1TRFA

Solution structure of the tr1c fragment of skeletal muscle troponin-c
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
b'AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN C
publication title Solution structure of the TR1C fragment of skeletal muscle troponin-C.
pubmed rcsb
source organism Meleagris gallopavo
molecule tags Muscle protein
total genus 16
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1993-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1trfA00
2Y1NA 3VGOA 2OS8B 3PFVA 3DVMA 2L51A 1W7IB 3GOFA 1PALA 1OSAA 1V1GA 1SY9A 2G2BA 2RGIA 1TOPA 3JTDB 4GBAA 4JPZB 1S5GY 1UWOA 3LL8B 1PSBA 1CLBA 1QX7A 1OMDA 3I5HC 1OQPA 2BL0B 3NSKA 1A75B 4QJ3B 1ZUZA 2KGRA 2LAPA 1NPQA 3OX6A 2M1UA 1NX3A 3FWBA 4JQ0D 1XFWO 1YRTB 1KK7Z 3SIBA 4WQ2A 2F3YA 2JT0A 3DVKA 1B7TY 1KSOA 3KO0A 3IQQA 3DVJA 4CIDA 1B47A 1S1EA 1Y6WA 5ER4X 1ZMZA 2LP3A 3SG4A 4C0KA 5KTYA 1J1EA 1DGVA 2KAYA 4DCKA 1FBVA 2JOJA 1QJTA 5I8NA 1QVIY 2WCFA 1SCVA 4YGDB 2KBIA 1CTRA 1EL4A 4USLA 5B8IB 4YI9A 4NDDA 1DGUA 1IH0A 2I7AA 2Y4QA 1DJYA 2K2FA 2ZNEA 1ALVA 1SNLA 1CKKA 2JWWA 1CDMA 1DMOA 2KAXA 4YBHB 1S6CA 3WXAA 1CFCA 1BJFA 2Y5IA 4M2PA 2BL0C 2F3ZA 1S36A 3DF0B 4CFRA 1DF0B 2KFHA 2BKIB 2NCOA 3OB2B 3CZTX 4R1EA 2L4HA 3A4UB 1GJYA 1TN4A 1XA5A 1V1FA 1AP4A 2JZIA 1JC2A 1DJZA 4BY4A 4AQJA 2COLB 2L2EA 1OE9B 2KSPA 2MAZA 3LK0A 1F8HA 1EJ3A 1KWOB 3CLNA 2MHHA 3CR5X 5DKNA 2KDHA 3VRRA 1WLMA 4Q04A 2M49B 3PM8A 4CLNA 2Q4UA 3EVRA 4PE1A 1H8BA 1G33A 1C7WA 1Y1UA 2F2OA 3FIAA 4PDZA 1GGWA 2LVIA 1JUOA 5J3XA 2ZKMX 1J7QA 1OOJA 5DKRA 4IL1A 1AUIB 4XJKB 4DS7A 1SRAA 4YGAA 1QV1A 1UURA 1KQMB 4I5LB 4BY5A 1CB1A 1J55A 3BOWA 1GGZA 1K95A 3H4SE 4DIRA 4N1FA 4PHNA 2HF5A 3SG5A 2JPTA 2JC2A 2KNEA 3OX5A 3CR4X 1UP5A 2V53A 3JVTB 2LV7A 5JOLA 1IQ5A 1AK8A 3HX4A 1AJ4A 1CNPA 1CDPA 2GGMA 4YI8A 4I5NB 2Y1MA 1YVHA 2BBMA 2LE9B 1SL7A 4MBEA 5CSJA 2L98A 2PALA 1B8RA 2SASA 1EXRA 3TZ1A 4NDBA 1IG5A 4C0JA 1RECA 2AAOA 4YGEB 4A4BA 2ZN8A 3I5HB 3KPXA 3LK1A 4ZCVA 1ODBA 1JFKA 4WRIA 1DF0A 1K90D 1NWDA 2HQWA 2CBLA 1K9UA 1C7VA 1SYMA 1QV0A 1NIWA 3I5FC 1NYAA 1CMFA 1J7PA 1F4OA 1Y0VH 4PCWA 1YX7A 2I18A 2PVBA 1J7OA 2ZRTA 1MXEA 1QLSA 4MEWA 1K94A 1SL9A 4WQ3A 1L2OB 3CR2A 2LMVA 1PSRA 3OHMB 4A4CA 1CDNA 1M39A 1MR8A 1DJIA 3A8RA 3DVEA 1PRWA 4XJKA 1UHJA 3JVTC 1EH2A 2K61A 1K93D 1Y1AA 2LVJA 1RTP1 1XFYO 4MRXA 1JF2A 1JFJA 1KFXL 2WORA 1K9KA 2R2IA 3C1VA 4ORBB 2L4IA 4PHJA 1UHHA 1FF1A 1IJ5A 3TS5C 2JNXA 1TCOB 1DJWA 1NCYA 4FTGA 1QS7A 1FPWA 3FWCA 2EC6B 4GGFC 1BMOA 2M29A 1S26D 2M7NA 4DRWA 3ICBA 2K7CA 3BUWB 3MSEB 1RJVA 5K89A 1S6IA 4OR9B 2CXJA 1IRJA 2LLSA 2QPTA 2LUXA 1BODA 2LVKA 1A29A 1CFPA 2JTTA 3I5IB 1MQ1A 1QXPA 1TCFA 1VRKA 1MUXA 4GGFA 2MLEC 3CS1A 3BUNB 2MLFC 3NXAA 5JJGA 1UHIA 2E6WA 2M97A 1A2XA 2LC5A 1K8UA 3BOWB 2E30A 1SBJA 1KK7Y 1L2OC 1PVAA 2KAVA 1OZSA 2NCPA 1K2HA 2KI6D 1JBAA 1PULA 4XYNA 4GNKB 1S6JA 2K7DA 4OCIA 3BQ3A 3EKHA 1DTLA 2ISDA 1DJXA 3BUOB 5AXIA 2Q91A 2WCEA 4MZJA 1NUBA 3O78A 3GK2A 1BU3A 1WLZA 1F71A 4I5KA 2EC6C 3KEVA 1QASA 4GGNA 3IQOA 3SG2A 1U5IB 1KQVA 2BCXA 2K0JA 1TNPA 2JNFA 2LANA 4HSZA 2WNDA 2BBNA 4P5OE 5AFPA 1YRUB 3ZWHA 4PALA 4YRUA 5KU1A 1SK6D 1SR6C 5BPJA 2LLUA 3I5IC 1DT7B 1A03A 1RK9A 1CM1A 1LVCD 3TDZA 1BG1A 2M7LA 1NX2A 2HQ8A 2WCBA 3SIAA 3EK4A 3SG6A 1F4QA 3EKJA 1PVBA 4PHKA 1J7RA 5HLOA 1WRKA 1CM4A 1C07A 1ZACA 3PALA 2KFGA 5CSFA 3I5FB 4YGCB 2LMUA 2LHLA 4GFTA 1WY9A 1MXLC 1AVSA 3HCMA 1B9AA 2K2AA 1SKTA 3QRXA 3OP0A 4U8DA 1E8AA 2PSRA 2BKHB 4JWQA 1B1GA 2ZFDA 5IBWA 2CCMA 1SL8A 3LLEA 4PE4A 3OB1B 2HETA 2LNKA 1YURA 3NSLA 3PN7B 1IKUA 3VROA 1RFJA 3WHUB 1Q80A 2JT3A 2ZNDA 1TNXA 2ZN9A 2MJWB 1QTXA 1ALWA 3BYAA 1YUSA 2D8NA 1R2UA 3FS7A 1WRZA 3TS5B 4ORCB 2H2KA 2KFFA 5GQQC 4PE7A 1IQ3A 2K7OA 2MBXA 2BE6A 2I2RE 1U5IA 3EVVA 1IJ6A 1OMVA 5ER5A 3SJSA 4DUQA 2MRDA 2F33A 1LA3A 1IWQA 2A4JA 1SPYA 2TN4A 2F2PA 2PASA 2KOTA 2JRFA 4E68A 2I94A 1YR5A 1Y1XA 4M2OA 1TRFA 1TNQA 3K21A 2JTZA 2G9BA 5I2QA 2KI4B 1KFUL 1AJ5A 4N1GA 2LCPA 3EK7A 1DJHA 1NCXA 2KYFA 4D1EA 2KGBC 5HYDA 3PN7C 1YUUA 4ICBA 3WHTB 2LUCA 4PHMA 3KF9A 4UPGA 2BCAA 4MLWA 3VRPA 1PK0D 1SCMC 2LP2A 2BCBA 4M2QA 2QACA 3F45A 3O6BA 4HREE 1NSHA 5HKYA 3PSRA 5HKWA 1EG3A 2M8UA 2PRUA 4ORAB 5F6TA 1LKJA 5FYXA 4C0LA 5I2OA 4F0ZB 1SW8A 1BF5A 2PMYA 1S5GZ 3D10A 3CTNA 5CSNA 1M46A 1SR6B 5KSZA 1YVLA 2CNPA 2KYCA 1XFZO 4QJ4B 1BOCA 1IGVA 1FW4A 1CLLA 1LINA 3GK4X 2BECA 4P2YB 2KI4C 1BR1B 1XVJA 1XO5A 4AQIA 1JSAA 3AKBA 2OTGC 1YX8A 2KBMA 3VRQA 2P6BB 1G4YR 2AMIA 2K7BA 1QATA 2NXQA 3RM1A 3CGAA 2CTNA 1N65A 1B7TZ 3AKAA 1MF8B 2JQ6A 1A4PA 1N0YA 2AUCA 1LXFC 1NCZA 1XFUO 1F54A 2JU0A 1FI6A 1GQMA 2K8MB 2M0RA 3D0YA 3TDIA 2VRGA 1QVIZ 3I5GC 5AERA 3BUMB 1WDCB 1TTXA 1KFUS 1QIWA 1KK8B 3IF7A 3VRNA 2FOTA 5G08A 1B4CA 2GV5A 1TIZA 4HRHA 3TDUA 1BT6A 1J1DA 1XFVO 2ZRSA 1B8LA 2M1KB 1CFDA 2EHBA 2O60A 1F70A 1RWYA 3NSOA 1AHRA 1M31A 4MRYA 2OS8C 4MSPA 2B1UA 1KFXS 1N2DA 2CT9A 3BUXB 3JTDC 3SG3A 2OPOA 2LLTA 2SCPA 1DVIA 1F55A 4GUKA 1S3PA 1NX0A 3LCPC 1H4BA 1QX2A 5AANA 2GGZA 2EGDA 2L5XB 1YUTA 1QIVA 1BR4B 1QLKA 1ZOTB 5D7FA 4YGBB 1MHOA 5DKQA 1G8IA 1UHNA 1D1OA 2KQ6A 1CFFA 2FCDA 2L50A 4CFQA 4AOMA 1R6PA 1XYDA 1WRLA 4OV2A 1A75A 1M63B 4OKHA 1WDCC 1K96A 1KK8C 3EK8A 4TNCA 5TNCA 2DOQA 3EVUA 4GAOA 5CPVA 4MZKA 3SG7A 4I5JA 1XK4C 2M3WA 1BLQA 2IS9A 3TUYB 1B8CA 3BXKA 4CPVA 2FJUB 3NSIA 3WNXB 5HKZA 1SCMB 1JF0A 4N5XA 1HT9A 2LM5A 4NQGA 1FI5A 2M9GA 1UUSA 1X02A 1MWNA 5AEQA 4QJ5B 1XFXO 1RROA 2H61C 3M0WA 1XK4A 3GK1A 1JWDA 3PLFB 1TNWA 4NDCA 3CWGA 1EG4A 3E3RA 3RLZA 2WC8A 3O2PA 2JXLA 3AAKA 2LMTA 1NX1A 5HLVA 5I2LA 1K9PA 1OZOA 1L7ZA 3AAJA 1CMGA 4FQOA 1DJGA 4MN0A 2H61A 1UHKA 1M45A 2O5GA 2F8PA 2OTGB 1KSMA 3D0YB 5PALA 1NP8A 2LHIA 1CDLA 1OMRA 4ETOA 3KHEA 3ZNIA 4ZCUA 1KWOC 1HQVA 2MA2A 2NLNA 1ZFSA 3DF0A 4OVNF 2JULA 2KQYA 2HPSA 4MVFA 5D69A 1W7JB 3PATA 3TUYC 3O4YA 2NZ0A 2FCEA 4PE0A 2KI6C 1YTZC 4L9MA 2LVVA 2JT8A 2WOSA 3I5GB 1KQMC 2KHNA 1SMGA 1KCYA 4HRGA 2JXCA 1LA0A 4MZLA 4GPLB 1CLMA 2L0PA 2BE4A 5CSIA 3DD4A 1QX5B
chains in the Genus database with same CATH superfamily
2Y1NA 3VGOA 3NHTA 1DC1A 2OS8B 3PFVA 3DVMA 2L51A 5FI2A 1W7IB 1ORGA 1PALA 3GOFA 1OSAA 1V1GA 1SY9A 2G2BA 2RGIA 1TOPA 3JTDB 4GBAA 4JPZB 1S5GY 1UWOA 3LL8B 2BAPA 1PSBA 1CLBA 1QX7A 1OMDA 3I5HC 2KLEA 1OQPA 1T14A 2BL0B 1A75B 2WCMA 3CZ1A 3NSKA 4QJ3B 1ZUZA 2KGRA 2LAPA 1NPQA 5D3OA 3OX6A 2M1UA 1NX3A 3FWBA 5EL2A 4JQ0D 1XFWO 1YRTB 1KK7Z 3SIBA 4WQ2A 5I94A 2F3YA 2JT0A 3DVKA 1B7TY 1KSOA 3KO0A 3IQQA 3DVJA 4CIDA 1B47A 1S1EA 1Y6WA 5ER4X 1ZMZA 2LP3A 3SG4A 4C0KA 5KTYA 1J1EA 1DGVA 2KAYA 4DCKA 1FBVA 2JOJA 1QJTA 5I8NA 1QVIY 2WCFA 1SCVA 3EG5B 4YGDB 2KBIA 1CTRA 1EL4A 4USLA 5B8IB 4YI9A 4NDDA 1DGUA 1IH0A 2I7AA 2Y4QA 1DJYA 2K2FA 2ZNEA 3B6XA 1ALVA 1SNLA 1CKKA 2JWWA 1CDMA 1DMOA 2KAXA 4YBHB 1S6CA 3WXAA 1CFCA 1BJFA 2Y5IA 4M2PA 2BL0C 2F3ZA 1S36A 3DF0B 4CFRA 1DF0B 2KFHA 2BKIB 2NCOA 3OB2B 3CZTX 4R1EA 2L4HA 3A4UB 1GJYA 1TN4A 1XA5A 1V1FA 1AP4A 2JZIA 1JC2A 1XFRA 1DJZA 4BY4A 4AQJA 4IJ7A 2COLB 2L2EA 1OE9B 2KSPA 2MAZA 3LK0A 2WC5A 1EJ3A 1KWOB 3IVTA 3CLNA 2MHHA 3CR5X 5DKNA 2KDHA 3VRRA 1WLMA 4Q04A 2M49B 3PM8A 1OOGA 2Q4UA 3EVRA 4PE1A 4CLNA 1H8BA 1G33A 1DQEA 4INXA 1C7WA 1Y1UA 2F2OA 3FIAA 4PDZA 1GGWA 2LVIA 1JUOA 5J3XA 2ZKMX 3FE8A 1OOJA 1J7QA 5DKRA 4IL1A 1AUIB 3L4AA 4XJKB 4DS7A 1SRAA 4YGAA 1QV1A 1UURA 1KQMB 4I5LB 4BY5A 1CB1A 1J55A 3BOWA 1GGZA 1K95A 2WCHA 3H4SE 4JD9A 4DIRA 4N1FA 4PHNA 2HF5A 3SG5A 3BFAA 2JPTA 2JC2A 2KNEA 3OX5A 3CR4X 1UP5A 2V53A 3JVTB 2LV7A 5JOLA 1IQ5A 1AK8A 3HX4A 1AJ4A 3B86A 1CDPA 3S0DA 1CNPA 2GGMA 4YI8A 3DXLA 2Y1MA 1YVHA 2BBMA 2LE9B 3R72A 4I5NB 1SL7A 4MBEA 5CSJA 2L98A 2PALA 1B8RA 2SASA 1EXRA 2QEHA 3TZ1A 4NDBA 1IG5A 4C0JA 3DZTA 1RECA 2AAOA 4YGEB 4A4BA 2ZN8A 3I5HB 3KPXA 3LK1A 4ZCVA 3RZSA 1ODBA 3R1VA 4KYNA 1JFKA 4WRIA 2KLDA 1DF0A 1K90D 1NWDA 2HQWA 2CBLA 3PJIA 1K9UA 1C7VA 1SYMA 1QV0A 1NIWA 3I5FC 3O4XA 1NYAA 3SS4A 1CMFA 1J7PA 1F4OA 1Y0VH 4PCWA 1YX7A 2I18A 2PVBA 1J7OA 2ZRTA 1MXEA 1QLSA 4MEWA 1K94A 1SL9A 3BJHA 1L2OB 2K60A 4WQ3A 3CR2A 3D74A 2LMVA 3S0GA 1PSRA 3OHMB 4A4CA 1CDNA 1M39A 1MR8A 1IIOA 1DJIA 3A8RA 3DVEA 1PRWA 4XJKA 1UHJA 3JVTC 1EH2A 2K61A 1K93D 1Y1AA 2LVJA 3L47A 1GM0A 1RTP1 3L4LA 1XFYO 4MRXA 1JF2A 3V2LA 1KFXL 2WORA 1JFJA 1K9KA 2R2IA 3SS5A 3C1VA 4ORBB 2L4IA 3FE9A 1UHHA 4PHJA 1FF1A 1IJ5A 3TS5C 2JNXA 1TCOB 2FJYA 4JKTA 1DJWA 1NCYA 4FTGA 1QS7A 1FPWA 3FWCA 2EC6B 4GGFC 1BMOA 2M29A 1S26D 2M7NA 4DRWA 3ICBA 2K7CA 3BUWB 3MSEB 1RJVA 5K89A 1S6IA 4OR9B 2CXJA 1IRJA 2LLSA 2QPTA 2LUXA 1DEKA 1OOFA 2LVKA 3UO9A 1BODA 1A29A 1CFPA 2JTTA 3I5IB 1MQ1A 1QXPA 1TCFA 2PYQA 1VRKA 1MUXA 4GGFA 2MLEC 3CS1A 3BUNB 2MLFC 3NXAA 5JJGA 1UHIA 2E6WA 2M97A 1A2XA 2LC5A 1K8UA 3BOWB 2E30A 1SBJA 1KK7Y 1L2OC 1PVAA 2KAVA 5FI7A 1OZSA 2NCPA 1K2HA 2KI6D 3B7AA 1JBAA 1PULA 4XYNA 4GNKB 1QWVA 1S6JA 2K7DA 3D75A 4OCIA 3NGVA 3BQ3A 4F7FA 3EKHA 1DTLA 2ISDA 1DJXA 4OZDA 3BUOB 5AXIA 2Q91A 2WCEA 4MZJA 1NUBA 3O78A 3GK2A 1BU3A 1WLZA 1F71A 4I5KA 2EC6C 3KEVA 3CDNA 1QASA 4GGNA 3IQOA 3SG2A 1U5IB 1KQVA 2BCXA 2K0JA 1TNPA 2JNFA 2LANA 4HSZA 2WNDA 2BBNA 2KPHA 4P5OE 5AFPA 1YRUB 3ZWHA 4PALA 4YRUA 5KU1A 1SK6D 1SR6C 5BPJA 2LLUA 3I5IC 1DT7B 1F8HA 1A03A 1RK9A 3DYEA 1CM1A 1LVCD 3TDZA 1Z2CB 2M7LA 1BG1A 1NX2A 2HQ8A 2WCBA 3SIAA 3EK4A 3SG6A 1F4QA 3EKJA 1PVBA 4PHKA 1J7RA 5HLOA 1WRKA 1CM4A 1C07A 1ZACA 3PALA 2KFGA 5CSFA 3I5FB 4YGCB 2WCKA 2LMUA 2LHLA 4GFTA 1WY9A 1MXLC 1AVSA 3NHIA 3HCMA 1B9AA 2K2AA 1SKTA 3QRXA 3OP0A 4U8DA 1E8AA 2PSRA 2BKHB 4JWQA 1B1GA 2ZFDA 3S0EA 5IBWA 2CCMA 1SL8A 3LLEA 4PE4A 3OB1B 2HETA 2LNKA 1YURA 3NSLA 3PN7B 1IKUA 3VROA 1RFJA 3WHUB 1Q80A 2JT3A 2ZNDA 2WCLA 1TNXA 2ZN9A 2MJWB 1QTXA 1Z4HA 1ALWA 3BYAA 1YUSA 2D8NA 1R2UA 3FS7A 1WRZA 3TS5B 3Q8IA 4ORCB 2H2KA 2KFFA 5GQQC 4PE7A 1IQ3A 2K7OA 2MBXA 2BE6A 2I2RE 1U5IA 3EVVA 1IJ6A 1OMVA 5ER5A 3SJSA 4DUQA 2MRDA 3QMEA 2F33A 1LA3A 1IWQA 2A4JA 1SPYA 2TN4A 2F2PA 2PASA 2KOTA 2JRFA 4E68A 2I94A 1C3YA 1YR5A 2P70A 2L5YA 1Y1XA 2QEVA 4M2OA 1TRFA 1TNQA 3K21A 2JTZA 2G9BA 5I2QA 2KI4B 1KFUL 1AJ5A 4N1GA 1DELA 2LCPA 3EK7A 1DJHA 1NCXA 1TUZA 2KYFA 4D1EA 3K1EA 2KGBC 2YGUA 5HYDA 2ERBA 3D73A 3PN7C 1YUUA 4ICBA 3WHTB 2LUCA 4PHMA 3KF9A 4UPGA 2BCAA 4MLWA 3VRPA 1PK0D 1SCMC 2LP2A 2BCBA 4M2QA 2QACA 3F45A 3O6BA 4HREE 1NSHA 5HKYA 3PSRA 5HKWA 1EG3A 2M8UA 2PRUA 4ORAB 2QEOA 1TUJA 1LS8A 1LKJA 5DICA 5F6TA 5FYXA 4C0LA 5I2OA 4F0ZB 1SW8A 1BF5A 1OOIX 2PMYA 1S5GZ 3D10A 4PT1A 1W9ZA 3CTNA 5CSNA 1M46A 1SR6B 5KSZA 1YVLA 2CNPA 2KYCA 1XFZO 4QJ4B 1BOCA 1IGVA 1FW4A 1CLLA 1LINA 3GK4X 2BECA 4P2YB 2KI4C 1BR1B 1XVJA 1XO5A 4AQIA 1JSAA 3AKBA 2OTGC 1YX8A 2KBMA 3VRQA 2P6BB 1G4YR 2AMIA 2K7BA 3BFBA 1QATA 2WCJA 3S0AA 2NXQA 3RM1A 3CGAA 2CTNA 1N65A 1B7TZ 3AKAA 1MF8B 3DY9A 2JQ6A 1A4PA 1N0YA 2AUCA 1LXFC 4INWA 1NCZA 1XFUO 1F54A 2JU0A 1FI6A 1GQMA 2K8MB 2M0RA 3D0YA 3TDIA 2VRGA 1C3ZA 1QVIZ 3I5GC 3PM2A 3BUMB 5AERA 1WDCB 1TTXA 3S0FA 1KFUS 1QIWA 1KK8B 3IF7A 3VRNA 2FOTA 5G08A 1B4CA 1TWOA 3R1OA 2GV5A 1TIZA 5FI6A 4HRHA 3TDUA 1BT6A 1J1DA 1XFVO 2ZRSA 1B8LA 2M1KB 1CFDA 3SS3A 3S0BA 2EHBA 2O60A 1F70A 1RWYA 3NSOA 1AHRA 1M31A 4MRYA 2OS8C 4MSPA 2B1UA 1KFXS 1N2DA 2CT9A 3BUXB 2JPOA 3JTDC 3SG3A 2OPOA 2LLTA 2SCPA 1DVIA 1F55A 2WC6A 4GUKA 5HL1A 1S3PA 1NX0A 3LCPC 1H4BA 1QX2A 5AANA 2GGZA 2EGDA 2L5XB 1YUTA 1QIVA 1BR4B 1OOHA 1QLKA 1OW4A 1ZOTB 4YGBB 3BFHA 1MHOA 5D7FA 3VB1A 5DKQA 1G8IA 1UHNA 1D1OA 2GTEA 2KQ6A 1CFFA 2FCDA 2L50A 4CFQA 4AOMA 1R6PA 1XYDA 1WRLA 4OV2A 1A75A 1M63B 4OKHA 1WDCC 1K96A 1KK8C 3EK8A 4TNCA 5TNCA 2DOQA 3EVUA 3CZ2A 4GAOA 4MZKA 5CPVA 4I5JA 1XK4C 2M3WA 4FQTA 3SG7A 3D77A 2IS9A 3TUYB 1B8CA 3BXKA 4CPVA 2FJUB 3NSIA 3WNXB 5HKZA 1SCMB 1JF0A 4N5XA 1HT9A 2LM5A 4NQGA 1FI5A 2M9GA 1UUSA 1X02A 1MWNA 5AEQA 4QJ5B 1XFXO 3D78A 1RROA 2H61C 3M0WA 1XK4A 3GK1A 1JWDA 3PLFB 3N7HA 1TNWA 4NDCA 3CWGA 1EG4A 2QEBA 3E3RA 3RLZA 2WC8A 3CZ0A 2JXLA 3O2PA 3AAKA 2LMTA 1NX1A 2L2CA 5HLVA 5I2LA 1K9PA 1OZOA 2QDIA 1L7ZA 3AAJA 1CMGA 3OGNA 4FQOA 3CYZA 1DJGA 4MN0A 2H61A 1UHKA 2H8VA 1M45A 2O5GA 2F8PA 2OTGB 1KSMA 3D0YB 5PALA 1NP8A 2LHIA 1CDLA 1OMRA 4ETOA 3KHEA 3ZNIA 4ZCUA 1KWOC 1HQVA 2MA2A 2NLNA 1ZFSA 2PQLA 3DF0A 4OVNF 2JULA 2KQYA 2HPSA 4MVFA 5D69A 1W7JB 3PATA 3R1PA 1BLQA 3TUYC 3O4YA 1P28A 2FCEA 2NZ0A 4PE0A 2KI6C 1YTZC 3D76A 4L9MA 2P71A 2LVVA 2JT8A 2WOSA 3B87A 3I5GB 3UNWA 1KQMC 1SSEB 3OBVA 2KHNA 3CABA 1SMGA 3B88A 4HRGA 2JXCA 1LA0A 4MZLA 1KCYA 4GPLB 2BNXA 1CLMA 2L0PA 2BE4A 5CSIA 3DD4A 3FE6A 1QX5B
chains in the Genus database with same CATH topology
2Y1NA 3VGOA 2OS8B 3PFVA 3DVMA 2L51A 1W7IB 3GOFA 1PALA 1OSAA 1V1GA 1SY9A 2G2BA 2RGIA 1TOPA 3JTDB 4GBAA 4JPZB 1S5GY 1UWOA 3LL8B 1PSBA 1CLBA 1QX7A 1OMDA 3I5HC 1OQPA 2BL0B 3NSKA 1A75B 4QJ3B 1ZUZA 2KGRA 2LAPA 1NPQA 3OX6A 2M1UA 1NX3A 3FWBA 4JQ0D 1XFWO 1YRTB 1KK7Z 3SIBA 4WQ2A 2F3YA 2JT0A 3DVKA 1B7TY 1KSOA 3KO0A 3IQQA 3DVJA 4CIDA 1B47A 1S1EA 1Y6WA 5ER4X 1ZMZA 2LP3A 3SG4A 4C0KA 5KTYA 1J1EA 1DGVA 2KAYA 4DCKA 1FBVA 2JOJA 1QJTA 5I8NA 1QVIY 2WCFA 1SCVA 4YGDB 2KBIA 1CTRA 1EL4A 4USLA 5B8IB 4YI9A 4NDDA 1DGUA 1IH0A 2I7AA 2Y4QA 1DJYA 2K2FA 2ZNEA 1ALVA 1SNLA 1CKKA 2JWWA 1CDMA 1DMOA 2KAXA 4YBHB 1S6CA 3WXAA 1CFCA 1BJFA 2Y5IA 4M2PA 2BL0C 2F3ZA 1S36A 3DF0B 4CFRA 1DF0B 2KFHA 2BKIB 2NCOA 3OB2B 3CZTX 4R1EA 2L4HA 3A4UB 1GJYA 1TN4A 1XA5A 1V1FA 1AP4A 2JZIA 1JC2A 1DJZA 4BY4A 4AQJA 2COLB 2L2EA 1OE9B 2KSPA 2MAZA 3LK0A 1F8HA 1EJ3A 1KWOB 3CLNA 2MHHA 3CR5X 5DKNA 2KDHA 3VRRA 1WLMA 4Q04A 2M49B 3PM8A 4CLNA 2Q4UA 3EVRA 4PE1A 1H8BA 1G33A 1C7WA 1Y1UA 2F2OA 3FIAA 4PDZA 1GGWA 2LVIA 1JUOA 5J3XA 2ZKMX 1J7QA 1OOJA 5DKRA 4IL1A 1AUIB 4XJKB 4DS7A 1SRAA 4YGAA 1QV1A 1UURA 1KQMB 4I5LB 4BY5A 1CB1A 1J55A 3BOWA 1GGZA 1K95A 3H4SE 4DIRA 4N1FA 4PHNA 2HF5A 3SG5A 2JPTA 2JC2A 2KNEA 3OX5A 3CR4X 1UP5A 2V53A 3JVTB 2LV7A 5JOLA 1IQ5A 1AK8A 3HX4A 1AJ4A 1CNPA 1CDPA 2GGMA 4YI8A 4I5NB 2Y1MA 1YVHA 2BBMA 2LE9B 1SL7A 4MBEA 5CSJA 2L98A 2PALA 1B8RA 2SASA 1EXRA 3TZ1A 4NDBA 1IG5A 4C0JA 1RECA 2AAOA 4YGEB 4A4BA 2ZN8A 3I5HB 3KPXA 3LK1A 4ZCVA 1ODBA 1JFKA 4WRIA 1DF0A 1K90D 1NWDA 2HQWA 2CBLA 1K9UA 1C7VA 1SYMA 1QV0A 1NIWA 3I5FC 1NYAA 1CMFA 1J7PA 1F4OA 1Y0VH 4PCWA 1YX7A 2I18A 2PVBA 1J7OA 2ZRTA 1MXEA 1QLSA 4MEWA 1K94A 1SL9A 4WQ3A 1L2OB 3CR2A 2LMVA 1PSRA 3OHMB 4A4CA 1CDNA 1M39A 1MR8A 1DJIA 3A8RA 3DVEA 1PRWA 4XJKA 1UHJA 3JVTC 1EH2A 2K61A 1K93D 1Y1AA 2LVJA 1RTP1 1XFYO 4MRXA 1JF2A 1JFJA 1KFXL 2WORA 1K9KA 2R2IA 3C1VA 4ORBB 2L4IA 4PHJA 1UHHA 1FF1A 1IJ5A 3TS5C 2JNXA 1TCOB 1DJWA 1NCYA 4FTGA 1QS7A 1FPWA 3FWCA 2EC6B 4GGFC 1BMOA 2M29A 1S26D 2M7NA 4DRWA 3ICBA 2K7CA 3BUWB 3MSEB 1RJVA 5K89A 1S6IA 4OR9B 2CXJA 1IRJA 2LLSA 2QPTA 2LUXA 1BODA 2LVKA 1A29A 1CFPA 2JTTA 3I5IB 1MQ1A 1QXPA 1TCFA 1VRKA 1MUXA 4GGFA 2MLEC 3CS1A 3BUNB 2MLFC 3NXAA 5JJGA 1UHIA 2E6WA 2M97A 1A2XA 2LC5A 1K8UA 3BOWB 2E30A 1SBJA 1KK7Y 1L2OC 1PVAA 2KAVA 1OZSA 2NCPA 1K2HA 2KI6D 1JBAA 1PULA 4XYNA 4GNKB 1S6JA 2K7DA 4OCIA 3BQ3A 3EKHA 1DTLA 2ISDA 1DJXA 3BUOB 5AXIA 2Q91A 2WCEA 4MZJA 1NUBA 3O78A 3GK2A 1BU3A 1WLZA 1F71A 4I5KA 2EC6C 3KEVA 1QASA 4GGNA 3IQOA 3SG2A 1U5IB 1KQVA 2BCXA 2K0JA 1TNPA 2JNFA 2LANA 4HSZA 2WNDA 2BBNA 4P5OE 5AFPA 1YRUB 3ZWHA 4PALA 4YRUA 5KU1A 1SK6D 1SR6C 5BPJA 2LLUA 3I5IC 1DT7B 1A03A 1RK9A 1CM1A 1LVCD 3TDZA 1BG1A 2M7LA 1NX2A 2HQ8A 2WCBA 3SIAA 3EK4A 3SG6A 1F4QA 3EKJA 1PVBA 4PHKA 1J7RA 5HLOA 1WRKA 1CM4A 1C07A 1ZACA 3PALA 2KFGA 5CSFA 3I5FB 4YGCB 2LMUA 2LHLA 4GFTA 1WY9A 1MXLC 1AVSA 3HCMA 1B9AA 2K2AA 1SKTA 3QRXA 3OP0A 4U8DA 1E8AA 2PSRA 2BKHB 4JWQA 1B1GA 2ZFDA 5IBWA 2CCMA 1SL8A 3LLEA 4PE4A 3OB1B 2HETA 2LNKA 1YURA 3NSLA 3PN7B 1IKUA 3VROA 1RFJA 3WHUB 1Q80A 2JT3A 2ZNDA 1TNXA 2ZN9A 2MJWB 1QTXA 1ALWA 3BYAA 1YUSA 2D8NA 1R2UA 3FS7A 1WRZA 3TS5B 4ORCB 2H2KA 2KFFA 5GQQC 4PE7A 1IQ3A 2K7OA 2MBXA 2BE6A 2I2RE 1U5IA 3EVVA 1IJ6A 1OMVA 5ER5A 3SJSA 4DUQA 2MRDA 2F33A 1LA3A 1IWQA 2A4JA 1SPYA 2TN4A 2F2PA 2PASA 2KOTA 2JRFA 4E68A 2I94A 1YR5A 1Y1XA 4M2OA 1TRFA 1TNQA 3K21A 2JTZA 2G9BA 5I2QA 2KI4B 1KFUL 1AJ5A 4N1GA 2LCPA 3EK7A 1DJHA 1NCXA 2KYFA 4D1EA 2KGBC 5HYDA 3PN7C 1YUUA 4ICBA 3WHTB 2LUCA 4PHMA 3KF9A 4UPGA 2BCAA 4MLWA 3VRPA 1PK0D 1SCMC 2LP2A 2BCBA 4M2QA 2QACA 3F45A 3O6BA 4HREE 1NSHA 5HKYA 3PSRA 5HKWA 1EG3A 2M8UA 2PRUA 4ORAB 5F6TA 1LKJA 5FYXA 4C0LA 5I2OA 4F0ZB 1SW8A 1BF5A 2PMYA 1S5GZ 3D10A 3CTNA 5CSNA 1M46A 1SR6B 5KSZA 1YVLA 2CNPA 2KYCA 1XFZO 4QJ4B 1BOCA 1IGVA 1FW4A 1CLLA 1LINA 3GK4X 2BECA 4P2YB 2KI4C 1BR1B 1XVJA 1XO5A 4AQIA 1JSAA 3AKBA 2OTGC 1YX8A 2KBMA 3VRQA 2P6BB 1G4YR 2AMIA 2K7BA 1QATA 2NXQA 3RM1A 3CGAA 2CTNA 1N65A 1B7TZ 3AKAA 1MF8B 2JQ6A 1A4PA 1N0YA 2AUCA 1LXFC 1NCZA 1XFUO 1F54A 2JU0A 1FI6A 1GQMA 2K8MB 2M0RA 3D0YA 3TDIA 2VRGA 1QVIZ 3I5GC 5AERA 3BUMB 1WDCB 1TTXA 1KFUS 1QIWA 1KK8B 3IF7A 3VRNA 2FOTA 5G08A 1B4CA 2GV5A 1TIZA 4HRHA 3TDUA 1BT6A 1J1DA 1XFVO 2ZRSA 1B8LA 2M1KB 1CFDA 2EHBA 2O60A 1F70A 1RWYA 3NSOA 1AHRA 1M31A 4MRYA 2OS8C 4MSPA 2B1UA 1KFXS 1N2DA 2CT9A 3BUXB 3JTDC 3SG3A 2OPOA 2LLTA 2SCPA 1DVIA 1F55A 4GUKA 1S3PA 1NX0A 3LCPC 1H4BA 1QX2A 5AANA 2GGZA 2EGDA 2L5XB 1YUTA 1QIVA 1BR4B 1QLKA 1ZOTB 5D7FA 4YGBB 1MHOA 5DKQA 1G8IA 1UHNA 1D1OA 2KQ6A 1CFFA 2FCDA 2L50A 4CFQA 4AOMA 1R6PA 1XYDA 1WRLA 4OV2A 1A75A 1M63B 4OKHA 1WDCC 1K96A 1KK8C 3EK8A 4TNCA 5TNCA 2DOQA 3EVUA 4GAOA 5CPVA 4MZKA 3SG7A 4I5JA 1XK4C 2M3WA 1BLQA 2IS9A 3TUYB 1B8CA 3BXKA 4CPVA 2FJUB 3NSIA 3WNXB 5HKZA 1SCMB 1JF0A 4N5XA 1HT9A 2LM5A 4NQGA 1FI5A 2M9GA 1UUSA 1X02A 1MWNA 5AEQA 4QJ5B 1XFXO 1RROA 2H61C 3M0WA 1XK4A 3GK1A 1JWDA 3PLFB 1TNWA 4NDCA 3CWGA 1EG4A 3E3RA 3RLZA 2WC8A 3O2PA 2JXLA 3AAKA 2LMTA 1NX1A 5HLVA 5I2LA 1K9PA 1OZOA 1L7ZA 3AAJA 1CMGA 4FQOA 1DJGA 4MN0A 2H61A 1UHKA 1M45A 2O5GA 2F8PA 2OTGB 1KSMA 3D0YB 5PALA 1NP8A 2LHIA 1CDLA 1OMRA 4ETOA 3KHEA 3ZNIA 4ZCUA 1KWOC 1HQVA 2MA2A 2NLNA 1ZFSA 3DF0A 4OVNF 2JULA 2KQYA 2HPSA 4MVFA 5D69A 1W7JB 3PATA 3TUYC 3O4YA 2NZ0A 2FCEA 4PE0A 2KI6C 1YTZC 4L9MA 2LVVA 2JT8A 2WOSA 3I5GB 1KQMC 2KHNA 1SMGA 1KCYA 4HRGA 2JXCA 1LA0A 4MZLA 4GPLB 1CLMA 2L0PA 2BE4A 5CSIA 3DD4A 1QX5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y1N A;  3VGO A;  2OS8 B;  3PFV A;  3DVM A;  2L51 A;  1W7I B;  3GOF A;  1PAL A;  1OSA A;  1V1G A;  1SY9 A;  2G2B A;  2RGI A;  1TOP A;  3JTD B;  4GBA A;  4JPZ B;  1S5G Y;  1UWO A;  3LL8 B;  1PSB A;  1CLB A;  1QX7 A;  1OMD A;  3I5H C;  1OQP A;  2BL0 B;  3NSK A;  1A75 B;  4QJ3 B;  1ZUZ A;  2KGR A;  2LAP A;  1NPQ A;  3OX6 A;  2M1U A;  1NX3 A;  3FWB A;  4JQ0 D;  1XFW O;  1YRT B;  1KK7 Z;  3SIB A;  4WQ2 A;  2F3Y A;  2JT0 A;  3DVK A;  1B7T Y;  1KSO A;  3KO0 A;  3IQQ A;  3DVJ A;  4CID A;  1B47 A;  1S1E A;  1Y6W A;  5ER4 X;  1ZMZ A;  2LP3 A;  3SG4 A;  4C0K A;  5KTY A;  1J1E A;  1DGV A;  2KAY A;  4DCK A;  1FBV A;  2JOJ A;  1QJT A;  5I8N A;  1QVI Y;  2WCF A;  1SCV A;  4YGD B;  2KBI A;  1CTR A;  1EL4 A;  4USL A;  5B8I B;  4YI9 A;  4NDD A;  1DGU A;  1IH0 A;  2I7A A;  2Y4Q A;  1DJY A;  2K2F A;  2ZNE A;  1ALV A;  1SNL A;  1CKK A;  2JWW A;  1CDM A;  1DMO A;  2KAX A;  4YBH B;  1S6C A;  3WXA A;  1CFC A;  1BJF A;  2Y5I A;  4M2P A;  2BL0 C;  2F3Z A;  1S36 A;  3DF0 B;  4CFR A;  1DF0 B;  2KFH A;  2BKI B;  2NCO A;  3OB2 B;  3CZT X;  4R1E A;  2L4H A;  3A4U B;  1GJY A;  1TN4 A;  1XA5 A;  1V1F A;  1AP4 A;  2JZI A;  1JC2 A;  1DJZ A;  4BY4 A;  4AQJ A;  2COL B;  2L2E A;  1OE9 B;  2KSP A;  2MAZ A;  3LK0 A;  1F8H A;  1EJ3 A;  1KWO B;  3CLN A;  2MHH A;  3CR5 X;  5DKN A;  2KDH A;  3VRR A;  1WLM A;  4Q04 A;  2M49 B;  3PM8 A;  4CLN A;  2Q4U A;  3EVR A;  4PE1 A;  1H8B A;  1G33 A;  1C7W A;  1Y1U A;  2F2O A;  3FIA A;  4PDZ A;  1GGW A;  2LVI A;  1JUO A;  5J3X A;  2ZKM X;  1J7Q A;  1OOJ A;  5DKR A;  4IL1 A;  1AUI B;  4XJK B;  4DS7 A;  1SRA A;  4YGA A;  1QV1 A;  1UUR A;  1KQM B;  4I5L B;  4BY5 A;  1CB1 A;  1J55 A;  3BOW A;  1GGZ A;  1K95 A;  3H4S E;  4DIR A;  4N1F A;  4PHN A;  2HF5 A;  3SG5 A;  2JPT A;  2JC2 A;  2KNE A;  3OX5 A;  3CR4 X;  1UP5 A;  2V53 A;  3JVT B;  2LV7 A;  5JOL A;  1IQ5 A;  1AK8 A;  3HX4 A;  1AJ4 A;  1CNP A;  1CDP A;  2GGM A;  4YI8 A;  4I5N B;  2Y1M A;  1YVH A;  2BBM A;  2LE9 B;  1SL7 A;  4MBE A;  5CSJ A;  2L98 A;  2PAL A;  1B8R A;  2SAS A;  1EXR A;  3TZ1 A;  4NDB A;  1IG5 A;  4C0J A;  1REC A;  2AAO A;  4YGE B;  4A4B A;  2ZN8 A;  3I5H B;  3KPX A;  3LK1 A;  4ZCV A;  1ODB A;  1JFK A;  4WRI A;  1DF0 A;  1K90 D;  1NWD A;  2HQW A;  2CBL A;  1K9U A;  1C7V A;  1SYM A;  1QV0 A;  1NIW A;  3I5F C;  1NYA A;  1CMF A;  1J7P A;  1F4O A;  1Y0V H;  4PCW A;  1YX7 A;  2I18 A;  2PVB A;  1J7O A;  2ZRT A;  1MXE A;  1QLS A;  4MEW A;  1K94 A;  1SL9 A;  4WQ3 A;  1L2O B;  3CR2 A;  2LMV A;  1PSR A;  3OHM B;  4A4C A;  1CDN A;  1M39 A;  1MR8 A;  1DJI A;  3A8R A;  3DVE A;  1PRW A;  4XJK A;  1UHJ A;  3JVT C;  1EH2 A;  2K61 A;  1K93 D;  1Y1A A;  2LVJ A;  1RTP 1;  1XFY O;  4MRX A;  1JF2 A;  1JFJ A;  1KFX L;  2WOR A;  1K9K A;  2R2I A;  3C1V A;  4ORB B;  2L4I A;  4PHJ A;  1UHH A;  1FF1 A;  1IJ5 A;  3TS5 C;  2JNX A;  1TCO B;  1DJW A;  1NCY A;  4FTG A;  1QS7 A;  1FPW A;  3FWC A;  2EC6 B;  4GGF C;  1BMO A;  2M29 A;  1S26 D;  2M7N A;  4DRW A;  3ICB A;  2K7C A;  3BUW B;  3MSE B;  1RJV A;  5K89 A;  1S6I A;  4OR9 B;  2CXJ A;  1IRJ A;  2LLS A;  2QPT A;  2LUX A;  1BOD A;  2LVK A;  1A29 A;  1CFP A;  2JTT A;  3I5I B;  1MQ1 A;  1QXP A;  1TCF A;  1VRK A;  1MUX A;  4GGF A;  2MLE C;  3CS1 A;  3BUN B;  2MLF C;  3NXA A;  5JJG A;  1UHI A;  2E6W A;  2M97 A;  1A2X A;  2LC5 A;  1K8U A;  3BOW B;  2E30 A;  1SBJ A;  1KK7 Y;  1L2O C;  1PVA A;  2KAV A;  1OZS A;  2NCP A;  1K2H A;  2KI6 D;  1JBA A;  1PUL A;  4XYN A;  4GNK B;  1S6J A;  2K7D A;  4OCI A;  3BQ3 A;  3EKH A;  1DTL A;  2ISD A;  1DJX A;  3BUO B;  5AXI A;  2Q91 A;  2WCE A;  4MZJ A;  1NUB A;  3O78 A;  3GK2 A;  1BU3 A;  1WLZ A;  1F71 A;  4I5K A;  2EC6 C;  3KEV A;  1QAS A;  4GGN A;  3IQO A;  3SG2 A;  1U5I B;  1KQV A;  2BCX A;  2K0J A;  1TNP A;  2JNF A;  2LAN A;  4HSZ A;  2WND A;  2BBN A;  4P5O E;  5AFP A;  1YRU B;  3ZWH A;  4PAL A;  4YRU A;  5KU1 A;  1SK6 D;  1SR6 C;  5BPJ A;  2LLU A;  3I5I C;  1DT7 B;  1A03 A;  1RK9 A;  1CM1 A;  1LVC D;  3TDZ A;  1BG1 A;  2M7L A;  1NX2 A;  2HQ8 A;  2WCB A;  3SIA A;  3EK4 A;  3SG6 A;  1F4Q A;  3EKJ A;  1PVB A;  4PHK A;  1J7R A;  5HLO A;  1WRK A;  1CM4 A;  1C07 A;  1ZAC A;  3PAL A;  2KFG A;  5CSF A;  3I5F B;  4YGC B;  2LMU A;  2LHL A;  4GFT A;  1WY9 A;  1MXL C;  1AVS A;  3HCM A;  1B9A A;  2K2A A;  1SKT A;  3QRX A;  3OP0 A;  4U8D A;  1E8A A;  2PSR A;  2BKH B;  4JWQ A;  1B1G A;  2ZFD A;  5IBW A;  2CCM A;  1SL8 A;  3LLE A;  4PE4 A;  3OB1 B;  2HET A;  2LNK A;  1YUR A;  3NSL A;  3PN7 B;  1IKU A;  3VRO A;  1RFJ A;  3WHU B;  1Q80 A;  2JT3 A;  2ZND A;  1TNX A;  2ZN9 A;  2MJW B;  1QTX A;  1ALW A;  3BYA A;  1YUS A;  2D8N A;  1R2U A;  3FS7 A;  1WRZ A;  3TS5 B;  4ORC B;  2H2K A;  2KFF A;  5GQQ C;  4PE7 A;  1IQ3 A;  2K7O A;  2MBX A;  2BE6 A;  2I2R E;  1U5I A;  3EVV A;  1IJ6 A;  1OMV A;  5ER5 A;  3SJS A;  4DUQ A;  2MRD A;  2F33 A;  1LA3 A;  1IWQ A;  2A4J A;  1SPY A;  2TN4 A;  2F2P A;  2PAS A;  2KOT A;  2JRF A;  4E68 A;  2I94 A;  1YR5 A;  1Y1X A;  4M2O A;  1TRF A;  1TNQ A;  3K21 A;  2JTZ A;  2G9B A;  5I2Q A;  2KI4 B;  1KFU L;  1AJ5 A;  4N1G A;  2LCP A;  3EK7 A;  1DJH A;  1NCX A;  2KYF A;  4D1E A;  2KGB C;  5HYD A;  3PN7 C;  1YUU A;  4ICB A;  3WHT B;  2LUC A;  4PHM A;  3KF9 A;  4UPG A;  2BCA A;  4MLW A;  3VRP A;  1PK0 D;  1SCM C;  2LP2 A;  2BCB A;  4M2Q A;  2QAC A;  3F45 A;  3O6B A;  4HRE E;  1NSH A;  5HKY A;  3PSR A;  5HKW A;  1EG3 A;  2M8U A;  2PRU A;  4ORA B;  5F6T A;  1LKJ A;  5FYX A;  4C0L A;  5I2O A;  4F0Z B;  1SW8 A;  1BF5 A;  2PMY A;  1S5G Z;  3D10 A;  3CTN A;  5CSN A;  1M46 A;  1SR6 B;  5KSZ A;  1YVL A;  2CNP A;  2KYC A;  1XFZ O;  4QJ4 B;  1BOC A;  1IGV A;  1FW4 A;  1CLL A;  1LIN A;  3GK4 X;  2BEC A;  4P2Y B;  2KI4 C;  1BR1 B;  1XVJ A;  1XO5 A;  4AQI A;  1JSA A;  3AKB A;  2OTG C;  1YX8 A;  2KBM A;  3VRQ A;  2P6B B;  1G4Y R;  2AMI A;  2K7B A;  1QAT A;  2NXQ A;  3RM1 A;  3CGA A;  2CTN A;  1N65 A;  1B7T Z;  3AKA A;  1MF8 B;  2JQ6 A;  1A4P A;  1N0Y A;  2AUC A;  1LXF C;  1NCZ A;  1XFU O;  1F54 A;  2JU0 A;  1FI6 A;  1GQM A;  2K8M B;  2M0R A;  3D0Y A;  3TDI A;  2VRG A;  1QVI Z;  3I5G C;  5AER A;  3BUM B;  1WDC B;  1TTX A;  1KFU S;  1QIW A;  1KK8 B;  3IF7 A;  3VRN A;  2FOT A;  5G08 A;  1B4C A;  2GV5 A;  1TIZ A;  4HRH A;  3TDU A;  1BT6 A;  1J1D A;  1XFV O;  2ZRS A;  1B8L A;  2M1K B;  1CFD A;  2EHB A;  2O60 A;  1F70 A;  1RWY A;  3NSO A;  1AHR A;  1M31 A;  4MRY A;  2OS8 C;  4MSP A;  2B1U A;  1KFX S;  1N2D A;  2CT9 A;  3BUX B;  3JTD C;  3SG3 A;  2OPO A;  2LLT A;  2SCP A;  1DVI A;  1F55 A;  4GUK A;  1S3P A;  1NX0 A;  3LCP C;  1H4B A;  1QX2 A;  5AAN A;  2GGZ A;  2EGD A;  2L5X B;  1YUT A;  1QIV A;  1BR4 B;  1QLK A;  1ZOT B;  5D7F A;  4YGB B;  1MHO A;  5DKQ A;  1G8I A;  1UHN A;  1D1O A;  2KQ6 A;  1CFF A;  2FCD A;  2L50 A;  4CFQ A;  4AOM A;  1R6P A;  1XYD A;  1WRL A;  4OV2 A;  1A75 A;  1M63 B;  4OKH A;  1WDC C;  1K96 A;  1KK8 C;  3EK8 A;  4TNC A;  5TNC A;  2DOQ A;  3EVU A;  4GAO A;  5CPV A;  4MZK A;  3SG7 A;  4I5J A;  1XK4 C;  2M3W A;  1BLQ A;  2IS9 A;  3TUY B;  1B8C A;  3BXK A;  4CPV A;  2FJU B;  3NSI A;  3WNX B;  5HKZ A;  1SCM B;  1JF0 A;  4N5X A;  1HT9 A;  2LM5 A;  4NQG A;  1FI5 A;  2M9G A;  1UUS A;  1X02 A;  1MWN A;  5AEQ A;  4QJ5 B;  1XFX O;  1RRO A;  2H61 C;  3M0W A;  1XK4 A;  3GK1 A;  1JWD A;  3PLF B;  1TNW A;  4NDC A;  3CWG A;  1EG4 A;  3E3R A;  3RLZ A;  2WC8 A;  3O2P A;  2JXL A;  3AAK A;  2LMT A;  1NX1 A;  5HLV A;  5I2L A;  1K9P A;  1OZO A;  1L7Z A;  3AAJ A;  1CMG A;  4FQO A;  1DJG A;  4MN0 A;  2H61 A;  1UHK A;  1M45 A;  2O5G A;  2F8P A;  2OTG B;  1KSM A;  3D0Y B;  5PAL A;  1NP8 A;  2LHI A;  1CDL A;  1OMR A;  4ETO A;  3KHE A;  3ZNI A;  4ZCU A;  1KWO C;  1HQV A;  2MA2 A;  2NLN A;  1ZFS A;  3DF0 A;  4OVN F;  2JUL A;  2KQY A;  2HPS A;  4MVF A;  5D69 A;  1W7J B;  3PAT A;  3TUY C;  3O4Y A;  2NZ0 A;  2FCE A;  4PE0 A;  2KI6 C;  1YTZ C;  4L9M A;  2LVV A;  2JT8 A;  2WOS A;  3I5G B;  1KQM C;  2KHN A;  1SMG A;  1KCY A;  4HRG A;  2JXC A;  1LA0 A;  4MZL A;  4GPL B;  1CLM A;  2L0P A;  2BE4 A;  5CSI A;  3DD4 A;  1QX5 B; 
#chains in the Genus database with same CATH topology
 2Y1N A;  3VGO A;  3NHT A;  1DC1 A;  2OS8 B;  3PFV A;  3DVM A;  2L51 A;  5FI2 A;  1W7I B;  1ORG A;  1PAL A;  3GOF A;  1OSA A;  1V1G A;  1SY9 A;  2G2B A;  2RGI A;  1TOP A;  3JTD B;  4GBA A;  4JPZ B;  1S5G Y;  1UWO A;  3LL8 B;  2BAP A;  1PSB A;  1CLB A;  1QX7 A;  1OMD A;  3I5H C;  2KLE A;  1OQP A;  1T14 A;  2BL0 B;  1A75 B;  2WCM A;  3CZ1 A;  3NSK A;  4QJ3 B;  1ZUZ A;  2KGR A;  2LAP A;  1NPQ A;  5D3O A;  3OX6 A;  2M1U A;  1NX3 A;  3FWB A;  5EL2 A;  4JQ0 D;  1XFW O;  1YRT B;  1KK7 Z;  3SIB A;  4WQ2 A;  5I94 A;  2F3Y A;  2JT0 A;  3DVK A;  1B7T Y;  1KSO A;  3KO0 A;  3IQQ A;  3DVJ A;  4CID A;  1B47 A;  1S1E A;  1Y6W A;  5ER4 X;  1ZMZ A;  2LP3 A;  3SG4 A;  4C0K A;  5KTY A;  1J1E A;  1DGV A;  2KAY A;  4DCK A;  1FBV A;  2JOJ A;  1QJT A;  5I8N A;  1QVI Y;  2WCF A;  1SCV A;  3EG5 B;  4YGD B;  2KBI A;  1CTR A;  1EL4 A;  4USL A;  5B8I B;  4YI9 A;  4NDD A;  1DGU A;  1IH0 A;  2I7A A;  2Y4Q A;  1DJY A;  2K2F A;  2ZNE A;  3B6X A;  1ALV A;  1SNL A;  1CKK A;  2JWW A;  1CDM A;  1DMO A;  2KAX A;  4YBH B;  1S6C A;  3WXA A;  1CFC A;  1BJF A;  2Y5I A;  4M2P A;  2BL0 C;  2F3Z A;  1S36 A;  3DF0 B;  4CFR A;  1DF0 B;  2KFH A;  2BKI B;  2NCO A;  3OB2 B;  3CZT X;  4R1E A;  2L4H A;  3A4U B;  1GJY A;  1TN4 A;  1XA5 A;  1V1F A;  1AP4 A;  2JZI A;  1JC2 A;  1XFR A;  1DJZ A;  4BY4 A;  4AQJ A;  4IJ7 A;  2COL B;  2L2E A;  1OE9 B;  2KSP A;  2MAZ A;  3LK0 A;  2WC5 A;  1EJ3 A;  1KWO B;  3IVT A;  3CLN A;  2MHH A;  3CR5 X;  5DKN A;  2KDH A;  3VRR A;  1WLM A;  4Q04 A;  2M49 B;  3PM8 A;  1OOG A;  2Q4U A;  3EVR A;  4PE1 A;  4CLN A;  1H8B A;  1G33 A;  1DQE A;  4INX A;  1C7W A;  1Y1U A;  2F2O A;  3FIA A;  4PDZ A;  1GGW A;  2LVI A;  1JUO A;  5J3X A;  2ZKM X;  3FE8 A;  1OOJ A;  1J7Q A;  5DKR A;  4IL1 A;  1AUI B;  3L4A A;  4XJK B;  4DS7 A;  1SRA A;  4YGA A;  1QV1 A;  1UUR A;  1KQM B;  4I5L B;  4BY5 A;  1CB1 A;  1J55 A;  3BOW A;  1GGZ A;  1K95 A;  2WCH A;  3H4S E;  4JD9 A;  4DIR A;  4N1F A;  4PHN A;  2HF5 A;  3SG5 A;  3BFA A;  2JPT A;  2JC2 A;  2KNE A;  3OX5 A;  3CR4 X;  1UP5 A;  2V53 A;  3JVT B;  2LV7 A;  5JOL A;  1IQ5 A;  1AK8 A;  3HX4 A;  1AJ4 A;  3B86 A;  1CDP A;  3S0D A;  1CNP A;  2GGM A;  4YI8 A;  3DXL A;  2Y1M A;  1YVH A;  2BBM A;  2LE9 B;  3R72 A;  4I5N B;  1SL7 A;  4MBE A;  5CSJ A;  2L98 A;  2PAL A;  1B8R A;  2SAS A;  1EXR A;  2QEH A;  3TZ1 A;  4NDB A;  1IG5 A;  4C0J A;  3DZT A;  1REC A;  2AAO A;  4YGE B;  4A4B A;  2ZN8 A;  3I5H B;  3KPX A;  3LK1 A;  4ZCV A;  3RZS A;  1ODB A;  3R1V A;  4KYN A;  1JFK A;  4WRI A;  2KLD A;  1DF0 A;  1K90 D;  1NWD A;  2HQW A;  2CBL A;  3PJI A;  1K9U A;  1C7V A;  1SYM A;  1QV0 A;  1NIW A;  3I5F C;  3O4X A;  1NYA A;  3SS4 A;  1CMF A;  1J7P A;  1F4O A;  1Y0V H;  4PCW A;  1YX7 A;  2I18 A;  2PVB A;  1J7O A;  2ZRT A;  1MXE A;  1QLS A;  4MEW A;  1K94 A;  1SL9 A;  3BJH A;  1L2O B;  2K60 A;  4WQ3 A;  3CR2 A;  3D74 A;  2LMV A;  3S0G A;  1PSR A;  3OHM B;  4A4C A;  1CDN A;  1M39 A;  1MR8 A;  1IIO A;  1DJI A;  3A8R A;  3DVE A;  1PRW A;  4XJK A;  1UHJ A;  3JVT C;  1EH2 A;  2K61 A;  1K93 D;  1Y1A A;  2LVJ A;  3L47 A;  1GM0 A;  1RTP 1;  3L4L A;  1XFY O;  4MRX A;  1JF2 A;  3V2L A;  1KFX L;  2WOR A;  1JFJ A;  1K9K A;  2R2I A;  3SS5 A;  3C1V A;  4ORB B;  2L4I A;  3FE9 A;  1UHH A;  4PHJ A;  1FF1 A;  1IJ5 A;  3TS5 C;  2JNX A;  1TCO B;  2FJY A;  4JKT A;  1DJW A;  1NCY A;  4FTG A;  1QS7 A;  1FPW A;  3FWC A;  2EC6 B;  4GGF C;  1BMO A;  2M29 A;  1S26 D;  2M7N A;  4DRW A;  3ICB A;  2K7C A;  3BUW B;  3MSE B;  1RJV A;  5K89 A;  1S6I A;  4OR9 B;  2CXJ A;  1IRJ A;  2LLS A;  2QPT A;  2LUX A;  1DEK A;  1OOF A;  2LVK A;  3UO9 A;  1BOD A;  1A29 A;  1CFP A;  2JTT A;  3I5I B;  1MQ1 A;  1QXP A;  1TCF A;  2PYQ A;  1VRK A;  1MUX A;  4GGF A;  2MLE C;  3CS1 A;  3BUN B;  2MLF C;  3NXA A;  5JJG A;  1UHI A;  2E6W A;  2M97 A;  1A2X A;  2LC5 A;  1K8U A;  3BOW B;  2E30 A;  1SBJ A;  1KK7 Y;  1L2O C;  1PVA A;  2KAV A;  5FI7 A;  1OZS A;  2NCP A;  1K2H A;  2KI6 D;  3B7A A;  1JBA A;  1PUL A;  4XYN A;  4GNK B;  1QWV A;  1S6J A;  2K7D A;  3D75 A;  4OCI A;  3NGV A;  3BQ3 A;  4F7F A;  3EKH A;  1DTL A;  2ISD A;  1DJX A;  4OZD A;  3BUO B;  5AXI A;  2Q91 A;  2WCE A;  4MZJ A;  1NUB A;  3O78 A;  3GK2 A;  1BU3 A;  1WLZ A;  1F71 A;  4I5K A;  2EC6 C;  3KEV A;  3CDN A;  1QAS A;  4GGN A;  3IQO A;  3SG2 A;  1U5I B;  1KQV A;  2BCX A;  2K0J A;  1TNP A;  2JNF A;  2LAN A;  4HSZ A;  2WND A;  2BBN A;  2KPH A;  4P5O E;  5AFP A;  1YRU B;  3ZWH A;  4PAL A;  4YRU A;  5KU1 A;  1SK6 D;  1SR6 C;  5BPJ A;  2LLU A;  3I5I C;  1DT7 B;  1F8H A;  1A03 A;  1RK9 A;  3DYE A;  1CM1 A;  1LVC D;  3TDZ A;  1Z2C B;  2M7L A;  1BG1 A;  1NX2 A;  2HQ8 A;  2WCB A;  3SIA A;  3EK4 A;  3SG6 A;  1F4Q A;  3EKJ A;  1PVB A;  4PHK A;  1J7R A;  5HLO A;  1WRK A;  1CM4 A;  1C07 A;  1ZAC A;  3PAL A;  2KFG A;  5CSF A;  3I5F B;  4YGC B;  2WCK A;  2LMU A;  2LHL A;  4GFT A;  1WY9 A;  1MXL C;  1AVS A;  3NHI A;  3HCM A;  1B9A A;  2K2A A;  1SKT A;  3QRX A;  3OP0 A;  4U8D A;  1E8A A;  2PSR A;  2BKH B;  4JWQ A;  1B1G A;  2ZFD A;  3S0E A;  5IBW A;  2CCM A;  1SL8 A;  3LLE A;  4PE4 A;  3OB1 B;  2HET A;  2LNK A;  1YUR A;  3NSL A;  3PN7 B;  1IKU A;  3VRO A;  1RFJ A;  3WHU B;  1Q80 A;  2JT3 A;  2ZND A;  2WCL A;  1TNX A;  2ZN9 A;  2MJW B;  1QTX A;  1Z4H A;  1ALW A;  3BYA A;  1YUS A;  2D8N A;  1R2U A;  3FS7 A;  1WRZ A;  3TS5 B;  3Q8I A;  4ORC B;  2H2K A;  2KFF A;  5GQQ C;  4PE7 A;  1IQ3 A;  2K7O A;  2MBX A;  2BE6 A;  2I2R E;  1U5I A;  3EVV A;  1IJ6 A;  1OMV A;  5ER5 A;  3SJS A;  4DUQ A;  2MRD A;  3QME A;  2F33 A;  1LA3 A;  1IWQ A;  2A4J A;  1SPY A;  2TN4 A;  2F2P A;  2PAS A;  2KOT A;  2JRF A;  4E68 A;  2I94 A;  1C3Y A;  1YR5 A;  2P70 A;  2L5Y A;  1Y1X A;  2QEV A;  4M2O A;  1TRF A;  1TNQ A;  3K21 A;  2JTZ A;  2G9B A;  5I2Q A;  2KI4 B;  1KFU L;  1AJ5 A;  4N1G A;  1DEL A;  2LCP A;  3EK7 A;  1DJH A;  1NCX A;  1TUZ A;  2KYF A;  4D1E A;  3K1E A;  2KGB C;  2YGU A;  5HYD A;  2ERB A;  3D73 A;  3PN7 C;  1YUU A;  4ICB A;  3WHT B;  2LUC A;  4PHM A;  3KF9 A;  4UPG A;  2BCA A;  4MLW A;  3VRP A;  1PK0 D;  1SCM C;  2LP2 A;  2BCB A;  4M2Q A;  2QAC A;  3F45 A;  3O6B A;  4HRE E;  1NSH A;  5HKY A;  3PSR A;  5HKW A;  1EG3 A;  2M8U A;  2PRU A;  4ORA B;  2QEO A;  1TUJ A;  1LS8 A;  1LKJ A;  5DIC A;  5F6T A;  5FYX A;  4C0L A;  5I2O A;  4F0Z B;  1SW8 A;  1BF5 A;  1OOI X;  2PMY A;  1S5G Z;  3D10 A;  4PT1 A;  1W9Z A;  3CTN A;  5CSN A;  1M46 A;  1SR6 B;  5KSZ A;  1YVL A;  2CNP A;  2KYC A;  1XFZ O;  4QJ4 B;  1BOC A;  1IGV A;  1FW4 A;  1CLL A;  1LIN A;  3GK4 X;  2BEC A;  4P2Y B;  2KI4 C;  1BR1 B;  1XVJ A;  1XO5 A;  4AQI A;  1JSA A;  3AKB A;  2OTG C;  1YX8 A;  2KBM A;  3VRQ A;  2P6B B;  1G4Y R;  2AMI A;  2K7B A;  3BFB A;  1QAT A;  2WCJ A;  3S0A A;  2NXQ A;  3RM1 A;  3CGA A;  2CTN A;  1N65 A;  1B7T Z;  3AKA A;  1MF8 B;  3DY9 A;  2JQ6 A;  1A4P A;  1N0Y A;  2AUC A;  1LXF C;  4INW A;  1NCZ A;  1XFU O;  1F54 A;  2JU0 A;  1FI6 A;  1GQM A;  2K8M B;  2M0R A;  3D0Y A;  3TDI A;  2VRG A;  1C3Z A;  1QVI Z;  3I5G C;  3PM2 A;  3BUM B;  5AER A;  1WDC B;  1TTX A;  3S0F A;  1KFU S;  1QIW A;  1KK8 B;  3IF7 A;  3VRN A;  2FOT A;  5G08 A;  1B4C A;  1TWO A;  3R1O A;  2GV5 A;  1TIZ A;  5FI6 A;  4HRH A;  3TDU A;  1BT6 A;  1J1D A;  1XFV O;  2ZRS A;  1B8L A;  2M1K B;  1CFD A;  3SS3 A;  3S0B A;  2EHB A;  2O60 A;  1F70 A;  1RWY A;  3NSO A;  1AHR A;  1M31 A;  4MRY A;  2OS8 C;  4MSP A;  2B1U A;  1KFX S;  1N2D A;  2CT9 A;  3BUX B;  2JPO A;  3JTD C;  3SG3 A;  2OPO A;  2LLT A;  2SCP A;  1DVI A;  1F55 A;  2WC6 A;  4GUK A;  5HL1 A;  1S3P A;  1NX0 A;  3LCP C;  1H4B A;  1QX2 A;  5AAN A;  2GGZ A;  2EGD A;  2L5X B;  1YUT A;  1QIV A;  1BR4 B;  1OOH A;  1QLK A;  1OW4 A;  1ZOT B;  4YGB B;  3BFH A;  1MHO A;  5D7F A;  3VB1 A;  5DKQ A;  1G8I A;  1UHN A;  1D1O A;  2GTE A;  2KQ6 A;  1CFF A;  2FCD A;  2L50 A;  4CFQ A;  4AOM A;  1R6P A;  1XYD A;  1WRL A;  4OV2 A;  1A75 A;  1M63 B;  4OKH A;  1WDC C;  1K96 A;  1KK8 C;  3EK8 A;  4TNC A;  5TNC A;  2DOQ A;  3EVU A;  3CZ2 A;  4GAO A;  4MZK A;  5CPV A;  4I5J A;  1XK4 C;  2M3W A;  4FQT A;  3SG7 A;  3D77 A;  2IS9 A;  3TUY B;  1B8C A;  3BXK A;  4CPV A;  2FJU B;  3NSI A;  3WNX B;  5HKZ A;  1SCM B;  1JF0 A;  4N5X A;  1HT9 A;  2LM5 A;  4NQG A;  1FI5 A;  2M9G A;  1UUS A;  1X02 A;  1MWN A;  5AEQ A;  4QJ5 B;  1XFX O;  3D78 A;  1RRO A;  2H61 C;  3M0W A;  1XK4 A;  3GK1 A;  1JWD A;  3PLF B;  3N7H A;  1TNW A;  4NDC A;  3CWG A;  1EG4 A;  2QEB A;  3E3R A;  3RLZ A;  2WC8 A;  3CZ0 A;  2JXL A;  3O2P A;  3AAK A;  2LMT A;  1NX1 A;  2L2C A;  5HLV A;  5I2L A;  1K9P A;  1OZO A;  2QDI A;  1L7Z A;  3AAJ A;  1CMG A;  3OGN A;  4FQO A;  3CYZ A;  1DJG A;  4MN0 A;  2H61 A;  1UHK A;  2H8V A;  1M45 A;  2O5G A;  2F8P A;  2OTG B;  1KSM A;  3D0Y B;  5PAL A;  1NP8 A;  2LHI A;  1CDL A;  1OMR A;  4ETO A;  3KHE A;  3ZNI A;  4ZCU A;  1KWO C;  1HQV A;  2MA2 A;  2NLN A;  1ZFS A;  2PQL A;  3DF0 A;  4OVN F;  2JUL A;  2KQY A;  2HPS A;  4MVF A;  5D69 A;  1W7J B;  3PAT A;  3R1P A;  1BLQ A;  3TUY C;  3O4Y A;  1P28 A;  2FCE A;  2NZ0 A;  4PE0 A;  2KI6 C;  1YTZ C;  3D76 A;  4L9M A;  2P71 A;  2LVV A;  2JT8 A;  2WOS A;  3B87 A;  3I5G B;  3UNW A;  1KQM C;  1SSE B;  3OBV A;  2KHN A;  3CAB A;  1SMG A;  3B88 A;  4HRG A;  2JXC A;  1LA0 A;  4MZL A;  1KCY A;  4GPL B;  2BNX A;  1CLM A;  2L0P A;  2BE4 A;  5CSI A;  3DD4 A;  3FE6 A;  1QX5 B; 
#chains in the Genus database with same CATH homology
 2Y1N A;  3VGO A;  2OS8 B;  3PFV A;  3DVM A;  2L51 A;  1W7I B;  3GOF A;  1PAL A;  1OSA A;  1V1G A;  1SY9 A;  2G2B A;  2RGI A;  1TOP A;  3JTD B;  4GBA A;  4JPZ B;  1S5G Y;  1UWO A;  3LL8 B;  1PSB A;  1CLB A;  1QX7 A;  1OMD A;  3I5H C;  1OQP A;  2BL0 B;  3NSK A;  1A75 B;  4QJ3 B;  1ZUZ A;  2KGR A;  2LAP A;  1NPQ A;  3OX6 A;  2M1U A;  1NX3 A;  3FWB A;  4JQ0 D;  1XFW O;  1YRT B;  1KK7 Z;  3SIB A;  4WQ2 A;  2F3Y A;  2JT0 A;  3DVK A;  1B7T Y;  1KSO A;  3KO0 A;  3IQQ A;  3DVJ A;  4CID A;  1B47 A;  1S1E A;  1Y6W A;  5ER4 X;  1ZMZ A;  2LP3 A;  3SG4 A;  4C0K A;  5KTY A;  1J1E A;  1DGV A;  2KAY A;  4DCK A;  1FBV A;  2JOJ A;  1QJT A;  5I8N A;  1QVI Y;  2WCF A;  1SCV A;  4YGD B;  2KBI A;  1CTR A;  1EL4 A;  4USL A;  5B8I B;  4YI9 A;  4NDD A;  1DGU A;  1IH0 A;  2I7A A;  2Y4Q A;  1DJY A;  2K2F A;  2ZNE A;  1ALV A;  1SNL A;  1CKK A;  2JWW A;  1CDM A;  1DMO A;  2KAX A;  4YBH B;  1S6C A;  3WXA A;  1CFC A;  1BJF A;  2Y5I A;  4M2P A;  2BL0 C;  2F3Z A;  1S36 A;  3DF0 B;  4CFR A;  1DF0 B;  2KFH A;  2BKI B;  2NCO A;  3OB2 B;  3CZT X;  4R1E A;  2L4H A;  3A4U B;  1GJY A;  1TN4 A;  1XA5 A;  1V1F A;  1AP4 A;  2JZI A;  1JC2 A;  1DJZ A;  4BY4 A;  4AQJ A;  2COL B;  2L2E A;  1OE9 B;  2KSP A;  2MAZ A;  3LK0 A;  1F8H A;  1EJ3 A;  1KWO B;  3CLN A;  2MHH A;  3CR5 X;  5DKN A;  2KDH A;  3VRR A;  1WLM A;  4Q04 A;  2M49 B;  3PM8 A;  4CLN A;  2Q4U A;  3EVR A;  4PE1 A;  1H8B A;  1G33 A;  1C7W A;  1Y1U A;  2F2O A;  3FIA A;  4PDZ A;  1GGW A;  2LVI A;  1JUO A;  5J3X A;  2ZKM X;  1J7Q A;  1OOJ A;  5DKR A;  4IL1 A;  1AUI B;  4XJK B;  4DS7 A;  1SRA A;  4YGA A;  1QV1 A;  1UUR A;  1KQM B;  4I5L B;  4BY5 A;  1CB1 A;  1J55 A;  3BOW A;  1GGZ A;  1K95 A;  3H4S E;  4DIR A;  4N1F A;  4PHN A;  2HF5 A;  3SG5 A;  2JPT A;  2JC2 A;  2KNE A;  3OX5 A;  3CR4 X;  1UP5 A;  2V53 A;  3JVT B;  2LV7 A;  5JOL A;  1IQ5 A;  1AK8 A;  3HX4 A;  1AJ4 A;  1CNP A;  1CDP A;  2GGM A;  4YI8 A;  4I5N B;  2Y1M A;  1YVH A;  2BBM A;  2LE9 B;  1SL7 A;  4MBE A;  5CSJ A;  2L98 A;  2PAL A;  1B8R A;  2SAS A;  1EXR A;  3TZ1 A;  4NDB A;  1IG5 A;  4C0J A;  1REC A;  2AAO A;  4YGE B;  4A4B A;  2ZN8 A;  3I5H B;  3KPX A;  3LK1 A;  4ZCV A;  1ODB A;  1JFK A;  4WRI A;  1DF0 A;  1K90 D;  1NWD A;  2HQW A;  2CBL A;  1K9U A;  1C7V A;  1SYM A;  1QV0 A;  1NIW A;  3I5F C;  1NYA A;  1CMF A;  1J7P A;  1F4O A;  1Y0V H;  4PCW A;  1YX7 A;  2I18 A;  2PVB A;  1J7O A;  2ZRT A;  1MXE A;  1QLS A;  4MEW A;  1K94 A;  1SL9 A;  4WQ3 A;  1L2O B;  3CR2 A;  2LMV A;  1PSR A;  3OHM B;  4A4C A;  1CDN A;  1M39 A;  1MR8 A;  1DJI A;  3A8R A;  3DVE A;  1PRW A;  4XJK A;  1UHJ A;  3JVT C;  1EH2 A;  2K61 A;  1K93 D;  1Y1A A;  2LVJ A;  1RTP 1;  1XFY O;  4MRX A;  1JF2 A;  1JFJ A;  1KFX L;  2WOR A;  1K9K A;  2R2I A;  3C1V A;  4ORB B;  2L4I A;  4PHJ A;  1UHH A;  1FF1 A;  1IJ5 A;  3TS5 C;  2JNX A;  1TCO B;  1DJW A;  1NCY A;  4FTG A;  1QS7 A;  1FPW A;  3FWC A;  2EC6 B;  4GGF C;  1BMO A;  2M29 A;  1S26 D;  2M7N A;  4DRW A;  3ICB A;  2K7C A;  3BUW B;  3MSE B;  1RJV A;  5K89 A;  1S6I A;  4OR9 B;  2CXJ A;  1IRJ A;  2LLS A;  2QPT A;  2LUX A;  1BOD A;  2LVK A;  1A29 A;  1CFP A;  2JTT A;  3I5I B;  1MQ1 A;  1QXP A;  1TCF A;  1VRK A;  1MUX A;  4GGF A;  2MLE C;  3CS1 A;  3BUN B;  2MLF C;  3NXA A;  5JJG A;  1UHI A;  2E6W A;  2M97 A;  1A2X A;  2LC5 A;  1K8U A;  3BOW B;  2E30 A;  1SBJ A;  1KK7 Y;  1L2O C;  1PVA A;  2KAV A;  1OZS A;  2NCP A;  1K2H A;  2KI6 D;  1JBA A;  1PUL A;  4XYN A;  4GNK B;  1S6J A;  2K7D A;  4OCI A;  3BQ3 A;  3EKH A;  1DTL A;  2ISD A;  1DJX A;  3BUO B;  5AXI A;  2Q91 A;  2WCE A;  4MZJ A;  1NUB A;  3O78 A;  3GK2 A;  1BU3 A;  1WLZ A;  1F71 A;  4I5K A;  2EC6 C;  3KEV A;  1QAS A;  4GGN A;  3IQO A;  3SG2 A;  1U5I B;  1KQV A;  2BCX A;  2K0J A;  1TNP A;  2JNF A;  2LAN A;  4HSZ A;  2WND A;  2BBN A;  4P5O E;  5AFP A;  1YRU B;  3ZWH A;  4PAL A;  4YRU A;  5KU1 A;  1SK6 D;  1SR6 C;  5BPJ A;  2LLU A;  3I5I C;  1DT7 B;  1A03 A;  1RK9 A;  1CM1 A;  1LVC D;  3TDZ A;  1BG1 A;  2M7L A;  1NX2 A;  2HQ8 A;  2WCB A;  3SIA A;  3EK4 A;  3SG6 A;  1F4Q A;  3EKJ A;  1PVB A;  4PHK A;  1J7R A;  5HLO A;  1WRK A;  1CM4 A;  1C07 A;  1ZAC A;  3PAL A;  2KFG A;  5CSF A;  3I5F B;  4YGC B;  2LMU A;  2LHL A;  4GFT A;  1WY9 A;  1MXL C;  1AVS A;  3HCM A;  1B9A A;  2K2A A;  1SKT A;  3QRX A;  3OP0 A;  4U8D A;  1E8A A;  2PSR A;  2BKH B;  4JWQ A;  1B1G A;  2ZFD A;  5IBW A;  2CCM A;  1SL8 A;  3LLE A;  4PE4 A;  3OB1 B;  2HET A;  2LNK A;  1YUR A;  3NSL A;  3PN7 B;  1IKU A;  3VRO A;  1RFJ A;  3WHU B;  1Q80 A;  2JT3 A;  2ZND A;  1TNX A;  2ZN9 A;  2MJW B;  1QTX A;  1ALW A;  3BYA A;  1YUS A;  2D8N A;  1R2U A;  3FS7 A;  1WRZ A;  3TS5 B;  4ORC B;  2H2K A;  2KFF A;  5GQQ C;  4PE7 A;  1IQ3 A;  2K7O A;  2MBX A;  2BE6 A;  2I2R E;  1U5I A;  3EVV A;  1IJ6 A;  1OMV A;  5ER5 A;  3SJS A;  4DUQ A;  2MRD A;  2F33 A;  1LA3 A;  1IWQ A;  2A4J A;  1SPY A;  2TN4 A;  2F2P A;  2PAS A;  2KOT A;  2JRF A;  4E68 A;  2I94 A;  1YR5 A;  1Y1X A;  4M2O A;  1TRF A;  1TNQ A;  3K21 A;  2JTZ A;  2G9B A;  5I2Q A;  2KI4 B;  1KFU L;  1AJ5 A;  4N1G A;  2LCP A;  3EK7 A;  1DJH A;  1NCX A;  2KYF A;  4D1E A;  2KGB C;  5HYD A;  3PN7 C;  1YUU A;  4ICB A;  3WHT B;  2LUC A;  4PHM A;  3KF9 A;  4UPG A;  2BCA A;  4MLW A;  3VRP A;  1PK0 D;  1SCM C;  2LP2 A;  2BCB A;  4M2Q A;  2QAC A;  3F45 A;  3O6B A;  4HRE E;  1NSH A;  5HKY A;  3PSR A;  5HKW A;  1EG3 A;  2M8U A;  2PRU A;  4ORA B;  5F6T A;  1LKJ A;  5FYX A;  4C0L A;  5I2O A;  4F0Z B;  1SW8 A;  1BF5 A;  2PMY A;  1S5G Z;  3D10 A;  3CTN A;  5CSN A;  1M46 A;  1SR6 B;  5KSZ A;  1YVL A;  2CNP A;  2KYC A;  1XFZ O;  4QJ4 B;  1BOC A;  1IGV A;  1FW4 A;  1CLL A;  1LIN A;  3GK4 X;  2BEC A;  4P2Y B;  2KI4 C;  1BR1 B;  1XVJ A;  1XO5 A;  4AQI A;  1JSA A;  3AKB A;  2OTG C;  1YX8 A;  2KBM A;  3VRQ A;  2P6B B;  1G4Y R;  2AMI A;  2K7B A;  1QAT A;  2NXQ A;  3RM1 A;  3CGA A;  2CTN A;  1N65 A;  1B7T Z;  3AKA A;  1MF8 B;  2JQ6 A;  1A4P A;  1N0Y A;  2AUC A;  1LXF C;  1NCZ A;  1XFU O;  1F54 A;  2JU0 A;  1FI6 A;  1GQM A;  2K8M B;  2M0R A;  3D0Y A;  3TDI A;  2VRG A;  1QVI Z;  3I5G C;  5AER A;  3BUM B;  1WDC B;  1TTX A;  1KFU S;  1QIW A;  1KK8 B;  3IF7 A;  3VRN A;  2FOT A;  5G08 A;  1B4C A;  2GV5 A;  1TIZ A;  4HRH A;  3TDU A;  1BT6 A;  1J1D A;  1XFV O;  2ZRS A;  1B8L A;  2M1K B;  1CFD A;  2EHB A;  2O60 A;  1F70 A;  1RWY A;  3NSO A;  1AHR A;  1M31 A;  4MRY A;  2OS8 C;  4MSP A;  2B1U A;  1KFX S;  1N2D A;  2CT9 A;  3BUX B;  3JTD C;  3SG3 A;  2OPO A;  2LLT A;  2SCP A;  1DVI A;  1F55 A;  4GUK A;  1S3P A;  1NX0 A;  3LCP C;  1H4B A;  1QX2 A;  5AAN A;  2GGZ A;  2EGD A;  2L5X B;  1YUT A;  1QIV A;  1BR4 B;  1QLK A;  1ZOT B;  5D7F A;  4YGB B;  1MHO A;  5DKQ A;  1G8I A;  1UHN A;  1D1O A;  2KQ6 A;  1CFF A;  2FCD A;  2L50 A;  4CFQ A;  4AOM A;  1R6P A;  1XYD A;  1WRL A;  4OV2 A;  1A75 A;  1M63 B;  4OKH A;  1WDC C;  1K96 A;  1KK8 C;  3EK8 A;  4TNC A;  5TNC A;  2DOQ A;  3EVU A;  4GAO A;  5CPV A;  4MZK A;  3SG7 A;  4I5J A;  1XK4 C;  2M3W A;  1BLQ A;  2IS9 A;  3TUY B;  1B8C A;  3BXK A;  4CPV A;  2FJU B;  3NSI A;  3WNX B;  5HKZ A;  1SCM B;  1JF0 A;  4N5X A;  1HT9 A;  2LM5 A;  4NQG A;  1FI5 A;  2M9G A;  1UUS A;  1X02 A;  1MWN A;  5AEQ A;  4QJ5 B;  1XFX O;  1RRO A;  2H61 C;  3M0W A;  1XK4 A;  3GK1 A;  1JWD A;  3PLF B;  1TNW A;  4NDC A;  3CWG A;  1EG4 A;  3E3R A;  3RLZ A;  2WC8 A;  3O2P A;  2JXL A;  3AAK A;  2LMT A;  1NX1 A;  5HLV A;  5I2L A;  1K9P A;  1OZO A;  1L7Z A;  3AAJ A;  1CMG A;  4FQO A;  1DJG A;  4MN0 A;  2H61 A;  1UHK A;  1M45 A;  2O5G A;  2F8P A;  2OTG B;  1KSM A;  3D0Y B;  5PAL A;  1NP8 A;  2LHI A;  1CDL A;  1OMR A;  4ETO A;  3KHE A;  3ZNI A;  4ZCU A;  1KWO C;  1HQV A;  2MA2 A;  2NLN A;  1ZFS A;  3DF0 A;  4OVN F;  2JUL A;  2KQY A;  2HPS A;  4MVF A;  5D69 A;  1W7J B;  3PAT A;  3TUY C;  3O4Y A;  2NZ0 A;  2FCE A;  4PE0 A;  2KI6 C;  1YTZ C;  4L9M A;  2LVV A;  2JT8 A;  2WOS A;  3I5G B;  1KQM C;  2KHN A;  1SMG A;  1KCY A;  4HRG A;  2JXC A;  1LA0 A;  4MZL A;  4GPL B;  1CLM A;  2L0P A;  2BE4 A;  5CSI A;  3DD4 A;  1QX5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...