1TRFA

Solution structure of the tr1c fragment of skeletal muscle troponin-c
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN C
publication title Solution structure of the TR1C fragment of skeletal muscle troponin-C.
pubmed rcsb
source organism Meleagris gallopavo
molecule tags Muscle protein
total genus 16
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1993-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1trfA00
4ZCVA 1NX0A 2LVIA 1IWQA 1CFFA 3O78A 1XK4C 3GK4X 5AANA 2ZNEA 1N0YA 2ZN8A 1EG3A 2L0PA 4WRIA 4CIDA 1NYAA 2LMUA 2RGIA 1KK8B 1SW8A 4I5LB 2WCBA 4NDDA 1TNPA 1NPQA 3VGOA 1MF8B 1D1OA 3JVTB 1TTXA 1DJIA 1SY9A 3HCMA 4N5XA 1ZFSA 1YURA 1OMRA 4PHKA 1SK6D 1YUTA 4JQ0D 4DCKA 1M39A 3ZWHA 4OCIA 2WCEA 3AKAA 1MR8A 1R6PA 3ICBA 3PN7B 3RLZA 1QVIZ 3O6BA 2JT8A 3CR5X 1QX5B 1K9KA 3O4YA 1J7OA 4N1FA 1FW4A 2K8MB 3ZNIA 1IJ6A 1CFDA 1UHJA 1F71A 1OZOA 1XFVO 2D8NA 1QXPA 1C07A 1NCYA 4WQ3A 3SIBA 4DS7A 2PVBA 1S6JA 2HETA 2JC2A 4GGFC 4A4CA 1KCYA 1A75B 1HT9A 1RWYA 2JOJA 5GQQC 2K7BA 2LLSA 1CTRA 2JNXA 1K9UA 1LA0A 3DF0B 3SG6A 3PLFB 1PVBA 1S5GZ 1K95A 5HLVA 1JF0A 1JSAA 1ZACA 1K2HA 3K21A 1S36A 4I5JA 5AXIA 2VRGA 3JTDC 1K94A 3CTNA 4WQ2A 4YI9A 3DVKA 1IQ3A 1JFKA 2LHLA 2I2RE 3A4UB 5AFPA 1OZSA 1CLMA 4C0KA 1SL9A 4MZJA 2ISDA 2LLTA 3EKHA 2KGRA 1WRZA 1CB1A 4GUKA 1KSOA 2F33A 4GBAA 1DF0B 4F0ZB 1CMFA 3CS1A 2WORA 1YX7A 1KK8C 1WDCB 1OOJA 1F70A 2M0RA 3TZ1A 1KK7Y 2L98A 2LCPA 4MLWA 4Q04A 1CDMA 1BU3A 2ZKMX 2Y1NA 1J55A 4P5OE 1ZOTB 2KFFA 1JF2A 2JXLA 3BUMB 1OMVA 3VRPA 4PHNA 2I7AA 1QX2A 2LMTA 1KFXL 3I5FC 5I2QA 1V1FA 1NCXA 2KFGA 3OB2B 1TCOB 1FBVA 4HRGA 3PN7C 1JUOA 1L2OC 3D0YA 5G08A 2K7CA 3DVEA 4BY4A 2CCMA 3SG7A 4HRHA 2NCOA 3LL8B 3E3RA 1CDPA 1ZMZA 3CR4X 1DT7B 1G33A 1C7WA 3F45A 4XYNA 5AERA 3VRQA 3VRRA 4NDCA 3FIAA 1TRFA 3GOFA 3VRNA 1DJYA 1SCVA 1S3PA 1B1GA 5D69A 1G8IA 4AQIA 2K7DA 2PSRA 2KHNA 3OP0A 4CLNA 2WOSA 2OTGC 1XFWO 2TN4A 4YGEB 4GNKB 1SYMA 5CSFA 1CMGA 2CNPA 5J3XA 4FQOA 3NXAA 1J7PA 1WY9A 3MSEB 4ICBA 1F54A 1X02A 4XJKA 4ZCUA 1B8LA 3JTDB 3DVMA 5BPJA 4PHMA 1Y0VH 2HQWA 2E6WA 2KI4B 1XFUO 4MRYA 1SRAA 1J7QA 1NP8A 1YVHA 2M49B 5HKYA 2MJWB 1R2UA 1RROA 1WLZA 3EVVA 4QJ3B 2LE9B 1JBAA 1M63B 2JU0A 5HKZA 1BODA 1KFUS 1LVCD 3O2PA 1SL7A 3A8RA 1GGZA 1VRKA 2K7OA 2LANA 4GPLB 4M2QA 2H61C 1UHHA 2M97A 2MBXA 3EK8A 2L50A 4PDZA 2WNDA 1WDCC 1N65A 1LINA 2BE4A 1NX2A 1W7JB 1SBJA 3BYAA 2LHIA 1XO5A 3LK1A 2BECA 3TDIA 1S6IA 1E8AA 1UUSA 2F2OA 2BBMA 3I5FB 5B8IB 2I18A 4MEWA 1UHNA 2KYFA 3WNXB 2KYCA 1TNQA 1QV0A 2QACA 4YGBB 1L2OB 2KOTA 1AUIB 1NX1A 4OR9B 2GGMA 3PM8A 2F2PA 1M45A 4GAOA 1KQMB 1QVIY 2LVVA 3BXKA 1NIWA 1OSAA 3VROA 2HPSA 1SKTA 1DJGA 1OE9B 1IQ5A 3WHTB 1NSHA 3OB1B 1JFJA 1CDLA 1K90D 2OTGB 2BCAA 1U5IA 1ZUZA 2F3ZA 3NSLA 1IJ5A 3PFVA 3IF7A 1BJFA 2LP3A 2AUCA 1CM4A 1MQ1A 4M2OA 3EKJA 4L9MA 1JC2A 1BMOA 3BUNB 1S5GY 4MRXA 1DGVA 2ZRTA 1UP5A 2G2BA 2JT0A 2KI4C 1B8RA 3D10A 2KI6C 2GV5A 1IG5A 2KFHA 1QTXA 1Y1UA 2PASA 3BUOB 3CR2A 5DKRA 4DUQA 2ZFDA 4YGAA 2SASA 1BR4B 3WHUB 1B9AA 1QV1A 1LKJA 1NWDA 2SCPA 3EVRA 4YI8A 2Q91A 2HF5A 1A2XA 2GGZA 3TUYC 2LVKA 1N2DA 2OPOA 1WLMA 2JZIA 2KQYA 4MVFA 2LLUA 2BL0B 2MHHA 1CNPA 1PSRA 2L5XB 1B8CA 3KF9A 4P2YB 2AAOA 4E68A 2MRDA 1FI5A 1M31A 1QIVA 4MBEA 1CFPA 1XK4A 1DF0A 2EHBA 1TOPA 2PALA 3BUWB 3FWCA 2ZN9A 3DD4A 4C0JA 1C7VA 1MUXA 3SIAA 1RK9A 4PE7A 3SJSA 2B1UA 2PMYA 3EVUA 5DKQA 1F8HA 1B7TZ 1ODBA 2JPTA 1FF1A 4ORCB 1QATA 1J1EA 4QJ4B 1S26D 1G4YR 3D0YB 3IQQA 5HKWA 3SG4A 1B7TY 5K89A 2BCBA 1DJWA 2F3YA 4HSZA 1BLQA 1KQMC 2CBLA 1SL8A 5DKNA 4M2PA 5AEQA 1UURA 4I5KA 4OKHA 5I2LA 1IH0A 3BOWA 3SG5A 2KAYA 1SNLA 1LA3A 1TCFA 1PALA 2H2KA 2BE6A 1QS7A 2AMIA 2M1KB 3GK2A 4OVNF 1AJ5A 1QX7A 1UHKA 3PSRA 3AKBA 1GJYA 2O60A 4YGDB 4QJ5B 1Y1XA 1CLBA 4HREE 1XYDA 2IS9A 1YUUA 1BF5A 2LAPA 1H8BA 1AHRA 4BY5A 2KBIA 1B4CA 4XJKB 3LCPC 2NXQA 3QRXA 3KPXA 5D7FA 2LMVA 1H4BA 3TDUA 1RECA 3DVJA 3NSOA 3TUYB 1FI6A 1K8UA 1A4PA 1Y1AA 1YRUB 4NDBA 2JQ6A 5ER4X 2EC6B 1F4OA 3M0WA 1BOCA 1MHOA 1WRLA 3EK7A 3I5HB 2M29A 5CSIA 2MA2A 1UWOA 1JWDA 2HQ8A 2K61A 2O5GA 1PSBA 3AAJA 3PALA 4CFRA 2EGDA 4N1GA 1NCZA 4ETOA 2BL0C 3TDZA 3NSIA 2M7NA 2JTZA 3I5GC 2BCXA 1KFUL 1S1EA 4JPZB 2KSPA 2OS8B 5FYXA 4C0LA 2LUXA 1WRKA 1TN4A 1NUBA 1DMOA 5CPVA 1QASA 1F55A 1A29A 4JWQA 5KSZA 4CPVA 5I8NA 2R2IA 1L7ZA 2BBNA 2NCPA 4PCWA 1IGVA 3FWBA 4PALA 1SR6B 1RJVA 1TNWA 2BKHB 1FPWA 1AK8A 1J1DA 3C1VA 1YTZC 4YRUA 5PALA 2DOQA 2JTTA 1YVLA 2NLNA 1SCMB 1UHIA 1ALWA 1LXFC 2G9BA 1KWOB 4USLA 1GGWA 1AVSA 4D1EA 4U8DA 1AP4A 3CWGA 1GQMA 1S6CA 1M46A 2LM5A 4GFTA 2M9GA 1W7IB 5CSNA 1U5IB 5KTYA 1CLLA 1SPYA 2KGBC 2MLFC 2QPTA 2Y1MA 3I5IB 3OX5A 4MZKA 5HLOA 2F8PA 2M8UA 3RM1A 2KDHA 2L2EA 3NSKA 1K9PA 1MXLC 2WCFA 1ALVA 2JXCA 2L4IA 3HX4A 1PK0D 1A75A 3WXAA 1YUSA 1IRJA 4DIRA 1PULA 3BQ3A 2LP2A 3TS5C 1KSMA 1TIZA 2EC6C 2Q4UA 5HYDA 3IQOA 1Q80A 3DF0A 3I5HC 3CGAA 3PATA 1DVIA 1CKKA 1KQVA 1EXRA 2PRUA 1YX8A 2K2FA 5IBWA 2E30A 1A03A 2MLEC 4FTGA 4PE0A 2JT3A 2K0JA 1DJXA 3I5GB 1V1GA 3KEVA 1CM1A 4GGNA 1QIWA 1YRTB 2FJUB 2A4JA 2KBMA 4CFQA 3LLEA 2OS8C 1OMDA 1DJHA 1BG1A 4YBHB 4MSPA 1IKUA 1B47A 1XA5A 2Y5IA 2H61A 1PRWA 1EH2A 5TNCA 5JOLA 3FS7A 1KK7Z 2LV7A 1AJ4A 4I5NB 2LUCA 1KFXS 1SR6C 2Y4QA 5JJGA 5ER5A 2L4HA 4PE4A 1J7RA 1RFJA 2M1UA 3H4SE 1SCMC 3JVTC 5KU1A 2KAVA 3KO0A 1XFYO 1KWOC 3BOWB 3LK0A 1SMGA 2COLB 3OHMB 4ORBB 4PE1A 3CZTX 4PHJA 1PVAA 2JRFA 1QJTA 1EG4A 3EK4A 1NX3A 1MXEA 4MZLA 4R1EA 2L51A 2CXJA 2FCDA 1HQVA 2P6BB 1CDNA 4TNCA 2JNFA 1EL4A 2CT9A 2I94A 3I5IC 2WC8A 3SG2A 3SG3A 4AOMA 3AAKA 1K96A 2MAZA 4AQJA 1TNXA 5F6TA 2NZ0A 4GGFA 1BR1B 1XFXO 3GK1A 1EJ3A 1MWNA 1XFZO 3CLNA 2FCEA 1DJZA 2ZRSA 1Y6WA 5CSJA 1OQPA 4OV2A 3TS5B 1XVJA 2LVJA 4IL1A 4DRWA 4ORAB 4MN0A 2JULA 2M3WA 1F4QA 2FOTA 2ZNDA 3OX6A 5I2OA 3KHEA 1DGUA 2LNKA 2KNEA 2CTNA 4NQGA 2K2AA 2LC5A 2BKIB 2V53A 1QLKA 1BT6A 2KQ6A 1YR5A 1DTLA 1RTP1 2M7LA 2KAXA 1CFCA 2KI6D 4YGCB 2JWWA 4A4BA 4UPGA 3BUXB 1QLSA 1K93D
chains in the Genus database with same CATH superfamily
4ZCVA 1NX0A 2LVIA 1IWQA 1CFFA 3O78A 1XK4C 3GK4X 5AANA 2ZNEA 1N0YA 2ZN8A 1EG3A 2L0PA 3D74A 1QWVA 4WRIA 1NYAA 4CIDA 2LMUA 2RGIA 1KK8B 1SW8A 4I5LB 2WCBA 4NDDA 1TNPA 1NPQA 3VGOA 1MF8B 1D1OA 3JVTB 1TTXA 1DJIA 1SY9A 1P28A 3HCMA 4N5XA 1ZFSA 1YURA 1OMRA 4PHKA 1SK6D 1YUTA 4JQ0D 4DCKA 1M39A 3D76A 3ZWHA 4OCIA 2WCEA 3AKAA 1MR8A 1R6PA 3ICBA 3PN7B 3RLZA 1QVIZ 3O6BA 3SS3A 2JT8A 3CR5X 4FQTA 1QX5B 1K9KA 3DYEA 3O4YA 1J7OA 4N1FA 1FW4A 2K8MB 3ZNIA 1IJ6A 1CFDA 1UHJA 1F71A 1OZOA 1XFVO 2D8NA 1QXPA 1C07A 1NCYA 2K60A 4WQ3A 3BFBA 3SIBA 3EG5B 4DS7A 2PVBA 1S6JA 2HETA 2JC2A 4GGFC 4A4CA 1KCYA 1A75B 1HT9A 1RWYA 2JOJA 3NHIA 1OOHA 5GQQC 2K7BA 2LLSA 1CTRA 2JNXA 3DXLA 3DZTA 1K9UA 1LA0A 3DF0B 3SG6A 3PLFB 1PVBA 1S5GZ 1K95A 5HLVA 1JF0A 1JSAA 1ZACA 3BFHA 1K2HA 3K21A 1S36A 4I5JA 5FI6A 5AXIA 2VRGA 3JTDC 1K94A 3CTNA 4WQ2A 4YI9A 3DVKA 1IQ3A 3CZ0A 1JFKA 2LHLA 2I2RE 3A4UB 5AFPA 1OZSA 1CLMA 4C0KA 3FE8A 1SL9A 4MZJA 2ISDA 1DEKA 2LLTA 3EKHA 2KGRA 1WRZA 1CB1A 4GUKA 1KSOA 2F33A 4GBAA 1DF0B 4PT1A 4F0ZB 3UO9A 5DICA 1CMFA 3OGNA 3BFAA 3CS1A 2WORA 1YX7A 1KK8C 1WDCB 1OOJA 2ERBA 1F70A 2M0RA 3TZ1A 1KK7Y 2L98A 2LCPA 4MLWA 4Q04A 1CDMA 1BU3A 2ZKMX 2Y1NA 1J55A 4P5OE 1ZOTB 2KFFA 1JF2A 2JXLA 3BUMB 1OMVA 3VRPA 4PHNA 5K89A 2I7AA 1QX2A 2LMTA 1KFXL 3B86A 3I5FC 3R1PA 5I2QA 5FI2A 1V1FA 1NCXA 2KFGA 3OB2B 1TCOB 1FBVA 3R72A 3PN7C 1JUOA 1L2OC 3D0YA 4HRGA 2K7CA 5G08A 3DVEA 4BY4A 2CCMA 3SG7A 4HRHA 2NCOA 3LL8B 3E3RA 1CDPA 1ZMZA 3CR4X 1DT7B 1GM0A 1G33A 1C7WA 2FJYA 3F45A 2L5YA 5I94A 4XYNA 5AERA 4KYNA 3VRQA 3VRRA 1XFRA 4NDCA 3FIAA 1TRFA 3GOFA 3VRNA 1DJYA 1SCVA 3CZ2A 3D75A 1S3PA 1B1GA 5D69A 2KLEA 1G8IA 2YGUA 4AQIA 2K7DA 1TUZA 2KHNA 2PSRA 3OP0A 4CLNA 2WOSA 2OTGC 1XFWO 2TN4A 4YGEB 4GNKB 1SYMA 5CSFA 1CMGA 2CNPA 2QDIA 5J3XA 4F7FA 3CABA 4FQOA 3NXAA 3D78A 1WY9A 1J7PA 3MSEB 4ICBA 1F54A 1X02A 3K1EA 4XJKA 4ZCUA 1B8LA 3JTDB 3DVMA 5BPJA 3B6XA 4PHMA 1Y0VH 2HQWA 2E6WA 2KI4B 1XFUO 4MRYA 1SRAA 1J7QA 1NP8A 1YVHA 2M49B 5HKYA 3S0GA 2MJWB 1R2UA 1RROA 1WLZA 3EVVA 4QJ3B 1IIOA 2LE9B 1JBAA 1M63B 2JU0A 5HKZA 1BODA 3BJHA 1KFUS 1LVCD 3O2PA 1SL7A 3A8RA 1GGZA 1VRKA 2K7OA 2LANA 4GPLB 4M2QA 3RZSA 2H61C 1UHHA 2M97A 2MBXA 3EK8A 2L50A 4PDZA 2WNDA 1WDCC 5D3OA 1N65A 1LINA 3VB1A 2BE4A 4INWA 1NX2A 1W7JB 1SBJA 3N7HA 3BYAA 2LHIA 1XO5A 3LK1A 2BECA 3TDIA 1S6IA 1E8AA 2PYQA 1UUSA 2F2OA 2BBMA 3I5FB 5B8IB 2I18A 4MEWA 1UHNA 3L47A 3QMEA 2KYFA 3WNXB 2KYCA 1TNQA 1QV0A 2QACA 4YGBB 1L2OB 2KOTA 1AUIB 1NX1A 2QEVA 4OR9B 1DC1A 2GGMA 3PM8A 2F2PA 1M45A 4GAOA 1KQMB 1QVIY 2LVVA 3BXKA 3L4AA 1NIWA 1OSAA 3VROA 2HPSA 3S0EA 1SKTA 1DJGA 1OE9B 1IQ5A 3WHTB 1NSHA 3OB1B 1DQEA 1JFJA 1CDLA 1K90D 2OTGB 4INXA 2BCAA 1U5IA 1Z2CB 1ZUZA 3S0DA 3V2LA 2F3ZA 3NSLA 1IJ5A 3PFVA 3IF7A 1BJFA 3CDNA 2LP3A 2AUCA 1CM4A 1MQ1A 4M2OA 3EKJA 4L9MA 1JC2A 1BMOA 3BUNB 1S5GY 4MRXA 2GTEA 1DGVA 2ZRTA 1UP5A 2G2BA 2JT0A 2KI4C 1B8RA 3D10A 2KI6C 2GV5A 1IG5A 2KFHA 1QTXA 1Y1UA 2PASA 3BUOB 2WCJA 3CR2A 2PQLA 2ZFDA 4YGAA 2SASA 5DKRA 1BR4B 3WHUB 1B9AA 1QV1A 1LKJA 1NWDA 2SCPA 3EVRA 4YI8A 2Q91A 2HF5A 1A2XA 2GGZA 3TUYC 2LVKA 1N2DA 2OPOA 1WLMA 2JZIA 2KQYA 4MVFA 2LLUA 2BL0B 2MHHA 1CNPA 1PSRA 2L5XB 1B8CA 3FE6A 3KF9A 4P2YB 2AAOA 4E68A 2MRDA 1FI5A 1M31A 2KLDA 1QIVA 4MBEA 1CFPA 1XK4A 1DF0A 2EHBA 1TOPA 2PALA 3BUWB 3FWCA 3Q8IA 2WC5A 4OZDA 2ZN9A 3DD4A 4C0JA 1C7VA 1MUXA 1OOFA 1RK9A 4PE7A 3SIAA 3SJSA 2B1UA 2PMYA 3EVUA 5DKQA 1F8HA 1B7TZ 1ODBA 2JPTA 1FF1A 4ORCB 3DY9A 1QATA 1J1EA 5FI7A 4QJ4B 1S26D 1G4YR 3D0YB 3CYZA 3IQQA 5HKWA 1B7TY 1ORGA 2BCBA 1DJWA 1LS8A 3D77A 2F3YA 1OOIX 4HSZA 1BLQA 1KQMC 1OOGA 2CBLA 1SL8A 5DKNA 4M2PA 5AEQA 1UURA 4I5KA 4OKHA 5I2LA 3B88A 1IH0A 3BOWA 3SG5A 2KAYA 1SNLA 1LA3A 1TCFA 1PALA 2H2KA 1QS7A 2AMIA 2BE6A 2M1KB 3GK2A 4OVNF 1AJ5A 1QX7A 1UHKA 3PSRA 3AKBA 1GJYA 1SSEB 2O60A 4YGDB 4QJ5B 1Y1XA 1CLBA 4HREE 1XYDA 2IS9A 1YUUA 2KPHA 3PM2A 1BF5A 2LAPA 1H8BA 1AHRA 4BY5A 2KBIA 1B4CA 4XJKB 3LCPC 2NXQA 2QEBA 3QRXA 3KPXA 5D7FA 2LMVA 1H4BA 3TDUA 1RECA 3DVJA 3NSOA 3TUYB 1FI6A 1K8UA 1Z4HA 1A4PA 2WCMA 1Y1AA 1YRUB 4NDBA 2JQ6A 5ER4X 2EC6B 1F4OA 3M0WA 1BOCA 1MHOA 1WRLA 3EK7A 1TWOA 2M29A 3I5HB 2MA2A 2QEOA 3CZ1A 1UWOA 5CSIA 1JWDA 2HQ8A 2K61A 2O5GA 1PSBA 3AAJA 3PALA 4CFRA 2EGDA 4N1GA 1NCZA 4ETOA 2BL0C 3TDZA 3NSIA 2M7NA 2JTZA 3I5GC 2BCXA 1KFUL 1S1EA 4JPZB 2KSPA 2OS8B 5FYXA 4C0LA 2LUXA 1WRKA 1TN4A 1NUBA 1DMOA 5CPVA 1QASA 1C3YA 1F55A 1A29A 4JWQA 5KSZA 4CPVA 5EL2A 2R2IA 5I8NA 1L7ZA 2BBNA 3B7AA 3OBVA 2NCPA 4PCWA 1IGVA 3FWBA 4PALA 1SR6B 2WCLA 1RJVA 1TNWA 2BKHB 1FPWA 1AK8A 1J1DA 3C1VA 1YTZC 4YRUA 3D73A 2DOQA 5PALA 2JTTA 1YVLA 2NLNA 1SCMB 3SS4A 1UHIA 1ALWA 1LXFC 2G9BA 2P70A 1KWOB 4USLA 1GGWA 2BAPA 1AVSA 1DELA 4U8DA 4D1EA 1AP4A 3CWGA 1GQMA 1S6CA 1M46A 2LM5A 4GFTA 2M9GA 1W7IB 5CSNA 1U5IB 5KTYA 1CLLA 1SPYA 2KGBC 2MLFC 2QPTA 2Y1MA 3I5IB 3OX5A 4MZKA 5HLOA 4JD9A 2F8PA 2M8UA 3RM1A 2KDHA 2L2EA 3UNWA 3L4LA 3NSKA 1K9PA 1MXLC 2WCFA 1ALVA 2JXCA 2L4IA 3HX4A 3S0FA 3SS5A 1PK0D 4DUQA 1A75A 3R1VA 3NHTA 3WXAA 1YUSA 1IRJA 4DIRA 1PULA 3BQ3A 2LP2A 3TS5C 1KSMA 2WC6A 1TIZA 2EC6C 2Q4UA 5HYDA 3IQOA 1Q80A 3DF0A 5HL1A 2QEHA 1T14A 3I5HC 3CGAA 3PATA 3B87A 1DVIA 1CKKA 1KQVA 1EXRA 2PRUA 1YX8A 2K2FA 5IBWA 2E30A 1A03A 2MLEC 4FTGA 4PE0A 2JT3A 2K0JA 1DJXA 3I5GB 1V1GA 3KEVA 2WCHA 1CM1A 4GGNA 1QIWA 1YRTB 2FJUB 3FE9A 3S0AA 2A4JA 2KBMA 4CFQA 3LLEA 3R1OA 2OS8C 1OMDA 1DJHA 1BG1A 4YBHB 4MSPA 1IKUA 1B47A 1XA5A 2Y5IA 3NGVA 2H61A 4IJ7A 1PRWA 1EH2A 5TNCA 5JOLA 3FS7A 1KK7Z 2LV7A 1AJ4A 4I5NB 2L2CA 2LUCA 3PJIA 1KFXS 3SG4A 1SR6C 2Y4QA 5JJGA 5ER5A 2L4HA 4PE4A 1J7RA 1RFJA 2M1UA 3H4SE 1SCMC 3JVTC 5KU1A 2KAVA 3KO0A 1XFYO 1KWOC 3BOWB 3LK0A 1SMGA 2COLB 3OHMB 4ORBB 4PE1A 3CZTX 4PHJA 1OW4A 1PVAA 1QJTA 1EG4A 2JRFA 3EK4A 1NX3A 1MXEA 4MZLA 4R1EA 2L51A 2CXJA 2FCDA 1HQVA 2P6BB 1CDNA 4TNCA 2JNFA 2WCKA 1EL4A 2CT9A 2I94A 3I5IC 2JPOA 2WC8A 3SG2A 3SG3A 4AOMA 3AAKA 1K96A 2MAZA 4AQJA 1TNXA 5F6TA 3O4XA 2NZ0A 4GGFA 1C3ZA 1BR1B 1XFXO 3GK1A 1EJ3A 1MWNA 1XFZO 1W9ZA 2P71A 2FCEA 1DJZA 2ZRSA 1Y6WA 3CLNA 1OQPA 4OV2A 5CSJA 3TS5B 1XVJA 2LVJA 4IL1A 4DRWA 4ORAB 4MN0A 2JULA 4JKTA 2M3WA 1F4QA 2FOTA 2ZNDA 3OX6A 2H8VA 5I2OA 3KHEA 1DGUA 2LNKA 2KNEA 2CTNA 4NQGA 2K2AA 2LC5A 2BKIB 2V53A 1QLKA 1BT6A 2KQ6A 2BNXA 1YR5A 1DTLA 1RTP1 3S0BA 2M7LA 2KAXA 1CFCA 1TUJA 2KI6D 4YGCB 2JWWA 4A4BA 3IVTA 4UPGA 3BUXB 1QLSA 1K93D
chains in the Genus database with same CATH topology
4ZCVA 1NX0A 2LVIA 1IWQA 1CFFA 3O78A 1XK4C 3GK4X 5AANA 2ZNEA 1N0YA 2ZN8A 1EG3A 2L0PA 4WRIA 4CIDA 1NYAA 2LMUA 2RGIA 1KK8B 1SW8A 4I5LB 2WCBA 4NDDA 1TNPA 1NPQA 3VGOA 1MF8B 1D1OA 3JVTB 1TTXA 1DJIA 1SY9A 3HCMA 4N5XA 1ZFSA 1YURA 1OMRA 4PHKA 1SK6D 1YUTA 4JQ0D 4DCKA 1M39A 3ZWHA 4OCIA 2WCEA 3AKAA 1MR8A 1R6PA 3ICBA 3PN7B 3RLZA 1QVIZ 3O6BA 2JT8A 3CR5X 1QX5B 1K9KA 3O4YA 1J7OA 4N1FA 1FW4A 2K8MB 3ZNIA 1IJ6A 1CFDA 1UHJA 1F71A 1OZOA 1XFVO 2D8NA 1QXPA 1C07A 1NCYA 4WQ3A 3SIBA 4DS7A 2PVBA 1S6JA 2HETA 2JC2A 4GGFC 4A4CA 1KCYA 1A75B 1HT9A 1RWYA 2JOJA 5GQQC 2K7BA 2LLSA 1CTRA 2JNXA 1K9UA 1LA0A 3DF0B 3SG6A 3PLFB 1PVBA 1S5GZ 1K95A 5HLVA 1JF0A 1JSAA 1ZACA 1K2HA 3K21A 1S36A 4I5JA 5AXIA 2VRGA 3JTDC 1K94A 3CTNA 4WQ2A 4YI9A 3DVKA 1IQ3A 1JFKA 2LHLA 2I2RE 3A4UB 5AFPA 1OZSA 1CLMA 4C0KA 1SL9A 4MZJA 2ISDA 2LLTA 3EKHA 2KGRA 1WRZA 1CB1A 4GUKA 1KSOA 2F33A 4GBAA 1DF0B 4F0ZB 1CMFA 3CS1A 2WORA 1YX7A 1KK8C 1WDCB 1OOJA 1F70A 2M0RA 3TZ1A 1KK7Y 2L98A 2LCPA 4MLWA 4Q04A 1CDMA 1BU3A 2ZKMX 2Y1NA 1J55A 4P5OE 1ZOTB 2KFFA 1JF2A 2JXLA 3BUMB 1OMVA 3VRPA 4PHNA 2I7AA 1QX2A 2LMTA 1KFXL 3I5FC 5I2QA 1V1FA 1NCXA 2KFGA 3OB2B 1TCOB 1FBVA 4HRGA 3PN7C 1JUOA 1L2OC 3D0YA 5G08A 2K7CA 3DVEA 4BY4A 2CCMA 3SG7A 4HRHA 2NCOA 3LL8B 3E3RA 1CDPA 1ZMZA 3CR4X 1DT7B 1G33A 1C7WA 3F45A 4XYNA 5AERA 3VRQA 3VRRA 4NDCA 3FIAA 1TRFA 3GOFA 3VRNA 1DJYA 1SCVA 1S3PA 1B1GA 5D69A 1G8IA 4AQIA 2K7DA 2PSRA 2KHNA 3OP0A 4CLNA 2WOSA 2OTGC 1XFWO 2TN4A 4YGEB 4GNKB 1SYMA 5CSFA 1CMGA 2CNPA 5J3XA 4FQOA 3NXAA 1J7PA 1WY9A 3MSEB 4ICBA 1F54A 1X02A 4XJKA 4ZCUA 1B8LA 3JTDB 3DVMA 5BPJA 4PHMA 1Y0VH 2HQWA 2E6WA 2KI4B 1XFUO 4MRYA 1SRAA 1J7QA 1NP8A 1YVHA 2M49B 5HKYA 2MJWB 1R2UA 1RROA 1WLZA 3EVVA 4QJ3B 2LE9B 1JBAA 1M63B 2JU0A 5HKZA 1BODA 1KFUS 1LVCD 3O2PA 1SL7A 3A8RA 1GGZA 1VRKA 2K7OA 2LANA 4GPLB 4M2QA 2H61C 1UHHA 2M97A 2MBXA 3EK8A 2L50A 4PDZA 2WNDA 1WDCC 1N65A 1LINA 2BE4A 1NX2A 1W7JB 1SBJA 3BYAA 2LHIA 1XO5A 3LK1A 2BECA 3TDIA 1S6IA 1E8AA 1UUSA 2F2OA 2BBMA 3I5FB 5B8IB 2I18A 4MEWA 1UHNA 2KYFA 3WNXB 2KYCA 1TNQA 1QV0A 2QACA 4YGBB 1L2OB 2KOTA 1AUIB 1NX1A 4OR9B 2GGMA 3PM8A 2F2PA 1M45A 4GAOA 1KQMB 1QVIY 2LVVA 3BXKA 1NIWA 1OSAA 3VROA 2HPSA 1SKTA 1DJGA 1OE9B 1IQ5A 3WHTB 1NSHA 3OB1B 1JFJA 1CDLA 1K90D 2OTGB 2BCAA 1U5IA 1ZUZA 2F3ZA 3NSLA 1IJ5A 3PFVA 3IF7A 1BJFA 2LP3A 2AUCA 1CM4A 1MQ1A 4M2OA 3EKJA 4L9MA 1JC2A 1BMOA 3BUNB 1S5GY 4MRXA 1DGVA 2ZRTA 1UP5A 2G2BA 2JT0A 2KI4C 1B8RA 3D10A 2KI6C 2GV5A 1IG5A 2KFHA 1QTXA 1Y1UA 2PASA 3BUOB 3CR2A 5DKRA 4DUQA 2ZFDA 4YGAA 2SASA 1BR4B 3WHUB 1B9AA 1QV1A 1LKJA 1NWDA 2SCPA 3EVRA 4YI8A 2Q91A 2HF5A 1A2XA 2GGZA 3TUYC 2LVKA 1N2DA 2OPOA 1WLMA 2JZIA 2KQYA 4MVFA 2LLUA 2BL0B 2MHHA 1CNPA 1PSRA 2L5XB 1B8CA 3KF9A 4P2YB 2AAOA 4E68A 2MRDA 1FI5A 1M31A 1QIVA 4MBEA 1CFPA 1XK4A 1DF0A 2EHBA 1TOPA 2PALA 3BUWB 3FWCA 2ZN9A 3DD4A 4C0JA 1C7VA 1MUXA 3SIAA 1RK9A 4PE7A 3SJSA 2B1UA 2PMYA 3EVUA 5DKQA 1F8HA 1B7TZ 1ODBA 2JPTA 1FF1A 4ORCB 1QATA 1J1EA 4QJ4B 1S26D 1G4YR 3D0YB 3IQQA 5HKWA 3SG4A 1B7TY 5K89A 2BCBA 1DJWA 2F3YA 4HSZA 1BLQA 1KQMC 2CBLA 1SL8A 5DKNA 4M2PA 5AEQA 1UURA 4I5KA 4OKHA 5I2LA 1IH0A 3BOWA 3SG5A 2KAYA 1SNLA 1LA3A 1TCFA 1PALA 2H2KA 2BE6A 1QS7A 2AMIA 2M1KB 3GK2A 4OVNF 1AJ5A 1QX7A 1UHKA 3PSRA 3AKBA 1GJYA 2O60A 4YGDB 4QJ5B 1Y1XA 1CLBA 4HREE 1XYDA 2IS9A 1YUUA 1BF5A 2LAPA 1H8BA 1AHRA 4BY5A 2KBIA 1B4CA 4XJKB 3LCPC 2NXQA 3QRXA 3KPXA 5D7FA 2LMVA 1H4BA 3TDUA 1RECA 3DVJA 3NSOA 3TUYB 1FI6A 1K8UA 1A4PA 1Y1AA 1YRUB 4NDBA 2JQ6A 5ER4X 2EC6B 1F4OA 3M0WA 1BOCA 1MHOA 1WRLA 3EK7A 3I5HB 2M29A 5CSIA 2MA2A 1UWOA 1JWDA 2HQ8A 2K61A 2O5GA 1PSBA 3AAJA 3PALA 4CFRA 2EGDA 4N1GA 1NCZA 4ETOA 2BL0C 3TDZA 3NSIA 2M7NA 2JTZA 3I5GC 2BCXA 1KFUL 1S1EA 4JPZB 2KSPA 2OS8B 5FYXA 4C0LA 2LUXA 1WRKA 1TN4A 1NUBA 1DMOA 5CPVA 1QASA 1F55A 1A29A 4JWQA 5KSZA 4CPVA 5I8NA 2R2IA 1L7ZA 2BBNA 2NCPA 4PCWA 1IGVA 3FWBA 4PALA 1SR6B 1RJVA 1TNWA 2BKHB 1FPWA 1AK8A 1J1DA 3C1VA 1YTZC 4YRUA 5PALA 2DOQA 2JTTA 1YVLA 2NLNA 1SCMB 1UHIA 1ALWA 1LXFC 2G9BA 1KWOB 4USLA 1GGWA 1AVSA 4D1EA 4U8DA 1AP4A 3CWGA 1GQMA 1S6CA 1M46A 2LM5A 4GFTA 2M9GA 1W7IB 5CSNA 1U5IB 5KTYA 1CLLA 1SPYA 2KGBC 2MLFC 2QPTA 2Y1MA 3I5IB 3OX5A 4MZKA 5HLOA 2F8PA 2M8UA 3RM1A 2KDHA 2L2EA 3NSKA 1K9PA 1MXLC 2WCFA 1ALVA 2JXCA 2L4IA 3HX4A 1PK0D 1A75A 3WXAA 1YUSA 1IRJA 4DIRA 1PULA 3BQ3A 2LP2A 3TS5C 1KSMA 1TIZA 2EC6C 2Q4UA 5HYDA 3IQOA 1Q80A 3DF0A 3I5HC 3CGAA 3PATA 1DVIA 1CKKA 1KQVA 1EXRA 2PRUA 1YX8A 2K2FA 5IBWA 2E30A 1A03A 2MLEC 4FTGA 4PE0A 2JT3A 2K0JA 1DJXA 3I5GB 1V1GA 3KEVA 1CM1A 4GGNA 1QIWA 1YRTB 2FJUB 2A4JA 2KBMA 4CFQA 3LLEA 2OS8C 1OMDA 1DJHA 1BG1A 4YBHB 4MSPA 1IKUA 1B47A 1XA5A 2Y5IA 2H61A 1PRWA 1EH2A 5TNCA 5JOLA 3FS7A 1KK7Z 2LV7A 1AJ4A 4I5NB 2LUCA 1KFXS 1SR6C 2Y4QA 5JJGA 5ER5A 2L4HA 4PE4A 1J7RA 1RFJA 2M1UA 3H4SE 1SCMC 3JVTC 5KU1A 2KAVA 3KO0A 1XFYO 1KWOC 3BOWB 3LK0A 1SMGA 2COLB 3OHMB 4ORBB 4PE1A 3CZTX 4PHJA 1PVAA 2JRFA 1QJTA 1EG4A 3EK4A 1NX3A 1MXEA 4MZLA 4R1EA 2L51A 2CXJA 2FCDA 1HQVA 2P6BB 1CDNA 4TNCA 2JNFA 1EL4A 2CT9A 2I94A 3I5IC 2WC8A 3SG2A 3SG3A 4AOMA 3AAKA 1K96A 2MAZA 4AQJA 1TNXA 5F6TA 2NZ0A 4GGFA 1BR1B 1XFXO 3GK1A 1EJ3A 1MWNA 1XFZO 3CLNA 2FCEA 1DJZA 2ZRSA 1Y6WA 5CSJA 1OQPA 4OV2A 3TS5B 1XVJA 2LVJA 4IL1A 4DRWA 4ORAB 4MN0A 2JULA 2M3WA 1F4QA 2FOTA 2ZNDA 3OX6A 5I2OA 3KHEA 1DGUA 2LNKA 2KNEA 2CTNA 4NQGA 2K2AA 2LC5A 2BKIB 2V53A 1QLKA 1BT6A 2KQ6A 1YR5A 1DTLA 1RTP1 2M7LA 2KAXA 1CFCA 2KI6D 4YGCB 2JWWA 4A4BA 4UPGA 3BUXB 1QLSA 1K93D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZCV A;  1NX0 A;  2LVI A;  1IWQ A;  1CFF A;  3O78 A;  1XK4 C;  3GK4 X;  5AAN A;  2ZNE A;  1N0Y A;  2ZN8 A;  1EG3 A;  2L0P A;  4WRI A;  4CID A;  1NYA A;  2LMU A;  2RGI A;  1KK8 B;  1SW8 A;  4I5L B;  2WCB A;  4NDD A;  1TNP A;  1NPQ A;  3VGO A;  1MF8 B;  1D1O A;  3JVT B;  1TTX A;  1DJI A;  1SY9 A;  3HCM A;  4N5X A;  1ZFS A;  1YUR A;  1OMR A;  4PHK A;  1SK6 D;  1YUT A;  4JQ0 D;  4DCK A;  1M39 A;  3ZWH A;  4OCI A;  2WCE A;  3AKA A;  1MR8 A;  1R6P A;  3ICB A;  3PN7 B;  3RLZ A;  1QVI Z;  3O6B A;  2JT8 A;  3CR5 X;  1QX5 B;  1K9K A;  3O4Y A;  1J7O A;  4N1F A;  1FW4 A;  2K8M B;  3ZNI A;  1IJ6 A;  1CFD A;  1UHJ A;  1F71 A;  1OZO A;  1XFV O;  2D8N A;  1QXP A;  1C07 A;  1NCY A;  4WQ3 A;  3SIB A;  4DS7 A;  2PVB A;  1S6J A;  2HET A;  2JC2 A;  4GGF C;  4A4C A;  1KCY A;  1A75 B;  1HT9 A;  1RWY A;  2JOJ A;  5GQQ C;  2K7B A;  2LLS A;  1CTR A;  2JNX A;  1K9U A;  1LA0 A;  3DF0 B;  3SG6 A;  3PLF B;  1PVB A;  1S5G Z;  1K95 A;  5HLV A;  1JF0 A;  1JSA A;  1ZAC A;  1K2H A;  3K21 A;  1S36 A;  4I5J A;  5AXI A;  2VRG A;  3JTD C;  1K94 A;  3CTN A;  4WQ2 A;  4YI9 A;  3DVK A;  1IQ3 A;  1JFK A;  2LHL A;  2I2R E;  3A4U B;  5AFP A;  1OZS A;  1CLM A;  4C0K A;  1SL9 A;  4MZJ A;  2ISD A;  2LLT A;  3EKH A;  2KGR A;  1WRZ A;  1CB1 A;  4GUK A;  1KSO A;  2F33 A;  4GBA A;  1DF0 B;  4F0Z B;  1CMF A;  3CS1 A;  2WOR A;  1YX7 A;  1KK8 C;  1WDC B;  1OOJ A;  1F70 A;  2M0R A;  3TZ1 A;  1KK7 Y;  2L98 A;  2LCP A;  4MLW A;  4Q04 A;  1CDM A;  1BU3 A;  2ZKM X;  2Y1N A;  1J55 A;  4P5O E;  1ZOT B;  2KFF A;  1JF2 A;  2JXL A;  3BUM B;  1OMV A;  3VRP A;  4PHN A;  2I7A A;  1QX2 A;  2LMT A;  1KFX L;  3I5F C;  5I2Q A;  1V1F A;  1NCX A;  2KFG A;  3OB2 B;  1TCO B;  1FBV A;  4HRG A;  3PN7 C;  1JUO A;  1L2O C;  3D0Y A;  5G08 A;  2K7C A;  3DVE A;  4BY4 A;  2CCM A;  3SG7 A;  4HRH A;  2NCO A;  3LL8 B;  3E3R A;  1CDP A;  1ZMZ A;  3CR4 X;  1DT7 B;  1G33 A;  1C7W A;  3F45 A;  4XYN A;  5AER A;  3VRQ A;  3VRR A;  4NDC A;  3FIA A;  1TRF A;  3GOF A;  3VRN A;  1DJY A;  1SCV A;  1S3P A;  1B1G A;  5D69 A;  1G8I A;  4AQI A;  2K7D A;  2PSR A;  2KHN A;  3OP0 A;  4CLN A;  2WOS A;  2OTG C;  1XFW O;  2TN4 A;  4YGE B;  4GNK B;  1SYM A;  5CSF A;  1CMG A;  2CNP A;  5J3X A;  4FQO A;  3NXA A;  1J7P A;  1WY9 A;  3MSE B;  4ICB A;  1F54 A;  1X02 A;  4XJK A;  4ZCU A;  1B8L A;  3JTD B;  3DVM A;  5BPJ A;  4PHM A;  1Y0V H;  2HQW A;  2E6W A;  2KI4 B;  1XFU O;  4MRY A;  1SRA A;  1J7Q A;  1NP8 A;  1YVH A;  2M49 B;  5HKY A;  2MJW B;  1R2U A;  1RRO A;  1WLZ A;  3EVV A;  4QJ3 B;  2LE9 B;  1JBA A;  1M63 B;  2JU0 A;  5HKZ A;  1BOD A;  1KFU S;  1LVC D;  3O2P A;  1SL7 A;  3A8R A;  1GGZ A;  1VRK A;  2K7O A;  2LAN A;  4GPL B;  4M2Q A;  2H61 C;  1UHH A;  2M97 A;  2MBX A;  3EK8 A;  2L50 A;  4PDZ A;  2WND A;  1WDC C;  1N65 A;  1LIN A;  2BE4 A;  1NX2 A;  1W7J B;  1SBJ A;  3BYA A;  2LHI A;  1XO5 A;  3LK1 A;  2BEC A;  3TDI A;  1S6I A;  1E8A A;  1UUS A;  2F2O A;  2BBM A;  3I5F B;  5B8I B;  2I18 A;  4MEW A;  1UHN A;  2KYF A;  3WNX B;  2KYC A;  1TNQ A;  1QV0 A;  2QAC A;  4YGB B;  1L2O B;  2KOT A;  1AUI B;  1NX1 A;  4OR9 B;  2GGM A;  3PM8 A;  2F2P A;  1M45 A;  4GAO A;  1KQM B;  1QVI Y;  2LVV A;  3BXK A;  1NIW A;  1OSA A;  3VRO A;  2HPS A;  1SKT A;  1DJG A;  1OE9 B;  1IQ5 A;  3WHT B;  1NSH A;  3OB1 B;  1JFJ A;  1CDL A;  1K90 D;  2OTG B;  2BCA A;  1U5I A;  1ZUZ A;  2F3Z A;  3NSL A;  1IJ5 A;  3PFV A;  3IF7 A;  1BJF A;  2LP3 A;  2AUC A;  1CM4 A;  1MQ1 A;  4M2O A;  3EKJ A;  4L9M A;  1JC2 A;  1BMO A;  3BUN B;  1S5G Y;  4MRX A;  1DGV A;  2ZRT A;  1UP5 A;  2G2B A;  2JT0 A;  2KI4 C;  1B8R A;  3D10 A;  2KI6 C;  2GV5 A;  1IG5 A;  2KFH A;  1QTX A;  1Y1U A;  2PAS A;  3BUO B;  3CR2 A;  5DKR A;  4DUQ A;  2ZFD A;  4YGA A;  2SAS A;  1BR4 B;  3WHU B;  1B9A A;  1QV1 A;  1LKJ A;  1NWD A;  2SCP A;  3EVR A;  4YI8 A;  2Q91 A;  2HF5 A;  1A2X A;  2GGZ A;  3TUY C;  2LVK A;  1N2D A;  2OPO A;  1WLM A;  2JZI A;  2KQY A;  4MVF A;  2LLU A;  2BL0 B;  2MHH A;  1CNP A;  1PSR A;  2L5X B;  1B8C A;  3KF9 A;  4P2Y B;  2AAO A;  4E68 A;  2MRD A;  1FI5 A;  1M31 A;  1QIV A;  4MBE A;  1CFP A;  1XK4 A;  1DF0 A;  2EHB A;  1TOP A;  2PAL A;  3BUW B;  3FWC A;  2ZN9 A;  3DD4 A;  4C0J A;  1C7V A;  1MUX A;  3SIA A;  1RK9 A;  4PE7 A;  3SJS A;  2B1U A;  2PMY A;  3EVU A;  5DKQ A;  1F8H A;  1B7T Z;  1ODB A;  2JPT A;  1FF1 A;  4ORC B;  1QAT A;  1J1E A;  4QJ4 B;  1S26 D;  1G4Y R;  3D0Y B;  3IQQ A;  5HKW A;  3SG4 A;  1B7T Y;  5K89 A;  2BCB A;  1DJW A;  2F3Y A;  4HSZ A;  1BLQ A;  1KQM C;  2CBL A;  1SL8 A;  5DKN A;  4M2P A;  5AEQ A;  1UUR A;  4I5K A;  4OKH A;  5I2L A;  1IH0 A;  3BOW A;  3SG5 A;  2KAY A;  1SNL A;  1LA3 A;  1TCF A;  1PAL A;  2H2K A;  2BE6 A;  1QS7 A;  2AMI A;  2M1K B;  3GK2 A;  4OVN F;  1AJ5 A;  1QX7 A;  1UHK A;  3PSR A;  3AKB A;  1GJY A;  2O60 A;  4YGD B;  4QJ5 B;  1Y1X A;  1CLB A;  4HRE E;  1XYD A;  2IS9 A;  1YUU A;  1BF5 A;  2LAP A;  1H8B A;  1AHR A;  4BY5 A;  2KBI A;  1B4C A;  4XJK B;  3LCP C;  2NXQ A;  3QRX A;  3KPX A;  5D7F A;  2LMV A;  1H4B A;  3TDU A;  1REC A;  3DVJ A;  3NSO A;  3TUY B;  1FI6 A;  1K8U A;  1A4P A;  1Y1A A;  1YRU B;  4NDB A;  2JQ6 A;  5ER4 X;  2EC6 B;  1F4O A;  3M0W A;  1BOC A;  1MHO A;  1WRL A;  3EK7 A;  3I5H B;  2M29 A;  5CSI A;  2MA2 A;  1UWO A;  1JWD A;  2HQ8 A;  2K61 A;  2O5G A;  1PSB A;  3AAJ A;  3PAL A;  4CFR A;  2EGD A;  4N1G A;  1NCZ A;  4ETO A;  2BL0 C;  3TDZ A;  3NSI A;  2M7N A;  2JTZ A;  3I5G C;  2BCX A;  1KFU L;  1S1E A;  4JPZ B;  2KSP A;  2OS8 B;  5FYX A;  4C0L A;  2LUX A;  1WRK A;  1TN4 A;  1NUB A;  1DMO A;  5CPV A;  1QAS A;  1F55 A;  1A29 A;  4JWQ A;  5KSZ A;  4CPV A;  5I8N A;  2R2I A;  1L7Z A;  2BBN A;  2NCP A;  4PCW A;  1IGV A;  3FWB A;  4PAL A;  1SR6 B;  1RJV A;  1TNW A;  2BKH B;  1FPW A;  1AK8 A;  1J1D A;  3C1V A;  1YTZ C;  4YRU A;  5PAL A;  2DOQ A;  2JTT A;  1YVL A;  2NLN A;  1SCM B;  1UHI A;  1ALW A;  1LXF C;  2G9B A;  1KWO B;  4USL A;  1GGW A;  1AVS A;  4D1E A;  4U8D A;  1AP4 A;  3CWG A;  1GQM A;  1S6C A;  1M46 A;  2LM5 A;  4GFT A;  2M9G A;  1W7I B;  5CSN A;  1U5I B;  5KTY A;  1CLL A;  1SPY A;  2KGB C;  2MLF C;  2QPT A;  2Y1M A;  3I5I B;  3OX5 A;  4MZK A;  5HLO A;  2F8P A;  2M8U A;  3RM1 A;  2KDH A;  2L2E A;  3NSK A;  1K9P A;  1MXL C;  2WCF A;  1ALV A;  2JXC A;  2L4I A;  3HX4 A;  1PK0 D;  1A75 A;  3WXA A;  1YUS A;  1IRJ A;  4DIR A;  1PUL A;  3BQ3 A;  2LP2 A;  3TS5 C;  1KSM A;  1TIZ A;  2EC6 C;  2Q4U A;  5HYD A;  3IQO A;  1Q80 A;  3DF0 A;  3I5H C;  3CGA A;  3PAT A;  1DVI A;  1CKK A;  1KQV A;  1EXR A;  2PRU A;  1YX8 A;  2K2F A;  5IBW A;  2E30 A;  1A03 A;  2MLE C;  4FTG A;  4PE0 A;  2JT3 A;  2K0J A;  1DJX A;  3I5G B;  1V1G A;  3KEV A;  1CM1 A;  4GGN A;  1QIW A;  1YRT B;  2FJU B;  2A4J A;  2KBM A;  4CFQ A;  3LLE A;  2OS8 C;  1OMD A;  1DJH A;  1BG1 A;  4YBH B;  4MSP A;  1IKU A;  1B47 A;  1XA5 A;  2Y5I A;  2H61 A;  1PRW A;  1EH2 A;  5TNC A;  5JOL A;  3FS7 A;  1KK7 Z;  2LV7 A;  1AJ4 A;  4I5N B;  2LUC A;  1KFX S;  1SR6 C;  2Y4Q A;  5JJG A;  5ER5 A;  2L4H A;  4PE4 A;  1J7R A;  1RFJ A;  2M1U A;  3H4S E;  1SCM C;  3JVT C;  5KU1 A;  2KAV A;  3KO0 A;  1XFY O;  1KWO C;  3BOW B;  3LK0 A;  1SMG A;  2COL B;  3OHM B;  4ORB B;  4PE1 A;  3CZT X;  4PHJ A;  1PVA A;  2JRF A;  1QJT A;  1EG4 A;  3EK4 A;  1NX3 A;  1MXE A;  4MZL A;  4R1E A;  2L51 A;  2CXJ A;  2FCD A;  1HQV A;  2P6B B;  1CDN A;  4TNC A;  2JNF A;  1EL4 A;  2CT9 A;  2I94 A;  3I5I C;  2WC8 A;  3SG2 A;  3SG3 A;  4AOM A;  3AAK A;  1K96 A;  2MAZ A;  4AQJ A;  1TNX A;  5F6T A;  2NZ0 A;  4GGF A;  1BR1 B;  1XFX O;  3GK1 A;  1EJ3 A;  1MWN A;  1XFZ O;  3CLN A;  2FCE A;  1DJZ A;  2ZRS A;  1Y6W A;  5CSJ A;  1OQP A;  4OV2 A;  3TS5 B;  1XVJ A;  2LVJ A;  4IL1 A;  4DRW A;  4ORA B;  4MN0 A;  2JUL A;  2M3W A;  1F4Q A;  2FOT A;  2ZND A;  3OX6 A;  5I2O A;  3KHE A;  1DGU A;  2LNK A;  2KNE A;  2CTN A;  4NQG A;  2K2A A;  2LC5 A;  2BKI B;  2V53 A;  1QLK A;  1BT6 A;  2KQ6 A;  1YR5 A;  1DTL A;  1RTP 1;  2M7L A;  2KAX A;  1CFC A;  2KI6 D;  4YGC B;  2JWW A;  4A4B A;  4UPG A;  3BUX B;  1QLS A;  1K93 D; 
#chains in the Genus database with same CATH topology
 4ZCV A;  1NX0 A;  2LVI A;  1IWQ A;  1CFF A;  3O78 A;  1XK4 C;  3GK4 X;  5AAN A;  2ZNE A;  1N0Y A;  2ZN8 A;  1EG3 A;  2L0P A;  3D74 A;  1QWV A;  4WRI A;  1NYA A;  4CID A;  2LMU A;  2RGI A;  1KK8 B;  1SW8 A;  4I5L B;  2WCB A;  4NDD A;  1TNP A;  1NPQ A;  3VGO A;  1MF8 B;  1D1O A;  3JVT B;  1TTX A;  1DJI A;  1SY9 A;  1P28 A;  3HCM A;  4N5X A;  1ZFS A;  1YUR A;  1OMR A;  4PHK A;  1SK6 D;  1YUT A;  4JQ0 D;  4DCK A;  1M39 A;  3D76 A;  3ZWH A;  4OCI A;  2WCE A;  3AKA A;  1MR8 A;  1R6P A;  3ICB A;  3PN7 B;  3RLZ A;  1QVI Z;  3O6B A;  3SS3 A;  2JT8 A;  3CR5 X;  4FQT A;  1QX5 B;  1K9K A;  3DYE A;  3O4Y A;  1J7O A;  4N1F A;  1FW4 A;  2K8M B;  3ZNI A;  1IJ6 A;  1CFD A;  1UHJ A;  1F71 A;  1OZO A;  1XFV O;  2D8N A;  1QXP A;  1C07 A;  1NCY A;  2K60 A;  4WQ3 A;  3BFB A;  3SIB A;  3EG5 B;  4DS7 A;  2PVB A;  1S6J A;  2HET A;  2JC2 A;  4GGF C;  4A4C A;  1KCY A;  1A75 B;  1HT9 A;  1RWY A;  2JOJ A;  3NHI A;  1OOH A;  5GQQ C;  2K7B A;  2LLS A;  1CTR A;  2JNX A;  3DXL A;  3DZT A;  1K9U A;  1LA0 A;  3DF0 B;  3SG6 A;  3PLF B;  1PVB A;  1S5G Z;  1K95 A;  5HLV A;  1JF0 A;  1JSA A;  1ZAC A;  3BFH A;  1K2H A;  3K21 A;  1S36 A;  4I5J A;  5FI6 A;  5AXI A;  2VRG A;  3JTD C;  1K94 A;  3CTN A;  4WQ2 A;  4YI9 A;  3DVK A;  1IQ3 A;  3CZ0 A;  1JFK A;  2LHL A;  2I2R E;  3A4U B;  5AFP A;  1OZS A;  1CLM A;  4C0K A;  3FE8 A;  1SL9 A;  4MZJ A;  2ISD A;  1DEK A;  2LLT A;  3EKH A;  2KGR A;  1WRZ A;  1CB1 A;  4GUK A;  1KSO A;  2F33 A;  4GBA A;  1DF0 B;  4PT1 A;  4F0Z B;  3UO9 A;  5DIC A;  1CMF A;  3OGN A;  3BFA A;  3CS1 A;  2WOR A;  1YX7 A;  1KK8 C;  1WDC B;  1OOJ A;  2ERB A;  1F70 A;  2M0R A;  3TZ1 A;  1KK7 Y;  2L98 A;  2LCP A;  4MLW A;  4Q04 A;  1CDM A;  1BU3 A;  2ZKM X;  2Y1N A;  1J55 A;  4P5O E;  1ZOT B;  2KFF A;  1JF2 A;  2JXL A;  3BUM B;  1OMV A;  3VRP A;  4PHN A;  5K89 A;  2I7A A;  1QX2 A;  2LMT A;  1KFX L;  3B86 A;  3I5F C;  3R1P A;  5I2Q A;  5FI2 A;  1V1F A;  1NCX A;  2KFG A;  3OB2 B;  1TCO B;  1FBV A;  3R72 A;  3PN7 C;  1JUO A;  1L2O C;  3D0Y A;  4HRG A;  2K7C A;  5G08 A;  3DVE A;  4BY4 A;  2CCM A;  3SG7 A;  4HRH A;  2NCO A;  3LL8 B;  3E3R A;  1CDP A;  1ZMZ A;  3CR4 X;  1DT7 B;  1GM0 A;  1G33 A;  1C7W A;  2FJY A;  3F45 A;  2L5Y A;  5I94 A;  4XYN A;  5AER A;  4KYN A;  3VRQ A;  3VRR A;  1XFR A;  4NDC A;  3FIA A;  1TRF A;  3GOF A;  3VRN A;  1DJY A;  1SCV A;  3CZ2 A;  3D75 A;  1S3P A;  1B1G A;  5D69 A;  2KLE A;  1G8I A;  2YGU A;  4AQI A;  2K7D A;  1TUZ A;  2KHN A;  2PSR A;  3OP0 A;  4CLN A;  2WOS A;  2OTG C;  1XFW O;  2TN4 A;  4YGE B;  4GNK B;  1SYM A;  5CSF A;  1CMG A;  2CNP A;  2QDI A;  5J3X A;  4F7F A;  3CAB A;  4FQO A;  3NXA A;  3D78 A;  1WY9 A;  1J7P A;  3MSE B;  4ICB A;  1F54 A;  1X02 A;  3K1E A;  4XJK A;  4ZCU A;  1B8L A;  3JTD B;  3DVM A;  5BPJ A;  3B6X A;  4PHM A;  1Y0V H;  2HQW A;  2E6W A;  2KI4 B;  1XFU O;  4MRY A;  1SRA A;  1J7Q A;  1NP8 A;  1YVH A;  2M49 B;  5HKY A;  3S0G A;  2MJW B;  1R2U A;  1RRO A;  1WLZ A;  3EVV A;  4QJ3 B;  1IIO A;  2LE9 B;  1JBA A;  1M63 B;  2JU0 A;  5HKZ A;  1BOD A;  3BJH A;  1KFU S;  1LVC D;  3O2P A;  1SL7 A;  3A8R A;  1GGZ A;  1VRK A;  2K7O A;  2LAN A;  4GPL B;  4M2Q A;  3RZS A;  2H61 C;  1UHH A;  2M97 A;  2MBX A;  3EK8 A;  2L50 A;  4PDZ A;  2WND A;  1WDC C;  5D3O A;  1N65 A;  1LIN A;  3VB1 A;  2BE4 A;  4INW A;  1NX2 A;  1W7J B;  1SBJ A;  3N7H A;  3BYA A;  2LHI A;  1XO5 A;  3LK1 A;  2BEC A;  3TDI A;  1S6I A;  1E8A A;  2PYQ A;  1UUS A;  2F2O A;  2BBM A;  3I5F B;  5B8I B;  2I18 A;  4MEW A;  1UHN A;  3L47 A;  3QME A;  2KYF A;  3WNX B;  2KYC A;  1TNQ A;  1QV0 A;  2QAC A;  4YGB B;  1L2O B;  2KOT A;  1AUI B;  1NX1 A;  2QEV A;  4OR9 B;  1DC1 A;  2GGM A;  3PM8 A;  2F2P A;  1M45 A;  4GAO A;  1KQM B;  1QVI Y;  2LVV A;  3BXK A;  3L4A A;  1NIW A;  1OSA A;  3VRO A;  2HPS A;  3S0E A;  1SKT A;  1DJG A;  1OE9 B;  1IQ5 A;  3WHT B;  1NSH A;  3OB1 B;  1DQE A;  1JFJ A;  1CDL A;  1K90 D;  2OTG B;  4INX A;  2BCA A;  1U5I A;  1Z2C B;  1ZUZ A;  3S0D A;  3V2L A;  2F3Z A;  3NSL A;  1IJ5 A;  3PFV A;  3IF7 A;  1BJF A;  3CDN A;  2LP3 A;  2AUC A;  1CM4 A;  1MQ1 A;  4M2O A;  3EKJ A;  4L9M A;  1JC2 A;  1BMO A;  3BUN B;  1S5G Y;  4MRX A;  2GTE A;  1DGV A;  2ZRT A;  1UP5 A;  2G2B A;  2JT0 A;  2KI4 C;  1B8R A;  3D10 A;  2KI6 C;  2GV5 A;  1IG5 A;  2KFH A;  1QTX A;  1Y1U A;  2PAS A;  3BUO B;  2WCJ A;  3CR2 A;  2PQL A;  2ZFD A;  4YGA A;  2SAS A;  5DKR A;  1BR4 B;  3WHU B;  1B9A A;  1QV1 A;  1LKJ A;  1NWD A;  2SCP A;  3EVR A;  4YI8 A;  2Q91 A;  2HF5 A;  1A2X A;  2GGZ A;  3TUY C;  2LVK A;  1N2D A;  2OPO A;  1WLM A;  2JZI A;  2KQY A;  4MVF A;  2LLU A;  2BL0 B;  2MHH A;  1CNP A;  1PSR A;  2L5X B;  1B8C A;  3FE6 A;  3KF9 A;  4P2Y B;  2AAO A;  4E68 A;  2MRD A;  1FI5 A;  1M31 A;  2KLD A;  1QIV A;  4MBE A;  1CFP A;  1XK4 A;  1DF0 A;  2EHB A;  1TOP A;  2PAL A;  3BUW B;  3FWC A;  3Q8I A;  2WC5 A;  4OZD A;  2ZN9 A;  3DD4 A;  4C0J A;  1C7V A;  1MUX A;  1OOF A;  1RK9 A;  4PE7 A;  3SIA A;  3SJS A;  2B1U A;  2PMY A;  3EVU A;  5DKQ A;  1F8H A;  1B7T Z;  1ODB A;  2JPT A;  1FF1 A;  4ORC B;  3DY9 A;  1QAT A;  1J1E A;  5FI7 A;  4QJ4 B;  1S26 D;  1G4Y R;  3D0Y B;  3CYZ A;  3IQQ A;  5HKW A;  1B7T Y;  1ORG A;  2BCB A;  1DJW A;  1LS8 A;  3D77 A;  2F3Y A;  1OOI X;  4HSZ A;  1BLQ A;  1KQM C;  1OOG A;  2CBL A;  1SL8 A;  5DKN A;  4M2P A;  5AEQ A;  1UUR A;  4I5K A;  4OKH A;  5I2L A;  3B88 A;  1IH0 A;  3BOW A;  3SG5 A;  2KAY A;  1SNL A;  1LA3 A;  1TCF A;  1PAL A;  2H2K A;  1QS7 A;  2AMI A;  2BE6 A;  2M1K B;  3GK2 A;  4OVN F;  1AJ5 A;  1QX7 A;  1UHK A;  3PSR A;  3AKB A;  1GJY A;  1SSE B;  2O60 A;  4YGD B;  4QJ5 B;  1Y1X A;  1CLB A;  4HRE E;  1XYD A;  2IS9 A;  1YUU A;  2KPH A;  3PM2 A;  1BF5 A;  2LAP A;  1H8B A;  1AHR A;  4BY5 A;  2KBI A;  1B4C A;  4XJK B;  3LCP C;  2NXQ A;  2QEB A;  3QRX A;  3KPX A;  5D7F A;  2LMV A;  1H4B A;  3TDU A;  1REC A;  3DVJ A;  3NSO A;  3TUY B;  1FI6 A;  1K8U A;  1Z4H A;  1A4P A;  2WCM A;  1Y1A A;  1YRU B;  4NDB A;  2JQ6 A;  5ER4 X;  2EC6 B;  1F4O A;  3M0W A;  1BOC A;  1MHO A;  1WRL A;  3EK7 A;  1TWO A;  2M29 A;  3I5H B;  2MA2 A;  2QEO A;  3CZ1 A;  1UWO A;  5CSI A;  1JWD A;  2HQ8 A;  2K61 A;  2O5G A;  1PSB A;  3AAJ A;  3PAL A;  4CFR A;  2EGD A;  4N1G A;  1NCZ A;  4ETO A;  2BL0 C;  3TDZ A;  3NSI A;  2M7N A;  2JTZ A;  3I5G C;  2BCX A;  1KFU L;  1S1E A;  4JPZ B;  2KSP A;  2OS8 B;  5FYX A;  4C0L A;  2LUX A;  1WRK A;  1TN4 A;  1NUB A;  1DMO A;  5CPV A;  1QAS A;  1C3Y A;  1F55 A;  1A29 A;  4JWQ A;  5KSZ A;  4CPV A;  5EL2 A;  2R2I A;  5I8N A;  1L7Z A;  2BBN A;  3B7A A;  3OBV A;  2NCP A;  4PCW A;  1IGV A;  3FWB A;  4PAL A;  1SR6 B;  2WCL A;  1RJV A;  1TNW A;  2BKH B;  1FPW A;  1AK8 A;  1J1D A;  3C1V A;  1YTZ C;  4YRU A;  3D73 A;  2DOQ A;  5PAL A;  2JTT A;  1YVL A;  2NLN A;  1SCM B;  3SS4 A;  1UHI A;  1ALW A;  1LXF C;  2G9B A;  2P70 A;  1KWO B;  4USL A;  1GGW A;  2BAP A;  1AVS A;  1DEL A;  4U8D A;  4D1E A;  1AP4 A;  3CWG A;  1GQM A;  1S6C A;  1M46 A;  2LM5 A;  4GFT A;  2M9G A;  1W7I B;  5CSN A;  1U5I B;  5KTY A;  1CLL A;  1SPY A;  2KGB C;  2MLF C;  2QPT A;  2Y1M A;  3I5I B;  3OX5 A;  4MZK A;  5HLO A;  4JD9 A;  2F8P A;  2M8U A;  3RM1 A;  2KDH A;  2L2E A;  3UNW A;  3L4L A;  3NSK A;  1K9P A;  1MXL C;  2WCF A;  1ALV A;  2JXC A;  2L4I A;  3HX4 A;  3S0F A;  3SS5 A;  1PK0 D;  4DUQ A;  1A75 A;  3R1V A;  3NHT A;  3WXA A;  1YUS A;  1IRJ A;  4DIR A;  1PUL A;  3BQ3 A;  2LP2 A;  3TS5 C;  1KSM A;  2WC6 A;  1TIZ A;  2EC6 C;  2Q4U A;  5HYD A;  3IQO A;  1Q80 A;  3DF0 A;  5HL1 A;  2QEH A;  1T14 A;  3I5H C;  3CGA A;  3PAT A;  3B87 A;  1DVI A;  1CKK A;  1KQV A;  1EXR A;  2PRU A;  1YX8 A;  2K2F A;  5IBW A;  2E30 A;  1A03 A;  2MLE C;  4FTG A;  4PE0 A;  2JT3 A;  2K0J A;  1DJX A;  3I5G B;  1V1G A;  3KEV A;  2WCH A;  1CM1 A;  4GGN A;  1QIW A;  1YRT B;  2FJU B;  3FE9 A;  3S0A A;  2A4J A;  2KBM A;  4CFQ A;  3LLE A;  3R1O A;  2OS8 C;  1OMD A;  1DJH A;  1BG1 A;  4YBH B;  4MSP A;  1IKU A;  1B47 A;  1XA5 A;  2Y5I A;  3NGV A;  2H61 A;  4IJ7 A;  1PRW A;  1EH2 A;  5TNC A;  5JOL A;  3FS7 A;  1KK7 Z;  2LV7 A;  1AJ4 A;  4I5N B;  2L2C A;  2LUC A;  3PJI A;  1KFX S;  3SG4 A;  1SR6 C;  2Y4Q A;  5JJG A;  5ER5 A;  2L4H A;  4PE4 A;  1J7R A;  1RFJ A;  2M1U A;  3H4S E;  1SCM C;  3JVT C;  5KU1 A;  2KAV A;  3KO0 A;  1XFY O;  1KWO C;  3BOW B;  3LK0 A;  1SMG A;  2COL B;  3OHM B;  4ORB B;  4PE1 A;  3CZT X;  4PHJ A;  1OW4 A;  1PVA A;  1QJT A;  1EG4 A;  2JRF A;  3EK4 A;  1NX3 A;  1MXE A;  4MZL A;  4R1E A;  2L51 A;  2CXJ A;  2FCD A;  1HQV A;  2P6B B;  1CDN A;  4TNC A;  2JNF A;  2WCK A;  1EL4 A;  2CT9 A;  2I94 A;  3I5I C;  2JPO A;  2WC8 A;  3SG2 A;  3SG3 A;  4AOM A;  3AAK A;  1K96 A;  2MAZ A;  4AQJ A;  1TNX A;  5F6T A;  3O4X A;  2NZ0 A;  4GGF A;  1C3Z A;  1BR1 B;  1XFX O;  3GK1 A;  1EJ3 A;  1MWN A;  1XFZ O;  1W9Z A;  2P71 A;  2FCE A;  1DJZ A;  2ZRS A;  1Y6W A;  3CLN A;  1OQP A;  4OV2 A;  5CSJ A;  3TS5 B;  1XVJ A;  2LVJ A;  4IL1 A;  4DRW A;  4ORA B;  4MN0 A;  2JUL A;  4JKT A;  2M3W A;  1F4Q A;  2FOT A;  2ZND A;  3OX6 A;  2H8V A;  5I2O A;  3KHE A;  1DGU A;  2LNK A;  2KNE A;  2CTN A;  4NQG A;  2K2A A;  2LC5 A;  2BKI B;  2V53 A;  1QLK A;  1BT6 A;  2KQ6 A;  2BNX A;  1YR5 A;  1DTL A;  1RTP 1;  3S0B A;  2M7L A;  2KAX A;  1CFC A;  1TUJ A;  2KI6 D;  4YGC B;  2JWW A;  4A4B A;  3IVT A;  4UPG A;  3BUX B;  1QLS A;  1K93 D; 
#chains in the Genus database with same CATH homology
 4ZCV A;  1NX0 A;  2LVI A;  1IWQ A;  1CFF A;  3O78 A;  1XK4 C;  3GK4 X;  5AAN A;  2ZNE A;  1N0Y A;  2ZN8 A;  1EG3 A;  2L0P A;  4WRI A;  4CID A;  1NYA A;  2LMU A;  2RGI A;  1KK8 B;  1SW8 A;  4I5L B;  2WCB A;  4NDD A;  1TNP A;  1NPQ A;  3VGO A;  1MF8 B;  1D1O A;  3JVT B;  1TTX A;  1DJI A;  1SY9 A;  3HCM A;  4N5X A;  1ZFS A;  1YUR A;  1OMR A;  4PHK A;  1SK6 D;  1YUT A;  4JQ0 D;  4DCK A;  1M39 A;  3ZWH A;  4OCI A;  2WCE A;  3AKA A;  1MR8 A;  1R6P A;  3ICB A;  3PN7 B;  3RLZ A;  1QVI Z;  3O6B A;  2JT8 A;  3CR5 X;  1QX5 B;  1K9K A;  3O4Y A;  1J7O A;  4N1F A;  1FW4 A;  2K8M B;  3ZNI A;  1IJ6 A;  1CFD A;  1UHJ A;  1F71 A;  1OZO A;  1XFV O;  2D8N A;  1QXP A;  1C07 A;  1NCY A;  4WQ3 A;  3SIB A;  4DS7 A;  2PVB A;  1S6J A;  2HET A;  2JC2 A;  4GGF C;  4A4C A;  1KCY A;  1A75 B;  1HT9 A;  1RWY A;  2JOJ A;  5GQQ C;  2K7B A;  2LLS A;  1CTR A;  2JNX A;  1K9U A;  1LA0 A;  3DF0 B;  3SG6 A;  3PLF B;  1PVB A;  1S5G Z;  1K95 A;  5HLV A;  1JF0 A;  1JSA A;  1ZAC A;  1K2H A;  3K21 A;  1S36 A;  4I5J A;  5AXI A;  2VRG A;  3JTD C;  1K94 A;  3CTN A;  4WQ2 A;  4YI9 A;  3DVK A;  1IQ3 A;  1JFK A;  2LHL A;  2I2R E;  3A4U B;  5AFP A;  1OZS A;  1CLM A;  4C0K A;  1SL9 A;  4MZJ A;  2ISD A;  2LLT A;  3EKH A;  2KGR A;  1WRZ A;  1CB1 A;  4GUK A;  1KSO A;  2F33 A;  4GBA A;  1DF0 B;  4F0Z B;  1CMF A;  3CS1 A;  2WOR A;  1YX7 A;  1KK8 C;  1WDC B;  1OOJ A;  1F70 A;  2M0R A;  3TZ1 A;  1KK7 Y;  2L98 A;  2LCP A;  4MLW A;  4Q04 A;  1CDM A;  1BU3 A;  2ZKM X;  2Y1N A;  1J55 A;  4P5O E;  1ZOT B;  2KFF A;  1JF2 A;  2JXL A;  3BUM B;  1OMV A;  3VRP A;  4PHN A;  2I7A A;  1QX2 A;  2LMT A;  1KFX L;  3I5F C;  5I2Q A;  1V1F A;  1NCX A;  2KFG A;  3OB2 B;  1TCO B;  1FBV A;  4HRG A;  3PN7 C;  1JUO A;  1L2O C;  3D0Y A;  5G08 A;  2K7C A;  3DVE A;  4BY4 A;  2CCM A;  3SG7 A;  4HRH A;  2NCO A;  3LL8 B;  3E3R A;  1CDP A;  1ZMZ A;  3CR4 X;  1DT7 B;  1G33 A;  1C7W A;  3F45 A;  4XYN A;  5AER A;  3VRQ A;  3VRR A;  4NDC A;  3FIA A;  1TRF A;  3GOF A;  3VRN A;  1DJY A;  1SCV A;  1S3P A;  1B1G A;  5D69 A;  1G8I A;  4AQI A;  2K7D A;  2PSR A;  2KHN A;  3OP0 A;  4CLN A;  2WOS A;  2OTG C;  1XFW O;  2TN4 A;  4YGE B;  4GNK B;  1SYM A;  5CSF A;  1CMG A;  2CNP A;  5J3X A;  4FQO A;  3NXA A;  1J7P A;  1WY9 A;  3MSE B;  4ICB A;  1F54 A;  1X02 A;  4XJK A;  4ZCU A;  1B8L A;  3JTD B;  3DVM A;  5BPJ A;  4PHM A;  1Y0V H;  2HQW A;  2E6W A;  2KI4 B;  1XFU O;  4MRY A;  1SRA A;  1J7Q A;  1NP8 A;  1YVH A;  2M49 B;  5HKY A;  2MJW B;  1R2U A;  1RRO A;  1WLZ A;  3EVV A;  4QJ3 B;  2LE9 B;  1JBA A;  1M63 B;  2JU0 A;  5HKZ A;  1BOD A;  1KFU S;  1LVC D;  3O2P A;  1SL7 A;  3A8R A;  1GGZ A;  1VRK A;  2K7O A;  2LAN A;  4GPL B;  4M2Q A;  2H61 C;  1UHH A;  2M97 A;  2MBX A;  3EK8 A;  2L50 A;  4PDZ A;  2WND A;  1WDC C;  1N65 A;  1LIN A;  2BE4 A;  1NX2 A;  1W7J B;  1SBJ A;  3BYA A;  2LHI A;  1XO5 A;  3LK1 A;  2BEC A;  3TDI A;  1S6I A;  1E8A A;  1UUS A;  2F2O A;  2BBM A;  3I5F B;  5B8I B;  2I18 A;  4MEW A;  1UHN A;  2KYF A;  3WNX B;  2KYC A;  1TNQ A;  1QV0 A;  2QAC A;  4YGB B;  1L2O B;  2KOT A;  1AUI B;  1NX1 A;  4OR9 B;  2GGM A;  3PM8 A;  2F2P A;  1M45 A;  4GAO A;  1KQM B;  1QVI Y;  2LVV A;  3BXK A;  1NIW A;  1OSA A;  3VRO A;  2HPS A;  1SKT A;  1DJG A;  1OE9 B;  1IQ5 A;  3WHT B;  1NSH A;  3OB1 B;  1JFJ A;  1CDL A;  1K90 D;  2OTG B;  2BCA A;  1U5I A;  1ZUZ A;  2F3Z A;  3NSL A;  1IJ5 A;  3PFV A;  3IF7 A;  1BJF A;  2LP3 A;  2AUC A;  1CM4 A;  1MQ1 A;  4M2O A;  3EKJ A;  4L9M A;  1JC2 A;  1BMO A;  3BUN B;  1S5G Y;  4MRX A;  1DGV A;  2ZRT A;  1UP5 A;  2G2B A;  2JT0 A;  2KI4 C;  1B8R A;  3D10 A;  2KI6 C;  2GV5 A;  1IG5 A;  2KFH A;  1QTX A;  1Y1U A;  2PAS A;  3BUO B;  3CR2 A;  5DKR A;  4DUQ A;  2ZFD A;  4YGA A;  2SAS A;  1BR4 B;  3WHU B;  1B9A A;  1QV1 A;  1LKJ A;  1NWD A;  2SCP A;  3EVR A;  4YI8 A;  2Q91 A;  2HF5 A;  1A2X A;  2GGZ A;  3TUY C;  2LVK A;  1N2D A;  2OPO A;  1WLM A;  2JZI A;  2KQY A;  4MVF A;  2LLU A;  2BL0 B;  2MHH A;  1CNP A;  1PSR A;  2L5X B;  1B8C A;  3KF9 A;  4P2Y B;  2AAO A;  4E68 A;  2MRD A;  1FI5 A;  1M31 A;  1QIV A;  4MBE A;  1CFP A;  1XK4 A;  1DF0 A;  2EHB A;  1TOP A;  2PAL A;  3BUW B;  3FWC A;  2ZN9 A;  3DD4 A;  4C0J A;  1C7V A;  1MUX A;  3SIA A;  1RK9 A;  4PE7 A;  3SJS A;  2B1U A;  2PMY A;  3EVU A;  5DKQ A;  1F8H A;  1B7T Z;  1ODB A;  2JPT A;  1FF1 A;  4ORC B;  1QAT A;  1J1E A;  4QJ4 B;  1S26 D;  1G4Y R;  3D0Y B;  3IQQ A;  5HKW A;  3SG4 A;  1B7T Y;  5K89 A;  2BCB A;  1DJW A;  2F3Y A;  4HSZ A;  1BLQ A;  1KQM C;  2CBL A;  1SL8 A;  5DKN A;  4M2P A;  5AEQ A;  1UUR A;  4I5K A;  4OKH A;  5I2L A;  1IH0 A;  3BOW A;  3SG5 A;  2KAY A;  1SNL A;  1LA3 A;  1TCF A;  1PAL A;  2H2K A;  2BE6 A;  1QS7 A;  2AMI A;  2M1K B;  3GK2 A;  4OVN F;  1AJ5 A;  1QX7 A;  1UHK A;  3PSR A;  3AKB A;  1GJY A;  2O60 A;  4YGD B;  4QJ5 B;  1Y1X A;  1CLB A;  4HRE E;  1XYD A;  2IS9 A;  1YUU A;  1BF5 A;  2LAP A;  1H8B A;  1AHR A;  4BY5 A;  2KBI A;  1B4C A;  4XJK B;  3LCP C;  2NXQ A;  3QRX A;  3KPX A;  5D7F A;  2LMV A;  1H4B A;  3TDU A;  1REC A;  3DVJ A;  3NSO A;  3TUY B;  1FI6 A;  1K8U A;  1A4P A;  1Y1A A;  1YRU B;  4NDB A;  2JQ6 A;  5ER4 X;  2EC6 B;  1F4O A;  3M0W A;  1BOC A;  1MHO A;  1WRL A;  3EK7 A;  3I5H B;  2M29 A;  5CSI A;  2MA2 A;  1UWO A;  1JWD A;  2HQ8 A;  2K61 A;  2O5G A;  1PSB A;  3AAJ A;  3PAL A;  4CFR A;  2EGD A;  4N1G A;  1NCZ A;  4ETO A;  2BL0 C;  3TDZ A;  3NSI A;  2M7N A;  2JTZ A;  3I5G C;  2BCX A;  1KFU L;  1S1E A;  4JPZ B;  2KSP A;  2OS8 B;  5FYX A;  4C0L A;  2LUX A;  1WRK A;  1TN4 A;  1NUB A;  1DMO A;  5CPV A;  1QAS A;  1F55 A;  1A29 A;  4JWQ A;  5KSZ A;  4CPV A;  5I8N A;  2R2I A;  1L7Z A;  2BBN A;  2NCP A;  4PCW A;  1IGV A;  3FWB A;  4PAL A;  1SR6 B;  1RJV A;  1TNW A;  2BKH B;  1FPW A;  1AK8 A;  1J1D A;  3C1V A;  1YTZ C;  4YRU A;  5PAL A;  2DOQ A;  2JTT A;  1YVL A;  2NLN A;  1SCM B;  1UHI A;  1ALW A;  1LXF C;  2G9B A;  1KWO B;  4USL A;  1GGW A;  1AVS A;  4D1E A;  4U8D A;  1AP4 A;  3CWG A;  1GQM A;  1S6C A;  1M46 A;  2LM5 A;  4GFT A;  2M9G A;  1W7I B;  5CSN A;  1U5I B;  5KTY A;  1CLL A;  1SPY A;  2KGB C;  2MLF C;  2QPT A;  2Y1M A;  3I5I B;  3OX5 A;  4MZK A;  5HLO A;  2F8P A;  2M8U A;  3RM1 A;  2KDH A;  2L2E A;  3NSK A;  1K9P A;  1MXL C;  2WCF A;  1ALV A;  2JXC A;  2L4I A;  3HX4 A;  1PK0 D;  1A75 A;  3WXA A;  1YUS A;  1IRJ A;  4DIR A;  1PUL A;  3BQ3 A;  2LP2 A;  3TS5 C;  1KSM A;  1TIZ A;  2EC6 C;  2Q4U A;  5HYD A;  3IQO A;  1Q80 A;  3DF0 A;  3I5H C;  3CGA A;  3PAT A;  1DVI A;  1CKK A;  1KQV A;  1EXR A;  2PRU A;  1YX8 A;  2K2F A;  5IBW A;  2E30 A;  1A03 A;  2MLE C;  4FTG A;  4PE0 A;  2JT3 A;  2K0J A;  1DJX A;  3I5G B;  1V1G A;  3KEV A;  1CM1 A;  4GGN A;  1QIW A;  1YRT B;  2FJU B;  2A4J A;  2KBM A;  4CFQ A;  3LLE A;  2OS8 C;  1OMD A;  1DJH A;  1BG1 A;  4YBH B;  4MSP A;  1IKU A;  1B47 A;  1XA5 A;  2Y5I A;  2H61 A;  1PRW A;  1EH2 A;  5TNC A;  5JOL A;  3FS7 A;  1KK7 Z;  2LV7 A;  1AJ4 A;  4I5N B;  2LUC A;  1KFX S;  1SR6 C;  2Y4Q A;  5JJG A;  5ER5 A;  2L4H A;  4PE4 A;  1J7R A;  1RFJ A;  2M1U A;  3H4S E;  1SCM C;  3JVT C;  5KU1 A;  2KAV A;  3KO0 A;  1XFY O;  1KWO C;  3BOW B;  3LK0 A;  1SMG A;  2COL B;  3OHM B;  4ORB B;  4PE1 A;  3CZT X;  4PHJ A;  1PVA A;  2JRF A;  1QJT A;  1EG4 A;  3EK4 A;  1NX3 A;  1MXE A;  4MZL A;  4R1E A;  2L51 A;  2CXJ A;  2FCD A;  1HQV A;  2P6B B;  1CDN A;  4TNC A;  2JNF A;  1EL4 A;  2CT9 A;  2I94 A;  3I5I C;  2WC8 A;  3SG2 A;  3SG3 A;  4AOM A;  3AAK A;  1K96 A;  2MAZ A;  4AQJ A;  1TNX A;  5F6T A;  2NZ0 A;  4GGF A;  1BR1 B;  1XFX O;  3GK1 A;  1EJ3 A;  1MWN A;  1XFZ O;  3CLN A;  2FCE A;  1DJZ A;  2ZRS A;  1Y6W A;  5CSJ A;  1OQP A;  4OV2 A;  3TS5 B;  1XVJ A;  2LVJ A;  4IL1 A;  4DRW A;  4ORA B;  4MN0 A;  2JUL A;  2M3W A;  1F4Q A;  2FOT A;  2ZND A;  3OX6 A;  5I2O A;  3KHE A;  1DGU A;  2LNK A;  2KNE A;  2CTN A;  4NQG A;  2K2A A;  2LC5 A;  2BKI B;  2V53 A;  1QLK A;  1BT6 A;  2KQ6 A;  1YR5 A;  1DTL A;  1RTP 1;  2M7L A;  2KAX A;  1CFC A;  2KI6 D;  4YGC B;  2JWW A;  4A4B A;  4UPG A;  3BUX B;  1QLS A;  1K93 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...