4M2OA

Crystal structure of a non-myristoylated c39a recoverin mutant with one calcium ion bound to ef-hand 3
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
191
structure length
191
Chain Sequence
b'GALSKEILEELQLNTKFTEEELSSWYQSFLKEAPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recoverin
publication title A Highly Conserved Cysteine of Neuronal Calcium-sensing Proteins Controls Cooperative Binding of Ca2+ to Recoverin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 78
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2oA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2oA01
2KQYA 1S5GY 1CMGA 3EK8A 3KPXA 1H8BA 1CMFA 5CSFA 2O5GA 1TCOB 1QIVA 1CDPA 3WHUB 1SRAA 2ZN9A 4MN0A 1RFJA 1SPYA 1B7TZ 2K0JA 3TDZA 1CFCA 2E6WA 1F55A 2HF5A 1J1DA 1YR5A 2I7AA 1YUSA 1BT6A 4HSZA 2MAZA 2PSRA 3SG6A 1FBVA 5I2OA 2K8MB 1WRLA 3NXAA 1KWOC 1MUXA 2LAPA 1S3PA 4C0LA 2Y1MA 2JT8A 1OSAA 2HQWA 5BPJA 1TIZA 1SL7A 2KDHA 2LC5A 2K7OA 1GGWA 5JJGA 3I5FC 1PRWA 1J7RA 2JC2A 5J3XA 4YGBB 5ER4X 4QJ4B 3DD4A 3RM1A 1K9KA 2KBMA 4DRWA 2WC8A 4CLNA 2NCOA 1Y6WA 3HX4A 2JXLA 3EK7A 1NX3A 1SKTA 1G33A 1JFJA 1F70A 2JT0A 1B8RA 2LM5A 1KQVA 1CDLA 1J1EA 2KHNA 2WNDA 4GBAA 2OTGC 2ZFDA 1R2UA 2GGZA 1XYDA 2SCPA 4M2OA 3FWBA 4NDBA 2AUCA 1NSHA 1SYMA 2BECA 3FWCA 4GFTA 5I2QA 5DKNA 1QATA 4OCIA 2JU0A 2FOTA 2KBIA 1S26D 1X02A 1UP5A 5GQQC 5KU1A 2MA2A 1NX2A 2PVBA 1KFXL 1BMOA 3F45A 5DKQA 1BF5A 1DJIA 1LINA 1SL8A 1K90D 2CXJA 2M7LA 1BR1B 1M31A 3TUYB 2L2EA 3JVTB 3BUOB 4YGCB 2NXQA 4GNKB 1J7PA 1LXFC 2F2OA 2KGRA 1CM1A 3PN7C 1QX5B 2LUCA 5HKWA 1NP8A 4N1GA 4MZKA 1G8IA 1S36A 2K7DA 5CSIA 2ZNEA 3I5GB 1IG5A 2M29A 1PULA 4ICBA 3EKHA 2KNEA 1TRFA 1IQ3A 1KQMC 1S5GZ 1CLBA 1XFXO 1KK8C 2OPOA 3OP0A 1MWNA 2LP3A 1JFKA 1QIWA 1F8HA 5FYXA 2EC6B 2Q91A 1BODA 3WXAA 4USLA 2F8PA 2AAOA 2K7CA 1C7VA 1WY9A 3ZNIA 2KQ6A 2O60A 1FW4A 3TS5B 2M0RA 2L4IA 1CLMA 2WCFA 5G08A 5AANA 4FQOA 3CR4X 1L2OC 2M8UA 1DVIA 2LNKA 4MRXA 3VGOA 4PE4A 1OZOA 4GAOA 4GUKA 2KFFA 3TZ1A 1YTZC 1IKUA 4A4CA 1SCMC 4MSPA 1DGUA 1AUIB 4PE1A 4ORCB 1WLZA 3E3RA 1QV1A 2KI4C 3BOWA 1IGVA 1MHOA 1WDCB 1RECA 4YI8A 1GGZA 1FI6A 3EKJA 3NSKA 1SR6B 1YUUA 3OB2B 1EG4A 2CBLA 1N2DA 1F54A 1KSMA 4ZCVA 1K8UA 1MF8B 1KFUL 1EJ3A 1ALVA 2HPSA 3BUNB 1F4OA 1CFDA 4E68A 1KSOA 1DMOA 2JZIA 3VRNA 1BLQA 1YX8A 5CPVA 2H61A 2B1UA 1C07A 2JNFA 1NPQA 1ZMZA 2BKHB 1CTRA 1D1OA 1NX1A 1YX7A 3NSIA 1BOCA 1MXLC 2KFGA 4JWQA 3BQ3A 2ISDA 3I5IC 2JULA 2PALA 3GK2A 3KEVA 1U5IA 4DIRA 4AOMA 1XVJA 4A4BA 1M45A 4QJ3B 1K95A 4OKHA 2LMVA 1ALWA 1B8LA 2G9BA 1S1EA 5F6TA 3CS1A 1QLSA 2GGMA 1BR4B 2CT9A 2LHIA 3GOFA 3EVRA 4GGNA 4JPZB 4TNCA 1IRJA 2ZKMX 3I5HB 4N1FA 3TDUA 1NCXA 3H4SE 1UUSA 1F4QA 1QVIY 3GK1A 2JTTA 4DS7A 2AMIA 1BJFA 2LANA 1IWQA 3AAJA 3LCPC 1YVHA 5TNCA 1UHIA 3IQQA 4MRYA 5PALA 4HREE 4PALA 1EG3A 3DF0A 2LV7A 3CR2A 1TNWA 1MQ1A 1OE9B 1A75B 1PSRA 3WHTB 3IF7A 2IS9A 1OMRA 2JNXA 1CNPA 4MZJA 4BY4A 1SBJA 3PATA 1JF2A 1CB1A 1L7ZA 1RTP1 2L4HA 3EVVA 2OS8C 4D1EA 3OX6A 3CGAA 4NQGA 3OHMB 1DJWA 1QLKA 1XFYO 1LKJA 3AKAA 5JOLA 1ZACA 1K94A 3CLNA 2F2PA 4M2PA 3VRRA 1H4BA 3CWGA 3D0YA 4CFRA 1XFWO 2Y1NA 1TNXA 4MVFA 3DVJA 3MSEB 2MBXA 4ORAB 3SIAA 2K2AA 4YBHB 2TN4A 1B9AA 2M1UA 5HLOA 4MEWA 1RROA 1WRZA 1A29A 1Y0VH 2F33A 3KF9A 4CIDA 3EVUA 1YRTB 1HT9A 3OX5A 1JBAA 1LA0A 4QJ5B 5HKZA 2JQ6A 4Q04A 3JTDB 1F71A 1U5IB 1W7IB 2WORA 1K96A 2ZNDA 1ODBA 1QV0A 4YGDB 1BU3A 1NUBA 2ZRTA 4HRGA 4XJKA 4JQ0D 4MZLA 2JOJA 2ZN8A 1CLLA 1HQVA 4PHJA 4YI9A 3LLEA 4GGFC 1K9UA 2PMYA 2A4JA 1YRUB 4YRUA 1J7OA 1OQPA 1AJ4A 5I2LA 3DVEA 1CFPA 2KSPA 2BL0C 2RGIA 1W7JB 1UURA 1UHNA 4OV2A 2GV5A 5B8IB 1DJHA 5AEQA 5AFPA 1TTXA 1AK8A 1JSAA 4BY5A 5HYDA 1TNPA 3AAKA 1QX2A 5DKRA 2NLNA 1CKKA 2LMTA 4AQJA 2K61A 3CR5X 2LLTA 1QVIZ 4PDZA 1KK7Y 1QXPA 1E8AA 2M3WA 2M9GA 2Y5IA 3PFVA 1KWOB 4GGFA 4U8DA 5IBWA 1XFZO 4MLWA 1IH0A 3D0YB 1K93D 3CTNA 3SG7A 1QASA 4CPVA 2MLFC 3CZTX 4R1EA 5CSJA 2M97A 2LVVA 1OZSA 3I5FB 3NSOA 1FF1A 1CFFA 2LHLA 2KFHA 3RLZA 2P6BB 1YURA 3D10A 4ORBB 4PE0A 1IQ5A 1EXRA 1RJVA 2I94A 3O78A 2SASA 1QX7A 3NSLA 4PHMA 4C0JA 1XK4C 2OS8B 2JWWA 2KOTA 3TUYC 3JVTC 3BYAA 2COLB 1UHJA 4L9MA 1C7WA 1IJ5A 2LVIA 2OTGB 4I5LB 1WLMA 1XFUO 3SJSA 2BCXA 2DOQA 3PSRA 4OR9B 3SIBA 1AP4A 3LK1A 5AERA 5ER5A 3ZWHA 2H2KA 1DJZA 1PVAA 1VRKA 2WCBA 1GJYA 4DUQA 3VRQA 1NX0A 1B1GA 1ZUZA 3A8RA 2BE4A 1DJYA 1Q80A 1WRKA 1DT7B 3LL8B 3BUXB 2EC6C 2L5XB 3KO0A 4UPGA 2JTZA 1UHHA 1XK4A 2LVKA 2M7NA 3O2PA 2EGDA 1PALA 3DVKA 3TS5C 1LVCD 1M63B 1NYAA 4WQ3A 1OOJA 2HETA 3IQOA 3PN7B 1NIWA 1SCVA 1SY9A 1M46A 4P5OE 2LCPA 3WNXB 3BXKA 1K9PA 4GPLB 1S6JA 4PCWA 1XFVO 1YUTA 2FCDA 1V1FA 1S6IA 3C1VA 1JUOA 1KQMB 5KTYA 4WQ2A 1FI5A 1KK8B 4DCKA 1AHRA 3BOWB 3TDIA 1RWYA 3O4YA 2BL0B 2FJUB 1MXEA 4PHKA 1WDCC 1IJ6A 2LVJA 3SG3A 1Y1XA 1SR6C 1AVSA 2MHHA 2WOSA 1S6CA 1DJGA 1UWOA 4NDCA 2VRGA 2V53A 2EHBA 2KI6C 3OB1B 4I5JA 4N5XA 5KSZA 1Y1UA 2LE9B 2JRFA 1N0YA 2L0PA 3SG5A 1J7QA 1KK7Z 1L2OB 2R2IA 4YGAA 1KFXS 2PRUA 1GQMA 1XA5A 1PVBA 4FTGA 4M2QA 2BBMA 2NZ0A 2BCAA 2KAYA 3GK4X 2BE6A 1G4YR 2LMUA 4CFQA 1JF0A 1OMVA 1SCMB 3ICBA 4PE7A 5D69A 4F0ZB 2BCBA 2KI4B 5HKYA 1OMDA 2K2FA 4I5NB 2M1KB 3VROA 1NWDA 1DJXA 1QTXA 2JT3A 2CTNA 4C0KA 1B7TY 2E30A 1FPWA 3BUMB 2QPTA 3K21A 3I5HC 2BKIB 5I8NA 1DF0A 1V1GA 1DGVA 2CCMA 2JPTA 1PSBA 2I2RE 1NCZA 1A2XA 5HLVA 3O6BA 4ETOA 4XYNA 4PHNA 1Y1AA 2L50A 1SMGA 1SK6D 2G2BA 1B8CA 1CM4A 2KAVA 3DF0B 2KYCA 1JC2A 1EH2A 1JWDA 1ZFSA 5K89A 2K7BA 3I5IB 2MLEC 3M0WA 1YVLA 2Y4QA 3SG4A 1N65A 4NDDA 1LA3A 1B4CA 2F3YA 2Q4UA 3FS7A 3VRPA 1SNLA 2CNPA 2KGBC 3SG2A 2WCEA 2LLSA 1M39A 2MJWB 2LLUA 1PK0D 4AQIA 3AKBA 2D8NA 1QS7A 2LP2A 1RK9A 3FIAA 4MBEA 1ZOTB 4IL1A 4I5KA 2LUXA 1CDMA 1AJ5A 2F3ZA 3HCMA 2KAXA 1KFUS 1TNQA 1A75A 3BUWB 2BBNA 2H61C 5D7FA 3PM8A 4P2YB 1TN4A 1R6PA 5AXIA 1A03A 1QJTA 2ZRSA 3PALA 5CSNA 1EL4A 2M49B 2KYFA 1K2HA 3JTDC 2JXCA 1SL9A 2L98A 2NCPA 3LK0A 1TOPA 3PLFB 1DTLA 4YGEB 4HRHA 4ZCUA 2QACA 2I18A 3EK4A 2HQ8A 1SW8A 1J55A 3A4UB 1B47A 4XJKB 1MR8A 3I5GC 2KI6D 1XO5A 1TCFA 2MRDA 1UHKA 3DVMA 1BG1A 1NCYA 3KHEA 2FCEA 3QRXA 1CDNA 1DF0B 1KCYA 2L51A 1A4PA 4WRIA 4OVNF 2PASA
chains in the Genus database with same CATH superfamily
2KQYA 1S5GY 1CMGA 3EK8A 3KPXA 1H8BA 5EL2A 1CMFA 5CSFA 2O5GA 1TCOB 1QIVA 3O4XA 1CDPA 3WHUB 1SRAA 2ZN9A 4F7FA 4MN0A 1RFJA 1SPYA 1B7TZ 2K0JA 3TDZA 1CFCA 2E6WA 1F55A 1T14A 1J1DA 1YR5A 2HF5A 3FE8A 2I7AA 1YUSA 1BT6A 4HSZA 2MAZA 2PSRA 3SG6A 1FBVA 5I2OA 2K8MB 1WRLA 3R72A 3NXAA 1KWOC 1MUXA 2LAPA 1S3PA 4C0LA 2Y1MA 2JT8A 1OSAA 2HQWA 5BPJA 1TIZA 2WC6A 1IIOA 3S0FA 1SL7A 2KDHA 2LC5A 2K7OA 3NHTA 1GGWA 5JJGA 4FQTA 3I5FC 1PRWA 1J7RA 2JC2A 5J3XA 4YGBB 5ER4X 4QJ4B 3DD4A 3RM1A 1K9KA 2KBMA 4DRWA 2WC8A 4CLNA 4JKTA 2NCOA 1Y6WA 3HX4A 2JXLA 3EK7A 1NX3A 1SKTA 1G33A 1JFJA 1F70A 2JT0A 1B8RA 2KLDA 2LM5A 1KQVA 1CDLA 1J1EA 2KHNA 2QEOA 2WNDA 4GBAA 2OTGC 2ZFDA 1R2UA 2GGZA 1XYDA 2SCPA 4M2OA 3FWBA 4NDBA 2AUCA 1NSHA 1SYMA 3UO9A 2BECA 1TWOA 3FWCA 4GFTA 5DKNA 5I2QA 1QATA 4OCIA 2JU0A 2FOTA 2KBIA 1S26D 1X02A 1UP5A 5GQQC 5KU1A 2MA2A 1NX2A 2PVBA 1KFXL 1BMOA 3F45A 5DKQA 3FE6A 1BF5A 1DJIA 1LINA 1SL8A 1K90D 2CXJA 2M7LA 1BR1B 1M31A 3TUYB 2L2EA 3JVTB 3BUOB 4YGCB 2NXQA 4GNKB 1J7PA 1LXFC 2F2OA 2KGRA 1CM1A 3PN7C 1QX5B 2LUCA 5HKWA 1NP8A 4N1GA 4MZKA 1G8IA 1S36A 2K7DA 5CSIA 2ZNEA 3I5GB 1IG5A 2M29A 1PULA 4ICBA 3DY9A 3EKHA 2KNEA 1TRFA 3R1VA 1KQMC 1S5GZ 1IQ3A 1XFXO 1KK8C 1DELA 1CLBA 2OPOA 3OP0A 1MWNA 2LP3A 1JFKA 1QIWA 1F8HA 3L4AA 5FYXA 2EC6B 2Q91A 1BODA 3WXAA 4USLA 2F8PA 2AAOA 2K7CA 1C7VA 1WY9A 3ZNIA 2KQ6A 1P28A 2O60A 1FW4A 3TS5B 2M0RA 2L4IA 1CLMA 2WCFA 5G08A 5AANA 4FQOA 2JPOA 3CR4X 3SS4A 1L2OC 2M8UA 1DVIA 2LNKA 4MRXA 3VGOA 4PE4A 1OZOA 4GAOA 4GUKA 2KFFA 3TZ1A 1YTZC 3OGNA 1IKUA 4A4CA 1SCMC 4MSPA 1DGUA 1AUIB 3NHIA 4PE1A 4ORCB 1WLZA 3E3RA 1QV1A 2KI4C 3BOWA 1IGVA 1MHOA 3CZ2A 1WDCB 1RECA 2KPHA 4YI8A 1GGZA 1FI6A 3EKJA 3CABA 3NSKA 1SR6B 1YUUA 3QMEA 3OB2B 1EG4A 2CBLA 2K60A 4INXA 1N2DA 1F54A 1KSMA 4ZCVA 1K8UA 1MF8B 1KFUL 2WCKA 1EJ3A 1ALVA 2HPSA 3BUNB 1F4OA 1CFDA 4E68A 1KSOA 1DMOA 2JZIA 3VRNA 1BLQA 2PYQA 2WC5A 1YX8A 2WCMA 2H61A 2B1UA 5CPVA 1C07A 2JNFA 1NPQA 1ZMZA 2BKHB 1CTRA 1D1OA 1NX1A 1YX7A 3NSIA 1BOCA 1MXLC 2KFGA 4JWQA 3BQ3A 3V2LA 2ISDA 3I5IC 2JULA 2PALA 3GK2A 3KEVA 1U5IA 4DIRA 4AOMA 4KYNA 1XVJA 4A4BA 1M45A 4QJ3B 1K95A 2L5YA 4INWA 4OKHA 2LMVA 1ALWA 1B8LA 2G9BA 3B86A 1S1EA 5F6TA 3BFAA 3CS1A 1QLSA 2GGMA 1BR4B 2CT9A 2LHIA 3GOFA 3EVRA 4GGNA 4JPZB 4TNCA 1IRJA 2ZKMX 3I5HB 4N1FA 3L47A 1NCXA 3H4SE 3TDUA 1UUSA 1OW4A 1F4QA 1QVIY 3GK1A 2JTTA 4DS7A 2AMIA 1DQEA 1BJFA 2LANA 1IWQA 3AAJA 3LCPC 1YVHA 5TNCA 1UHIA 3IQQA 4MRYA 5PALA 4HREE 4PALA 1EG3A 3DF0A 2LV7A 3CR2A 1TNWA 1MQ1A 3L4LA 1OE9B 1ORGA 1A75B 1PSRA 3WHTB 3IF7A 2IS9A 1OMRA 2JNXA 1CNPA 4MZJA 4BY4A 1TUJA 1SBJA 3PATA 1JF2A 1CB1A 3FE9A 1L7ZA 1RTP1 2L4HA 3EVVA 2OS8C 4D1EA 1C3YA 2FJYA 3OX6A 3CGAA 4NQGA 3OHMB 1DJWA 1DEKA 1QLKA 1XFYO 1LKJA 3AKAA 5JOLA 1ZACA 1K94A 3CLNA 2F2PA 4M2PA 3VRRA 1H4BA 3CWGA 3D0YA 4CFRA 1XFWO 2Y1NA 5I94A 1TNXA 4MVFA 3DVJA 3MSEB 2MBXA 4ORAB 3SIAA 2K2AA 4YBHB 2TN4A 1B9AA 2M1UA 5HLOA 4MEWA 3BJHA 1RROA 1WRZA 1A29A 1OOHA 1Y0VH 2F33A 3KF9A 4CIDA 3EVUA 1YRTB 1HT9A 3OX5A 1JBAA 1LA0A 4QJ5B 5HKZA 2JQ6A 4Q04A 3JTDB 3Q8IA 1F71A 1U5IB 1W7IB 2BAPA 2WORA 1K96A 2ZNDA 1ODBA 1QV0A 2P71A 4YGDB 1BU3A 1NUBA 2ZRTA 3D76A 2KLEA 4HRGA 4XJKA 4JQ0D 2WCJA 2JOJA 4MZLA 2ZN8A 1CLLA 1OOFA 1HQVA 4PHJA 4YI9A 5FI7A 3LLEA 4GGFC 1K9UA 2PMYA 2A4JA 1YRUB 4YRUA 3BFBA 3SS5A 1J7OA 1OQPA 1AJ4A 5I2LA 3CZ1A 3DVEA 1CFPA 2KSPA 2BL0C 2RGIA 1W7JB 1UURA 1UHNA 4OV2A 2GV5A 5B8IB 1DJHA 5AEQA 5AFPA 1TTXA 1AK8A 3PM2A 1JSAA 4BY5A 3BFHA 5HYDA 1TNPA 3AAKA 1QX2A 3N7HA 5DKRA 2NLNA 1CKKA 5D3OA 2GTEA 2LMTA 4AQJA 2BNXA 2K61A 3CR5X 2LLTA 1QVIZ 4PDZA 1KK7Y 1QXPA 1E8AA 2M3WA 2M9GA 2Y5IA 3PFVA 1KWOB 4GGFA 4U8DA 2QEVA 5IBWA 1XFZO 4MLWA 4OZDA 1IH0A 3D0YB 1GM0A 1K93D 3CTNA 3SG7A 1QASA 4CPVA 2MLFC 3CDNA 3CZTX 4R1EA 5FI2A 5CSJA 2M97A 1LS8A 2LVVA 1OZSA 3I5FB 3NSOA 1FF1A 1CFFA 2LHLA 4JD9A 2KFHA 3RLZA 2P6BB 1YURA 2L2CA 3D10A 4ORBB 4PE0A 1IQ5A 1EXRA 3D78A 1RJVA 2I94A 3O78A 2SASA 1QX7A 1OOGA 3NSLA 4PHMA 4C0JA 5FI6A 3B88A 1XK4C 2OS8B 2JWWA 2KOTA 3DYEA 3TUYC 3JVTC 3BYAA 3IVTA 2COLB 1UHJA 4L9MA 1C7WA 1IJ5A 2LVIA 5HL1A 2OTGB 4I5LB 1WLMA 1XFUO 3S0BA 3SJSA 4DUQA 3B7AA 2BCXA 2DOQA 3PSRA 4OR9B 3SIBA 1AP4A 3R1PA 3LK1A 5AERA 3DZTA 5ER5A 3ZWHA 2H2KA 1DJZA 1PVAA 1SSEB 1VRKA 1GJYA 2PQLA 2QEBA 2WCBA 3VRQA 1NX0A 1B1GA 1ZUZA 3A8RA 2BE4A 1DJYA 1Q80A 2H8VA 1WRKA 2P70A 1DT7B 3LL8B 3BUXB 2EC6C 2L5XB 1Z2CB 3KO0A 4UPGA 2JTZA 1UHHA 1XK4A 2LVKA 2M7NA 1W9ZA 2EGDA 1PALA 3DVKA 3O2PA 3TS5C 1LVCD 1M63B 1NYAA 2WCHA 4WQ3A 3UNWA 1OOJA 2HETA 3IQOA 3PN7B 1NIWA 1SCVA 1SY9A 1M46A 4P5OE 2LCPA 3WNXB 2QDIA 3BXKA 1K9PA 4GPLB 1S6JA 4PCWA 1XFVO 1YUTA 2FCDA 1V1FA 1S6IA 3C1VA 1JUOA 1KQMB 5KTYA 4WQ2A 1FI5A 1KK8B 4DCKA 1AHRA 3CYZA 3BOWB 3TDIA 1RWYA 3O4YA 2BL0B 2FJUB 1MXEA 4PHKA 3PJIA 1WDCC 1IJ6A 2LVJA 3SG3A 2ERBA 1Y1XA 2QEHA 1SR6C 1AVSA 2MHHA 2WOSA 1S6CA 3S0EA 1DJGA 1UWOA 4NDCA 2VRGA 2V53A 2EHBA 3S0AA 2KI6C 3OB1B 4I5JA 4N5XA 5KSZA 1Y1UA 2LE9B 3SS3A 2JRFA 1N0YA 2L0PA 3SG5A 1J7QA 1KK7Z 1L2OB 1XFRA 2R2IA 4YGAA 1KFXS 2PRUA 1GQMA 1XA5A 1PVBA 2WCLA 3DXLA 2BBMA 4FTGA 1C3ZA 1OOIX 1TUZA 2BCAA 2NZ0A 4M2QA 3D73A 2KAYA 3GK4X 2BE6A 1G4YR 2LMUA 3NGVA 4CFQA 1JF0A 1OMVA 1SCMB 3ICBA 4PE7A 4PT1A 5D69A 5DICA 4F0ZB 2BCBA 2KI4B 5HKYA 1OMDA 2K2FA 4I5NB 2M1KB 3VROA 1NWDA 1DJXA 1QTXA 2JT3A 2CTNA 4C0KA 1B7TY 3B6XA 2E30A 1FPWA 3BUMB 2QPTA 3K21A 3S0DA 3I5HC 2BKIB 5I8NA 1DF0A 1V1GA 1DGVA 2CCMA 2JPTA 1PSBA 3VB1A 2I2RE 1NCZA 2YGUA 1A2XA 5HLVA 3O6BA 4ETOA 4XYNA 4PHNA 1Y1AA 2L50A 1SMGA 1SK6D 2G2BA 1B8CA 1CM4A 2KAVA 3DF0B 2KYCA 1JC2A 1EH2A 1JWDA 1ZFSA 5K89A 2K7BA 3I5IB 2MLEC 3M0WA 1YVLA 2Y4QA 3SG4A 1N65A 4IJ7A 1LA3A 4NDDA 1B4CA 2F3YA 2Q4UA 3FS7A 3VRPA 1SNLA 2CNPA 3D77A 2KGBC 3SG2A 2WCEA 2LLSA 1M39A 2MJWB 2LLUA 1PK0D 4AQIA 3AKBA 2D8NA 3K1EA 1QS7A 2LP2A 1RK9A 3FIAA 4MBEA 1ZOTB 4IL1A 4I5KA 3RZSA 2LUXA 1CDMA 1AJ5A 2F3ZA 1QWVA 3HCMA 2KAXA 1KFUS 1TNQA 1A75A 3BUWB 3D75A 2BBNA 2H61C 5D7FA 3PM8A 4P2YB 1TN4A 1R6PA 1Z4HA 5AXIA 1A03A 1QJTA 2ZRSA 3PALA 5CSNA 1EL4A 2M49B 2KYFA 3B87A 1K2HA 3JTDC 2JXCA 1SL9A 2L98A 2NCPA 3LK0A 1TOPA 3PLFB 1DTLA 4YGEB 4HRHA 4ZCUA 2QACA 2I18A 3EK4A 2HQ8A 1SW8A 3R1OA 1J55A 3A4UB 1B47A 3EG5B 4XJKB 1MR8A 3D74A 3I5GC 2KI6D 1XO5A 3OBVA 3S0GA 1TCFA 2MRDA 1UHKA 3DVMA 1BG1A 1NCYA 3KHEA 3CZ0A 2FCEA 3QRXA 1CDNA 1DF0B 1KCYA 2L51A 1A4PA 1DC1A 4WRIA 4OVNF 2PASA
chains in the Genus database with same CATH topology
2KQYA 1S5GY 1CMGA 3EK8A 3KPXA 1H8BA 1CMFA 5CSFA 2O5GA 1TCOB 1QIVA 1CDPA 3WHUB 1SRAA 2ZN9A 4MN0A 1RFJA 1SPYA 1B7TZ 2K0JA 3TDZA 1CFCA 2E6WA 1F55A 2HF5A 1J1DA 1YR5A 2I7AA 1YUSA 1BT6A 4HSZA 2MAZA 2PSRA 3SG6A 1FBVA 5I2OA 2K8MB 1WRLA 3NXAA 1KWOC 1MUXA 2LAPA 1S3PA 4C0LA 2Y1MA 2JT8A 1OSAA 2HQWA 5BPJA 1TIZA 1SL7A 2KDHA 2LC5A 2K7OA 1GGWA 5JJGA 3I5FC 1PRWA 1J7RA 2JC2A 5J3XA 4YGBB 5ER4X 4QJ4B 3DD4A 3RM1A 1K9KA 2KBMA 4DRWA 2WC8A 4CLNA 2NCOA 1Y6WA 3HX4A 2JXLA 3EK7A 1NX3A 1SKTA 1G33A 1JFJA 1F70A 2JT0A 1B8RA 2LM5A 1KQVA 1CDLA 1J1EA 2KHNA 2WNDA 4GBAA 2OTGC 2ZFDA 1R2UA 2GGZA 1XYDA 2SCPA 4M2OA 3FWBA 4NDBA 2AUCA 1NSHA 1SYMA 2BECA 3FWCA 4GFTA 5I2QA 5DKNA 1QATA 4OCIA 2JU0A 2FOTA 2KBIA 1S26D 1X02A 1UP5A 5GQQC 5KU1A 2MA2A 1NX2A 2PVBA 1KFXL 1BMOA 3F45A 5DKQA 1BF5A 1DJIA 1LINA 1SL8A 1K90D 2CXJA 2M7LA 1BR1B 1M31A 3TUYB 2L2EA 3JVTB 3BUOB 4YGCB 2NXQA 4GNKB 1J7PA 1LXFC 2F2OA 2KGRA 1CM1A 3PN7C 1QX5B 2LUCA 5HKWA 1NP8A 4N1GA 4MZKA 1G8IA 1S36A 2K7DA 5CSIA 2ZNEA 3I5GB 1IG5A 2M29A 1PULA 4ICBA 3EKHA 2KNEA 1TRFA 1IQ3A 1KQMC 1S5GZ 1CLBA 1XFXO 1KK8C 2OPOA 3OP0A 1MWNA 2LP3A 1JFKA 1QIWA 1F8HA 5FYXA 2EC6B 2Q91A 1BODA 3WXAA 4USLA 2F8PA 2AAOA 2K7CA 1C7VA 1WY9A 3ZNIA 2KQ6A 2O60A 1FW4A 3TS5B 2M0RA 2L4IA 1CLMA 2WCFA 5G08A 5AANA 4FQOA 3CR4X 1L2OC 2M8UA 1DVIA 2LNKA 4MRXA 3VGOA 4PE4A 1OZOA 4GAOA 4GUKA 2KFFA 3TZ1A 1YTZC 1IKUA 4A4CA 1SCMC 4MSPA 1DGUA 1AUIB 4PE1A 4ORCB 1WLZA 3E3RA 1QV1A 2KI4C 3BOWA 1IGVA 1MHOA 1WDCB 1RECA 4YI8A 1GGZA 1FI6A 3EKJA 3NSKA 1SR6B 1YUUA 3OB2B 1EG4A 2CBLA 1N2DA 1F54A 1KSMA 4ZCVA 1K8UA 1MF8B 1KFUL 1EJ3A 1ALVA 2HPSA 3BUNB 1F4OA 1CFDA 4E68A 1KSOA 1DMOA 2JZIA 3VRNA 1BLQA 1YX8A 5CPVA 2H61A 2B1UA 1C07A 2JNFA 1NPQA 1ZMZA 2BKHB 1CTRA 1D1OA 1NX1A 1YX7A 3NSIA 1BOCA 1MXLC 2KFGA 4JWQA 3BQ3A 2ISDA 3I5IC 2JULA 2PALA 3GK2A 3KEVA 1U5IA 4DIRA 4AOMA 1XVJA 4A4BA 1M45A 4QJ3B 1K95A 4OKHA 2LMVA 1ALWA 1B8LA 2G9BA 1S1EA 5F6TA 3CS1A 1QLSA 2GGMA 1BR4B 2CT9A 2LHIA 3GOFA 3EVRA 4GGNA 4JPZB 4TNCA 1IRJA 2ZKMX 3I5HB 4N1FA 3TDUA 1NCXA 3H4SE 1UUSA 1F4QA 1QVIY 3GK1A 2JTTA 4DS7A 2AMIA 1BJFA 2LANA 1IWQA 3AAJA 3LCPC 1YVHA 5TNCA 1UHIA 3IQQA 4MRYA 5PALA 4HREE 4PALA 1EG3A 3DF0A 2LV7A 3CR2A 1TNWA 1MQ1A 1OE9B 1A75B 1PSRA 3WHTB 3IF7A 2IS9A 1OMRA 2JNXA 1CNPA 4MZJA 4BY4A 1SBJA 3PATA 1JF2A 1CB1A 1L7ZA 1RTP1 2L4HA 3EVVA 2OS8C 4D1EA 3OX6A 3CGAA 4NQGA 3OHMB 1DJWA 1QLKA 1XFYO 1LKJA 3AKAA 5JOLA 1ZACA 1K94A 3CLNA 2F2PA 4M2PA 3VRRA 1H4BA 3CWGA 3D0YA 4CFRA 1XFWO 2Y1NA 1TNXA 4MVFA 3DVJA 3MSEB 2MBXA 4ORAB 3SIAA 2K2AA 4YBHB 2TN4A 1B9AA 2M1UA 5HLOA 4MEWA 1RROA 1WRZA 1A29A 1Y0VH 2F33A 3KF9A 4CIDA 3EVUA 1YRTB 1HT9A 3OX5A 1JBAA 1LA0A 4QJ5B 5HKZA 2JQ6A 4Q04A 3JTDB 1F71A 1U5IB 1W7IB 2WORA 1K96A 2ZNDA 1ODBA 1QV0A 4YGDB 1BU3A 1NUBA 2ZRTA 4HRGA 4XJKA 4JQ0D 4MZLA 2JOJA 2ZN8A 1CLLA 1HQVA 4PHJA 4YI9A 3LLEA 4GGFC 1K9UA 2PMYA 2A4JA 1YRUB 4YRUA 1J7OA 1OQPA 1AJ4A 5I2LA 3DVEA 1CFPA 2KSPA 2BL0C 2RGIA 1W7JB 1UURA 1UHNA 4OV2A 2GV5A 5B8IB 1DJHA 5AEQA 5AFPA 1TTXA 1AK8A 1JSAA 4BY5A 5HYDA 1TNPA 3AAKA 1QX2A 5DKRA 2NLNA 1CKKA 2LMTA 4AQJA 2K61A 3CR5X 2LLTA 1QVIZ 4PDZA 1KK7Y 1QXPA 1E8AA 2M3WA 2M9GA 2Y5IA 3PFVA 1KWOB 4GGFA 4U8DA 5IBWA 1XFZO 4MLWA 1IH0A 3D0YB 1K93D 3CTNA 3SG7A 1QASA 4CPVA 2MLFC 3CZTX 4R1EA 5CSJA 2M97A 2LVVA 1OZSA 3I5FB 3NSOA 1FF1A 1CFFA 2LHLA 2KFHA 3RLZA 2P6BB 1YURA 3D10A 4ORBB 4PE0A 1IQ5A 1EXRA 1RJVA 2I94A 3O78A 2SASA 1QX7A 3NSLA 4PHMA 4C0JA 1XK4C 2OS8B 2JWWA 2KOTA 3TUYC 3JVTC 3BYAA 2COLB 1UHJA 4L9MA 1C7WA 1IJ5A 2LVIA 2OTGB 4I5LB 1WLMA 1XFUO 3SJSA 2BCXA 2DOQA 3PSRA 4OR9B 3SIBA 1AP4A 3LK1A 5AERA 5ER5A 3ZWHA 2H2KA 1DJZA 1PVAA 1VRKA 2WCBA 1GJYA 4DUQA 3VRQA 1NX0A 1B1GA 1ZUZA 3A8RA 2BE4A 1DJYA 1Q80A 1WRKA 1DT7B 3LL8B 3BUXB 2EC6C 2L5XB 3KO0A 4UPGA 2JTZA 1UHHA 1XK4A 2LVKA 2M7NA 3O2PA 2EGDA 1PALA 3DVKA 3TS5C 1LVCD 1M63B 1NYAA 4WQ3A 1OOJA 2HETA 3IQOA 3PN7B 1NIWA 1SCVA 1SY9A 1M46A 4P5OE 2LCPA 3WNXB 3BXKA 1K9PA 4GPLB 1S6JA 4PCWA 1XFVO 1YUTA 2FCDA 1V1FA 1S6IA 3C1VA 1JUOA 1KQMB 5KTYA 4WQ2A 1FI5A 1KK8B 4DCKA 1AHRA 3BOWB 3TDIA 1RWYA 3O4YA 2BL0B 2FJUB 1MXEA 4PHKA 1WDCC 1IJ6A 2LVJA 3SG3A 1Y1XA 1SR6C 1AVSA 2MHHA 2WOSA 1S6CA 1DJGA 1UWOA 4NDCA 2VRGA 2V53A 2EHBA 2KI6C 3OB1B 4I5JA 4N5XA 5KSZA 1Y1UA 2LE9B 2JRFA 1N0YA 2L0PA 3SG5A 1J7QA 1KK7Z 1L2OB 2R2IA 4YGAA 1KFXS 2PRUA 1GQMA 1XA5A 1PVBA 4FTGA 4M2QA 2BBMA 2NZ0A 2BCAA 2KAYA 3GK4X 2BE6A 1G4YR 2LMUA 4CFQA 1JF0A 1OMVA 1SCMB 3ICBA 4PE7A 5D69A 4F0ZB 2BCBA 2KI4B 5HKYA 1OMDA 2K2FA 4I5NB 2M1KB 3VROA 1NWDA 1DJXA 1QTXA 2JT3A 2CTNA 4C0KA 1B7TY 2E30A 1FPWA 3BUMB 2QPTA 3K21A 3I5HC 2BKIB 5I8NA 1DF0A 1V1GA 1DGVA 2CCMA 2JPTA 1PSBA 2I2RE 1NCZA 1A2XA 5HLVA 3O6BA 4ETOA 4XYNA 4PHNA 1Y1AA 2L50A 1SMGA 1SK6D 2G2BA 1B8CA 1CM4A 2KAVA 3DF0B 2KYCA 1JC2A 1EH2A 1JWDA 1ZFSA 5K89A 2K7BA 3I5IB 2MLEC 3M0WA 1YVLA 2Y4QA 3SG4A 1N65A 4NDDA 1LA3A 1B4CA 2F3YA 2Q4UA 3FS7A 3VRPA 1SNLA 2CNPA 2KGBC 3SG2A 2WCEA 2LLSA 1M39A 2MJWB 2LLUA 1PK0D 4AQIA 3AKBA 2D8NA 1QS7A 2LP2A 1RK9A 3FIAA 4MBEA 1ZOTB 4IL1A 4I5KA 2LUXA 1CDMA 1AJ5A 2F3ZA 3HCMA 2KAXA 1KFUS 1TNQA 1A75A 3BUWB 2BBNA 2H61C 5D7FA 3PM8A 4P2YB 1TN4A 1R6PA 5AXIA 1A03A 1QJTA 2ZRSA 3PALA 5CSNA 1EL4A 2M49B 2KYFA 1K2HA 3JTDC 2JXCA 1SL9A 2L98A 2NCPA 3LK0A 1TOPA 3PLFB 1DTLA 4YGEB 4HRHA 4ZCUA 2QACA 2I18A 3EK4A 2HQ8A 1SW8A 1J55A 3A4UB 1B47A 4XJKB 1MR8A 3I5GC 2KI6D 1XO5A 1TCFA 2MRDA 1UHKA 3DVMA 1BG1A 1NCYA 3KHEA 2FCEA 3QRXA 1CDNA 1DF0B 1KCYA 2L51A 1A4PA 4WRIA 4OVNF 2PASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQY A;  1S5G Y;  1CMG A;  3EK8 A;  3KPX A;  1H8B A;  1CMF A;  5CSF A;  2O5G A;  1TCO B;  1QIV A;  1CDP A;  3WHU B;  1SRA A;  2ZN9 A;  4MN0 A;  1RFJ A;  1SPY A;  1B7T Z;  2K0J A;  3TDZ A;  1CFC A;  2E6W A;  1F55 A;  2HF5 A;  1J1D A;  1YR5 A;  2I7A A;  1YUS A;  1BT6 A;  4HSZ A;  2MAZ A;  2PSR A;  3SG6 A;  1FBV A;  5I2O A;  2K8M B;  1WRL A;  3NXA A;  1KWO C;  1MUX A;  2LAP A;  1S3P A;  4C0L A;  2Y1M A;  2JT8 A;  1OSA A;  2HQW A;  5BPJ A;  1TIZ A;  1SL7 A;  2KDH A;  2LC5 A;  2K7O A;  1GGW A;  5JJG A;  3I5F C;  1PRW A;  1J7R A;  2JC2 A;  5J3X A;  4YGB B;  5ER4 X;  4QJ4 B;  3DD4 A;  3RM1 A;  1K9K A;  2KBM A;  4DRW A;  2WC8 A;  4CLN A;  2NCO A;  1Y6W A;  3HX4 A;  2JXL A;  3EK7 A;  1NX3 A;  1SKT A;  1G33 A;  1JFJ A;  1F70 A;  2JT0 A;  1B8R A;  2LM5 A;  1KQV A;  1CDL A;  1J1E A;  2KHN A;  2WND A;  4GBA A;  2OTG C;  2ZFD A;  1R2U A;  2GGZ A;  1XYD A;  2SCP A;  4M2O A;  3FWB A;  4NDB A;  2AUC A;  1NSH A;  1SYM A;  2BEC A;  3FWC A;  4GFT A;  5I2Q A;  5DKN A;  1QAT A;  4OCI A;  2JU0 A;  2FOT A;  2KBI A;  1S26 D;  1X02 A;  1UP5 A;  5GQQ C;  5KU1 A;  2MA2 A;  1NX2 A;  2PVB A;  1KFX L;  1BMO A;  3F45 A;  5DKQ A;  1BF5 A;  1DJI A;  1LIN A;  1SL8 A;  1K90 D;  2CXJ A;  2M7L A;  1BR1 B;  1M31 A;  3TUY B;  2L2E A;  3JVT B;  3BUO B;  4YGC B;  2NXQ A;  4GNK B;  1J7P A;  1LXF C;  2F2O A;  2KGR A;  1CM1 A;  3PN7 C;  1QX5 B;  2LUC A;  5HKW A;  1NP8 A;  4N1G A;  4MZK A;  1G8I A;  1S36 A;  2K7D A;  5CSI A;  2ZNE A;  3I5G B;  1IG5 A;  2M29 A;  1PUL A;  4ICB A;  3EKH A;  2KNE A;  1TRF A;  1IQ3 A;  1KQM C;  1S5G Z;  1CLB A;  1XFX O;  1KK8 C;  2OPO A;  3OP0 A;  1MWN A;  2LP3 A;  1JFK A;  1QIW A;  1F8H A;  5FYX A;  2EC6 B;  2Q91 A;  1BOD A;  3WXA A;  4USL A;  2F8P A;  2AAO A;  2K7C A;  1C7V A;  1WY9 A;  3ZNI A;  2KQ6 A;  2O60 A;  1FW4 A;  3TS5 B;  2M0R A;  2L4I A;  1CLM A;  2WCF A;  5G08 A;  5AAN A;  4FQO A;  3CR4 X;  1L2O C;  2M8U A;  1DVI A;  2LNK A;  4MRX A;  3VGO A;  4PE4 A;  1OZO A;  4GAO A;  4GUK A;  2KFF A;  3TZ1 A;  1YTZ C;  1IKU A;  4A4C A;  1SCM C;  4MSP A;  1DGU A;  1AUI B;  4PE1 A;  4ORC B;  1WLZ A;  3E3R A;  1QV1 A;  2KI4 C;  3BOW A;  1IGV A;  1MHO A;  1WDC B;  1REC A;  4YI8 A;  1GGZ A;  1FI6 A;  3EKJ A;  3NSK A;  1SR6 B;  1YUU A;  3OB2 B;  1EG4 A;  2CBL A;  1N2D A;  1F54 A;  1KSM A;  4ZCV A;  1K8U A;  1MF8 B;  1KFU L;  1EJ3 A;  1ALV A;  2HPS A;  3BUN B;  1F4O A;  1CFD A;  4E68 A;  1KSO A;  1DMO A;  2JZI A;  3VRN A;  1BLQ A;  1YX8 A;  5CPV A;  2H61 A;  2B1U A;  1C07 A;  2JNF A;  1NPQ A;  1ZMZ A;  2BKH B;  1CTR A;  1D1O A;  1NX1 A;  1YX7 A;  3NSI A;  1BOC A;  1MXL C;  2KFG A;  4JWQ A;  3BQ3 A;  2ISD A;  3I5I C;  2JUL A;  2PAL A;  3GK2 A;  3KEV A;  1U5I A;  4DIR A;  4AOM A;  1XVJ A;  4A4B A;  1M45 A;  4QJ3 B;  1K95 A;  4OKH A;  2LMV A;  1ALW A;  1B8L A;  2G9B A;  1S1E A;  5F6T A;  3CS1 A;  1QLS A;  2GGM A;  1BR4 B;  2CT9 A;  2LHI A;  3GOF A;  3EVR A;  4GGN A;  4JPZ B;  4TNC A;  1IRJ A;  2ZKM X;  3I5H B;  4N1F A;  3TDU A;  1NCX A;  3H4S E;  1UUS A;  1F4Q A;  1QVI Y;  3GK1 A;  2JTT A;  4DS7 A;  2AMI A;  1BJF A;  2LAN A;  1IWQ A;  3AAJ A;  3LCP C;  1YVH A;  5TNC A;  1UHI A;  3IQQ A;  4MRY A;  5PAL A;  4HRE E;  4PAL A;  1EG3 A;  3DF0 A;  2LV7 A;  3CR2 A;  1TNW A;  1MQ1 A;  1OE9 B;  1A75 B;  1PSR A;  3WHT B;  3IF7 A;  2IS9 A;  1OMR A;  2JNX A;  1CNP A;  4MZJ A;  4BY4 A;  1SBJ A;  3PAT A;  1JF2 A;  1CB1 A;  1L7Z A;  1RTP 1;  2L4H A;  3EVV A;  2OS8 C;  4D1E A;  3OX6 A;  3CGA A;  4NQG A;  3OHM B;  1DJW A;  1QLK A;  1XFY O;  1LKJ A;  3AKA A;  5JOL A;  1ZAC A;  1K94 A;  3CLN A;  2F2P A;  4M2P A;  3VRR A;  1H4B A;  3CWG A;  3D0Y A;  4CFR A;  1XFW O;  2Y1N A;  1TNX A;  4MVF A;  3DVJ A;  3MSE B;  2MBX A;  4ORA B;  3SIA A;  2K2A A;  4YBH B;  2TN4 A;  1B9A A;  2M1U A;  5HLO A;  4MEW A;  1RRO A;  1WRZ A;  1A29 A;  1Y0V H;  2F33 A;  3KF9 A;  4CID A;  3EVU A;  1YRT B;  1HT9 A;  3OX5 A;  1JBA A;  1LA0 A;  4QJ5 B;  5HKZ A;  2JQ6 A;  4Q04 A;  3JTD B;  1F71 A;  1U5I B;  1W7I B;  2WOR A;  1K96 A;  2ZND A;  1ODB A;  1QV0 A;  4YGD B;  1BU3 A;  1NUB A;  2ZRT A;  4HRG A;  4XJK A;  4JQ0 D;  4MZL A;  2JOJ A;  2ZN8 A;  1CLL A;  1HQV A;  4PHJ A;  4YI9 A;  3LLE A;  4GGF C;  1K9U A;  2PMY A;  2A4J A;  1YRU B;  4YRU A;  1J7O A;  1OQP A;  1AJ4 A;  5I2L A;  3DVE A;  1CFP A;  2KSP A;  2BL0 C;  2RGI A;  1W7J B;  1UUR A;  1UHN A;  4OV2 A;  2GV5 A;  5B8I B;  1DJH A;  5AEQ A;  5AFP A;  1TTX A;  1AK8 A;  1JSA A;  4BY5 A;  5HYD A;  1TNP A;  3AAK A;  1QX2 A;  5DKR A;  2NLN A;  1CKK A;  2LMT A;  4AQJ A;  2K61 A;  3CR5 X;  2LLT A;  1QVI Z;  4PDZ A;  1KK7 Y;  1QXP A;  1E8A A;  2M3W A;  2M9G A;  2Y5I A;  3PFV A;  1KWO B;  4GGF A;  4U8D A;  5IBW A;  1XFZ O;  4MLW A;  1IH0 A;  3D0Y B;  1K93 D;  3CTN A;  3SG7 A;  1QAS A;  4CPV A;  2MLF C;  3CZT X;  4R1E A;  5CSJ A;  2M97 A;  2LVV A;  1OZS A;  3I5F B;  3NSO A;  1FF1 A;  1CFF A;  2LHL A;  2KFH A;  3RLZ A;  2P6B B;  1YUR A;  3D10 A;  4ORB B;  4PE0 A;  1IQ5 A;  1EXR A;  1RJV A;  2I94 A;  3O78 A;  2SAS A;  1QX7 A;  3NSL A;  4PHM A;  4C0J A;  1XK4 C;  2OS8 B;  2JWW A;  2KOT A;  3TUY C;  3JVT C;  3BYA A;  2COL B;  1UHJ A;  4L9M A;  1C7W A;  1IJ5 A;  2LVI A;  2OTG B;  4I5L B;  1WLM A;  1XFU O;  3SJS A;  2BCX A;  2DOQ A;  3PSR A;  4OR9 B;  3SIB A;  1AP4 A;  3LK1 A;  5AER A;  5ER5 A;  3ZWH A;  2H2K A;  1DJZ A;  1PVA A;  1VRK A;  2WCB A;  1GJY A;  4DUQ A;  3VRQ A;  1NX0 A;  1B1G A;  1ZUZ A;  3A8R A;  2BE4 A;  1DJY A;  1Q80 A;  1WRK A;  1DT7 B;  3LL8 B;  3BUX B;  2EC6 C;  2L5X B;  3KO0 A;  4UPG A;  2JTZ A;  1UHH A;  1XK4 A;  2LVK A;  2M7N A;  3O2P A;  2EGD A;  1PAL A;  3DVK A;  3TS5 C;  1LVC D;  1M63 B;  1NYA A;  4WQ3 A;  1OOJ A;  2HET A;  3IQO A;  3PN7 B;  1NIW A;  1SCV A;  1SY9 A;  1M46 A;  4P5O E;  2LCP A;  3WNX B;  3BXK A;  1K9P A;  4GPL B;  1S6J A;  4PCW A;  1XFV O;  1YUT A;  2FCD A;  1V1F A;  1S6I A;  3C1V A;  1JUO A;  1KQM B;  5KTY A;  4WQ2 A;  1FI5 A;  1KK8 B;  4DCK A;  1AHR A;  3BOW B;  3TDI A;  1RWY A;  3O4Y A;  2BL0 B;  2FJU B;  1MXE A;  4PHK A;  1WDC C;  1IJ6 A;  2LVJ A;  3SG3 A;  1Y1X A;  1SR6 C;  1AVS A;  2MHH A;  2WOS A;  1S6C A;  1DJG A;  1UWO A;  4NDC A;  2VRG A;  2V53 A;  2EHB A;  2KI6 C;  3OB1 B;  4I5J A;  4N5X A;  5KSZ A;  1Y1U A;  2LE9 B;  2JRF A;  1N0Y A;  2L0P A;  3SG5 A;  1J7Q A;  1KK7 Z;  1L2O B;  2R2I A;  4YGA A;  1KFX S;  2PRU A;  1GQM A;  1XA5 A;  1PVB A;  4FTG A;  4M2Q A;  2BBM A;  2NZ0 A;  2BCA A;  2KAY A;  3GK4 X;  2BE6 A;  1G4Y R;  2LMU A;  4CFQ A;  1JF0 A;  1OMV A;  1SCM B;  3ICB A;  4PE7 A;  5D69 A;  4F0Z B;  2BCB A;  2KI4 B;  5HKY A;  1OMD A;  2K2F A;  4I5N B;  2M1K B;  3VRO A;  1NWD A;  1DJX A;  1QTX A;  2JT3 A;  2CTN A;  4C0K A;  1B7T Y;  2E30 A;  1FPW A;  3BUM B;  2QPT A;  3K21 A;  3I5H C;  2BKI B;  5I8N A;  1DF0 A;  1V1G A;  1DGV A;  2CCM A;  2JPT A;  1PSB A;  2I2R E;  1NCZ A;  1A2X A;  5HLV A;  3O6B A;  4ETO A;  4XYN A;  4PHN A;  1Y1A A;  2L50 A;  1SMG A;  1SK6 D;  2G2B A;  1B8C A;  1CM4 A;  2KAV A;  3DF0 B;  2KYC A;  1JC2 A;  1EH2 A;  1JWD A;  1ZFS A;  5K89 A;  2K7B A;  3I5I B;  2MLE C;  3M0W A;  1YVL A;  2Y4Q A;  3SG4 A;  1N65 A;  4NDD A;  1LA3 A;  1B4C A;  2F3Y A;  2Q4U A;  3FS7 A;  3VRP A;  1SNL A;  2CNP A;  2KGB C;  3SG2 A;  2WCE A;  2LLS A;  1M39 A;  2MJW B;  2LLU A;  1PK0 D;  4AQI A;  3AKB A;  2D8N A;  1QS7 A;  2LP2 A;  1RK9 A;  3FIA A;  4MBE A;  1ZOT B;  4IL1 A;  4I5K A;  2LUX A;  1CDM A;  1AJ5 A;  2F3Z A;  3HCM A;  2KAX A;  1KFU S;  1TNQ A;  1A75 A;  3BUW B;  2BBN A;  2H61 C;  5D7F A;  3PM8 A;  4P2Y B;  1TN4 A;  1R6P A;  5AXI A;  1A03 A;  1QJT A;  2ZRS A;  3PAL A;  5CSN A;  1EL4 A;  2M49 B;  2KYF A;  1K2H A;  3JTD C;  2JXC A;  1SL9 A;  2L98 A;  2NCP A;  3LK0 A;  1TOP A;  3PLF B;  1DTL A;  4YGE B;  4HRH A;  4ZCU A;  2QAC A;  2I18 A;  3EK4 A;  2HQ8 A;  1SW8 A;  1J55 A;  3A4U B;  1B47 A;  4XJK B;  1MR8 A;  3I5G C;  2KI6 D;  1XO5 A;  1TCF A;  2MRD A;  1UHK A;  3DVM A;  1BG1 A;  1NCY A;  3KHE A;  2FCE A;  3QRX A;  1CDN A;  1DF0 B;  1KCY A;  2L51 A;  1A4P A;  4WRI A;  4OVN F;  2PAS A; 
#chains in the Genus database with same CATH topology
 2KQY A;  1S5G Y;  1CMG A;  3EK8 A;  3KPX A;  1H8B A;  5EL2 A;  1CMF A;  5CSF A;  2O5G A;  1TCO B;  1QIV A;  3O4X A;  1CDP A;  3WHU B;  1SRA A;  2ZN9 A;  4F7F A;  4MN0 A;  1RFJ A;  1SPY A;  1B7T Z;  2K0J A;  3TDZ A;  1CFC A;  2E6W A;  1F55 A;  1T14 A;  1J1D A;  1YR5 A;  2HF5 A;  3FE8 A;  2I7A A;  1YUS A;  1BT6 A;  4HSZ A;  2MAZ A;  2PSR A;  3SG6 A;  1FBV A;  5I2O A;  2K8M B;  1WRL A;  3R72 A;  3NXA A;  1KWO C;  1MUX A;  2LAP A;  1S3P A;  4C0L A;  2Y1M A;  2JT8 A;  1OSA A;  2HQW A;  5BPJ A;  1TIZ A;  2WC6 A;  1IIO A;  3S0F A;  1SL7 A;  2KDH A;  2LC5 A;  2K7O A;  3NHT A;  1GGW A;  5JJG A;  4FQT A;  3I5F C;  1PRW A;  1J7R A;  2JC2 A;  5J3X A;  4YGB B;  5ER4 X;  4QJ4 B;  3DD4 A;  3RM1 A;  1K9K A;  2KBM A;  4DRW A;  2WC8 A;  4CLN A;  4JKT A;  2NCO A;  1Y6W A;  3HX4 A;  2JXL A;  3EK7 A;  1NX3 A;  1SKT A;  1G33 A;  1JFJ A;  1F70 A;  2JT0 A;  1B8R A;  2KLD A;  2LM5 A;  1KQV A;  1CDL A;  1J1E A;  2KHN A;  2QEO A;  2WND A;  4GBA A;  2OTG C;  2ZFD A;  1R2U A;  2GGZ A;  1XYD A;  2SCP A;  4M2O A;  3FWB A;  4NDB A;  2AUC A;  1NSH A;  1SYM A;  3UO9 A;  2BEC A;  1TWO A;  3FWC A;  4GFT A;  5DKN A;  5I2Q A;  1QAT A;  4OCI A;  2JU0 A;  2FOT A;  2KBI A;  1S26 D;  1X02 A;  1UP5 A;  5GQQ C;  5KU1 A;  2MA2 A;  1NX2 A;  2PVB A;  1KFX L;  1BMO A;  3F45 A;  5DKQ A;  3FE6 A;  1BF5 A;  1DJI A;  1LIN A;  1SL8 A;  1K90 D;  2CXJ A;  2M7L A;  1BR1 B;  1M31 A;  3TUY B;  2L2E A;  3JVT B;  3BUO B;  4YGC B;  2NXQ A;  4GNK B;  1J7P A;  1LXF C;  2F2O A;  2KGR A;  1CM1 A;  3PN7 C;  1QX5 B;  2LUC A;  5HKW A;  1NP8 A;  4N1G A;  4MZK A;  1G8I A;  1S36 A;  2K7D A;  5CSI A;  2ZNE A;  3I5G B;  1IG5 A;  2M29 A;  1PUL A;  4ICB A;  3DY9 A;  3EKH A;  2KNE A;  1TRF A;  3R1V A;  1KQM C;  1S5G Z;  1IQ3 A;  1XFX O;  1KK8 C;  1DEL A;  1CLB A;  2OPO A;  3OP0 A;  1MWN A;  2LP3 A;  1JFK A;  1QIW A;  1F8H A;  3L4A A;  5FYX A;  2EC6 B;  2Q91 A;  1BOD A;  3WXA A;  4USL A;  2F8P A;  2AAO A;  2K7C A;  1C7V A;  1WY9 A;  3ZNI A;  2KQ6 A;  1P28 A;  2O60 A;  1FW4 A;  3TS5 B;  2M0R A;  2L4I A;  1CLM A;  2WCF A;  5G08 A;  5AAN A;  4FQO A;  2JPO A;  3CR4 X;  3SS4 A;  1L2O C;  2M8U A;  1DVI A;  2LNK A;  4MRX A;  3VGO A;  4PE4 A;  1OZO A;  4GAO A;  4GUK A;  2KFF A;  3TZ1 A;  1YTZ C;  3OGN A;  1IKU A;  4A4C A;  1SCM C;  4MSP A;  1DGU A;  1AUI B;  3NHI A;  4PE1 A;  4ORC B;  1WLZ A;  3E3R A;  1QV1 A;  2KI4 C;  3BOW A;  1IGV A;  1MHO A;  3CZ2 A;  1WDC B;  1REC A;  2KPH A;  4YI8 A;  1GGZ A;  1FI6 A;  3EKJ A;  3CAB A;  3NSK A;  1SR6 B;  1YUU A;  3QME A;  3OB2 B;  1EG4 A;  2CBL A;  2K60 A;  4INX A;  1N2D A;  1F54 A;  1KSM A;  4ZCV A;  1K8U A;  1MF8 B;  1KFU L;  2WCK A;  1EJ3 A;  1ALV A;  2HPS A;  3BUN B;  1F4O A;  1CFD A;  4E68 A;  1KSO A;  1DMO A;  2JZI A;  3VRN A;  1BLQ A;  2PYQ A;  2WC5 A;  1YX8 A;  2WCM A;  2H61 A;  2B1U A;  5CPV A;  1C07 A;  2JNF A;  1NPQ A;  1ZMZ A;  2BKH B;  1CTR A;  1D1O A;  1NX1 A;  1YX7 A;  3NSI A;  1BOC A;  1MXL C;  2KFG A;  4JWQ A;  3BQ3 A;  3V2L A;  2ISD A;  3I5I C;  2JUL A;  2PAL A;  3GK2 A;  3KEV A;  1U5I A;  4DIR A;  4AOM A;  4KYN A;  1XVJ A;  4A4B A;  1M45 A;  4QJ3 B;  1K95 A;  2L5Y A;  4INW A;  4OKH A;  2LMV A;  1ALW A;  1B8L A;  2G9B A;  3B86 A;  1S1E A;  5F6T A;  3BFA A;  3CS1 A;  1QLS A;  2GGM A;  1BR4 B;  2CT9 A;  2LHI A;  3GOF A;  3EVR A;  4GGN A;  4JPZ B;  4TNC A;  1IRJ A;  2ZKM X;  3I5H B;  4N1F A;  3L47 A;  1NCX A;  3H4S E;  3TDU A;  1UUS A;  1OW4 A;  1F4Q A;  1QVI Y;  3GK1 A;  2JTT A;  4DS7 A;  2AMI A;  1DQE A;  1BJF A;  2LAN A;  1IWQ A;  3AAJ A;  3LCP C;  1YVH A;  5TNC A;  1UHI A;  3IQQ A;  4MRY A;  5PAL A;  4HRE E;  4PAL A;  1EG3 A;  3DF0 A;  2LV7 A;  3CR2 A;  1TNW A;  1MQ1 A;  3L4L A;  1OE9 B;  1ORG A;  1A75 B;  1PSR A;  3WHT B;  3IF7 A;  2IS9 A;  1OMR A;  2JNX A;  1CNP A;  4MZJ A;  4BY4 A;  1TUJ A;  1SBJ A;  3PAT A;  1JF2 A;  1CB1 A;  3FE9 A;  1L7Z A;  1RTP 1;  2L4H A;  3EVV A;  2OS8 C;  4D1E A;  1C3Y A;  2FJY A;  3OX6 A;  3CGA A;  4NQG A;  3OHM B;  1DJW A;  1DEK A;  1QLK A;  1XFY O;  1LKJ A;  3AKA A;  5JOL A;  1ZAC A;  1K94 A;  3CLN A;  2F2P A;  4M2P A;  3VRR A;  1H4B A;  3CWG A;  3D0Y A;  4CFR A;  1XFW O;  2Y1N A;  5I94 A;  1TNX A;  4MVF A;  3DVJ A;  3MSE B;  2MBX A;  4ORA B;  3SIA A;  2K2A A;  4YBH B;  2TN4 A;  1B9A A;  2M1U A;  5HLO A;  4MEW A;  3BJH A;  1RRO A;  1WRZ A;  1A29 A;  1OOH A;  1Y0V H;  2F33 A;  3KF9 A;  4CID A;  3EVU A;  1YRT B;  1HT9 A;  3OX5 A;  1JBA A;  1LA0 A;  4QJ5 B;  5HKZ A;  2JQ6 A;  4Q04 A;  3JTD B;  3Q8I A;  1F71 A;  1U5I B;  1W7I B;  2BAP A;  2WOR A;  1K96 A;  2ZND A;  1ODB A;  1QV0 A;  2P71 A;  4YGD B;  1BU3 A;  1NUB A;  2ZRT A;  3D76 A;  2KLE A;  4HRG A;  4XJK A;  4JQ0 D;  2WCJ A;  2JOJ A;  4MZL A;  2ZN8 A;  1CLL A;  1OOF A;  1HQV A;  4PHJ A;  4YI9 A;  5FI7 A;  3LLE A;  4GGF C;  1K9U A;  2PMY A;  2A4J A;  1YRU B;  4YRU A;  3BFB A;  3SS5 A;  1J7O A;  1OQP A;  1AJ4 A;  5I2L A;  3CZ1 A;  3DVE A;  1CFP A;  2KSP A;  2BL0 C;  2RGI A;  1W7J B;  1UUR A;  1UHN A;  4OV2 A;  2GV5 A;  5B8I B;  1DJH A;  5AEQ A;  5AFP A;  1TTX A;  1AK8 A;  3PM2 A;  1JSA A;  4BY5 A;  3BFH A;  5HYD A;  1TNP A;  3AAK A;  1QX2 A;  3N7H A;  5DKR A;  2NLN A;  1CKK A;  5D3O A;  2GTE A;  2LMT A;  4AQJ A;  2BNX A;  2K61 A;  3CR5 X;  2LLT A;  1QVI Z;  4PDZ A;  1KK7 Y;  1QXP A;  1E8A A;  2M3W A;  2M9G A;  2Y5I A;  3PFV A;  1KWO B;  4GGF A;  4U8D A;  2QEV A;  5IBW A;  1XFZ O;  4MLW A;  4OZD A;  1IH0 A;  3D0Y B;  1GM0 A;  1K93 D;  3CTN A;  3SG7 A;  1QAS A;  4CPV A;  2MLF C;  3CDN A;  3CZT X;  4R1E A;  5FI2 A;  5CSJ A;  2M97 A;  1LS8 A;  2LVV A;  1OZS A;  3I5F B;  3NSO A;  1FF1 A;  1CFF A;  2LHL A;  4JD9 A;  2KFH A;  3RLZ A;  2P6B B;  1YUR A;  2L2C A;  3D10 A;  4ORB B;  4PE0 A;  1IQ5 A;  1EXR A;  3D78 A;  1RJV A;  2I94 A;  3O78 A;  2SAS A;  1QX7 A;  1OOG A;  3NSL A;  4PHM A;  4C0J A;  5FI6 A;  3B88 A;  1XK4 C;  2OS8 B;  2JWW A;  2KOT A;  3DYE A;  3TUY C;  3JVT C;  3BYA A;  3IVT A;  2COL B;  1UHJ A;  4L9M A;  1C7W A;  1IJ5 A;  2LVI A;  5HL1 A;  2OTG B;  4I5L B;  1WLM A;  1XFU O;  3S0B A;  3SJS A;  4DUQ A;  3B7A A;  2BCX A;  2DOQ A;  3PSR A;  4OR9 B;  3SIB A;  1AP4 A;  3R1P A;  3LK1 A;  5AER A;  3DZT A;  5ER5 A;  3ZWH A;  2H2K A;  1DJZ A;  1PVA A;  1SSE B;  1VRK A;  1GJY A;  2PQL A;  2QEB A;  2WCB A;  3VRQ A;  1NX0 A;  1B1G A;  1ZUZ A;  3A8R A;  2BE4 A;  1DJY A;  1Q80 A;  2H8V A;  1WRK A;  2P70 A;  1DT7 B;  3LL8 B;  3BUX B;  2EC6 C;  2L5X B;  1Z2C B;  3KO0 A;  4UPG A;  2JTZ A;  1UHH A;  1XK4 A;  2LVK A;  2M7N A;  1W9Z A;  2EGD A;  1PAL A;  3DVK A;  3O2P A;  3TS5 C;  1LVC D;  1M63 B;  1NYA A;  2WCH A;  4WQ3 A;  3UNW A;  1OOJ A;  2HET A;  3IQO A;  3PN7 B;  1NIW A;  1SCV A;  1SY9 A;  1M46 A;  4P5O E;  2LCP A;  3WNX B;  2QDI A;  3BXK A;  1K9P A;  4GPL B;  1S6J A;  4PCW A;  1XFV O;  1YUT A;  2FCD A;  1V1F A;  1S6I A;  3C1V A;  1JUO A;  1KQM B;  5KTY A;  4WQ2 A;  1FI5 A;  1KK8 B;  4DCK A;  1AHR A;  3CYZ A;  3BOW B;  3TDI A;  1RWY A;  3O4Y A;  2BL0 B;  2FJU B;  1MXE A;  4PHK A;  3PJI A;  1WDC C;  1IJ6 A;  2LVJ A;  3SG3 A;  2ERB A;  1Y1X A;  2QEH A;  1SR6 C;  1AVS A;  2MHH A;  2WOS A;  1S6C A;  3S0E A;  1DJG A;  1UWO A;  4NDC A;  2VRG A;  2V53 A;  2EHB A;  3S0A A;  2KI6 C;  3OB1 B;  4I5J A;  4N5X A;  5KSZ A;  1Y1U A;  2LE9 B;  3SS3 A;  2JRF A;  1N0Y A;  2L0P A;  3SG5 A;  1J7Q A;  1KK7 Z;  1L2O B;  1XFR A;  2R2I A;  4YGA A;  1KFX S;  2PRU A;  1GQM A;  1XA5 A;  1PVB A;  2WCL A;  3DXL A;  2BBM A;  4FTG A;  1C3Z A;  1OOI X;  1TUZ A;  2BCA A;  2NZ0 A;  4M2Q A;  3D73 A;  2KAY A;  3GK4 X;  2BE6 A;  1G4Y R;  2LMU A;  3NGV A;  4CFQ A;  1JF0 A;  1OMV A;  1SCM B;  3ICB A;  4PE7 A;  4PT1 A;  5D69 A;  5DIC A;  4F0Z B;  2BCB A;  2KI4 B;  5HKY A;  1OMD A;  2K2F A;  4I5N B;  2M1K B;  3VRO A;  1NWD A;  1DJX A;  1QTX A;  2JT3 A;  2CTN A;  4C0K A;  1B7T Y;  3B6X A;  2E30 A;  1FPW A;  3BUM B;  2QPT A;  3K21 A;  3S0D A;  3I5H C;  2BKI B;  5I8N A;  1DF0 A;  1V1G A;  1DGV A;  2CCM A;  2JPT A;  1PSB A;  3VB1 A;  2I2R E;  1NCZ A;  2YGU A;  1A2X A;  5HLV A;  3O6B A;  4ETO A;  4XYN A;  4PHN A;  1Y1A A;  2L50 A;  1SMG A;  1SK6 D;  2G2B A;  1B8C A;  1CM4 A;  2KAV A;  3DF0 B;  2KYC A;  1JC2 A;  1EH2 A;  1JWD A;  1ZFS A;  5K89 A;  2K7B A;  3I5I B;  2MLE C;  3M0W A;  1YVL A;  2Y4Q A;  3SG4 A;  1N65 A;  4IJ7 A;  1LA3 A;  4NDD A;  1B4C A;  2F3Y A;  2Q4U A;  3FS7 A;  3VRP A;  1SNL A;  2CNP A;  3D77 A;  2KGB C;  3SG2 A;  2WCE A;  2LLS A;  1M39 A;  2MJW B;  2LLU A;  1PK0 D;  4AQI A;  3AKB A;  2D8N A;  3K1E A;  1QS7 A;  2LP2 A;  1RK9 A;  3FIA A;  4MBE A;  1ZOT B;  4IL1 A;  4I5K A;  3RZS A;  2LUX A;  1CDM A;  1AJ5 A;  2F3Z A;  1QWV A;  3HCM A;  2KAX A;  1KFU S;  1TNQ A;  1A75 A;  3BUW B;  3D75 A;  2BBN A;  2H61 C;  5D7F A;  3PM8 A;  4P2Y B;  1TN4 A;  1R6P A;  1Z4H A;  5AXI A;  1A03 A;  1QJT A;  2ZRS A;  3PAL A;  5CSN A;  1EL4 A;  2M49 B;  2KYF A;  3B87 A;  1K2H A;  3JTD C;  2JXC A;  1SL9 A;  2L98 A;  2NCP A;  3LK0 A;  1TOP A;  3PLF B;  1DTL A;  4YGE B;  4HRH A;  4ZCU A;  2QAC A;  2I18 A;  3EK4 A;  2HQ8 A;  1SW8 A;  3R1O A;  1J55 A;  3A4U B;  1B47 A;  3EG5 B;  4XJK B;  1MR8 A;  3D74 A;  3I5G C;  2KI6 D;  1XO5 A;  3OBV A;  3S0G A;  1TCF A;  2MRD A;  1UHK A;  3DVM A;  1BG1 A;  1NCY A;  3KHE A;  3CZ0 A;  2FCE A;  3QRX A;  1CDN A;  1DF0 B;  1KCY A;  2L51 A;  1A4P A;  1DC1 A;  4WRI A;  4OVN F;  2PAS A; 
#chains in the Genus database with same CATH homology
 2KQY A;  1S5G Y;  1CMG A;  3EK8 A;  3KPX A;  1H8B A;  1CMF A;  5CSF A;  2O5G A;  1TCO B;  1QIV A;  1CDP A;  3WHU B;  1SRA A;  2ZN9 A;  4MN0 A;  1RFJ A;  1SPY A;  1B7T Z;  2K0J A;  3TDZ A;  1CFC A;  2E6W A;  1F55 A;  2HF5 A;  1J1D A;  1YR5 A;  2I7A A;  1YUS A;  1BT6 A;  4HSZ A;  2MAZ A;  2PSR A;  3SG6 A;  1FBV A;  5I2O A;  2K8M B;  1WRL A;  3NXA A;  1KWO C;  1MUX A;  2LAP A;  1S3P A;  4C0L A;  2Y1M A;  2JT8 A;  1OSA A;  2HQW A;  5BPJ A;  1TIZ A;  1SL7 A;  2KDH A;  2LC5 A;  2K7O A;  1GGW A;  5JJG A;  3I5F C;  1PRW A;  1J7R A;  2JC2 A;  5J3X A;  4YGB B;  5ER4 X;  4QJ4 B;  3DD4 A;  3RM1 A;  1K9K A;  2KBM A;  4DRW A;  2WC8 A;  4CLN A;  2NCO A;  1Y6W A;  3HX4 A;  2JXL A;  3EK7 A;  1NX3 A;  1SKT A;  1G33 A;  1JFJ A;  1F70 A;  2JT0 A;  1B8R A;  2LM5 A;  1KQV A;  1CDL A;  1J1E A;  2KHN A;  2WND A;  4GBA A;  2OTG C;  2ZFD A;  1R2U A;  2GGZ A;  1XYD A;  2SCP A;  4M2O A;  3FWB A;  4NDB A;  2AUC A;  1NSH A;  1SYM A;  2BEC A;  3FWC A;  4GFT A;  5I2Q A;  5DKN A;  1QAT A;  4OCI A;  2JU0 A;  2FOT A;  2KBI A;  1S26 D;  1X02 A;  1UP5 A;  5GQQ C;  5KU1 A;  2MA2 A;  1NX2 A;  2PVB A;  1KFX L;  1BMO A;  3F45 A;  5DKQ A;  1BF5 A;  1DJI A;  1LIN A;  1SL8 A;  1K90 D;  2CXJ A;  2M7L A;  1BR1 B;  1M31 A;  3TUY B;  2L2E A;  3JVT B;  3BUO B;  4YGC B;  2NXQ A;  4GNK B;  1J7P A;  1LXF C;  2F2O A;  2KGR A;  1CM1 A;  3PN7 C;  1QX5 B;  2LUC A;  5HKW A;  1NP8 A;  4N1G A;  4MZK A;  1G8I A;  1S36 A;  2K7D A;  5CSI A;  2ZNE A;  3I5G B;  1IG5 A;  2M29 A;  1PUL A;  4ICB A;  3EKH A;  2KNE A;  1TRF A;  1IQ3 A;  1KQM C;  1S5G Z;  1CLB A;  1XFX O;  1KK8 C;  2OPO A;  3OP0 A;  1MWN A;  2LP3 A;  1JFK A;  1QIW A;  1F8H A;  5FYX A;  2EC6 B;  2Q91 A;  1BOD A;  3WXA A;  4USL A;  2F8P A;  2AAO A;  2K7C A;  1C7V A;  1WY9 A;  3ZNI A;  2KQ6 A;  2O60 A;  1FW4 A;  3TS5 B;  2M0R A;  2L4I A;  1CLM A;  2WCF A;  5G08 A;  5AAN A;  4FQO A;  3CR4 X;  1L2O C;  2M8U A;  1DVI A;  2LNK A;  4MRX A;  3VGO A;  4PE4 A;  1OZO A;  4GAO A;  4GUK A;  2KFF A;  3TZ1 A;  1YTZ C;  1IKU A;  4A4C A;  1SCM C;  4MSP A;  1DGU A;  1AUI B;  4PE1 A;  4ORC B;  1WLZ A;  3E3R A;  1QV1 A;  2KI4 C;  3BOW A;  1IGV A;  1MHO A;  1WDC B;  1REC A;  4YI8 A;  1GGZ A;  1FI6 A;  3EKJ A;  3NSK A;  1SR6 B;  1YUU A;  3OB2 B;  1EG4 A;  2CBL A;  1N2D A;  1F54 A;  1KSM A;  4ZCV A;  1K8U A;  1MF8 B;  1KFU L;  1EJ3 A;  1ALV A;  2HPS A;  3BUN B;  1F4O A;  1CFD A;  4E68 A;  1KSO A;  1DMO A;  2JZI A;  3VRN A;  1BLQ A;  1YX8 A;  5CPV A;  2H61 A;  2B1U A;  1C07 A;  2JNF A;  1NPQ A;  1ZMZ A;  2BKH B;  1CTR A;  1D1O A;  1NX1 A;  1YX7 A;  3NSI A;  1BOC A;  1MXL C;  2KFG A;  4JWQ A;  3BQ3 A;  2ISD A;  3I5I C;  2JUL A;  2PAL A;  3GK2 A;  3KEV A;  1U5I A;  4DIR A;  4AOM A;  1XVJ A;  4A4B A;  1M45 A;  4QJ3 B;  1K95 A;  4OKH A;  2LMV A;  1ALW A;  1B8L A;  2G9B A;  1S1E A;  5F6T A;  3CS1 A;  1QLS A;  2GGM A;  1BR4 B;  2CT9 A;  2LHI A;  3GOF A;  3EVR A;  4GGN A;  4JPZ B;  4TNC A;  1IRJ A;  2ZKM X;  3I5H B;  4N1F A;  3TDU A;  1NCX A;  3H4S E;  1UUS A;  1F4Q A;  1QVI Y;  3GK1 A;  2JTT A;  4DS7 A;  2AMI A;  1BJF A;  2LAN A;  1IWQ A;  3AAJ A;  3LCP C;  1YVH A;  5TNC A;  1UHI A;  3IQQ A;  4MRY A;  5PAL A;  4HRE E;  4PAL A;  1EG3 A;  3DF0 A;  2LV7 A;  3CR2 A;  1TNW A;  1MQ1 A;  1OE9 B;  1A75 B;  1PSR A;  3WHT B;  3IF7 A;  2IS9 A;  1OMR A;  2JNX A;  1CNP A;  4MZJ A;  4BY4 A;  1SBJ A;  3PAT A;  1JF2 A;  1CB1 A;  1L7Z A;  1RTP 1;  2L4H A;  3EVV A;  2OS8 C;  4D1E A;  3OX6 A;  3CGA A;  4NQG A;  3OHM B;  1DJW A;  1QLK A;  1XFY O;  1LKJ A;  3AKA A;  5JOL A;  1ZAC A;  1K94 A;  3CLN A;  2F2P A;  4M2P A;  3VRR A;  1H4B A;  3CWG A;  3D0Y A;  4CFR A;  1XFW O;  2Y1N A;  1TNX A;  4MVF A;  3DVJ A;  3MSE B;  2MBX A;  4ORA B;  3SIA A;  2K2A A;  4YBH B;  2TN4 A;  1B9A A;  2M1U A;  5HLO A;  4MEW A;  1RRO A;  1WRZ A;  1A29 A;  1Y0V H;  2F33 A;  3KF9 A;  4CID A;  3EVU A;  1YRT B;  1HT9 A;  3OX5 A;  1JBA A;  1LA0 A;  4QJ5 B;  5HKZ A;  2JQ6 A;  4Q04 A;  3JTD B;  1F71 A;  1U5I B;  1W7I B;  2WOR A;  1K96 A;  2ZND A;  1ODB A;  1QV0 A;  4YGD B;  1BU3 A;  1NUB A;  2ZRT A;  4HRG A;  4XJK A;  4JQ0 D;  4MZL A;  2JOJ A;  2ZN8 A;  1CLL A;  1HQV A;  4PHJ A;  4YI9 A;  3LLE A;  4GGF C;  1K9U A;  2PMY A;  2A4J A;  1YRU B;  4YRU A;  1J7O A;  1OQP A;  1AJ4 A;  5I2L A;  3DVE A;  1CFP A;  2KSP A;  2BL0 C;  2RGI A;  1W7J B;  1UUR A;  1UHN A;  4OV2 A;  2GV5 A;  5B8I B;  1DJH A;  5AEQ A;  5AFP A;  1TTX A;  1AK8 A;  1JSA A;  4BY5 A;  5HYD A;  1TNP A;  3AAK A;  1QX2 A;  5DKR A;  2NLN A;  1CKK A;  2LMT A;  4AQJ A;  2K61 A;  3CR5 X;  2LLT A;  1QVI Z;  4PDZ A;  1KK7 Y;  1QXP A;  1E8A A;  2M3W A;  2M9G A;  2Y5I A;  3PFV A;  1KWO B;  4GGF A;  4U8D A;  5IBW A;  1XFZ O;  4MLW A;  1IH0 A;  3D0Y B;  1K93 D;  3CTN A;  3SG7 A;  1QAS A;  4CPV A;  2MLF C;  3CZT X;  4R1E A;  5CSJ A;  2M97 A;  2LVV A;  1OZS A;  3I5F B;  3NSO A;  1FF1 A;  1CFF A;  2LHL A;  2KFH A;  3RLZ A;  2P6B B;  1YUR A;  3D10 A;  4ORB B;  4PE0 A;  1IQ5 A;  1EXR A;  1RJV A;  2I94 A;  3O78 A;  2SAS A;  1QX7 A;  3NSL A;  4PHM A;  4C0J A;  1XK4 C;  2OS8 B;  2JWW A;  2KOT A;  3TUY C;  3JVT C;  3BYA A;  2COL B;  1UHJ A;  4L9M A;  1C7W A;  1IJ5 A;  2LVI A;  2OTG B;  4I5L B;  1WLM A;  1XFU O;  3SJS A;  2BCX A;  2DOQ A;  3PSR A;  4OR9 B;  3SIB A;  1AP4 A;  3LK1 A;  5AER A;  5ER5 A;  3ZWH A;  2H2K A;  1DJZ A;  1PVA A;  1VRK A;  2WCB A;  1GJY A;  4DUQ A;  3VRQ A;  1NX0 A;  1B1G A;  1ZUZ A;  3A8R A;  2BE4 A;  1DJY A;  1Q80 A;  1WRK A;  1DT7 B;  3LL8 B;  3BUX B;  2EC6 C;  2L5X B;  3KO0 A;  4UPG A;  2JTZ A;  1UHH A;  1XK4 A;  2LVK A;  2M7N A;  3O2P A;  2EGD A;  1PAL A;  3DVK A;  3TS5 C;  1LVC D;  1M63 B;  1NYA A;  4WQ3 A;  1OOJ A;  2HET A;  3IQO A;  3PN7 B;  1NIW A;  1SCV A;  1SY9 A;  1M46 A;  4P5O E;  2LCP A;  3WNX B;  3BXK A;  1K9P A;  4GPL B;  1S6J A;  4PCW A;  1XFV O;  1YUT A;  2FCD A;  1V1F A;  1S6I A;  3C1V A;  1JUO A;  1KQM B;  5KTY A;  4WQ2 A;  1FI5 A;  1KK8 B;  4DCK A;  1AHR A;  3BOW B;  3TDI A;  1RWY A;  3O4Y A;  2BL0 B;  2FJU B;  1MXE A;  4PHK A;  1WDC C;  1IJ6 A;  2LVJ A;  3SG3 A;  1Y1X A;  1SR6 C;  1AVS A;  2MHH A;  2WOS A;  1S6C A;  1DJG A;  1UWO A;  4NDC A;  2VRG A;  2V53 A;  2EHB A;  2KI6 C;  3OB1 B;  4I5J A;  4N5X A;  5KSZ A;  1Y1U A;  2LE9 B;  2JRF A;  1N0Y A;  2L0P A;  3SG5 A;  1J7Q A;  1KK7 Z;  1L2O B;  2R2I A;  4YGA A;  1KFX S;  2PRU A;  1GQM A;  1XA5 A;  1PVB A;  4FTG A;  4M2Q A;  2BBM A;  2NZ0 A;  2BCA A;  2KAY A;  3GK4 X;  2BE6 A;  1G4Y R;  2LMU A;  4CFQ A;  1JF0 A;  1OMV A;  1SCM B;  3ICB A;  4PE7 A;  5D69 A;  4F0Z B;  2BCB A;  2KI4 B;  5HKY A;  1OMD A;  2K2F A;  4I5N B;  2M1K B;  3VRO A;  1NWD A;  1DJX A;  1QTX A;  2JT3 A;  2CTN A;  4C0K A;  1B7T Y;  2E30 A;  1FPW A;  3BUM B;  2QPT A;  3K21 A;  3I5H C;  2BKI B;  5I8N A;  1DF0 A;  1V1G A;  1DGV A;  2CCM A;  2JPT A;  1PSB A;  2I2R E;  1NCZ A;  1A2X A;  5HLV A;  3O6B A;  4ETO A;  4XYN A;  4PHN A;  1Y1A A;  2L50 A;  1SMG A;  1SK6 D;  2G2B A;  1B8C A;  1CM4 A;  2KAV A;  3DF0 B;  2KYC A;  1JC2 A;  1EH2 A;  1JWD A;  1ZFS A;  5K89 A;  2K7B A;  3I5I B;  2MLE C;  3M0W A;  1YVL A;  2Y4Q A;  3SG4 A;  1N65 A;  4NDD A;  1LA3 A;  1B4C A;  2F3Y A;  2Q4U A;  3FS7 A;  3VRP A;  1SNL A;  2CNP A;  2KGB C;  3SG2 A;  2WCE A;  2LLS A;  1M39 A;  2MJW B;  2LLU A;  1PK0 D;  4AQI A;  3AKB A;  2D8N A;  1QS7 A;  2LP2 A;  1RK9 A;  3FIA A;  4MBE A;  1ZOT B;  4IL1 A;  4I5K A;  2LUX A;  1CDM A;  1AJ5 A;  2F3Z A;  3HCM A;  2KAX A;  1KFU S;  1TNQ A;  1A75 A;  3BUW B;  2BBN A;  2H61 C;  5D7F A;  3PM8 A;  4P2Y B;  1TN4 A;  1R6P A;  5AXI A;  1A03 A;  1QJT A;  2ZRS A;  3PAL A;  5CSN A;  1EL4 A;  2M49 B;  2KYF A;  1K2H A;  3JTD C;  2JXC A;  1SL9 A;  2L98 A;  2NCP A;  3LK0 A;  1TOP A;  3PLF B;  1DTL A;  4YGE B;  4HRH A;  4ZCU A;  2QAC A;  2I18 A;  3EK4 A;  2HQ8 A;  1SW8 A;  1J55 A;  3A4U B;  1B47 A;  4XJK B;  1MR8 A;  3I5G C;  2KI6 D;  1XO5 A;  1TCF A;  2MRD A;  1UHK A;  3DVM A;  1BG1 A;  1NCY A;  3KHE A;  2FCE A;  3QRX A;  1CDN A;  1DF0 B;  1KCY A;  2L51 A;  1A4P A;  4WRI A;  4OVN F;  2PAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...