG5 B;  1R6P A;  4DIR A;  1S36 A;  4GBA A;  3CZT X;  3DXL A;  2JC2 A;  2KPH A;  1M46 A;  4ORC B;  5HKZ A;  3SS3 A;  3RM1 A;  1XFV O;  3VB1 A;  1AUI B;  1XK4 C;  1BG1 A;  3SG2 A;  5KSZ A;  2NCP A;  1KQM C;  4JKT A;  4OKH A;  2KFF A;  2L4H A;  3DF0 A;  3KF9 A;  4DCK A;  1LXF C;  2P6B B;  1DTL A;  4JPZ B;  4ZCU A;  2BKI B;  5AXI A;  1S6I A;  4JWQ A;  3BUO B;  1S6C A;  3I5I C;  3VRN A;  4XJK A;  3CR5 X;  4GNK B;  2L5X B;  2CNP A;  4HSZ A;  3MSE B;  2HET A;  2LMT A;  3AAJ A;  1YUR A;  1IJ5 A;  3C1V A;  3D77 A;  4GGN A;  2BAP A;  3VRR A;  4F7F A;  4INX A;  2KYC A;  3CYZ A;  2OTG B;  5EL2 A;  1JF0 A;  4L9M A;  2HQW A;  1ZMZ A;  1HQV A;  1K9U A;  2BL0 B;  2WCJ A;  4PHK A;  1S5G Y;  3EK8 A;  2MHH A;  2O5G A;  3EKJ A;  3S0A A;  4QJ5 B;  1ZFS A;  1N2D A;  3S0G A;  1QXP A;  2KBM A;  3LK1 A;  3SG4 A;  4MLW A;  1KFU S;  4ZCV A;  2KOT A;  2WCK A;  3KHE A;  1B4C A;  2CCM A;  1Y1U A;  1J7O A;  1OZS A;  3TUY B;  3PJI A;  2K61 A;  4CID A;  1J7P A;  1OOF A;  2HF5 A;  3CZ1 A;  2JTT A;  2ZKM X;  1LIN A;  5B8I B;  2H2K A;  1F4Q A;  1QX7 A;  2EC6 B;  5FI2 A;  1RRO A;  1P28 A;  4PDZ A;  1F70 A;  1L2O B;  3NSI A;  1YRU B;  1C3Z A;  1ALW A;  1DJG A;  5HKY A;  3R1P A;  2LVI A;  2BNX A;  2A4J A;  1UHH A;  5ER4 X;  1PRW A;  4IJ7 A;  3B88 A;  2K7O A;  5PAL A;  1OSA A;  4PHJ A;  1GGZ A;  3DVJ A;  2JT0 A;  1A03 A;  4C0J A;  1OQP A;  1YUT A;  3EVR A;  3FE8 A;  1Z2C B;  1IWQ A;  3PM8 A;  2FCD A;  3BOW B;  1TN4 A;  1NPQ A;  2BBM A;  2K0J A;  3NHT A;  4YGC B;  1MXL C;  2KYF A;  1N65 A;  5IBW A;  1NX0 A;  1S6J A;  2H61 A;  2KI4 B;  4YGB B;  1Y1A A;  1UUS A;  3EK4 A;  1K9P A;  1UHJ A;  2M1K B;  2K7B A;  3S0D A;  1IQ3 A;  1RJV A;  3S0B A;  3OB1 B;  4OR9 B;  4I5N B;  1KFX L;  4QJ4 B;  4AQJ A;  2LC5 A;  2LAP A;  1CNP A;  2KNE A;  1A2X A;  1QS7 A;  2NXQ A;  2ISD A;  1KSM A;  2I18 A;  4HRE E;  4PE1 A;  4CFQ A;  2JXL A;  1X02 A;  1C3Y A;  3R1V A;  1FBV A;  5KU1 A;  1AK8 A;  4GFT A;  3TS5 B;  5I2Q A;  1QVI Z;  2Y5I A;  3DY9 A;  2PAS A;  5AEQ A;  3TDZ A;  5HYD A;  2JXC A;  1IQ5 A;  1KSO A;  1CFP A;  2E30 A;  2F2P A;  2QPT A;  4DS7 A;  1QIW A;  3I5H B;  4GUK A;  2PMY A;  5HLV A;  1CMG A;  1XFY O;  1QX5 B;  3EKH A;  1WDC B;  2P70 A;  4I5J A;  1SL8 A;  1XFX O;  2COL B;  3BQ3 A;  1JF2 A;  1M39 A;  1SMG A;  1AVS A;  1DT7 B;  2L2E A;  1NCY A;  4GAO A;  1MF8 B;  1KK8 C;  2JNF A;  3GK4 X;  2LHI A;  1CKK A;  1KK7 Z;  3OBV A;  1J55 A;  2KFG A;  4PAL A;  1K2H A;  4YBH B;  3SG7 A;  3PAL A;  1C7W A;  2LAN A;  2WCF A;  1YUS A;  2GGM A;  1TIZ A;  2CXJ A;  2RGI A;  4NDB A;  1JSA A;  1IG5 A;  1Z4H A;  1K9K A;  2M49 B;  3LL8 B;  5DIC A;  1XFR A;  1UHN A;  1OOJ A;  3PFV A;  3SS5 A;  4A4B A;  4YI9 A;  2QEB A;  3DVK A;  1AJ4 A;  1BJF A;  4U8D A;  5AER A;  5JOL A;  2KQY A;  3DVM A;  2M8U A;  3BOW A;  4PHN A;  1IRJ A;  2LP2 A;  1UHI A;  1ZAC A;  1SCM B;  5I2L A;  1DJY A;  3BJH A;  2KI6 C;  3V2L A;  1XFU O;  3DD4 A;  2H61 C;  1AHR A;  1AJ5 A;  1TUZ A;  1CTR A;  2ZFD A;  3SIA A;  2LV7 A;  2JOJ A;  5G08 A;  2KI6 D;  4PCW A;  3CDN A;  2FJU B;  2PQL A;  2PSR A;  5AAN A;  2KLE A;  4ETO A;  1TCF A;  1K95 A;  2K8M B;  2Y1M A;  5J3X A;  5AFP A;  1UP5 A;  4NDC A;  1QJT A;  3GOF A;  1NIW A;  2KAY A;  1SK6 D;  3K1E A;  1DF0 A;  3JTD B;  3O6B A;  2OTG C;  2LMU A;  1B7T Y;  2G2B A;  4UPG A;  4PE7 A;  4OVN F;  5HKW A;  1SYM A;  1WRK A;  1IH0 A;  1MR8 A;  5I2O A;  2MLF C;  1EG4 A;  1G4Y R;  1K94 A;  2BL0 C;  2M9G A;  1BR4 B;  1XVJ A;  1YUU A;  2MLE C;  2BE6 A;  2JNX A;  1CDP A;  2CTN A;  3NSL A;  1PSB A;  5K89 A;  1SSE B;  2F2O A;  3WNX B;  2WC6 A;  3S0F A;  5FYX A;  3PM2 A;  4MSP A;  1GM0 A;  4YGE B;  1KFU L;  1JFK A;  2LVK A;  1YR5 A;  3R72 A;  3UO9 A;  3CR4 X;  3OX5 A;  3CTN A;  4MZK A;  3TUY C;  4MZL A;  2LM5 A;  2PVB A;  2JZI A;  1EL4 A;  2E6W A;  4DRW A;  2Q4U A;  1T14 A;  1SPY A;  1TWO A;  1M31 A;  2EC6 C;  4JQ0 D;  1DC1 A;  1L2O C;  2F33 A;  1UUR A;  2JWW A;  1TTX A;  3AAK A;  1A75 B;  1QVI Y;  3BYA A;  3QME A;  3JVT B;  4N5X A;  4PT1 A;  1CB1 A;  2B1U A;  1GJY A;  3IF7 A;  2MAZ A;  1UWO A;  2FJY A;  2QDI A;  4C0K A;  1TNW A;  5HLO A;  2L51 A;  1PUL A;  1U5I B;  2FCE A;  3D10 A;  3CGA A;  3LK0 A;  2LLT A;  1IKU A;  2SCP A;  3BUM B;  2CT9 A;  4MN0 A;  5CSJ A;  3I5F B;  2KSP A;  4MVF A;  1B7T Z;  2K7D A;  4I5L B;  1KK7 Y;  4WQ3 A;  3CS1 A;  3DVE A;  2GGZ A;  3A4U B;  4MBE A;  2M97 A;  1KCY A;  1B47 A;  1CDN A;  1REC A;  2QEH A;  4ICB A;  1ODB A;  3TS5 C;  1MUX A;  2KGB C;  4OV2 A;  1FPW A;  2F3Y A;  2MA2 A;  5I8N A;  1TNX A;  1RFJ A;  2L5Y A;  1OOI X;  3D0Y B;  3S0E A;  2BE4 A;  3I5H C;  2LVJ A;  1DJI A;  2ERB A;  1EJ3 A;  3SIB A;  2PRU A;  2DOQ A;  4D1E A;  1WDC C;  1YVH A;  3DZT A;  1Q80 A;  2ZRS A;  3EK7 A;  2LUX A;  4PHM A;  2WCB A;  2PYQ A;  3DYE A;  3SG6 A;  3RZS A;  2LE9 B;  1NX1 A;  3VRO A;  3L4A A;  2M7N A;  2O60 A;  2G9B A;  2LLS A;  4TNC A;  1MWN A;  5CPV A;  1DEL A;  1XYD A;  1XFZ O;  4M2O A;  5KTY A;  4N1G A;  1JWD A;  1F54 A;  2WOS A;  1R2U A;  1J1D A;  1A75 A;  2BCB A;  4MEW A;  3FWC A;  1D1O A;  2BCX A;  3O4X A;  3SS4 A;  1C7V A;  1JFJ A;  3SJS A;  1QTX A;  1QV0 A;  2JQ6 A;  3CLN A;  1NX2 A;  2ZNE A;  2WCL A;  1LVC D;  1U5I A;  4DUQ A;  1A29 A;  1OW4 A;  3FE6 A;  1SCM C;  2QAC A;  1J1E A;  3PN7 C;  2KAV A;  2R2I A;  3NSO A;  1WLM A;  4M2P A;  4XJK B;  2LMV A;  1IJ6 A;  1H8B A;  2NZ0 A;  2SAS A;  3GK2 A;  2WC8 A;  4QJ3 B;  5CSN A;  1EXR A;  3BUX B;  3WXA A;  2M3W A;  2M7L A;  2PAL A;  4CFR A;  1CFF A;  3ZNI A;  1ALV A;  1PK0 D;  3CZ2 A;  3PLF B;  3FIA A;  2ZRT A;  1LKJ A;  4KYN A;  1KWO B;  2CBL A;  4IL1 A;  4PE0 A;  2EHB A;  2LNK A;  4CLN A;  4P5O E;  5FI6 A;  2ZN9 A;  1PAL A;  1CFC A;  4MRX A;  2V53 A;  3D0Y A;  2WCH A;  1S1E A;  4I5K A;  1QAT A;  1NSH A;  3I5G B;  1SL9 A;  2K60 A;  1OE9 B;  4CPV A;  5BPJ A;  3L47 A;  2KBI A;  1B8R A;  1QLS A;  5F6T A;  1LA3 A;  1EH2 A;  1V1F A;  4NDD A;  2AUC A;  2QEV A;  3D76 A;  1NWD A;  3PSR A;  1DJW A;  4WQ2 A;  2L50 A;  2FOT A;  2JRF A;  3F45 A;  2K2A A;  2Y4Q A;  1CDL A;  2JT8 A;  4BY5 A;  1Y6W A;  1DGU A;  2F3Z A;  5TNC A;  1CMF A;  1GQM A;  1K8U A;  2MJW B;  2KGR A;  2GV5 A;  2GTE A;  1SKT A;  4BY4 A;  2LUC A;  1SL7 A;  4OCI A;  2I94 A;  4AQI A;  3JVT C;  2M0R A;  1V1G A;  1J7Q A;  2L98 A;  1OMD A;  2KDH A;  2AMI A;  3CWG A;  1FI5 A;  1BLQ A;  2K2F A;  1GGW A;  1W7I B;  1RTP 1;  3WHU B;  1CDM A;  2OS8 B;  5DKQ A;  1QIV A;  1YRT B;  3ICB A;  1CFD A;  1J7R A;  1JUO A;  1SR6 B;  5ER5 A;  4GGF A;  5D3O A;  4N1F A;  1HT9 A;  3EVU A;  5HL1 A;  2Q91 A;  1EG3 A;  3AKB A;  3BUW B;  2P71 A;  3I5F C;  1OOG A;  2ZND A;  1SY9 A;  1S26 D;  2NLN A;  2MRD A;  3D78 A;  5JJG A;  1RWY A;  1M45 A;  1TCO B;  1DJX A;  3EVV A;  2WND A;  1NUB A;  1CLM A;  1KQM B;  2M29 A;  1CM1 A;  1BF5 A;  3TZ1 A;  1FI6 A;  4C0L A;  1OOH A;  3OB2 B;  4M2Q A;  3BFH A;  5CSI A;  3QRX A;  1NYA A;  1G33 A;  2K7C A;  3HX4 A;  1SCV A;  3I5I B;  1QLK A;  3BXK A;  2KI4 C;  3NXA A;  2L0P A;  3CR2 A;  1YVL A;  4GPL B;  1ZOT B;  3FS7 A;  1PSR A;  3D73 A;  1QWV A;  1BMO A;  1SBJ A;  1DMO A;  1W9Z A;  2L2C A;  2VRG A;  3OGN A;  1VRK A;  4MRY A;  4PE4 A;  1JBA A;  3B7A A;  1MQ1 A;  1FW4 A;  2D8N A;  2M1U A;  3B86 A;  4HRG A;  5FI7 A;  1JC2 A;  2WCE A;  1LA0 A;  1F55 A;  1B8L A;  5D69 A;  1IIO A;  1YTZ C;  2BKH B;  1A4P A;  1OMR A;  2KQ6 A;  1TOP A;  3N7H A;  4FQO A;  4Q04 A;  1NCZ A;  4MZJ A;  2WOR A;  3NHI A;  1G8I A;  1DQE A;  1L7Z A;  3LCP C;  3PAT A;  3R1O A;  4OZD A;  2LCP A;  4XYN A;  3B6X A;  1XA5 A;  3K21 A;  3A8R A;  1DEK A;  1B8C A;  2KHN A;  1BT6 A;  3O78 A;  2LHL A;  2EGD A;  1K90 D;  2KFH A;  1CLL A;  2BEC A;  1AP4 A;  2KAX A;  3CZ0 A;  2F8P A;  2QEO A;  5DKN A;  2KLD A;  4GGF C;  1QV1 A;  4ORA B;  3BUN B;  3SG3 A;  2TN4 A;  1DVI A;  3IQO A;  1TNP A;  3NSK A;  3FE9 A;  3L4L A;  1OMV A;  1SNL A;  5D7F A;  1F8H A;  1XFW O;  3OP0 A;  2LVV A;  2JT3 A;  3FWB A;  3AKA A;  3OX6 A;  1CM4 A;  1BU3 A;  2NCO A;  1B9A A;  3CAB A;  5CSF A;  2AAO A;  1B1G A;  1BOC A;  3BFB A;  3VRQ A;  3RLZ A;  1XO5 A;  5GQQ C;  1XK4 A;  4INW A;  1DF0 B;  3TDI A;  1S5G Z;  1FF1 A;  1WRL A;  4R1E A;  3DF0 B;  3O2P A;  4ORB B;  1KWO C;  1OZO A;  3IQQ A;  2HPS A;  1WY9 A;  1IGV A;  3B87 A;  4YGD B;  2IS9 A;  1DGV A;  3E3R A;  1UHK A;  3ZWH A;  4YRU A;  1W7J B;  1CLB A;  1TRF A;  2LP3 A;  1H4B A;  3NGV A;  4FTG A;  1QX2 A;  1WLZ A;  3I5G C;  1TNQ A;  1KQV A;  1BR1 B;  3HCM A;  3SG5 A;  1YX8 A;  3KEV A;  4NQG A;  4YI8 A;  1KFX S;  1SRA A;  2BCA A;  2JPO A;  2I7A A;  2Y1N A;  2YGU A;  5DKR A;  2ZN8 A;  3JTD C;  3OHM B;  3D74 A;  4A4C A;  1ZUZ A;  1NP8 A;  2JTZ A;  1ORG A;  3UNW A;  4HRH A;  2LLU A;  3TDU A;  1M63 B;  4F0Z B;  1PVA A;  1BOD A;  1K96 A;  1RK9 A;  1S3P A;  5I94 A;  1TUJ A;  2BBN A;  2JUL A;  3KPX A;  3O4Y A;  1F71 A;  1K93 D;  1F4O A;  3BFA A;  1SW8 A;  1Y0V H;  3GK1 A;  1LS8 A;  4YGA A;  4P2Y B;  3VGO A;  1DJH A;  1MHO A;  3D75 A;  3IVT A;  3LLE A;  1NCX A;  2L4I A;  3H4S E;  1YX7 A;  2H8V A;  4E68 A;  1N0Y A;  2OS8 C;  1QAS A;  1DJZ A;  2HQ8 A;  2WC5 A;  2WCM A;  4FQT A;  2JU0 A;  4JD9 A;  4USL A;  4WRI A;  2MBX A;  3WHT B;  1KK8 B;  1MXE A;  1NX3 A;  1SR6 C;  4AOM A;  3VRP A;  3M0W A;  3Q8I A;  1E8A A;  2JPT A;  1Y1X A;  2I2R E;  1WRZ A; 
#chains in the Genus database with same CATH homology
 3PN7 B;  1PVB A;  3KO0 A;  1C07 A;  2OPO A;  1R6P A;  4DIR A;  1S36 A;  4GBA A;  3CZT X;  2JC2 A;  4ORC B;  1M46 A;  5HKZ A;  3RM1 A;  1XFV O;  1AUI B;  1XK4 C;  1BG1 A;  3SG2 A;  5KSZ A;  2NCP A;  1KQM C;  4OKH A;  2KFF A;  2L4H A;  3DF0 A;  3KF9 A;  4DCK A;  1LXF C;  2P6B B;  1DTL A;  4JPZ B;  4ZCU A;  2BKI B;  5AXI A;  1S6I A;  4JWQ A;  3BUO B;  1S6C A;  3I5I C;  3VRN A;  4XJK A;  3CR5 X;  4GNK B;  2L5X B;  2CNP A;  4HSZ A;  3MSE B;  2HET A;  2LMT A;  3AAJ A;  1YUR A;  1IJ5 A;  3C1V A;  4GGN A;  3VRR A;  2KYC A;  2OTG B;  1JF0 A;  4L9M A;  2HQW A;  1ZMZ A;  1HQV A;  1K9U A;  2BL0 B;  4PHK A;  1S5G Y;  3EK8 A;  2MHH A;  2O5G A;  3EKJ A;  4QJ5 B;  1ZFS A;  1N2D A;  1QXP A;  2KBM A;  3LK1 A;  3SG4 A;  4MLW A;  1KFU S;  4ZCV A;  2KOT A;  3KHE A;  1B4C A;  2CCM A;  1Y1U A;  1J7O A;  1OZS A;  3TUY B;  2K61 A;  4CID A;  1J7P A;  2HF5 A;  2JTT A;  2ZKM X;  1LIN A;  5B8I B;  2H2K A;  1F4Q A;  1QX7 A;  2EC6 B;  1RRO A;  4PDZ A;  1L2O B;  3NSI A;  1YRU B;  1ALW A;  1DJG A;  5HKY A;  2LVI A;  2A4J A;  1UHH A;  5ER4 X;  1PRW A;  2K7O A;  5PAL A;  1OSA A;  4PHJ A;  1GGZ A;  3DVJ A;  2JT0 A;  1A03 A;  4C0J A;  1OQP A;  1YUT A;  3EVR A;  1IWQ A;  3PM8 A;  2FCD A;  3BOW B;  1TN4 A;  1NPQ A;  2BBM A;  2K0J A;  4YGC B;  1MXL C;  2KYF A;  1N65 A;  5IBW A;  1NX0 A;  1S6J A;  2H61 A;  2KI4 B;  4YGB B;  1Y1A A;  1UUS A;  3EK4 A;  1K9P A;  1UHJ A;  2M1K B;  2K7B A;  1IQ3 A;  1RJV A;  3OB1 B;  4OR9 B;  4I5N B;  1KFX L;  4QJ4 B;  4AQJ A;  2LC5 A;  2LAP A;  1CNP A;  2KNE A;  1A2X A;  1QS7 A;  2NXQ A;  2ISD A;  1KSM A;  2I18 A;  4HRE E;  4PE1 A;  4CFQ A;  2JXL A;  1X02 A;  1FBV A;  5KU1 A;  1AK8 A;  4GFT A;  3TS5 B;  5I2Q A;  1QVI Z;  2Y5I A;  2PAS A;  5AEQ A;  3TDZ A;  5HYD A;  2JXC A;  1IQ5 A;  1KSO A;  1CFP A;  2E30 A;  2F2P A;  2QPT A;  4DS7 A;  1QIW A;  3I5H B;  4GUK A;  2PMY A;  5HLV A;  1CMG A;  1XFY O;  1QX5 B;  3EKH A;  1WDC B;  4I5J A;  1SL8 A;  1XFX O;  2COL B;  3BQ3 A;  1JF2 A;  1M39 A;  1SMG A;  1AVS A;  1DT7 B;  2L2E A;  1NCY A;  4GAO A;  1MF8 B;  1KK8 C;  2JNF A;  3GK4 X;  2LHI A;  1CKK A;  1KK7 Z;  1J55 A;  2KFG A;  4PAL A;  1K2H A;  4YBH B;  3SG7 A;  3PAL A;  1C7W A;  2LAN A;  2WCF A;  1YUS A;  2GGM A;  1TIZ A;  2CXJ A;  2RGI A;  4NDB A;  1JSA A;  1IG5 A;  1K9K A;  2M49 B;  3LL8 B;  1UHN A;  1OOJ A;  3PFV A;  4A4B A;  4YI9 A;  3DVK A;  4U8D A;  1AJ4 A;  1BJF A;  5AER A;  5JOL A;  2KQY A;  3DVM A;  2M8U A;  3BOW A;  4PHN A;  1IRJ A;  2LP2 A;  1UHI A;  1ZAC A;  1SCM B;  5I2L A;  1DJY A;  2KI6 C;  1XFU O;  3DD4 A;  2H61 C;  1AHR A;  1AJ5 A;  2ZFD A;  1CTR A;  3SIA A;  2LV7 A;  2JOJ A;  5G08 A;  2KI6 D;  4PCW A;  2FJU B;  2PSR A;  5AAN A;  4ETO A;  1F70 A;  5AFP A;  1TCF A;  1K95 A;  2K8M B;  2Y1M A;  5J3X A;  1UP5 A;  4NDC A;  1QJT A;  3GOF A;  1NIW A;  2KAY A;  1SK6 D;  3O6B A;  1DF0 A;  3JTD B;  2OTG C;  2LMU A;  1B7T Y;  2G2B A;  4UPG A;  4PE7 A;  4OVN F;  5HKW A;  1SYM A;  1WRK A;  1IH0 A;  1MR8 A;  5I2O A;  2MLF C;  1EG4 A;  1G4Y R;  1K94 A;  2BL0 C;  2M9G A;  1BR4 B;  1XVJ A;  1YUU A;  2MLE C;  2BE6 A;  2JNX A;  1CDP A;  2CTN A;  3NSL A;  1PSB A;  5K89 A;  3WNX B;  2F2O A;  5FYX A;  4MSP A;  4YGE B;  1KFU L;  1JFK A;  2LVK A;  1YR5 A;  3CR4 X;  3OX5 A;  3CTN A;  4MZK A;  3TUY C;  4MZL A;  2LM5 A;  2PVB A;  2JZI A;  1EL4 A;  2E6W A;  4DRW A;  2Q4U A;  1SPY A;  2EC6 C;  1M31 A;  4JQ0 D;  1L2O C;  2F33 A;  1UUR A;  2JWW A;  1TTX A;  3AAK A;  1A75 B;  1QVI Y;  3BYA A;  3JVT B;  4N5X A;  1CB1 A;  2B1U A;  1GJY A;  3IF7 A;  2MAZ A;  1UWO A;  4C0K A;  1TNW A;  5HLO A;  2L51 A;  1PUL A;  1U5I B;  2FCE A;  3D10 A;  3CGA A;  3LK0 A;  2LLT A;  1IKU A;  2SCP A;  3BUM B;  2CT9 A;  4MN0 A;  5CSJ A;  3I5F B;  2KSP A;  4MVF A;  1B7T Z;  2K7D A;  4I5L B;  1KK7 Y;  4WQ3 A;  3CS1 A;  3DVE A;  2GGZ A;  3A4U B;  4MBE A;  2M97 A;  1KCY A;  1B47 A;  1CDN A;  1REC A;  4ICB A;  1ODB A;  3TS5 C;  1MUX A;  2KGB C;  4OV2 A;  1FPW A;  2F3Y A;  2MA2 A;  5I8N A;  1TNX A;  1RFJ A;  3D0Y B;  2BE4 A;  3I5H C;  2LVJ A;  1DJI A;  3SIB A;  1EJ3 A;  2PRU A;  2DOQ A;  4D1E A;  1WDC C;  1YVH A;  1Q80 A;  2ZRS A;  3EK7 A;  2LUX A;  4PHM A;  2WCB A;  3SG6 A;  2LE9 B;  1NX1 A;  3VRO A;  2M7N A;  2O60 A;  2G9B A;  2LLS A;  4TNC A;  1MWN A;  5CPV A;  1XYD A;  1XFZ O;  4M2O A;  5KTY A;  4N1G A;  1JWD A;  1F54 A;  2WOS A;  1R2U A;  1J1D A;  1A75 A;  2BCB A;  4MEW A;  3FWC A;  1D1O A;  2BCX A;  1C7V A;  1JFJ A;  3SJS A;  1QTX A;  1QV0 A;  2JQ6 A;  3CLN A;  1NX2 A;  2ZNE A;  1LVC D;  1U5I A;  4DUQ A;  1A29 A;  1SCM C;  2QAC A;  1J1E A;  3PN7 C;  2KAV A;  2R2I A;  3NSO A;  1WLM A;  4M2P A;  4XJK B;  2LMV A;  1IJ6 A;  1H8B A;  2NZ0 A;  2SAS A;  3GK2 A;  2WC8 A;  4QJ3 B;  5CSN A;  1EXR A;  3BUX B;  3WXA A;  2M3W A;  2M7L A;  2PAL A;  4CFR A;  1CFF A;  3ZNI A;  1ALV A;  1PK0 D;  3PLF B;  3FIA A;  2ZRT A;  1LKJ A;  1KWO B;  2CBL A;  4IL1 A;  4PE0 A;  2EHB A;  2LNK A;  4CLN A;  4P5O E;  1CFC A;  2ZN9 A;  1PAL A;  4MRX A;  2V53 A;  3D0Y A;  1S1E A;  4I5K A;  1QAT A;  1NSH A;  3I5G B;  1SL9 A;  4CPV A;  1OE9 B;  5BPJ A;  2KBI A;  1B8R A;  1QLS A;  5F6T A;  1LA3 A;  1EH2 A;  1V1F A;  4NDD A;  2AUC A;  1NWD A;  3PSR A;  1DJW A;  4WQ2 A;  2L50 A;  2FOT A;  2JRF A;  3F45 A;  2K2A A;  2Y4Q A;  1CDL A;  2JT8 A;  4BY5 A;  1Y6W A;  1DGU A;  2F3Z A;  5TNC A;  1CMF A;  1GQM A;  1K8U A;  2MJW B;  2KGR A;  2GV5 A;  1SKT A;  4BY4 A;  2LUC A;  1SL7 A;  4OCI A;  2I94 A;  4AQI A;  3JVT C;  2M0R A;  1V1G A;  1J7Q A;  2L98 A;  1OMD A;  2KDH A;  2AMI A;  3CWG A;  1BLQ A;  2K2F A;  1GGW A;  1W7I B;  1RTP 1;  3WHU B;  1CDM A;  2OS8 B;  5DKQ A;  1QIV A;  1YRT B;  3ICB A;  1CFD A;  1J7R A;  1JUO A;  1SR6 B;  5ER5 A;  4GGF A;  4N1F A;  1HT9 A;  3EVU A;  2Q91 A;  1EG3 A;  3AKB A;  3BUW B;  3I5F C;  2ZND A;  1SY9 A;  1S26 D;  2NLN A;  2MRD A;  5JJG A;  1RWY A;  1M45 A;  1TCO B;  1DJX A;  3EVV A;  2WND A;  1NUB A;  1CLM A;  1KQM B;  2M29 A;  1CM1 A;  1BF5 A;  3TZ1 A;  1FI6 A;  4C0L A;  3OB2 B;  4M2Q A;  5CSI A;  3QRX A;  1NYA A;  1G33 A;  2K7C A;  3HX4 A;  1SCV A;  3I5I B;  1QLK A;  3BXK A;  2KI4 C;  3NXA A;  2L0P A;  3CR2 A;  1YVL A;  4GPL B;  1ZOT B;  3FS7 A;  1PSR A;  1BMO A;  1SBJ A;  1DMO A;  2VRG A;  1JBA A;  4MRY A;  4PE4 A;  1VRK A;  1MQ1 A;  1FW4 A;  2D8N A;  2M1U A;  1JC2 A;  4HRG A;  2WCE A;  1LA0 A;  1F55 A;  1B8L A;  5D69 A;  1YTZ C;  2BKH B;  1A4P A;  1OMR A;  2KQ6 A;  1TOP A;  4FQO A;  4Q04 A;  1NCZ A;  4MZJ A;  2WOR A;  1G8I A;  1L7Z A;  3LCP C;  4XYN A;  3PAT A;  2LCP A;  1XA5 A;  3K21 A;  3A8R A;  1B8C A;  2KHN A;  1BT6 A;  3O78 A;  2LHL A;  2EGD A;  1K90 D;  2KFH A;  1CLL A;  2BEC A;  1AP4 A;  2KAX A;  2F8P A;  5DKN A;  4GGF C;  1QV1 A;  4ORA B;  3BUN B;  3SG3 A;  2TN4 A;  1DVI A;  3IQO A;  1TNP A;  3NSK A;  1OMV A;  1SNL A;  5D7F A;  1F8H A;  1XFW O;  3OP0 A;  2LVV A;  2JT3 A;  3FWB A;  3AKA A;  3OX6 A;  1CM4 A;  1BU3 A;  2NCO A;  1B9A A;  5CSF A;  1B1G A;  2AAO A;  1BOC A;  3VRQ A;  3RLZ A;  1XO5 A;  5GQQ C;  1XK4 A;  1DF0 B;  3TDI A;  1S5G Z;  1FF1 A;  1WRL A;  4R1E A;  3DF0 B;  3O2P A;  4ORB B;  1KWO C;  1OZO A;  3IQQ A;  2HPS A;  1WY9 A;  1IGV A;  4YGD B;  2IS9 A;  1DGV A;  3E3R A;  1UHK A;  3ZWH A;  4YRU A;  1W7J B;  1CLB A;  1TRF A;  2LP3 A;  1H4B A;  4FTG A;  1QX2 A;  1WLZ A;  3I5G C;  1TNQ A;  1KQV A;  1BR1 B;  3HCM A;  3SG5 A;  1YX8 A;  3KEV A;  4NQG A;  4YI8 A;  1KFX S;  1SRA A;  2BCA A;  2Y1N A;  2I7A A;  5DKR A;  2ZN8 A;  3JTD C;  3OHM B;  4A4C A;  1ZUZ A;  1NP8 A;  2JTZ A;  4HRH A;  2LLU A;  3TDU A;  1M63 B;  4F0Z B;  1PVA A;  1BOD A;  1K96 A;  1RK9 A;  1S3P A;  2BBN A;  2JUL A;  3KPX A;  3O4Y A;  1F71 A;  1K93 D;  1F4O A;  1SW8 A;  1Y0V H;  3GK1 A;  4YGA A;  4P2Y B;  3VGO A;  1DJH A;  1MHO A;  3LLE A;  1NCX A;  2L4I A;  3H4S E;  1YX7 A;  4E68 A;  1N0Y A;  2OS8 C;  1QAS A;  1DJZ A;  2HQ8 A;  2MBX A;  4WRI A;  1FI5 A;  2JU0 A;  4USL A;  3WHT B;  1KK8 B;  1MXE A;  1NX3 A;  1SR6 C;  4AOM A;  3VRP A;  3M0W A;  1E8A A;  2JPT A;  1Y1X A;  2I2R E;  1WRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...