1TRFA

Solution structure of the tr1c fragment of skeletal muscle troponin-c
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the TR1C fragment of skeletal muscle troponin-C.
pubmed rcsb
source organism Meleagris gallopavo
molecule tags Muscle protein
molecule keywords TROPONIN C
total genus 16
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1993-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1trfA00
2KI6D 2KAYA 1K90D 1NX1A 3D0YB 4AQIA 1S5GY 2CTNA 3AKAA 4BY5A 2MHHA 1RWYA 1H8BA 1UHHA 2L98A 2JNXA 3CZTX 1K9UA 1DF0B 3IQQA 1U5IA 4WRIA 4IL1A 4P5OE 1EG3A 1Y6WA 2V53A 4MRXA 3VGOA 1DJYA 1K93D 1PULA 1XO5A 4GAOA 1BU3A 4F0ZB 4HRHA 4HREE 2EC6B 2PMYA 2WOSA 2WNDA 3WXAA 1FPWA 4NDBA 5AEQA 1FI5A 1DJWA 1NIWA 2BE6A 2I7AA 1BG1A 3IQOA 1JFJA 4CIDA 1CDPA 4M2QA 2F33A 1CFDA 2MA2A 3PLFB 3LLEA 1KFUS 3PATA 2PRUA 1QX5B 1J7RA 3GK2A 2LVJA 1IG5A 3PM8A 3SIBA 1S1EA 4YI9A 3AAKA 1IRJA 1QVIZ 2NCOA 5AFPA 2OTGB 4QJ3B 2NXQA 1IKUA 3ZNIA 1SY9A 2JTZA 1B7TZ 3DVMA 3WHTB 1UP5A 3CS1A 4AOMA 1IQ3A 1AP4A 3PN7C 2KOTA 3A8RA 4YGEB 1K9PA 4I5LB 3GK1A 4WQ3A 4E68A 2FCDA 1BR4B 1DVIA 2KAVA 1NX3A 4YRUA 1R2UA 1CKKA 1A75B 1M45A 2LVIA 2JT0A 2WCBA 4YGAA 1H4BA 3SIAA 1YUTA 3I5GC 3DVJA 1CDMA 1A03A 1KK7Z 1XFZO 4AQJA 1YX8A 1XFXO 1QIVA 4TNCA 1B8LA 1WY9A 1DMOA 3JTDC 4YGDB 2BL0B 3TUYC 1RTP1 1KSOA 1S6CA 3TDUA 3OB2B 3OX6A 5G08A 3OHMB 3DF0B 1NSHA 1IWQA 4QJ5B 1XFUO 4YGBB 2PVBA 2HPSA 5I8NA 1PALA 3CLNA 3RLZA 2LMUA 4M2PA 2JWWA 5I2LA 2TN4A 1K8UA 1JFKA 1NPQA 1BMOA 2KQYA 4DS7A 1K94A 1K9KA 3BQ3A 5I2QA 1B9AA 4ORCB 5CSIA 1ALVA 1LXFC 5HLVA 5HLOA 4CLNA 1CLLA 2LNKA 3TS5C 2BCBA 1K95A 4GPLB 3LK0A 1Y0VH 2M7NA 2MJWB 4ICBA 4USLA 2K61A 3SJSA 1XFYO 2KHNA 1OZSA 2LVKA 3EK7A 4DIRA 5CSFA 4DUQA 2LMVA 2F8PA 2L0PA 1PVBA 1XA5A 2LM5A 3OX5A 4GGFA 2OS8B 1Y1AA 1MHOA 4GGNA 1DJZA 2KI4B 2K7OA 2LV7A 4MZLA 1DGVA 1KFXS 1TCOB 3QRXA 1JBAA 1KFXL 2LANA 4PE7A 2HQWA 5F6TA 3DF0A 1QATA 2JXLA 1C7WA 1TIZA 1SCMC 2KGRA 3JTDB 3TUYB 1KQVA 2Y4QA 3BUXB 2BCXA 1NX2A 1GJYA 4MEWA 2BKIB 2JRFA 1KWOC 4C0KA 3O2PA 2KFFA 4MZKA 1DGUA 1NYAA 2CNPA 3TDZA 3H4SE 4YBHB 1L2OB 1OSAA 3EK4A 2E6WA 3PN7B 2JTTA 4ZCUA 4MVFA 3EVUA 2PASA 1TCFA 1BJFA 2H61C 2WCEA 4JQ0D 4A4CA 3FS7A 2KI4C 2EHBA 2LCPA 2BKHB 2LP3A 3KF9A 1TNPA 2SCPA 1IQ5A 1CLMA 1CTRA 4P2YB 5ER4X 4NDCA 2KGBC 1DJIA 4PHJA 1S6IA 3BUNB 5AXIA 1OMVA 2CCMA 1PK0D 2LLUA 3SG5A 1UHKA 1NCXA 1J7OA 1UWOA 3JVTC 4OV2A 3F45A 2GV5A 4ORBB 3VRNA 3EKJA 1KFUL 2IS9A 3BXKA 2Y5IA 3O78A 5DKQA 1DJHA 1QX2A 2JT8A 1QX7A 1A75A 2K2FA 4C0JA 2NCPA 5KSZA 2I94A 1XFVO 3VROA 2M29A 3I5HB 2KFHA 3TS5B 2L2EA 1ODBA 1TNWA 4I5KA 1EG4A 1HT9A 2HQ8A 5TNCA 1CFPA 1K2HA 1KQMC 1AJ4A 2OPOA 5HYDA 3CR2A 4U8DA 1PSRA 1J7QA 1TN4A 1AUIB 2NLNA 2FJUB 4OR9B 1UHIA 4XJKA 2BECA 1CDNA 2M8UA 1EL4A 1TRFA 2JQ6A 4N1GA 2ZN8A 2KYFA 2QACA 1IJ6A 4XJKB 1SYMA 3I5HC 1QJTA 4D1EA 1BR1B 1SL9A 1F8HA 1G4YR 1TNXA 4OVNF 2R2IA 1N0YA 4L9MA 1Y1XA 4PHNA 2JULA 2M1KB 1J7PA 2KSPA 2KDHA 1MQ1A 1M39A 5HKWA 1KQMB 2KBIA 3FWCA 1F4QA 1FI6A 1MUXA 2JPTA 1ZMZA 3A4UB 4R1EA 5I2OA 2K2AA 1QV0A 3WNXB 1CLBA 3PALA 1CFFA 2MLFC 4NDDA 1IH0A 5CSJA 2ZFDA 2K7CA 3JVTB 4HSZA 2MBXA 1X02A 2P6BB 3BOWA 2M49B 4MLWA 1SPYA 1S5GZ 5CSNA 1YURA 5AANA 1K96A 5DKRA 3PSRA 2CT9A 2ISDA 2LLSA 4JWQA 4MBEA 2L5XB 1RJVA 1NWDA 2M3WA 3DVEA 2Q4UA 2B1UA 4GGFC 1BLQA 3M0WA 1WLZA 4CFQA 1B1GA 4OCIA 2BBNA 2ZRSA 2LHLA 1XYDA 1B8CA 1MF8B 2EGDA 5B8IB 1L7ZA 2K0JA 3TDIA 1XK4C 1F70A 3E3RA 1SBJA 1U5IB 3RM1A 1J1DA 3NXAA 5FYXA 2F2OA 1SRAA 1BOCA 3CTNA 1KK8B 1A4PA 2ZNEA 4PALA 2MAZA 1L2OC 1QS7A 3EK8A 4ORAB 3VRQA 2O60A 1IGVA 1E8AA 5ER5A 3D0YA 1RROA 1SR6C 2AUCA 1EH2A 4JPZB 1KWOB 2LC5A 3I5IC 1MXLC 3SG2A 4I5NB 4DRWA 1SCMB 1J55A 1S6JA 2WORA 4NQGA 1W7IB 4WQ2A 2HETA 1OMRA 2H61A 2ZKMX 1A29A 4HRGA 3I5FC 1JUOA 2Y1MA 2GGMA 1S3PA 1FF1A 1BT6A 1QIWA 2KNEA 3LK1A 1IJ5A 5BPJA 1SR6B 2ZN9A 2CBLA 3FWBA 1SW8A 3CGAA 4MRYA 3NSIA 2FOTA 5D7FA 1CM4A 3SG4A 3VRRA 1QV1A 2G2BA 1AK8A 2MRDA 2M1UA 2JT3A 1DTLA 4DCKA 2Q91A 1EXRA 4PE4A 1SKTA 2Y1NA 2EC6C 2COLB 5D69A 1N65A 3LCPC 1V1FA 5K89A 3EVVA 1PVAA 4PCWA 2K7DA 1DJGA 2GGZA 2AAOA 1GGZA 1S36A 3BYAA 3VRPA 1YX7A 4GUKA 1C7VA 1F4OA 1VRKA 2AMIA 4CFRA 3GK4X 1JF2A 1BODA 1YUSA 2K8MB 2QPTA 3FIAA 4QJ4B 1YVHA 4ZCVA 1LKJA 3SG6A 3C1VA 4BY4A 3MSEB 4UPGA 1CMGA 2RGIA 1CFCA 5GQQC 1NCYA 3OP0A 1UUSA 2LUXA 2G9BA 2LAPA 1DJXA 4GNKB 1WRLA 1YRTB 1ZOTB 1HQVA 1MR8A 1CDLA 1TTXA 5PALA 3O6BA 1XVJA 2F3ZA 2PSRA 1F71A 4A4BA 1OOJA 1SMGA 1TOPA 2LVVA 5AERA 1CB1A 3KEVA 1AJ5A 1DF0A 1QXPA 1KSMA 1QVIY 5HKYA 2L51A 1QLSA 1TNQA 4XYNA 4C0LA 2KAXA 1G33A 1OMDA 2LLTA 1C07A 1QLKA 3NSOA 4FTGA 1XK4A 4MSPA 4GBAA 4PHKA 1WDCB 1LA0A 2KI6C 4Q04A 3OB1B 3DD4A 4MZJA 4YGCB 3AAJA 1KK7Y 2OTGC 3BOWB 1JSAA 2BBMA 2VRGA 4PHMA 5HKZA 1DT7B 1ZACA 1GGWA 4N1FA 5DKNA 1FBVA 2WC8A 3SG3A 1OZOA 1RECA 1ZFSA 3EVRA 1LVCD 1M31A 1OE9B 1SL8A 3D10A 4M2OA 2OS8C 2L50A 1EJ3A 2K7BA 3BUMB 2HF5A 3CWGA 3HCMA 1F54A 5J3XA 2ZRTA 3BUOB 3LL8B 2MLEC 3WHUB 5KTYA 2O5GA 3CR4X 1WDCC 2JOJA 2M97A 4YI8A 5KU1A 1GQMA 4ETOA 2NZ0A 1MXEA 2BL0C 2KQ6A 1PRWA 1YUUA 1J1EA 2F3YA 3SG7A 1CMFA 1NP8A 3I5IB 1NX0A 3I5GB 4MN0A 2I2RE 1UURA 4GFTA 1ALWA 1YTZC 1LINA 1XFWO 5JOLA 3ZWHA 1CNPA 1M63B 3I5FB 2ZNDA 2BCAA 4PE0A 1WRKA 3K21A 3KO0A 2I18A 3NSLA 2H2KA 2A4JA 3IF7A 2LHIA 1QASA 1R6PA 1ZUZA 2JZIA 1RK9A 1JWDA 2KFGA 3DVKA 1BF5A 2PALA 1CM1A 1V1GA 1SK6D 1LA3A 1G8IA 1YVLA 2LE9B 3KPXA 1NUBA 1SCVA 3AKBA 4CPVA 4PE1A 3TZ1A 1AVSA 1B8RA 1NCZA 3ICBA 3GOFA 4FQOA 4PDZA 1OQPA 3KHEA 1MWNA 5IBWA 1KCYA 2DOQA 1Q80A 4OKHA 1Y1UA 2SASA 1N2DA 1D1OA 2LP2A 1KK8C 2D8NA 2E30A 2JC2A 4N5XA 5CPVA 2F2PA 1FW4A 1UHJA 1B4CA 2JNFA 3O4YA 1YRUB 1SNLA 2JU0A 2L4IA 1YR5A 1M46A 1RFJA 2JXCA 3PFVA 2FCEA 1JF0A 2WCFA 1WRZA 2LUCA 1W7JB 1B7TY 2M9GA 1UHNA 2M7LA 2CXJA 1PSBA 2LMTA 1QTXA 5JJGA 1F55A 1JC2A 3EKHA 3NSKA 1B47A 2KYCA 1S26D 3CR5X 2BE4A 1SL7A 3HX4A 4I5JA 1A2XA 1AHRA 1WLMA 2KBMA 2L4HA 2M0RA 3BUWB
chains in the Genus database with same CATH superfamily
2KI6D 2KAYA 1K90D 1NX1A 3D0YB 3R1PA 4AQIA 1S5GY 2CTNA 2WCKA 3AKAA 4BY5A 2MHHA 1RWYA 1H8BA 1UHHA 2L98A 2JNXA 3L4AA 3DXLA 3CZTX 1K9UA 1DF0B 3IQQA 1U5IA 4WRIA 4IL1A 4P5OE 1EG3A 1Y6WA 2QEBA 2V53A 3PJIA 4MRXA 3VGOA 1DJYA 1K93D 1PULA 1XO5A 2PQLA 4GAOA 1BU3A 4F0ZB 4HRHA 4HREE 2EC6B 2PMYA 2WOSA 2L5YA 2WNDA 3WXAA 2BNXA 1FPWA 4NDBA 5AEQA 1LS8A 1DJWA 1FI5A 1GM0A 1NIWA 2BE6A 2I7AA 1BG1A 3IQOA 1JFJA 4CIDA 1CDPA 1OOIX 4M2QA 2F33A 1CFDA 2MA2A 3PLFB 3LLEA 1KFUS 3PATA 2PRUA 1QX5B 1J7RA 3GK2A 2LVJA 1IG5A 3PM8A 3SIBA 1S1EA 4YI9A 3AAKA 1IRJA 1QVIZ 2NCOA 2P70A 5AFPA 2OTGB 4QJ3B 2NXQA 1IKUA 3ZNIA 1SY9A 2JTZA 1B7TZ 3DVMA 3WHTB 1UP5A 3CS1A 2GTEA 4AOMA 1IQ3A 1AP4A 3PN7C 2KOTA 3A8RA 3BFBA 4OZDA 4YGEB 1K9PA 3FE9A 4I5LB 3GK1A 4WQ3A 4E68A 2FCDA 1BR4B 1DVIA 2KAVA 1NX3A 4YRUA 1R2UA 1CKKA 1A75B 1M45A 2LVIA 2JT0A 2WCBA 4YGAA 1H4BA 3SIAA 1YUTA 3I5GC 3DVJA 1CDMA 1A03A 1KK7Z 1XFZO 4AQJA 1YX8A 1XFXO 1QIVA 4TNCA 1B8LA 1WY9A 1DMOA 3JTDC 4YGDB 2BL0B 3TUYC 1RTP1 1KSOA 1S6CA 3TDUA 3OB2B 3OX6A 5G08A 3OHMB 3DF0B 1NSHA 1IWQA 4QJ5B 1XFUO 4YGBB 1OOHA 2WCJA 2PVBA 2HPSA 5I8NA 1QWVA 1PALA 3CLNA 3RLZA 1TUZA 2LMUA 4M2PA 2JWWA 5I2LA 2TN4A 1K8UA 2WC5A 3S0FA 1JFKA 1NPQA 1BMOA 2KQYA 4DS7A 1K94A 4KYNA 1K9KA 3BQ3A 5I2QA 1B9AA 1DC1A 4ORCB 5CSIA 1ALVA 1LXFC 5HLVA 5HLOA 4CLNA 1CLLA 2LNKA 3TS5C 2BCBA 1K95A 4GPLB 3LK0A 1Y0VH 2M7NA 2MJWB 2PYQA 4ICBA 3FE6A 4USLA 3QMEA 2K61A 5FI7A 1XFYO 2KHNA 3SJSA 1OZSA 5FI6A 2LVKA 2BAPA 3EK7A 4DIRA 5CSFA 4DUQA 2LMVA 2F8PA 3D76A 2L0PA 3B87A 1PVBA 1XA5A 2LM5A 3BJHA 3OX5A 4GGFA 2OS8B 1Y1AA 1MHOA 4GGNA 1DJZA 2KI4B 2K7OA 2LV7A 3VB1A 3D73A 4MZLA 1DGVA 1KFXS 1TCOB 3QRXA 1JBAA 1KFXL 3D74A 2LANA 4PE7A 2HQWA 5F6TA 3DF0A 1QATA 5I94A 2JXLA 4JD9A 1C7WA 1TIZA 1SCMC 1OW4A 2KGRA 3JTDB 3TUYB 2Y4QA 3BUXB 4IJ7A 1KQVA 2BCXA 1NX2A 1GJYA 2H8VA 2BKIB 2JRFA 3BFHA 1KWOC 4MEWA 3CZ0A 2KLDA 4C0KA 3O2PA 2KFFA 4MZKA 1DGUA 1TUJA 1NYAA 2CNPA 3TDZA 3H4SE 4YBHB 1L2OB 1OSAA 3EK4A 2QEVA 2E6WA 2QEOA 2JTTA 3D75A 3PN7B 4ZCUA 3SS3A 4MVFA 3EVUA 2PASA 1TCFA 1BJFA 2H61C 2WCEA 3UO9A 3NHTA 4JQ0D 4A4CA 3FS7A 2KI4C 2EHBA 2LCPA 2BKHB 2LP3A 3KF9A 1TNPA 2SCPA 1IQ5A 1CLMA 2YGUA 1CTRA 1P28A 4P2YB 5ER4X 3S0EA 4NDCA 2KGBC 1DJIA 4PHJA 1S6IA 3BUNB 3PM2A 1TWOA 5AXIA 1OMVA 2CCMA 1PK0D 2LLUA 3SG5A 3DYEA 1UHKA 1NCXA 1J7OA 1UWOA 3JVTC 4OV2A 3F45A 2GV5A 3OBVA 4ORBB 3VRNA 3EKJA 1KFUL 2IS9A 3BXKA 2Y5IA 3O78A 5DKQA 1DJHA 1QX2A 2JT8A 1QX7A 1A75A 2K2FA 4C0JA 2NCPA 5KSZA 2I94A 1XFVO 3S0AA 3VROA 2M29A 3I5HB 2KFHA 3TS5B 2L2EA 1ODBA 1TNWA 2P71A 4I5KA 1EG4A 1HT9A 3IVTA 2HQ8A 3B6XA 1SSEB 5TNCA 1CFPA 1K2HA 1KQMC 1AJ4A 2OPOA 5HYDA 3CR2A 4U8DA 1PSRA 2FJYA 1J7QA 1TN4A 1AUIB 2NLNA 2FJUB 4OR9B 1DQEA 1UHIA 4XJKA 2BECA 1CDNA 2M8UA 3R1VA 1EL4A 1TRFA 2JQ6A 4INWA 4N1GA 2ZN8A 2KYFA 2QACA 1IJ6A 4XJKB 1SYMA 3I5HC 1QJTA 4D1EA 1BR1B 1SL9A 1F8HA 3CABA 1G4YR 1TNXA 4OVNF 2R2IA 1N0YA 4L9MA 1Y1XA 4PHNA 2JULA 2M1KB 3CYZA 1J7PA 2KSPA 2KDHA 5D3OA 1MQ1A 1M39A 5HKWA 1KQMB 2KBIA 3FWCA 1F4QA 3NGVA 1FI6A 1MUXA 2JPTA 1ZMZA 3A4UB 4R1EA 3S0DA 2K2AA 1QV0A 3WNXB 5I2OA 1CLBA 3PALA 1CFFA 2MLFC 4NDDA 1IH0A 2WCHA 2ZFDA 2K7CA 5CSJA 3JVTB 4HSZA 2MBXA 1X02A 2P6BB 3BFAA 2M49B 3BOWA 4MLWA 1SPYA 5FI2A 1S5GZ 3DZTA 3B88A 3SS5A 5CSNA 1YURA 5AANA 1K96A 5DKRA 3PSRA 2CT9A 2ISDA 2LLSA 4JWQA 4MBEA 2L5XB 1RJVA 1NWDA 2M3WA 2WC6A 3DVEA 2Q4UA 2B1UA 4GGFC 1BLQA 3M0WA 1WLZA 2WCMA 4CFQA 1B1GA 4OCIA 2BBNA 2ZRSA 5HL1A 2LHLA 1XYDA 3R72A 1B8CA 1MF8B 2EGDA 5B8IB 1L7ZA 2K0JA 3TDIA 1XK4C 1F70A 3E3RA 1SBJA 1U5IB 3RM1A 1J1DA 3NXAA 3UNWA 3L4LA 5FYXA 2F2OA 1SRAA 1BOCA 3CTNA 1KK8B 1A4PA 2ZNEA 4PALA 2MAZA 1L2OC 1QS7A 3EK8A 4ORAB 3VRQA 2O60A 1IGVA 1E8AA 3D77A 5ER5A 3D0YA 1RROA 4PT1A 1SR6C 2AUCA 1EH2A 4JPZB 1KWOB 2LC5A 3I5IC 1MXLC 3SG2A 1C3YA 4I5NB 4DRWA 1SCMB 1J55A 1S6JA 2WORA 4NQGA 1W7IB 4WQ2A 2HETA 1OMRA 2H61A 2ZKMX 1A29A 4HRGA 3I5FC 1JUOA 2Y1MA 2GGMA 1S3PA 1FF1A 1BT6A 1QIWA 3V2LA 2KNEA 3LK1A 1IJ5A 5BPJA 1SR6B 2ZN9A 2CBLA 3FWBA 1SW8A 3CGAA 4MRYA 3NSIA 2FOTA 5D7FA 1CM4A 2K60A 3SG4A 1QV1A 2G2BA 3VRRA 2MRDA 1AK8A 2M1UA 2JT3A 1DTLA 2L2CA 4DCKA 3FE8A 2Q91A 1EXRA 4PE4A 1SKTA 2Y1NA 2EC6C 2COLB 5D69A 1N65A 3LCPC 1V1FA 5K89A 3EVVA 1PVAA 4PCWA 2K7DA 1DJGA 2GGZA 2AAOA 1GGZA 1S36A 3BYAA 3VRPA 1YX7A 4GUKA 1C7VA 1ORGA 1F4OA 1VRKA 2AMIA 4CFRA 3GK4X 1JF2A 2WCLA 1BODA 1YUSA 2K8MB 2QPTA 3FIAA 4FQTA 4F7FA 1YVHA 4ZCVA 4QJ4B 1LKJA 3SG6A 3C1VA 4BY4A 3MSEB 4UPGA 1XFRA 1CMGA 1T14A 2RGIA 1CFCA 5GQQC 1NCYA 3OP0A 1UUSA 2LUXA 2G9BA 2LAPA 1DJXA 4GNKB 1ZOTB 1WRLA 1YRTB 1C3ZA 1HQVA 1MR8A 1CDLA 1TTXA 3DY9A 1DEKA 3O6BA 5PALA 1XVJA 2F3ZA 2PSRA 1F71A 4A4BA 1OOJA 1SMGA 1TOPA 2LVVA 5AERA 1CB1A 3KEVA 1AJ5A 1DF0A 1QXPA 1KSMA 1QVIY 5HKYA 2L51A 1QLSA 1TNQA 4XYNA 4C0LA 2KAXA 5DICA 1G33A 1OMDA 3OGNA 2LLTA 1C07A 1QLKA 3NSOA 3CZ1A 4FTGA 1XK4A 4MSPA 4GBAA 4PHKA 1WDCB 1LA0A 2KI6C 4Q04A 3OB1B 3DD4A 4MZJA 4YGCB 3AAJA 1KK7Y 2OTGC 3BOWB 1JSAA 2BBMA 2VRGA 4PHMA 5HKZA 3S0GA 1ZACA 1DT7B 1GGWA 4N1FA 5DKNA 1FBVA 2WC8A 3S0BA 3SG3A 1OZOA 1RECA 1ZFSA 3EVRA 1LVCD 1M31A 1OE9B 1SL8A 3D10A 4M2OA 1Z4HA 2OS8C 2L50A 4JKTA 1EJ3A 2K7BA 3BUMB 2HF5A 3CWGA 2KLEA 3HCMA 3RZSA 1F54A 3CDNA 5J3XA 2ZRTA 3BUOB 3LL8B 2MLEC 3WHUB 5KTYA 2O5GA 3CR4X 1WDCC 2JOJA 2M97A 4YI8A 5KU1A 3NHIA 1OOGA 1GQMA 4ETOA 2NZ0A 1MXEA 2BL0C 2KQ6A 2QDIA 1PRWA 1YUUA 1J1EA 2F3YA 3SG7A 1CMFA 1NP8A 3I5IB 1NX0A 3D78A 3I5GB 4MN0A 2I2RE 1Z2CB 1UURA 1OOFA 4GFTA 1ALWA 1YTZC 1LINA 1XFWO 5JOLA 3ZWHA 1CNPA 1M63B 3O4XA 3I5FB 2ZNDA 2BCAA 4PE0A 1WRKA 1DELA 3K21A 3KO0A 2I18A 3NSLA 2H2KA 2A4JA 3IF7A 3SS4A 2LHIA 1QASA 1R6PA 1ZUZA 3L47A 2JPOA 2JZIA 1RK9A 3R1OA 1JWDA 2KFGA 3DVKA 1BF5A 2PALA 1CM1A 1V1GA 1SK6D 1LA3A 1G8IA 1YVLA 2LE9B 3KPXA 1NUBA 1SCVA 3AKBA 4CPVA 4PE1A 3TZ1A 1AVSA 1B8RA 1NCZA 3ICBA 3GOFA 4FQOA 4PDZA 2QEHA 1OQPA 3KHEA 1MWNA 5IBWA 1KCYA 2DOQA 1Q80A 4OKHA 1Y1UA 2SASA 1N2DA 1D1OA 2LP2A 1KK8C 2D8NA 4INXA 1W9ZA 2E30A 3N7HA 2JC2A 4N5XA 5CPVA 2F2PA 3EG5B 1FW4A 1UHJA 1B4CA 2JNFA 3O4YA 1YRUB 3Q8IA 1SNLA 2JU0A 2L4IA 1YR5A 1M46A 1RFJA 2JXCA 3CZ2A 3PFVA 1IIOA 2FCEA 1JF0A 2WCFA 3B86A 1WRZA 2ERBA 1W7JB 2LUCA 1B7TY 2M9GA 1UHNA 2M7LA 2CXJA 1PSBA 2LMTA 1QTXA 5JJGA 3B7AA 1F55A 1JC2A 3EKHA 3NSKA 1B47A 2KPHA 5EL2A 2KYCA 1S26D 3CR5X 2BE4A 1SL7A 3HX4A 4I5JA 1A2XA 1AHRA 3K1EA 1WLMA 2KBMA 2L4HA 2M0RA 3BUWB
chains in the Genus database with same CATH topology
2KI6D 2KAYA 1K90D 1NX1A 3D0YB 4AQIA 1S5GY 2CTNA 3AKAA 4BY5A 2MHHA 1RWYA 1H8BA 1UHHA 2L98A 2JNXA 3CZTX 1K9UA 1DF0B 3IQQA 1U5IA 4WRIA 4IL1A 4P5OE 1EG3A 1Y6WA 2V53A 4MRXA 3VGOA 1DJYA 1K93D 1PULA 1XO5A 4GAOA 1BU3A 4F0ZB 4HRHA 4HREE 2EC6B 2PMYA 2WOSA 2WNDA 3WXAA 1FPWA 4NDBA 5AEQA 1FI5A 1DJWA 1NIWA 2BE6A 2I7AA 1BG1A 3IQOA 1JFJA 4CIDA 1CDPA 4M2QA 2F33A 1CFDA 2MA2A 3PLFB 3LLEA 1KFUS 3PATA 2PRUA 1QX5B 1J7RA 3GK2A 2LVJA 1IG5A 3PM8A 3SIBA 1S1EA 4YI9A 3AAKA 1IRJA 1QVIZ 2NCOA 5AFPA 2OTGB 4QJ3B 2NXQA 1IKUA 3ZNIA 1SY9A 2JTZA 1B7TZ 3DVMA 3WHTB 1UP5A 3CS1A 4AOMA 1IQ3A 1AP4A 3PN7C 2KOTA 3A8RA 4YGEB 1K9PA 4I5LB 3GK1A 4WQ3A 4E68A 2FCDA 1BR4B 1DVIA 2KAVA 1NX3A 4YRUA 1R2UA 1CKKA 1A75B 1M45A 2LVIA 2JT0A 2WCBA 4YGAA 1H4BA 3SIAA 1YUTA 3I5GC 3DVJA 1CDMA 1A03A 1KK7Z 1XFZO 4AQJA 1YX8A 1XFXO 1QIVA 4TNCA 1B8LA 1WY9A 1DMOA 3JTDC 4YGDB 2BL0B 3TUYC 1RTP1 1KSOA 1S6CA 3TDUA 3OB2B 3OX6A 5G08A 3OHMB 3DF0B 1NSHA 1IWQA 4QJ5B 1XFUO 4YGBB 2PVBA 2HPSA 5I8NA 1PALA 3CLNA 3RLZA 2LMUA 4M2PA 2JWWA 5I2LA 2TN4A 1K8UA 1JFKA 1NPQA 1BMOA 2KQYA 4DS7A 1K94A 1K9KA 3BQ3A 5I2QA 1B9AA 4ORCB 5CSIA 1ALVA 1LXFC 5HLVA 5HLOA 4CLNA 1CLLA 2LNKA 3TS5C 2BCBA 1K95A 4GPLB 3LK0A 1Y0VH 2M7NA 2MJWB 4ICBA 4USLA 2K61A 3SJSA 1XFYO 2KHNA 1OZSA 2LVKA 3EK7A 4DIRA 5CSFA 4DUQA 2LMVA 2F8PA 2L0PA 1PVBA 1XA5A 2LM5A 3OX5A 4GGFA 2OS8B 1Y1AA 1MHOA 4GGNA 1DJZA 2KI4B 2K7OA 2LV7A 4MZLA 1DGVA 1KFXS 1TCOB 3QRXA 1JBAA 1KFXL 2LANA 4PE7A 2HQWA 5F6TA 3DF0A 1QATA 2JXLA 1C7WA 1TIZA 1SCMC 2KGRA 3JTDB 3TUYB 1KQVA 2Y4QA 3BUXB 2BCXA 1NX2A 1GJYA 4MEWA 2BKIB 2JRFA 1KWOC 4C0KA 3O2PA 2KFFA 4MZKA 1DGUA 1NYAA 2CNPA 3TDZA 3H4SE 4YBHB 1L2OB 1OSAA 3EK4A 2E6WA 3PN7B 2JTTA 4ZCUA 4MVFA 3EVUA 2PASA 1TCFA 1BJFA 2H61C 2WCEA 4JQ0D 4A4CA 3FS7A 2KI4C 2EHBA 2LCPA 2BKHB 2LP3A 3KF9A 1TNPA 2SCPA 1IQ5A 1CLMA 1CTRA 4P2YB 5ER4X 4NDCA 2KGBC 1DJIA 4PHJA 1S6IA 3BUNB 5AXIA 1OMVA 2CCMA 1PK0D 2LLUA 3SG5A 1UHKA 1NCXA 1J7OA 1UWOA 3JVTC 4OV2A 3F45A 2GV5A 4ORBB 3VRNA 3EKJA 1KFUL 2IS9A 3BXKA 2Y5IA 3O78A 5DKQA 1DJHA 1QX2A 2JT8A 1QX7A 1A75A 2K2FA 4C0JA 2NCPA 5KSZA 2I94A 1XFVO 3VROA 2M29A 3I5HB 2KFHA 3TS5B 2L2EA 1ODBA 1TNWA 4I5KA 1EG4A 1HT9A 2HQ8A 5TNCA 1CFPA 1K2HA 1KQMC 1AJ4A 2OPOA 5HYDA 3CR2A 4U8DA 1PSRA 1J7QA 1TN4A 1AUIB 2NLNA 2FJUB 4OR9B 1UHIA 4XJKA 2BECA 1CDNA 2M8UA 1EL4A 1TRFA 2JQ6A 4N1GA 2ZN8A 2KYFA 2QACA 1IJ6A 4XJKB 1SYMA 3I5HC 1QJTA 4D1EA 1BR1B 1SL9A 1F8HA 1G4YR 1TNXA 4OVNF 2R2IA 1N0YA 4L9MA 1Y1XA 4PHNA 2JULA 2M1KB 1J7PA 2KSPA 2KDHA 1MQ1A 1M39A 5HKWA 1KQMB 2KBIA 3FWCA 1F4QA 1FI6A 1MUXA 2JPTA 1ZMZA 3A4UB 4R1EA 5I2OA 2K2AA 1QV0A 3WNXB 1CLBA 3PALA 1CFFA 2MLFC 4NDDA 1IH0A 5CSJA 2ZFDA 2K7CA 3JVTB 4HSZA 2MBXA 1X02A 2P6BB 3BOWA 2M49B 4MLWA 1SPYA 1S5GZ 5CSNA 1YURA 5AANA 1K96A 5DKRA 3PSRA 2CT9A 2ISDA 2LLSA 4JWQA 4MBEA 2L5XB 1RJVA 1NWDA 2M3WA 3DVEA 2Q4UA 2B1UA 4GGFC 1BLQA 3M0WA 1WLZA 4CFQA 1B1GA 4OCIA 2BBNA 2ZRSA 2LHLA 1XYDA 1B8CA 1MF8B 2EGDA 5B8IB 1L7ZA 2K0JA 3TDIA 1XK4C 1F70A 3E3RA 1SBJA 1U5IB 3RM1A 1J1DA 3NXAA 5FYXA 2F2OA 1SRAA 1BOCA 3CTNA 1KK8B 1A4PA 2ZNEA 4PALA 2MAZA 1L2OC 1QS7A 3EK8A 4ORAB 3VRQA 2O60A 1IGVA 1E8AA 5ER5A 3D0YA 1RROA 1SR6C 2AUCA 1EH2A 4JPZB 1KWOB 2LC5A 3I5IC 1MXLC 3SG2A 4I5NB 4DRWA 1SCMB 1J55A 1S6JA 2WORA 4NQGA 1W7IB 4WQ2A 2HETA 1OMRA 2H61A 2ZKMX 1A29A 4HRGA 3I5FC 1JUOA 2Y1MA 2GGMA 1S3PA 1FF1A 1BT6A 1QIWA 2KNEA 3LK1A 1IJ5A 5BPJA 1SR6B 2ZN9A 2CBLA 3FWBA 1SW8A 3CGAA 4MRYA 3NSIA 2FOTA 5D7FA 1CM4A 3SG4A 3VRRA 1QV1A 2G2BA 1AK8A 2MRDA 2M1UA 2JT3A 1DTLA 4DCKA 2Q91A 1EXRA 4PE4A 1SKTA 2Y1NA 2EC6C 2COLB 5D69A 1N65A 3LCPC 1V1FA 5K89A 3EVVA 1PVAA 4PCWA 2K7DA 1DJGA 2GGZA 2AAOA 1GGZA 1S36A 3BYAA 3VRPA 1YX7A 4GUKA 1C7VA 1F4OA 1VRKA 2AMIA 4CFRA 3GK4X 1JF2A 1BODA 1YUSA 2K8MB 2QPTA 3FIAA 4QJ4B 1YVHA 4ZCVA 1LKJA 3SG6A 3C1VA 4BY4A 3MSEB 4UPGA 1CMGA 2RGIA 1CFCA 5GQQC 1NCYA 3OP0A 1UUSA 2LUXA 2G9BA 2LAPA 1DJXA 4GNKB 1WRLA 1YRTB 1ZOTB 1HQVA 1MR8A 1CDLA 1TTXA 5PALA 3O6BA 1XVJA 2F3ZA 2PSRA 1F71A 4A4BA 1OOJA 1SMGA 1TOPA 2LVVA 5AERA 1CB1A 3KEVA 1AJ5A 1DF0A 1QXPA 1KSMA 1QVIY 5HKYA 2L51A 1QLSA 1TNQA 4XYNA 4C0LA 2KAXA 1G33A 1OMDA 2LLTA 1C07A 1QLKA 3NSOA 4FTGA 1XK4A 4MSPA 4GBAA 4PHKA 1WDCB 1LA0A 2KI6C 4Q04A 3OB1B 3DD4A 4MZJA 4YGCB 3AAJA 1KK7Y 2OTGC 3BOWB 1JSAA 2BBMA 2VRGA 4PHMA 5HKZA 1DT7B 1ZACA 1GGWA 4N1FA 5DKNA 1FBVA 2WC8A 3SG3A 1OZOA 1RECA 1ZFSA 3EVRA 1LVCD 1M31A 1OE9B 1SL8A 3D10A 4M2OA 2OS8C 2L50A 1EJ3A 2K7BA 3BUMB 2HF5A 3CWGA 3HCMA 1F54A 5J3XA 2ZRTA 3BUOB 3LL8B 2MLEC 3WHUB 5KTYA 2O5GA 3CR4X 1WDCC 2JOJA 2M97A 4YI8A 5KU1A 1GQMA 4ETOA 2NZ0A 1MXEA 2BL0C 2KQ6A 1PRWA 1YUUA 1J1EA 2F3YA 3SG7A 1CMFA 1NP8A 3I5IB 1NX0A 3I5GB 4MN0A 2I2RE 1UURA 4GFTA 1ALWA 1YTZC 1LINA 1XFWO 5JOLA 3ZWHA 1CNPA 1M63B 3I5FB 2ZNDA 2BCAA 4PE0A 1WRKA 3K21A 3KO0A 2I18A 3NSLA 2H2KA 2A4JA 3IF7A 2LHIA 1QASA 1R6PA 1ZUZA 2JZIA 1RK9A 1JWDA 2KFGA 3DVKA 1BF5A 2PALA 1CM1A 1V1GA 1SK6D 1LA3A 1G8IA 1YVLA 2LE9B 3KPXA 1NUBA 1SCVA 3AKBA 4CPVA 4PE1A 3TZ1A 1AVSA 1B8RA 1NCZA 3ICBA 3GOFA 4FQOA 4PDZA 1OQPA 3KHEA 1MWNA 5IBWA 1KCYA 2DOQA 1Q80A 4OKHA 1Y1UA 2SASA 1N2DA 1D1OA 2LP2A 1KK8C 2D8NA 2E30A 2JC2A 4N5XA 5CPVA 2F2PA 1FW4A 1UHJA 1B4CA 2JNFA 3O4YA 1YRUB 1SNLA 2JU0A 2L4IA 1YR5A 1M46A 1RFJA 2JXCA 3PFVA 2FCEA 1JF0A 2WCFA 1WRZA 2LUCA 1W7JB 1B7TY 2M9GA 1UHNA 2M7LA 2CXJA 1PSBA 2LMTA 1QTXA 5JJGA 1F55A 1JC2A 3EKHA 3NSKA 1B47A 2KYCA 1S26D 3CR5X 2BE4A 1SL7A 3HX4A 4I5JA 1A2XA 1AHRA 1WLMA 2KBMA 2L4HA 2M0RA 3BUWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI6 D;  2KAY A;  1K90 D;  1NX1 A;  3D0Y B;  4AQI A;  1S5G Y;  2CTN A;  3AKA A;  4BY5 A;  2MHH A;  1RWY A;  1H8B A;  1UHH A;  2L98 A;  2JNX A;  3CZT X;  1K9U A;  1DF0 B;  3IQQ A;  1U5I A;  4WRI A;  4IL1 A;  4P5O E;  1EG3 A;  1Y6W A;  2V53 A;  4MRX A;  3VGO A;  1DJY A;  1K93 D;  1PUL A;  1XO5 A;  4GAO A;  1BU3 A;  4F0Z B;  4HRH A;  4HRE E;  2EC6 B;  2PMY A;  2WOS A;  2WND A;  3WXA A;  1FPW A;  4NDB A;  5AEQ A;  1FI5 A;  1DJW A;  1NIW A;  2BE6 A;  2I7A A;  1BG1 A;  3IQO A;  1JFJ A;  4CID A;  1CDP A;  4M2Q A;  2F33 A;  1CFD A;  2MA2 A;  3PLF B;  3LLE A;  1KFU S;  3PAT A;  2PRU A;  1QX5 B;  1J7R A;  3GK2 A;  2LVJ A;  1IG5 A;  3PM8 A;  3SIB A;  1S1E A;  4YI9 A;  3AAK A;  1IRJ A;  1QVI Z;  2NCO A;  5AFP A;  2OTG B;  4QJ3 B;  2NXQ A;  1IKU A;  3ZNI A;  1SY9 A;  2JTZ A;  1B7T Z;  3DVM A;  3WHT B;  1UP5 A;  3CS1 A;  4AOM A;  1IQ3 A;  1AP4 A;  3PN7 C;  2KOT A;  3A8R A;  4YGE B;  1K9P A;  4I5L B;  3GK1 A;  4WQ3 A;  4E68 A;  2FCD A;  1BR4 B;  1DVI A;  2KAV A;  1NX3 A;  4YRU A;  1R2U A;  1CKK A;  1A75 B;  1M45 A;  2LVI A;  2JT0 A;  2WCB A;  4YGA A;  1H4B A;  3SIA A;  1YUT A;  3I5G C;  3DVJ A;  1CDM A;  1A03 A;  1KK7 Z;  1XFZ O;  4AQJ A;  1YX8 A;  1XFX O;  1QIV A;  4TNC A;  1B8L A;  1WY9 A;  1DMO A;  3JTD C;  4YGD B;  2BL0 B;  3TUY C;  1RTP 1;  1KSO A;  1S6C A;  3TDU A;  3OB2 B;  3OX6 A;  5G08 A;  3OHM B;  3DF0 B;  1NSH A;  1IWQ A;  4QJ5 B;  1XFU O;  4YGB B;  2PVB A;  2HPS A;  5I8N A;  1PAL A;  3CLN A;  3RLZ A;  2LMU A;  4M2P A;  2JWW A;  5I2L A;  2TN4 A;  1K8U A;  1JFK A;  1NPQ A;  1BMO A;  2KQY A;  4DS7 A;  1K94 A;  1K9K A;  3BQ3 A;  5I2Q A;  1B9A A;  4ORC B;  5CSI A;  1ALV A;  1LXF C;  5HLV A;  5HLO A;  4CLN A;  1CLL A;  2LNK A;  3TS5 C;  2BCB A;  1K95 A;  4GPL B;  3LK0 A;  1Y0V H;  2M7N A;  2MJW B;  4ICB A;  4USL A;  2K61 A;  3SJS A;  1XFY O;  2KHN A;  1OZS A;  2LVK A;  3EK7 A;  4DIR A;  5CSF A;  4DUQ A;  2LMV A;  2F8P A;  2L0P A;  1PVB A;  1XA5 A;  2LM5 A;  3OX5 A;  4GGF A;  2OS8 B;  1Y1A A;  1MHO A;  4GGN A;  1DJZ A;  2KI4 B;  2K7O A;  2LV7 A;  4MZL A;  1DGV A;  1KFX S;  1TCO B;  3QRX A;  1JBA A;  1KFX L;  2LAN A;  4PE7 A;  2HQW A;  5F6T A;  3DF0 A;  1QAT A;  2JXL A;  1C7W A;  1TIZ A;  1SCM C;  2KGR A;  3JTD B;  3TUY B;  1KQV A;  2Y4Q A;  3BUX B;  2BCX A;  1NX2 A;  1GJY A;  4MEW A;  2BKI B;  2JRF A;  1KWO C;  4C0K A;  3O2P A;  2KFF A;  4MZK A;  1DGU A;  1NYA A;  2CNP A;  3TDZ A;  3H4S E;  4YBH B;  1L2O B;  1OSA A;  3EK4 A;  2E6W A;  3PN7 B;  2JTT A;  4ZCU A;  4MVF A;  3EVU A;  2PAS A;  1TCF A;  1BJF A;  2H61 C;  2WCE A;  4JQ0 D;  4A4C A;  3FS7 A;  2KI4 C;  2EHB A;  2LCP A;  2BKH B;  2LP3 A;  3KF9 A;  1TNP A;  2SCP A;  1IQ5 A;  1CLM A;  1CTR A;  4P2Y B;  5ER4 X;  4NDC A;  2KGB C;  1DJI A;  4PHJ A;  1S6I A;  3BUN B;  5AXI A;  1OMV A;  2CCM A;  1PK0 D;  2LLU A;  3SG5 A;  1UHK A;  1NCX A;  1J7O A;  1UWO A;  3JVT C;  4OV2 A;  3F45 A;  2GV5 A;  4ORB B;  3VRN A;  3EKJ A;  1KFU L;  2IS9 A;  3BXK A;  2Y5I A;  3O78 A;  5DKQ A;  1DJH A;  1QX2 A;  2JT8 A;  1QX7 A;  1A75 A;  2K2F A;  4C0J A;  2NCP A;  5KSZ A;  2I94 A;  1XFV O;  3VRO A;  2M29 A;  3I5H B;  2KFH A;  3TS5 B;  2L2E A;  1ODB A;  1TNW A;  4I5K A;  1EG4 A;  1HT9 A;  2HQ8 A;  5TNC A;  1CFP A;  1K2H A;  1KQM C;  1AJ4 A;  2OPO A;  5HYD A;  3CR2 A;  4U8D A;  1PSR A;  1J7Q A;  1TN4 A;  1AUI B;  2NLN A;  2FJU B;  4OR9 B;  1UHI A;  4XJK A;  2BEC A;  1CDN A;  2M8U A;  1EL4 A;  1TRF A;  2JQ6 A;  4N1G A;  2ZN8 A;  2KYF A;  2QAC A;  1IJ6 A;  4XJK B;  1SYM A;  3I5H C;  1QJT A;  4D1E A;  1BR1 B;  1SL9 A;  1F8H A;  1G4Y R;  1TNX A;  4OVN F;  2R2I A;  1N0Y A;  4L9M A;  1Y1X A;  4PHN A;  2JUL A;  2M1K B;  1J7P A;  2KSP A;  2KDH A;  1MQ1 A;  1M39 A;  5HKW A;  1KQM B;  2KBI A;  3FWC A;  1F4Q A;  1FI6 A;  1MUX A;  2JPT A;  1ZMZ A;  3A4U B;  4R1E A;  5I2O A;  2K2A A;  1QV0 A;  3WNX B;  1CLB A;  3PAL A;  1CFF A;  2MLF C;  4NDD A;  1IH0 A;  5CSJ A;  2ZFD A;  2K7C A;  3JVT B;  4HSZ A;  2MBX A;  1X02 A;  2P6B B;  3BOW A;  2M49 B;  4MLW A;  1SPY A;  1S5G Z;  5CSN A;  1YUR A;  5AAN A;  1K96 A;  5DKR A;  3PSR A;  2CT9 A;  2ISD A;  2LLS A;  4JWQ A;  4MBE A;  2L5X B;  1RJV A;  1NWD A;  2M3W A;  3DVE A;  2Q4U A;  2B1U A;  4GGF C;  1BLQ A;  3M0W A;  1WLZ A;  4CFQ A;  1B1G A;  4OCI A;  2BBN A;  2ZRS A;  2LHL A;  1XYD A;  1B8C A;  1MF8 B;  2EGD A;  5B8I B;  1L7Z A;  2K0J A;  3TDI A;  1XK4 C;  1F70 A;  3E3R A;  1SBJ A;  1U5I B;  3RM1 A;  1J1D A;  3NXA A;  5FYX A;  2F2O A;  1SRA A;  1BOC A;  3CTN A;  1KK8 B;  1A4P A;  2ZNE A;  4PAL A;  2MAZ A;  1L2O C;  1QS7 A;  3EK8 A;  4ORA B;  3VRQ A;  2O60 A;  1IGV A;  1E8A A;  5ER5 A;  3D0Y A;  1RRO A;  1SR6 C;  2AUC A;  1EH2 A;  4JPZ B;  1KWO B;  2LC5 A;  3I5I C;  1MXL C;  3SG2 A;  4I5N B;  4DRW A;  1SCM B;  1J55 A;  1S6J A;  2WOR A;  4NQG A;  1W7I B;  4WQ2 A;  2HET A;  1OMR A;  2H61 A;  2ZKM X;  1A29 A;  4HRG A;  3I5F C;  1JUO A;  2Y1M A;  2GGM A;  1S3P A;  1FF1 A;  1BT6 A;  1QIW A;  2KNE A;  3LK1 A;  1IJ5 A;  5BPJ A;  1SR6 B;  2ZN9 A;  2CBL A;  3FWB A;  1SW8 A;  3CGA A;  4MRY A;  3NSI A;  2FOT A;  5D7F A;  1CM4 A;  3SG4 A;  3VRR A;  1QV1 A;  2G2B A;  1AK8 A;  2MRD A;  2M1U A;  2JT3 A;  1DTL A;  4DCK A;  2Q91 A;  1EXR A;  4PE4 A;  1SKT A;  2Y1N A;  2EC6 C;  2COL B;  5D69 A;  1N65 A;  3LCP C;  1V1F A;  5K89 A;  3EVV A;  1PVA A;  4PCW A;  2K7D A;  1DJG A;  2GGZ A;  2AAO A;  1GGZ A;  1S36 A;  3BYA A;  3VRP A;  1YX7 A;  4GUK A;  1C7V A;  1F4O A;  1VRK A;  2AMI A;  4CFR A;  3GK4 X;  1JF2 A;  1BOD A;  1YUS A;  2K8M B;  2QPT A;  3FIA A;  4QJ4 B;  1YVH A;  4ZCV A;  1LKJ A;  3SG6 A;  3C1V A;  4BY4 A;  3MSE B;  4UPG A;  1CMG A;  2RGI A;  1CFC A;  5GQQ C;  1NCY A;  3OP0 A;  1UUS A;  2LUX A;  2G9B A;  2LAP A;  1DJX A;  4GNK B;  1WRL A;  1YRT B;  1ZOT B;  1HQV A;  1MR8 A;  1CDL A;  1TTX A;  5PAL A;  3O6B A;  1XVJ A;  2F3Z A;  2PSR A;  1F71 A;  4A4B A;  1OOJ A;  1SMG A;  1TOP A;  2LVV A;  5AER A;  1CB1 A;  3KEV A;  1AJ5 A;  1DF0 A;  1QXP A;  1KSM A;  1QVI Y;  5HKY A;  2L51 A;  1QLS A;  1TNQ A;  4XYN A;  4C0L A;  2KAX A;  1G33 A;  1OMD A;  2LLT A;  1C07 A;  1QLK A;  3NSO A;  4FTG A;  1XK4 A;  4MSP A;  4GBA A;  4PHK A;  1WDC B;  1LA0 A;  2KI6 C;  4Q04 A;  3OB1 B;  3DD4 A;  4MZJ A;  4YGC B;  3AAJ A;  1KK7 Y;  2OTG C;  3BOW B;  1JSA A;  2BBM A;  2VRG A;  4PHM A;  5HKZ A;  1DT7 B;  1ZAC A;  1GGW A;  4N1F A;  5DKN A;  1FBV A;  2WC8 A;  3SG3 A;  1OZO A;  1REC A;  1ZFS A;  3EVR A;  1LVC D;  1M31 A;  1OE9 B;  1SL8 A;  3D10 A;  4M2O A;  2OS8 C;  2L50 A;  1EJ3 A;  2K7B A;  3BUM B;  2HF5 A;  3CWG A;  3HCM A;  1F54 A;  5J3X A;  2ZRT A;  3BUO B;  3LL8 B;  2MLE C;  3WHU B;  5KTY A;  2O5G A;  3CR4 X;  1WDC C;  2JOJ A;  2M97 A;  4YI8 A;  5KU1 A;  1GQM A;  4ETO A;  2NZ0 A;  1MXE A;  2BL0 C;  2KQ6 A;  1PRW A;  1YUU A;  1J1E A;  2F3Y A;  3SG7 A;  1CMF A;  1NP8 A;  3I5I B;  1NX0 A;  3I5G B;  4MN0 A;  2I2R E;  1UUR A;  4GFT A;  1ALW A;  1YTZ C;  1LIN A;  1XFW O;  5JOL A;  3ZWH A;  1CNP A;  1M63 B;  3I5F B;  2ZND A;  2BCA A;  4PE0 A;  1WRK A;  3K21 A;  3KO0 A;  2I18 A;  3NSL A;  2H2K A;  2A4J A;  3IF7 A;  2LHI A;  1QAS A;  1R6P A;  1ZUZ A;  2JZI A;  1RK9 A;  1JWD A;  2KFG A;  3DVK A;  1BF5 A;  2PAL A;  1CM1 A;  1V1G A;  1SK6 D;  1LA3 A;  1G8I A;  1YVL A;  2LE9 B;  3KPX A;  1NUB A;  1SCV A;  3AKB A;  4CPV A;  4PE1 A;  3TZ1 A;  1AVS A;  1B8R A;  1NCZ A;  3ICB A;  3GOF A;  4FQO A;  4PDZ A;  1OQP A;  3KHE A;  1MWN A;  5IBW A;  1KCY A;  2DOQ A;  1Q80 A;  4OKH A;  1Y1U A;  2SAS A;  1N2D A;  1D1O A;  2LP2 A;  1KK8 C;  2D8N A;  2E30 A;  2JC2 A;  4N5X A;  5CPV A;  2F2P A;  1FW4 A;  1UHJ A;  1B4C A;  2JNF A;  3O4Y A;  1YRU B;  1SNL A;  2JU0 A;  2L4I A;  1YR5 A;  1M46 A;  1RFJ A;  2JXC A;  3PFV A;  2FCE A;  1JF0 A;  2WCF A;  1WRZ A;  2LUC A;  1W7J B;  1B7T Y;  2M9G A;  1UHN A;  2M7L A;  2CXJ A;  1PSB A;  2LMT A;  1QTX A;  5JJG A;  1F55 A;  1JC2 A;  3EKH A;  3NSK A;  1B47 A;  2KYC A;  1S26 D;  3CR5 X;  2BE4 A;  1SL7 A;  3HX4 A;  4I5J A;  1A2X A;  1AHR A;  1WLM A;  2KBM A;  2L4H A;  2M0R A;  3BUW B; 
#chains in the Genus database with same CATH topology
 2KI6 D;  2KAY A;  1K90 D;  1NX1 A;  3D0Y B;  3R1P A;  4AQI A;  1S5G Y;  2CTN A;  2WCK A;  3AKA A;  4BY5 A;  2MHH A;  1RWY A;  1H8B A;  1UHH A;  2L98 A;  2JNX A;  3L4A A;  3DXL A;  3CZT X;  1K9U A;  1DF0 B;  3IQQ A;  1U5I A;  4WRI A;  4IL1 A;  4P5O E;  1EG3 A;  1Y6W A;  2QEB A;  2V53 A;  3PJI A;  4MRX A;  3VGO A;  1DJY A;  1K93 D;  1PUL A;  1XO5 A;  2PQL A;  4GAO A;  1BU3 A;  4F0Z B;  4HRH A;  4HRE E;  2EC6 B;  2PMY A;  2WOS A;  2L5Y A;  2WND A;  3WXA A;  2BNX A;  1FPW A;  4NDB A;  5AEQ A;  1LS8 A;  1DJW A;  1FI5 A;  1GM0 A;  1NIW A;  2BE6 A;  2I7A A;  1BG1 A;  3IQO A;  1JFJ A;  4CID A;  1CDP A;  1OOI X;  4M2Q A;  2F33 A;  1CFD A;  2MA2 A;  3PLF B;  3LLE A;  1KFU S;  3PAT A;  2PRU A;  1QX5 B;  1J7R A;  3GK2 A;  2LVJ A;  1IG5 A;  3PM8 A;  3SIB A;  1S1E A;  4YI9 A;  3AAK A;  1IRJ A;  1QVI Z;  2NCO A;  2P70 A;  5AFP A;  2OTG B;  4QJ3 B;  2NXQ A;  1IKU A;  3ZNI A;  1SY9 A;  2JTZ A;  1B7T Z;  3DVM A;  3WHT B;  1UP5 A;  3CS1 A;  2GTE A;  4AOM A;  1IQ3 A;  1AP4 A;  3PN7 C;  2KOT A;  3A8R A;  3BFB A;  4OZD A;  4YGE B;  1K9P A;  3FE9 A;  4I5L B;  3GK1 A;  4WQ3 A;  4E68 A;  2FCD A;  1BR4 B;  1DVI A;  2KAV A;  1NX3 A;  4YRU A;  1R2U A;  1CKK A;  1A75 B;  1M45 A;  2LVI A;  2JT0 A;  2WCB A;  4YGA A;  1H4B A;  3SIA A;  1YUT A;  3I5G C;  3DVJ A;  1CDM A;  1A03 A;  1KK7 Z;  1XFZ O;  4AQJ A;  1YX8 A;  1XFX O;  1QIV A;  4TNC A;  1B8L A;  1WY9 A;  1DMO A;  3JTD C;  4YGD B;  2BL0 B;  3TUY C;  1RTP 1;  1KSO A;  1S6C A;  3TDU A;  3OB2 B;  3OX6 A;  5G08 A;  3OHM B;  3DF0 B;  1NSH A;  1IWQ A;  4QJ5 B;  1XFU O;  4YGB B;  1OOH A;  2WCJ A;  2PVB A;  2HPS A;  5I8N A;  1QWV A;  1PAL A;  3CLN A;  3RLZ A;  1TUZ A;  2LMU A;  4M2P A;  2JWW A;  5I2L A;  2TN4 A;  1K8U A;  2WC5 A;  3S0F A;  1JFK A;  1NPQ A;  1BMO A;  2KQY A;  4DS7 A;  1K94 A;  4KYN A;  1K9K A;  3BQ3 A;  5I2Q A;  1B9A A;  1DC1 A;  4ORC B;  5CSI A;  1ALV A;  1LXF C;  5HLV A;  5HLO A;  4CLN A;  1CLL A;  2LNK A;  3TS5 C;  2BCB A;  1K95 A;  4GPL B;  3LK0 A;  1Y0V H;  2M7N A;  2MJW B;  2PYQ A;  4ICB A;  3FE6 A;  4USL A;  3QME A;  2K61 A;  5FI7 A;  1XFY O;  2KHN A;  3SJS A;  1OZS A;  5FI6 A;  2LVK A;  2BAP A;  3EK7 A;  4DIR A;  5CSF A;  4DUQ A;  2LMV A;  2F8P A;  3D76 A;  2L0P A;  3B87 A;  1PVB A;  1XA5 A;  2LM5 A;  3BJH A;  3OX5 A;  4GGF A;  2OS8 B;  1Y1A A;  1MHO A;  4GGN A;  1DJZ A;  2KI4 B;  2K7O A;  2LV7 A;  3VB1 A;  3D73 A;  4MZL A;  1DGV A;  1KFX S;  1TCO B;  3QRX A;  1JBA A;  1KFX L;  3D74 A;  2LAN A;  4PE7 A;  2HQW A;  5F6T A;  3DF0 A;  1QAT A;  5I94 A;  2JXL A;  4JD9 A;  1C7W A;  1TIZ A;  1SCM C;  1OW4 A;  2KGR A;  3JTD B;  3TUY B;  2Y4Q A;  3BUX B;  4IJ7 A;  1KQV A;  2BCX A;  1NX2 A;  1GJY A;  2H8V A;  2BKI B;  2JRF A;  3BFH A;  1KWO C;  4MEW A;  3CZ0 A;  2KLD A;  4C0K A;  3O2P A;  2KFF A;  4MZK A;  1DGU A;  1TUJ A;  1NYA A;  2CNP A;  3TDZ A;  3H4S E;  4YBH B;  1L2O B;  1OSA A;  3EK4 A;  2QEV A;  2E6W A;  2QEO A;  2JTT A;  3D75 A;  3PN7 B;  4ZCU A;  3SS3 A;  4MVF A;  3EVU A;  2PAS A;  1TCF A;  1BJF A;  2H61 C;  2WCE A;  3UO9 A;  3NHT A;  4JQ0 D;  4A4C A;  3FS7 A;  2KI4 C;  2EHB A;  2LCP A;  2BKH B;  2LP3 A;  3KF9 A;  1TNP A;  2SCP A;  1IQ5 A;  1CLM A;  2YGU A;  1CTR A;  1P28 A;  4P2Y B;  5ER4 X;  3S0E A;  4NDC A;  2KGB C;  1DJI A;  4PHJ A;  1S6I A;  3BUN B;  3PM2 A;  1TWO A;  5AXI A;  1OMV A;  2CCM A;  1PK0 D;  2LLU A;  3SG5 A;  3DYE A;  1UHK A;  1NCX A;  1J7O A;  1UWO A;  3JVT C;  4OV2 A;  3F45 A;  2GV5 A;  3OBV A;  4ORB B;  3VRN A;  3EKJ A;  1KFU L;  2IS9 A;  3BXK A;  2Y5I A;  3O78 A;  5DKQ A;  1DJH A;  1QX2 A;  2JT8 A;  1QX7 A;  1A75 A;  2K2F A;  4C0J A;  2NCP A;  5KSZ A;  2I94 A;  1XFV O;  3S0A A;  3VRO A;  2M29 A;  3I5H B;  2KFH A;  3TS5 B;  2L2E A;  1ODB A;  1TNW A;  2P71 A;  4I5K A;  1EG4 A;  1HT9 A;  3IVT A;  2HQ8 A;  3B6X A;  1SSE B;  5TNC A;  1CFP A;  1K2H A;  1KQM C;  1AJ4 A;  2OPO A;  5HYD A;  3CR2 A;  4U8D A;  1PSR A;  2FJY A;  1J7Q A;  1TN4 A;  1AUI B;  2NLN A;  2FJU B;  4OR9 B;  1DQE A;  1UHI A;  4XJK A;  2BEC A;  1CDN A;  2M8U A;  3R1V A;  1EL4 A;  1TRF A;  2JQ6 A;  4INW A;  4N1G A;  2ZN8 A;  2KYF A;  2QAC A;  1IJ6 A;  4XJK B;  1SYM A;  3I5H C;  1QJT A;  4D1E A;  1BR1 B;  1SL9 A;  1F8H A;  3CAB A;  1G4Y R;  1TNX A;  4OVN F;  2R2I A;  1N0Y A;  4L9M A;  1Y1X A;  4PHN A;  2JUL A;  2M1K B;  3CYZ A;  1J7P A;  2KSP A;  2KDH A;  5D3O A;  1MQ1 A;  1M39 A;  5HKW A;  1KQM B;  2KBI A;  3FWC A;  1F4Q A;  3NGV A;  1FI6 A;  1MUX A;  2JPT A;  1ZMZ A;  3A4U B;  4R1E A;  3S0D A;  2K2A A;  1QV0 A;  3WNX B;  5I2O A;  1CLB A;  3PAL A;  1CFF A;  2MLF C;  4NDD A;  1IH0 A;  2WCH A;  2ZFD A;  2K7C A;  5CSJ A;  3JVT B;  4HSZ A;  2MBX A;  1X02 A;  2P6B B;  3BFA A;  2M49 B;  3BOW A;  4MLW A;  1SPY A;  5FI2 A;  1S5G Z;  3DZT A;  3B88 A;  3SS5 A;  5CSN A;  1YUR A;  5AAN A;  1K96 A;  5DKR A;  3PSR A;  2CT9 A;  2ISD A;  2LLS A;  4JWQ A;  4MBE A;  2L5X B;  1RJV A;  1NWD A;  2M3W A;  2WC6 A;  3DVE A;  2Q4U A;  2B1U A;  4GGF C;  1BLQ A;  3M0W A;  1WLZ A;  2WCM A;  4CFQ A;  1B1G A;  4OCI A;  2BBN A;  2ZRS A;  5HL1 A;  2LHL A;  1XYD A;  3R72 A;  1B8C A;  1MF8 B;  2EGD A;  5B8I B;  1L7Z A;  2K0J A;  3TDI A;  1XK4 C;  1F70 A;  3E3R A;  1SBJ A;  1U5I B;  3RM1 A;  1J1D A;  3NXA A;  3UNW A;  3L4L A;  5FYX A;  2F2O A;  1SRA A;  1BOC A;  3CTN A;  1KK8 B;  1A4P A;  2ZNE A;  4PAL A;  2MAZ A;  1L2O C;  1QS7 A;  3EK8 A;  4ORA B;  3VRQ A;  2O60 A;  1IGV A;  1E8A A;  3D77 A;  5ER5 A;  3D0Y A;  1RRO A;  4PT1 A;  1SR6 C;  2AUC A;  1EH2 A;  4JPZ B;  1KWO B;  2LC5 A;  3I5I C;  1MXL C;  3SG2 A;  1C3Y A;  4I5N B;  4DRW A;  1SCM B;  1J55 A;  1S6J A;  2WOR A;  4NQG A;  1W7I B;  4WQ2 A;  2HET A;  1OMR A;  2H61 A;  2ZKM X;  1A29 A;  4HRG A;  3I5F C;  1JUO A;  2Y1M A;  2GGM A;  1S3P A;  1FF1 A;  1BT6 A;  1QIW A;  3V2L A;  2KNE A;  3LK1 A;  1IJ5 A;  5BPJ A;  1SR6 B;  2ZN9 A;  2CBL A;  3FWB A;  1SW8 A;  3CGA A;  4MRY A;  3NSI A;  2FOT A;  5D7F A;  1CM4 A;  2K60 A;  3SG4 A;  1QV1 A;  2G2B A;  3VRR A;  2MRD A;  1AK8 A;  2M1U A;  2JT3 A;  1DTL A;  2L2C A;  4DCK A;  3FE8 A;  2Q91 A;  1EXR A;  4PE4 A;  1SKT A;  2Y1N A;  2EC6 C;  2COL B;  5D69 A;  1N65 A;  3LCP C;  1V1F A;  5K89 A;  3EVV A;  1PVA A;  4PCW A;  2K7D A;  1DJG A;  2GGZ A;  2AAO A;  1GGZ A;  1S36 A;  3BYA A;  3VRP A;  1YX7 A;  4GUK A;  1C7V A;  1ORG A;  1F4O A;  1VRK A;  2AMI A;  4CFR A;  3GK4 X;  1JF2 A;  2WCL A;  1BOD A;  1YUS A;  2K8M B;  2QPT A;  3FIA A;  4FQT A;  4F7F A;  1YVH A;  4ZCV A;  4QJ4 B;  1LKJ A;  3SG6 A;  3C1V A;  4BY4 A;  3MSE B;  4UPG A;  1XFR A;  1CMG A;  1T14 A;  2RGI A;  1CFC A;  5GQQ C;  1NCY A;  3OP0 A;  1UUS A;  2LUX A;  2G9B A;  2LAP A;  1DJX A;  4GNK B;  1ZOT B;  1WRL A;  1YRT B;  1C3Z A;  1HQV A;  1MR8 A;  1CDL A;  1TTX A;  3DY9 A;  1DEK A;  3O6B A;  5PAL A;  1XVJ A;  2F3Z A;  2PSR A;  1F71 A;  4A4B A;  1OOJ A;  1SMG A;  1TOP A;  2LVV A;  5AER A;  1CB1 A;  3KEV A;  1AJ5 A;  1DF0 A;  1QXP A;  1KSM A;  1QVI Y;  5HKY A;  2L51 A;  1QLS A;  1TNQ A;  4XYN A;  4C0L A;  2KAX A;  5DIC A;  1G33 A;  1OMD A;  3OGN A;  2LLT A;  1C07 A;  1QLK A;  3NSO A;  3CZ1 A;  4FTG A;  1XK4 A;  4MSP A;  4GBA A;  4PHK A;  1WDC B;  1LA0 A;  2KI6 C;  4Q04 A;  3OB1 B;  3DD4 A;  4MZJ A;  4YGC B;  3AAJ A;  1KK7 Y;  2OTG C;  3BOW B;  1JSA A;  2BBM A;  2VRG A;  4PHM A;  5HKZ A;  3S0G A;  1ZAC A;  1DT7 B;  1GGW A;  4N1F A;  5DKN A;  1FBV A;  2WC8 A;  3S0B A;  3SG3 A;  1OZO A;  1REC A;  1ZFS A;  3EVR A;  1LVC D;  1M31 A;  1OE9 B;  1SL8 A;  3D10 A;  4M2O A;  1Z4H A;  2OS8 C;  2L50 A;  4JKT A;  1EJ3 A;  2K7B A;  3BUM B;  2HF5 A;  3CWG A;  2KLE A;  3HCM A;  3RZS A;  1F54 A;  3CDN A;  5J3X A;  2ZRT A;  3BUO B;  3LL8 B;  2MLE C;  3WHU B;  5KTY A;  2O5G A;  3CR4 X;  1WDC C;  2JOJ A;  2M97 A;  4YI8 A;  5KU1 A;  3NHI A;  1OOG A;  1GQM A;  4ETO A;  2NZ0 A;  1MXE A;  2BL0 C;  2KQ6 A;  2QDI A;  1PRW A;  1YUU A;  1J1E A;  2F3Y A;  3SG7 A;  1CMF A;  1NP8 A;  3I5I B;  1NX0 A;  3D78 A;  3I5G B;  4MN0 A;  2I2R E;  1Z2C B;  1UUR A;  1OOF A;  4GFT A;  1ALW A;  1YTZ C;  1LIN A;  1XFW O;  5JOL A;  3ZWH A;  1CNP A;  1M63 B;  3O4X A;  3I5F B;  2ZND A;  2BCA A;  4PE0 A;  1WRK A;  1DEL A;  3K21 A;  3KO0 A;  2I18 A;  3NSL A;  2H2K A;  2A4J A;  3IF7 A;  3SS4 A;  2LHI A;  1QAS A;  1R6P A;  1ZUZ A;  3L47 A;  2JPO A;  2JZI A;  1RK9 A;  3R1O A;  1JWD A;  2KFG A;  3DVK A;  1BF5 A;  2PAL A;  1CM1 A;  1V1G A;  1SK6 D;  1LA3 A;  1G8I A;  1YVL A;  2LE9 B;  3KPX A;  1NUB A;  1SCV A;  3AKB A;  4CPV A;  4PE1 A;  3TZ1 A;  1AVS A;  1B8R A;  1NCZ A;  3ICB A;  3GOF A;  4FQO A;  4PDZ A;  2QEH A;  1OQP A;  3KHE A;  1MWN A;  5IBW A;  1KCY A;  2DOQ A;  1Q80 A;  4OKH A;  1Y1U A;  2SAS A;  1N2D A;  1D1O A;  2LP2 A;  1KK8 C;  2D8N A;  4INX A;  1W9Z A;  2E30 A;  3N7H A;  2JC2 A;  4N5X A;  5CPV A;  2F2P A;  3EG5 B;  1FW4 A;  1UHJ A;  1B4C A;  2JNF A;  3O4Y A;  1YRU B;  3Q8I A;  1SNL A;  2JU0 A;  2L4I A;  1YR5 A;  1M46 A;  1RFJ A;  2JXC A;  3CZ2 A;  3PFV A;  1IIO A;  2FCE A;  1JF0 A;  2WCF A;  3B86 A;  1WRZ A;  2ERB A;  1W7J B;  2LUC A;  1B7T Y;  2M9G A;  1UHN A;  2M7L A;  2CXJ A;  1PSB A;  2LMT A;  1QTX A;  5JJG A;  3B7A A;  1F55 A;  1JC2 A;  3EKH A;  3NSK A;  1B47 A;  2KPH A;  5EL2 A;  2KYC A;  1S26 D;  3CR5 X;  2BE4 A;  1SL7 A;  3HX4 A;  4I5J A;  1A2X A;  1AHR A;  3K1E A;  1WLM A;  2KBM A;  2L4H A;  2M0R A;  3BUW B; 
#chains in the Genus database with same CATH homology
 2KI6 D;  2KAY A;  1K90 D;  1NX1 A;  3D0Y B;  4AQI A;  1S5G Y;  2CTN A;  3AKA A;  4BY5 A;  2MHH A;  1RWY A;  1H8B A;  1UHH A;  2L98 A;  2JNX A;  3CZT X;  1K9U A;  1DF0 B;  3IQQ A;  1U5I A;  4WRI A;  4IL1 A;  4P5O E;  1EG3 A;  1Y6W A;  2V53 A;  4MRX A;  3VGO A;  1DJY A;  1K93 D;  1PUL A;  1XO5 A;  4GAO A;  1BU3 A;  4F0Z B;  4HRH A;  4HRE E;  2EC6 B;  2PMY A;  2WOS A;  2WND A;  3WXA A;  1FPW A;  4NDB A;  5AEQ A;  1FI5 A;  1DJW A;  1NIW A;  2BE6 A;  2I7A A;  1BG1 A;  3IQO A;  1JFJ A;  4CID A;  1CDP A;  4M2Q A;  2F33 A;  1CFD A;  2MA2 A;  3PLF B;  3LLE A;  1KFU S;  3PAT A;  2PRU A;  1QX5 B;  1J7R A;  3GK2 A;  2LVJ A;  1IG5 A;  3PM8 A;  3SIB A;  1S1E A;  4YI9 A;  3AAK A;  1IRJ A;  1QVI Z;  2NCO A;  5AFP A;  2OTG B;  4QJ3 B;  2NXQ A;  1IKU A;  3ZNI A;  1SY9 A;  2JTZ A;  1B7T Z;  3DVM A;  3WHT B;  1UP5 A;  3CS1 A;  4AOM A;  1IQ3 A;  1AP4 A;  3PN7 C;  2KOT A;  3A8R A;  4YGE B;  1K9P A;  4I5L B;  3GK1 A;  4WQ3 A;  4E68 A;  2FCD A;  1BR4 B;  1DVI A;  2KAV A;  1NX3 A;  4YRU A;  1R2U A;  1CKK A;  1A75 B;  1M45 A;  2LVI A;  2JT0 A;  2WCB A;  4YGA A;  1H4B A;  3SIA A;  1YUT A;  3I5G C;  3DVJ A;  1CDM A;  1A03 A;  1KK7 Z;  1XFZ O;  4AQJ A;  1YX8 A;  1XFX O;  1QIV A;  4TNC A;  1B8L A;  1WY9 A;  1DMO A;  3JTD C;  4YGD B;  2BL0 B;  3TUY C;  1RTP 1;  1KSO A;  1S6C A;  3TDU A;  3OB2 B;  3OX6 A;  5G08 A;  3OHM B;  3DF0 B;  1NSH A;  1IWQ A;  4QJ5 B;  1XFU O;  4YGB B;  2PVB A;  2HPS A;  5I8N A;  1PAL A;  3CLN A;  3RLZ A;  2LMU A;  4M2P A;  2JWW A;  5I2L A;  2TN4 A;  1K8U A;  1JFK A;  1NPQ A;  1BMO A;  2KQY A;  4DS7 A;  1K94 A;  1K9K A;  3BQ3 A;  5I2Q A;  1B9A A;  4ORC B;  5CSI A;  1ALV A;  1LXF C;  5HLV A;  5HLO A;  4CLN A;  1CLL A;  2LNK A;  3TS5 C;  2BCB A;  1K95 A;  4GPL B;  3LK0 A;  1Y0V H;  2M7N A;  2MJW B;  4ICB A;  4USL A;  2K61 A;  3SJS A;  1XFY O;  2KHN A;  1OZS A;  2LVK A;  3EK7 A;  4DIR A;  5CSF A;  4DUQ A;  2LMV A;  2F8P A;  2L0P A;  1PVB A;  1XA5 A;  2LM5 A;  3OX5 A;  4GGF A;  2OS8 B;  1Y1A A;  1MHO A;  4GGN A;  1DJZ A;  2KI4 B;  2K7O A;  2LV7 A;  4MZL A;  1DGV A;  1KFX S;  1TCO B;  3QRX A;  1JBA A;  1KFX L;  2LAN A;  4PE7 A;  2HQW A;  5F6T A;  3DF0 A;  1QAT A;  2JXL A;  1C7W A;  1TIZ A;  1SCM C;  2KGR A;  3JTD B;  3TUY B;  1KQV A;  2Y4Q A;  3BUX B;  2BCX A;  1NX2 A;  1GJY A;  4MEW A;  2BKI B;  2JRF A;  1KWO C;  4C0K A;  3O2P A;  2KFF A;  4MZK A;  1DGU A;  1NYA A;  2CNP A;  3TDZ A;  3H4S E;  4YBH B;  1L2O B;  1OSA A;  3EK4 A;  2E6W A;  3PN7 B;  2JTT A;  4ZCU A;  4MVF A;  3EVU A;  2PAS A;  1TCF A;  1BJF A;  2H61 C;  2WCE A;  4JQ0 D;  4A4C A;  3FS7 A;  2KI4 C;  2EHB A;  2LCP A;  2BKH B;  2LP3 A;  3KF9 A;  1TNP A;  2SCP A;  1IQ5 A;  1CLM A;  1CTR A;  4P2Y B;  5ER4 X;  4NDC A;  2KGB C;  1DJI A;  4PHJ A;  1S6I A;  3BUN B;  5AXI A;  1OMV A;  2CCM A;  1PK0 D;  2LLU A;  3SG5 A;  1UHK A;  1NCX A;  1J7O A;  1UWO A;  3JVT C;  4OV2 A;  3F45 A;  2GV5 A;  4ORB B;  3VRN A;  3EKJ A;  1KFU L;  2IS9 A;  3BXK A;  2Y5I A;  3O78 A;  5DKQ A;  1DJH A;  1QX2 A;  2JT8 A;  1QX7 A;  1A75 A;  2K2F A;  4C0J A;  2NCP A;  5KSZ A;  2I94 A;  1XFV O;  3VRO A;  2M29 A;  3I5H B;  2KFH A;  3TS5 B;  2L2E A;  1ODB A;  1TNW A;  4I5K A;  1EG4 A;  1HT9 A;  2HQ8 A;  5TNC A;  1CFP A;  1K2H A;  1KQM C;  1AJ4 A;  2OPO A;  5HYD A;  3CR2 A;  4U8D A;  1PSR A;  1J7Q A;  1TN4 A;  1AUI B;  2NLN A;  2FJU B;  4OR9 B;  1UHI A;  4XJK A;  2BEC A;  1CDN A;  2M8U A;  1EL4 A;  1TRF A;  2JQ6 A;  4N1G A;  2ZN8 A;  2KYF A;  2QAC A;  1IJ6 A;  4XJK B;  1SYM A;  3I5H C;  1QJT A;  4D1E A;  1BR1 B;  1SL9 A;  1F8H A;  1G4Y R;  1TNX A;  4OVN F;  2R2I A;  1N0Y A;  4L9M A;  1Y1X A;  4PHN A;  2JUL A;  2M1K B;  1J7P A;  2KSP A;  2KDH A;  1MQ1 A;  1M39 A;  5HKW A;  1KQM B;  2KBI A;  3FWC A;  1F4Q A;  1FI6 A;  1MUX A;  2JPT A;  1ZMZ A;  3A4U B;  4R1E A;  5I2O A;  2K2A A;  1QV0 A;  3WNX B;  1CLB A;  3PAL A;  1CFF A;  2MLF C;  4NDD A;  1IH0 A;  5CSJ A;  2ZFD A;  2K7C A;  3JVT B;  4HSZ A;  2MBX A;  1X02 A;  2P6B B;  3BOW A;  2M49 B;  4MLW A;  1SPY A;  1S5G Z;  5CSN A;  1YUR A;  5AAN A;  1K96 A;  5DKR A;  3PSR A;  2CT9 A;  2ISD A;  2LLS A;  4JWQ A;  4MBE A;  2L5X B;  1RJV A;  1NWD A;  2M3W A;  3DVE A;  2Q4U A;  2B1U A;  4GGF C;  1BLQ A;  3M0W A;  1WLZ A;  4CFQ A;  1B1G A;  4OCI A;  2BBN A;  2ZRS A;  2LHL A;  1XYD A;  1B8C A;  1MF8 B;  2EGD A;  5B8I B;  1L7Z A;  2K0J A;  3TDI A;  1XK4 C;  1F70 A;  3E3R A;  1SBJ A;  1U5I B;  3RM1 A;  1J1D A;  3NXA A;  5FYX A;  2F2O A;  1SRA A;  1BOC A;  3CTN A;  1KK8 B;  1A4P A;  2ZNE A;  4PAL A;  2MAZ A;  1L2O C;  1QS7 A;  3EK8 A;  4ORA B;  3VRQ A;  2O60 A;  1IGV A;  1E8A A;  5ER5 A;  3D0Y A;  1RRO A;  1SR6 C;  2AUC A;  1EH2 A;  4JPZ B;  1KWO B;  2LC5 A;  3I5I C;  1MXL C;  3SG2 A;  4I5N B;  4DRW A;  1SCM B;  1J55 A;  1S6J A;  2WOR A;  4NQG A;  1W7I B;  4WQ2 A;  2HET A;  1OMR A;  2H61 A;  2ZKM X;  1A29 A;  4HRG A;  3I5F C;  1JUO A;  2Y1M A;  2GGM A;  1S3P A;  1FF1 A;  1BT6 A;  1QIW A;  2KNE A;  3LK1 A;  1IJ5 A;  5BPJ A;  1SR6 B;  2ZN9 A;  2CBL A;  3FWB A;  1SW8 A;  3CGA A;  4MRY A;  3NSI A;  2FOT A;  5D7F A;  1CM4 A;  3SG4 A;  3VRR A;  1QV1 A;  2G2B A;  1AK8 A;  2MRD A;  2M1U A;  2JT3 A;  1DTL A;  4DCK A;  2Q91 A;  1EXR A;  4PE4 A;  1SKT A;  2Y1N A;  2EC6 C;  2COL B;  5D69 A;  1N65 A;  3LCP C;  1V1F A;  5K89 A;  3EVV A;  1PVA A;  4PCW A;  2K7D A;  1DJG A;  2GGZ A;  2AAO A;  1GGZ A;  1S36 A;  3BYA A;  3VRP A;  1YX7 A;  4GUK A;  1C7V A;  1F4O A;  1VRK A;  2AMI A;  4CFR A;  3GK4 X;  1JF2 A;  1BOD A;  1YUS A;  2K8M B;  2QPT A;  3FIA A;  4QJ4 B;  1YVH A;  4ZCV A;  1LKJ A;  3SG6 A;  3C1V A;  4BY4 A;  3MSE B;  4UPG A;  1CMG A;  2RGI A;  1CFC A;  5GQQ C;  1NCY A;  3OP0 A;  1UUS A;  2LUX A;  2G9B A;  2LAP A;  1DJX A;  4GNK B;  1WRL A;  1YRT B;  1ZOT B;  1HQV A;  1MR8 A;  1CDL A;  1TTX A;  5PAL A;  3O6B A;  1XVJ A;  2F3Z A;  2PSR A;  1F71 A;  4A4B A;  1OOJ A;  1SMG A;  1TOP A;  2LVV A;  5AER A;  1CB1 A;  3KEV A;  1AJ5 A;  1DF0 A;  1QXP A;  1KSM A;  1QVI Y;  5HKY A;  2L51 A;  1QLS A;  1TNQ A;  4XYN A;  4C0L A;  2KAX A;  1G33 A;  1OMD A;  2LLT A;  1C07 A;  1QLK A;  3NSO A;  4FTG A;  1XK4 A;  4MSP A;  4GBA A;  4PHK A;  1WDC B;  1LA0 A;  2KI6 C;  4Q04 A;  3OB1 B;  3DD4 A;  4MZJ A;  4YGC B;  3AAJ A;  1KK7 Y;  2OTG C;  3BOW B;  1JSA A;  2BBM A;  2VRG A;  4PHM A;  5HKZ A;  1DT7 B;  1ZAC A;  1GGW A;  4N1F A;  5DKN A;  1FBV A;  2WC8 A;  3SG3 A;  1OZO A;  1REC A;  1ZFS A;  3EVR A;  1LVC D;  1M31 A;  1OE9 B;  1SL8 A;  3D10 A;  4M2O A;  2OS8 C;  2L50 A;  1EJ3 A;  2K7B A;  3BUM B;  2HF5 A;  3CWG A;  3HCM A;  1F54 A;  5J3X A;  2ZRT A;  3BUO B;  3LL8 B;  2MLE C;  3WHU B;  5KTY A;  2O5G A;  3CR4 X;  1WDC C;  2JOJ A;  2M97 A;  4YI8 A;  5KU1 A;  1GQM A;  4ETO A;  2NZ0 A;  1MXE A;  2BL0 C;  2KQ6 A;  1PRW A;  1YUU A;  1J1E A;  2F3Y A;  3SG7 A;  1CMF A;  1NP8 A;  3I5I B;  1NX0 A;  3I5G B;  4MN0 A;  2I2R E;  1UUR A;  4GFT A;  1ALW A;  1YTZ C;  1LIN A;  1XFW O;  5JOL A;  3ZWH A;  1CNP A;  1M63 B;  3I5F B;  2ZND A;  2BCA A;  4PE0 A;  1WRK A;  3K21 A;  3KO0 A;  2I18 A;  3NSL A;  2H2K A;  2A4J A;  3IF7 A;  2LHI A;  1QAS A;  1R6P A;  1ZUZ A;  2JZI A;  1RK9 A;  1JWD A;  2KFG A;  3DVK A;  1BF5 A;  2PAL A;  1CM1 A;  1V1G A;  1SK6 D;  1LA3 A;  1G8I A;  1YVL A;  2LE9 B;  3KPX A;  1NUB A;  1SCV A;  3AKB A;  4CPV A;  4PE1 A;  3TZ1 A;  1AVS A;  1B8R A;  1NCZ A;  3ICB A;  3GOF A;  4FQO A;  4PDZ A;  1OQP A;  3KHE A;  1MWN A;  5IBW A;  1KCY A;  2DOQ A;  1Q80 A;  4OKH A;  1Y1U A;  2SAS A;  1N2D A;  1D1O A;  2LP2 A;  1KK8 C;  2D8N A;  2E30 A;  2JC2 A;  4N5X A;  5CPV A;  2F2P A;  1FW4 A;  1UHJ A;  1B4C A;  2JNF A;  3O4Y A;  1YRU B;  1SNL A;  2JU0 A;  2L4I A;  1YR5 A;  1M46 A;  1RFJ A;  2JXC A;  3PFV A;  2FCE A;  1JF0 A;  2WCF A;  1WRZ A;  2LUC A;  1W7J B;  1B7T Y;  2M9G A;  1UHN A;  2M7L A;  2CXJ A;  1PSB A;  2LMT A;  1QTX A;  5JJG A;  1F55 A;  1JC2 A;  3EKH A;  3NSK A;  1B47 A;  2KYC A;  1S26 D;  3CR5 X;  2BE4 A;  1SL7 A;  3HX4 A;  4I5J A;  1A2X A;  1AHR A;  1WLM A;  2KBM A;  2L4H A;  2M0R A;  3BUW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...