1TRFA

Solution structure of the tr1c fragment of skeletal muscle troponin-c
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the TR1C fragment of skeletal muscle troponin-C.
pubmed rcsb
source organism Meleagris gallopavo
molecule tags Muscle protein
molecule keywords TROPONIN C
total genus 16
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1993-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1trfA00
3EKHA 5F6TA 1OZSA 3PFVA 1ZMZA 1KK8C 1FI5A 1BR4B 3TUYB 1C7WA 2L4HA 1CDNA 1F70A 4NQGA 2JOJA 1FI6A 1YUUA 2F2OA 1A75B 1F55A 1XFXO 4MBEA 2KI6C 1QX5B 1IG5A 3WXAA 1CLMA 1S5GZ 1BU3A 1DJWA 1N0YA 1QJTA 1F4QA 4IL1A 4AQJA 1F71A 4MZJA 1JWDA 2CT9A 1B47A 1J7RA 3BOWA 3NSIA 1IRJA 3PN7C 1OSAA 1B4CA 1B8LA 1WRLA 2MLFC 4D1EA 2M29A 1SCVA 2HF5A 2V53A 2JTZA 2OTGB 1X02A 2WCBA 1KWOB 4YGEB 4MN0A 4PE4A 3SJSA 2K7DA 1KFXS 3CS1A 3HCMA 2JWWA 2KAVA 1CM4A 5JOLA 2H61C 5I8NA 1K90D 2K61A 2BL0B 3SIBA 1SL9A 2LLUA 1B7TY 2BCAA 1KQMC 1QIVA 3I5GC 1BLQA 3LLEA 2JT3A 1SR6B 2KOTA 4WRIA 3JVTB 2B1UA 4MEWA 2CNPA 4CFQA 1S6CA 1GGZA 2H2KA 1XFUO 1K9UA 5HKZA 2H61A 1NUBA 1K9KA 1G4YR 3JTDB 5HLVA 2L4IA 3KF9A 5KTYA 2KQYA 2LP2A 2QACA 2QPTA 3H4SE 2LHIA 4GAOA 1L7ZA 4M2OA 1MWNA 1KK7Z 1KFUS 1ODBA 3O4YA 2DOQA 1LVCD 3WNXB 1LA0A 1MUXA 1NCZA 2KI4C 2LVIA 3DVKA 2CXJA 2ZRSA 2KHNA 1D1OA 1J7QA 1EJ3A 4NDCA 2I7AA 1K9PA 2L51A 2JQ6A 1SRAA 1DJGA 2M7NA 1K8UA 2KFFA 1IQ5A 1G8IA 1IQ3A 1Y1XA 2HQWA 2M97A 3AKBA 3JVTC 3SG2A 2KAYA 1WDCC 4YGAA 3OX5A 3I5GB 2NCPA 1TCOB 3WHUB 1C07A 2OS8C 5TNCA 2HETA 3EVUA 4JQ0D 2LMTA 1OMVA 2JRFA 1XFYO 3O6BA 1B8RA 4GUKA 2ZNDA 1A03A 4M2PA 3KO0A 5BPJA 2ZN8A 1FF1A 2COLB 5I2QA 4FTGA 1MXLC 1J1DA 3HX4A 5HYDA 2RGIA 3KPXA 1IKUA 2KI6D 1FBVA 1EL4A 1U5IA 1Y0VH 1SPYA 3D10A 1NCXA 2JU0A 2EC6B 2LHLA 1UWOA 1LINA 2ZKMX 4OR9B 2JPTA 2KBMA 1NPQA 1BR1B 2F2PA 3LCPC 1YX7A 4YRUA 1J7PA 3PALA 4P5OE 1OZOA 3NXAA 2WORA 1SCMB 4WQ2A 2NZ0A 1EH2A 2LVVA 3D0YA 3RLZA 4BY5A 4YGCB 2KGBC 2LMUA 2K7BA 1BODA 3EK7A 1CFFA 4NDDA 1QS7A 1EG4A 1V1GA 1KK7Y 1YRUB 4DRWA 4C0KA 1LA3A 4HRGA 1NP8A 2Y1NA 1IJ6A 1YVHA 4M2QA 4YBHB 1XFWO 1XK4A 2MRDA 2LAPA 3CLNA 2FOTA 5CSNA 1CFPA 1NX3A 1QIWA 4MRYA 4NDBA 1DJXA 1ALWA 2MJWB 3CR5X 2FCDA 1HT9A 2VRGA 4N5XA 3TS5B 1R6PA 3DD4A 2LVJA 1K95A 3FWCA 5CSIA 1AUIB 4A4CA 2NLNA 2PALA 2EC6C 3LK1A 5KU1A 1GGWA 1QATA 1E8AA 4XJKA 3D0YB 3FS7A 1NX2A 2Y1MA 1V1FA 2WCFA 1TNQA 1JFKA 5D7FA 3BUOB 3CR4X 3EVVA 3VRQA 1A2XA 2EGDA 2LUCA 4PE7A 2PASA 3AAJA 1UHHA 5AEQA 2LCPA 4C0LA 3IQOA 1JF0A 3EK4A 2Q91A 3LK0A 4FQOA 1NYAA 2IS9A 3I5HB 2GGMA 1CLBA 2HPSA 1JC2A 1K96A 2LVKA 1SL8A 4P2YB 1IWQA 1H4BA 4UPGA 5KSZA 2KDHA 1SCMC 2O60A 3TDZA 4ORAB 2JZIA 5HKYA 1AP4A 2WNDA 1S1EA 4ORBB 4U8DA 3CR2A 3A4UB 5HKWA 4ETOA 2HQ8A 1F8HA 5AANA 2JT0A 1NWDA 2SASA 2BE4A 1BG1A 1DJIA 1N2DA 2G9BA 2KFHA 1MQ1A 1TN4A 1L2OC 3AKAA 4XJKB 2BCXA 3BOWB 4QJ4B 3SG4A 1B1GA 2WOSA 1PALA 1OOJA 2E30A 1G33A 4BY4A 2L98A 3C1VA 4R1EA 1NIWA 5B8IB 2OS8B 2K2AA 2BCBA 3BXKA 3JTDC 4I5LB 1J55A 4E68A 1WDCB 2JT8A 4DUQA 1BF5A 2KBIA 1YUSA 1CMGA 1OE9B 2BE6A 2JULA 1K93D 4I5KA 5CPVA 1H8BA 5DKQA 3BUMB 2D8NA 1KFUL 2A4JA 3CTNA 2CTNA 3CZTX 3VRPA 1CDLA 4JWQA 3GK4X 1DJZA 1KQMB 2KI4B 1JF2A 1JFJA 2EHBA 1KSOA 2WCEA 2KGRA 1J1EA 3OB1B 3A8RA 1SBJA 1FW4A 1QASA 1AJ4A 2K7CA 4OCIA 1ZFSA 2MHHA 3TDUA 1KWOC 2NXQA 1TCFA 4L9MA 1L2OB 4PHNA 1CMFA 3NSKA 3BUXB 3BQ3A 4XYNA 4MSPA 4Q04A 1OMRA 1UURA 3I5FC 2JXLA 2KFGA 3PN7B 3K21A 2K8MB 4ZCVA 1DMOA 4HREE 1WLZA 2BBNA 2L50A 1SKTA 1AK8A 3EK8A 4GPLB 4JPZB 4PCWA 5ER4X 1TOPA 1XYDA 1KFXL 1PULA 1QV1A 2Y4QA 1QX2A 4PE1A 2G2BA 1EXRA 1SR6C 1OMDA 2LUXA 2Y5IA 1DJYA 2KQ6A 3DF0B 3PATA 2WC8A 1W7JB 2BL0C 1Y1UA 1WY9A 2LC5A 2PMYA 3I5HC 3SG5A 5ER5A 2LM5A 1N65A 2MA2A 1HQVA 3I5IB 1TRFA 2LANA 5DKNA 1JUOA 1RFJA 4GGNA 1IJ5A 3BYAA 1NX1A 3SG7A 1A75A 1ALVA 5CSJA 1K94A 5D69A 1M39A 3CGAA 1SW8A 1DGVA 1TNXA 1TNWA 2GGZA 2MAZA 4PE0A 2KNEA 4OKHA 3GK1A 1CKKA 3EKJA 5G08A 4MZKA 1M46A 1S5GY 2P6BB 2LLTA 1S36A 1ZOTB 3DF0A 1CDPA 1MHOA 3OHMB 3DVJA 3FIAA 2PVBA 1YR5A 1YRTB 3VROA 2FCEA 1CM1A 1GQMA 1KCYA 1Y1AA 4MRXA 2LLSA 4DS7A 5GQQC 1NCYA 3TUYC 1MR8A 2KSPA 2KYFA 1YX8A 1BT6A 1KK8B 1TTXA 3AAKA 3I5IC 2JXCA 1DGUA 2M1UA 1YVLA 5DKRA 4ZCUA 1F54A 1AHRA 5J3XA 1RWYA 3O78A 3VRRA 4PHJA 1A29A 5HLOA 1XVJA 1UHNA 1WLMA 1XA5A 2F33A 2MLEC 2M49B 1B7TZ 2K0JA 2F3ZA 1BOCA 1NX0A 1YURA 5AERA 4PALA 3PM8A 1RJVA 4C0JA 1UUSA 2JNFA 1RROA 2CBLA 1M63B 1PSRA 1GJYA 3I5FB 5CSFA 3VRNA 2M3WA 2LV7A 1CFDA 4MLWA 1XO5A 1J7OA 4AOMA 2MBXA 2K2FA 4I5JA 4GGFC 4MVFA 1SK6D 1MF8B 1UHKA 4CLNA 1EG3A 1Q80A 2JC2A 2PSRA 3IQQA 2E6WA 1LKJA 1R2UA 2O5GA 2KYCA 2F3YA 4DIRA 2M0RA 2BBMA 4N1FA 1QVIY 4N1GA 1WRKA 4GBAA 1BJFA 4TNCA 1U5IB 1S3PA 5I2LA 1VRKA 3GOFA 5I2OA 3NSLA 1BMOA 2AMIA 3FWBA 1PVBA 4OV2A 4USLA 1OQPA 1XK4C 1DVIA 2FJUB 1QLSA 3IF7A 1PVAA 2AUCA 5FYXA 1IH0A 2ZRTA 3MSEB 2L2EA 3ICBA 2R2IA 3TZ1A 1DF0A 3OB2B 2CCMA 2LNKA 2ZFDA 1PRWA 1XFVO 2F8PA 1B9AA 3KEVA 2M1KB 3VGOA 1QX7A 1RK9A 4YI9A 1S6IA 2LMVA 3CWGA 3SIAA 1CTRA 3ZNIA 1KSMA 2OPOA 1SNLA 3OX6A 1ZACA 1S6JA 2LP3A 4GNKB 2ISDA 3WHTB 1FPWA 1Y6WA 1QV0A 1YTZC 4CFRA 2LE9B 1M31A 3E3RA 1NSHA 3EVRA 1QLKA 3KHEA 3RM1A 3SG3A 1MXEA 1DT7B 1ZUZA 1QVIZ 4YI8A 1YUTA 1XFZO 4PHKA 1CNPA 2M7LA 2NCOA 4ORCB 2K7OA 2BKHB 2I18A 3M0WA 4HSZA 5AXIA 4AQIA 1CB1A 2ZNEA 5JJGA 2KAXA 1UHIA 2PRUA 4MZLA 1DTLA 1F4OA 4ICBA 3ZWHA 5IBWA 3DVMA 1SY9A 4OVNF 3O2PA 3BUWB 1SL7A 1K2HA 2BKIB 2M8UA 5K89A 1CLLA 2L5XB 3LL8B 1DJHA 4PHMA 4CPVA 5AFPA 1A4PA 2AAOA 1PSBA 2GV5A 1JSAA 1JBAA 4QJ3B 1AJ5A 3NSOA 2BECA 3OP0A 4QJ5B 1B8CA 4CIDA 5PALA 1W7IB 2JNXA 2OTGC 1UHJA 4PDZA 1WRZA 1IGVA 2JTTA 1UP5A 1QTXA 4YGDB 4WQ3A 1TIZA 3PLFB 1KQVA 4GFTA 4GGFA 1LXFC 2M9GA 4YGBB 2TN4A 2L0PA 3SG6A 4A4BA 1CFCA 2I94A 4F0ZB 3QRXA 3F45A 3GK2A 3BUNB 3DVEA 1TNPA 3TS5C 1SMGA 2SCPA 1CDMA 1S26D 3PSRA 2ZN9A 1M45A 2Q4UA 3TDIA 4DCKA 4HRHA 1RECA 1RTP1 1QXPA 1DF0B 1PK0D 1C7VA 1SYMA 1AVSA 4I5NB 2I2RE
chains in the Genus database with same CATH superfamily
3EKHA 5F6TA 1OZSA 3PFVA 1ZMZA 1KK8C 1FI5A 1BR4B 1IIOA 3TUYB 1C7WA 2L4HA 1CDNA 1F70A 4NQGA 2JOJA 1FI6A 1YUUA 2F2OA 1A75B 1F55A 1XFXO 4MBEA 2KI6C 1QX5B 1IG5A 3WXAA 1CLMA 1S5GZ 1BU3A 1DJWA 1N0YA 1QJTA 1F4QA 4IL1A 4AQJA 1F71A 4MZJA 1JWDA 2CT9A 1B47A 1J7RA 3BOWA 3NSIA 1IRJA 3PN7C 1W9ZA 1OSAA 1B4CA 1LS8A 1B8LA 1WRLA 2MLFC 4D1EA 2M29A 3L4LA 1SCVA 2HF5A 2V53A 2JTZA 2OTGB 1X02A 2WCBA 1KWOB 4YGEB 4MN0A 4PE4A 3SJSA 2K7DA 1KFXS 3CS1A 3HCMA 2JWWA 2KAVA 1CM4A 5JOLA 2H61C 5I8NA 1K90D 2K61A 5DICA 2BL0B 3SIBA 1SL9A 2ERBA 1B7TY 2LLUA 3SS4A 2BCAA 3CZ0A 1KQMC 1QIVA 3I5GC 5HL1A 2KLDA 3LLEA 1BLQA 2JT3A 1SR6B 2KOTA 2BNXA 4WRIA 3JVTB 2B1UA 4MEWA 3UO9A 2CNPA 4CFQA 1S6CA 1GGZA 2H2KA 3R1OA 1OOHA 1XFUO 1K9UA 5HKZA 2H61A 1NUBA 3NGVA 1K9KA 1G4YR 3JTDB 5HLVA 2L4IA 3KF9A 5KTYA 2KQYA 2LP2A 3CYZA 2QACA 2QPTA 3H4SE 3BFAA 2LHIA 4GAOA 4KYNA 3BFBA 1L7ZA 4M2OA 1MWNA 1KK7Z 1KFUS 3R1VA 1ODBA 3O4YA 2DOQA 1LVCD 3FE8A 2WCLA 3CDNA 3WNXB 1LA0A 1MUXA 1NCZA 2KI4C 2LVIA 3DVKA 2CXJA 2ZRSA 2KHNA 1D1OA 1J7QA 1EJ3A 4NDCA 2I7AA 1K9PA 2L51A 2JQ6A 1SRAA 1DJGA 3O4XA 2M7NA 1K8UA 2KFFA 1IQ5A 1G8IA 3B6XA 2WCKA 1IQ3A 1Y1XA 2HQWA 2M97A 3AKBA 3JVTC 3SG2A 2KAYA 1WDCC 4YGAA 3OX5A 2KPHA 3DYEA 3I5GB 2NCPA 1TCOB 3WHUB 1C07A 2OS8C 5TNCA 2HETA 3EVUA 4JQ0D 2LMTA 1OMVA 2JRFA 1XFYO 3O6BA 1B8RA 4GUKA 2ZNDA 1A03A 4M2PA 3KO0A 5BPJA 2ZN8A 2PQLA 1FF1A 2COLB 5I2QA 4FTGA 1MXLC 1J1DA 2QDIA 3HX4A 5HYDA 2RGIA 3KPXA 1IKUA 2KI6D 1FBVA 2QEVA 3OGNA 1EL4A 1U5IA 1Y0VH 1SPYA 3CABA 3D10A 1NCXA 2JU0A 2EC6B 2LHLA 2QEBA 1UWOA 1LINA 2ZKMX 4OR9B 5FI6A 2JPTA 2KBMA 1NPQA 1BR1B 1TUJA 2F2PA 3B87A 3LCPC 1YX7A 3RZSA 4YRUA 1J7PA 3S0FA 3PALA 4P5OE 1OZOA 3NHTA 2WORA 1SCMB 3NXAA 4WQ2A 2NZ0A 1EH2A 2LVVA 3D0YA 3RLZA 4BY5A 4YGCB 2KGBC 2LMUA 3R72A 2K7BA 1BODA 3EK7A 1CFFA 4NDDA 1QS7A 1EG4A 1V1GA 2BAPA 1KK7Y 1YRUB 4DRWA 4C0KA 1LA3A 4HRGA 1NP8A 2Y1NA 1IJ6A 1YVHA 4M2QA 4YBHB 1XFWO 1XK4A 2MRDA 2LAPA 3CLNA 2FOTA 5CSNA 1CFPA 1NX3A 1QIWA 4MRYA 4NDBA 1DJXA 1ALWA 2MJWB 3CR5X 2FCDA 1HT9A 2GTEA 2VRGA 4N5XA 2YGUA 3TS5B 3QMEA 1R6PA 3DD4A 2LVJA 1K95A 3FWCA 5CSIA 1AUIB 4A4CA 2NLNA 2PALA 2EC6C 3LK1A 5KU1A 1GGWA 1QATA 5FI2A 1E8AA 4XJKA 3D0YB 3FS7A 1NX2A 2Y1MA 1V1FA 2WCFA 1TNQA 1JFKA 5D7FA 3BUOB 3CR4X 3EVVA 3VRQA 1A2XA 3NHIA 2WC5A 2EGDA 2LUCA 4PE7A 2PASA 3AAJA 1UHHA 5AEQA 4INXA 2LCPA 3CZ1A 4C0LA 3IQOA 1TWOA 1JF0A 3EK4A 2Q91A 3LK0A 4FQOA 1NYAA 2IS9A 3I5HB 2GGMA 1CLBA 2HPSA 3S0BA 1JC2A 1K96A 3CZ2A 2LVKA 3FE6A 1SL8A 4P2YB 1IWQA 1H4BA 4UPGA 5KSZA 2KDHA 1SCMC 2O60A 1ORGA 3TDZA 4ORAB 2JZIA 5HKYA 1AP4A 2WNDA 1S1EA 4ORBB 4U8DA 3CR2A 3BFHA 3A4UB 5HKWA 4ETOA 2HQ8A 4PT1A 1F8HA 5AANA 3DXLA 1OW4A 2JT0A 1NWDA 2SASA 2BE4A 1BG1A 1DJIA 1N2DA 2G9BA 2KFHA 1MQ1A 1TN4A 5FI7A 1L2OC 3AKAA 3D73A 4XJKB 2BCXA 3BOWB 4QJ4B 3SG4A 1B1GA 2WOSA 1PALA 3L47A 1OOJA 2E30A 3L4AA 1G33A 4BY4A 2L98A 2PYQA 4OZDA 3C1VA 4R1EA 1NIWA 5B8IB 2OS8B 2K2AA 2BCBA 3BXKA 3JTDC 4I5LB 1J55A 4E68A 1WDCB 2JT8A 4DUQA 1BF5A 2KBIA 1YUSA 1CMGA 1OE9B 2BE6A 2JULA 1K93D 4I5KA 5CPVA 1H8BA 3EG5B 3N7HA 5DKQA 3BUMB 3B88A 2D8NA 1KFUL 2A4JA 2P70A 2CTNA 2QEHA 3CTNA 3CZTX 3VRPA 1CDLA 4JWQA 3GK4X 1DJZA 1KQMB 2KI4B 1JF2A 1JFJA 2EHBA 1KSOA 2WCEA 2KGRA 4INWA 1J1EA 3OB1B 3A8RA 3DY9A 1SBJA 1FW4A 2L5YA 1QASA 3S0DA 1AJ4A 1DELA 2K7CA 4OCIA 1ZFSA 2MHHA 3TDUA 1KWOC 1XFRA 2NXQA 1TCFA 4L9MA 1L2OB 4PHNA 1CMFA 2WCHA 3NSKA 3BUXB 3BQ3A 3PM2A 4XYNA 4MSPA 4Q04A 1OMRA 1UURA 3I5FC 2JXLA 2KFGA 3PN7B 3K21A 2K8MB 4ZCVA 1GM0A 3BJHA 4HREE 1WLZA 2BBNA 2L50A 1SKTA 1AK8A 1DMOA 3EK8A 4GPLB 4JPZB 4PCWA 5ER4X 1DT7B 1TOPA 1XYDA 1KFXL 1PULA 1QV1A 2Y4QA 1QX2A 4IJ7A 4PE1A 2G2BA 1EXRA 1SR6C 5D3OA 1OMDA 2LUXA 2Y5IA 1DJYA 2KQ6A 3DF0B 3PATA 2WC8A 1DQEA 1W7JB 2BL0C 1Y1UA 1WY9A 2LC5A 2PMYA 3I5HC 3SG5A 5ER5A 2LM5A 1N65A 2MA2A 1HQVA 3I5IB 1TRFA 2LANA 5DKNA 1JUOA 1RFJA 4GGNA 1IJ5A 4JD9A 3BYAA 1NX1A 3SG7A 1A75A 1ALVA 5CSJA 1K94A 5D69A 1M39A 2WCJA 3CGAA 1SW8A 1DGVA 1TNXA 1TNWA 2GGZA 2MAZA 4PE0A 2KNEA 4OKHA 3GK1A 1CKKA 3EKJA 5G08A 1C3YA 4MZKA 1M46A 1S5GY 2P6BB 2LLTA 1S36A 1ZOTB 3DF0A 1CDPA 1MHOA 3OHMB 3DVJA 3FIAA 4F7FA 2PVBA 1YR5A 1YRTB 3IVTA 3VROA 2FCEA 1CM1A 3B86A 1GQMA 1KCYA 1Y1AA 4MRXA 2LLSA 4DS7A 5GQQC 1NCYA 3TUYC 1MR8A 2KSPA 2KYFA 1YX8A 1BT6A 1KK8B 1QWVA 1TTXA 3AAKA 3I5IC 2JXCA 1DGUA 2M1UA 1YVLA 5DKRA 4ZCUA 1F54A 1AHRA 2WC6A 5J3XA 1RWYA 3D76A 3O78A 3VRRA 4PHJA 1A29A 5HLOA 1XVJA 1UHNA 1WLMA 1XA5A 1TUZA 1Z2CB 2F33A 2MLEC 2M49B 1B7TZ 2K0JA 2F3ZA 1BOCA 1NX0A 1YURA 5AERA 4PALA 3PM8A 1RJVA 4C0JA 1UUSA 2JNFA 3S0EA 1RROA 2CBLA 1M63B 1PSRA 1GJYA 3I5FB 5CSFA 3VRNA 2M3WA 2LV7A 1CFDA 4MLWA 1XO5A 3DZTA 5EL2A 3SS3A 2JPOA 1J7OA 4AOMA 2MBXA 2K2FA 4I5JA 3FE9A 4GGFC 1SK6D 1MF8B 1UHKA 4MVFA 1EG3A 1Q80A 4CLNA 2JC2A 2PSRA 3V2LA 3IQQA 2E6WA 1LKJA 1R2UA 2KLEA 2KYCA 2F3YA 2O5GA 4DIRA 1SSEB 2M0RA 2BBMA 4N1FA 1QVIY 1P28A 4N1GA 1WRKA 4GBAA 1BJFA 4TNCA 1Z4HA 1U5IB 2L2CA 1S3PA 5I2LA 3D74A 1VRKA 3GOFA 5I2OA 3NSLA 3K1EA 1BMOA 2AMIA 3FWBA 1PVBA 4OV2A 4USLA 1OQPA 1XK4C 1DVIA 2FJUB 1QLSA 3IF7A 1PVAA 3UNWA 2AUCA 1C3ZA 5FYXA 4JKTA 1IH0A 3D77A 2ZRTA 3MSEB 2L2EA 3ICBA 2R2IA 3TZ1A 1DF0A 3B7AA 3OB2B 2CCMA 2LNKA 2ZFDA 1PRWA 1XFVO 2F8PA 1B9AA 3KEVA 2M1KB 3VGOA 1QX7A 1RK9A 4YI9A 1S6IA 2LMVA 3CWGA 3SIAA 1CTRA 3ZNIA 1KSMA 2OPOA 1SNLA 3R1PA 3OX6A 1ZACA 1S6JA 2H8VA 2LP3A 4GNKB 2ISDA 3WHTB 1FPWA 1Y6WA 1QV0A 1YTZC 4CFRA 2LE9B 1M31A 3E3RA 1NSHA 1OOGA 1QLKA 3EVRA 3KHEA 3RM1A 1MXEA 3SG3A 1OOIX 1ZUZA 1QVIZ 4YI8A 1YUTA 5I94A 1XFZO 4PHKA 1CNPA 2M7LA 2NCOA 4ORCB 2K7OA 3OBVA 2BKHB 2I18A 3M0WA 4HSZA 5AXIA 4AQIA 1CB1A 2ZNEA 5JJGA 2KAXA 1UHIA 2PRUA 4MZLA 1DTLA 1F4OA 4ICBA 3ZWHA 5IBWA 3PJIA 3DVMA 1SY9A 4OVNF 3O2PA 4FQTA 3BUWB 1SL7A 1K2HA 2BKIB 2M8UA 5K89A 1CLLA 2L5XB 3LL8B 1DJHA 1OOFA 4PHMA 3SS5A 4CPVA 2P71A 1A4PA 2AAOA 1PSBA 2GV5A 5AFPA 1JSAA 1JBAA 4QJ3B 1AJ5A 3NSOA 2FJYA 2BECA 3OP0A 3D78A 3VB1A 4QJ5B 1B8CA 3S0GA 4CIDA 5PALA 1W7IB 1T14A 2JNXA 2OTGC 1UHJA 4PDZA 1WRZA 1IGVA 2JTTA 3Q8IA 1UP5A 1QTXA 4YGDB 4WQ3A 1TIZA 1DEKA 3PLFB 2QEOA 4GFTA 1KQVA 4GGFA 1LXFC 2K60A 2M9GA 4YGBB 3S0AA 2TN4A 2L0PA 3SG6A 4A4BA 1CFCA 2I94A 4F0ZB 3QRXA 1DC1A 3F45A 3GK2A 3BUNB 3DVEA 1TNPA 3TS5C 1SMGA 2SCPA 1CDMA 1S26D 3PSRA 3D75A 2ZN9A 1M45A 2Q4UA 3TDIA 4DCKA 4HRHA 2WCMA 1RECA 1RTP1 1QXPA 1DF0B 1PK0D 1C7VA 1SYMA 1AVSA 4I5NB 2I2RE
chains in the Genus database with same CATH topology
3EKHA 5F6TA 1OZSA 3PFVA 1ZMZA 1KK8C 1FI5A 1BR4B 3TUYB 1C7WA 2L4HA 1CDNA 1F70A 4NQGA 2JOJA 1FI6A 1YUUA 2F2OA 1A75B 1F55A 1XFXO 4MBEA 2KI6C 1QX5B 1IG5A 3WXAA 1CLMA 1S5GZ 1BU3A 1DJWA 1N0YA 1QJTA 1F4QA 4IL1A 4AQJA 1F71A 4MZJA 1JWDA 2CT9A 1B47A 1J7RA 3BOWA 3NSIA 1IRJA 3PN7C 1OSAA 1B4CA 1B8LA 1WRLA 2MLFC 4D1EA 2M29A 1SCVA 2HF5A 2V53A 2JTZA 2OTGB 1X02A 2WCBA 1KWOB 4YGEB 4MN0A 4PE4A 3SJSA 2K7DA 1KFXS 3CS1A 3HCMA 2JWWA 2KAVA 1CM4A 5JOLA 2H61C 5I8NA 1K90D 2K61A 2BL0B 3SIBA 1SL9A 2LLUA 1B7TY 2BCAA 1KQMC 1QIVA 3I5GC 1BLQA 3LLEA 2JT3A 1SR6B 2KOTA 4WRIA 3JVTB 2B1UA 4MEWA 2CNPA 4CFQA 1S6CA 1GGZA 2H2KA 1XFUO 1K9UA 5HKZA 2H61A 1NUBA 1K9KA 1G4YR 3JTDB 5HLVA 2L4IA 3KF9A 5KTYA 2KQYA 2LP2A 2QACA 2QPTA 3H4SE 2LHIA 4GAOA 1L7ZA 4M2OA 1MWNA 1KK7Z 1KFUS 1ODBA 3O4YA 2DOQA 1LVCD 3WNXB 1LA0A 1MUXA 1NCZA 2KI4C 2LVIA 3DVKA 2CXJA 2ZRSA 2KHNA 1D1OA 1J7QA 1EJ3A 4NDCA 2I7AA 1K9PA 2L51A 2JQ6A 1SRAA 1DJGA 2M7NA 1K8UA 2KFFA 1IQ5A 1G8IA 1IQ3A 1Y1XA 2HQWA 2M97A 3AKBA 3JVTC 3SG2A 2KAYA 1WDCC 4YGAA 3OX5A 3I5GB 2NCPA 1TCOB 3WHUB 1C07A 2OS8C 5TNCA 2HETA 3EVUA 4JQ0D 2LMTA 1OMVA 2JRFA 1XFYO 3O6BA 1B8RA 4GUKA 2ZNDA 1A03A 4M2PA 3KO0A 5BPJA 2ZN8A 1FF1A 2COLB 5I2QA 4FTGA 1MXLC 1J1DA 3HX4A 5HYDA 2RGIA 3KPXA 1IKUA 2KI6D 1FBVA 1EL4A 1U5IA 1Y0VH 1SPYA 3D10A 1NCXA 2JU0A 2EC6B 2LHLA 1UWOA 1LINA 2ZKMX 4OR9B 2JPTA 2KBMA 1NPQA 1BR1B 2F2PA 3LCPC 1YX7A 4YRUA 1J7PA 3PALA 4P5OE 1OZOA 3NXAA 2WORA 1SCMB 4WQ2A 2NZ0A 1EH2A 2LVVA 3D0YA 3RLZA 4BY5A 4YGCB 2KGBC 2LMUA 2K7BA 1BODA 3EK7A 1CFFA 4NDDA 1QS7A 1EG4A 1V1GA 1KK7Y 1YRUB 4DRWA 4C0KA 1LA3A 4HRGA 1NP8A 2Y1NA 1IJ6A 1YVHA 4M2QA 4YBHB 1XFWO 1XK4A 2MRDA 2LAPA 3CLNA 2FOTA 5CSNA 1CFPA 1NX3A 1QIWA 4MRYA 4NDBA 1DJXA 1ALWA 2MJWB 3CR5X 2FCDA 1HT9A 2VRGA 4N5XA 3TS5B 1R6PA 3DD4A 2LVJA 1K95A 3FWCA 5CSIA 1AUIB 4A4CA 2NLNA 2PALA 2EC6C 3LK1A 5KU1A 1GGWA 1QATA 1E8AA 4XJKA 3D0YB 3FS7A 1NX2A 2Y1MA 1V1FA 2WCFA 1TNQA 1JFKA 5D7FA 3BUOB 3CR4X 3EVVA 3VRQA 1A2XA 2EGDA 2LUCA 4PE7A 2PASA 3AAJA 1UHHA 5AEQA 2LCPA 4C0LA 3IQOA 1JF0A 3EK4A 2Q91A 3LK0A 4FQOA 1NYAA 2IS9A 3I5HB 2GGMA 1CLBA 2HPSA 1JC2A 1K96A 2LVKA 1SL8A 4P2YB 1IWQA 1H4BA 4UPGA 5KSZA 2KDHA 1SCMC 2O60A 3TDZA 4ORAB 2JZIA 5HKYA 1AP4A 2WNDA 1S1EA 4ORBB 4U8DA 3CR2A 3A4UB 5HKWA 4ETOA 2HQ8A 1F8HA 5AANA 2JT0A 1NWDA 2SASA 2BE4A 1BG1A 1DJIA 1N2DA 2G9BA 2KFHA 1MQ1A 1TN4A 1L2OC 3AKAA 4XJKB 2BCXA 3BOWB 4QJ4B 3SG4A 1B1GA 2WOSA 1PALA 1OOJA 2E30A 1G33A 4BY4A 2L98A 3C1VA 4R1EA 1NIWA 5B8IB 2OS8B 2K2AA 2BCBA 3BXKA 3JTDC 4I5LB 1J55A 4E68A 1WDCB 2JT8A 4DUQA 1BF5A 2KBIA 1YUSA 1CMGA 1OE9B 2BE6A 2JULA 1K93D 4I5KA 5CPVA 1H8BA 5DKQA 3BUMB 2D8NA 1KFUL 2A4JA 3CTNA 2CTNA 3CZTX 3VRPA 1CDLA 4JWQA 3GK4X 1DJZA 1KQMB 2KI4B 1JF2A 1JFJA 2EHBA 1KSOA 2WCEA 2KGRA 1J1EA 3OB1B 3A8RA 1SBJA 1FW4A 1QASA 1AJ4A 2K7CA 4OCIA 1ZFSA 2MHHA 3TDUA 1KWOC 2NXQA 1TCFA 4L9MA 1L2OB 4PHNA 1CMFA 3NSKA 3BUXB 3BQ3A 4XYNA 4MSPA 4Q04A 1OMRA 1UURA 3I5FC 2JXLA 2KFGA 3PN7B 3K21A 2K8MB 4ZCVA 1DMOA 4HREE 1WLZA 2BBNA 2L50A 1SKTA 1AK8A 3EK8A 4GPLB 4JPZB 4PCWA 5ER4X 1TOPA 1XYDA 1KFXL 1PULA 1QV1A 2Y4QA 1QX2A 4PE1A 2G2BA 1EXRA 1SR6C 1OMDA 2LUXA 2Y5IA 1DJYA 2KQ6A 3DF0B 3PATA 2WC8A 1W7JB 2BL0C 1Y1UA 1WY9A 2LC5A 2PMYA 3I5HC 3SG5A 5ER5A 2LM5A 1N65A 2MA2A 1HQVA 3I5IB 1TRFA 2LANA 5DKNA 1JUOA 1RFJA 4GGNA 1IJ5A 3BYAA 1NX1A 3SG7A 1A75A 1ALVA 5CSJA 1K94A 5D69A 1M39A 3CGAA 1SW8A 1DGVA 1TNXA 1TNWA 2GGZA 2MAZA 4PE0A 2KNEA 4OKHA 3GK1A 1CKKA 3EKJA 5G08A 4MZKA 1M46A 1S5GY 2P6BB 2LLTA 1S36A 1ZOTB 3DF0A 1CDPA 1MHOA 3OHMB 3DVJA 3FIAA 2PVBA 1YR5A 1YRTB 3VROA 2FCEA 1CM1A 1GQMA 1KCYA 1Y1AA 4MRXA 2LLSA 4DS7A 5GQQC 1NCYA 3TUYC 1MR8A 2KSPA 2KYFA 1YX8A 1BT6A 1KK8B 1TTXA 3AAKA 3I5IC 2JXCA 1DGUA 2M1UA 1YVLA 5DKRA 4ZCUA 1F54A 1AHRA 5J3XA 1RWYA 3O78A 3VRRA 4PHJA 1A29A 5HLOA 1XVJA 1UHNA 1WLMA 1XA5A 2F33A 2MLEC 2M49B 1B7TZ 2K0JA 2F3ZA 1BOCA 1NX0A 1YURA 5AERA 4PALA 3PM8A 1RJVA 4C0JA 1UUSA 2JNFA 1RROA 2CBLA 1M63B 1PSRA 1GJYA 3I5FB 5CSFA 3VRNA 2M3WA 2LV7A 1CFDA 4MLWA 1XO5A 1J7OA 4AOMA 2MBXA 2K2FA 4I5JA 4GGFC 4MVFA 1SK6D 1MF8B 1UHKA 4CLNA 1EG3A 1Q80A 2JC2A 2PSRA 3IQQA 2E6WA 1LKJA 1R2UA 2O5GA 2KYCA 2F3YA 4DIRA 2M0RA 2BBMA 4N1FA 1QVIY 4N1GA 1WRKA 4GBAA 1BJFA 4TNCA 1U5IB 1S3PA 5I2LA 1VRKA 3GOFA 5I2OA 3NSLA 1BMOA 2AMIA 3FWBA 1PVBA 4OV2A 4USLA 1OQPA 1XK4C 1DVIA 2FJUB 1QLSA 3IF7A 1PVAA 2AUCA 5FYXA 1IH0A 2ZRTA 3MSEB 2L2EA 3ICBA 2R2IA 3TZ1A 1DF0A 3OB2B 2CCMA 2LNKA 2ZFDA 1PRWA 1XFVO 2F8PA 1B9AA 3KEVA 2M1KB 3VGOA 1QX7A 1RK9A 4YI9A 1S6IA 2LMVA 3CWGA 3SIAA 1CTRA 3ZNIA 1KSMA 2OPOA 1SNLA 3OX6A 1ZACA 1S6JA 2LP3A 4GNKB 2ISDA 3WHTB 1FPWA 1Y6WA 1QV0A 1YTZC 4CFRA 2LE9B 1M31A 3E3RA 1NSHA 3EVRA 1QLKA 3KHEA 3RM1A 3SG3A 1MXEA 1DT7B 1ZUZA 1QVIZ 4YI8A 1YUTA 1XFZO 4PHKA 1CNPA 2M7LA 2NCOA 4ORCB 2K7OA 2BKHB 2I18A 3M0WA 4HSZA 5AXIA 4AQIA 1CB1A 2ZNEA 5JJGA 2KAXA 1UHIA 2PRUA 4MZLA 1DTLA 1F4OA 4ICBA 3ZWHA 5IBWA 3DVMA 1SY9A 4OVNF 3O2PA 3BUWB 1SL7A 1K2HA 2BKIB 2M8UA 5K89A 1CLLA 2L5XB 3LL8B 1DJHA 4PHMA 4CPVA 5AFPA 1A4PA 2AAOA 1PSBA 2GV5A 1JSAA 1JBAA 4QJ3B 1AJ5A 3NSOA 2BECA 3OP0A 4QJ5B 1B8CA 4CIDA 5PALA 1W7IB 2JNXA 2OTGC 1UHJA 4PDZA 1WRZA 1IGVA 2JTTA 1UP5A 1QTXA 4YGDB 4WQ3A 1TIZA 3PLFB 1KQVA 4GFTA 4GGFA 1LXFC 2M9GA 4YGBB 2TN4A 2L0PA 3SG6A 4A4BA 1CFCA 2I94A 4F0ZB 3QRXA 3F45A 3GK2A 3BUNB 3DVEA 1TNPA 3TS5C 1SMGA 2SCPA 1CDMA 1S26D 3PSRA 2ZN9A 1M45A 2Q4UA 3TDIA 4DCKA 4HRHA 1RECA 1RTP1 1QXPA 1DF0B 1PK0D 1C7VA 1SYMA 1AVSA 4I5NB 2I2RE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EKH A;  5F6T A;  1OZS A;  3PFV A;  1ZMZ A;  1KK8 C;  1FI5 A;  1BR4 B;  3TUY B;  1C7W A;  2L4H A;  1CDN A;  1F70 A;  4NQG A;  2JOJ A;  1FI6 A;  1YUU A;  2F2O A;  1A75 B;  1F55 A;  1XFX O;  4MBE A;  2KI6 C;  1QX5 B;  1IG5 A;  3WXA A;  1CLM A;  1S5G Z;  1BU3 A;  1DJW A;  1N0Y A;  1QJT A;  1F4Q A;  4IL1 A;  4AQJ A;  1F71 A;  4MZJ A;  1JWD A;  2CT9 A;  1B47 A;  1J7R A;  3BOW A;  3NSI A;  1IRJ A;  3PN7 C;  1OSA A;  1B4C A;  1B8L A;  1WRL A;  2MLF C;  4D1E A;  2M29 A;  1SCV A;  2HF5 A;  2V53 A;  2JTZ A;  2OTG B;  1X02 A;  2WCB A;  1KWO B;  4YGE B;  4MN0 A;  4PE4 A;  3SJS A;  2K7D A;  1KFX S;  3CS1 A;  3HCM A;  2JWW A;  2KAV A;  1CM4 A;  5JOL A;  2H61 C;  5I8N A;  1K90 D;  2K61 A;  2BL0 B;  3SIB A;  1SL9 A;  2LLU A;  1B7T Y;  2BCA A;  1KQM C;  1QIV A;  3I5G C;  1BLQ A;  3LLE A;  2JT3 A;  1SR6 B;  2KOT A;  4WRI A;  3JVT B;  2B1U A;  4MEW A;  2CNP A;  4CFQ A;  1S6C A;  1GGZ A;  2H2K A;  1XFU O;  1K9U A;  5HKZ A;  2H61 A;  1NUB A;  1K9K A;  1G4Y R;  3JTD B;  5HLV A;  2L4I A;  3KF9 A;  5KTY A;  2KQY A;  2LP2 A;  2QAC A;  2QPT A;  3H4S E;  2LHI A;  4GAO A;  1L7Z A;  4M2O A;  1MWN A;  1KK7 Z;  1KFU S;  1ODB A;  3O4Y A;  2DOQ A;  1LVC D;  3WNX B;  1LA0 A;  1MUX A;  1NCZ A;  2KI4 C;  2LVI A;  3DVK A;  2CXJ A;  2ZRS A;  2KHN A;  1D1O A;  1J7Q A;  1EJ3 A;  4NDC A;  2I7A A;  1K9P A;  2L51 A;  2JQ6 A;  1SRA A;  1DJG A;  2M7N A;  1K8U A;  2KFF A;  1IQ5 A;  1G8I A;  1IQ3 A;  1Y1X A;  2HQW A;  2M97 A;  3AKB A;  3JVT C;  3SG2 A;  2KAY A;  1WDC C;  4YGA A;  3OX5 A;  3I5G B;  2NCP A;  1TCO B;  3WHU B;  1C07 A;  2OS8 C;  5TNC A;  2HET A;  3EVU A;  4JQ0 D;  2LMT A;  1OMV A;  2JRF A;  1XFY O;  3O6B A;  1B8R A;  4GUK A;  2ZND A;  1A03 A;  4M2P A;  3KO0 A;  5BPJ A;  2ZN8 A;  1FF1 A;  2COL B;  5I2Q A;  4FTG A;  1MXL C;  1J1D A;  3HX4 A;  5HYD A;  2RGI A;  3KPX A;  1IKU A;  2KI6 D;  1FBV A;  1EL4 A;  1U5I A;  1Y0V H;  1SPY A;  3D10 A;  1NCX A;  2JU0 A;  2EC6 B;  2LHL A;  1UWO A;  1LIN A;  2ZKM X;  4OR9 B;  2JPT A;  2KBM A;  1NPQ A;  1BR1 B;  2F2P A;  3LCP C;  1YX7 A;  4YRU A;  1J7P A;  3PAL A;  4P5O E;  1OZO A;  3NXA A;  2WOR A;  1SCM B;  4WQ2 A;  2NZ0 A;  1EH2 A;  2LVV A;  3D0Y A;  3RLZ A;  4BY5 A;  4YGC B;  2KGB C;  2LMU A;  2K7B A;  1BOD A;  3EK7 A;  1CFF A;  4NDD A;  1QS7 A;  1EG4 A;  1V1G A;  1KK7 Y;  1YRU B;  4DRW A;  4C0K A;  1LA3 A;  4HRG A;  1NP8 A;  2Y1N A;  1IJ6 A;  1YVH A;  4M2Q A;  4YBH B;  1XFW O;  1XK4 A;  2MRD A;  2LAP A;  3CLN A;  2FOT A;  5CSN A;  1CFP A;  1NX3 A;  1QIW A;  4MRY A;  4NDB A;  1DJX A;  1ALW A;  2MJW B;  3CR5 X;  2FCD A;  1HT9 A;  2VRG A;  4N5X A;  3TS5 B;  1R6P A;  3DD4 A;  2LVJ A;  1K95 A;  3FWC A;  5CSI A;  1AUI B;  4A4C A;  2NLN A;  2PAL A;  2EC6 C;  3LK1 A;  5KU1 A;  1GGW A;  1QAT A;  1E8A A;  4XJK A;  3D0Y B;  3FS7 A;  1NX2 A;  2Y1M A;  1V1F A;  2WCF A;  1TNQ A;  1JFK A;  5D7F A;  3BUO B;  3CR4 X;  3EVV A;  3VRQ A;  1A2X A;  2EGD A;  2LUC A;  4PE7 A;  2PAS A;  3AAJ A;  1UHH A;  5AEQ A;  2LCP A;  4C0L A;  3IQO A;  1JF0 A;  3EK4 A;  2Q91 A;  3LK0 A;  4FQO A;  1NYA A;  2IS9 A;  3I5H B;  2GGM A;  1CLB A;  2HPS A;  1JC2 A;  1K96 A;  2LVK A;  1SL8 A;  4P2Y B;  1IWQ A;  1H4B A;  4UPG A;  5KSZ A;  2KDH A;  1SCM C;  2O60 A;  3TDZ A;  4ORA B;  2JZI A;  5HKY A;  1AP4 A;  2WND A;  1S1E A;  4ORB B;  4U8D A;  3CR2 A;  3A4U B;  5HKW A;  4ETO A;  2HQ8 A;  1F8H A;  5AAN A;  2JT0 A;  1NWD A;  2SAS A;  2BE4 A;  1BG1 A;  1DJI A;  1N2D A;  2G9B A;  2KFH A;  1MQ1 A;  1TN4 A;  1L2O C;  3AKA A;  4XJK B;  2BCX A;  3BOW B;  4QJ4 B;  3SG4 A;  1B1G A;  2WOS A;  1PAL A;  1OOJ A;  2E30 A;  1G33 A;  4BY4 A;  2L98 A;  3C1V A;  4R1E A;  1NIW A;  5B8I B;  2OS8 B;  2K2A A;  2BCB A;  3BXK A;  3JTD C;  4I5L B;  1J55 A;  4E68 A;  1WDC B;  2JT8 A;  4DUQ A;  1BF5 A;  2KBI A;  1YUS A;  1CMG A;  1OE9 B;  2BE6 A;  2JUL A;  1K93 D;  4I5K A;  5CPV A;  1H8B A;  5DKQ A;  3BUM B;  2D8N A;  1KFU L;  2A4J A;  3CTN A;  2CTN A;  3CZT X;  3VRP A;  1CDL A;  4JWQ A;  3GK4 X;  1DJZ A;  1KQM B;  2KI4 B;  1JF2 A;  1JFJ A;  2EHB A;  1KSO A;  2WCE A;  2KGR A;  1J1E A;  3OB1 B;  3A8R A;  1SBJ A;  1FW4 A;  1QAS A;  1AJ4 A;  2K7C A;  4OCI A;  1ZFS A;  2MHH A;  3TDU A;  1KWO C;  2NXQ A;  1TCF A;  4L9M A;  1L2O B;  4PHN A;  1CMF A;  3NSK A;  3BUX B;  3BQ3 A;  4XYN A;  4MSP A;  4Q04 A;  1OMR A;  1UUR A;  3I5F C;  2JXL A;  2KFG A;  3PN7 B;  3K21 A;  2K8M B;  4ZCV A;  1DMO A;  4HRE E;  1WLZ A;  2BBN A;  2L50 A;  1SKT A;  1AK8 A;  3EK8 A;  4GPL B;  4JPZ B;  4PCW A;  5ER4 X;  1TOP A;  1XYD A;  1KFX L;  1PUL A;  1QV1 A;  2Y4Q A;  1QX2 A;  4PE1 A;  2G2B A;  1EXR A;  1SR6 C;  1OMD A;  2LUX A;  2Y5I A;  1DJY A;  2KQ6 A;  3DF0 B;  3PAT A;  2WC8 A;  1W7J B;  2BL0 C;  1Y1U A;  1WY9 A;  2LC5 A;  2PMY A;  3I5H C;  3SG5 A;  5ER5 A;  2LM5 A;  1N65 A;  2MA2 A;  1HQV A;  3I5I B;  1TRF A;  2LAN A;  5DKN A;  1JUO A;  1RFJ A;  4GGN A;  1IJ5 A;  3BYA A;  1NX1 A;  3SG7 A;  1A75 A;  1ALV A;  5CSJ A;  1K94 A;  5D69 A;  1M39 A;  3CGA A;  1SW8 A;  1DGV A;  1TNX A;  1TNW A;  2GGZ A;  2MAZ A;  4PE0 A;  2KNE A;  4OKH A;  3GK1 A;  1CKK A;  3EKJ A;  5G08 A;  4MZK A;  1M46 A;  1S5G Y;  2P6B B;  2LLT A;  1S36 A;  1ZOT B;  3DF0 A;  1CDP A;  1MHO A;  3OHM B;  3DVJ A;  3FIA A;  2PVB A;  1YR5 A;  1YRT B;  3VRO A;  2FCE A;  1CM1 A;  1GQM A;  1KCY A;  1Y1A A;  4MRX A;  2LLS A;  4DS7 A;  5GQQ C;  1NCY A;  3TUY C;  1MR8 A;  2KSP A;  2KYF A;  1YX8 A;  1BT6 A;  1KK8 B;  1TTX A;  3AAK A;  3I5I C;  2JXC A;  1DGU A;  2M1U A;  1YVL A;  5DKR A;  4ZCU A;  1F54 A;  1AHR A;  5J3X A;  1RWY A;  3O78 A;  3VRR A;  4PHJ A;  1A29 A;  5HLO A;  1XVJ A;  1UHN A;  1WLM A;  1XA5 A;  2F33 A;  2MLE C;  2M49 B;  1B7T Z;  2K0J A;  2F3Z A;  1BOC A;  1NX0 A;  1YUR A;  5AER A;  4PAL A;  3PM8 A;  1RJV A;  4C0J A;  1UUS A;  2JNF A;  1RRO A;  2CBL A;  1M63 B;  1PSR A;  1GJY A;  3I5F B;  5CSF A;  3VRN A;  2M3W A;  2LV7 A;  1CFD A;  4MLW A;  1XO5 A;  1J7O A;  4AOM A;  2MBX A;  2K2F A;  4I5J A;  4GGF C;  4MVF A;  1SK6 D;  1MF8 B;  1UHK A;  4CLN A;  1EG3 A;  1Q80 A;  2JC2 A;  2PSR A;  3IQQ A;  2E6W A;  1LKJ A;  1R2U A;  2O5G A;  2KYC A;  2F3Y A;  4DIR A;  2M0R A;  2BBM A;  4N1F A;  1QVI Y;  4N1G A;  1WRK A;  4GBA A;  1BJF A;  4TNC A;  1U5I B;  1S3P A;  5I2L A;  1VRK A;  3GOF A;  5I2O A;  3NSL A;  1BMO A;  2AMI A;  3FWB A;  1PVB A;  4OV2 A;  4USL A;  1OQP A;  1XK4 C;  1DVI A;  2FJU B;  1QLS A;  3IF7 A;  1PVA A;  2AUC A;  5FYX A;  1IH0 A;  2ZRT A;  3MSE B;  2L2E A;  3ICB A;  2R2I A;  3TZ1 A;  1DF0 A;  3OB2 B;  2CCM A;  2LNK A;  2ZFD A;  1PRW A;  1XFV O;  2F8P A;  1B9A A;  3KEV A;  2M1K B;  3VGO A;  1QX7 A;  1RK9 A;  4YI9 A;  1S6I A;  2LMV A;  3CWG A;  3SIA A;  1CTR A;  3ZNI A;  1KSM A;  2OPO A;  1SNL A;  3OX6 A;  1ZAC A;  1S6J A;  2LP3 A;  4GNK B;  2ISD A;  3WHT B;  1FPW A;  1Y6W A;  1QV0 A;  1YTZ C;  4CFR A;  2LE9 B;  1M31 A;  3E3R A;  1NSH A;  3EVR A;  1QLK A;  3KHE A;  3RM1 A;  3SG3 A;  1MXE A;  1DT7 B;  1ZUZ A;  1QVI Z;  4YI8 A;  1YUT A;  1XFZ O;  4PHK A;  1CNP A;  2M7L A;  2NCO A;  4ORC B;  2K7O A;  2BKH B;  2I18 A;  3M0W A;  4HSZ A;  5AXI A;  4AQI A;  1CB1 A;  2ZNE A;  5JJG A;  2KAX A;  1UHI A;  2PRU A;  4MZL A;  1DTL A;  1F4O A;  4ICB A;  3ZWH A;  5IBW A;  3DVM A;  1SY9 A;  4OVN F;  3O2P A;  3BUW B;  1SL7 A;  1K2H A;  2BKI B;  2M8U A;  5K89 A;  1CLL A;  2L5X B;  3LL8 B;  1DJH A;  4PHM A;  4CPV A;  5AFP A;  1A4P A;  2AAO A;  1PSB A;  2GV5 A;  1JSA A;  1JBA A;  4QJ3 B;  1AJ5 A;  3NSO A;  2BEC A;  3OP0 A;  4QJ5 B;  1B8C A;  4CID A;  5PAL A;  1W7I B;  2JNX A;  2OTG C;  1UHJ A;  4PDZ A;  1WRZ A;  1IGV A;  2JTT A;  1UP5 A;  1QTX A;  4YGD B;  4WQ3 A;  1TIZ A;  3PLF B;  1KQV A;  4GFT A;  4GGF A;  1LXF C;  2M9G A;  4YGB B;  2TN4 A;  2L0P A;  3SG6 A;  4A4B A;  1CFC A;  2I94 A;  4F0Z B;  3QRX A;  3F45 A;  3GK2 A;  3BUN B;  3DVE A;  1TNP A;  3TS5 C;  1SMG A;  2SCP A;  1CDM A;  1S26 D;  3PSR A;  2ZN9 A;  1M45 A;  2Q4U A;  3TDI A;  4DCK A;  4HRH A;  1REC A;  1RTP 1;  1QXP A;  1DF0 B;  1PK0 D;  1C7V A;  1SYM A;  1AVS A;  4I5N B;  2I2R E; 
#chains in the Genus database with same CATH topology
 3EKH A;  5F6T A;  1OZS A;  3PFV A;  1ZMZ A;  1KK8 C;  1FI5 A;  1BR4 B;  1IIO A;  3TUY B;  1C7W A;  2L4H A;  1CDN A;  1F70 A;  4NQG A;  2JOJ A;  1FI6 A;  1YUU A;  2F2O A;  1A75 B;  1F55 A;  1XFX O;  4MBE A;  2KI6 C;  1QX5 B;  1IG5 A;  3WXA A;  1CLM A;  1S5G Z;  1BU3 A;  1DJW A;  1N0Y A;  1QJT A;  1F4Q A;  4IL1 A;  4AQJ A;  1F71 A;  4MZJ A;  1JWD A;  2CT9 A;  1B47 A;  1J7R A;  3BOW A;  3NSI A;  1IRJ A;  3PN7 C;  1W9Z A;  1OSA A;  1B4C A;  1LS8 A;  1B8L A;  1WRL A;  2MLF C;  4D1E A;  2M29 A;  3L4L A;  1SCV A;  2HF5 A;  2V53 A;  2JTZ A;  2OTG B;  1X02 A;  2WCB A;  1KWO B;  4YGE B;  4MN0 A;  4PE4 A;  3SJS A;  2K7D A;  1KFX S;  3CS1 A;  3HCM A;  2JWW A;  2KAV A;  1CM4 A;  5JOL A;  2H61 C;  5I8N A;  1K90 D;  2K61 A;  5DIC A;  2BL0 B;  3SIB A;  1SL9 A;  2ERB A;  1B7T Y;  2LLU A;  3SS4 A;  2BCA A;  3CZ0 A;  1KQM C;  1QIV A;  3I5G C;  5HL1 A;  2KLD A;  3LLE A;  1BLQ A;  2JT3 A;  1SR6 B;  2KOT A;  2BNX A;  4WRI A;  3JVT B;  2B1U A;  4MEW A;  3UO9 A;  2CNP A;  4CFQ A;  1S6C A;  1GGZ A;  2H2K A;  3R1O A;  1OOH A;  1XFU O;  1K9U A;  5HKZ A;  2H61 A;  1NUB A;  3NGV A;  1K9K A;  1G4Y R;  3JTD B;  5HLV A;  2L4I A;  3KF9 A;  5KTY A;  2KQY A;  2LP2 A;  3CYZ A;  2QAC A;  2QPT A;  3H4S E;  3BFA A;  2LHI A;  4GAO A;  4KYN A;  3BFB A;  1L7Z A;  4M2O A;  1MWN A;  1KK7 Z;  1KFU S;  3R1V A;  1ODB A;  3O4Y A;  2DOQ A;  1LVC D;  3FE8 A;  2WCL A;  3CDN A;  3WNX B;  1LA0 A;  1MUX A;  1NCZ A;  2KI4 C;  2LVI A;  3DVK A;  2CXJ A;  2ZRS A;  2KHN A;  1D1O A;  1J7Q A;  1EJ3 A;  4NDC A;  2I7A A;  1K9P A;  2L51 A;  2JQ6 A;  1SRA A;  1DJG A;  3O4X A;  2M7N A;  1K8U A;  2KFF A;  1IQ5 A;  1G8I A;  3B6X A;  2WCK A;  1IQ3 A;  1Y1X A;  2HQW A;  2M97 A;  3AKB A;  3JVT C;  3SG2 A;  2KAY A;  1WDC C;  4YGA A;  3OX5 A;  2KPH A;  3DYE A;  3I5G B;  2NCP A;  1TCO B;  3WHU B;  1C07 A;  2OS8 C;  5TNC A;  2HET A;  3EVU A;  4JQ0 D;  2LMT A;  1OMV A;  2JRF A;  1XFY O;  3O6B A;  1B8R A;  4GUK A;  2ZND A;  1A03 A;  4M2P A;  3KO0 A;  5BPJ A;  2ZN8 A;  2PQL A;  1FF1 A;  2COL B;  5I2Q A;  4FTG A;  1MXL C;  1J1D A;  2QDI A;  3HX4 A;  5HYD A;  2RGI A;  3KPX A;  1IKU A;  2KI6 D;  1FBV A;  2QEV A;  3OGN A;  1EL4 A;  1U5I A;  1Y0V H;  1SPY A;  3CAB A;  3D10 A;  1NCX A;  2JU0 A;  2EC6 B;  2LHL A;  2QEB A;  1UWO A;  1LIN A;  2ZKM X;  4OR9 B;  5FI6 A;  2JPT A;  2KBM A;  1NPQ A;  1BR1 B;  1TUJ A;  2F2P A;  3B87 A;  3LCP C;  1YX7 A;  3RZS A;  4YRU A;  1J7P A;  3S0F A;  3PAL A;  4P5O E;  1OZO A;  3NHT A;  2WOR A;  1SCM B;  3NXA A;  4WQ2 A;  2NZ0 A;  1EH2 A;  2LVV A;  3D0Y A;  3RLZ A;  4BY5 A;  4YGC B;  2KGB C;  2LMU A;  3R72 A;  2K7B A;  1BOD A;  3EK7 A;  1CFF A;  4NDD A;  1QS7 A;  1EG4 A;  1V1G A;  2BAP A;  1KK7 Y;  1YRU B;  4DRW A;  4C0K A;  1LA3 A;  4HRG A;  1NP8 A;  2Y1N A;  1IJ6 A;  1YVH A;  4M2Q A;  4YBH B;  1XFW O;  1XK4 A;  2MRD A;  2LAP A;  3CLN A;  2FOT A;  5CSN A;  1CFP A;  1NX3 A;  1QIW A;  4MRY A;  4NDB A;  1DJX A;  1ALW A;  2MJW B;  3CR5 X;  2FCD A;  1HT9 A;  2GTE A;  2VRG A;  4N5X A;  2YGU A;  3TS5 B;  3QME A;  1R6P A;  3DD4 A;  2LVJ A;  1K95 A;  3FWC A;  5CSI A;  1AUI B;  4A4C A;  2NLN A;  2PAL A;  2EC6 C;  3LK1 A;  5KU1 A;  1GGW A;  1QAT A;  5FI2 A;  1E8A A;  4XJK A;  3D0Y B;  3FS7 A;  1NX2 A;  2Y1M A;  1V1F A;  2WCF A;  1TNQ A;  1JFK A;  5D7F A;  3BUO B;  3CR4 X;  3EVV A;  3VRQ A;  1A2X A;  3NHI A;  2WC5 A;  2EGD A;  2LUC A;  4PE7 A;  2PAS A;  3AAJ A;  1UHH A;  5AEQ A;  4INX A;  2LCP A;  3CZ1 A;  4C0L A;  3IQO A;  1TWO A;  1JF0 A;  3EK4 A;  2Q91 A;  3LK0 A;  4FQO A;  1NYA A;  2IS9 A;  3I5H B;  2GGM A;  1CLB A;  2HPS A;  3S0B A;  1JC2 A;  1K96 A;  3CZ2 A;  2LVK A;  3FE6 A;  1SL8 A;  4P2Y B;  1IWQ A;  1H4B A;  4UPG A;  5KSZ A;  2KDH A;  1SCM C;  2O60 A;  1ORG A;  3TDZ A;  4ORA B;  2JZI A;  5HKY A;  1AP4 A;  2WND A;  1S1E A;  4ORB B;  4U8D A;  3CR2 A;  3BFH A;  3A4U B;  5HKW A;  4ETO A;  2HQ8 A;  4PT1 A;  1F8H A;  5AAN A;  3DXL A;  1OW4 A;  2JT0 A;  1NWD A;  2SAS A;  2BE4 A;  1BG1 A;  1DJI A;  1N2D A;  2G9B A;  2KFH A;  1MQ1 A;  1TN4 A;  5FI7 A;  1L2O C;  3AKA A;  3D73 A;  4XJK B;  2BCX A;  3BOW B;  4QJ4 B;  3SG4 A;  1B1G A;  2WOS A;  1PAL A;  3L47 A;  1OOJ A;  2E30 A;  3L4A A;  1G33 A;  4BY4 A;  2L98 A;  2PYQ A;  4OZD A;  3C1V A;  4R1E A;  1NIW A;  5B8I B;  2OS8 B;  2K2A A;  2BCB A;  3BXK A;  3JTD C;  4I5L B;  1J55 A;  4E68 A;  1WDC B;  2JT8 A;  4DUQ A;  1BF5 A;  2KBI A;  1YUS A;  1CMG A;  1OE9 B;  2BE6 A;  2JUL A;  1K93 D;  4I5K A;  5CPV A;  1H8B A;  3EG5 B;  3N7H A;  5DKQ A;  3BUM B;  3B88 A;  2D8N A;  1KFU L;  2A4J A;  2P70 A;  2CTN A;  2QEH A;  3CTN A;  3CZT X;  3VRP A;  1CDL A;  4JWQ A;  3GK4 X;  1DJZ A;  1KQM B;  2KI4 B;  1JF2 A;  1JFJ A;  2EHB A;  1KSO A;  2WCE A;  2KGR A;  4INW A;  1J1E A;  3OB1 B;  3A8R A;  3DY9 A;  1SBJ A;  1FW4 A;  2L5Y A;  1QAS A;  3S0D A;  1AJ4 A;  1DEL A;  2K7C A;  4OCI A;  1ZFS A;  2MHH A;  3TDU A;  1KWO C;  1XFR A;  2NXQ A;  1TCF A;  4L9M A;  1L2O B;  4PHN A;  1CMF A;  2WCH A;  3NSK A;  3BUX B;  3BQ3 A;  3PM2 A;  4XYN A;  4MSP A;  4Q04 A;  1OMR A;  1UUR A;  3I5F C;  2JXL A;  2KFG A;  3PN7 B;  3K21 A;  2K8M B;  4ZCV A;  1GM0 A;  3BJH A;  4HRE E;  1WLZ A;  2BBN A;  2L50 A;  1SKT A;  1AK8 A;  1DMO A;  3EK8 A;  4GPL B;  4JPZ B;  4PCW A;  5ER4 X;  1DT7 B;  1TOP A;  1XYD A;  1KFX L;  1PUL A;  1QV1 A;  2Y4Q A;  1QX2 A;  4IJ7 A;  4PE1 A;  2G2B A;  1EXR A;  1SR6 C;  5D3O A;  1OMD A;  2LUX A;  2Y5I A;  1DJY A;  2KQ6 A;  3DF0 B;  3PAT A;  2WC8 A;  1DQE A;  1W7J B;  2BL0 C;  1Y1U A;  1WY9 A;  2LC5 A;  2PMY A;  3I5H C;  3SG5 A;  5ER5 A;  2LM5 A;  1N65 A;  2MA2 A;  1HQV A;  3I5I B;  1TRF A;  2LAN A;  5DKN A;  1JUO A;  1RFJ A;  4GGN A;  1IJ5 A;  4JD9 A;  3BYA A;  1NX1 A;  3SG7 A;  1A75 A;  1ALV A;  5CSJ A;  1K94 A;  5D69 A;  1M39 A;  2WCJ A;  3CGA A;  1SW8 A;  1DGV A;  1TNX A;  1TNW A;  2GGZ A;  2MAZ A;  4PE0 A;  2KNE A;  4OKH A;  3GK1 A;  1CKK A;  3EKJ A;  5G08 A;  1C3Y A;  4MZK A;  1M46 A;  1S5G Y;  2P6B B;  2LLT A;  1S36 A;  1ZOT B;  3DF0 A;  1CDP A;  1MHO A;  3OHM B;  3DVJ A;  3FIA A;  4F7F A;  2PVB A;  1YR5 A;  1YRT B;  3IVT A;  3VRO A;  2FCE A;  1CM1 A;  3B86 A;  1GQM A;  1KCY A;  1Y1A A;  4MRX A;  2LLS A;  4DS7 A;  5GQQ C;  1NCY A;  3TUY C;  1MR8 A;  2KSP A;  2KYF A;  1YX8 A;  1BT6 A;  1KK8 B;  1QWV A;  1TTX A;  3AAK A;  3I5I C;  2JXC A;  1DGU A;  2M1U A;  1YVL A;  5DKR A;  4ZCU A;  1F54 A;  1AHR A;  2WC6 A;  5J3X A;  1RWY A;  3D76 A;  3O78 A;  3VRR A;  4PHJ A;  1A29 A;  5HLO A;  1XVJ A;  1UHN A;  1WLM A;  1XA5 A;  1TUZ A;  1Z2C B;  2F33 A;  2MLE C;  2M49 B;  1B7T Z;  2K0J A;  2F3Z A;  1BOC A;  1NX0 A;  1YUR A;  5AER A;  4PAL A;  3PM8 A;  1RJV A;  4C0J A;  1UUS A;  2JNF A;  3S0E A;  1RRO A;  2CBL A;  1M63 B;  1PSR A;  1GJY A;  3I5F B;  5CSF A;  3VRN A;  2M3W A;  2LV7 A;  1CFD A;  4MLW A;  1XO5 A;  3DZT A;  5EL2 A;  3SS3 A;  2JPO A;  1J7O A;  4AOM A;  2MBX A;  2K2F A;  4I5J A;  3FE9 A;  4GGF C;  1SK6 D;  1MF8 B;  1UHK A;  4MVF A;  1EG3 A;  1Q80 A;  4CLN A;  2JC2 A;  2PSR A;  3V2L A;  3IQQ A;  2E6W A;  1LKJ A;  1R2U A;  2KLE A;  2KYC A;  2F3Y A;  2O5G A;  4DIR A;  1SSE B;  2M0R A;  2BBM A;  4N1F A;  1QVI Y;  1P28 A;  4N1G A;  1WRK A;  4GBA A;  1BJF A;  4TNC A;  1Z4H A;  1U5I B;  2L2C A;  1S3P A;  5I2L A;  3D74 A;  1VRK A;  3GOF A;  5I2O A;  3NSL A;  3K1E A;  1BMO A;  2AMI A;  3FWB A;  1PVB A;  4OV2 A;  4USL A;  1OQP A;  1XK4 C;  1DVI A;  2FJU B;  1QLS A;  3IF7 A;  1PVA A;  3UNW A;  2AUC A;  1C3Z A;  5FYX A;  4JKT A;  1IH0 A;  3D77 A;  2ZRT A;  3MSE B;  2L2E A;  3ICB A;  2R2I A;  3TZ1 A;  1DF0 A;  3B7A A;  3OB2 B;  2CCM A;  2LNK A;  2ZFD A;  1PRW A;  1XFV O;  2F8P A;  1B9A A;  3KEV A;  2M1K B;  3VGO A;  1QX7 A;  1RK9 A;  4YI9 A;  1S6I A;  2LMV A;  3CWG A;  3SIA A;  1CTR A;  3ZNI A;  1KSM A;  2OPO A;  1SNL A;  3R1P A;  3OX6 A;  1ZAC A;  1S6J A;  2H8V A;  2LP3 A;  4GNK B;  2ISD A;  3WHT B;  1FPW A;  1Y6W A;  1QV0 A;  1YTZ C;  4CFR A;  2LE9 B;  1M31 A;  3E3R A;  1NSH A;  1OOG A;  1QLK A;  3EVR A;  3KHE A;  3RM1 A;  1MXE A;  3SG3 A;  1OOI X;  1ZUZ A;  1QVI Z;  4YI8 A;  1YUT A;  5I94 A;  1XFZ O;  4PHK A;  1CNP A;  2M7L A;  2NCO A;  4ORC B;  2K7O A;  3OBV A;  2BKH B;  2I18 A;  3M0W A;  4HSZ A;  5AXI A;  4AQI A;  1CB1 A;  2ZNE A;  5JJG A;  2KAX A;  1UHI A;  2PRU A;  4MZL A;  1DTL A;  1F4O A;  4ICB A;  3ZWH A;  5IBW A;  3PJI A;  3DVM A;  1SY9 A;  4OVN F;  3O2P A;  4FQT A;  3BUW B;  1SL7 A;  1K2H A;  2BKI B;  2M8U A;  5K89 A;  1CLL A;  2L5X B;  3LL8 B;  1DJH A;  1OOF A;  4PHM A;  3SS5 A;  4CPV A;  2P71 A;  1A4P A;  2AAO A;  1PSB A;  2GV5 A;  5AFP A;  1JSA A;  1JBA A;  4QJ3 B;  1AJ5 A;  3NSO A;  2FJY A;  2BEC A;  3OP0 A;  3D78 A;  3VB1 A;  4QJ5 B;  1B8C A;  3S0G A;  4CID A;  5PAL A;  1W7I B;  1T14 A;  2JNX A;  2OTG C;  1UHJ A;  4PDZ A;  1WRZ A;  1IGV A;  2JTT A;  3Q8I A;  1UP5 A;  1QTX A;  4YGD B;  4WQ3 A;  1TIZ A;  1DEK A;  3PLF B;  2QEO A;  4GFT A;  1KQV A;  4GGF A;  1LXF C;  2K60 A;  2M9G A;  4YGB B;  3S0A A;  2TN4 A;  2L0P A;  3SG6 A;  4A4B A;  1CFC A;  2I94 A;  4F0Z B;  3QRX A;  1DC1 A;  3F45 A;  3GK2 A;  3BUN B;  3DVE A;  1TNP A;  3TS5 C;  1SMG A;  2SCP A;  1CDM A;  1S26 D;  3PSR A;  3D75 A;  2ZN9 A;  1M45 A;  2Q4U A;  3TDI A;  4DCK A;  4HRH A;  2WCM A;  1REC A;  1RTP 1;  1QXP A;  1DF0 B;  1PK0 D;  1C7V A;  1SYM A;  1AVS A;  4I5N B;  2I2R E; 
#chains in the Genus database with same CATH homology
 3EKH A;  5F6T A;  1OZS A;  3PFV A;  1ZMZ A;  1KK8 C;  1FI5 A;  1BR4 B;  3TUY B;  1C7W A;  2L4H A;  1CDN A;  1F70 A;  4NQG A;  2JOJ A;  1FI6 A;  1YUU A;  2F2O A;  1A75 B;  1F55 A;  1XFX O;  4MBE A;  2KI6 C;  1QX5 B;  1IG5 A;  3WXA A;  1CLM A;  1S5G Z;  1BU3 A;  1DJW A;  1N0Y A;  1QJT A;  1F4Q A;  4IL1 A;  4AQJ A;  1F71 A;  4MZJ A;  1JWD A;  2CT9 A;  1B47 A;  1J7R A;  3BOW A;  3NSI A;  1IRJ A;  3PN7 C;  1OSA A;  1B4C A;  1B8L A;  1WRL A;  2MLF C;  4D1E A;  2M29 A;  1SCV A;  2HF5 A;  2V53 A;  2JTZ A;  2OTG B;  1X02 A;  2WCB A;  1KWO B;  4YGE B;  4MN0 A;  4PE4 A;  3SJS A;  2K7D A;  1KFX S;  3CS1 A;  3HCM A;  2JWW A;  2KAV A;  1CM4 A;  5JOL A;  2H61 C;  5I8N A;  1K90 D;  2K61 A;  2BL0 B;  3SIB A;  1SL9 A;  2LLU A;  1B7T Y;  2BCA A;  1KQM C;  1QIV A;  3I5G C;  1BLQ A;  3LLE A;  2JT3 A;  1SR6 B;  2KOT A;  4WRI A;  3JVT B;  2B1U A;  4MEW A;  2CNP A;  4CFQ A;  1S6C A;  1GGZ A;  2H2K A;  1XFU O;  1K9U A;  5HKZ A;  2H61 A;  1NUB A;  1K9K A;  1G4Y R;  3JTD B;  5HLV A;  2L4I A;  3KF9 A;  5KTY A;  2KQY A;  2LP2 A;  2QAC A;  2QPT A;  3H4S E;  2LHI A;  4GAO A;  1L7Z A;  4M2O A;  1MWN A;  1KK7 Z;  1KFU S;  1ODB A;  3O4Y A;  2DOQ A;  1LVC D;  3WNX B;  1LA0 A;  1MUX A;  1NCZ A;  2KI4 C;  2LVI A;  3DVK A;  2CXJ A;  2ZRS A;  2KHN A;  1D1O A;  1J7Q A;  1EJ3 A;  4NDC A;  2I7A A;  1K9P A;  2L51 A;  2JQ6 A;  1SRA A;  1DJG A;  2M7N A;  1K8U A;  2KFF A;  1IQ5 A;  1G8I A;  1IQ3 A;  1Y1X A;  2HQW A;  2M97 A;  3AKB A;  3JVT C;  3SG2 A;  2KAY A;  1WDC C;  4YGA A;  3OX5 A;  3I5G B;  2NCP A;  1TCO B;  3WHU B;  1C07 A;  2OS8 C;  5TNC A;  2HET A;  3EVU A;  4JQ0 D;  2LMT A;  1OMV A;  2JRF A;  1XFY O;  3O6B A;  1B8R A;  4GUK A;  2ZND A;  1A03 A;  4M2P A;  3KO0 A;  5BPJ A;  2ZN8 A;  1FF1 A;  2COL B;  5I2Q A;  4FTG A;  1MXL C;  1J1D A;  3HX4 A;  5HYD A;  2RGI A;  3KPX A;  1IKU A;  2KI6 D;  1FBV A;  1EL4 A;  1U5I A;  1Y0V H;  1SPY A;  3D10 A;  1NCX A;  2JU0 A;  2EC6 B;  2LHL A;  1UWO A;  1LIN A;  2ZKM X;  4OR9 B;  2JPT A;  2KBM A;  1NPQ A;  1BR1 B;  2F2P A;  3LCP C;  1YX7 A;  4YRU A;  1J7P A;  3PAL A;  4P5O E;  1OZO A;  3NXA A;  2WOR A;  1SCM B;  4WQ2 A;  2NZ0 A;  1EH2 A;  2LVV A;  3D0Y A;  3RLZ A;  4BY5 A;  4YGC B;  2KGB C;  2LMU A;  2K7B A;  1BOD A;  3EK7 A;  1CFF A;  4NDD A;  1QS7 A;  1EG4 A;  1V1G A;  1KK7 Y;  1YRU B;  4DRW A;  4C0K A;  1LA3 A;  4HRG A;  1NP8 A;  2Y1N A;  1IJ6 A;  1YVH A;  4M2Q A;  4YBH B;  1XFW O;  1XK4 A;  2MRD A;  2LAP A;  3CLN A;  2FOT A;  5CSN A;  1CFP A;  1NX3 A;  1QIW A;  4MRY A;  4NDB A;  1DJX A;  1ALW A;  2MJW B;  3CR5 X;  2FCD A;  1HT9 A;  2VRG A;  4N5X A;  3TS5 B;  1R6P A;  3DD4 A;  2LVJ A;  1K95 A;  3FWC A;  5CSI A;  1AUI B;  4A4C A;  2NLN A;  2PAL A;  2EC6 C;  3LK1 A;  5KU1 A;  1GGW A;  1QAT A;  1E8A A;  4XJK A;  3D0Y B;  3FS7 A;  1NX2 A;  2Y1M A;  1V1F A;  2WCF A;  1TNQ A;  1JFK A;  5D7F A;  3BUO B;  3CR4 X;  3EVV A;  3VRQ A;  1A2X A;  2EGD A;  2LUC A;  4PE7 A;  2PAS A;  3AAJ A;  1UHH A;  5AEQ A;  2LCP A;  4C0L A;  3IQO A;  1JF0 A;  3EK4 A;  2Q91 A;  3LK0 A;  4FQO A;  1NYA A;  2IS9 A;  3I5H B;  2GGM A;  1CLB A;  2HPS A;  1JC2 A;  1K96 A;  2LVK A;  1SL8 A;  4P2Y B;  1IWQ A;  1H4B A;  4UPG A;  5KSZ A;  2KDH A;  1SCM C;  2O60 A;  3TDZ A;  4ORA B;  2JZI A;  5HKY A;  1AP4 A;  2WND A;  1S1E A;  4ORB B;  4U8D A;  3CR2 A;  3A4U B;  5HKW A;  4ETO A;  2HQ8 A;  1F8H A;  5AAN A;  2JT0 A;  1NWD A;  2SAS A;  2BE4 A;  1BG1 A;  1DJI A;  1N2D A;  2G9B A;  2KFH A;  1MQ1 A;  1TN4 A;  1L2O C;  3AKA A;  4XJK B;  2BCX A;  3BOW B;  4QJ4 B;  3SG4 A;  1B1G A;  2WOS A;  1PAL A;  1OOJ A;  2E30 A;  1G33 A;  4BY4 A;  2L98 A;  3C1V A;  4R1E A;  1NIW A;  5B8I B;  2OS8 B;  2K2A A;  2BCB A;  3BXK A;  3JTD C;  4I5L B;  1J55 A;  4E68 A;  1WDC B;  2JT8 A;  4DUQ A;  1BF5 A;  2KBI A;  1YUS A;  1CMG A;  1OE9 B;  2BE6 A;  2JUL A;  1K93 D;  4I5K A;  5CPV A;  1H8B A;  5DKQ A;  3BUM B;  2D8N A;  1KFU L;  2A4J A;  3CTN A;  2CTN A;  3CZT X;  3VRP A;  1CDL A;  4JWQ A;  3GK4 X;  1DJZ A;  1KQM B;  2KI4 B;  1JF2 A;  1JFJ A;  2EHB A;  1KSO A;  2WCE A;  2KGR A;  1J1E A;  3OB1 B;  3A8R A;  1SBJ A;  1FW4 A;  1QAS A;  1AJ4 A;  2K7C A;  4OCI A;  1ZFS A;  2MHH A;  3TDU A;  1KWO C;  2NXQ A;  1TCF A;  4L9M A;  1L2O B;  4PHN A;  1CMF A;  3NSK A;  3BUX B;  3BQ3 A;  4XYN A;  4MSP A;  4Q04 A;  1OMR A;  1UUR A;  3I5F C;  2JXL A;  2KFG A;  3PN7 B;  3K21 A;  2K8M B;  4ZCV A;  1DMO A;  4HRE E;  1WLZ A;  2BBN A;  2L50 A;  1SKT A;  1AK8 A;  3EK8 A;  4GPL B;  4JPZ B;  4PCW A;  5ER4 X;  1TOP A;  1XYD A;  1KFX L;  1PUL A;  1QV1 A;  2Y4Q A;  1QX2 A;  4PE1 A;  2G2B A;  1EXR A;  1SR6 C;  1OMD A;  2LUX A;  2Y5I A;  1DJY A;  2KQ6 A;  3DF0 B;  3PAT A;  2WC8 A;  1W7J B;  2BL0 C;  1Y1U A;  1WY9 A;  2LC5 A;  2PMY A;  3I5H C;  3SG5 A;  5ER5 A;  2LM5 A;  1N65 A;  2MA2 A;  1HQV A;  3I5I B;  1TRF A;  2LAN A;  5DKN A;  1JUO A;  1RFJ A;  4GGN A;  1IJ5 A;  3BYA A;  1NX1 A;  3SG7 A;  1A75 A;  1ALV A;  5CSJ A;  1K94 A;  5D69 A;  1M39 A;  3CGA A;  1SW8 A;  1DGV A;  1TNX A;  1TNW A;  2GGZ A;  2MAZ A;  4PE0 A;  2KNE A;  4OKH A;  3GK1 A;  1CKK A;  3EKJ A;  5G08 A;  4MZK A;  1M46 A;  1S5G Y;  2P6B B;  2LLT A;  1S36 A;  1ZOT B;  3DF0 A;  1CDP A;  1MHO A;  3OHM B;  3DVJ A;  3FIA A;  2PVB A;  1YR5 A;  1YRT B;  3VRO A;  2FCE A;  1CM1 A;  1GQM A;  1KCY A;  1Y1A A;  4MRX A;  2LLS A;  4DS7 A;  5GQQ C;  1NCY A;  3TUY C;  1MR8 A;  2KSP A;  2KYF A;  1YX8 A;  1BT6 A;  1KK8 B;  1TTX A;  3AAK A;  3I5I C;  2JXC A;  1DGU A;  2M1U A;  1YVL A;  5DKR A;  4ZCU A;  1F54 A;  1AHR A;  5J3X A;  1RWY A;  3O78 A;  3VRR A;  4PHJ A;  1A29 A;  5HLO A;  1XVJ A;  1UHN A;  1WLM A;  1XA5 A;  2F33 A;  2MLE C;  2M49 B;  1B7T Z;  2K0J A;  2F3Z A;  1BOC A;  1NX0 A;  1YUR A;  5AER A;  4PAL A;  3PM8 A;  1RJV A;  4C0J A;  1UUS A;  2JNF A;  1RRO A;  2CBL A;  1M63 B;  1PSR A;  1GJY A;  3I5F B;  5CSF A;  3VRN A;  2M3W A;  2LV7 A;  1CFD A;  4MLW A;  1XO5 A;  1J7O A;  4AOM A;  2MBX A;  2K2F A;  4I5J A;  4GGF C;  4MVF A;  1SK6 D;  1MF8 B;  1UHK A;  4CLN A;  1EG3 A;  1Q80 A;  2JC2 A;  2PSR A;  3IQQ A;  2E6W A;  1LKJ A;  1R2U A;  2O5G A;  2KYC A;  2F3Y A;  4DIR A;  2M0R A;  2BBM A;  4N1F A;  1QVI Y;  4N1G A;  1WRK A;  4GBA A;  1BJF A;  4TNC A;  1U5I B;  1S3P A;  5I2L A;  1VRK A;  3GOF A;  5I2O A;  3NSL A;  1BMO A;  2AMI A;  3FWB A;  1PVB A;  4OV2 A;  4USL A;  1OQP A;  1XK4 C;  1DVI A;  2FJU B;  1QLS A;  3IF7 A;  1PVA A;  2AUC A;  5FYX A;  1IH0 A;  2ZRT A;  3MSE B;  2L2E A;  3ICB A;  2R2I A;  3TZ1 A;  1DF0 A;  3OB2 B;  2CCM A;  2LNK A;  2ZFD A;  1PRW A;  1XFV O;  2F8P A;  1B9A A;  3KEV A;  2M1K B;  3VGO A;  1QX7 A;  1RK9 A;  4YI9 A;  1S6I A;  2LMV A;  3CWG A;  3SIA A;  1CTR A;  3ZNI A;  1KSM A;  2OPO A;  1SNL A;  3OX6 A;  1ZAC A;  1S6J A;  2LP3 A;  4GNK B;  2ISD A;  3WHT B;  1FPW A;  1Y6W A;  1QV0 A;  1YTZ C;  4CFR A;  2LE9 B;  1M31 A;  3E3R A;  1NSH A;  3EVR A;  1QLK A;  3KHE A;  3RM1 A;  3SG3 A;  1MXE A;  1DT7 B;  1ZUZ A;  1QVI Z;  4YI8 A;  1YUT A;  1XFZ O;  4PHK A;  1CNP A;  2M7L A;  2NCO A;  4ORC B;  2K7O A;  2BKH B;  2I18 A;  3M0W A;  4HSZ A;  5AXI A;  4AQI A;  1CB1 A;  2ZNE A;  5JJG A;  2KAX A;  1UHI A;  2PRU A;  4MZL A;  1DTL A;  1F4O A;  4ICB A;  3ZWH A;  5IBW A;  3DVM A;  1SY9 A;  4OVN F;  3O2P A;  3BUW B;  1SL7 A;  1K2H A;  2BKI B;  2M8U A;  5K89 A;  1CLL A;  2L5X B;  3LL8 B;  1DJH A;  4PHM A;  4CPV A;  5AFP A;  1A4P A;  2AAO A;  1PSB A;  2GV5 A;  1JSA A;  1JBA A;  4QJ3 B;  1AJ5 A;  3NSO A;  2BEC A;  3OP0 A;  4QJ5 B;  1B8C A;  4CID A;  5PAL A;  1W7I B;  2JNX A;  2OTG C;  1UHJ A;  4PDZ A;  1WRZ A;  1IGV A;  2JTT A;  1UP5 A;  1QTX A;  4YGD B;  4WQ3 A;  1TIZ A;  3PLF B;  1KQV A;  4GFT A;  4GGF A;  1LXF C;  2M9G A;  4YGB B;  2TN4 A;  2L0P A;  3SG6 A;  4A4B A;  1CFC A;  2I94 A;  4F0Z B;  3QRX A;  3F45 A;  3GK2 A;  3BUN B;  3DVE A;  1TNP A;  3TS5 C;  1SMG A;  2SCP A;  1CDM A;  1S26 D;  3PSR A;  2ZN9 A;  1M45 A;  2Q4U A;  3TDI A;  4DCK A;  4HRH A;  1REC A;  1RTP 1;  1QXP A;  1DF0 B;  1PK0 D;  1C7V A;  1SYM A;  1AVS A;  4I5N B;  2I2R E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...