1KFUS

Crystal structure of human m-calpain form ii
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
184
structure length
184
Chain Sequence
THYSNIEANESEEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of calcium-free human m-calpain suggests an electrostatic switch mechanism for activation by calcium.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords M-CALPAIN LARGE SUBUNIT
total genus 51
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2001-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kfuS00
3DVJA 1KK8C 2M0RA 4GAOA 1IKUA 1AUIB 1ZFSA 5KU1A 3NXAA 1SR6C 1SRAA 1Y6WA 2KAVA 2LV7A 1B4CA 1K90D 5TNCA 1K2HA 2LMUA 5DKRA 4M2QA 1UP5A 4YGAA 4R1EA 3I5GC 4MLWA 1XA5A 2MBXA 1QASA 1XK4A 4XJKB 2I7AA 4YGDB 3EVRA 1B7TY 2SCPA 1FI6A 1K95A 2BCXA 1JF2A 1UWOA 2PRUA 1YUUA 4NDBA 1K8UA 3FWCA 2O5GA 2BL0B 1M46A 1V1FA 4AQIA 1CLLA 2WCBA 3PM8A 4DS7A 2KFFA 3DVEA 1SL9A 1XFZO 1YRUB 2F2PA 1NIWA 1PSRA 1UHHA 1N2DA 1EG3A 1M39A 2ZFDA 3PALA 5I2OA 1CLBA 1JUOA 1QV1A 3WNXB 1JFJA 1UHIA 5CSNA 1OOJA 1NSHA 1OE9B 1Y1XA 2AMIA 2COLB 1JF0A 5HYDA 2LC5A 1J7RA 2KAXA 2JWWA 4OVNF 2ISDA 2OTGC 1YR5A 1K9PA 3TS5B 2FJUB 2LM5A 1K9KA 1B8RA 2JNFA 4PE4A 2WNDA 2LP2A 2E6WA 2TN4A 3FS7A 3OB2B 1CTRA 5J3XA 3I5GB 2M1UA 1R2UA 1CFPA 1J55A 2K7CA 1QLSA 1AP4A 1C07A 3C1VA 5PALA 1NUBA 4AQJA 1IH0A 1KFXL 4PHNA 2LE9B 4PALA 3BQ3A 1XFXO 2GV5A 4OV2A 2F33A 4I5LB 1MUXA 4GGNA 2Y5IA 2M8UA 4GNKB 4M2OA 4N1GA 4ZCVA 2KDHA 1LA3A 1WDCC 3SG7A 2EC6C 3I5FB 1CDLA 2A4JA 1J1DA 4JQ0D 2ZRSA 1TIZA 4L9MA 1JSAA 3TS5C 1C7VA 5KTYA 2K7OA 2LAPA 5AXIA 3SG6A 2KNEA 4QJ4B 4GBAA 1AK8A 3FIAA 1NX1A 1EG4A 5AEQA 2NLNA 2KFHA 4HSZA 4F0ZB 2JU0A 1A03A 4QJ3B 1XVJA 1K94A 4YI8A 3D0YA 1TOPA 1S26D 3OHMB 3HX4A 1NX2A 1HT9A 1YX8A 3PN7C 1FI5A 1L2OC 4PCWA 4YGCB 1YURA 4ICBA 1QVIY 2WC8A 4PDZA 3CR2A 2M97A 1GGWA 1G33A 4YGBB 3SG5A 3VRRA 2K2AA 1ALVA 2LVKA 3LK0A 2E30A 2L50A 1WLZA 1NP8A 2PALA 1LKJA 2BBNA 1BT6A 2BL0C 4PHKA 4Q04A 2NCOA 4MZJA 1IQ3A 2ZNDA 2JXLA 1CB1A 2Q91A 2HF5A 1OMDA 1YVLA 1CKKA 1CDNA 2GGZA 1BMOA 1K96A 1G8IA 2HPSA 1QX7A 2I18A 1OMRA 1A2XA 1SY9A 1W7JB 2LLTA 1J7PA 4GPLB 3E3RA 4MBEA 1SBJA 1ZOTB 1G4YR 5I8NA 1L7ZA 1QS7A 1TRFA 4ORBB 1UHKA 3LL8B 1TNQA 2KBIA 1HQVA 1PULA 2EHBA 3RLZA 1DT7B 2KQ6A 3ICBA 4I5KA 1F4OA 1DJZA 4CFQA 1YRTB 4NQGA 1SPYA 4GGFA 1WRLA 2CNPA 3KHEA 1J1EA 3CR5X 1WRZA 1F4QA 3BYAA 4IL1A 3RM1A 3WXAA 1SKTA 1X02A 2M1KB 4HREE 1MWNA 2H61A 2M7LA 2K0JA 3O2PA 2KI6C 3BOWB 1JFKA 2Q4UA 2LMVA 5AANA 3TZ1A 1B8CA 1KWOC 1R6PA 2LVIA 4ORCB 4A4BA 3F45A 4GUKA 5BPJA 2PASA 1QLKA 1H4BA 2JT3A 1QX2A 1FPWA 2CTNA 3EK4A 2BBMA 1EL4A 2JNXA 2LUCA 3JTDC 2K7BA 4P2YB 1M63B 3MSEB 1XO5A 3FWBA 2M29A 4YGEB 2PMYA 3EKJA 2LMTA 3KEVA 4MEWA 4C0KA 2F8PA 1WDCB 2WCFA 3DVKA 1RFJA 4C0LA 2LNKA 3JTDB 1N65A 2CXJA 2H61C 1IJ5A 1OQPA 2KI6D 3GK4X 4OR9B 5I2LA 1AVSA 1UHJA 1SL7A 3K21A 5B8IB 1WRKA 3JVTC 1SCMB 1OZOA 3IQOA 2IS9A 1BJFA 1QV0A 1LVCD 5FYXA 1PK0D 2ZN8A 1A75A 3DD4A 1M31A 1XFVO 4FTGA 1H8BA 2AAOA 1Y0VH 2KGRA 3SG4A 1F55A 3PFVA 3CTNA 4MZKA 3CS1A 4BY4A 1LXFC 2EC6B 4I5NB 3VROA 1LINA 3OB1B 1IQ5A 2LHLA 4FQOA 3BOWA 1SNLA 3ZWHA 4MRXA 1BLQA 1DJXA 1U5IA 1AJ5A 1QJTA 2QPTA 1CM4A 1KK8B 2K8MB 3IQQA 2AUCA 3I5HC 1KFUL 2BCBA 2ZN9A 1SW8A 4UPGA 1SMGA 1YX7A 1CLMA 1DJYA 2L2EA 1SCMC 1RJVA 1A4PA 2SASA 1CFFA 5CSFA 1CFCA 2KOTA 4USLA 1B1GA 2HQWA 1ZMZA 1IRJA 5JOLA 4DIRA 4U8DA 3TUYC 2LHIA 1TCFA 5D7FA 4P5OE 1SL8A 4HRGA 4GFTA 2JC2A 3AKAA 2F2OA 2JQ6A 1S5GZ 3SJSA 1F70A 1D1OA 1S6JA 1SR6B 3BUWB 3CGAA 2L98A 2M49B 1JWDA 1KSMA 3KO0A 1EXRA 2CCMA 1A29A 1DF0B 2FOTA 2DOQA 1PSBA 1JC2A 2MA2A 1UURA 3DF0B 3BUNB 3OX5A 2JT8A 3ZNIA 3TDUA 3TUYB 3LCPC 3SIAA 3TDZA 4QJ5B 1DTLA 1F54A 2VRGA 1BF5A 1QX5B 2JULA 1A75B 3I5HB 4JPZB 3D0YB 1QVIZ 4JWQA 2WOSA 1CNPA 1Q80A 2V53A 3BUMB 1PVAA 1ZUZA 2R2IA 2JTTA 1C7WA 3DVMA 2BE6A 1OMVA 1SCVA 2EGDA 1GGZA 2M9GA 2L4IA 1DF0A 1ZACA 2M3WA 1QTXA 3I5IC 3PATA 1DGUA 2G9BA 1Y1UA 1OSAA 4PE0A 5G08A 1MXEA 1TN4A 2KAYA 5F6TA 5HLOA 2D8NA 1K93D 2LLSA 4D1EA 2L0PA 3O6BA 2M7NA 3WHUB 1UUSA 1IWQA 1N0YA 2KSPA 1MXLC 1OZSA 2KFGA 2LVJA 1S36A 3PN7B 4GGFC 2LLUA 2CT9A 2CBLA 2PVBA 1PRWA 1MF8B 3I5IB 4M2PA 1NWDA 1BR1B 4YI9A 3TDIA 3SG3A 5KSZA 3LLEA 4AOMA 1KK7Z 3NSLA 1NCYA 1FF1A 1WLMA 3OP0A 2LVVA 4WQ3A 1EJ3A 3GK1A 1XFYO 4ETOA 1YVHA 2I94A 3IF7A 2L51A 1PVBA 1CMFA 3A8RA 2K7DA 1J7QA 5DKQA 2QACA 1PALA 3PSRA 4N5XA 5HKYA 1S6IA 5HKWA 4MVFA 1NPQA 2JPTA 3DF0A 2KQYA 1F71A 2KI4C 1BR4B 1WY9A 1SYMA 2I2RE 3GOFA 2MJWB 1MQ1A 1QATA 1YUSA 2JTZA 2LP3A 1QIVA 3GK2A 4TNCA 4HRHA 1TNWA 2NXQA 1BODA 4XYNA 4WQ2A 5HKZA 1L2OB 4CIDA 1MHOA 2H2KA 2Y1MA 5DKNA 4MN0A 1XFWO 3SG2A 3EK8A 3VRNA 2BKIB 5CPVA 2HETA 3JVTB 4WRIA 2PSRA 2JRFA 4MZLA 5I2QA 1W7IB 4NDDA 1NX3A 1S1EA 3EVVA 1RECA 1RWYA 1QXPA 2LUXA 2OS8C 4CFRA 2F3YA 1B8LA 1KFUS 1SK6D 4PHMA 1U5IB 1CFDA 1CDMA 1UHNA 1ODBA 2JZIA 1DJGA 1NYAA 1Y1AA 2FCEA 5ER5A 1IGVA 3AAJA 2MLFC 1NX0A 3CLNA 1IJ6A 1NCXA 2BE4A 4OCIA 2G2BA 4PE1A 3NSOA 1DJWA 2MLEC 2HQ8A 3WHTB 1RK9A 1NCZA 5GQQC 1TNXA 1VRKA 1TNPA 3CZTX 4DUQA 1KQMC 1S5GY 3OX6A 5JJGA 4ORAB 2JT0A 1AJ4A 1DVIA 1ALWA 4DRWA 2MAZA 5AFPA 2KGBC 3NSKA 2Y4QA 4PE7A 2OS8B 2BECA 1BG1A 2O60A 1DMOA 2KBMA 1S3PA 2F3ZA 3H4SE 2MRDA 4C0JA 2Y1NA 5AERA 3D10A 1FW4A 1QIWA 1XK4C 1YUTA 2JXCA 3AKBA 1TCOB 1E8AA 1F8HA 3KPXA 1JBAA 1S6CA 5CSJA 4MSPA 4PHJA 4ZCUA 1KK7Y 3VRQA 1RTP1 1B7TZ 2JOJA 1DGVA 3VRPA 2KYFA 1GQMA 3EK7A 4MRYA 1KQVA 2BCAA 3EKHA 3I5FC 1BOCA 4I5JA 4CPVA 4CLNA 1YTZC 2ZRTA 5D69A 1RROA 3KF9A 1CMGA 3VGOA 2FCDA 4A4CA 1B9AA 2K61A 2L4HA 2WCEA 4N1FA 4XJKA 1V1GA 1IG5A 5K89A 3AAKA 4OKHA 2OTGB 3BUXB 2LCPA 1KWOB 2GGMA 1KSOA 2BKHB 2KHNA 3BUOB 3O4YA 1J7OA 5IBWA 1DJIA 2KI4B 1CM1A 5ER4X 3M0WA 4YBHB 2NCPA 2ZNEA 4NDCA 3NSIA 4BY5A 1XFUO 3HCMA 1AHRA 1M45A 2B1UA 2OPOA 1GJYA 1KFXS 3SIBA 1EH2A 3CR4X 1MR8A 3O78A 2KYCA 5CSIA 1B47A 2K2FA 2MHHA 4DCKA 1CDPA 1TTXA 2L5XB 3QRXA 2ZKMX 1KCYA 3EVUA 3PLFB 5HLVA 2WORA 1XYDA 2NZ0A 4E68A 1FBVA 1KQMB 3BXKA 4YRUA 2P6BB 1BU3A 1LA0A 3LK1A 2RGIA 3CWGA 3A4UB 1DJHA 1K9UA 2LANA
chains in the Genus database with same CATH superfamily
3DVJA 1KK8C 2M0RA 4GAOA 1IKUA 1AUIB 1ZFSA 5KU1A 3NXAA 1SR6C 1SRAA 1Y6WA 2KAVA 2LV7A 1B4CA 1K90D 5TNCA 1K2HA 2LMUA 5DKRA 4M2QA 1C3YA 1UP5A 4YGAA 3FE8A 4R1EA 3I5GC 4MLWA 1ORGA 1XA5A 3R1PA 2MBXA 1QASA 1XK4A 4XJKB 2I7AA 4YGDB 3EVRA 1B7TY 2SCPA 1FI6A 1K95A 2BCXA 1JF2A 1UWOA 2PRUA 1YUUA 2YGUA 1K8UA 3FWCA 4NDBA 2O5GA 2BL0B 1M46A 1V1FA 4AQIA 1CLLA 3DZTA 2WCBA 3PM8A 4DS7A 1IIOA 2KFFA 3DVEA 1SL9A 1XFZO 1YRUB 2F2PA 1GM0A 4INXA 1NIWA 1PSRA 1UHHA 1N2DA 1XFRA 1EG3A 1M39A 2ZFDA 3PALA 5I2OA 1CLBA 1JUOA 1QV1A 3WNXB 1JFJA 3CZ1A 1UHIA 5CSNA 1OOJA 1NSHA 1OE9B 1TUJA 1Y1XA 2AMIA 2COLB 1JF0A 5HYDA 2LC5A 1J7RA 2KAXA 2JWWA 4OVNF 2ISDA 2OTGC 1YR5A 1K9PA 3TS5B 2FJUB 2LM5A 1K9KA 1B8RA 2JNFA 4PE4A 1OOFA 2WNDA 2LP2A 2E6WA 2TN4A 3FS7A 3OB2B 1CTRA 5J3XA 3I5GB 2M1UA 1R2UA 2GTEA 1CFPA 1J55A 2K7CA 1QLSA 1AP4A 1C07A 3C1VA 5PALA 1NUBA 4AQJA 1IH0A 1KFXL 3D74A 4PHNA 2LE9B 4PALA 3BQ3A 1XFXO 2GV5A 4OV2A 2F33A 4I5LB 1MUXA 4GGNA 2Y5IA 2M8UA 3NHIA 4GNKB 4M2OA 4N1GA 4ZCVA 1DC1A 2KDHA 1LA3A 1WDCC 3SG7A 2EC6C 3I5FB 1CDLA 2A4JA 1J1DA 4JQ0D 2ZRSA 3RZSA 1TIZA 3NHTA 4L9MA 4FQTA 3TS5C 1C7VA 1JSAA 4JKTA 5KTYA 2P71A 2K7OA 1W9ZA 5I94A 3S0BA 2LAPA 5AXIA 3SG6A 2KNEA 4QJ4B 4GBAA 1AK8A 2JPOA 3FIAA 1NX1A 1EG4A 5AEQA 2NLNA 2KFHA 4HSZA 4F0ZB 2JU0A 1A03A 4QJ3B 1XVJA 1K94A 4YI8A 3D0YA 1TOPA 1S26D 3OHMB 3HX4A 1NX2A 1HT9A 1YX8A 3PN7C 1FI5A 1L2OC 4PCWA 1Z2CB 4YGCB 1YURA 4ICBA 1QVIY 2WC8A 4PDZA 3CR2A 2M97A 1GGWA 1DQEA 1G33A 4YGBB 3SG5A 3VRRA 2K2AA 2WCLA 1ALVA 2LVKA 3LK0A 2E30A 2L50A 1WLZA 1NP8A 2PALA 1LKJA 2WCJA 2BBNA 3S0FA 1BT6A 2BL0C 4PHKA 3D78A 4Q04A 2NCOA 2KLDA 4MZJA 1IQ3A 2ZNDA 2JXLA 1P28A 1CB1A 2Q91A 2HF5A 1OMDA 1YVLA 2ERBA 1CKKA 1CDNA 2GGZA 1BMOA 2H8VA 1K96A 1G8IA 2HPSA 1QX7A 2I18A 4PT1A 1OMRA 1A2XA 1SY9A 1W7JB 2LLTA 1J7PA 4GPLB 3E3RA 4MBEA 1SBJA 3CABA 1ZOTB 1G4YR 5I8NA 1L7ZA 3CYZA 1QS7A 1TRFA 3R1OA 1UHKA 3LL8B 4ORBB 2WC5A 1TNQA 2KBIA 3S0AA 1HQVA 3S0EA 1PULA 1OW4A 2EHBA 3RLZA 1DT7B 2KQ6A 3ICBA 4I5KA 1F4OA 1DJZA 4CFQA 1YRTB 3V2LA 4NQGA 3S0GA 1SPYA 4GGFA 1WRLA 2CNPA 3KHEA 1J1EA 3BFBA 3N7HA 3CR5X 1WRZA 2K60A 1F4QA 3BYAA 3VB1A 3L4LA 4IL1A 3RM1A 3WXAA 1SKTA 1X02A 2M1KB 4HREE 1MWNA 4IJ7A 2H61A 2M7LA 2K0JA 3O2PA 2KI6C 3BOWB 1JFKA 2Q4UA 2LMVA 5AANA 3TZ1A 1B8CA 1TWOA 1KWOC 1R6PA 2FJYA 2LVIA 4ORCB 3F45A 4GUKA 4A4BA 5BPJA 3S0DA 2QEHA 2PASA 1QLKA 1H4BA 3BFHA 2JT3A 1QX2A 3CDNA 1FPWA 2CTNA 3EK4A 2BBMA 1EL4A 2JNXA 2LUCA 3JTDC 2K7BA 4P2YB 1M63B 3MSEB 3SS5A 1XO5A 3FWBA 2M29A 4YGEB 2PMYA 3EKJA 2LMTA 3KEVA 4MEWA 3O4XA 4C0KA 2F8PA 1WDCB 2WCFA 3Q8IA 3DVKA 1RFJA 4C0LA 2LNKA 3JTDB 1N65A 2CXJA 2WCHA 2H61C 1IJ5A 1OQPA 2KI6D 3GK4X 4OR9B 5I2LA 1AVSA 1UHJA 1SL7A 3K21A 3FE9A 5B8IB 3D76A 2QDIA 1WRKA 3JVTC 1SCMB 1OZOA 3IQOA 2IS9A 3FE6A 1BJFA 1QV0A 1LVCD 5FYXA 1PK0D 2ZN8A 1A75A 3DD4A 1M31A 1XFVO 4FTGA 1H8BA 2AAOA 1Y0VH 2KGRA 3SG4A 1F55A 3PFVA 3CTNA 3NGVA 4MZKA 3CS1A 4BY4A 1LXFC 2EC6B 2QEVA 4I5NB 3VROA 1LINA 3OB1B 5HL1A 1IQ5A 2LHLA 4FQOA 3BOWA 5DICA 1SNLA 3ZWHA 4MRXA 1BLQA 1DJXA 1U5IA 3B7AA 1AJ5A 1QJTA 2QPTA 1CM4A 5FI7A 1KK8B 2K8MB 3IQQA 2AUCA 3I5HC 3B88A 1KFUL 2BCBA 2ZN9A 4INWA 1SW8A 2QEOA 4UPGA 1SMGA 1YX7A 1CLMA 1DJYA 2WCMA 2L2EA 1SCMC 1RJVA 1A4PA 2SASA 5FI2A 5CSFA 1CFCA 1CFFA 2KOTA 4USLA 1B1GA 2HQWA 3IVTA 1ZMZA 1IRJA 5JOLA 4DIRA 3L4AA 4U8DA 3TUYC 2P70A 2LHIA 5D3OA 1TCFA 5D7FA 4P5OE 1SL8A 4HRGA 4GFTA 2JC2A 3AKAA 2F2OA 2JQ6A 1S5GZ 3B6XA 3B87A 3SJSA 1F70A 1D1OA 1S6JA 1SR6B 3BUWB 3CGAA 2L98A 2M49B 1JWDA 1KSMA 1SSEB 3KO0A 1DEKA 1EXRA 2CCMA 1A29A 4F7FA 3DXLA 1DF0B 2FOTA 2DOQA 1PSBA 1JC2A 2MA2A 1UURA 3DF0B 3BUNB 3UO9A 2BAPA 3OX5A 2JT8A 3ZNIA 2PQLA 3PM2A 2KLEA 3SS3A 3TDUA 3TUYB 3LCPC 3SIAA 1OOIX 3TDZA 2KPHA 4QJ5B 1DTLA 1F54A 2VRGA 1BF5A 1QX5B 2JULA 1A75B 3I5HB 4JPZB 3D0YB 1QVIZ 4JWQA 2WOSA 1CNPA 3BFAA 1Q80A 2V53A 3CZ0A 3BUMB 1PVAA 1ZUZA 2R2IA 2JTTA 1C7WA 3DVMA 3UNWA 1T14A 2BE6A 1OMVA 1SCVA 2EGDA 1GGZA 2M9GA 2L4IA 1DF0A 1ZACA 2M3WA 1QTXA 3I5IC 3PATA 1DGUA 2G9BA 1Y1UA 1OSAA 2BNXA 4PE0A 5G08A 3SS4A 1MXEA 1TN4A 2KAYA 5F6TA 5HLOA 2D8NA 3L47A 1QWVA 1K93D 2LLSA 3R1VA 4D1EA 2L0PA 2WC6A 3DY9A 3O6BA 2M7NA 3WHUB 1UUSA 1IWQA 1N0YA 2KSPA 1LS8A 1MXLC 1OZSA 2KFGA 1S36A 2LVJA 3PN7B 4GGFC 2LLUA 2CT9A 2CBLA 2PVBA 1PRWA 3DYEA 1MF8B 3I5IB 4M2PA 1NWDA 1Z4HA 1BR1B 2QEBA 4YI9A 3SG3A 3TDIA 5KSZA 3LLEA 4AOMA 1KK7Z 3NSLA 1NCYA 1FF1A 1WLMA 3OP0A 2LVVA 4WQ3A 1EJ3A 3GK1A 1XFYO 4ETOA 1YVHA 2I94A 3IF7A 2L51A 1PVBA 1CMFA 3A8RA 2K7DA 3QMEA 1J7QA 5DKQA 2QACA 1PALA 3PSRA 4N5XA 5HKYA 1S6IA 5HKWA 4MVFA 1NPQA 2JPTA 3DF0A 2KQYA 1F71A 3K1EA 2KI4C 1BR4B 1WY9A 1SYMA 2I2RE 3GOFA 2MJWB 1MQ1A 1QATA 1YUSA 2JTZA 2LP3A 1QIVA 3D75A 1C3ZA 3GK2A 4TNCA 2WCKA 4HRHA 1TNWA 2NXQA 1BODA 4XYNA 4WQ2A 5HKZA 1L2OB 4CIDA 1MHOA 2H2KA 2Y1MA 5DKNA 4MN0A 1XFWO 3SG2A 3EK8A 3VRNA 2BKIB 5CPVA 2HETA 3JVTB 4WRIA 2PSRA 2JRFA 4MZLA 4KYNA 2L2CA 1W7IB 5FI6A 5I2QA 4NDDA 1NX3A 1S1EA 3EVVA 1RECA 1RWYA 1QXPA 2PYQA 2LUXA 2OS8C 4CFRA 2F3YA 1B8LA 1KFUS 1SK6D 4PHMA 1U5IB 1CFDA 1CDMA 1UHNA 1ODBA 2JZIA 1DJGA 1NYAA 1Y1AA 2FCEA 5ER5A 1IGVA 3AAJA 2MLFC 1NX0A 3CLNA 1IJ6A 1NCXA 2BE4A 4OCIA 2G2BA 4PE1A 3NSOA 1DJWA 2MLEC 2HQ8A 3R72A 3WHTB 1RK9A 1NCZA 5GQQC 1TNXA 1VRKA 1TNPA 3CZTX 4DUQA 3D73A 1KQMC 1S5GY 3OX6A 5JJGA 4ORAB 2JT0A 1AJ4A 1DVIA 1ALWA 4DRWA 2MAZA 5AFPA 2KGBC 3CZ2A 3NSKA 2Y4QA 4PE7A 1DELA 2OS8B 2BECA 1BG1A 2O60A 1DMOA 2KBMA 3PJIA 1S3PA 2F3ZA 3H4SE 2MRDA 4C0JA 2Y1NA 5AERA 3D10A 1FW4A 1QIWA 1XK4C 1YUTA 2JXCA 3AKBA 1TCOB 2L5YA 1E8AA 1F8HA 3KPXA 1OOHA 1S6CA 3B86A 1JBAA 5EL2A 3EG5B 5CSJA 4MSPA 4PHJA 4ZCUA 1KK7Y 3VRQA 1RTP1 1B7TZ 3D77A 2JOJA 1DGVA 3VRPA 2KYFA 1GQMA 3EK7A 4MRYA 1KQVA 2BCAA 3EKHA 3I5FC 1BOCA 4I5JA 4CPVA 4CLNA 1YTZC 2ZRTA 5D69A 1RROA 3KF9A 1CMGA 3VGOA 2FCDA 4A4CA 1B9AA 2K61A 2L4HA 2WCEA 4N1FA 4XJKA 1V1GA 1IG5A 5K89A 3BJHA 3AAKA 4OKHA 2OTGB 3BUXB 2LCPA 1KWOB 2GGMA 1KSOA 2BKHB 3OBVA 2KHNA 3BUOB 3O4YA 1J7OA 5IBWA 1DJIA 2KI4B 1CM1A 5ER4X 3M0WA 4YBHB 2NCPA 1OOGA 2ZNEA 4NDCA 3NSIA 4BY5A 1XFUO 4JD9A 3HCMA 1AHRA 1M45A 2B1UA 2OPOA 1GJYA 1KFXS 3SIBA 1EH2A 3CR4X 1MR8A 3O78A 2KYCA 5CSIA 1B47A 2K2FA 2MHHA 4DCKA 1CDPA 1TTXA 2L5XB 3QRXA 2ZKMX 1KCYA 3EVUA 3PLFB 5HLVA 2WORA 1XYDA 2NZ0A 4E68A 1FBVA 1KQMB 3BXKA 4YRUA 2P6BB 1BU3A 1LA0A 3LK1A 2RGIA 3CWGA 3A4UB 1DJHA 4OZDA 1K9UA 2LANA 3OGNA 1TUZA
chains in the Genus database with same CATH topology
3DVJA 1KK8C 2M0RA 4GAOA 1IKUA 1AUIB 1ZFSA 5KU1A 3NXAA 1SR6C 1SRAA 1Y6WA 2KAVA 2LV7A 1B4CA 1K90D 5TNCA 1K2HA 2LMUA 5DKRA 4M2QA 1UP5A 4YGAA 4R1EA 3I5GC 4MLWA 1XA5A 2MBXA 1QASA 1XK4A 4XJKB 2I7AA 4YGDB 3EVRA 1B7TY 2SCPA 1FI6A 1K95A 2BCXA 1JF2A 1UWOA 2PRUA 1YUUA 4NDBA 1K8UA 3FWCA 2O5GA 2BL0B 1M46A 1V1FA 4AQIA 1CLLA 2WCBA 3PM8A 4DS7A 2KFFA 3DVEA 1SL9A 1XFZO 1YRUB 2F2PA 1NIWA 1PSRA 1UHHA 1N2DA 1EG3A 1M39A 2ZFDA 3PALA 5I2OA 1CLBA 1JUOA 1QV1A 3WNXB 1JFJA 1UHIA 5CSNA 1OOJA 1NSHA 1OE9B 1Y1XA 2AMIA 2COLB 1JF0A 5HYDA 2LC5A 1J7RA 2KAXA 2JWWA 4OVNF 2ISDA 2OTGC 1YR5A 1K9PA 3TS5B 2FJUB 2LM5A 1K9KA 1B8RA 2JNFA 4PE4A 2WNDA 2LP2A 2E6WA 2TN4A 3FS7A 3OB2B 1CTRA 5J3XA 3I5GB 2M1UA 1R2UA 1CFPA 1J55A 2K7CA 1QLSA 1AP4A 1C07A 3C1VA 5PALA 1NUBA 4AQJA 1IH0A 1KFXL 4PHNA 2LE9B 4PALA 3BQ3A 1XFXO 2GV5A 4OV2A 2F33A 4I5LB 1MUXA 4GGNA 2Y5IA 2M8UA 4GNKB 4M2OA 4N1GA 4ZCVA 2KDHA 1LA3A 1WDCC 3SG7A 2EC6C 3I5FB 1CDLA 2A4JA 1J1DA 4JQ0D 2ZRSA 1TIZA 4L9MA 1JSAA 3TS5C 1C7VA 5KTYA 2K7OA 2LAPA 5AXIA 3SG6A 2KNEA 4QJ4B 4GBAA 1AK8A 3FIAA 1NX1A 1EG4A 5AEQA 2NLNA 2KFHA 4HSZA 4F0ZB 2JU0A 1A03A 4QJ3B 1XVJA 1K94A 4YI8A 3D0YA 1TOPA 1S26D 3OHMB 3HX4A 1NX2A 1HT9A 1YX8A 3PN7C 1FI5A 1L2OC 4PCWA 4YGCB 1YURA 4ICBA 1QVIY 2WC8A 4PDZA 3CR2A 2M97A 1GGWA 1G33A 4YGBB 3SG5A 3VRRA 2K2AA 1ALVA 2LVKA 3LK0A 2E30A 2L50A 1WLZA 1NP8A 2PALA 1LKJA 2BBNA 1BT6A 2BL0C 4PHKA 4Q04A 2NCOA 4MZJA 1IQ3A 2ZNDA 2JXLA 1CB1A 2Q91A 2HF5A 1OMDA 1YVLA 1CKKA 1CDNA 2GGZA 1BMOA 1K96A 1G8IA 2HPSA 1QX7A 2I18A 1OMRA 1A2XA 1SY9A 1W7JB 2LLTA 1J7PA 4GPLB 3E3RA 4MBEA 1SBJA 1ZOTB 1G4YR 5I8NA 1L7ZA 1QS7A 1TRFA 4ORBB 1UHKA 3LL8B 1TNQA 2KBIA 1HQVA 1PULA 2EHBA 3RLZA 1DT7B 2KQ6A 3ICBA 4I5KA 1F4OA 1DJZA 4CFQA 1YRTB 4NQGA 1SPYA 4GGFA 1WRLA 2CNPA 3KHEA 1J1EA 3CR5X 1WRZA 1F4QA 3BYAA 4IL1A 3RM1A 3WXAA 1SKTA 1X02A 2M1KB 4HREE 1MWNA 2H61A 2M7LA 2K0JA 3O2PA 2KI6C 3BOWB 1JFKA 2Q4UA 2LMVA 5AANA 3TZ1A 1B8CA 1KWOC 1R6PA 2LVIA 4ORCB 4A4BA 3F45A 4GUKA 5BPJA 2PASA 1QLKA 1H4BA 2JT3A 1QX2A 1FPWA 2CTNA 3EK4A 2BBMA 1EL4A 2JNXA 2LUCA 3JTDC 2K7BA 4P2YB 1M63B 3MSEB 1XO5A 3FWBA 2M29A 4YGEB 2PMYA 3EKJA 2LMTA 3KEVA 4MEWA 4C0KA 2F8PA 1WDCB 2WCFA 3DVKA 1RFJA 4C0LA 2LNKA 3JTDB 1N65A 2CXJA 2H61C 1IJ5A 1OQPA 2KI6D 3GK4X 4OR9B 5I2LA 1AVSA 1UHJA 1SL7A 3K21A 5B8IB 1WRKA 3JVTC 1SCMB 1OZOA 3IQOA 2IS9A 1BJFA 1QV0A 1LVCD 5FYXA 1PK0D 2ZN8A 1A75A 3DD4A 1M31A 1XFVO 4FTGA 1H8BA 2AAOA 1Y0VH 2KGRA 3SG4A 1F55A 3PFVA 3CTNA 4MZKA 3CS1A 4BY4A 1LXFC 2EC6B 4I5NB 3VROA 1LINA 3OB1B 1IQ5A 2LHLA 4FQOA 3BOWA 1SNLA 3ZWHA 4MRXA 1BLQA 1DJXA 1U5IA 1AJ5A 1QJTA 2QPTA 1CM4A 1KK8B 2K8MB 3IQQA 2AUCA 3I5HC 1KFUL 2BCBA 2ZN9A 1SW8A 4UPGA 1SMGA 1YX7A 1CLMA 1DJYA 2L2EA 1SCMC 1RJVA 1A4PA 2SASA 1CFFA 5CSFA 1CFCA 2KOTA 4USLA 1B1GA 2HQWA 1ZMZA 1IRJA 5JOLA 4DIRA 4U8DA 3TUYC 2LHIA 1TCFA 5D7FA 4P5OE 1SL8A 4HRGA 4GFTA 2JC2A 3AKAA 2F2OA 2JQ6A 1S5GZ 3SJSA 1F70A 1D1OA 1S6JA 1SR6B 3BUWB 3CGAA 2L98A 2M49B 1JWDA 1KSMA 3KO0A 1EXRA 2CCMA 1A29A 1DF0B 2FOTA 2DOQA 1PSBA 1JC2A 2MA2A 1UURA 3DF0B 3BUNB 3OX5A 2JT8A 3ZNIA 3TDUA 3TUYB 3LCPC 3SIAA 3TDZA 4QJ5B 1DTLA 1F54A 2VRGA 1BF5A 1QX5B 2JULA 1A75B 3I5HB 4JPZB 3D0YB 1QVIZ 4JWQA 2WOSA 1CNPA 1Q80A 2V53A 3BUMB 1PVAA 1ZUZA 2R2IA 2JTTA 1C7WA 3DVMA 2BE6A 1OMVA 1SCVA 2EGDA 1GGZA 2M9GA 2L4IA 1DF0A 1ZACA 2M3WA 1QTXA 3I5IC 3PATA 1DGUA 2G9BA 1Y1UA 1OSAA 4PE0A 5G08A 1MXEA 1TN4A 2KAYA 5F6TA 5HLOA 2D8NA 1K93D 2LLSA 4D1EA 2L0PA 3O6BA 2M7NA 3WHUB 1UUSA 1IWQA 1N0YA 2KSPA 1MXLC 1OZSA 2KFGA 2LVJA 1S36A 3PN7B 4GGFC 2LLUA 2CT9A 2CBLA 2PVBA 1PRWA 1MF8B 3I5IB 4M2PA 1NWDA 1BR1B 4YI9A 3TDIA 3SG3A 5KSZA 3LLEA 4AOMA 1KK7Z 3NSLA 1NCYA 1FF1A 1WLMA 3OP0A 2LVVA 4WQ3A 1EJ3A 3GK1A 1XFYO 4ETOA 1YVHA 2I94A 3IF7A 2L51A 1PVBA 1CMFA 3A8RA 2K7DA 1J7QA 5DKQA 2QACA 1PALA 3PSRA 4N5XA 5HKYA 1S6IA 5HKWA 4MVFA 1NPQA 2JPTA 3DF0A 2KQYA 1F71A 2KI4C 1BR4B 1WY9A 1SYMA 2I2RE 3GOFA 2MJWB 1MQ1A 1QATA 1YUSA 2JTZA 2LP3A 1QIVA 3GK2A 4TNCA 4HRHA 1TNWA 2NXQA 1BODA 4XYNA 4WQ2A 5HKZA 1L2OB 4CIDA 1MHOA 2H2KA 2Y1MA 5DKNA 4MN0A 1XFWO 3SG2A 3EK8A 3VRNA 2BKIB 5CPVA 2HETA 3JVTB 4WRIA 2PSRA 2JRFA 4MZLA 5I2QA 1W7IB 4NDDA 1NX3A 1S1EA 3EVVA 1RECA 1RWYA 1QXPA 2LUXA 2OS8C 4CFRA 2F3YA 1B8LA 1KFUS 1SK6D 4PHMA 1U5IB 1CFDA 1CDMA 1UHNA 1ODBA 2JZIA 1DJGA 1NYAA 1Y1AA 2FCEA 5ER5A 1IGVA 3AAJA 2MLFC 1NX0A 3CLNA 1IJ6A 1NCXA 2BE4A 4OCIA 2G2BA 4PE1A 3NSOA 1DJWA 2MLEC 2HQ8A 3WHTB 1RK9A 1NCZA 5GQQC 1TNXA 1VRKA 1TNPA 3CZTX 4DUQA 1KQMC 1S5GY 3OX6A 5JJGA 4ORAB 2JT0A 1AJ4A 1DVIA 1ALWA 4DRWA 2MAZA 5AFPA 2KGBC 3NSKA 2Y4QA 4PE7A 2OS8B 2BECA 1BG1A 2O60A 1DMOA 2KBMA 1S3PA 2F3ZA 3H4SE 2MRDA 4C0JA 2Y1NA 5AERA 3D10A 1FW4A 1QIWA 1XK4C 1YUTA 2JXCA 3AKBA 1TCOB 1E8AA 1F8HA 3KPXA 1JBAA 1S6CA 5CSJA 4MSPA 4PHJA 4ZCUA 1KK7Y 3VRQA 1RTP1 1B7TZ 2JOJA 1DGVA 3VRPA 2KYFA 1GQMA 3EK7A 4MRYA 1KQVA 2BCAA 3EKHA 3I5FC 1BOCA 4I5JA 4CPVA 4CLNA 1YTZC 2ZRTA 5D69A 1RROA 3KF9A 1CMGA 3VGOA 2FCDA 4A4CA 1B9AA 2K61A 2L4HA 2WCEA 4N1FA 4XJKA 1V1GA 1IG5A 5K89A 3AAKA 4OKHA 2OTGB 3BUXB 2LCPA 1KWOB 2GGMA 1KSOA 2BKHB 2KHNA 3BUOB 3O4YA 1J7OA 5IBWA 1DJIA 2KI4B 1CM1A 5ER4X 3M0WA 4YBHB 2NCPA 2ZNEA 4NDCA 3NSIA 4BY5A 1XFUO 3HCMA 1AHRA 1M45A 2B1UA 2OPOA 1GJYA 1KFXS 3SIBA 1EH2A 3CR4X 1MR8A 3O78A 2KYCA 5CSIA 1B47A 2K2FA 2MHHA 4DCKA 1CDPA 1TTXA 2L5XB 3QRXA 2ZKMX 1KCYA 3EVUA 3PLFB 5HLVA 2WORA 1XYDA 2NZ0A 4E68A 1FBVA 1KQMB 3BXKA 4YRUA 2P6BB 1BU3A 1LA0A 3LK1A 2RGIA 3CWGA 3A4UB 1DJHA 1K9UA 2LANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVJ A;  1KK8 C;  2M0R A;  4GAO A;  1IKU A;  1AUI B;  1ZFS A;  5KU1 A;  3NXA A;  1SR6 C;  1SRA A;  1Y6W A;  2KAV A;  2LV7 A;  1B4C A;  1K90 D;  5TNC A;  1K2H A;  2LMU A;  5DKR A;  4M2Q A;  1UP5 A;  4YGA A;  4R1E A;  3I5G C;  4MLW A;  1XA5 A;  2MBX A;  1QAS A;  1XK4 A;  4XJK B;  2I7A A;  4YGD B;  3EVR A;  1B7T Y;  2SCP A;  1FI6 A;  1K95 A;  2BCX A;  1JF2 A;  1UWO A;  2PRU A;  1YUU A;  4NDB A;  1K8U A;  3FWC A;  2O5G A;  2BL0 B;  1M46 A;  1V1F A;  4AQI A;  1CLL A;  2WCB A;  3PM8 A;  4DS7 A;  2KFF A;  3DVE A;  1SL9 A;  1XFZ O;  1YRU B;  2F2P A;  1NIW A;  1PSR A;  1UHH A;  1N2D A;  1EG3 A;  1M39 A;  2ZFD A;  3PAL A;  5I2O A;  1CLB A;  1JUO A;  1QV1 A;  3WNX B;  1JFJ A;  1UHI A;  5CSN A;  1OOJ A;  1NSH A;  1OE9 B;  1Y1X A;  2AMI A;  2COL B;  1JF0 A;  5HYD A;  2LC5 A;  1J7R A;  2KAX A;  2JWW A;  4OVN F;  2ISD A;  2OTG C;  1YR5 A;  1K9P A;  3TS5 B;  2FJU B;  2LM5 A;  1K9K A;  1B8R A;  2JNF A;  4PE4 A;  2WND A;  2LP2 A;  2E6W A;  2TN4 A;  3FS7 A;  3OB2 B;  1CTR A;  5J3X A;  3I5G B;  2M1U A;  1R2U A;  1CFP A;  1J55 A;  2K7C A;  1QLS A;  1AP4 A;  1C07 A;  3C1V A;  5PAL A;  1NUB A;  4AQJ A;  1IH0 A;  1KFX L;  4PHN A;  2LE9 B;  4PAL A;  3BQ3 A;  1XFX O;  2GV5 A;  4OV2 A;  2F33 A;  4I5L B;  1MUX A;  4GGN A;  2Y5I A;  2M8U A;  4GNK B;  4M2O A;  4N1G A;  4ZCV A;  2KDH A;  1LA3 A;  1WDC C;  3SG7 A;  2EC6 C;  3I5F B;  1CDL A;  2A4J A;  1J1D A;  4JQ0 D;  2ZRS A;  1TIZ A;  4L9M A;  1JSA A;  3TS5 C;  1C7V A;  5KTY A;  2K7O A;  2LAP A;  5AXI A;  3SG6 A;  2KNE A;  4QJ4 B;  4GBA A;  1AK8 A;  3FIA A;  1NX1 A;  1EG4 A;  5AEQ A;  2NLN A;  2KFH A;  4HSZ A;  4F0Z B;  2JU0 A;  1A03 A;  4QJ3 B;  1XVJ A;  1K94 A;  4YI8 A;  3D0Y A;  1TOP A;  1S26 D;  3OHM B;  3HX4 A;  1NX2 A;  1HT9 A;  1YX8 A;  3PN7 C;  1FI5 A;  1L2O C;  4PCW A;  4YGC B;  1YUR A;  4ICB A;  1QVI Y;  2WC8 A;  4PDZ A;  3CR2 A;  2M97 A;  1GGW A;  1G33 A;  4YGB B;  3SG5 A;  3VRR A;  2K2A A;  1ALV A;  2LVK A;  3LK0 A;  2E30 A;  2L50 A;  1WLZ A;  1NP8 A;  2PAL A;  1LKJ A;  2BBN A;  1BT6 A;  2BL0 C;  4PHK A;  4Q04 A;  2NCO A;  4MZJ A;  1IQ3 A;  2ZND A;  2JXL A;  1CB1 A;  2Q91 A;  2HF5 A;  1OMD A;  1YVL A;  1CKK A;  1CDN A;  2GGZ A;  1BMO A;  1K96 A;  1G8I A;  2HPS A;  1QX7 A;  2I18 A;  1OMR A;  1A2X A;  1SY9 A;  1W7J B;  2LLT A;  1J7P A;  4GPL B;  3E3R A;  4MBE A;  1SBJ A;  1ZOT B;  1G4Y R;  5I8N A;  1L7Z A;  1QS7 A;  1TRF A;  4ORB B;  1UHK A;  3LL8 B;  1TNQ A;  2KBI A;  1HQV A;  1PUL A;  2EHB A;  3RLZ A;  1DT7 B;  2KQ6 A;  3ICB A;  4I5K A;  1F4O A;  1DJZ A;  4CFQ A;  1YRT B;  4NQG A;  1SPY A;  4GGF A;  1WRL A;  2CNP A;  3KHE A;  1J1E A;  3CR5 X;  1WRZ A;  1F4Q A;  3BYA A;  4IL1 A;  3RM1 A;  3WXA A;  1SKT A;  1X02 A;  2M1K B;  4HRE E;  1MWN A;  2H61 A;  2M7L A;  2K0J A;  3O2P A;  2KI6 C;  3BOW B;  1JFK A;  2Q4U A;  2LMV A;  5AAN A;  3TZ1 A;  1B8C A;  1KWO C;  1R6P A;  2LVI A;  4ORC B;  4A4B A;  3F45 A;  4GUK A;  5BPJ A;  2PAS A;  1QLK A;  1H4B A;  2JT3 A;  1QX2 A;  1FPW A;  2CTN A;  3EK4 A;  2BBM A;  1EL4 A;  2JNX A;  2LUC A;  3JTD C;  2K7B A;  4P2Y B;  1M63 B;  3MSE B;  1XO5 A;  3FWB A;  2M29 A;  4YGE B;  2PMY A;  3EKJ A;  2LMT A;  3KEV A;  4MEW A;  4C0K A;  2F8P A;  1WDC B;  2WCF A;  3DVK A;  1RFJ A;  4C0L A;  2LNK A;  3JTD B;  1N65 A;  2CXJ A;  2H61 C;  1IJ5 A;  1OQP A;  2KI6 D;  3GK4 X;  4OR9 B;  5I2L A;  1AVS A;  1UHJ A;  1SL7 A;  3K21 A;  5B8I B;  1WRK A;  3JVT C;  1SCM B;  1OZO A;  3IQO A;  2IS9 A;  1BJF A;  1QV0 A;  1LVC D;  5FYX A;  1PK0 D;  2ZN8 A;  1A75 A;  3DD4 A;  1M31 A;  1XFV O;  4FTG A;  1H8B A;  2AAO A;  1Y0V H;  2KGR A;  3SG4 A;  1F55 A;  3PFV A;  3CTN A;  4MZK A;  3CS1 A;  4BY4 A;  1LXF C;  2EC6 B;  4I5N B;  3VRO A;  1LIN A;  3OB1 B;  1IQ5 A;  2LHL A;  4FQO A;  3BOW A;  1SNL A;  3ZWH A;  4MRX A;  1BLQ A;  1DJX A;  1U5I A;  1AJ5 A;  1QJT A;  2QPT A;  1CM4 A;  1KK8 B;  2K8M B;  3IQQ A;  2AUC A;  3I5H C;  1KFU L;  2BCB A;  2ZN9 A;  1SW8 A;  4UPG A;  1SMG A;  1YX7 A;  1CLM A;  1DJY A;  2L2E A;  1SCM C;  1RJV A;  1A4P A;  2SAS A;  1CFF A;  5CSF A;  1CFC A;  2KOT A;  4USL A;  1B1G A;  2HQW A;  1ZMZ A;  1IRJ A;  5JOL A;  4DIR A;  4U8D A;  3TUY C;  2LHI A;  1TCF A;  5D7F A;  4P5O E;  1SL8 A;  4HRG A;  4GFT A;  2JC2 A;  3AKA A;  2F2O A;  2JQ6 A;  1S5G Z;  3SJS A;  1F70 A;  1D1O A;  1S6J A;  1SR6 B;  3BUW B;  3CGA A;  2L98 A;  2M49 B;  1JWD A;  1KSM A;  3KO0 A;  1EXR A;  2CCM A;  1A29 A;  1DF0 B;  2FOT A;  2DOQ A;  1PSB A;  1JC2 A;  2MA2 A;  1UUR A;  3DF0 B;  3BUN B;  3OX5 A;  2JT8 A;  3ZNI A;  3TDU A;  3TUY B;  3LCP C;  3SIA A;  3TDZ A;  4QJ5 B;  1DTL A;  1F54 A;  2VRG A;  1BF5 A;  1QX5 B;  2JUL A;  1A75 B;  3I5H B;  4JPZ B;  3D0Y B;  1QVI Z;  4JWQ A;  2WOS A;  1CNP A;  1Q80 A;  2V53 A;  3BUM B;  1PVA A;  1ZUZ A;  2R2I A;  2JTT A;  1C7W A;  3DVM A;  2BE6 A;  1OMV A;  1SCV A;  2EGD A;  1GGZ A;  2M9G A;  2L4I A;  1DF0 A;  1ZAC A;  2M3W A;  1QTX A;  3I5I C;  3PAT A;  1DGU A;  2G9B A;  1Y1U A;  1OSA A;  4PE0 A;  5G08 A;  1MXE A;  1TN4 A;  2KAY A;  5F6T A;  5HLO A;  2D8N A;  1K93 D;  2LLS A;  4D1E A;  2L0P A;  3O6B A;  2M7N A;  3WHU B;  1UUS A;  1IWQ A;  1N0Y A;  2KSP A;  1MXL C;  1OZS A;  2KFG A;  2LVJ A;  1S36 A;  3PN7 B;  4GGF C;  2LLU A;  2CT9 A;  2CBL A;  2PVB A;  1PRW A;  1MF8 B;  3I5I B;  4M2P A;  1NWD A;  1BR1 B;  4YI9 A;  3TDI A;  3SG3 A;  5KSZ A;  3LLE A;  4AOM A;  1KK7 Z;  3NSL A;  1NCY A;  1FF1 A;  1WLM A;  3OP0 A;  2LVV A;  4WQ3 A;  1EJ3 A;  3GK1 A;  1XFY O;  4ETO A;  1YVH A;  2I94 A;  3IF7 A;  2L51 A;  1PVB A;  1CMF A;  3A8R A;  2K7D A;  1J7Q A;  5DKQ A;  2QAC A;  1PAL A;  3PSR A;  4N5X A;  5HKY A;  1S6I A;  5HKW A;  4MVF A;  1NPQ A;  2JPT A;  3DF0 A;  2KQY A;  1F71 A;  2KI4 C;  1BR4 B;  1WY9 A;  1SYM A;  2I2R E;  3GOF A;  2MJW B;  1MQ1 A;  1QAT A;  1YUS A;  2JTZ A;  2LP3 A;  1QIV A;  3GK2 A;  4TNC A;  4HRH A;  1TNW A;  2NXQ A;  1BOD A;  4XYN A;  4WQ2 A;  5HKZ A;  1L2O B;  4CID A;  1MHO A;  2H2K A;  2Y1M A;  5DKN A;  4MN0 A;  1XFW O;  3SG2 A;  3EK8 A;  3VRN A;  2BKI B;  5CPV A;  2HET A;  3JVT B;  4WRI A;  2PSR A;  2JRF A;  4MZL A;  5I2Q A;  1W7I B;  4NDD A;  1NX3 A;  1S1E A;  3EVV A;  1REC A;  1RWY A;  1QXP A;  2LUX A;  2OS8 C;  4CFR A;  2F3Y A;  1B8L A;  1KFU S;  1SK6 D;  4PHM A;  1U5I B;  1CFD A;  1CDM A;  1UHN A;  1ODB A;  2JZI A;  1DJG A;  1NYA A;  1Y1A A;  2FCE A;  5ER5 A;  1IGV A;  3AAJ A;  2MLF C;  1NX0 A;  3CLN A;  1IJ6 A;  1NCX A;  2BE4 A;  4OCI A;  2G2B A;  4PE1 A;  3NSO A;  1DJW A;  2MLE C;  2HQ8 A;  3WHT B;  1RK9 A;  1NCZ A;  5GQQ C;  1TNX A;  1VRK A;  1TNP A;  3CZT X;  4DUQ A;  1KQM C;  1S5G Y;  3OX6 A;  5JJG A;  4ORA B;  2JT0 A;  1AJ4 A;  1DVI A;  1ALW A;  4DRW A;  2MAZ A;  5AFP A;  2KGB C;  3NSK A;  2Y4Q A;  4PE7 A;  2OS8 B;  2BEC A;  1BG1 A;  2O60 A;  1DMO A;  2KBM A;  1S3P A;  2F3Z A;  3H4S E;  2MRD A;  4C0J A;  2Y1N A;  5AER A;  3D10 A;  1FW4 A;  1QIW A;  1XK4 C;  1YUT A;  2JXC A;  3AKB A;  1TCO B;  1E8A A;  1F8H A;  3KPX A;  1JBA A;  1S6C A;  5CSJ A;  4MSP A;  4PHJ A;  4ZCU A;  1KK7 Y;  3VRQ A;  1RTP 1;  1B7T Z;  2JOJ A;  1DGV A;  3VRP A;  2KYF A;  1GQM A;  3EK7 A;  4MRY A;  1KQV A;  2BCA A;  3EKH A;  3I5F C;  1BOC A;  4I5J A;  4CPV A;  4CLN A;  1YTZ C;  2ZRT A;  5D69 A;  1RRO A;  3KF9 A;  1CMG A;  3VGO A;  2FCD A;  4A4C A;  1B9A A;  2K61 A;  2L4H A;  2WCE A;  4N1F A;  4XJK A;  1V1G A;  1IG5 A;  5K89 A;  3AAK A;  4OKH A;  2OTG B;  3BUX B;  2LCP A;  1KWO B;  2GGM A;  1KSO A;  2BKH B;  2KHN A;  3BUO B;  3O4Y A;  1J7O A;  5IBW A;  1DJI A;  2KI4 B;  1CM1 A;  5ER4 X;  3M0W A;  4YBH B;  2NCP A;  2ZNE A;  4NDC A;  3NSI A;  4BY5 A;  1XFU O;  3HCM A;  1AHR A;  1M45 A;  2B1U A;  2OPO A;  1GJY A;  1KFX S;  3SIB A;  1EH2 A;  3CR4 X;  1MR8 A;  3O78 A;  2KYC A;  5CSI A;  1B47 A;  2K2F A;  2MHH A;  4DCK A;  1CDP A;  1TTX A;  2L5X B;  3QRX A;  2ZKM X;  1KCY A;  3EVU A;  3PLF B;  5HLV A;  2WOR A;  1XYD A;  2NZ0 A;  4E68 A;  1FBV A;  1KQM B;  3BXK A;  4YRU A;  2P6B B;  1BU3 A;  1LA0 A;  3LK1 A;  2RGI A;  3CWG A;  3A4U B;  1DJH A;  1K9U A;  2LAN A; 
#chains in the Genus database with same CATH topology
 3DVJ A;  1KK8 C;  2M0R A;  4GAO A;  1IKU A;  1AUI B;  1ZFS A;  5KU1 A;  3NXA A;  1SR6 C;  1SRA A;  1Y6W A;  2KAV A;  2LV7 A;  1B4C A;  1K90 D;  5TNC A;  1K2H A;  2LMU A;  5DKR A;  4M2Q A;  1C3Y A;  1UP5 A;  4YGA A;  3FE8 A;  4R1E A;  3I5G C;  4MLW A;  1ORG A;  1XA5 A;  3R1P A;  2MBX A;  1QAS A;  1XK4 A;  4XJK B;  2I7A A;  4YGD B;  3EVR A;  1B7T Y;  2SCP A;  1FI6 A;  1K95 A;  2BCX A;  1JF2 A;  1UWO A;  2PRU A;  1YUU A;  2YGU A;  1K8U A;  3FWC A;  4NDB A;  2O5G A;  2BL0 B;  1M46 A;  1V1F A;  4AQI A;  1CLL A;  3DZT A;  2WCB A;  3PM8 A;  4DS7 A;  1IIO A;  2KFF A;  3DVE A;  1SL9 A;  1XFZ O;  1YRU B;  2F2P A;  1GM0 A;  4INX A;  1NIW A;  1PSR A;  1UHH A;  1N2D A;  1XFR A;  1EG3 A;  1M39 A;  2ZFD A;  3PAL A;  5I2O A;  1CLB A;  1JUO A;  1QV1 A;  3WNX B;  1JFJ A;  3CZ1 A;  1UHI A;  5CSN A;  1OOJ A;  1NSH A;  1OE9 B;  1TUJ A;  1Y1X A;  2AMI A;  2COL B;  1JF0 A;  5HYD A;  2LC5 A;  1J7R A;  2KAX A;  2JWW A;  4OVN F;  2ISD A;  2OTG C;  1YR5 A;  1K9P A;  3TS5 B;  2FJU B;  2LM5 A;  1K9K A;  1B8R A;  2JNF A;  4PE4 A;  1OOF A;  2WND A;  2LP2 A;  2E6W A;  2TN4 A;  3FS7 A;  3OB2 B;  1CTR A;  5J3X A;  3I5G B;  2M1U A;  1R2U A;  2GTE A;  1CFP A;  1J55 A;  2K7C A;  1QLS A;  1AP4 A;  1C07 A;  3C1V A;  5PAL A;  1NUB A;  4AQJ A;  1IH0 A;  1KFX L;  3D74 A;  4PHN A;  2LE9 B;  4PAL A;  3BQ3 A;  1XFX O;  2GV5 A;  4OV2 A;  2F33 A;  4I5L B;  1MUX A;  4GGN A;  2Y5I A;  2M8U A;  3NHI A;  4GNK B;  4M2O A;  4N1G A;  4ZCV A;  1DC1 A;  2KDH A;  1LA3 A;  1WDC C;  3SG7 A;  2EC6 C;  3I5F B;  1CDL A;  2A4J A;  1J1D A;  4JQ0 D;  2ZRS A;  3RZS A;  1TIZ A;  3NHT A;  4L9M A;  4FQT A;  3TS5 C;  1C7V A;  1JSA A;  4JKT A;  5KTY A;  2P71 A;  2K7O A;  1W9Z A;  5I94 A;  3S0B A;  2LAP A;  5AXI A;  3SG6 A;  2KNE A;  4QJ4 B;  4GBA A;  1AK8 A;  2JPO A;  3FIA A;  1NX1 A;  1EG4 A;  5AEQ A;  2NLN A;  2KFH A;  4HSZ A;  4F0Z B;  2JU0 A;  1A03 A;  4QJ3 B;  1XVJ A;  1K94 A;  4YI8 A;  3D0Y A;  1TOP A;  1S26 D;  3OHM B;  3HX4 A;  1NX2 A;  1HT9 A;  1YX8 A;  3PN7 C;  1FI5 A;  1L2O C;  4PCW A;  1Z2C B;  4YGC B;  1YUR A;  4ICB A;  1QVI Y;  2WC8 A;  4PDZ A;  3CR2 A;  2M97 A;  1GGW A;  1DQE A;  1G33 A;  4YGB B;  3SG5 A;  3VRR A;  2K2A A;  2WCL A;  1ALV A;  2LVK A;  3LK0 A;  2E30 A;  2L50 A;  1WLZ A;  1NP8 A;  2PAL A;  1LKJ A;  2WCJ A;  2BBN A;  3S0F A;  1BT6 A;  2BL0 C;  4PHK A;  3D78 A;  4Q04 A;  2NCO A;  2KLD A;  4MZJ A;  1IQ3 A;  2ZND A;  2JXL A;  1P28 A;  1CB1 A;  2Q91 A;  2HF5 A;  1OMD A;  1YVL A;  2ERB A;  1CKK A;  1CDN A;  2GGZ A;  1BMO A;  2H8V A;  1K96 A;  1G8I A;  2HPS A;  1QX7 A;  2I18 A;  4PT1 A;  1OMR A;  1A2X A;  1SY9 A;  1W7J B;  2LLT A;  1J7P A;  4GPL B;  3E3R A;  4MBE A;  1SBJ A;  3CAB A;  1ZOT B;  1G4Y R;  5I8N A;  1L7Z A;  3CYZ A;  1QS7 A;  1TRF A;  3R1O A;  1UHK A;  3LL8 B;  4ORB B;  2WC5 A;  1TNQ A;  2KBI A;  3S0A A;  1HQV A;  3S0E A;  1PUL A;  1OW4 A;  2EHB A;  3RLZ A;  1DT7 B;  2KQ6 A;  3ICB A;  4I5K A;  1F4O A;  1DJZ A;  4CFQ A;  1YRT B;  3V2L A;  4NQG A;  3S0G A;  1SPY A;  4GGF A;  1WRL A;  2CNP A;  3KHE A;  1J1E A;  3BFB A;  3N7H A;  3CR5 X;  1WRZ A;  2K60 A;  1F4Q A;  3BYA A;  3VB1 A;  3L4L A;  4IL1 A;  3RM1 A;  3WXA A;  1SKT A;  1X02 A;  2M1K B;  4HRE E;  1MWN A;  4IJ7 A;  2H61 A;  2M7L A;  2K0J A;  3O2P A;  2KI6 C;  3BOW B;  1JFK A;  2Q4U A;  2LMV A;  5AAN A;  3TZ1 A;  1B8C A;  1TWO A;  1KWO C;  1R6P A;  2FJY A;  2LVI A;  4ORC B;  3F45 A;  4GUK A;  4A4B A;  5BPJ A;  3S0D A;  2QEH A;  2PAS A;  1QLK A;  1H4B A;  3BFH A;  2JT3 A;  1QX2 A;  3CDN A;  1FPW A;  2CTN A;  3EK4 A;  2BBM A;  1EL4 A;  2JNX A;  2LUC A;  3JTD C;  2K7B A;  4P2Y B;  1M63 B;  3MSE B;  3SS5 A;  1XO5 A;  3FWB A;  2M29 A;  4YGE B;  2PMY A;  3EKJ A;  2LMT A;  3KEV A;  4MEW A;  3O4X A;  4C0K A;  2F8P A;  1WDC B;  2WCF A;  3Q8I A;  3DVK A;  1RFJ A;  4C0L A;  2LNK A;  3JTD B;  1N65 A;  2CXJ A;  2WCH A;  2H61 C;  1IJ5 A;  1OQP A;  2KI6 D;  3GK4 X;  4OR9 B;  5I2L A;  1AVS A;  1UHJ A;  1SL7 A;  3K21 A;  3FE9 A;  5B8I B;  3D76 A;  2QDI A;  1WRK A;  3JVT C;  1SCM B;  1OZO A;  3IQO A;  2IS9 A;  3FE6 A;  1BJF A;  1QV0 A;  1LVC D;  5FYX A;  1PK0 D;  2ZN8 A;  1A75 A;  3DD4 A;  1M31 A;  1XFV O;  4FTG A;  1H8B A;  2AAO A;  1Y0V H;  2KGR A;  3SG4 A;  1F55 A;  3PFV A;  3CTN A;  3NGV A;  4MZK A;  3CS1 A;  4BY4 A;  1LXF C;  2EC6 B;  2QEV A;  4I5N B;  3VRO A;  1LIN A;  3OB1 B;  5HL1 A;  1IQ5 A;  2LHL A;  4FQO A;  3BOW A;  5DIC A;  1SNL A;  3ZWH A;  4MRX A;  1BLQ A;  1DJX A;  1U5I A;  3B7A A;  1AJ5 A;  1QJT A;  2QPT A;  1CM4 A;  5FI7 A;  1KK8 B;  2K8M B;  3IQQ A;  2AUC A;  3I5H C;  3B88 A;  1KFU L;  2BCB A;  2ZN9 A;  4INW A;  1SW8 A;  2QEO A;  4UPG A;  1SMG A;  1YX7 A;  1CLM A;  1DJY A;  2WCM A;  2L2E A;  1SCM C;  1RJV A;  1A4P A;  2SAS A;  5FI2 A;  5CSF A;  1CFC A;  1CFF A;  2KOT A;  4USL A;  1B1G A;  2HQW A;  3IVT A;  1ZMZ A;  1IRJ A;  5JOL A;  4DIR A;  3L4A A;  4U8D A;  3TUY C;  2P70 A;  2LHI A;  5D3O A;  1TCF A;  5D7F A;  4P5O E;  1SL8 A;  4HRG A;  4GFT A;  2JC2 A;  3AKA A;  2F2O A;  2JQ6 A;  1S5G Z;  3B6X A;  3B87 A;  3SJS A;  1F70 A;  1D1O A;  1S6J A;  1SR6 B;  3BUW B;  3CGA A;  2L98 A;  2M49 B;  1JWD A;  1KSM A;  1SSE B;  3KO0 A;  1DEK A;  1EXR A;  2CCM A;  1A29 A;  4F7F A;  3DXL A;  1DF0 B;  2FOT A;  2DOQ A;  1PSB A;  1JC2 A;  2MA2 A;  1UUR A;  3DF0 B;  3BUN B;  3UO9 A;  2BAP A;  3OX5 A;  2JT8 A;  3ZNI A;  2PQL A;  3PM2 A;  2KLE A;  3SS3 A;  3TDU A;  3TUY B;  3LCP C;  3SIA A;  1OOI X;  3TDZ A;  2KPH A;  4QJ5 B;  1DTL A;  1F54 A;  2VRG A;  1BF5 A;  1QX5 B;  2JUL A;  1A75 B;  3I5H B;  4JPZ B;  3D0Y B;  1QVI Z;  4JWQ A;  2WOS A;  1CNP A;  3BFA A;  1Q80 A;  2V53 A;  3CZ0 A;  3BUM B;  1PVA A;  1ZUZ A;  2R2I A;  2JTT A;  1C7W A;  3DVM A;  3UNW A;  1T14 A;  2BE6 A;  1OMV A;  1SCV A;  2EGD A;  1GGZ A;  2M9G A;  2L4I A;  1DF0 A;  1ZAC A;  2M3W A;  1QTX A;  3I5I C;  3PAT A;  1DGU A;  2G9B A;  1Y1U A;  1OSA A;  2BNX A;  4PE0 A;  5G08 A;  3SS4 A;  1MXE A;  1TN4 A;  2KAY A;  5F6T A;  5HLO A;  2D8N A;  3L47 A;  1QWV A;  1K93 D;  2LLS A;  3R1V A;  4D1E A;  2L0P A;  2WC6 A;  3DY9 A;  3O6B A;  2M7N A;  3WHU B;  1UUS A;  1IWQ A;  1N0Y A;  2KSP A;  1LS8 A;  1MXL C;  1OZS A;  2KFG A;  1S36 A;  2LVJ A;  3PN7 B;  4GGF C;  2LLU A;  2CT9 A;  2CBL A;  2PVB A;  1PRW A;  3DYE A;  1MF8 B;  3I5I B;  4M2P A;  1NWD A;  1Z4H A;  1BR1 B;  2QEB A;  4YI9 A;  3SG3 A;  3TDI A;  5KSZ A;  3LLE A;  4AOM A;  1KK7 Z;  3NSL A;  1NCY A;  1FF1 A;  1WLM A;  3OP0 A;  2LVV A;  4WQ3 A;  1EJ3 A;  3GK1 A;  1XFY O;  4ETO A;  1YVH A;  2I94 A;  3IF7 A;  2L51 A;  1PVB A;  1CMF A;  3A8R A;  2K7D A;  3QME A;  1J7Q A;  5DKQ A;  2QAC A;  1PAL A;  3PSR A;  4N5X A;  5HKY A;  1S6I A;  5HKW A;  4MVF A;  1NPQ A;  2JPT A;  3DF0 A;  2KQY A;  1F71 A;  3K1E A;  2KI4 C;  1BR4 B;  1WY9 A;  1SYM A;  2I2R E;  3GOF A;  2MJW B;  1MQ1 A;  1QAT A;  1YUS A;  2JTZ A;  2LP3 A;  1QIV A;  3D75 A;  1C3Z A;  3GK2 A;  4TNC A;  2WCK A;  4HRH A;  1TNW A;  2NXQ A;  1BOD A;  4XYN A;  4WQ2 A;  5HKZ A;  1L2O B;  4CID A;  1MHO A;  2H2K A;  2Y1M A;  5DKN A;  4MN0 A;  1XFW O;  3SG2 A;  3EK8 A;  3VRN A;  2BKI B;  5CPV A;  2HET A;  3JVT B;  4WRI A;  2PSR A;  2JRF A;  4MZL A;  4KYN A;  2L2C A;  1W7I B;  5FI6 A;  5I2Q A;  4NDD A;  1NX3 A;  1S1E A;  3EVV A;  1REC A;  1RWY A;  1QXP A;  2PYQ A;  2LUX A;  2OS8 C;  4CFR A;  2F3Y A;  1B8L A;  1KFU S;  1SK6 D;  4PHM A;  1U5I B;  1CFD A;  1CDM A;  1UHN A;  1ODB A;  2JZI A;  1DJG A;  1NYA A;  1Y1A A;  2FCE A;  5ER5 A;  1IGV A;  3AAJ A;  2MLF C;  1NX0 A;  3CLN A;  1IJ6 A;  1NCX A;  2BE4 A;  4OCI A;  2G2B A;  4PE1 A;  3NSO A;  1DJW A;  2MLE C;  2HQ8 A;  3R72 A;  3WHT B;  1RK9 A;  1NCZ A;  5GQQ C;  1TNX A;  1VRK A;  1TNP A;  3CZT X;  4DUQ A;  3D73 A;  1KQM C;  1S5G Y;  3OX6 A;  5JJG A;  4ORA B;  2JT0 A;  1AJ4 A;  1DVI A;  1ALW A;  4DRW A;  2MAZ A;  5AFP A;  2KGB C;  3CZ2 A;  3NSK A;  2Y4Q A;  4PE7 A;  1DEL A;  2OS8 B;  2BEC A;  1BG1 A;  2O60 A;  1DMO A;  2KBM A;  3PJI A;  1S3P A;  2F3Z A;  3H4S E;  2MRD A;  4C0J A;  2Y1N A;  5AER A;  3D10 A;  1FW4 A;  1QIW A;  1XK4 C;  1YUT A;  2JXC A;  3AKB A;  1TCO B;  2L5Y A;  1E8A A;  1F8H A;  3KPX A;  1OOH A;  1S6C A;  3B86 A;  1JBA A;  5EL2 A;  3EG5 B;  5CSJ A;  4MSP A;  4PHJ A;  4ZCU A;  1KK7 Y;  3VRQ A;  1RTP 1;  1B7T Z;  3D77 A;  2JOJ A;  1DGV A;  3VRP A;  2KYF A;  1GQM A;  3EK7 A;  4MRY A;  1KQV A;  2BCA A;  3EKH A;  3I5F C;  1BOC A;  4I5J A;  4CPV A;  4CLN A;  1YTZ C;  2ZRT A;  5D69 A;  1RRO A;  3KF9 A;  1CMG A;  3VGO A;  2FCD A;  4A4C A;  1B9A A;  2K61 A;  2L4H A;  2WCE A;  4N1F A;  4XJK A;  1V1G A;  1IG5 A;  5K89 A;  3BJH A;  3AAK A;  4OKH A;  2OTG B;  3BUX B;  2LCP A;  1KWO B;  2GGM A;  1KSO A;  2BKH B;  3OBV A;  2KHN A;  3BUO B;  3O4Y A;  1J7O A;  5IBW A;  1DJI A;  2KI4 B;  1CM1 A;  5ER4 X;  3M0W A;  4YBH B;  2NCP A;  1OOG A;  2ZNE A;  4NDC A;  3NSI A;  4BY5 A;  1XFU O;  4JD9 A;  3HCM A;  1AHR A;  1M45 A;  2B1U A;  2OPO A;  1GJY A;  1KFX S;  3SIB A;  1EH2 A;  3CR4 X;  1MR8 A;  3O78 A;  2KYC A;  5CSI A;  1B47 A;  2K2F A;  2MHH A;  4DCK A;  1CDP A;  1TTX A;  2L5X B;  3QRX A;  2ZKM X;  1KCY A;  3EVU A;  3PLF B;  5HLV A;  2WOR A;  1XYD A;  2NZ0 A;  4E68 A;  1FBV A;  1KQM B;  3BXK A;  4YRU A;  2P6B B;  1BU3 A;  1LA0 A;  3LK1 A;  2RGI A;  3CWG A;  3A4U B;  1DJH A;  4OZD A;  1K9U A;  2LAN A;  3OGN A;  1TUZ A; 
#chains in the Genus database with same CATH homology
 3DVJ A;  1KK8 C;  2M0R A;  4GAO A;  1IKU A;  1AUI B;  1ZFS A;  5KU1 A;  3NXA A;  1SR6 C;  1SRA A;  1Y6W A;  2KAV A;  2LV7 A;  1B4C A;  1K90 D;  5TNC A;  1K2H A;  2LMU A;  5DKR A;  4M2Q A;  1UP5 A;  4YGA A;  4R1E A;  3I5G C;  4MLW A;  1XA5 A;  2MBX A;  1QAS A;  1XK4 A;  4XJK B;  2I7A A;  4YGD B;  3EVR A;  1B7T Y;  2SCP A;  1FI6 A;  1K95 A;  2BCX A;  1JF2 A;  1UWO A;  2PRU A;  1YUU A;  4NDB A;  1K8U A;  3FWC A;  2O5G A;  2BL0 B;  1M46 A;  1V1F A;  4AQI A;  1CLL A;  2WCB A;  3PM8 A;  4DS7 A;  2KFF A;  3DVE A;  1SL9 A;  1XFZ O;  1YRU B;  2F2P A;  1NIW A;  1PSR A;  1UHH A;  1N2D A;  1EG3 A;  1M39 A;  2ZFD A;  3PAL A;  5I2O A;  1CLB A;  1JUO A;  1QV1 A;  3WNX B;  1JFJ A;  1UHI A;  5CSN A;  1OOJ A;  1NSH A;  1OE9 B;  1Y1X A;  2AMI A;  2COL B;  1JF0 A;  5HYD A;  2LC5 A;  1J7R A;  2KAX A;  2JWW A;  4OVN F;  2ISD A;  2OTG C;  1YR5 A;  1K9P A;  3TS5 B;  2FJU B;  2LM5 A;  1K9K A;  1B8R A;  2JNF A;  4PE4 A;  2WND A;  2LP2 A;  2E6W A;  2TN4 A;  3FS7 A;  3OB2 B;  1CTR A;  5J3X A;  3I5G B;  2M1U A;  1R2U A;  1CFP A;  1J55 A;  2K7C A;  1QLS A;  1AP4 A;  1C07 A;  3C1V A;  5PAL A;  1NUB A;  4AQJ A;  1IH0 A;  1KFX L;  4PHN A;  2LE9 B;  4PAL A;  3BQ3 A;  1XFX O;  2GV5 A;  4OV2 A;  2F33 A;  4I5L B;  1MUX A;  4GGN A;  2Y5I A;  2M8U A;  4GNK B;  4M2O A;  4N1G A;  4ZCV A;  2KDH A;  1LA3 A;  1WDC C;  3SG7 A;  2EC6 C;  3I5F B;  1CDL A;  2A4J A;  1J1D A;  4JQ0 D;  2ZRS A;  1TIZ A;  4L9M A;  1JSA A;  3TS5 C;  1C7V A;  5KTY A;  2K7O A;  2LAP A;  5AXI A;  3SG6 A;  2KNE A;  4QJ4 B;  4GBA A;  1AK8 A;  3FIA A;  1NX1 A;  1EG4 A;  5AEQ A;  2NLN A;  2KFH A;  4HSZ A;  4F0Z B;  2JU0 A;  1A03 A;  4QJ3 B;  1XVJ A;  1K94 A;  4YI8 A;  3D0Y A;  1TOP A;  1S26 D;  3OHM B;  3HX4 A;  1NX2 A;  1HT9 A;  1YX8 A;  3PN7 C;  1FI5 A;  1L2O C;  4PCW A;  4YGC B;  1YUR A;  4ICB A;  1QVI Y;  2WC8 A;  4PDZ A;  3CR2 A;  2M97 A;  1GGW A;  1G33 A;  4YGB B;  3SG5 A;  3VRR A;  2K2A A;  1ALV A;  2LVK A;  3LK0 A;  2E30 A;  2L50 A;  1WLZ A;  1NP8 A;  2PAL A;  1LKJ A;  2BBN A;  1BT6 A;  2BL0 C;  4PHK A;  4Q04 A;  2NCO A;  4MZJ A;  1IQ3 A;  2ZND A;  2JXL A;  1CB1 A;  2Q91 A;  2HF5 A;  1OMD A;  1YVL A;  1CKK A;  1CDN A;  2GGZ A;  1BMO A;  1K96 A;  1G8I A;  2HPS A;  1QX7 A;  2I18 A;  1OMR A;  1A2X A;  1SY9 A;  1W7J B;  2LLT A;  1J7P A;  4GPL B;  3E3R A;  4MBE A;  1SBJ A;  1ZOT B;  1G4Y R;  5I8N A;  1L7Z A;  1QS7 A;  1TRF A;  4ORB B;  1UHK A;  3LL8 B;  1TNQ A;  2KBI A;  1HQV A;  1PUL A;  2EHB A;  3RLZ A;  1DT7 B;  2KQ6 A;  3ICB A;  4I5K A;  1F4O A;  1DJZ A;  4CFQ A;  1YRT B;  4NQG A;  1SPY A;  4GGF A;  1WRL A;  2CNP A;  3KHE A;  1J1E A;  3CR5 X;  1WRZ A;  1F4Q A;  3BYA A;  4IL1 A;  3RM1 A;  3WXA A;  1SKT A;  1X02 A;  2M1K B;  4HRE E;  1MWN A;  2H61 A;  2M7L A;  2K0J A;  3O2P A;  2KI6 C;  3BOW B;  1JFK A;  2Q4U A;  2LMV A;  5AAN A;  3TZ1 A;  1B8C A;  1KWO C;  1R6P A;  2LVI A;  4ORC B;  4A4B A;  3F45 A;  4GUK A;  5BPJ A;  2PAS A;  1QLK A;  1H4B A;  2JT3 A;  1QX2 A;  1FPW A;  2CTN A;  3EK4 A;  2BBM A;  1EL4 A;  2JNX A;  2LUC A;  3JTD C;  2K7B A;  4P2Y B;  1M63 B;  3MSE B;  1XO5 A;  3FWB A;  2M29 A;  4YGE B;  2PMY A;  3EKJ A;  2LMT A;  3KEV A;  4MEW A;  4C0K A;  2F8P A;  1WDC B;  2WCF A;  3DVK A;  1RFJ A;  4C0L A;  2LNK A;  3JTD B;  1N65 A;  2CXJ A;  2H61 C;  1IJ5 A;  1OQP A;  2KI6 D;  3GK4 X;  4OR9 B;  5I2L A;  1AVS A;  1UHJ A;  1SL7 A;  3K21 A;  5B8I B;  1WRK A;  3JVT C;  1SCM B;  1OZO A;  3IQO A;  2IS9 A;  1BJF A;  1QV0 A;  1LVC D;  5FYX A;  1PK0 D;  2ZN8 A;  1A75 A;  3DD4 A;  1M31 A;  1XFV O;  4FTG A;  1H8B A;  2AAO A;  1Y0V H;  2KGR A;  3SG4 A;  1F55 A;  3PFV A;  3CTN A;  4MZK A;  3CS1 A;  4BY4 A;  1LXF C;  2EC6 B;  4I5N B;  3VRO A;  1LIN A;  3OB1 B;  1IQ5 A;  2LHL A;  4FQO A;  3BOW A;  1SNL A;  3ZWH A;  4MRX A;  1BLQ A;  1DJX A;  1U5I A;  1AJ5 A;  1QJT A;  2QPT A;  1CM4 A;  1KK8 B;  2K8M B;  3IQQ A;  2AUC A;  3I5H C;  1KFU L;  2BCB A;  2ZN9 A;  1SW8 A;  4UPG A;  1SMG A;  1YX7 A;  1CLM A;  1DJY A;  2L2E A;  1SCM C;  1RJV A;  1A4P A;  2SAS A;  1CFF A;  5CSF A;  1CFC A;  2KOT A;  4USL A;  1B1G A;  2HQW A;  1ZMZ A;  1IRJ A;  5JOL A;  4DIR A;  4U8D A;  3TUY C;  2LHI A;  1TCF A;  5D7F A;  4P5O E;  1SL8 A;  4HRG A;  4GFT A;  2JC2 A;  3AKA A;  2F2O A;  2JQ6 A;  1S5G Z;  3SJS A;  1F70 A;  1D1O A;  1S6J A;  1SR6 B;  3BUW B;  3CGA A;  2L98 A;  2M49 B;  1JWD A;  1KSM A;  3KO0 A;  1EXR A;  2CCM A;  1A29 A;  1DF0 B;  2FOT A;  2DOQ A;  1PSB A;  1JC2 A;  2MA2 A;  1UUR A;  3DF0 B;  3BUN B;  3OX5 A;  2JT8 A;  3ZNI A;  3TDU A;  3TUY B;  3LCP C;  3SIA A;  3TDZ A;  4QJ5 B;  1DTL A;  1F54 A;  2VRG A;  1BF5 A;  1QX5 B;  2JUL A;  1A75 B;  3I5H B;  4JPZ B;  3D0Y B;  1QVI Z;  4JWQ A;  2WOS A;  1CNP A;  1Q80 A;  2V53 A;  3BUM B;  1PVA A;  1ZUZ A;  2R2I A;  2JTT A;  1C7W A;  3DVM A;  2BE6 A;  1OMV A;  1SCV A;  2EGD A;  1GGZ A;  2M9G A;  2L4I A;  1DF0 A;  1ZAC A;  2M3W A;  1QTX A;  3I5I C;  3PAT A;  1DGU A;  2G9B A;  1Y1U A;  1OSA A;  4PE0 A;  5G08 A;  1MXE A;  1TN4 A;  2KAY A;  5F6T A;  5HLO A;  2D8N A;  1K93 D;  2LLS A;  4D1E A;  2L0P A;  3O6B A;  2M7N A;  3WHU B;  1UUS A;  1IWQ A;  1N0Y A;  2KSP A;  1MXL C;  1OZS A;  2KFG A;  2LVJ A;  1S36 A;  3PN7 B;  4GGF C;  2LLU A;  2CT9 A;  2CBL A;  2PVB A;  1PRW A;  1MF8 B;  3I5I B;  4M2P A;  1NWD A;  1BR1 B;  4YI9 A;  3TDI A;  3SG3 A;  5KSZ A;  3LLE A;  4AOM A;  1KK7 Z;  3NSL A;  1NCY A;  1FF1 A;  1WLM A;  3OP0 A;  2LVV A;  4WQ3 A;  1EJ3 A;  3GK1 A;  1XFY O;  4ETO A;  1YVH A;  2I94 A;  3IF7 A;  2L51 A;  1PVB A;  1CMF A;  3A8R A;  2K7D A;  1J7Q A;  5DKQ A;  2QAC A;  1PAL A;  3PSR A;  4N5X A;  5HKY A;  1S6I A;  5HKW A;  4MVF A;  1NPQ A;  2JPT A;  3DF0 A;  2KQY A;  1F71 A;  2KI4 C;  1BR4 B;  1WY9 A;  1SYM A;  2I2R E;  3GOF A;  2MJW B;  1MQ1 A;  1QAT A;  1YUS A;  2JTZ A;  2LP3 A;  1QIV A;  3GK2 A;  4TNC A;  4HRH A;  1TNW A;  2NXQ A;  1BOD A;  4XYN A;  4WQ2 A;  5HKZ A;  1L2O B;  4CID A;  1MHO A;  2H2K A;  2Y1M A;  5DKN A;  4MN0 A;  1XFW O;  3SG2 A;  3EK8 A;  3VRN A;  2BKI B;  5CPV A;  2HET A;  3JVT B;  4WRI A;  2PSR A;  2JRF A;  4MZL A;  5I2Q A;  1W7I B;  4NDD A;  1NX3 A;  1S1E A;  3EVV A;  1REC A;  1RWY A;  1QXP A;  2LUX A;  2OS8 C;  4CFR A;  2F3Y A;  1B8L A;  1KFU S;  1SK6 D;  4PHM A;  1U5I B;  1CFD A;  1CDM A;  1UHN A;  1ODB A;  2JZI A;  1DJG A;  1NYA A;  1Y1A A;  2FCE A;  5ER5 A;  1IGV A;  3AAJ A;  2MLF C;  1NX0 A;  3CLN A;  1IJ6 A;  1NCX A;  2BE4 A;  4OCI A;  2G2B A;  4PE1 A;  3NSO A;  1DJW A;  2MLE C;  2HQ8 A;  3WHT B;  1RK9 A;  1NCZ A;  5GQQ C;  1TNX A;  1VRK A;  1TNP A;  3CZT X;  4DUQ A;  1KQM C;  1S5G Y;  3OX6 A;  5JJG A;  4ORA B;  2JT0 A;  1AJ4 A;  1DVI A;  1ALW A;  4DRW A;  2MAZ A;  5AFP A;  2KGB C;  3NSK A;  2Y4Q A;  4PE7 A;  2OS8 B;  2BEC A;  1BG1 A;  2O60 A;  1DMO A;  2KBM A;  1S3P A;  2F3Z A;  3H4S E;  2MRD A;  4C0J A;  2Y1N A;  5AER A;  3D10 A;  1FW4 A;  1QIW A;  1XK4 C;  1YUT A;  2JXC A;  3AKB A;  1TCO B;  1E8A A;  1F8H A;  3KPX A;  1JBA A;  1S6C A;  5CSJ A;  4MSP A;  4PHJ A;  4ZCU A;  1KK7 Y;  3VRQ A;  1RTP 1;  1B7T Z;  2JOJ A;  1DGV A;  3VRP A;  2KYF A;  1GQM A;  3EK7 A;  4MRY A;  1KQV A;  2BCA A;  3EKH A;  3I5F C;  1BOC A;  4I5J A;  4CPV A;  4CLN A;  1YTZ C;  2ZRT A;  5D69 A;  1RRO A;  3KF9 A;  1CMG A;  3VGO A;  2FCD A;  4A4C A;  1B9A A;  2K61 A;  2L4H A;  2WCE A;  4N1F A;  4XJK A;  1V1G A;  1IG5 A;  5K89 A;  3AAK A;  4OKH A;  2OTG B;  3BUX B;  2LCP A;  1KWO B;  2GGM A;  1KSO A;  2BKH B;  2KHN A;  3BUO B;  3O4Y A;  1J7O A;  5IBW A;  1DJI A;  2KI4 B;  1CM1 A;  5ER4 X;  3M0W A;  4YBH B;  2NCP A;  2ZNE A;  4NDC A;  3NSI A;  4BY5 A;  1XFU O;  3HCM A;  1AHR A;  1M45 A;  2B1U A;  2OPO A;  1GJY A;  1KFX S;  3SIB A;  1EH2 A;  3CR4 X;  1MR8 A;  3O78 A;  2KYC A;  5CSI A;  1B47 A;  2K2F A;  2MHH A;  4DCK A;  1CDP A;  1TTX A;  2L5X B;  3QRX A;  2ZKM X;  1KCY A;  3EVU A;  3PLF B;  5HLV A;  2WOR A;  1XYD A;  2NZ0 A;  4E68 A;  1FBV A;  1KQM B;  3BXK A;  4YRU A;  2P6B B;  1BU3 A;  1LA0 A;  3LK1 A;  2RGI A;  3CWG A;  3A4U B;  1DJH A;  1K9U A;  2LAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...