4M2OA

Crystal structure of a non-myristoylated c39a recoverin mutant with one calcium ion bound to ef-hand 3
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
191
structure length
191
Chain Sequence
GALSKEILEELQLNTKFTEEELSSWYQSFLKEAPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Recoverin
publication title A Highly Conserved Cysteine of Neuronal Calcium-sensing Proteins Controls Cooperative Binding of Ca2+ to Recoverin.
pubmed doi rcsb
source organism Bos taurus
total genus 78
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2oA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2oA01
1XYDA 3AKAA 3OX5A 2LMTA 1X02A 1BOCA 2KFGA 2LHLA 1B47A 1QX7A 1PSRA 1U5IB 1S5GZ 1KSMA 4NDBA 3KO0A 1IQ3A 4GFTA 4YGEB 3FS7A 1PALA 3BYAA 4OV2A 1J55A 1TNWA 3EKJA 3DF0B 4C0JA 3VRNA 1SKTA 5HKWA 2KFFA 2MLFC 2BBNA 1A75B 2JNXA 2VRGA 4GGNA 1SR6C 2WC8A 1RROA 3TS5B 2CTNA 1NP8A 2JZIA 4NDCA 2KGBC 2OTGC 1DJYA 1J7RA 2HPSA 1M45A 1QLSA 2KI4B 3DD4A 2BCAA 2K61A 5J3XA 2ZRTA 1NCZA 1CB1A 1W7IB 1A2XA 1B8LA 1FW4A 2LMVA 4HSZA 1NSHA 4N5XA 2EHBA 2WORA 1CM1A 2OS8B 1R6PA 2KAYA 1F4OA 3DVEA 3WHUB 2HQWA 2A4JA 2KSPA 3SJSA 4E68A 2L5XB 3BUWB 2K7CA 1JF2A 3PLFB 5D7FA 5I2OA 3NSLA 5TNCA 3TDIA 2WOSA 3EK8A 4AQIA 2KAXA 4MN0A 4C0LA 1EJ3A 2JT0A 4U8DA 3I5FB 2JRFA 2F3ZA 2WNDA 1NYAA 4QJ4B 2H61A 1QVIZ 2KAVA 1N65A 1PVBA 3CTNA 1K96A 4MRXA 2COLB 1S1EA 2LVKA 5F6TA 3LL8B 4R1EA 5I2LA 3BXKA 2M49B 1SK6D 1ODBA 3VROA 1B7TY 2O5GA 2LNKA 4OKHA 3CS1A 3OB2B 2CXJA 4YGAA 3I5GC 1R2UA 1YX8A 1S6IA 2MA2A 1B8CA 1UHIA 1DJXA 3JTDB 4MZJA 1JSAA 2CCMA 4CIDA 3AKBA 2GGZA 1SCMB 2L0PA 1M31A 3GK4X 1JF0A 1N2DA 1S6JA 1SY9A 1IJ5A 2FCDA 3PM8A 1J1EA 3LCPC 4I5JA 3A4UB 5HKZA 1XFXO 4ZCVA 1K9PA 3IQQA 1OE9B 1KQMB 3KPXA 1S36A 1SBJA 1F70A 4GAOA 4HREE 2AUCA 2M1UA 4I5LB 4IL1A 3I5HB 1JFJA 2CT9A 1YUUA 3WXAA 1PULA 1YURA 1KK8C 2MBXA 1CKKA 4GGFC 3CGAA 1DJHA 1IQ5A 1ZUZA 1JUOA 1S26D 4GBAA 1TOPA 1MHOA 4F0ZB 2KBMA 1F4QA 5ER4X 1GGWA 3OX6A 4DS7A 2BBMA 1BODA 2BL0C 2FJUB 2H2KA 2LVVA 1OMDA 2M0RA 3A8RA 1DF0A 2K2AA 2LMUA 1IKUA 1A29A 2KQ6A 2BCBA 4WRIA 1MWNA 1F8HA 1VRKA 2ZRSA 4JWQA 1XFWO 1YR5A 1FI5A 1QIVA 2M97A 4M2OA 5BPJA 5KU1A 1LA0A 2K0JA 5AANA 1UP5A 1UHNA 2JT3A 2ZNEA 4PHNA 2LHIA 1AP4A 4PHJA 3D10A 2HETA 1NX1A 2EC6B 1MUXA 3SG3A 2ZKMX 4MVFA 1WRZA 2V53A 1NCXA 2LP3A 1ZFSA 1CLLA 5DKNA 2M9GA 3BOWB 1WRLA 4PALA 2HF5A 2I18A 3KF9A 1SNLA 1EG3A 5CSNA 3CLNA 4CFQA 2D8NA 1YVLA 2OS8C 3BUOB 2JC2A 4MZLA 3TUYC 2Q4UA 1C07A 2QACA 2PRUA 3PFVA 2PSRA 5CSFA 1AHRA 1K94A 3NSOA 1XO5A 1NX3A 1KFUL 4MLWA 2LE9B 2F33A 2KYFA 2WCBA 3BUXB 1K9UA 2LVJA 1M46A 3EK7A 1TNQA 1MXLC 3EVRA 1AJ5A 1RECA 1YRTB 2ZNDA 3JVTC 4GPLB 4BY4A 1AK8A 1B1GA 2PMYA 1RK9A 1TTXA 4CLNA 3BUNB 2KNEA 4PDZA 2R2IA 2BE4A 3CR5X 1LVCD 4YBHB 1QJTA 5D69A 1KK7Y 2LLSA 2K7BA 1QASA 3GK1A 3PATA 2LCPA 1OSAA 1N0YA 3SG2A 2PVBA 1YRUB 2LC5A 1OOJA 1ZOTB 1EG4A 4HRHA 2GV5A 1RJVA 2JWWA 1XFUO 2TN4A 2KBIA 4AOMA 1D1OA 5HLVA 1QTXA 1AJ4A 1KFXS 3OB1B 2I7AA 3JTDC 1PK0D 2FOTA 2M1KB 1SCMC 2JTZA 2PALA 1K93D 1QV0A 3O2PA 2M7LA 3BOWA 2SCPA 3EKHA 2NXQA 4MEWA 4GNKB 4XYNA 1MQ1A 1L2OB 1LXFC 1S5GY 3OHMB 5KSZA 1CFPA 5ER5A 3SG4A 2KI6C 4M2QA 1ALVA 4ICBA 3FWCA 4USLA 1TN4A 2OPOA 4NDDA 4PHMA 1TCFA 1DF0B 2LAPA 1V1FA 3RLZA 2ZFDA 5HYDA 4GGFA 1AUIB 5B8IB 1LKJA 1V1GA 2BCXA 1XK4A 1FBVA 2KGRA 1XFYO 2BKIB 3O4YA 1EH2A 4M2PA 2F2OA 3SG5A 1KCYA 1SR6B 1UHHA 1EL4A 5JOLA 3PN7B 1KSOA 3DVKA 1KWOB 1WDCB 3CR2A 1UUSA 3F45A 1F54A 2SASA 2OTGB 1WY9A 5AERA 4A4BA 1QS7A 2BE6A 2G2BA 2GGMA 1UWOA 1NIWA 1IJ6A 3VGOA 2KQYA 3CZTX 1NX0A 2JTTA 4D1EA 4JQ0D 1DJIA 2L98A 1M63B 2LM5A 3KHEA 3NXAA 5K89A 1DJGA 1CFCA 4DRWA 4MBEA 4FTGA 1BU3A 4HRGA 2K2FA 2MLEC 1K8UA 3PALA 2F3YA 2EGDA 5AFPA 4C0KA 2K8MB 2O60A 5FYXA 1OMRA 1PRWA 1CDPA 4PCWA 3WNXB 2EC6C 1SW8A 1K95A 1NCYA 1YTZC 3BQ3A 3BUMB 1BG1A 1BR1B 1BJFA 1A4PA 2L4IA 2Y1NA 1L7ZA 3RM1A 1UHJA 1SMGA 1K9KA 1QVIY 1DJWA 2L51A 3VRPA 4PHKA 1DGVA 3CR4X 3DVMA 4Q04A 2PASA 3MSEB 2MHHA 1CFFA 1SYMA 1BF5A 3SG7A 1NPQA 1Y0VH 4I5KA 2H61C 3C1VA 4YI9A 1ZMZA 3K21A 1H4BA 2FCEA 1IH0A 1G8IA 3I5GB 4MRYA 1DTLA 1B4CA 2RGIA 4N1GA 3TS5C 1CLMA 1TCOB 1SL7A 4YRUA 2M8UA 1MR8A 1OZSA 1GJYA 2KI4C 1XFZO 3IQOA 2L2EA 2I94A 2AAOA 1HQVA 2LLUA 2M3WA 4PE1A 1DVIA 2F2PA 4A4CA 2ZN9A 2P6BB 3LK0A 1QV1A 2CNPA 5IBWA 1C7VA 1JFKA 4PE7A 2ISDA 1WLZA 1Y1XA 2JNFA 1SCVA 1J1DA 1CFDA 1EXRA 5PALA 1JWDA 1KK8B 3WHTB 4P2YB 3EVVA 1J7OA 2LLTA 1Y1AA 1A03A 2Y5IA 2Y4QA 4PE0A 1KFXL 3M0WA 1OQPA 3AAJA 4DIRA 4CPVA 1PVAA 1IG5A 3TDZA 5AEQA 3D0YB 1C7WA 1BLQA 3ZWHA 1QX2A 3VRRA 2BL0B 4OVNF 3I5FC 1L2OC 1CMGA 4GUKA 1UURA 1YX7A 3CWGA 1BMOA 4YGBB 1JBAA 2L50A 2MJWB 2LV7A 4N1FA 1RWYA 2G9BA 4DUQA 3O6BA 5HLOA 1J7PA 2ZN8A 1GGZA 3EVUA 3I5IB 1B7TZ 1S6CA 1UHKA 2BKHB 1Y6WA 1SL9A 3PN7C 4YI8A 3FIAA 1KWOC 1WDCC 4ETOA 1HT9A 3VRQA 1IGVA 2B1UA 2LVIA 1JC2A 1TNPA 1K90D 2JU0A 4NQGA 2K7OA 2JXCA 3EK4A 1CM4A 1CDLA 3GK2A 2JQ6A 2LUXA 1CNPA 1M39A 1TIZA 2JOJA 1WRKA 1G4YR 4JPZB 1Q80A 1QIWA 1F71A 1SPYA 2WCFA 1FF1A 1B9AA 1KQMC 1W7JB 1QATA 3TUYB 3TZ1A 2KOTA 2E6WA 4TNCA 1SRAA 3PSRA 1CDNA 2KHNA 3I5HC 5I8NA 1KFUS 2QPTA 2WCEA 1CTRA 3FWBA 3SIBA 1FI6A 1CDMA 2F8PA 1BR4B 1PSBA 2AMIA 2MRDA 1QX5B 3D0YA 4PE4A 4ORBB 2LANA 3JVTB 1K2HA 1DGUA 1BT6A 2KDHA 1E8AA 1U5IA 2NZ0A 4FQOA 4YGCB 1OZOA 5HKYA 1S3PA 4WQ3A 1XVJA 5G08A 2KI6D 1CMFA 3DF0A 4OCIA 5CSJA 3HX4A 1DT7B 3SIAA 4L9MA 2MAZA 1YVHA 4ZCUA 5DKRA 1AVSA 1ZACA 1A75A 2Q91A 1H8BA 4P5OE 2HQ8A 4WQ2A 3O78A 4BY5A 4XJKB 3ICBA 4AQJA 1YUTA 2NLNA 4MZKA 3QRXA 3TDUA 1RFJA 1FPWA 1QXPA 2JXLA 1LA3A 3LK1A 1GQMA 4YGDB 2E30A 3KEVA 3SG6A 1WLMA 2DOQA 1LINA 1XA5A 3AAKA 3NSKA 2JT8A 1DJZA 1MF8B 3H4SE 4MSPA 1CLBA 1G33A 3IF7A 2BECA 5I2QA 3ZNIA 2LUCA 3OP0A 3HCMA 4ORCB 1XFVO 1Y1UA 1IWQA 2CBLA 4QJ3B 2JPTA 2L4HA 1B8RA 1F55A 4UPGA 4I5NB 1XK4C 1IRJA 3LLEA 2Y1MA 2LP2A 5JJGA 5KTYA 2IS9A 2KYCA 5CPVA 1QLKA 5DKQA 4ORAB 4QJ5B 1RTP1 1NWDA 1TNXA 2KFHA 2M29A 2JULA 1ALWA 2NCOA 3DVJA 1TRFA 3GOFA 3NSIA 3E3RA 1KK7Z 1NX2A 1SL8A 5AXIA 1DMOA 1MXEA 1YUSA 4XJKA 2M7NA 5CSIA 3I5IC 1OMVA 2NCPA 4CFRA 5GQQC 1KQVA 1NUBA 4OR9B 2I2RE 4DCKA 1J7QA 2K7DA
chains in the Genus database with same CATH superfamily
1XYDA 3AKAA 3OX5A 2LMTA 1X02A 5FI7A 1BOCA 2KFGA 2LHLA 1B47A 1QX7A 1PSRA 1U5IB 1S5GZ 1KSMA 4NDBA 3KO0A 1IQ3A 1OOIX 4GFTA 4YGEB 3FS7A 1PALA 3BYAA 3FE8A 1J55A 4OV2A 1TNWA 3EKJA 3DF0B 4C0JA 3VRNA 1SKTA 2L2CA 1SSEB 5HKWA 2KFFA 2MLFC 2BBNA 1A75B 2JNXA 2VRGA 3K1EA 4GGNA 1SR6C 2WC8A 1RROA 3TS5B 2CTNA 1NP8A 2JZIA 4NDCA 2KGBC 2OTGC 2QEBA 1DJYA 1J7RA 2HPSA 1M45A 1QLSA 2KI4B 3DD4A 3S0AA 2BCAA 2K60A 2K61A 5J3XA 2ZRTA 1NCZA 1CB1A 1W7IB 1A2XA 1B8LA 1FW4A 2LMVA 4HSZA 1NSHA 4N5XA 2EHBA 2KPHA 3L4AA 2WORA 1CM1A 2OS8B 1R6PA 2ERBA 2KAYA 1F4OA 3DVEA 3WHUB 2HQWA 2A4JA 2KSPA 3SJSA 4E68A 2L5XB 1XFRA 3BUWB 1DELA 1JF2A 2K7CA 2WCJA 3DZTA 3NSLA 3PLFB 5D7FA 5TNCA 3TDIA 5I2OA 2WOSA 3EK8A 2WCMA 4AQIA 2H8VA 2KAXA 3D78A 4MN0A 4C0LA 1EJ3A 2JT0A 4U8DA 3I5FB 2JRFA 2F3ZA 2WNDA 2JPOA 1NYAA 4QJ4B 2H61A 1QVIZ 2KAVA 1N65A 1PVBA 3CTNA 1K96A 4MRXA 2COLB 1GM0A 1S1EA 2LVKA 5F6TA 3LL8B 4R1EA 5I94A 5I2LA 3BXKA 2M49B 1SK6D 1ODBA 3VROA 1B7TY 2O5GA 2LNKA 5FI6A 4OKHA 3CS1A 3OB2B 2CXJA 4YGAA 3I5GC 1R2UA 1YX8A 1S6IA 2MA2A 1B8CA 1UHIA 1DJXA 3JTDB 4MZJA 2WCLA 2CCMA 4CIDA 1JSAA 2WC5A 3AKBA 2GGZA 1SCMB 2L0PA 1M31A 3GK4X 1JF0A 1N2DA 1S6JA 1SY9A 1IJ5A 5DICA 2FCDA 3PM8A 1J1EA 3LCPC 4I5JA 3A4UB 5HKZA 1XFXO 4ZCVA 1K9PA 3IQQA 1OE9B 1KQMB 3KPXA 1S36A 1SBJA 1F70A 4GAOA 4HREE 2AUCA 2M1UA 4I5LB 4IL1A 3I5HB 1JFJA 2CT9A 1YUUA 3WXAA 1PULA 1YURA 3PJIA 1KK8C 3DXLA 2MBXA 1CKKA 4GGFC 3CGAA 1DJHA 1IQ5A 1ZUZA 1JUOA 1S26D 4GBAA 1TOPA 1MHOA 3FE9A 4F0ZB 2KBMA 1F4QA 5ER4X 2PQLA 1GGWA 3OX6A 4DS7A 2BBMA 4INWA 4OZDA 1BODA 2BL0C 2FJUB 2H2KA 2LVVA 1C3YA 1OMDA 2M0RA 3A8RA 1DF0A 2K2AA 2LMUA 1IKUA 1A29A 2BAPA 2BCBA 2KQ6A 1MWNA 3DY9A 3N7HA 2KLDA 4WRIA 3D73A 1VRKA 1F8HA 2ZRSA 4JWQA 1XFWO 1YR5A 1FI5A 1QIVA 2M97A 4M2OA 5BPJA 5KU1A 1LA0A 3OBVA 2K0JA 5AANA 1UP5A 3B6XA 1UHNA 2JT3A 2ZNEA 3R1PA 4PHNA 2LHIA 1AP4A 4PHJA 3D10A 2HETA 1NX1A 3B88A 1OOHA 2EC6B 3PM2A 1MUXA 3SG3A 2ZKMX 4MVFA 1WRZA 2V53A 1NCXA 2LP3A 1ZFSA 1CLLA 3CABA 3CDNA 2M9GA 5DKNA 3BOWB 1WRLA 4PALA 2HF5A 2I18A 3KF9A 1SNLA 1EG3A 4IJ7A 5CSNA 3CLNA 4CFQA 2D8NA 1YVLA 2OS8C 3Q8IA 3BUOB 2JC2A 3NHIA 4MZLA 3TUYC 2Q4UA 3S0FA 1C07A 2QACA 2PRUA 3PFVA 1OW4A 2PSRA 5CSFA 1AHRA 3BFHA 1K94A 2PYQA 3CZ2A 3NSOA 1XO5A 1NX3A 3QMEA 1KFUL 4MLWA 3SS3A 2LE9B 2F33A 2KYFA 2WCBA 3BUXB 1K9UA 2LVJA 1M46A 3EK7A 1TNQA 1MXLC 3EVRA 1AJ5A 1RECA 1YRTB 2ZNDA 3JVTC 4GPLB 4BY4A 1AK8A 1B1GA 2PMYA 1RK9A 1TTXA 4CLNA 3BUNB 2KNEA 4PDZA 2R2IA 2BE4A 3CR5X 1OOGA 1LVCD 4YBHB 1QJTA 5D69A 1KK7Y 2LLSA 2K7BA 1QASA 3B87A 3GK1A 2LCPA 1OSAA 1N0YA 3PATA 3SG2A 2PVBA 1YRUB 2LC5A 1OOJA 3FE6A 1ZOTB 1EG4A 4HRHA 3B86A 2GV5A 1RJVA 2JWWA 1XFUO 2TN4A 1TUZA 2KBIA 4AOMA 1D1OA 1C3ZA 1QTXA 1AJ4A 5HLVA 1KFXS 3SS4A 3OB1B 2I7AA 3JTDC 1PK0D 2FOTA 2M1KB 1SCMC 2JTZA 2PALA 1K93D 1QV0A 3O2PA 2M7LA 3BOWA 2SCPA 3EKHA 3S0GA 2GTEA 2NXQA 4MEWA 4GNKB 4XYNA 1MQ1A 1L2OB 1LXFC 1S5GY 3OHMB 5KSZA 1CFPA 5ER5A 3SG4A 3D74A 2KI6C 2FJYA 1ALVA 4ICBA 3FWCA 4M2QA 1TN4A 4USLA 2OPOA 4NDDA 4PHMA 1TCFA 1DF0B 2LAPA 1V1FA 3RLZA 2ZFDA 5HYDA 4GGFA 1AUIB 5B8IB 1LKJA 1V1GA 2BCXA 4INXA 1XK4A 1LS8A 1FBVA 2KGRA 1XFYO 4FQTA 2BKIB 3O4YA 1EH2A 5FI2A 4M2PA 2F2OA 3SG5A 5HL1A 1KCYA 1SR6B 1UHHA 1EL4A 5JOLA 3PN7B 1KSOA 3DVKA 1KWOB 1WDCB 3CR2A 1UUSA 3F45A 1F54A 2SASA 2L5YA 2OTGB 1WY9A 3CZ0A 4A4BA 3D76A 5AERA 1QS7A 2BE6A 2G2BA 2GGMA 1UWOA 3S0DA 1NIWA 1IJ6A 3VGOA 2KQYA 3CZTX 1NX0A 2JTTA 4D1EA 3RZSA 3VB1A 4JQ0D 1DJIA 2L98A 1M63B 2LM5A 3KHEA 3NXAA 5K89A 1DJGA 1CFCA 4DRWA 4MBEA 4FTGA 1BU3A 4HRGA 2K2FA 2MLEC 1K8UA 3PALA 2F3YA 2EGDA 5AFPA 4C0KA 2K8MB 2O60A 5FYXA 1OMRA 3BJHA 1PRWA 1CDPA 4PCWA 5EL2A 2EC6C 3WNXB 1SW8A 1K95A 1NCYA 1YTZC 3BQ3A 3BUMB 1BG1A 1BR1B 1BJFA 1A4PA 2L4IA 2Y1NA 1L7ZA 3BFAA 1UHJA 3RM1A 1SMGA 1K9KA 1QVIY 3D77A 2KLEA 1DJWA 2L51A 3VRPA 4PHKA 1DGVA 3CR4X 3DVMA 4Q04A 2PASA 3MSEB 2MHHA 1CFFA 1SYMA 1BF5A 3SG7A 1NPQA 1Y0VH 4I5KA 2H61C 3C1VA 4YI9A 1ZMZA 2QEOA 1TUJA 3K21A 1H4BA 2FCEA 1IH0A 1G8IA 3I5GB 4KYNA 4MRYA 1DTLA 1B4CA 2RGIA 4N1GA 3TS5C 1CLMA 1TCOB 1SL7A 4YRUA 2M8UA 1MR8A 1OOFA 1OZSA 1GJYA 2KI4C 1XFZO 3IQOA 2L2EA 2I94A 2AAOA 1HQVA 2LLUA 2M3WA 4PE1A 1DVIA 2F2PA 4A4CA 2ZN9A 2P6BB 3LK0A 1QV1A 2CNPA 2P70A 5IBWA 1C7VA 1JFKA 4PE7A 2ISDA 1WLZA 1Y1XA 2JNFA 1SCVA 3EG5B 1J1DA 1CFDA 1EXRA 5PALA 3UNWA 1JWDA 1KK8B 3WHTB 4P2YB 3EVVA 1J7OA 2LLTA 1Y1AA 1A03A 2Y5IA 2Y4QA 4PE0A 1KFXL 3M0WA 1OQPA 3AAJA 4DIRA 4CPVA 3NHTA 1PVAA 1IG5A 3TDZA 5AEQA 3D0YB 1C7WA 2YGUA 1BLQA 3ZWHA 1QX2A 3VRRA 2BL0B 4OVNF 3I5FC 4PT1A 1L2OC 1CMGA 4GUKA 3DYEA 1UURA 1YX7A 3CWGA 1BMOA 2WC6A 4YGBB 1JBAA 2L50A 3D75A 2MJWB 2LV7A 3OGNA 4N1FA 1RWYA 2G9BA 4DUQA 3O6BA 5HLOA 1J7PA 2ZN8A 1DEKA 1GGZA 3EVUA 3I5IB 1B7TZ 1W9ZA 1S6CA 1UHKA 2BKHB 1Y6WA 1SL9A 3PN7C 4YI8A 3FIAA 1KWOC 1WDCC 4ETOA 1HT9A 3VRQA 1IGVA 2B1UA 2LVIA 1JC2A 1TNPA 1K90D 2JU0A 4NQGA 2K7OA 2JXCA 3EK4A 1CM4A 1CDLA 3B7AA 3GK2A 2JQ6A 2LUXA 1CNPA 1M39A 1TIZA 2JOJA 1WRKA 1G4YR 4JPZB 1Q80A 2QEVA 1QIWA 4JD9A 1SPYA 2WCFA 1F71A 1FF1A 1B9AA 1KQMC 1W7JB 1QATA 3TUYB 3TZ1A 2KOTA 2E6WA 4TNCA 1SRAA 3PSRA 1CDNA 2KHNA 3I5HC 5I8NA 1KFUS 2QPTA 2WCEA 1CTRA 3FWBA 3SIBA 3BFBA 1FI6A 3NGVA 1CDMA 2F8PA 1BR4B 1PSBA 2AMIA 2MRDA 4F7FA 1QX5B 3D0YA 4PE4A 4ORBB 2LANA 2QDIA 3JVTB 1K2HA 1DGUA 3SS5A 1BT6A 2KDHA 1E8AA 1U5IA 2NZ0A 4FQOA 4YGCB 1OZOA 5HKYA 1S3PA 4WQ3A 1XVJA 2BNXA 5G08A 2KI6D 1CMFA 3DF0A 4OCIA 5CSJA 3HX4A 1DT7B 1DQEA 3SIAA 4L9MA 2MAZA 1YVHA 4ZCUA 5DKRA 1AVSA 1ZACA 1A75A 2Q91A 1H8BA 4P5OE 2HQ8A 2QEHA 3O78A 4WQ2A 4BY5A 3S0BA 4XJKB 3ICBA 3L47A 4AQJA 1YUTA 3CZ1A 2NLNA 4MZKA 3QRXA 3TDUA 5D3OA 1RFJA 1FPWA 1QXPA 2JXLA 1LA3A 3LK1A 1GQMA 4YGDB 2E30A 1ORGA 3CYZA 3KEVA 3SG6A 1WLMA 3IVTA 2DOQA 1LINA 1XA5A 2WCKA 3AAKA 3NSKA 2JT8A 1DJZA 1MF8B 3H4SE 4MSPA 1CLBA 1G33A 3IF7A 2BECA 2P71A 5I2QA 3ZNIA 2LUCA 3OP0A 3HCMA 4ORCB 1XFVO 1TWOA 1Y1UA 1IWQA 2CBLA 4QJ3B 2JPTA 2L4HA 1B8RA 1F55A 4UPGA 4I5NB 1XK4C 1IRJA 3LLEA 2Y1MA 1IIOA 2LP2A 5JJGA 5KTYA 2IS9A 2KYCA 5CPVA 1QLKA 5DKQA 4ORAB 4QJ5B 1RTP1 1NWDA 1TNXA 2KFHA 2M29A 2JULA 1ALWA 2NCOA 3DVJA 1TRFA 3GOFA 1T14A 3NSIA 3E3RA 1KK7Z 1NX2A 3R1VA 1SL8A 3V2LA 5AXIA 1DMOA 1MXEA 1YUSA 4XJKA 2M7NA 1Z4HA 3O4XA 5CSIA 3I5IC 1OMVA 2NCPA 4JKTA 3R72A 3S0EA 4CFRA 5GQQC 3R1OA 1Z2CB 1KQVA 1NUBA 1P28A 3UO9A 4OR9B 2I2RE 4DCKA 2WCHA 1QWVA 3L4LA 1J7QA 1DC1A 2K7DA
chains in the Genus database with same CATH topology
1XYDA 3AKAA 3OX5A 2LMTA 1X02A 1BOCA 2KFGA 2LHLA 1B47A 1QX7A 1PSRA 1U5IB 1S5GZ 1KSMA 4NDBA 3KO0A 1IQ3A 4GFTA 4YGEB 3FS7A 1PALA 3BYAA 4OV2A 1J55A 1TNWA 3EKJA 3DF0B 4C0JA 3VRNA 1SKTA 5HKWA 2KFFA 2MLFC 2BBNA 1A75B 2JNXA 2VRGA 4GGNA 1SR6C 2WC8A 1RROA 3TS5B 2CTNA 1NP8A 2JZIA 4NDCA 2KGBC 2OTGC 1DJYA 1J7RA 2HPSA 1M45A 1QLSA 2KI4B 3DD4A 2BCAA 2K61A 5J3XA 2ZRTA 1NCZA 1CB1A 1W7IB 1A2XA 1B8LA 1FW4A 2LMVA 4HSZA 1NSHA 4N5XA 2EHBA 2WORA 1CM1A 2OS8B 1R6PA 2KAYA 1F4OA 3DVEA 3WHUB 2HQWA 2A4JA 2KSPA 3SJSA 4E68A 2L5XB 3BUWB 2K7CA 1JF2A 3PLFB 5D7FA 5I2OA 3NSLA 5TNCA 3TDIA 2WOSA 3EK8A 4AQIA 2KAXA 4MN0A 4C0LA 1EJ3A 2JT0A 4U8DA 3I5FB 2JRFA 2F3ZA 2WNDA 1NYAA 4QJ4B 2H61A 1QVIZ 2KAVA 1N65A 1PVBA 3CTNA 1K96A 4MRXA 2COLB 1S1EA 2LVKA 5F6TA 3LL8B 4R1EA 5I2LA 3BXKA 2M49B 1SK6D 1ODBA 3VROA 1B7TY 2O5GA 2LNKA 4OKHA 3CS1A 3OB2B 2CXJA 4YGAA 3I5GC 1R2UA 1YX8A 1S6IA 2MA2A 1B8CA 1UHIA 1DJXA 3JTDB 4MZJA 1JSAA 2CCMA 4CIDA 3AKBA 2GGZA 1SCMB 2L0PA 1M31A 3GK4X 1JF0A 1N2DA 1S6JA 1SY9A 1IJ5A 2FCDA 3PM8A 1J1EA 3LCPC 4I5JA 3A4UB 5HKZA 1XFXO 4ZCVA 1K9PA 3IQQA 1OE9B 1KQMB 3KPXA 1S36A 1SBJA 1F70A 4GAOA 4HREE 2AUCA 2M1UA 4I5LB 4IL1A 3I5HB 1JFJA 2CT9A 1YUUA 3WXAA 1PULA 1YURA 1KK8C 2MBXA 1CKKA 4GGFC 3CGAA 1DJHA 1IQ5A 1ZUZA 1JUOA 1S26D 4GBAA 1TOPA 1MHOA 4F0ZB 2KBMA 1F4QA 5ER4X 1GGWA 3OX6A 4DS7A 2BBMA 1BODA 2BL0C 2FJUB 2H2KA 2LVVA 1OMDA 2M0RA 3A8RA 1DF0A 2K2AA 2LMUA 1IKUA 1A29A 2KQ6A 2BCBA 4WRIA 1MWNA 1F8HA 1VRKA 2ZRSA 4JWQA 1XFWO 1YR5A 1FI5A 1QIVA 2M97A 4M2OA 5BPJA 5KU1A 1LA0A 2K0JA 5AANA 1UP5A 1UHNA 2JT3A 2ZNEA 4PHNA 2LHIA 1AP4A 4PHJA 3D10A 2HETA 1NX1A 2EC6B 1MUXA 3SG3A 2ZKMX 4MVFA 1WRZA 2V53A 1NCXA 2LP3A 1ZFSA 1CLLA 5DKNA 2M9GA 3BOWB 1WRLA 4PALA 2HF5A 2I18A 3KF9A 1SNLA 1EG3A 5CSNA 3CLNA 4CFQA 2D8NA 1YVLA 2OS8C 3BUOB 2JC2A 4MZLA 3TUYC 2Q4UA 1C07A 2QACA 2PRUA 3PFVA 2PSRA 5CSFA 1AHRA 1K94A 3NSOA 1XO5A 1NX3A 1KFUL 4MLWA 2LE9B 2F33A 2KYFA 2WCBA 3BUXB 1K9UA 2LVJA 1M46A 3EK7A 1TNQA 1MXLC 3EVRA 1AJ5A 1RECA 1YRTB 2ZNDA 3JVTC 4GPLB 4BY4A 1AK8A 1B1GA 2PMYA 1RK9A 1TTXA 4CLNA 3BUNB 2KNEA 4PDZA 2R2IA 2BE4A 3CR5X 1LVCD 4YBHB 1QJTA 5D69A 1KK7Y 2LLSA 2K7BA 1QASA 3GK1A 3PATA 2LCPA 1OSAA 1N0YA 3SG2A 2PVBA 1YRUB 2LC5A 1OOJA 1ZOTB 1EG4A 4HRHA 2GV5A 1RJVA 2JWWA 1XFUO 2TN4A 2KBIA 4AOMA 1D1OA 5HLVA 1QTXA 1AJ4A 1KFXS 3OB1B 2I7AA 3JTDC 1PK0D 2FOTA 2M1KB 1SCMC 2JTZA 2PALA 1K93D 1QV0A 3O2PA 2M7LA 3BOWA 2SCPA 3EKHA 2NXQA 4MEWA 4GNKB 4XYNA 1MQ1A 1L2OB 1LXFC 1S5GY 3OHMB 5KSZA 1CFPA 5ER5A 3SG4A 2KI6C 4M2QA 1ALVA 4ICBA 3FWCA 4USLA 1TN4A 2OPOA 4NDDA 4PHMA 1TCFA 1DF0B 2LAPA 1V1FA 3RLZA 2ZFDA 5HYDA 4GGFA 1AUIB 5B8IB 1LKJA 1V1GA 2BCXA 1XK4A 1FBVA 2KGRA 1XFYO 2BKIB 3O4YA 1EH2A 4M2PA 2F2OA 3SG5A 1KCYA 1SR6B 1UHHA 1EL4A 5JOLA 3PN7B 1KSOA 3DVKA 1KWOB 1WDCB 3CR2A 1UUSA 3F45A 1F54A 2SASA 2OTGB 1WY9A 5AERA 4A4BA 1QS7A 2BE6A 2G2BA 2GGMA 1UWOA 1NIWA 1IJ6A 3VGOA 2KQYA 3CZTX 1NX0A 2JTTA 4D1EA 4JQ0D 1DJIA 2L98A 1M63B 2LM5A 3KHEA 3NXAA 5K89A 1DJGA 1CFCA 4DRWA 4MBEA 4FTGA 1BU3A 4HRGA 2K2FA 2MLEC 1K8UA 3PALA 2F3YA 2EGDA 5AFPA 4C0KA 2K8MB 2O60A 5FYXA 1OMRA 1PRWA 1CDPA 4PCWA 3WNXB 2EC6C 1SW8A 1K95A 1NCYA 1YTZC 3BQ3A 3BUMB 1BG1A 1BR1B 1BJFA 1A4PA 2L4IA 2Y1NA 1L7ZA 3RM1A 1UHJA 1SMGA 1K9KA 1QVIY 1DJWA 2L51A 3VRPA 4PHKA 1DGVA 3CR4X 3DVMA 4Q04A 2PASA 3MSEB 2MHHA 1CFFA 1SYMA 1BF5A 3SG7A 1NPQA 1Y0VH 4I5KA 2H61C 3C1VA 4YI9A 1ZMZA 3K21A 1H4BA 2FCEA 1IH0A 1G8IA 3I5GB 4MRYA 1DTLA 1B4CA 2RGIA 4N1GA 3TS5C 1CLMA 1TCOB 1SL7A 4YRUA 2M8UA 1MR8A 1OZSA 1GJYA 2KI4C 1XFZO 3IQOA 2L2EA 2I94A 2AAOA 1HQVA 2LLUA 2M3WA 4PE1A 1DVIA 2F2PA 4A4CA 2ZN9A 2P6BB 3LK0A 1QV1A 2CNPA 5IBWA 1C7VA 1JFKA 4PE7A 2ISDA 1WLZA 1Y1XA 2JNFA 1SCVA 1J1DA 1CFDA 1EXRA 5PALA 1JWDA 1KK8B 3WHTB 4P2YB 3EVVA 1J7OA 2LLTA 1Y1AA 1A03A 2Y5IA 2Y4QA 4PE0A 1KFXL 3M0WA 1OQPA 3AAJA 4DIRA 4CPVA 1PVAA 1IG5A 3TDZA 5AEQA 3D0YB 1C7WA 1BLQA 3ZWHA 1QX2A 3VRRA 2BL0B 4OVNF 3I5FC 1L2OC 1CMGA 4GUKA 1UURA 1YX7A 3CWGA 1BMOA 4YGBB 1JBAA 2L50A 2MJWB 2LV7A 4N1FA 1RWYA 2G9BA 4DUQA 3O6BA 5HLOA 1J7PA 2ZN8A 1GGZA 3EVUA 3I5IB 1B7TZ 1S6CA 1UHKA 2BKHB 1Y6WA 1SL9A 3PN7C 4YI8A 3FIAA 1KWOC 1WDCC 4ETOA 1HT9A 3VRQA 1IGVA 2B1UA 2LVIA 1JC2A 1TNPA 1K90D 2JU0A 4NQGA 2K7OA 2JXCA 3EK4A 1CM4A 1CDLA 3GK2A 2JQ6A 2LUXA 1CNPA 1M39A 1TIZA 2JOJA 1WRKA 1G4YR 4JPZB 1Q80A 1QIWA 1F71A 1SPYA 2WCFA 1FF1A 1B9AA 1KQMC 1W7JB 1QATA 3TUYB 3TZ1A 2KOTA 2E6WA 4TNCA 1SRAA 3PSRA 1CDNA 2KHNA 3I5HC 5I8NA 1KFUS 2QPTA 2WCEA 1CTRA 3FWBA 3SIBA 1FI6A 1CDMA 2F8PA 1BR4B 1PSBA 2AMIA 2MRDA 1QX5B 3D0YA 4PE4A 4ORBB 2LANA 3JVTB 1K2HA 1DGUA 1BT6A 2KDHA 1E8AA 1U5IA 2NZ0A 4FQOA 4YGCB 1OZOA 5HKYA 1S3PA 4WQ3A 1XVJA 5G08A 2KI6D 1CMFA 3DF0A 4OCIA 5CSJA 3HX4A 1DT7B 3SIAA 4L9MA 2MAZA 1YVHA 4ZCUA 5DKRA 1AVSA 1ZACA 1A75A 2Q91A 1H8BA 4P5OE 2HQ8A 4WQ2A 3O78A 4BY5A 4XJKB 3ICBA 4AQJA 1YUTA 2NLNA 4MZKA 3QRXA 3TDUA 1RFJA 1FPWA 1QXPA 2JXLA 1LA3A 3LK1A 1GQMA 4YGDB 2E30A 3KEVA 3SG6A 1WLMA 2DOQA 1LINA 1XA5A 3AAKA 3NSKA 2JT8A 1DJZA 1MF8B 3H4SE 4MSPA 1CLBA 1G33A 3IF7A 2BECA 5I2QA 3ZNIA 2LUCA 3OP0A 3HCMA 4ORCB 1XFVO 1Y1UA 1IWQA 2CBLA 4QJ3B 2JPTA 2L4HA 1B8RA 1F55A 4UPGA 4I5NB 1XK4C 1IRJA 3LLEA 2Y1MA 2LP2A 5JJGA 5KTYA 2IS9A 2KYCA 5CPVA 1QLKA 5DKQA 4ORAB 4QJ5B 1RTP1 1NWDA 1TNXA 2KFHA 2M29A 2JULA 1ALWA 2NCOA 3DVJA 1TRFA 3GOFA 3NSIA 3E3RA 1KK7Z 1NX2A 1SL8A 5AXIA 1DMOA 1MXEA 1YUSA 4XJKA 2M7NA 5CSIA 3I5IC 1OMVA 2NCPA 4CFRA 5GQQC 1KQVA 1NUBA 4OR9B 2I2RE 4DCKA 1J7QA 2K7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XYD A;  3AKA A;  3OX5 A;  2LMT A;  1X02 A;  1BOC A;  2KFG A;  2LHL A;  1B47 A;  1QX7 A;  1PSR A;  1U5I B;  1S5G Z;  1KSM A;  4NDB A;  3KO0 A;  1IQ3 A;  4GFT A;  4YGE B;  3FS7 A;  1PAL A;  3BYA A;  4OV2 A;  1J55 A;  1TNW A;  3EKJ A;  3DF0 B;  4C0J A;  3VRN A;  1SKT A;  5HKW A;  2KFF A;  2MLF C;  2BBN A;  1A75 B;  2JNX A;  2VRG A;  4GGN A;  1SR6 C;  2WC8 A;  1RRO A;  3TS5 B;  2CTN A;  1NP8 A;  2JZI A;  4NDC A;  2KGB C;  2OTG C;  1DJY A;  1J7R A;  2HPS A;  1M45 A;  1QLS A;  2KI4 B;  3DD4 A;  2BCA A;  2K61 A;  5J3X A;  2ZRT A;  1NCZ A;  1CB1 A;  1W7I B;  1A2X A;  1B8L A;  1FW4 A;  2LMV A;  4HSZ A;  1NSH A;  4N5X A;  2EHB A;  2WOR A;  1CM1 A;  2OS8 B;  1R6P A;  2KAY A;  1F4O A;  3DVE A;  3WHU B;  2HQW A;  2A4J A;  2KSP A;  3SJS A;  4E68 A;  2L5X B;  3BUW B;  2K7C A;  1JF2 A;  3PLF B;  5D7F A;  5I2O A;  3NSL A;  5TNC A;  3TDI A;  2WOS A;  3EK8 A;  4AQI A;  2KAX A;  4MN0 A;  4C0L A;  1EJ3 A;  2JT0 A;  4U8D A;  3I5F B;  2JRF A;  2F3Z A;  2WND A;  1NYA A;  4QJ4 B;  2H61 A;  1QVI Z;  2KAV A;  1N65 A;  1PVB A;  3CTN A;  1K96 A;  4MRX A;  2COL B;  1S1E A;  2LVK A;  5F6T A;  3LL8 B;  4R1E A;  5I2L A;  3BXK A;  2M49 B;  1SK6 D;  1ODB A;  3VRO A;  1B7T Y;  2O5G A;  2LNK A;  4OKH A;  3CS1 A;  3OB2 B;  2CXJ A;  4YGA A;  3I5G C;  1R2U A;  1YX8 A;  1S6I A;  2MA2 A;  1B8C A;  1UHI A;  1DJX A;  3JTD B;  4MZJ A;  1JSA A;  2CCM A;  4CID A;  3AKB A;  2GGZ A;  1SCM B;  2L0P A;  1M31 A;  3GK4 X;  1JF0 A;  1N2D A;  1S6J A;  1SY9 A;  1IJ5 A;  2FCD A;  3PM8 A;  1J1E A;  3LCP C;  4I5J A;  3A4U B;  5HKZ A;  1XFX O;  4ZCV A;  1K9P A;  3IQQ A;  1OE9 B;  1KQM B;  3KPX A;  1S36 A;  1SBJ A;  1F70 A;  4GAO A;  4HRE E;  2AUC A;  2M1U A;  4I5L B;  4IL1 A;  3I5H B;  1JFJ A;  2CT9 A;  1YUU A;  3WXA A;  1PUL A;  1YUR A;  1KK8 C;  2MBX A;  1CKK A;  4GGF C;  3CGA A;  1DJH A;  1IQ5 A;  1ZUZ A;  1JUO A;  1S26 D;  4GBA A;  1TOP A;  1MHO A;  4F0Z B;  2KBM A;  1F4Q A;  5ER4 X;  1GGW A;  3OX6 A;  4DS7 A;  2BBM A;  1BOD A;  2BL0 C;  2FJU B;  2H2K A;  2LVV A;  1OMD A;  2M0R A;  3A8R A;  1DF0 A;  2K2A A;  2LMU A;  1IKU A;  1A29 A;  2KQ6 A;  2BCB A;  4WRI A;  1MWN A;  1F8H A;  1VRK A;  2ZRS A;  4JWQ A;  1XFW O;  1YR5 A;  1FI5 A;  1QIV A;  2M97 A;  4M2O A;  5BPJ A;  5KU1 A;  1LA0 A;  2K0J A;  5AAN A;  1UP5 A;  1UHN A;  2JT3 A;  2ZNE A;  4PHN A;  2LHI A;  1AP4 A;  4PHJ A;  3D10 A;  2HET A;  1NX1 A;  2EC6 B;  1MUX A;  3SG3 A;  2ZKM X;  4MVF A;  1WRZ A;  2V53 A;  1NCX A;  2LP3 A;  1ZFS A;  1CLL A;  5DKN A;  2M9G A;  3BOW B;  1WRL A;  4PAL A;  2HF5 A;  2I18 A;  3KF9 A;  1SNL A;  1EG3 A;  5CSN A;  3CLN A;  4CFQ A;  2D8N A;  1YVL A;  2OS8 C;  3BUO B;  2JC2 A;  4MZL A;  3TUY C;  2Q4U A;  1C07 A;  2QAC A;  2PRU A;  3PFV A;  2PSR A;  5CSF A;  1AHR A;  1K94 A;  3NSO A;  1XO5 A;  1NX3 A;  1KFU L;  4MLW A;  2LE9 B;  2F33 A;  2KYF A;  2WCB A;  3BUX B;  1K9U A;  2LVJ A;  1M46 A;  3EK7 A;  1TNQ A;  1MXL C;  3EVR A;  1AJ5 A;  1REC A;  1YRT B;  2ZND A;  3JVT C;  4GPL B;  4BY4 A;  1AK8 A;  1B1G A;  2PMY A;  1RK9 A;  1TTX A;  4CLN A;  3BUN B;  2KNE A;  4PDZ A;  2R2I A;  2BE4 A;  3CR5 X;  1LVC D;  4YBH B;  1QJT A;  5D69 A;  1KK7 Y;  2LLS A;  2K7B A;  1QAS A;  3GK1 A;  3PAT A;  2LCP A;  1OSA A;  1N0Y A;  3SG2 A;  2PVB A;  1YRU B;  2LC5 A;  1OOJ A;  1ZOT B;  1EG4 A;  4HRH A;  2GV5 A;  1RJV A;  2JWW A;  1XFU O;  2TN4 A;  2KBI A;  4AOM A;  1D1O A;  5HLV A;  1QTX A;  1AJ4 A;  1KFX S;  3OB1 B;  2I7A A;  3JTD C;  1PK0 D;  2FOT A;  2M1K B;  1SCM C;  2JTZ A;  2PAL A;  1K93 D;  1QV0 A;  3O2P A;  2M7L A;  3BOW A;  2SCP A;  3EKH A;  2NXQ A;  4MEW A;  4GNK B;  4XYN A;  1MQ1 A;  1L2O B;  1LXF C;  1S5G Y;  3OHM B;  5KSZ A;  1CFP A;  5ER5 A;  3SG4 A;  2KI6 C;  4M2Q A;  1ALV A;  4ICB A;  3FWC A;  4USL A;  1TN4 A;  2OPO A;  4NDD A;  4PHM A;  1TCF A;  1DF0 B;  2LAP A;  1V1F A;  3RLZ A;  2ZFD A;  5HYD A;  4GGF A;  1AUI B;  5B8I B;  1LKJ A;  1V1G A;  2BCX A;  1XK4 A;  1FBV A;  2KGR A;  1XFY O;  2BKI B;  3O4Y A;  1EH2 A;  4M2P A;  2F2O A;  3SG5 A;  1KCY A;  1SR6 B;  1UHH A;  1EL4 A;  5JOL A;  3PN7 B;  1KSO A;  3DVK A;  1KWO B;  1WDC B;  3CR2 A;  1UUS A;  3F45 A;  1F54 A;  2SAS A;  2OTG B;  1WY9 A;  5AER A;  4A4B A;  1QS7 A;  2BE6 A;  2G2B A;  2GGM A;  1UWO A;  1NIW A;  1IJ6 A;  3VGO A;  2KQY A;  3CZT X;  1NX0 A;  2JTT A;  4D1E A;  4JQ0 D;  1DJI A;  2L98 A;  1M63 B;  2LM5 A;  3KHE A;  3NXA A;  5K89 A;  1DJG A;  1CFC A;  4DRW A;  4MBE A;  4FTG A;  1BU3 A;  4HRG A;  2K2F A;  2MLE C;  1K8U A;  3PAL A;  2F3Y A;  2EGD A;  5AFP A;  4C0K A;  2K8M B;  2O60 A;  5FYX A;  1OMR A;  1PRW A;  1CDP A;  4PCW A;  3WNX B;  2EC6 C;  1SW8 A;  1K95 A;  1NCY A;  1YTZ C;  3BQ3 A;  3BUM B;  1BG1 A;  1BR1 B;  1BJF A;  1A4P A;  2L4I A;  2Y1N A;  1L7Z A;  3RM1 A;  1UHJ A;  1SMG A;  1K9K A;  1QVI Y;  1DJW A;  2L51 A;  3VRP A;  4PHK A;  1DGV A;  3CR4 X;  3DVM A;  4Q04 A;  2PAS A;  3MSE B;  2MHH A;  1CFF A;  1SYM A;  1BF5 A;  3SG7 A;  1NPQ A;  1Y0V H;  4I5K A;  2H61 C;  3C1V A;  4YI9 A;  1ZMZ A;  3K21 A;  1H4B A;  2FCE A;  1IH0 A;  1G8I A;  3I5G B;  4MRY A;  1DTL A;  1B4C A;  2RGI A;  4N1G A;  3TS5 C;  1CLM A;  1TCO B;  1SL7 A;  4YRU A;  2M8U A;  1MR8 A;  1OZS A;  1GJY A;  2KI4 C;  1XFZ O;  3IQO A;  2L2E A;  2I94 A;  2AAO A;  1HQV A;  2LLU A;  2M3W A;  4PE1 A;  1DVI A;  2F2P A;  4A4C A;  2ZN9 A;  2P6B B;  3LK0 A;  1QV1 A;  2CNP A;  5IBW A;  1C7V A;  1JFK A;  4PE7 A;  2ISD A;  1WLZ A;  1Y1X A;  2JNF A;  1SCV A;  1J1D A;  1CFD A;  1EXR A;  5PAL A;  1JWD A;  1KK8 B;  3WHT B;  4P2Y B;  3EVV A;  1J7O A;  2LLT A;  1Y1A A;  1A03 A;  2Y5I A;  2Y4Q A;  4PE0 A;  1KFX L;  3M0W A;  1OQP A;  3AAJ A;  4DIR A;  4CPV A;  1PVA A;  1IG5 A;  3TDZ A;  5AEQ A;  3D0Y B;  1C7W A;  1BLQ A;  3ZWH A;  1QX2 A;  3VRR A;  2BL0 B;  4OVN F;  3I5F C;  1L2O C;  1CMG A;  4GUK A;  1UUR A;  1YX7 A;  3CWG A;  1BMO A;  4YGB B;  1JBA A;  2L50 A;  2MJW B;  2LV7 A;  4N1F A;  1RWY A;  2G9B A;  4DUQ A;  3O6B A;  5HLO A;  1J7P A;  2ZN8 A;  1GGZ A;  3EVU A;  3I5I B;  1B7T Z;  1S6C A;  1UHK A;  2BKH B;  1Y6W A;  1SL9 A;  3PN7 C;  4YI8 A;  3FIA A;  1KWO C;  1WDC C;  4ETO A;  1HT9 A;  3VRQ A;  1IGV A;  2B1U A;  2LVI A;  1JC2 A;  1TNP A;  1K90 D;  2JU0 A;  4NQG A;  2K7O A;  2JXC A;  3EK4 A;  1CM4 A;  1CDL A;  3GK2 A;  2JQ6 A;  2LUX A;  1CNP A;  1M39 A;  1TIZ A;  2JOJ A;  1WRK A;  1G4Y R;  4JPZ B;  1Q80 A;  1QIW A;  1F71 A;  1SPY A;  2WCF A;  1FF1 A;  1B9A A;  1KQM C;  1W7J B;  1QAT A;  3TUY B;  3TZ1 A;  2KOT A;  2E6W A;  4TNC A;  1SRA A;  3PSR A;  1CDN A;  2KHN A;  3I5H C;  5I8N A;  1KFU S;  2QPT A;  2WCE A;  1CTR A;  3FWB A;  3SIB A;  1FI6 A;  1CDM A;  2F8P A;  1BR4 B;  1PSB A;  2AMI A;  2MRD A;  1QX5 B;  3D0Y A;  4PE4 A;  4ORB B;  2LAN A;  3JVT B;  1K2H A;  1DGU A;  1BT6 A;  2KDH A;  1E8A A;  1U5I A;  2NZ0 A;  4FQO A;  4YGC B;  1OZO A;  5HKY A;  1S3P A;  4WQ3 A;  1XVJ A;  5G08 A;  2KI6 D;  1CMF A;  3DF0 A;  4OCI A;  5CSJ A;  3HX4 A;  1DT7 B;  3SIA A;  4L9M A;  2MAZ A;  1YVH A;  4ZCU A;  5DKR A;  1AVS A;  1ZAC A;  1A75 A;  2Q91 A;  1H8B A;  4P5O E;  2HQ8 A;  4WQ2 A;  3O78 A;  4BY5 A;  4XJK B;  3ICB A;  4AQJ A;  1YUT A;  2NLN A;  4MZK A;  3QRX A;  3TDU A;  1RFJ A;  1FPW A;  1QXP A;  2JXL A;  1LA3 A;  3LK1 A;  1GQM A;  4YGD B;  2E30 A;  3KEV A;  3SG6 A;  1WLM A;  2DOQ A;  1LIN A;  1XA5 A;  3AAK A;  3NSK A;  2JT8 A;  1DJZ A;  1MF8 B;  3H4S E;  4MSP A;  1CLB A;  1G33 A;  3IF7 A;  2BEC A;  5I2Q A;  3ZNI A;  2LUC A;  3OP0 A;  3HCM A;  4ORC B;  1XFV O;  1Y1U A;  1IWQ A;  2CBL A;  4QJ3 B;  2JPT A;  2L4H A;  1B8R A;  1F55 A;  4UPG A;  4I5N B;  1XK4 C;  1IRJ A;  3LLE A;  2Y1M A;  2LP2 A;  5JJG A;  5KTY A;  2IS9 A;  2KYC A;  5CPV A;  1QLK A;  5DKQ A;  4ORA B;  4QJ5 B;  1RTP 1;  1NWD A;  1TNX A;  2KFH A;  2M29 A;  2JUL A;  1ALW A;  2NCO A;  3DVJ A;  1TRF A;  3GOF A;  3NSI A;  3E3R A;  1KK7 Z;  1NX2 A;  1SL8 A;  5AXI A;  1DMO A;  1MXE A;  1YUS A;  4XJK A;  2M7N A;  5CSI A;  3I5I C;  1OMV A;  2NCP A;  4CFR A;  5GQQ C;  1KQV A;  1NUB A;  4OR9 B;  2I2R E;  4DCK A;  1J7Q A;  2K7D A; 
#chains in the Genus database with same CATH topology
 1XYD A;  3AKA A;  3OX5 A;  2LMT A;  1X02 A;  5FI7 A;  1BOC A;  2KFG A;  2LHL A;  1B47 A;  1QX7 A;  1PSR A;  1U5I B;  1S5G Z;  1KSM A;  4NDB A;  3KO0 A;  1IQ3 A;  1OOI X;  4GFT A;  4YGE B;  3FS7 A;  1PAL A;  3BYA A;  3FE8 A;  1J55 A;  4OV2 A;  1TNW A;  3EKJ A;  3DF0 B;  4C0J A;  3VRN A;  1SKT A;  2L2C A;  1SSE B;  5HKW A;  2KFF A;  2MLF C;  2BBN A;  1A75 B;  2JNX A;  2VRG A;  3K1E A;  4GGN A;  1SR6 C;  2WC8 A;  1RRO A;  3TS5 B;  2CTN A;  1NP8 A;  2JZI A;  4NDC A;  2KGB C;  2OTG C;  2QEB A;  1DJY A;  1J7R A;  2HPS A;  1M45 A;  1QLS A;  2KI4 B;  3DD4 A;  3S0A A;  2BCA A;  2K60 A;  2K61 A;  5J3X A;  2ZRT A;  1NCZ A;  1CB1 A;  1W7I B;  1A2X A;  1B8L A;  1FW4 A;  2LMV A;  4HSZ A;  1NSH A;  4N5X A;  2EHB A;  2KPH A;  3L4A A;  2WOR A;  1CM1 A;  2OS8 B;  1R6P A;  2ERB A;  2KAY A;  1F4O A;  3DVE A;  3WHU B;  2HQW A;  2A4J A;  2KSP A;  3SJS A;  4E68 A;  2L5X B;  1XFR A;  3BUW B;  1DEL A;  1JF2 A;  2K7C A;  2WCJ A;  3DZT A;  3NSL A;  3PLF B;  5D7F A;  5TNC A;  3TDI A;  5I2O A;  2WOS A;  3EK8 A;  2WCM A;  4AQI A;  2H8V A;  2KAX A;  3D78 A;  4MN0 A;  4C0L A;  1EJ3 A;  2JT0 A;  4U8D A;  3I5F B;  2JRF A;  2F3Z A;  2WND A;  2JPO A;  1NYA A;  4QJ4 B;  2H61 A;  1QVI Z;  2KAV A;  1N65 A;  1PVB A;  3CTN A;  1K96 A;  4MRX A;  2COL B;  1GM0 A;  1S1E A;  2LVK A;  5F6T A;  3LL8 B;  4R1E A;  5I94 A;  5I2L A;  3BXK A;  2M49 B;  1SK6 D;  1ODB A;  3VRO A;  1B7T Y;  2O5G A;  2LNK A;  5FI6 A;  4OKH A;  3CS1 A;  3OB2 B;  2CXJ A;  4YGA A;  3I5G C;  1R2U A;  1YX8 A;  1S6I A;  2MA2 A;  1B8C A;  1UHI A;  1DJX A;  3JTD B;  4MZJ A;  2WCL A;  2CCM A;  4CID A;  1JSA A;  2WC5 A;  3AKB A;  2GGZ A;  1SCM B;  2L0P A;  1M31 A;  3GK4 X;  1JF0 A;  1N2D A;  1S6J A;  1SY9 A;  1IJ5 A;  5DIC A;  2FCD A;  3PM8 A;  1J1E A;  3LCP C;  4I5J A;  3A4U B;  5HKZ A;  1XFX O;  4ZCV A;  1K9P A;  3IQQ A;  1OE9 B;  1KQM B;  3KPX A;  1S36 A;  1SBJ A;  1F70 A;  4GAO A;  4HRE E;  2AUC A;  2M1U A;  4I5L B;  4IL1 A;  3I5H B;  1JFJ A;  2CT9 A;  1YUU A;  3WXA A;  1PUL A;  1YUR A;  3PJI A;  1KK8 C;  3DXL A;  2MBX A;  1CKK A;  4GGF C;  3CGA A;  1DJH A;  1IQ5 A;  1ZUZ A;  1JUO A;  1S26 D;  4GBA A;  1TOP A;  1MHO A;  3FE9 A;  4F0Z B;  2KBM A;  1F4Q A;  5ER4 X;  2PQL A;  1GGW A;  3OX6 A;  4DS7 A;  2BBM A;  4INW A;  4OZD A;  1BOD A;  2BL0 C;  2FJU B;  2H2K A;  2LVV A;  1C3Y A;  1OMD A;  2M0R A;  3A8R A;  1DF0 A;  2K2A A;  2LMU A;  1IKU A;  1A29 A;  2BAP A;  2BCB A;  2KQ6 A;  1MWN A;  3DY9 A;  3N7H A;  2KLD A;  4WRI A;  3D73 A;  1VRK A;  1F8H A;  2ZRS A;  4JWQ A;  1XFW O;  1YR5 A;  1FI5 A;  1QIV A;  2M97 A;  4M2O A;  5BPJ A;  5KU1 A;  1LA0 A;  3OBV A;  2K0J A;  5AAN A;  1UP5 A;  3B6X A;  1UHN A;  2JT3 A;  2ZNE A;  3R1P A;  4PHN A;  2LHI A;  1AP4 A;  4PHJ A;  3D10 A;  2HET A;  1NX1 A;  3B88 A;  1OOH A;  2EC6 B;  3PM2 A;  1MUX A;  3SG3 A;  2ZKM X;  4MVF A;  1WRZ A;  2V53 A;  1NCX A;  2LP3 A;  1ZFS A;  1CLL A;  3CAB A;  3CDN A;  2M9G A;  5DKN A;  3BOW B;  1WRL A;  4PAL A;  2HF5 A;  2I18 A;  3KF9 A;  1SNL A;  1EG3 A;  4IJ7 A;  5CSN A;  3CLN A;  4CFQ A;  2D8N A;  1YVL A;  2OS8 C;  3Q8I A;  3BUO B;  2JC2 A;  3NHI A;  4MZL A;  3TUY C;  2Q4U A;  3S0F A;  1C07 A;  2QAC A;  2PRU A;  3PFV A;  1OW4 A;  2PSR A;  5CSF A;  1AHR A;  3BFH A;  1K94 A;  2PYQ A;  3CZ2 A;  3NSO A;  1XO5 A;  1NX3 A;  3QME A;  1KFU L;  4MLW A;  3SS3 A;  2LE9 B;  2F33 A;  2KYF A;  2WCB A;  3BUX B;  1K9U A;  2LVJ A;  1M46 A;  3EK7 A;  1TNQ A;  1MXL C;  3EVR A;  1AJ5 A;  1REC A;  1YRT B;  2ZND A;  3JVT C;  4GPL B;  4BY4 A;  1AK8 A;  1B1G A;  2PMY A;  1RK9 A;  1TTX A;  4CLN A;  3BUN B;  2KNE A;  4PDZ A;  2R2I A;  2BE4 A;  3CR5 X;  1OOG A;  1LVC D;  4YBH B;  1QJT A;  5D69 A;  1KK7 Y;  2LLS A;  2K7B A;  1QAS A;  3B87 A;  3GK1 A;  2LCP A;  1OSA A;  1N0Y A;  3PAT A;  3SG2 A;  2PVB A;  1YRU B;  2LC5 A;  1OOJ A;  3FE6 A;  1ZOT B;  1EG4 A;  4HRH A;  3B86 A;  2GV5 A;  1RJV A;  2JWW A;  1XFU O;  2TN4 A;  1TUZ A;  2KBI A;  4AOM A;  1D1O A;  1C3Z A;  1QTX A;  1AJ4 A;  5HLV A;  1KFX S;  3SS4 A;  3OB1 B;  2I7A A;  3JTD C;  1PK0 D;  2FOT A;  2M1K B;  1SCM C;  2JTZ A;  2PAL A;  1K93 D;  1QV0 A;  3O2P A;  2M7L A;  3BOW A;  2SCP A;  3EKH A;  3S0G A;  2GTE A;  2NXQ A;  4MEW A;  4GNK B;  4XYN A;  1MQ1 A;  1L2O B;  1LXF C;  1S5G Y;  3OHM B;  5KSZ A;  1CFP A;  5ER5 A;  3SG4 A;  3D74 A;  2KI6 C;  2FJY A;  1ALV A;  4ICB A;  3FWC A;  4M2Q A;  1TN4 A;  4USL A;  2OPO A;  4NDD A;  4PHM A;  1TCF A;  1DF0 B;  2LAP A;  1V1F A;  3RLZ A;  2ZFD A;  5HYD A;  4GGF A;  1AUI B;  5B8I B;  1LKJ A;  1V1G A;  2BCX A;  4INX A;  1XK4 A;  1LS8 A;  1FBV A;  2KGR A;  1XFY O;  4FQT A;  2BKI B;  3O4Y A;  1EH2 A;  5FI2 A;  4M2P A;  2F2O A;  3SG5 A;  5HL1 A;  1KCY A;  1SR6 B;  1UHH A;  1EL4 A;  5JOL A;  3PN7 B;  1KSO A;  3DVK A;  1KWO B;  1WDC B;  3CR2 A;  1UUS A;  3F45 A;  1F54 A;  2SAS A;  2L5Y A;  2OTG B;  1WY9 A;  3CZ0 A;  4A4B A;  3D76 A;  5AER A;  1QS7 A;  2BE6 A;  2G2B A;  2GGM A;  1UWO A;  3S0D A;  1NIW A;  1IJ6 A;  3VGO A;  2KQY A;  3CZT X;  1NX0 A;  2JTT A;  4D1E A;  3RZS A;  3VB1 A;  4JQ0 D;  1DJI A;  2L98 A;  1M63 B;  2LM5 A;  3KHE A;  3NXA A;  5K89 A;  1DJG A;  1CFC A;  4DRW A;  4MBE A;  4FTG A;  1BU3 A;  4HRG A;  2K2F A;  2MLE C;  1K8U A;  3PAL A;  2F3Y A;  2EGD A;  5AFP A;  4C0K A;  2K8M B;  2O60 A;  5FYX A;  1OMR A;  3BJH A;  1PRW A;  1CDP A;  4PCW A;  5EL2 A;  2EC6 C;  3WNX B;  1SW8 A;  1K95 A;  1NCY A;  1YTZ C;  3BQ3 A;  3BUM B;  1BG1 A;  1BR1 B;  1BJF A;  1A4P A;  2L4I A;  2Y1N A;  1L7Z A;  3BFA A;  1UHJ A;  3RM1 A;  1SMG A;  1K9K A;  1QVI Y;  3D77 A;  2KLE A;  1DJW A;  2L51 A;  3VRP A;  4PHK A;  1DGV A;  3CR4 X;  3DVM A;  4Q04 A;  2PAS A;  3MSE B;  2MHH A;  1CFF A;  1SYM A;  1BF5 A;  3SG7 A;  1NPQ A;  1Y0V H;  4I5K A;  2H61 C;  3C1V A;  4YI9 A;  1ZMZ A;  2QEO A;  1TUJ A;  3K21 A;  1H4B A;  2FCE A;  1IH0 A;  1G8I A;  3I5G B;  4KYN A;  4MRY A;  1DTL A;  1B4C A;  2RGI A;  4N1G A;  3TS5 C;  1CLM A;  1TCO B;  1SL7 A;  4YRU A;  2M8U A;  1MR8 A;  1OOF A;  1OZS A;  1GJY A;  2KI4 C;  1XFZ O;  3IQO A;  2L2E A;  2I94 A;  2AAO A;  1HQV A;  2LLU A;  2M3W A;  4PE1 A;  1DVI A;  2F2P A;  4A4C A;  2ZN9 A;  2P6B B;  3LK0 A;  1QV1 A;  2CNP A;  2P70 A;  5IBW A;  1C7V A;  1JFK A;  4PE7 A;  2ISD A;  1WLZ A;  1Y1X A;  2JNF A;  1SCV A;  3EG5 B;  1J1D A;  1CFD A;  1EXR A;  5PAL A;  3UNW A;  1JWD A;  1KK8 B;  3WHT B;  4P2Y B;  3EVV A;  1J7O A;  2LLT A;  1Y1A A;  1A03 A;  2Y5I A;  2Y4Q A;  4PE0 A;  1KFX L;  3M0W A;  1OQP A;  3AAJ A;  4DIR A;  4CPV A;  3NHT A;  1PVA A;  1IG5 A;  3TDZ A;  5AEQ A;  3D0Y B;  1C7W A;  2YGU A;  1BLQ A;  3ZWH A;  1QX2 A;  3VRR A;  2BL0 B;  4OVN F;  3I5F C;  4PT1 A;  1L2O C;  1CMG A;  4GUK A;  3DYE A;  1UUR A;  1YX7 A;  3CWG A;  1BMO A;  2WC6 A;  4YGB B;  1JBA A;  2L50 A;  3D75 A;  2MJW B;  2LV7 A;  3OGN A;  4N1F A;  1RWY A;  2G9B A;  4DUQ A;  3O6B A;  5HLO A;  1J7P A;  2ZN8 A;  1DEK A;  1GGZ A;  3EVU A;  3I5I B;  1B7T Z;  1W9Z A;  1S6C A;  1UHK A;  2BKH B;  1Y6W A;  1SL9 A;  3PN7 C;  4YI8 A;  3FIA A;  1KWO C;  1WDC C;  4ETO A;  1HT9 A;  3VRQ A;  1IGV A;  2B1U A;  2LVI A;  1JC2 A;  1TNP A;  1K90 D;  2JU0 A;  4NQG A;  2K7O A;  2JXC A;  3EK4 A;  1CM4 A;  1CDL A;  3B7A A;  3GK2 A;  2JQ6 A;  2LUX A;  1CNP A;  1M39 A;  1TIZ A;  2JOJ A;  1WRK A;  1G4Y R;  4JPZ B;  1Q80 A;  2QEV A;  1QIW A;  4JD9 A;  1SPY A;  2WCF A;  1F71 A;  1FF1 A;  1B9A A;  1KQM C;  1W7J B;  1QAT A;  3TUY B;  3TZ1 A;  2KOT A;  2E6W A;  4TNC A;  1SRA A;  3PSR A;  1CDN A;  2KHN A;  3I5H C;  5I8N A;  1KFU S;  2QPT A;  2WCE A;  1CTR A;  3FWB A;  3SIB A;  3BFB A;  1FI6 A;  3NGV A;  1CDM A;  2F8P A;  1BR4 B;  1PSB A;  2AMI A;  2MRD A;  4F7F A;  1QX5 B;  3D0Y A;  4PE4 A;  4ORB B;  2LAN A;  2QDI A;  3JVT B;  1K2H A;  1DGU A;  3SS5 A;  1BT6 A;  2KDH A;  1E8A A;  1U5I A;  2NZ0 A;  4FQO A;  4YGC B;  1OZO A;  5HKY A;  1S3P A;  4WQ3 A;  1XVJ A;  2BNX A;  5G08 A;  2KI6 D;  1CMF A;  3DF0 A;  4OCI A;  5CSJ A;  3HX4 A;  1DT7 B;  1DQE A;  3SIA A;  4L9M A;  2MAZ A;  1YVH A;  4ZCU A;  5DKR A;  1AVS A;  1ZAC A;  1A75 A;  2Q91 A;  1H8B A;  4P5O E;  2HQ8 A;  2QEH A;  3O78 A;  4WQ2 A;  4BY5 A;  3S0B A;  4XJK B;  3ICB A;  3L47 A;  4AQJ A;  1YUT A;  3CZ1 A;  2NLN A;  4MZK A;  3QRX A;  3TDU A;  5D3O A;  1RFJ A;  1FPW A;  1QXP A;  2JXL A;  1LA3 A;  3LK1 A;  1GQM A;  4YGD B;  2E30 A;  1ORG A;  3CYZ A;  3KEV A;  3SG6 A;  1WLM A;  3IVT A;  2DOQ A;  1LIN A;  1XA5 A;  2WCK A;  3AAK A;  3NSK A;  2JT8 A;  1DJZ A;  1MF8 B;  3H4S E;  4MSP A;  1CLB A;  1G33 A;  3IF7 A;  2BEC A;  2P71 A;  5I2Q A;  3ZNI A;  2LUC A;  3OP0 A;  3HCM A;  4ORC B;  1XFV O;  1TWO A;  1Y1U A;  1IWQ A;  2CBL A;  4QJ3 B;  2JPT A;  2L4H A;  1B8R A;  1F55 A;  4UPG A;  4I5N B;  1XK4 C;  1IRJ A;  3LLE A;  2Y1M A;  1IIO A;  2LP2 A;  5JJG A;  5KTY A;  2IS9 A;  2KYC A;  5CPV A;  1QLK A;  5DKQ A;  4ORA B;  4QJ5 B;  1RTP 1;  1NWD A;  1TNX A;  2KFH A;  2M29 A;  2JUL A;  1ALW A;  2NCO A;  3DVJ A;  1TRF A;  3GOF A;  1T14 A;  3NSI A;  3E3R A;  1KK7 Z;  1NX2 A;  3R1V A;  1SL8 A;  3V2L A;  5AXI A;  1DMO A;  1MXE A;  1YUS A;  4XJK A;  2M7N A;  1Z4H A;  3O4X A;  5CSI A;  3I5I C;  1OMV A;  2NCP A;  4JKT A;  3R72 A;  3S0E A;  4CFR A;  5GQQ C;  3R1O A;  1Z2C B;  1KQV A;  1NUB A;  1P28 A;  3UO9 A;  4OR9 B;  2I2R E;  4DCK A;  2WCH A;  1QWV A;  3L4L A;  1J7Q A;  1DC1 A;  2K7D A; 
#chains in the Genus database with same CATH homology
 1XYD A;  3AKA A;  3OX5 A;  2LMT A;  1X02 A;  1BOC A;  2KFG A;  2LHL A;  1B47 A;  1QX7 A;  1PSR A;  1U5I B;  1S5G Z;  1KSM A;  4NDB A;  3KO0 A;  1IQ3 A;  4GFT A;  4YGE B;  3FS7 A;  1PAL A;  3BYA A;  4OV2 A;  1J55 A;  1TNW A;  3EKJ A;  3DF0 B;  4C0J A;  3VRN A;  1SKT A;  5HKW A;  2KFF A;  2MLF C;  2BBN A;  1A75 B;  2JNX A;  2VRG A;  4GGN A;  1SR6 C;  2WC8 A;  1RRO A;  3TS5 B;  2CTN A;  1NP8 A;  2JZI A;  4NDC A;  2KGB C;  2OTG C;  1DJY A;  1J7R A;  2HPS A;  1M45 A;  1QLS A;  2KI4 B;  3DD4 A;  2BCA A;  2K61 A;  5J3X A;  2ZRT A;  1NCZ A;  1CB1 A;  1W7I B;  1A2X A;  1B8L A;  1FW4 A;  2LMV A;  4HSZ A;  1NSH A;  4N5X A;  2EHB A;  2WOR A;  1CM1 A;  2OS8 B;  1R6P A;  2KAY A;  1F4O A;  3DVE A;  3WHU B;  2HQW A;  2A4J A;  2KSP A;  3SJS A;  4E68 A;  2L5X B;  3BUW B;  2K7C A;  1JF2 A;  3PLF B;  5D7F A;  5I2O A;  3NSL A;  5TNC A;  3TDI A;  2WOS A;  3EK8 A;  4AQI A;  2KAX A;  4MN0 A;  4C0L A;  1EJ3 A;  2JT0 A;  4U8D A;  3I5F B;  2JRF A;  2F3Z A;  2WND A;  1NYA A;  4QJ4 B;  2H61 A;  1QVI Z;  2KAV A;  1N65 A;  1PVB A;  3CTN A;  1K96 A;  4MRX A;  2COL B;  1S1E A;  2LVK A;  5F6T A;  3LL8 B;  4R1E A;  5I2L A;  3BXK A;  2M49 B;  1SK6 D;  1ODB A;  3VRO A;  1B7T Y;  2O5G A;  2LNK A;  4OKH A;  3CS1 A;  3OB2 B;  2CXJ A;  4YGA A;  3I5G C;  1R2U A;  1YX8 A;  1S6I A;  2MA2 A;  1B8C A;  1UHI A;  1DJX A;  3JTD B;  4MZJ A;  1JSA A;  2CCM A;  4CID A;  3AKB A;  2GGZ A;  1SCM B;  2L0P A;  1M31 A;  3GK4 X;  1JF0 A;  1N2D A;  1S6J A;  1SY9 A;  1IJ5 A;  2FCD A;  3PM8 A;  1J1E A;  3LCP C;  4I5J A;  3A4U B;  5HKZ A;  1XFX O;  4ZCV A;  1K9P A;  3IQQ A;  1OE9 B;  1KQM B;  3KPX A;  1S36 A;  1SBJ A;  1F70 A;  4GAO A;  4HRE E;  2AUC A;  2M1U A;  4I5L B;  4IL1 A;  3I5H B;  1JFJ A;  2CT9 A;  1YUU A;  3WXA A;  1PUL A;  1YUR A;  1KK8 C;  2MBX A;  1CKK A;  4GGF C;  3CGA A;  1DJH A;  1IQ5 A;  1ZUZ A;  1JUO A;  1S26 D;  4GBA A;  1TOP A;  1MHO A;  4F0Z B;  2KBM A;  1F4Q A;  5ER4 X;  1GGW A;  3OX6 A;  4DS7 A;  2BBM A;  1BOD A;  2BL0 C;  2FJU B;  2H2K A;  2LVV A;  1OMD A;  2M0R A;  3A8R A;  1DF0 A;  2K2A A;  2LMU A;  1IKU A;  1A29 A;  2KQ6 A;  2BCB A;  4WRI A;  1MWN A;  1F8H A;  1VRK A;  2ZRS A;  4JWQ A;  1XFW O;  1YR5 A;  1FI5 A;  1QIV A;  2M97 A;  4M2O A;  5BPJ A;  5KU1 A;  1LA0 A;  2K0J A;  5AAN A;  1UP5 A;  1UHN A;  2JT3 A;  2ZNE A;  4PHN A;  2LHI A;  1AP4 A;  4PHJ A;  3D10 A;  2HET A;  1NX1 A;  2EC6 B;  1MUX A;  3SG3 A;  2ZKM X;  4MVF A;  1WRZ A;  2V53 A;  1NCX A;  2LP3 A;  1ZFS A;  1CLL A;  5DKN A;  2M9G A;  3BOW B;  1WRL A;  4PAL A;  2HF5 A;  2I18 A;  3KF9 A;  1SNL A;  1EG3 A;  5CSN A;  3CLN A;  4CFQ A;  2D8N A;  1YVL A;  2OS8 C;  3BUO B;  2JC2 A;  4MZL A;  3TUY C;  2Q4U A;  1C07 A;  2QAC A;  2PRU A;  3PFV A;  2PSR A;  5CSF A;  1AHR A;  1K94 A;  3NSO A;  1XO5 A;  1NX3 A;  1KFU L;  4MLW A;  2LE9 B;  2F33 A;  2KYF A;  2WCB A;  3BUX B;  1K9U A;  2LVJ A;  1M46 A;  3EK7 A;  1TNQ A;  1MXL C;  3EVR A;  1AJ5 A;  1REC A;  1YRT B;  2ZND A;  3JVT C;  4GPL B;  4BY4 A;  1AK8 A;  1B1G A;  2PMY A;  1RK9 A;  1TTX A;  4CLN A;  3BUN B;  2KNE A;  4PDZ A;  2R2I A;  2BE4 A;  3CR5 X;  1LVC D;  4YBH B;  1QJT A;  5D69 A;  1KK7 Y;  2LLS A;  2K7B A;  1QAS A;  3GK1 A;  3PAT A;  2LCP A;  1OSA A;  1N0Y A;  3SG2 A;  2PVB A;  1YRU B;  2LC5 A;  1OOJ A;  1ZOT B;  1EG4 A;  4HRH A;  2GV5 A;  1RJV A;  2JWW A;  1XFU O;  2TN4 A;  2KBI A;  4AOM A;  1D1O A;  5HLV A;  1QTX A;  1AJ4 A;  1KFX S;  3OB1 B;  2I7A A;  3JTD C;  1PK0 D;  2FOT A;  2M1K B;  1SCM C;  2JTZ A;  2PAL A;  1K93 D;  1QV0 A;  3O2P A;  2M7L A;  3BOW A;  2SCP A;  3EKH A;  2NXQ A;  4MEW A;  4GNK B;  4XYN A;  1MQ1 A;  1L2O B;  1LXF C;  1S5G Y;  3OHM B;  5KSZ A;  1CFP A;  5ER5 A;  3SG4 A;  2KI6 C;  4M2Q A;  1ALV A;  4ICB A;  3FWC A;  4USL A;  1TN4 A;  2OPO A;  4NDD A;  4PHM A;  1TCF A;  1DF0 B;  2LAP A;  1V1F A;  3RLZ A;  2ZFD A;  5HYD A;  4GGF A;  1AUI B;  5B8I B;  1LKJ A;  1V1G A;  2BCX A;  1XK4 A;  1FBV A;  2KGR A;  1XFY O;  2BKI B;  3O4Y A;  1EH2 A;  4M2P A;  2F2O A;  3SG5 A;  1KCY A;  1SR6 B;  1UHH A;  1EL4 A;  5JOL A;  3PN7 B;  1KSO A;  3DVK A;  1KWO B;  1WDC B;  3CR2 A;  1UUS A;  3F45 A;  1F54 A;  2SAS A;  2OTG B;  1WY9 A;  5AER A;  4A4B A;  1QS7 A;  2BE6 A;  2G2B A;  2GGM A;  1UWO A;  1NIW A;  1IJ6 A;  3VGO A;  2KQY A;  3CZT X;  1NX0 A;  2JTT A;  4D1E A;  4JQ0 D;  1DJI A;  2L98 A;  1M63 B;  2LM5 A;  3KHE A;  3NXA A;  5K89 A;  1DJG A;  1CFC A;  4DRW A;  4MBE A;  4FTG A;  1BU3 A;  4HRG A;  2K2F A;  2MLE C;  1K8U A;  3PAL A;  2F3Y A;  2EGD A;  5AFP A;  4C0K A;  2K8M B;  2O60 A;  5FYX A;  1OMR A;  1PRW A;  1CDP A;  4PCW A;  3WNX B;  2EC6 C;  1SW8 A;  1K95 A;  1NCY A;  1YTZ C;  3BQ3 A;  3BUM B;  1BG1 A;  1BR1 B;  1BJF A;  1A4P A;  2L4I A;  2Y1N A;  1L7Z A;  3RM1 A;  1UHJ A;  1SMG A;  1K9K A;  1QVI Y;  1DJW A;  2L51 A;  3VRP A;  4PHK A;  1DGV A;  3CR4 X;  3DVM A;  4Q04 A;  2PAS A;  3MSE B;  2MHH A;  1CFF A;  1SYM A;  1BF5 A;  3SG7 A;  1NPQ A;  1Y0V H;  4I5K A;  2H61 C;  3C1V A;  4YI9 A;  1ZMZ A;  3K21 A;  1H4B A;  2FCE A;  1IH0 A;  1G8I A;  3I5G B;  4MRY A;  1DTL A;  1B4C A;  2RGI A;  4N1G A;  3TS5 C;  1CLM A;  1TCO B;  1SL7 A;  4YRU A;  2M8U A;  1MR8 A;  1OZS A;  1GJY A;  2KI4 C;  1XFZ O;  3IQO A;  2L2E A;  2I94 A;  2AAO A;  1HQV A;  2LLU A;  2M3W A;  4PE1 A;  1DVI A;  2F2P A;  4A4C A;  2ZN9 A;  2P6B B;  3LK0 A;  1QV1 A;  2CNP A;  5IBW A;  1C7V A;  1JFK A;  4PE7 A;  2ISD A;  1WLZ A;  1Y1X A;  2JNF A;  1SCV A;  1J1D A;  1CFD A;  1EXR A;  5PAL A;  1JWD A;  1KK8 B;  3WHT B;  4P2Y B;  3EVV A;  1J7O A;  2LLT A;  1Y1A A;  1A03 A;  2Y5I A;  2Y4Q A;  4PE0 A;  1KFX L;  3M0W A;  1OQP A;  3AAJ A;  4DIR A;  4CPV A;  1PVA A;  1IG5 A;  3TDZ A;  5AEQ A;  3D0Y B;  1C7W A;  1BLQ A;  3ZWH A;  1QX2 A;  3VRR A;  2BL0 B;  4OVN F;  3I5F C;  1L2O C;  1CMG A;  4GUK A;  1UUR A;  1YX7 A;  3CWG A;  1BMO A;  4YGB B;  1JBA A;  2L50 A;  2MJW B;  2LV7 A;  4N1F A;  1RWY A;  2G9B A;  4DUQ A;  3O6B A;  5HLO A;  1J7P A;  2ZN8 A;  1GGZ A;  3EVU A;  3I5I B;  1B7T Z;  1S6C A;  1UHK A;  2BKH B;  1Y6W A;  1SL9 A;  3PN7 C;  4YI8 A;  3FIA A;  1KWO C;  1WDC C;  4ETO A;  1HT9 A;  3VRQ A;  1IGV A;  2B1U A;  2LVI A;  1JC2 A;  1TNP A;  1K90 D;  2JU0 A;  4NQG A;  2K7O A;  2JXC A;  3EK4 A;  1CM4 A;  1CDL A;  3GK2 A;  2JQ6 A;  2LUX A;  1CNP A;  1M39 A;  1TIZ A;  2JOJ A;  1WRK A;  1G4Y R;  4JPZ B;  1Q80 A;  1QIW A;  1F71 A;  1SPY A;  2WCF A;  1FF1 A;  1B9A A;  1KQM C;  1W7J B;  1QAT A;  3TUY B;  3TZ1 A;  2KOT A;  2E6W A;  4TNC A;  1SRA A;  3PSR A;  1CDN A;  2KHN A;  3I5H C;  5I8N A;  1KFU S;  2QPT A;  2WCE A;  1CTR A;  3FWB A;  3SIB A;  1FI6 A;  1CDM A;  2F8P A;  1BR4 B;  1PSB A;  2AMI A;  2MRD A;  1QX5 B;  3D0Y A;  4PE4 A;  4ORB B;  2LAN A;  3JVT B;  1K2H A;  1DGU A;  1BT6 A;  2KDH A;  1E8A A;  1U5I A;  2NZ0 A;  4FQO A;  4YGC B;  1OZO A;  5HKY A;  1S3P A;  4WQ3 A;  1XVJ A;  5G08 A;  2KI6 D;  1CMF A;  3DF0 A;  4OCI A;  5CSJ A;  3HX4 A;  1DT7 B;  3SIA A;  4L9M A;  2MAZ A;  1YVH A;  4ZCU A;  5DKR A;  1AVS A;  1ZAC A;  1A75 A;  2Q91 A;  1H8B A;  4P5O E;  2HQ8 A;  4WQ2 A;  3O78 A;  4BY5 A;  4XJK B;  3ICB A;  4AQJ A;  1YUT A;  2NLN A;  4MZK A;  3QRX A;  3TDU A;  1RFJ A;  1FPW A;  1QXP A;  2JXL A;  1LA3 A;  3LK1 A;  1GQM A;  4YGD B;  2E30 A;  3KEV A;  3SG6 A;  1WLM A;  2DOQ A;  1LIN A;  1XA5 A;  3AAK A;  3NSK A;  2JT8 A;  1DJZ A;  1MF8 B;  3H4S E;  4MSP A;  1CLB A;  1G33 A;  3IF7 A;  2BEC A;  5I2Q A;  3ZNI A;  2LUC A;  3OP0 A;  3HCM A;  4ORC B;  1XFV O;  1Y1U A;  1IWQ A;  2CBL A;  4QJ3 B;  2JPT A;  2L4H A;  1B8R A;  1F55 A;  4UPG A;  4I5N B;  1XK4 C;  1IRJ A;  3LLE A;  2Y1M A;  2LP2 A;  5JJG A;  5KTY A;  2IS9 A;  2KYC A;  5CPV A;  1QLK A;  5DKQ A;  4ORA B;  4QJ5 B;  1RTP 1;  1NWD A;  1TNX A;  2KFH A;  2M29 A;  2JUL A;  1ALW A;  2NCO A;  3DVJ A;  1TRF A;  3GOF A;  3NSI A;  3E3R A;  1KK7 Z;  1NX2 A;  1SL8 A;  5AXI A;  1DMO A;  1MXE A;  1YUS A;  4XJK A;  2M7N A;  5CSI A;  3I5I C;  1OMV A;  2NCP A;  4CFR A;  5GQQ C;  1KQV A;  1NUB A;  4OR9 B;  2I2R E;  4DCK A;  1J7Q A;  2K7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...