3AAKA

Crystal structure of zn2+-bound form of des3-20alg-2f122a
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
167
structure length
167
Chain Sequence
QSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGAGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 6
publication title Molecular basis for defect in Alix-binding by alternatively spliced isoform of ALG-2 (ALG-2DeltaGF122) and structural roles of F122 in target recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 59
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3aakA00
1ODBA 2WORA 3QRXA 1VRKA 4FTGA 2WC8A 4QJ3B 1NYAA 3AAJA 5IBWA 2MLEC 5FYXA 1NX1A 1ZFSA 2CT9A 4ZCUA 1XFZO 2MRDA 1IH0A 1DGUA 1CFDA 2KQ6A 3SG3A 1Y1UA 1ZOTB 1M45A 3AKBA 4PDZA 4AQIA 4JPZB 3TUYC 3O78A 1KQMB 1QX2A 1SPYA 2BE4A 1RFJA 1SCMB 1BU3A 1KSMA 2KI6D 2ZNDA 4F0ZB 1K95A 3GK1A 2LUXA 5ER5A 1DMOA 1UHKA 1V1GA 5D7FA 3PN7B 2LNKA 1J55A 1KFXL 2ZN8A 5AEQA 2MBXA 1JSAA 1JUOA 2L98A 1G8IA 2LLUA 3KPXA 3SJSA 1B4CA 1G33A 2K8MB 1MXEA 3EVUA 2EC6C 1SCVA 1QTXA 3CGAA 3TS5B 1OOJA 2AMIA 2BCAA 2CCMA 3VGOA 2M1UA 3ICBA 2MJWB 1GJYA 1D1OA 2K7BA 2LMUA 4GNKB 1DJIA 1K9PA 1DTLA 2Y4QA 3TDUA 2KQYA 2HETA 2LLTA 2ZRTA 1BJFA 1YTZC 3SG5A 1TNQA 1KFUS 3DF0B 4GBAA 4C0LA 1PK0D 1JBAA 2JU0A 1TCFA 3HX4A 1S5GY 1Y6WA 2OS8B 1QX5B 1TNXA 2K2AA 4I5KA 4N5XA 1MWNA 1F54A 1TTXA 1NSHA 1JC2A 4MZJA 1KWOC 3SG2A 2KI6C 2F3ZA 1XFWO 1J7OA 1IWQA 2LANA 2G2BA 2JTTA 3FWCA 4GAOA 3EK8A 4DS7A 5JOLA 1NCXA 4UPGA 3CS1A 3I5GB 3FIAA 2CTNA 1DVIA 1JFJA 4USLA 1KQMC 3BXKA 3I5IB 2JWWA 3EKJA 2NZ0A 1KSOA 1S3PA 1IGVA 3CTNA 3OHMB 4U8DA 1CDNA 1PSRA 1LXFC 2EGDA 3KF9A 1KCYA 1KFXS 4CFRA 1QLKA 5PALA 1QIVA 2DOQA 1DGVA 1R2UA 1Y1XA 2KYCA 2MHHA 1JFKA 4JQ0D 3M0WA 1J1EA 4ORCB 1G4YR 1RWYA 1NP8A 1X02A 2LV7A 2P6BB 4D1EA 1KK7Y 1SR6B 1NX0A 2FJUB 1FPWA 1A29A 1WRLA 3RLZA 2BL0B 1N0YA 4HRGA 1EXRA 1SY9A 1PALA 4MZKA 1IQ3A 2OTGB 4C0JA 4CLNA 2JQ6A 5AFPA 1UUSA 2BKHB 1MF8B 5TNCA 2KDHA 3BUOB 1OZSA 2LVJA 4HREE 3SG6A 2F2OA 2JPTA 2Y1MA 3SIAA 2Q91A 4YGCB 1KQVA 1XFUO 2KFGA 1K90D 1CLBA 1K2HA 1QXPA 2I7AA 1FBVA 1FI5A 5ER4X 1SL7A 1DF0B 1TOPA 5AANA 3BOWB 2H2KA 2LHIA 1AVSA 3DVMA 1L7ZA 2L4HA 4PE1A 3VRRA 1XFXO 5F6TA 1CM4A 3FWBA 2WCFA 5HKZA 3MSEB 1KK8C 1CLMA 2KAVA 2QPTA 1NUBA 3CLNA 2LMTA 3BUMB 4P5OE 3DVEA 5I2QA 2K2FA 1UHIA 1FI6A 2F2PA 3ZWHA 4PHNA 2CBLA 4PE0A 4MBEA 3I5HC 3IQOA 4YGAA 1GGZA 1K93D 2KAXA 3I5GC 4HSZA 2PALA 2Y5IA 1YRUB 2L50A 2L5XB 2JXCA 4Q04A 1K8UA 4NDBA 1B8CA 1DJXA 1F71A 2BCBA 5HKWA 1CLLA 1MQ1A 3I5FB 3SG7A 3E3RA 3WHTB 1MR8A 1Y0VH 1YURA 2AAOA 2JT3A 3IQQA 1BR1B 2CNPA 5CSIA 1V1FA 3DVJA 3EKHA 3VROA 2H61A 2PVBA 1BF5A 1SR6C 1FF1A 3JVTB 3KO0A 1LA3A 1WRZA 4ORAB 1SL8A 2MAZA 3OB2B 1OQPA 5CSNA 2LVKA 4L9MA 3DD4A 4N1GA 1NX2A 3PSRA 3GOFA 2ZNEA 1WY9A 1OMDA 2M0RA 2KFHA 1TNWA 4I5JA 4M2OA 1J7PA 2KI4C 2O5GA 4TNCA 2M9GA 1JF0A 1XFYO 1YX8A 5HLOA 2SCPA 2HQWA 2HPSA 3OP0A 2GV5A 4MLWA 1SRAA 2BE6A 2HF5A 2KFFA 2G9BA 2WCEA 1WDCB 2L2EA 1F4QA 4GPLB 4GGFC 4N1FA 1L2OC 4C0KA 2H61C 2F33A 3IF7A 1C7VA 1AUIB 1UHJA 1XFVO 4CPVA 5HKYA 4MSPA 4GFTA 1NCYA 2NLNA 2GGZA 3NSIA 1NCZA 4CFQA 3O6BA 1B8RA 2M7NA 1J1DA 4QJ4B 2JXLA 1CTRA 2WCBA 1OMVA 1ZACA 2ZFDA 4I5LB 2HQ8A 2LLSA 4IL1A 2VRGA 1K9UA 1NIWA 2E6WA 3AAKA 1S26D 1TIZA 2M97A 3BUXB 4PALA 1IKUA 2NXQA 2B1UA 2BBNA 4NDDA 1FW4A 1QX7A 4XJKB 1S6IA 1NX3A 1Q80A 1QS7A 3CWGA 5B8IB 1OZOA 1QVIZ 2V53A 1Y1AA 2KGRA 1A03A 2BBMA 4WRIA 2D8NA 1B9AA 1SCMC 2LVVA 4NDCA 3TZ1A 4ETOA 3DF0A 3D0YA 1IJ6A 2A4JA 1AJ4A 1B47A 4WQ3A 3PN7C 2GGMA 2KAYA 3BYAA 2I94A 3SG4A 1CB1A 1H8BA 2KBMA 1A75B 1XO5A 3NSOA 3PATA 1CM1A 3K21A 4YBHB 4JWQA 1TRFA 5CPVA 1NWDA 1SW8A 2PMYA 2K7CA 1BLQA 1YUUA 3TS5C 1RTP1 1EH2A 2KHNA 3O2PA 3KEVA 1F70A 3WXAA 1QV1A 1EG3A 1F4OA 1XK4C 1SYMA 4NQGA 1SNLA 1PULA 3LLEA 3TUYB 2K7DA 3FS7A 1RECA 3PALA 4HRHA 1BR4B 1N2DA 1IRJA 1CMGA 5CSFA 1DJGA 4BY5A 1BMOA 3PLFB 2AUCA 4AOMA 4OR9B 1DJYA 1QLSA 5I2LA 4DCKA 4FQOA 2OS8C 5GQQC 3LCPC 2Y1NA 1CDPA 5DKRA 2LCPA 5AXIA 5AERA 5BPJA 1TN4A 1CDLA 2ISDA 1CKKA 4DIRA 1CDMA 2EC6B 4DRWA 1B1GA 4I5NB 1YRTB 3CR2A 4XYNA 2KBIA 4PE7A 1IJ5A 2PRUA 1ALWA 2L51A 2LAPA 1H4BA 1DJWA 2LMVA 1IQ5A 1YVLA 1YR5A 2M3WA 1SBJA 1U5IA 1J7QA 3D10A 1OSAA 1GQMA 4YI8A 1UURA 1MUXA 3AKAA 1OE9B 3I5IC 4OCIA 1TCOB 2LHLA 3OX6A 4QJ5B 1UHHA 4OV2A 1WRKA 4M2PA 1M39A 3NSLA 2JZIA 2BECA 1PRWA 1DF0A 2JT8A 1CFCA 1LINA 2L0PA 3BOWA 1OMRA 4MRYA 5DKNA 5J3XA 4AQJA 1AK8A 1A4PA 5HLVA 3WHUB 1QATA 1KWOB 3F45A 1XYDA 2F8PA 1WLMA 1S5GZ 2LE9B 2FCEA 4GGFA 4MN0A 1B7TZ 2M1KB 2FCDA 1PVAA 1W7IB 2BL0C 3JTDB 2JRFA 4PHKA 2NCOA 2OTGC 3H4SE 2M7LA 1M46A 2PASA 3BUNB 1BODA 1F55A 5KSZA 3EK7A 1HT9A 2PSRA 2R2IA 1C7WA 2LC5A 5HYDA 1S6CA 1M63B 2JNFA 2OPOA 3OX5A 1ALVA 2KYFA 2WNDA 2FOTA 2LUCA 1S6JA 2ZRSA 1UWOA 3NXAA 3WNXB 4PCWA 2K7OA 1SKTA 3GK4X 3A4UB 2RGIA 4DUQA 4A4BA 3EVRA 1CFFA 2JULA 1WLZA 2LP2A 5KTYA 1K9KA 2KOTA 1LA0A 1B8LA 3KHEA 2NCPA 1BT6A 3CZTX 1PSBA 2IS9A 3LK0A 3VRNA 2MLFC 1DJHA 3A8RA 1DT7B 1E8AA 1KK7Z 1N65A 3O4YA 4OVNF 1QIWA 1CMFA 2ZN9A 1EJ3A 2M29A 1RK9A 2O60A 1BG1A 3ZNIA 4YGDB 3HCMA 4MEWA 4A4CA 4MZLA 1QJTA 3D0YB 4ORBB 2L4IA 1A2XA 1DJZA 1MXLC 1XK4A 2K0JA 3I5FC 4M2QA 5CSJA 1YX7A 2JC2A 1B7TY 4PHJA 2JT0A 4BY4A 3VRQA 1NPQA 1F8HA 1TNPA 1S36A 1SK6D 2F3YA 2LVIA 1KK8B 2KGBC 1XA5A 5K89A 2TN4A 1UP5A 1ZMZA 2M8UA 2EHBA 3JVTC 2LM5A 1YUTA 1BOCA 2KNEA 3JTDC 1JF2A 1R6PA 4ICBA 4OKHA 1K96A 2K61A 3EK4A 4PE4A 4YGEB 1CFPA 5DKQA 4GUKA 5D69A 3I5HB 3NSKA 1AP4A 1MHOA 1YUSA 1IG5A 3BUWB 4GGNA 1SMGA 3SIBA 4WQ2A 2BKIB 3CR5X 3DVKA 4YI9A 2CXJA 1S1EA 3TDIA 4XJKA 2ZKMX 3EVVA 2QACA 1QASA 1J7RA 2BCXA 1SL9A 1QV0A 1WDCC 2E30A 4MVFA 1RJVA 1JWDA 3GK2A 3VRPA 1RROA 4P2YB 2JTZA 5I2OA 1ZUZA 1W7JB 4MRXA 1A75A 3C1VA 2I2RE 1EL4A 5G08A 2LP3A 2I18A 4YGBB 3LL8B 3PM8A 5KU1A 4CIDA 1U5IB 1QVIY 3RM1A 1K94A 3PFVA 2JNXA 2KI4B 4ZCVA 3TDZA 1EG4A 1LVCD 3BQ3A 5I8NA 2SASA 1XVJA 5JJGA 4E68A 2WOSA 3OB1B 2MA2A 1C07A 3CR4X 1GGWA 4YRUA 2COLB 4R1EA 2Q4UA 2JOJA 1YVHA 1KFUL 1UHNA 2M49B 1LKJA 1M31A 1AJ5A 1L2OB 1AHRA 2KSPA 1CNPA 1HQVA 4PHMA 3LK1A 1PVBA
chains in the Genus database with same CATH superfamily
1ODBA 2WORA 3QRXA 3CDNA 1VRKA 4FTGA 1DELA 2WC8A 4QJ3B 1NYAA 3AAJA 5IBWA 2KPHA 2MLEC 1NX1A 5FYXA 1ZFSA 2CT9A 4ZCUA 1OW4A 1XFZO 2MRDA 4IJ7A 1IH0A 1DGUA 1CFDA 2KQ6A 3SG3A 1Y1UA 1ZOTB 1M45A 2QEVA 3AKBA 4PDZA 4FQTA 4JPZB 3V2LA 4AQIA 3TUYC 3O78A 1KQMB 1QX2A 1SPYA 2BE4A 1RFJA 1SCMB 1BU3A 1KSMA 2KI6D 2ZNDA 4F0ZB 1K95A 1DEKA 2LUXA 3GK1A 3OBVA 5ER5A 1DMOA 3D73A 1UHKA 1V1GA 5D7FA 3PN7B 2LNKA 2WCLA 1J55A 1KFXL 5FI6A 2ZN8A 5AEQA 2MBXA 1JSAA 1JUOA 2L98A 1G8IA 2LLUA 3KPXA 3SJSA 1B4CA 1G33A 2K8MB 1MXEA 3EVUA 3DXLA 2EC6C 3S0EA 3FE6A 1SCVA 1QTXA 3CGAA 3TS5B 1OOJA 2AMIA 2BCAA 2CCMA 3VGOA 2L5YA 2M1UA 3ICBA 2MJWB 1GJYA 3NGVA 1D1OA 2K7BA 2LMUA 4GNKB 1DJIA 1K9PA 3S0DA 1DTLA 2Y4QA 3B87A 3TDUA 2KQYA 1TUZA 2HETA 2LLTA 2ZRTA 1BJFA 1YTZC 3SG5A 1TNQA 4JKTA 3O4XA 1KFUS 3DF0B 3NHIA 4GBAA 2WC6A 1PK0D 3Q8IA 4C0LA 2JU0A 1JBAA 1TCFA 3HX4A 1S5GY 1Y6WA 2OS8B 1QX5B 1TNXA 2K2AA 4I5KA 4N5XA 1MWNA 1F54A 1TTXA 1NSHA 1JC2A 4MZJA 1KWOC 3SG2A 2KI6C 2F3ZA 1XFWO 1ORGA 1J7OA 1IWQA 2LANA 2G2BA 2JTTA 2WCJA 3FWCA 4GAOA 2BNXA 2P70A 3EK8A 4DS7A 5JOLA 1NCXA 3DY9A 4UPGA 1LS8A 3CS1A 3I5GB 3FIAA 2CTNA 1DVIA 1JFJA 4USLA 1KQMC 4JD9A 3BXKA 3I5IB 2JWWA 3EKJA 2NZ0A 3FE9A 1KSOA 1S3PA 1IGVA 3CTNA 3OHMB 4U8DA 1CDNA 1PSRA 1LXFC 2EGDA 3KF9A 1KCYA 1KFXS 4CFRA 1QLKA 5PALA 1QIVA 2DOQA 1DGVA 1R2UA 1Y1XA 2KYCA 2MHHA 1JFKA 3D74A 4JQ0D 3M0WA 1J1EA 4ORCB 1G4YR 1RWYA 1NP8A 3OGNA 1X02A 2LV7A 2P6BB 4D1EA 1KK7Y 1SR6B 1NX0A 2FJUB 3UO9A 1A29A 1WRLA 3RLZA 1FPWA 2BL0B 1N0YA 4HRGA 1EXRA 1SY9A 1PALA 4MZKA 1IQ3A 1XFRA 2OTGB 4C0JA 1QWVA 1TUJA 4CLNA 2JQ6A 5AFPA 1UUSA 2BKHB 1MF8B 5TNCA 2KDHA 3BUOB 1OZSA 2LVJA 4HREE 3SG6A 2F2OA 2JPTA 2Y1MA 3SIAA 2Q91A 4YGCB 1KQVA 2FJYA 1XFUO 2KFGA 1K90D 1CLBA 1K2HA 1QXPA 2I7AA 1FBVA 1FI5A 5ER4X 1SL7A 1DF0B 1TOPA 5AANA 3BOWB 2H2KA 2LHIA 3K1EA 1AVSA 3DVMA 1L7ZA 2L4HA 3D75A 4PE1A 1XFXO 5F6TA 1CM4A 3FWBA 3VRRA 2WCFA 5HKZA 3MSEB 1KK8C 4INXA 1CLMA 2KAVA 2QPTA 1NUBA 3CLNA 3FE8A 2LMTA 3BUMB 4P5OE 3DVEA 5I2QA 1SSEB 2K2FA 1UHIA 1FI6A 3L47A 3RZSA 2F2PA 3ZWHA 4PHNA 1OOIX 2CBLA 1OOFA 4MBEA 3I5HC 3IQOA 4PE0A 4YGAA 1GGZA 1K93D 2KAXA 3I5GC 4HSZA 2PALA 2Y5IA 1YRUB 2L50A 2L5XB 2JXCA 4Q04A 1K8UA 3NHTA 4NDBA 1B8CA 1DJXA 1F71A 2BCBA 5HKWA 1CLLA 1MQ1A 3I5FB 3SG7A 3E3RA 3WHTB 1MR8A 1Y0VH 1YURA 2AAOA 2JT3A 3IQQA 1BR1B 2CNPA 5CSIA 1V1FA 3DVJA 3EKHA 3VROA 2H61A 2PVBA 2YGUA 1BF5A 1SR6C 1FF1A 3JVTB 3KO0A 1LA3A 1WRZA 4ORAB 1SL8A 2MAZA 3OB2B 1OQPA 5CSNA 2LVKA 4L9MA 3DD4A 4N1GA 3B6XA 1NX2A 3PSRA 3GOFA 2QEHA 2ZNEA 1WY9A 1OMDA 2M0RA 2KFHA 1TNWA 3R72A 4I5JA 4M2OA 1J7PA 2KI4C 2O5GA 4TNCA 2M9GA 1JF0A 1XFYO 1YX8A 5HLOA 1C3YA 2SCPA 2HQWA 2HPSA 3OP0A 2GV5A 3BFHA 4MLWA 1SRAA 2QEOA 3UNWA 2BE6A 2HF5A 2KFFA 2G9BA 2WCEA 1WDCB 2L2EA 1F4QA 4GPLB 4GGFC 4N1FA 1L2OC 4C0KA 2H61C 2F33A 3IF7A 1C7VA 1AUIB 1UHJA 1XFVO 4CPVA 5HKYA 4MSPA 4GFTA 1NCYA 2NLNA 2GGZA 3NSIA 1NCZA 4CFQA 5D3OA 3O6BA 2WCMA 1B8RA 2M7NA 1J1DA 4QJ4B 2JXLA 1CTRA 2WCBA 1OMVA 1ZACA 2ZFDA 4I5LB 2HQ8A 2LLSA 4IL1A 2VRGA 1K9UA 1NIWA 2E6WA 3AAKA 1S26D 1TIZA 2M97A 3BUXB 3DYEA 4PALA 1IKUA 2NXQA 2B1UA 2BBNA 2WCKA 4NDDA 1FW4A 1QX7A 4XJKB 1S6IA 1NX3A 1OOHA 1Q80A 1QS7A 3CWGA 4KYNA 5B8IB 1OZOA 1QVIZ 2V53A 1Y1AA 2KGRA 1A03A 2BBMA 4WRIA 2D8NA 1B9AA 1SCMC 2LVVA 4NDCA 3TZ1A 4ETOA 3DF0A 5EL2A 3D0YA 1IJ6A 2A4JA 1AJ4A 1B47A 2K60A 3PN7C 2GGMA 2KAYA 3BYAA 2I94A 4WQ3A 3SG4A 1CB1A 2BAPA 3BFAA 1H8BA 2KBMA 1A75B 1XO5A 3NSOA 3BFBA 3PATA 2PQLA 3S0AA 1CM1A 3K21A 3B86A 4JWQA 1TRFA 3CZ2A 4YBHB 1NWDA 1SW8A 5CPVA 2PMYA 2K7CA 1BLQA 1YUUA 3SS3A 3TS5C 1RTP1 3D77A 1EH2A 2KHNA 3O2PA 3VB1A 3KEVA 1F70A 3WXAA 1QV1A 1EG3A 1F4OA 3PM2A 1XK4C 1SYMA 4NQGA 1SNLA 1PULA 3LLEA 3TUYB 2K7DA 2QDIA 1RECA 3FS7A 3PALA 4HRHA 1BR4B 1N2DA 1IRJA 1CMGA 5CSFA 1DJGA 4BY5A 1BMOA 3PLFB 2AUCA 3QMEA 2KLEA 4OR9B 4AOMA 1DJYA 1QLSA 5I2LA 3L4AA 4FQOA 4DCKA 2OS8C 5GQQC 3LCPC 2Y1NA 1CDPA 5DKRA 2LCPA 5AXIA 5AERA 5BPJA 1TN4A 1CDLA 2ISDA 1CKKA 4DIRA 1CDMA 2EC6B 4DRWA 1B1GA 4I5NB 1YRTB 2GTEA 3CR2A 4XYNA 2KBIA 3D78A 4PE7A 1IJ5A 2PRUA 1ALWA 2L51A 2LAPA 1H4BA 1DJWA 1OOGA 2LMVA 1IQ5A 4OZDA 1YVLA 1YR5A 2M3WA 1SBJA 1U5IA 1J7QA 3D10A 1OSAA 1GQMA 4YI8A 1UURA 1MUXA 3AKAA 1OE9B 3I5IC 4OCIA 1TCOB 2LHLA 3OX6A 4QJ5B 1UHHA 4OV2A 1WRKA 4M2PA 1M39A 3NSLA 2JZIA 3S0GA 2BECA 1PRWA 1DF0A 2JT8A 1CFCA 1LINA 2L0PA 2KLDA 1OMRA 3BOWA 4MRYA 5DKNA 5J3XA 4AQJA 1A4PA 1AK8A 5HLVA 3WHUB 1QATA 1KWOB 3F45A 1XYDA 5DICA 2F8PA 1WLMA 1S5GZ 2LE9B 2FCEA 4GGFA 2H8VA 4MN0A 1B7TZ 2M1KB 2FCDA 2JPOA 1PVAA 1W7IB 2BL0C 3JTDB 2JRFA 4PHKA 5FI7A 2NCOA 2OTGC 3H4SE 2M7LA 1M46A 2PASA 3BUNB 5I94A 1BODA 1F55A 5KSZA 3EK7A 1W9ZA 1HT9A 2PSRA 2R2IA 1C7WA 2LC5A 2WC5A 1S6CA 5HYDA 1M63B 2JNFA 2OPOA 3OX5A 3PJIA 1ALVA 2KYFA 2WNDA 2FOTA 2LUCA 1S6JA 2ZRSA 1UWOA 3NXAA 3WNXB 4PCWA 2K7OA 1SKTA 3GK4X 3A4UB 3B88A 2RGIA 3B7AA 4DUQA 4A4BA 5FI2A 3EVRA 1CFFA 2JULA 1WLZA 2LP2A 5KTYA 1K9KA 2KOTA 1DC1A 1LA0A 1B8LA 3KHEA 2NCPA 1GM0A 1BT6A 3CZTX 1PSBA 2IS9A 3LK0A 3R1OA 2MLFC 3VRNA 1Z2CB 1DJHA 3A8RA 1DT7B 1E8AA 1KK7Z 1N65A 3O4YA 4OVNF 1QIWA 1CMFA 2ZN9A 3CZ1A 1EJ3A 2M29A 1RK9A 2O60A 1BG1A 3ZNIA 4YGDB 3HCMA 4MEWA 4A4CA 4MZLA 1QJTA 3D0YB 4ORBB 2L4IA 1A2XA 1C3ZA 1DJZA 1MXLC 1XK4A 2K0JA 3I5FC 4M2QA 5CSJA 1YX7A 2JC2A 1B7TY 3CZ0A 4PHJA 2JT0A 4BY4A 3VRQA 1NPQA 1F8HA 1TNPA 1S36A 3CABA 1SK6D 3S0BA 2F3YA 2LVIA 1KK8B 2KGBC 1XA5A 5K89A 2TN4A 2ERBA 1UP5A 1ZMZA 2M8UA 2EHBA 3JVTC 2LM5A 2P71A 1YUTA 1BOCA 2KNEA 3JTDC 2L2CA 1JF2A 1R6PA 4ICBA 4OKHA 1K96A 1TWOA 2K61A 3EK4A 4PE4A 4YGEB 1CFPA 5DKQA 4GUKA 5D69A 3I5HB 3NSKA 1AP4A 1MHOA 1YUSA 1IG5A 3BUWB 3D76A 4GGNA 1SMGA 3SIBA 4WQ2A 2BKIB 3CR5X 3DVKA 3DZTA 4YI9A 2CXJA 2PYQA 1S1EA 3TDIA 4XJKA 2ZKMX 1Z4HA 3EVVA 2QACA 1QASA 1J7RA 3CYZA 2BCXA 1SL9A 1IIOA 1QV0A 3N7HA 1WDCC 2E30A 4INWA 4MVFA 1RJVA 3IVTA 1JWDA 3GK2A 2QEBA 3EG5B 1RROA 3VRPA 4P2YB 3BJHA 2JTZA 3SS4A 5I2OA 1ZUZA 1W7JB 4MRXA 1A75A 3C1VA 2I2RE 1EL4A 3R1VA 2LP3A 2I18A 4YGBB 3LL8B 4PT1A 5G08A 1DQEA 3PM8A 5KU1A 3L4LA 3SS5A 4CIDA 1U5IB 2WCHA 5HL1A 1QVIY 3RM1A 1K94A 3PFVA 2JNXA 2KI4B 4ZCVA 3TDZA 1EG4A 1LVCD 3BQ3A 5I8NA 2SASA 1XVJA 5JJGA 4E68A 2WOSA 3OB1B 2MA2A 1C07A 3CR4X 4F7FA 1GGWA 4YRUA 2COLB 4R1EA 2Q4UA 2JOJA 3R1PA 1YVHA 1KFUL 1UHNA 2M49B 3S0FA 1LKJA 1M31A 1AJ5A 1L2OB 1AHRA 2KSPA 1CNPA 1HQVA 1P28A 1T14A 4PHMA 3LK1A 1PVBA
chains in the Genus database with same CATH topology
1ODBA 2WORA 3QRXA 1VRKA 4FTGA 2WC8A 4QJ3B 1NYAA 3AAJA 5IBWA 2MLEC 5FYXA 1NX1A 1ZFSA 2CT9A 4ZCUA 1XFZO 2MRDA 1IH0A 1DGUA 1CFDA 2KQ6A 3SG3A 1Y1UA 1ZOTB 1M45A 3AKBA 4PDZA 4AQIA 4JPZB 3TUYC 3O78A 1KQMB 1QX2A 1SPYA 2BE4A 1RFJA 1SCMB 1BU3A 1KSMA 2KI6D 2ZNDA 4F0ZB 1K95A 3GK1A 2LUXA 5ER5A 1DMOA 1UHKA 1V1GA 5D7FA 3PN7B 2LNKA 1J55A 1KFXL 2ZN8A 5AEQA 2MBXA 1JSAA 1JUOA 2L98A 1G8IA 2LLUA 3KPXA 3SJSA 1B4CA 1G33A 2K8MB 1MXEA 3EVUA 2EC6C 1SCVA 1QTXA 3CGAA 3TS5B 1OOJA 2AMIA 2BCAA 2CCMA 3VGOA 2M1UA 3ICBA 2MJWB 1GJYA 1D1OA 2K7BA 2LMUA 4GNKB 1DJIA 1K9PA 1DTLA 2Y4QA 3TDUA 2KQYA 2HETA 2LLTA 2ZRTA 1BJFA 1YTZC 3SG5A 1TNQA 1KFUS 3DF0B 4GBAA 4C0LA 1PK0D 1JBAA 2JU0A 1TCFA 3HX4A 1S5GY 1Y6WA 2OS8B 1QX5B 1TNXA 2K2AA 4I5KA 4N5XA 1MWNA 1F54A 1TTXA 1NSHA 1JC2A 4MZJA 1KWOC 3SG2A 2KI6C 2F3ZA 1XFWO 1J7OA 1IWQA 2LANA 2G2BA 2JTTA 3FWCA 4GAOA 3EK8A 4DS7A 5JOLA 1NCXA 4UPGA 3CS1A 3I5GB 3FIAA 2CTNA 1DVIA 1JFJA 4USLA 1KQMC 3BXKA 3I5IB 2JWWA 3EKJA 2NZ0A 1KSOA 1S3PA 1IGVA 3CTNA 3OHMB 4U8DA 1CDNA 1PSRA 1LXFC 2EGDA 3KF9A 1KCYA 1KFXS 4CFRA 1QLKA 5PALA 1QIVA 2DOQA 1DGVA 1R2UA 1Y1XA 2KYCA 2MHHA 1JFKA 4JQ0D 3M0WA 1J1EA 4ORCB 1G4YR 1RWYA 1NP8A 1X02A 2LV7A 2P6BB 4D1EA 1KK7Y 1SR6B 1NX0A 2FJUB 1FPWA 1A29A 1WRLA 3RLZA 2BL0B 1N0YA 4HRGA 1EXRA 1SY9A 1PALA 4MZKA 1IQ3A 2OTGB 4C0JA 4CLNA 2JQ6A 5AFPA 1UUSA 2BKHB 1MF8B 5TNCA 2KDHA 3BUOB 1OZSA 2LVJA 4HREE 3SG6A 2F2OA 2JPTA 2Y1MA 3SIAA 2Q91A 4YGCB 1KQVA 1XFUO 2KFGA 1K90D 1CLBA 1K2HA 1QXPA 2I7AA 1FBVA 1FI5A 5ER4X 1SL7A 1DF0B 1TOPA 5AANA 3BOWB 2H2KA 2LHIA 1AVSA 3DVMA 1L7ZA 2L4HA 4PE1A 3VRRA 1XFXO 5F6TA 1CM4A 3FWBA 2WCFA 5HKZA 3MSEB 1KK8C 1CLMA 2KAVA 2QPTA 1NUBA 3CLNA 2LMTA 3BUMB 4P5OE 3DVEA 5I2QA 2K2FA 1UHIA 1FI6A 2F2PA 3ZWHA 4PHNA 2CBLA 4PE0A 4MBEA 3I5HC 3IQOA 4YGAA 1GGZA 1K93D 2KAXA 3I5GC 4HSZA 2PALA 2Y5IA 1YRUB 2L50A 2L5XB 2JXCA 4Q04A 1K8UA 4NDBA 1B8CA 1DJXA 1F71A 2BCBA 5HKWA 1CLLA 1MQ1A 3I5FB 3SG7A 3E3RA 3WHTB 1MR8A 1Y0VH 1YURA 2AAOA 2JT3A 3IQQA 1BR1B 2CNPA 5CSIA 1V1FA 3DVJA 3EKHA 3VROA 2H61A 2PVBA 1BF5A 1SR6C 1FF1A 3JVTB 3KO0A 1LA3A 1WRZA 4ORAB 1SL8A 2MAZA 3OB2B 1OQPA 5CSNA 2LVKA 4L9MA 3DD4A 4N1GA 1NX2A 3PSRA 3GOFA 2ZNEA 1WY9A 1OMDA 2M0RA 2KFHA 1TNWA 4I5JA 4M2OA 1J7PA 2KI4C 2O5GA 4TNCA 2M9GA 1JF0A 1XFYO 1YX8A 5HLOA 2SCPA 2HQWA 2HPSA 3OP0A 2GV5A 4MLWA 1SRAA 2BE6A 2HF5A 2KFFA 2G9BA 2WCEA 1WDCB 2L2EA 1F4QA 4GPLB 4GGFC 4N1FA 1L2OC 4C0KA 2H61C 2F33A 3IF7A 1C7VA 1AUIB 1UHJA 1XFVO 4CPVA 5HKYA 4MSPA 4GFTA 1NCYA 2NLNA 2GGZA 3NSIA 1NCZA 4CFQA 3O6BA 1B8RA 2M7NA 1J1DA 4QJ4B 2JXLA 1CTRA 2WCBA 1OMVA 1ZACA 2ZFDA 4I5LB 2HQ8A 2LLSA 4IL1A 2VRGA 1K9UA 1NIWA 2E6WA 3AAKA 1S26D 1TIZA 2M97A 3BUXB 4PALA 1IKUA 2NXQA 2B1UA 2BBNA 4NDDA 1FW4A 1QX7A 4XJKB 1S6IA 1NX3A 1Q80A 1QS7A 3CWGA 5B8IB 1OZOA 1QVIZ 2V53A 1Y1AA 2KGRA 1A03A 2BBMA 4WRIA 2D8NA 1B9AA 1SCMC 2LVVA 4NDCA 3TZ1A 4ETOA 3DF0A 3D0YA 1IJ6A 2A4JA 1AJ4A 1B47A 4WQ3A 3PN7C 2GGMA 2KAYA 3BYAA 2I94A 3SG4A 1CB1A 1H8BA 2KBMA 1A75B 1XO5A 3NSOA 3PATA 1CM1A 3K21A 4YBHB 4JWQA 1TRFA 5CPVA 1NWDA 1SW8A 2PMYA 2K7CA 1BLQA 1YUUA 3TS5C 1RTP1 1EH2A 2KHNA 3O2PA 3KEVA 1F70A 3WXAA 1QV1A 1EG3A 1F4OA 1XK4C 1SYMA 4NQGA 1SNLA 1PULA 3LLEA 3TUYB 2K7DA 3FS7A 1RECA 3PALA 4HRHA 1BR4B 1N2DA 1IRJA 1CMGA 5CSFA 1DJGA 4BY5A 1BMOA 3PLFB 2AUCA 4AOMA 4OR9B 1DJYA 1QLSA 5I2LA 4DCKA 4FQOA 2OS8C 5GQQC 3LCPC 2Y1NA 1CDPA 5DKRA 2LCPA 5AXIA 5AERA 5BPJA 1TN4A 1CDLA 2ISDA 1CKKA 4DIRA 1CDMA 2EC6B 4DRWA 1B1GA 4I5NB 1YRTB 3CR2A 4XYNA 2KBIA 4PE7A 1IJ5A 2PRUA 1ALWA 2L51A 2LAPA 1H4BA 1DJWA 2LMVA 1IQ5A 1YVLA 1YR5A 2M3WA 1SBJA 1U5IA 1J7QA 3D10A 1OSAA 1GQMA 4YI8A 1UURA 1MUXA 3AKAA 1OE9B 3I5IC 4OCIA 1TCOB 2LHLA 3OX6A 4QJ5B 1UHHA 4OV2A 1WRKA 4M2PA 1M39A 3NSLA 2JZIA 2BECA 1PRWA 1DF0A 2JT8A 1CFCA 1LINA 2L0PA 3BOWA 1OMRA 4MRYA 5DKNA 5J3XA 4AQJA 1AK8A 1A4PA 5HLVA 3WHUB 1QATA 1KWOB 3F45A 1XYDA 2F8PA 1WLMA 1S5GZ 2LE9B 2FCEA 4GGFA 4MN0A 1B7TZ 2M1KB 2FCDA 1PVAA 1W7IB 2BL0C 3JTDB 2JRFA 4PHKA 2NCOA 2OTGC 3H4SE 2M7LA 1M46A 2PASA 3BUNB 1BODA 1F55A 5KSZA 3EK7A 1HT9A 2PSRA 2R2IA 1C7WA 2LC5A 5HYDA 1S6CA 1M63B 2JNFA 2OPOA 3OX5A 1ALVA 2KYFA 2WNDA 2FOTA 2LUCA 1S6JA 2ZRSA 1UWOA 3NXAA 3WNXB 4PCWA 2K7OA 1SKTA 3GK4X 3A4UB 2RGIA 4DUQA 4A4BA 3EVRA 1CFFA 2JULA 1WLZA 2LP2A 5KTYA 1K9KA 2KOTA 1LA0A 1B8LA 3KHEA 2NCPA 1BT6A 3CZTX 1PSBA 2IS9A 3LK0A 3VRNA 2MLFC 1DJHA 3A8RA 1DT7B 1E8AA 1KK7Z 1N65A 3O4YA 4OVNF 1QIWA 1CMFA 2ZN9A 1EJ3A 2M29A 1RK9A 2O60A 1BG1A 3ZNIA 4YGDB 3HCMA 4MEWA 4A4CA 4MZLA 1QJTA 3D0YB 4ORBB 2L4IA 1A2XA 1DJZA 1MXLC 1XK4A 2K0JA 3I5FC 4M2QA 5CSJA 1YX7A 2JC2A 1B7TY 4PHJA 2JT0A 4BY4A 3VRQA 1NPQA 1F8HA 1TNPA 1S36A 1SK6D 2F3YA 2LVIA 1KK8B 2KGBC 1XA5A 5K89A 2TN4A 1UP5A 1ZMZA 2M8UA 2EHBA 3JVTC 2LM5A 1YUTA 1BOCA 2KNEA 3JTDC 1JF2A 1R6PA 4ICBA 4OKHA 1K96A 2K61A 3EK4A 4PE4A 4YGEB 1CFPA 5DKQA 4GUKA 5D69A 3I5HB 3NSKA 1AP4A 1MHOA 1YUSA 1IG5A 3BUWB 4GGNA 1SMGA 3SIBA 4WQ2A 2BKIB 3CR5X 3DVKA 4YI9A 2CXJA 1S1EA 3TDIA 4XJKA 2ZKMX 3EVVA 2QACA 1QASA 1J7RA 2BCXA 1SL9A 1QV0A 1WDCC 2E30A 4MVFA 1RJVA 1JWDA 3GK2A 3VRPA 1RROA 4P2YB 2JTZA 5I2OA 1ZUZA 1W7JB 4MRXA 1A75A 3C1VA 2I2RE 1EL4A 5G08A 2LP3A 2I18A 4YGBB 3LL8B 3PM8A 5KU1A 4CIDA 1U5IB 1QVIY 3RM1A 1K94A 3PFVA 2JNXA 2KI4B 4ZCVA 3TDZA 1EG4A 1LVCD 3BQ3A 5I8NA 2SASA 1XVJA 5JJGA 4E68A 2WOSA 3OB1B 2MA2A 1C07A 3CR4X 1GGWA 4YRUA 2COLB 4R1EA 2Q4UA 2JOJA 1YVHA 1KFUL 1UHNA 2M49B 1LKJA 1M31A 1AJ5A 1L2OB 1AHRA 2KSPA 1CNPA 1HQVA 4PHMA 3LK1A 1PVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ODB A;  2WOR A;  3QRX A;  1VRK A;  4FTG A;  2WC8 A;  4QJ3 B;  1NYA A;  3AAJ A;  5IBW A;  2MLE C;  5FYX A;  1NX1 A;  1ZFS A;  2CT9 A;  4ZCU A;  1XFZ O;  2MRD A;  1IH0 A;  1DGU A;  1CFD A;  2KQ6 A;  3SG3 A;  1Y1U A;  1ZOT B;  1M45 A;  3AKB A;  4PDZ A;  4AQI A;  4JPZ B;  3TUY C;  3O78 A;  1KQM B;  1QX2 A;  1SPY A;  2BE4 A;  1RFJ A;  1SCM B;  1BU3 A;  1KSM A;  2KI6 D;  2ZND A;  4F0Z B;  1K95 A;  3GK1 A;  2LUX A;  5ER5 A;  1DMO A;  1UHK A;  1V1G A;  5D7F A;  3PN7 B;  2LNK A;  1J55 A;  1KFX L;  2ZN8 A;  5AEQ A;  2MBX A;  1JSA A;  1JUO A;  2L98 A;  1G8I A;  2LLU A;  3KPX A;  3SJS A;  1B4C A;  1G33 A;  2K8M B;  1MXE A;  3EVU A;  2EC6 C;  1SCV A;  1QTX A;  3CGA A;  3TS5 B;  1OOJ A;  2AMI A;  2BCA A;  2CCM A;  3VGO A;  2M1U A;  3ICB A;  2MJW B;  1GJY A;  1D1O A;  2K7B A;  2LMU A;  4GNK B;  1DJI A;  1K9P A;  1DTL A;  2Y4Q A;  3TDU A;  2KQY A;  2HET A;  2LLT A;  2ZRT A;  1BJF A;  1YTZ C;  3SG5 A;  1TNQ A;  1KFU S;  3DF0 B;  4GBA A;  4C0L A;  1PK0 D;  1JBA A;  2JU0 A;  1TCF A;  3HX4 A;  1S5G Y;  1Y6W A;  2OS8 B;  1QX5 B;  1TNX A;  2K2A A;  4I5K A;  4N5X A;  1MWN A;  1F54 A;  1TTX A;  1NSH A;  1JC2 A;  4MZJ A;  1KWO C;  3SG2 A;  2KI6 C;  2F3Z A;  1XFW O;  1J7O A;  1IWQ A;  2LAN A;  2G2B A;  2JTT A;  3FWC A;  4GAO A;  3EK8 A;  4DS7 A;  5JOL A;  1NCX A;  4UPG A;  3CS1 A;  3I5G B;  3FIA A;  2CTN A;  1DVI A;  1JFJ A;  4USL A;  1KQM C;  3BXK A;  3I5I B;  2JWW A;  3EKJ A;  2NZ0 A;  1KSO A;  1S3P A;  1IGV A;  3CTN A;  3OHM B;  4U8D A;  1CDN A;  1PSR A;  1LXF C;  2EGD A;  3KF9 A;  1KCY A;  1KFX S;  4CFR A;  1QLK A;  5PAL A;  1QIV A;  2DOQ A;  1DGV A;  1R2U A;  1Y1X A;  2KYC A;  2MHH A;  1JFK A;  4JQ0 D;  3M0W A;  1J1E A;  4ORC B;  1G4Y R;  1RWY A;  1NP8 A;  1X02 A;  2LV7 A;  2P6B B;  4D1E A;  1KK7 Y;  1SR6 B;  1NX0 A;  2FJU B;  1FPW A;  1A29 A;  1WRL A;  3RLZ A;  2BL0 B;  1N0Y A;  4HRG A;  1EXR A;  1SY9 A;  1PAL A;  4MZK A;  1IQ3 A;  2OTG B;  4C0J A;  4CLN A;  2JQ6 A;  5AFP A;  1UUS A;  2BKH B;  1MF8 B;  5TNC A;  2KDH A;  3BUO B;  1OZS A;  2LVJ A;  4HRE E;  3SG6 A;  2F2O A;  2JPT A;  2Y1M A;  3SIA A;  2Q91 A;  4YGC B;  1KQV A;  1XFU O;  2KFG A;  1K90 D;  1CLB A;  1K2H A;  1QXP A;  2I7A A;  1FBV A;  1FI5 A;  5ER4 X;  1SL7 A;  1DF0 B;  1TOP A;  5AAN A;  3BOW B;  2H2K A;  2LHI A;  1AVS A;  3DVM A;  1L7Z A;  2L4H A;  4PE1 A;  3VRR A;  1XFX O;  5F6T A;  1CM4 A;  3FWB A;  2WCF A;  5HKZ A;  3MSE B;  1KK8 C;  1CLM A;  2KAV A;  2QPT A;  1NUB A;  3CLN A;  2LMT A;  3BUM B;  4P5O E;  3DVE A;  5I2Q A;  2K2F A;  1UHI A;  1FI6 A;  2F2P A;  3ZWH A;  4PHN A;  2CBL A;  4PE0 A;  4MBE A;  3I5H C;  3IQO A;  4YGA A;  1GGZ A;  1K93 D;  2KAX A;  3I5G C;  4HSZ A;  2PAL A;  2Y5I A;  1YRU B;  2L50 A;  2L5X B;  2JXC A;  4Q04 A;  1K8U A;  4NDB A;  1B8C A;  1DJX A;  1F71 A;  2BCB A;  5HKW A;  1CLL A;  1MQ1 A;  3I5F B;  3SG7 A;  3E3R A;  3WHT B;  1MR8 A;  1Y0V H;  1YUR A;  2AAO A;  2JT3 A;  3IQQ A;  1BR1 B;  2CNP A;  5CSI A;  1V1F A;  3DVJ A;  3EKH A;  3VRO A;  2H61 A;  2PVB A;  1BF5 A;  1SR6 C;  1FF1 A;  3JVT B;  3KO0 A;  1LA3 A;  1WRZ A;  4ORA B;  1SL8 A;  2MAZ A;  3OB2 B;  1OQP A;  5CSN A;  2LVK A;  4L9M A;  3DD4 A;  4N1G A;  1NX2 A;  3PSR A;  3GOF A;  2ZNE A;  1WY9 A;  1OMD A;  2M0R A;  2KFH A;  1TNW A;  4I5J A;  4M2O A;  1J7P A;  2KI4 C;  2O5G A;  4TNC A;  2M9G A;  1JF0 A;  1XFY O;  1YX8 A;  5HLO A;  2SCP A;  2HQW A;  2HPS A;  3OP0 A;  2GV5 A;  4MLW A;  1SRA A;  2BE6 A;  2HF5 A;  2KFF A;  2G9B A;  2WCE A;  1WDC B;  2L2E A;  1F4Q A;  4GPL B;  4GGF C;  4N1F A;  1L2O C;  4C0K A;  2H61 C;  2F33 A;  3IF7 A;  1C7V A;  1AUI B;  1UHJ A;  1XFV O;  4CPV A;  5HKY A;  4MSP A;  4GFT A;  1NCY A;  2NLN A;  2GGZ A;  3NSI A;  1NCZ A;  4CFQ A;  3O6B A;  1B8R A;  2M7N A;  1J1D A;  4QJ4 B;  2JXL A;  1CTR A;  2WCB A;  1OMV A;  1ZAC A;  2ZFD A;  4I5L B;  2HQ8 A;  2LLS A;  4IL1 A;  2VRG A;  1K9U A;  1NIW A;  2E6W A;  3AAK A;  1S26 D;  1TIZ A;  2M97 A;  3BUX B;  4PAL A;  1IKU A;  2NXQ A;  2B1U A;  2BBN A;  4NDD A;  1FW4 A;  1QX7 A;  4XJK B;  1S6I A;  1NX3 A;  1Q80 A;  1QS7 A;  3CWG A;  5B8I B;  1OZO A;  1QVI Z;  2V53 A;  1Y1A A;  2KGR A;  1A03 A;  2BBM A;  4WRI A;  2D8N A;  1B9A A;  1SCM C;  2LVV A;  4NDC A;  3TZ1 A;  4ETO A;  3DF0 A;  3D0Y A;  1IJ6 A;  2A4J A;  1AJ4 A;  1B47 A;  4WQ3 A;  3PN7 C;  2GGM A;  2KAY A;  3BYA A;  2I94 A;  3SG4 A;  1CB1 A;  1H8B A;  2KBM A;  1A75 B;  1XO5 A;  3NSO A;  3PAT A;  1CM1 A;  3K21 A;  4YBH B;  4JWQ A;  1TRF A;  5CPV A;  1NWD A;  1SW8 A;  2PMY A;  2K7C A;  1BLQ A;  1YUU A;  3TS5 C;  1RTP 1;  1EH2 A;  2KHN A;  3O2P A;  3KEV A;  1F70 A;  3WXA A;  1QV1 A;  1EG3 A;  1F4O A;  1XK4 C;  1SYM A;  4NQG A;  1SNL A;  1PUL A;  3LLE A;  3TUY B;  2K7D A;  3FS7 A;  1REC A;  3PAL A;  4HRH A;  1BR4 B;  1N2D A;  1IRJ A;  1CMG A;  5CSF A;  1DJG A;  4BY5 A;  1BMO A;  3PLF B;  2AUC A;  4AOM A;  4OR9 B;  1DJY A;  1QLS A;  5I2L A;  4DCK A;  4FQO A;  2OS8 C;  5GQQ C;  3LCP C;  2Y1N A;  1CDP A;  5DKR A;  2LCP A;  5AXI A;  5AER A;  5BPJ A;  1TN4 A;  1CDL A;  2ISD A;  1CKK A;  4DIR A;  1CDM A;  2EC6 B;  4DRW A;  1B1G A;  4I5N B;  1YRT B;  3CR2 A;  4XYN A;  2KBI A;  4PE7 A;  1IJ5 A;  2PRU A;  1ALW A;  2L51 A;  2LAP A;  1H4B A;  1DJW A;  2LMV A;  1IQ5 A;  1YVL A;  1YR5 A;  2M3W A;  1SBJ A;  1U5I A;  1J7Q A;  3D10 A;  1OSA A;  1GQM A;  4YI8 A;  1UUR A;  1MUX A;  3AKA A;  1OE9 B;  3I5I C;  4OCI A;  1TCO B;  2LHL A;  3OX6 A;  4QJ5 B;  1UHH A;  4OV2 A;  1WRK A;  4M2P A;  1M39 A;  3NSL A;  2JZI A;  2BEC A;  1PRW A;  1DF0 A;  2JT8 A;  1CFC A;  1LIN A;  2L0P A;  3BOW A;  1OMR A;  4MRY A;  5DKN A;  5J3X A;  4AQJ A;  1AK8 A;  1A4P A;  5HLV A;  3WHU B;  1QAT A;  1KWO B;  3F45 A;  1XYD A;  2F8P A;  1WLM A;  1S5G Z;  2LE9 B;  2FCE A;  4GGF A;  4MN0 A;  1B7T Z;  2M1K B;  2FCD A;  1PVA A;  1W7I B;  2BL0 C;  3JTD B;  2JRF A;  4PHK A;  2NCO A;  2OTG C;  3H4S E;  2M7L A;  1M46 A;  2PAS A;  3BUN B;  1BOD A;  1F55 A;  5KSZ A;  3EK7 A;  1HT9 A;  2PSR A;  2R2I A;  1C7W A;  2LC5 A;  5HYD A;  1S6C A;  1M63 B;  2JNF A;  2OPO A;  3OX5 A;  1ALV A;  2KYF A;  2WND A;  2FOT A;  2LUC A;  1S6J A;  2ZRS A;  1UWO A;  3NXA A;  3WNX B;  4PCW A;  2K7O A;  1SKT A;  3GK4 X;  3A4U B;  2RGI A;  4DUQ A;  4A4B A;  3EVR A;  1CFF A;  2JUL A;  1WLZ A;  2LP2 A;  5KTY A;  1K9K A;  2KOT A;  1LA0 A;  1B8L A;  3KHE A;  2NCP A;  1BT6 A;  3CZT X;  1PSB A;  2IS9 A;  3LK0 A;  3VRN A;  2MLF C;  1DJH A;  3A8R A;  1DT7 B;  1E8A A;  1KK7 Z;  1N65 A;  3O4Y A;  4OVN F;  1QIW A;  1CMF A;  2ZN9 A;  1EJ3 A;  2M29 A;  1RK9 A;  2O60 A;  1BG1 A;  3ZNI A;  4YGD B;  3HCM A;  4MEW A;  4A4C A;  4MZL A;  1QJT A;  3D0Y B;  4ORB B;  2L4I A;  1A2X A;  1DJZ A;  1MXL C;  1XK4 A;  2K0J A;  3I5F C;  4M2Q A;  5CSJ A;  1YX7 A;  2JC2 A;  1B7T Y;  4PHJ A;  2JT0 A;  4BY4 A;  3VRQ A;  1NPQ A;  1F8H A;  1TNP A;  1S36 A;  1SK6 D;  2F3Y A;  2LVI A;  1KK8 B;  2KGB C;  1XA5 A;  5K89 A;  2TN4 A;  1UP5 A;  1ZMZ A;  2M8U A;  2EHB A;  3JVT C;  2LM5 A;  1YUT A;  1BOC A;  2KNE A;  3JTD C;  1JF2 A;  1R6P A;  4ICB A;  4OKH A;  1K96 A;  2K61 A;  3EK4 A;  4PE4 A;  4YGE B;  1CFP A;  5DKQ A;  4GUK A;  5D69 A;  3I5H B;  3NSK A;  1AP4 A;  1MHO A;  1YUS A;  1IG5 A;  3BUW B;  4GGN A;  1SMG A;  3SIB A;  4WQ2 A;  2BKI B;  3CR5 X;  3DVK A;  4YI9 A;  2CXJ A;  1S1E A;  3TDI A;  4XJK A;  2ZKM X;  3EVV A;  2QAC A;  1QAS A;  1J7R A;  2BCX A;  1SL9 A;  1QV0 A;  1WDC C;  2E30 A;  4MVF A;  1RJV A;  1JWD A;  3GK2 A;  3VRP A;  1RRO A;  4P2Y B;  2JTZ A;  5I2O A;  1ZUZ A;  1W7J B;  4MRX A;  1A75 A;  3C1V A;  2I2R E;  1EL4 A;  5G08 A;  2LP3 A;  2I18 A;  4YGB B;  3LL8 B;  3PM8 A;  5KU1 A;  4CID A;  1U5I B;  1QVI Y;  3RM1 A;  1K94 A;  3PFV A;  2JNX A;  2KI4 B;  4ZCV A;  3TDZ A;  1EG4 A;  1LVC D;  3BQ3 A;  5I8N A;  2SAS A;  1XVJ A;  5JJG A;  4E68 A;  2WOS A;  3OB1 B;  2MA2 A;  1C07 A;  3CR4 X;  1GGW A;  4YRU A;  2COL B;  4R1E A;  2Q4U A;  2JOJ A;  1YVH A;  1KFU L;  1UHN A;  2M49 B;  1LKJ A;  1M31 A;  1AJ5 A;  1L2O B;  1AHR A;  2KSP A;  1CNP A;  1HQV A;  4PHM A;  3LK1 A;  1PVB A; 
#chains in the Genus database with same CATH topology
 1ODB A;  2WOR A;  3QRX A;  3CDN A;  1VRK A;  4FTG A;  1DEL A;  2WC8 A;  4QJ3 B;  1NYA A;  3AAJ A;  5IBW A;  2KPH A;  2MLE C;  1NX1 A;  5FYX A;  1ZFS A;  2CT9 A;  4ZCU A;  1OW4 A;  1XFZ O;  2MRD A;  4IJ7 A;  1IH0 A;  1DGU A;  1CFD A;  2KQ6 A;  3SG3 A;  1Y1U A;  1ZOT B;  1M45 A;  2QEV A;  3AKB A;  4PDZ A;  4FQT A;  4JPZ B;  3V2L A;  4AQI A;  3TUY C;  3O78 A;  1KQM B;  1QX2 A;  1SPY A;  2BE4 A;  1RFJ A;  1SCM B;  1BU3 A;  1KSM A;  2KI6 D;  2ZND A;  4F0Z B;  1K95 A;  1DEK A;  2LUX A;  3GK1 A;  3OBV A;  5ER5 A;  1DMO A;  3D73 A;  1UHK A;  1V1G A;  5D7F A;  3PN7 B;  2LNK A;  2WCL A;  1J55 A;  1KFX L;  5FI6 A;  2ZN8 A;  5AEQ A;  2MBX A;  1JSA A;  1JUO A;  2L98 A;  1G8I A;  2LLU A;  3KPX A;  3SJS A;  1B4C A;  1G33 A;  2K8M B;  1MXE A;  3EVU A;  3DXL A;  2EC6 C;  3S0E A;  3FE6 A;  1SCV A;  1QTX A;  3CGA A;  3TS5 B;  1OOJ A;  2AMI A;  2BCA A;  2CCM A;  3VGO A;  2L5Y A;  2M1U A;  3ICB A;  2MJW B;  1GJY A;  3NGV A;  1D1O A;  2K7B A;  2LMU A;  4GNK B;  1DJI A;  1K9P A;  3S0D A;  1DTL A;  2Y4Q A;  3B87 A;  3TDU A;  2KQY A;  1TUZ A;  2HET A;  2LLT A;  2ZRT A;  1BJF A;  1YTZ C;  3SG5 A;  1TNQ A;  4JKT A;  3O4X A;  1KFU S;  3DF0 B;  3NHI A;  4GBA A;  2WC6 A;  1PK0 D;  3Q8I A;  4C0L A;  2JU0 A;  1JBA A;  1TCF A;  3HX4 A;  1S5G Y;  1Y6W A;  2OS8 B;  1QX5 B;  1TNX A;  2K2A A;  4I5K A;  4N5X A;  1MWN A;  1F54 A;  1TTX A;  1NSH A;  1JC2 A;  4MZJ A;  1KWO C;  3SG2 A;  2KI6 C;  2F3Z A;  1XFW O;  1ORG A;  1J7O A;  1IWQ A;  2LAN A;  2G2B A;  2JTT A;  2WCJ A;  3FWC A;  4GAO A;  2BNX A;  2P70 A;  3EK8 A;  4DS7 A;  5JOL A;  1NCX A;  3DY9 A;  4UPG A;  1LS8 A;  3CS1 A;  3I5G B;  3FIA A;  2CTN A;  1DVI A;  1JFJ A;  4USL A;  1KQM C;  4JD9 A;  3BXK A;  3I5I B;  2JWW A;  3EKJ A;  2NZ0 A;  3FE9 A;  1KSO A;  1S3P A;  1IGV A;  3CTN A;  3OHM B;  4U8D A;  1CDN A;  1PSR A;  1LXF C;  2EGD A;  3KF9 A;  1KCY A;  1KFX S;  4CFR A;  1QLK A;  5PAL A;  1QIV A;  2DOQ A;  1DGV A;  1R2U A;  1Y1X A;  2KYC A;  2MHH A;  1JFK A;  3D74 A;  4JQ0 D;  3M0W A;  1J1E A;  4ORC B;  1G4Y R;  1RWY A;  1NP8 A;  3OGN A;  1X02 A;  2LV7 A;  2P6B B;  4D1E A;  1KK7 Y;  1SR6 B;  1NX0 A;  2FJU B;  3UO9 A;  1A29 A;  1WRL A;  3RLZ A;  1FPW A;  2BL0 B;  1N0Y A;  4HRG A;  1EXR A;  1SY9 A;  1PAL A;  4MZK A;  1IQ3 A;  1XFR A;  2OTG B;  4C0J A;  1QWV A;  1TUJ A;  4CLN A;  2JQ6 A;  5AFP A;  1UUS A;  2BKH B;  1MF8 B;  5TNC A;  2KDH A;  3BUO B;  1OZS A;  2LVJ A;  4HRE E;  3SG6 A;  2F2O A;  2JPT A;  2Y1M A;  3SIA A;  2Q91 A;  4YGC B;  1KQV A;  2FJY A;  1XFU O;  2KFG A;  1K90 D;  1CLB A;  1K2H A;  1QXP A;  2I7A A;  1FBV A;  1FI5 A;  5ER4 X;  1SL7 A;  1DF0 B;  1TOP A;  5AAN A;  3BOW B;  2H2K A;  2LHI A;  3K1E A;  1AVS A;  3DVM A;  1L7Z A;  2L4H A;  3D75 A;  4PE1 A;  1XFX O;  5F6T A;  1CM4 A;  3FWB A;  3VRR A;  2WCF A;  5HKZ A;  3MSE B;  1KK8 C;  4INX A;  1CLM A;  2KAV A;  2QPT A;  1NUB A;  3CLN A;  3FE8 A;  2LMT A;  3BUM B;  4P5O E;  3DVE A;  5I2Q A;  1SSE B;  2K2F A;  1UHI A;  1FI6 A;  3L47 A;  3RZS A;  2F2P A;  3ZWH A;  4PHN A;  1OOI X;  2CBL A;  1OOF A;  4MBE A;  3I5H C;  3IQO A;  4PE0 A;  4YGA A;  1GGZ A;  1K93 D;  2KAX A;  3I5G C;  4HSZ A;  2PAL A;  2Y5I A;  1YRU B;  2L50 A;  2L5X B;  2JXC A;  4Q04 A;  1K8U A;  3NHT A;  4NDB A;  1B8C A;  1DJX A;  1F71 A;  2BCB A;  5HKW A;  1CLL A;  1MQ1 A;  3I5F B;  3SG7 A;  3E3R A;  3WHT B;  1MR8 A;  1Y0V H;  1YUR A;  2AAO A;  2JT3 A;  3IQQ A;  1BR1 B;  2CNP A;  5CSI A;  1V1F A;  3DVJ A;  3EKH A;  3VRO A;  2H61 A;  2PVB A;  2YGU A;  1BF5 A;  1SR6 C;  1FF1 A;  3JVT B;  3KO0 A;  1LA3 A;  1WRZ A;  4ORA B;  1SL8 A;  2MAZ A;  3OB2 B;  1OQP A;  5CSN A;  2LVK A;  4L9M A;  3DD4 A;  4N1G A;  3B6X A;  1NX2 A;  3PSR A;  3GOF A;  2QEH A;  2ZNE A;  1WY9 A;  1OMD A;  2M0R A;  2KFH A;  1TNW A;  3R72 A;  4I5J A;  4M2O A;  1J7P A;  2KI4 C;  2O5G A;  4TNC A;  2M9G A;  1JF0 A;  1XFY O;  1YX8 A;  5HLO A;  1C3Y A;  2SCP A;  2HQW A;  2HPS A;  3OP0 A;  2GV5 A;  3BFH A;  4MLW A;  1SRA A;  2QEO A;  3UNW A;  2BE6 A;  2HF5 A;  2KFF A;  2G9B A;  2WCE A;  1WDC B;  2L2E A;  1F4Q A;  4GPL B;  4GGF C;  4N1F A;  1L2O C;  4C0K A;  2H61 C;  2F33 A;  3IF7 A;  1C7V A;  1AUI B;  1UHJ A;  1XFV O;  4CPV A;  5HKY A;  4MSP A;  4GFT A;  1NCY A;  2NLN A;  2GGZ A;  3NSI A;  1NCZ A;  4CFQ A;  5D3O A;  3O6B A;  2WCM A;  1B8R A;  2M7N A;  1J1D A;  4QJ4 B;  2JXL A;  1CTR A;  2WCB A;  1OMV A;  1ZAC A;  2ZFD A;  4I5L B;  2HQ8 A;  2LLS A;  4IL1 A;  2VRG A;  1K9U A;  1NIW A;  2E6W A;  3AAK A;  1S26 D;  1TIZ A;  2M97 A;  3BUX B;  3DYE A;  4PAL A;  1IKU A;  2NXQ A;  2B1U A;  2BBN A;  2WCK A;  4NDD A;  1FW4 A;  1QX7 A;  4XJK B;  1S6I A;  1NX3 A;  1OOH A;  1Q80 A;  1QS7 A;  3CWG A;  4KYN A;  5B8I B;  1OZO A;  1QVI Z;  2V53 A;  1Y1A A;  2KGR A;  1A03 A;  2BBM A;  4WRI A;  2D8N A;  1B9A A;  1SCM C;  2LVV A;  4NDC A;  3TZ1 A;  4ETO A;  3DF0 A;  5EL2 A;  3D0Y A;  1IJ6 A;  2A4J A;  1AJ4 A;  1B47 A;  2K60 A;  3PN7 C;  2GGM A;  2KAY A;  3BYA A;  2I94 A;  4WQ3 A;  3SG4 A;  1CB1 A;  2BAP A;  3BFA A;  1H8B A;  2KBM A;  1A75 B;  1XO5 A;  3NSO A;  3BFB A;  3PAT A;  2PQL A;  3S0A A;  1CM1 A;  3K21 A;  3B86 A;  4JWQ A;  1TRF A;  3CZ2 A;  4YBH B;  1NWD A;  1SW8 A;  5CPV A;  2PMY A;  2K7C A;  1BLQ A;  1YUU A;  3SS3 A;  3TS5 C;  1RTP 1;  3D77 A;  1EH2 A;  2KHN A;  3O2P A;  3VB1 A;  3KEV A;  1F70 A;  3WXA A;  1QV1 A;  1EG3 A;  1F4O A;  3PM2 A;  1XK4 C;  1SYM A;  4NQG A;  1SNL A;  1PUL A;  3LLE A;  3TUY B;  2K7D A;  2QDI A;  1REC A;  3FS7 A;  3PAL A;  4HRH A;  1BR4 B;  1N2D A;  1IRJ A;  1CMG A;  5CSF A;  1DJG A;  4BY5 A;  1BMO A;  3PLF B;  2AUC A;  3QME A;  2KLE A;  4OR9 B;  4AOM A;  1DJY A;  1QLS A;  5I2L A;  3L4A A;  4FQO A;  4DCK A;  2OS8 C;  5GQQ C;  3LCP C;  2Y1N A;  1CDP A;  5DKR A;  2LCP A;  5AXI A;  5AER A;  5BPJ A;  1TN4 A;  1CDL A;  2ISD A;  1CKK A;  4DIR A;  1CDM A;  2EC6 B;  4DRW A;  1B1G A;  4I5N B;  1YRT B;  2GTE A;  3CR2 A;  4XYN A;  2KBI A;  3D78 A;  4PE7 A;  1IJ5 A;  2PRU A;  1ALW A;  2L51 A;  2LAP A;  1H4B A;  1DJW A;  1OOG A;  2LMV A;  1IQ5 A;  4OZD A;  1YVL A;  1YR5 A;  2M3W A;  1SBJ A;  1U5I A;  1J7Q A;  3D10 A;  1OSA A;  1GQM A;  4YI8 A;  1UUR A;  1MUX A;  3AKA A;  1OE9 B;  3I5I C;  4OCI A;  1TCO B;  2LHL A;  3OX6 A;  4QJ5 B;  1UHH A;  4OV2 A;  1WRK A;  4M2P A;  1M39 A;  3NSL A;  2JZI A;  3S0G A;  2BEC A;  1PRW A;  1DF0 A;  2JT8 A;  1CFC A;  1LIN A;  2L0P A;  2KLD A;  1OMR A;  3BOW A;  4MRY A;  5DKN A;  5J3X A;  4AQJ A;  1A4P A;  1AK8 A;  5HLV A;  3WHU B;  1QAT A;  1KWO B;  3F45 A;  1XYD A;  5DIC A;  2F8P A;  1WLM A;  1S5G Z;  2LE9 B;  2FCE A;  4GGF A;  2H8V A;  4MN0 A;  1B7T Z;  2M1K B;  2FCD A;  2JPO A;  1PVA A;  1W7I B;  2BL0 C;  3JTD B;  2JRF A;  4PHK A;  5FI7 A;  2NCO A;  2OTG C;  3H4S E;  2M7L A;  1M46 A;  2PAS A;  3BUN B;  5I94 A;  1BOD A;  1F55 A;  5KSZ A;  3EK7 A;  1W9Z A;  1HT9 A;  2PSR A;  2R2I A;  1C7W A;  2LC5 A;  2WC5 A;  1S6C A;  5HYD A;  1M63 B;  2JNF A;  2OPO A;  3OX5 A;  3PJI A;  1ALV A;  2KYF A;  2WND A;  2FOT A;  2LUC A;  1S6J A;  2ZRS A;  1UWO A;  3NXA A;  3WNX B;  4PCW A;  2K7O A;  1SKT A;  3GK4 X;  3A4U B;  3B88 A;  2RGI A;  3B7A A;  4DUQ A;  4A4B A;  5FI2 A;  3EVR A;  1CFF A;  2JUL A;  1WLZ A;  2LP2 A;  5KTY A;  1K9K A;  2KOT A;  1DC1 A;  1LA0 A;  1B8L A;  3KHE A;  2NCP A;  1GM0 A;  1BT6 A;  3CZT X;  1PSB A;  2IS9 A;  3LK0 A;  3R1O A;  2MLF C;  3VRN A;  1Z2C B;  1DJH A;  3A8R A;  1DT7 B;  1E8A A;  1KK7 Z;  1N65 A;  3O4Y A;  4OVN F;  1QIW A;  1CMF A;  2ZN9 A;  3CZ1 A;  1EJ3 A;  2M29 A;  1RK9 A;  2O60 A;  1BG1 A;  3ZNI A;  4YGD B;  3HCM A;  4MEW A;  4A4C A;  4MZL A;  1QJT A;  3D0Y B;  4ORB B;  2L4I A;  1A2X A;  1C3Z A;  1DJZ A;  1MXL C;  1XK4 A;  2K0J A;  3I5F C;  4M2Q A;  5CSJ A;  1YX7 A;  2JC2 A;  1B7T Y;  3CZ0 A;  4PHJ A;  2JT0 A;  4BY4 A;  3VRQ A;  1NPQ A;  1F8H A;  1TNP A;  1S36 A;  3CAB A;  1SK6 D;  3S0B A;  2F3Y A;  2LVI A;  1KK8 B;  2KGB C;  1XA5 A;  5K89 A;  2TN4 A;  2ERB A;  1UP5 A;  1ZMZ A;  2M8U A;  2EHB A;  3JVT C;  2LM5 A;  2P71 A;  1YUT A;  1BOC A;  2KNE A;  3JTD C;  2L2C A;  1JF2 A;  1R6P A;  4ICB A;  4OKH A;  1K96 A;  1TWO A;  2K61 A;  3EK4 A;  4PE4 A;  4YGE B;  1CFP A;  5DKQ A;  4GUK A;  5D69 A;  3I5H B;  3NSK A;  1AP4 A;  1MHO A;  1YUS A;  1IG5 A;  3BUW B;  3D76 A;  4GGN A;  1SMG A;  3SIB A;  4WQ2 A;  2BKI B;  3CR5 X;  3DVK A;  3DZT A;  4YI9 A;  2CXJ A;  2PYQ A;  1S1E A;  3TDI A;  4XJK A;  2ZKM X;  1Z4H A;  3EVV A;  2QAC A;  1QAS A;  1J7R A;  3CYZ A;  2BCX A;  1SL9 A;  1IIO A;  1QV0 A;  3N7H A;  1WDC C;  2E30 A;  4INW A;  4MVF A;  1RJV A;  3IVT A;  1JWD A;  3GK2 A;  2QEB A;  3EG5 B;  1RRO A;  3VRP A;  4P2Y B;  3BJH A;  2JTZ A;  3SS4 A;  5I2O A;  1ZUZ A;  1W7J B;  4MRX A;  1A75 A;  3C1V A;  2I2R E;  1EL4 A;  3R1V A;  2LP3 A;  2I18 A;  4YGB B;  3LL8 B;  4PT1 A;  5G08 A;  1DQE A;  3PM8 A;  5KU1 A;  3L4L A;  3SS5 A;  4CID A;  1U5I B;  2WCH A;  5HL1 A;  1QVI Y;  3RM1 A;  1K94 A;  3PFV A;  2JNX A;  2KI4 B;  4ZCV A;  3TDZ A;  1EG4 A;  1LVC D;  3BQ3 A;  5I8N A;  2SAS A;  1XVJ A;  5JJG A;  4E68 A;  2WOS A;  3OB1 B;  2MA2 A;  1C07 A;  3CR4 X;  4F7F A;  1GGW A;  4YRU A;  2COL B;  4R1E A;  2Q4U A;  2JOJ A;  3R1P A;  1YVH A;  1KFU L;  1UHN A;  2M49 B;  3S0F A;  1LKJ A;  1M31 A;  1AJ5 A;  1L2O B;  1AHR A;  2KSP A;  1CNP A;  1HQV A;  1P28 A;  1T14 A;  4PHM A;  3LK1 A;  1PVB A; 
#chains in the Genus database with same CATH homology
 1ODB A;  2WOR A;  3QRX A;  1VRK A;  4FTG A;  2WC8 A;  4QJ3 B;  1NYA A;  3AAJ A;  5IBW A;  2MLE C;  5FYX A;  1NX1 A;  1ZFS A;  2CT9 A;  4ZCU A;  1XFZ O;  2MRD A;  1IH0 A;  1DGU A;  1CFD A;  2KQ6 A;  3SG3 A;  1Y1U A;  1ZOT B;  1M45 A;  3AKB A;  4PDZ A;  4AQI A;  4JPZ B;  3TUY C;  3O78 A;  1KQM B;  1QX2 A;  1SPY A;  2BE4 A;  1RFJ A;  1SCM B;  1BU3 A;  1KSM A;  2KI6 D;  2ZND A;  4F0Z B;  1K95 A;  3GK1 A;  2LUX A;  5ER5 A;  1DMO A;  1UHK A;  1V1G A;  5D7F A;  3PN7 B;  2LNK A;  1J55 A;  1KFX L;  2ZN8 A;  5AEQ A;  2MBX A;  1JSA A;  1JUO A;  2L98 A;  1G8I A;  2LLU A;  3KPX A;  3SJS A;  1B4C A;  1G33 A;  2K8M B;  1MXE A;  3EVU A;  2EC6 C;  1SCV A;  1QTX A;  3CGA A;  3TS5 B;  1OOJ A;  2AMI A;  2BCA A;  2CCM A;  3VGO A;  2M1U A;  3ICB A;  2MJW B;  1GJY A;  1D1O A;  2K7B A;  2LMU A;  4GNK B;  1DJI A;  1K9P A;  1DTL A;  2Y4Q A;  3TDU A;  2KQY A;  2HET A;  2LLT A;  2ZRT A;  1BJF A;  1YTZ C;  3SG5 A;  1TNQ A;  1KFU S;  3DF0 B;  4GBA A;  4C0L A;  1PK0 D;  1JBA A;  2JU0 A;  1TCF A;  3HX4 A;  1S5G Y;  1Y6W A;  2OS8 B;  1QX5 B;  1TNX A;  2K2A A;  4I5K A;  4N5X A;  1MWN A;  1F54 A;  1TTX A;  1NSH A;  1JC2 A;  4MZJ A;  1KWO C;  3SG2 A;  2KI6 C;  2F3Z A;  1XFW O;  1J7O A;  1IWQ A;  2LAN A;  2G2B A;  2JTT A;  3FWC A;  4GAO A;  3EK8 A;  4DS7 A;  5JOL A;  1NCX A;  4UPG A;  3CS1 A;  3I5G B;  3FIA A;  2CTN A;  1DVI A;  1JFJ A;  4USL A;  1KQM C;  3BXK A;  3I5I B;  2JWW A;  3EKJ A;  2NZ0 A;  1KSO A;  1S3P A;  1IGV A;  3CTN A;  3OHM B;  4U8D A;  1CDN A;  1PSR A;  1LXF C;  2EGD A;  3KF9 A;  1KCY A;  1KFX S;  4CFR A;  1QLK A;  5PAL A;  1QIV A;  2DOQ A;  1DGV A;  1R2U A;  1Y1X A;  2KYC A;  2MHH A;  1JFK A;  4JQ0 D;  3M0W A;  1J1E A;  4ORC B;  1G4Y R;  1RWY A;  1NP8 A;  1X02 A;  2LV7 A;  2P6B B;  4D1E A;  1KK7 Y;  1SR6 B;  1NX0 A;  2FJU B;  1FPW A;  1A29 A;  1WRL A;  3RLZ A;  2BL0 B;  1N0Y A;  4HRG A;  1EXR A;  1SY9 A;  1PAL A;  4MZK A;  1IQ3 A;  2OTG B;  4C0J A;  4CLN A;  2JQ6 A;  5AFP A;  1UUS A;  2BKH B;  1MF8 B;  5TNC A;  2KDH A;  3BUO B;  1OZS A;  2LVJ A;  4HRE E;  3SG6 A;  2F2O A;  2JPT A;  2Y1M A;  3SIA A;  2Q91 A;  4YGC B;  1KQV A;  1XFU O;  2KFG A;  1K90 D;  1CLB A;  1K2H A;  1QXP A;  2I7A A;  1FBV A;  1FI5 A;  5ER4 X;  1SL7 A;  1DF0 B;  1TOP A;  5AAN A;  3BOW B;  2H2K A;  2LHI A;  1AVS A;  3DVM A;  1L7Z A;  2L4H A;  4PE1 A;  3VRR A;  1XFX O;  5F6T A;  1CM4 A;  3FWB A;  2WCF A;  5HKZ A;  3MSE B;  1KK8 C;  1CLM A;  2KAV A;  2QPT A;  1NUB A;  3CLN A;  2LMT A;  3BUM B;  4P5O E;  3DVE A;  5I2Q A;  2K2F A;  1UHI A;  1FI6 A;  2F2P A;  3ZWH A;  4PHN A;  2CBL A;  4PE0 A;  4MBE A;  3I5H C;  3IQO A;  4YGA A;  1GGZ A;  1K93 D;  2KAX A;  3I5G C;  4HSZ A;  2PAL A;  2Y5I A;  1YRU B;  2L50 A;  2L5X B;  2JXC A;  4Q04 A;  1K8U A;  4NDB A;  1B8C A;  1DJX A;  1F71 A;  2BCB A;  5HKW A;  1CLL A;  1MQ1 A;  3I5F B;  3SG7 A;  3E3R A;  3WHT B;  1MR8 A;  1Y0V H;  1YUR A;  2AAO A;  2JT3 A;  3IQQ A;  1BR1 B;  2CNP A;  5CSI A;  1V1F A;  3DVJ A;  3EKH A;  3VRO A;  2H61 A;  2PVB A;  1BF5 A;  1SR6 C;  1FF1 A;  3JVT B;  3KO0 A;  1LA3 A;  1WRZ A;  4ORA B;  1SL8 A;  2MAZ A;  3OB2 B;  1OQP A;  5CSN A;  2LVK A;  4L9M A;  3DD4 A;  4N1G A;  1NX2 A;  3PSR A;  3GOF A;  2ZNE A;  1WY9 A;  1OMD A;  2M0R A;  2KFH A;  1TNW A;  4I5J A;  4M2O A;  1J7P A;  2KI4 C;  2O5G A;  4TNC A;  2M9G A;  1JF0 A;  1XFY O;  1YX8 A;  5HLO A;  2SCP A;  2HQW A;  2HPS A;  3OP0 A;  2GV5 A;  4MLW A;  1SRA A;  2BE6 A;  2HF5 A;  2KFF A;  2G9B A;  2WCE A;  1WDC B;  2L2E A;  1F4Q A;  4GPL B;  4GGF C;  4N1F A;  1L2O C;  4C0K A;  2H61 C;  2F33 A;  3IF7 A;  1C7V A;  1AUI B;  1UHJ A;  1XFV O;  4CPV A;  5HKY A;  4MSP A;  4GFT A;  1NCY A;  2NLN A;  2GGZ A;  3NSI A;  1NCZ A;  4CFQ A;  3O6B A;  1B8R A;  2M7N A;  1J1D A;  4QJ4 B;  2JXL A;  1CTR A;  2WCB A;  1OMV A;  1ZAC A;  2ZFD A;  4I5L B;  2HQ8 A;  2LLS A;  4IL1 A;  2VRG A;  1K9U A;  1NIW A;  2E6W A;  3AAK A;  1S26 D;  1TIZ A;  2M97 A;  3BUX B;  4PAL A;  1IKU A;  2NXQ A;  2B1U A;  2BBN A;  4NDD A;  1FW4 A;  1QX7 A;  4XJK B;  1S6I A;  1NX3 A;  1Q80 A;  1QS7 A;  3CWG A;  5B8I B;  1OZO A;  1QVI Z;  2V53 A;  1Y1A A;  2KGR A;  1A03 A;  2BBM A;  4WRI A;  2D8N A;  1B9A A;  1SCM C;  2LVV A;  4NDC A;  3TZ1 A;  4ETO A;  3DF0 A;  3D0Y A;  1IJ6 A;  2A4J A;  1AJ4 A;  1B47 A;  4WQ3 A;  3PN7 C;  2GGM A;  2KAY A;  3BYA A;  2I94 A;  3SG4 A;  1CB1 A;  1H8B A;  2KBM A;  1A75 B;  1XO5 A;  3NSO A;  3PAT A;  1CM1 A;  3K21 A;  4YBH B;  4JWQ A;  1TRF A;  5CPV A;  1NWD A;  1SW8 A;  2PMY A;  2K7C A;  1BLQ A;  1YUU A;  3TS5 C;  1RTP 1;  1EH2 A;  2KHN A;  3O2P A;  3KEV A;  1F70 A;  3WXA A;  1QV1 A;  1EG3 A;  1F4O A;  1XK4 C;  1SYM A;  4NQG A;  1SNL A;  1PUL A;  3LLE A;  3TUY B;  2K7D A;  3FS7 A;  1REC A;  3PAL A;  4HRH A;  1BR4 B;  1N2D A;  1IRJ A;  1CMG A;  5CSF A;  1DJG A;  4BY5 A;  1BMO A;  3PLF B;  2AUC A;  4AOM A;  4OR9 B;  1DJY A;  1QLS A;  5I2L A;  4DCK A;  4FQO A;  2OS8 C;  5GQQ C;  3LCP C;  2Y1N A;  1CDP A;  5DKR A;  2LCP A;  5AXI A;  5AER A;  5BPJ A;  1TN4 A;  1CDL A;  2ISD A;  1CKK A;  4DIR A;  1CDM A;  2EC6 B;  4DRW A;  1B1G A;  4I5N B;  1YRT B;  3CR2 A;  4XYN A;  2KBI A;  4PE7 A;  1IJ5 A;  2PRU A;  1ALW A;  2L51 A;  2LAP A;  1H4B A;  1DJW A;  2LMV A;  1IQ5 A;  1YVL A;  1YR5 A;  2M3W A;  1SBJ A;  1U5I A;  1J7Q A;  3D10 A;  1OSA A;  1GQM A;  4YI8 A;  1UUR A;  1MUX A;  3AKA A;  1OE9 B;  3I5I C;  4OCI A;  1TCO B;  2LHL A;  3OX6 A;  4QJ5 B;  1UHH A;  4OV2 A;  1WRK A;  4M2P A;  1M39 A;  3NSL A;  2JZI A;  2BEC A;  1PRW A;  1DF0 A;  2JT8 A;  1CFC A;  1LIN A;  2L0P A;  3BOW A;  1OMR A;  4MRY A;  5DKN A;  5J3X A;  4AQJ A;  1AK8 A;  1A4P A;  5HLV A;  3WHU B;  1QAT A;  1KWO B;  3F45 A;  1XYD A;  2F8P A;  1WLM A;  1S5G Z;  2LE9 B;  2FCE A;  4GGF A;  4MN0 A;  1B7T Z;  2M1K B;  2FCD A;  1PVA A;  1W7I B;  2BL0 C;  3JTD B;  2JRF A;  4PHK A;  2NCO A;  2OTG C;  3H4S E;  2M7L A;  1M46 A;  2PAS A;  3BUN B;  1BOD A;  1F55 A;  5KSZ A;  3EK7 A;  1HT9 A;  2PSR A;  2R2I A;  1C7W A;  2LC5 A;  5HYD A;  1S6C A;  1M63 B;  2JNF A;  2OPO A;  3OX5 A;  1ALV A;  2KYF A;  2WND A;  2FOT A;  2LUC A;  1S6J A;  2ZRS A;  1UWO A;  3NXA A;  3WNX B;  4PCW A;  2K7O A;  1SKT A;  3GK4 X;  3A4U B;  2RGI A;  4DUQ A;  4A4B A;  3EVR A;  1CFF A;  2JUL A;  1WLZ A;  2LP2 A;  5KTY A;  1K9K A;  2KOT A;  1LA0 A;  1B8L A;  3KHE A;  2NCP A;  1BT6 A;  3CZT X;  1PSB A;  2IS9 A;  3LK0 A;  3VRN A;  2MLF C;  1DJH A;  3A8R A;  1DT7 B;  1E8A A;  1KK7 Z;  1N65 A;  3O4Y A;  4OVN F;  1QIW A;  1CMF A;  2ZN9 A;  1EJ3 A;  2M29 A;  1RK9 A;  2O60 A;  1BG1 A;  3ZNI A;  4YGD B;  3HCM A;  4MEW A;  4A4C A;  4MZL A;  1QJT A;  3D0Y B;  4ORB B;  2L4I A;  1A2X A;  1DJZ A;  1MXL C;  1XK4 A;  2K0J A;  3I5F C;  4M2Q A;  5CSJ A;  1YX7 A;  2JC2 A;  1B7T Y;  4PHJ A;  2JT0 A;  4BY4 A;  3VRQ A;  1NPQ A;  1F8H A;  1TNP A;  1S36 A;  1SK6 D;  2F3Y A;  2LVI A;  1KK8 B;  2KGB C;  1XA5 A;  5K89 A;  2TN4 A;  1UP5 A;  1ZMZ A;  2M8U A;  2EHB A;  3JVT C;  2LM5 A;  1YUT A;  1BOC A;  2KNE A;  3JTD C;  1JF2 A;  1R6P A;  4ICB A;  4OKH A;  1K96 A;  2K61 A;  3EK4 A;  4PE4 A;  4YGE B;  1CFP A;  5DKQ A;  4GUK A;  5D69 A;  3I5H B;  3NSK A;  1AP4 A;  1MHO A;  1YUS A;  1IG5 A;  3BUW B;  4GGN A;  1SMG A;  3SIB A;  4WQ2 A;  2BKI B;  3CR5 X;  3DVK A;  4YI9 A;  2CXJ A;  1S1E A;  3TDI A;  4XJK A;  2ZKM X;  3EVV A;  2QAC A;  1QAS A;  1J7R A;  2BCX A;  1SL9 A;  1QV0 A;  1WDC C;  2E30 A;  4MVF A;  1RJV A;  1JWD A;  3GK2 A;  3VRP A;  1RRO A;  4P2Y B;  2JTZ A;  5I2O A;  1ZUZ A;  1W7J B;  4MRX A;  1A75 A;  3C1V A;  2I2R E;  1EL4 A;  5G08 A;  2LP3 A;  2I18 A;  4YGB B;  3LL8 B;  3PM8 A;  5KU1 A;  4CID A;  1U5I B;  1QVI Y;  3RM1 A;  1K94 A;  3PFV A;  2JNX A;  2KI4 B;  4ZCV A;  3TDZ A;  1EG4 A;  1LVC D;  3BQ3 A;  5I8N A;  2SAS A;  1XVJ A;  5JJG A;  4E68 A;  2WOS A;  3OB1 B;  2MA2 A;  1C07 A;  3CR4 X;  1GGW A;  4YRU A;  2COL B;  4R1E A;  2Q4U A;  2JOJ A;  1YVH A;  1KFU L;  1UHN A;  2M49 B;  1LKJ A;  1M31 A;  1AJ5 A;  1L2O B;  1AHR A;  2KSP A;  1CNP A;  1HQV A;  4PHM A;  3LK1 A;  1PVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...