2NZ0A

Crystal structure of potassium channel kv4.3 in complex with its regulatory subunit kchip1 (casp target)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
180
structure length
170
Chain Sequence
MGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Kv channel-interacting protein 1
publication title Structural basis for modulation of Kv4 K(+) channels by auxiliary KChIP subunits.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 170
sequence length 180
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2nz0A00
5K89A 1XK4C 3D0YA 1CMGA 1YX8A 3TDUA 4GNKB 2KQ6A 2LANA 3VRNA 4DRWA 4QJ4B 1S5GZ 1CDLA 2GGMA 1IJ5A 1M63B 2EHBA 4P2YB 4AQJA 2L5XB 1NCYA 2P6BB 3I5GC 1QX2A 2QPTA 2H61A 3OP0A 1SL8A 3QRXA 2HQWA 2Y5IA 1RFJA 1BJFA 3VRPA 4HRHA 1F54A 1SL9A 1MF8B 1S5GY 3TDZA 1DF0A 1IJ6A 1IQ5A 2LLUA 3H4SE 3KHEA 1JFKA 2G2BA 2Y1MA 3HX4A 1DJXA 2JT0A 3AKBA 4Q04A 2K7BA 4D1EA 1S3PA 2KI6D 3BUMB 1BLQA 1Y6WA 3CR2A 1CMFA 2I94A 2KYCA 5HKZA 5KSZA 2JPTA 1N2DA 2JT3A 2L4IA 1NUBA 2OS8B 1BU3A 2LMVA 2Q4UA 1JC2A 1KWOC 4MZKA 2KFGA 2ZRSA 1DJZA 1ODBA 2BCBA 1BMOA 1KK7Y 1YTZC 1XVJA 3GOFA 1NP8A 2BBMA 1CNPA 2NCOA 1K94A 2PMYA 1WDCC 3PN7C 2BCAA 3D0YB 1QXPA 2OTGC 1K9UA 3BYAA 2HPSA 1SCMB 1QATA 3LK0A 4DCKA 1NSHA 2JZIA 2BBNA 3NSKA 4OVNF 4N1GA 1XK4A 2KAYA 2I18A 2M97A 2LNKA 3FWCA 1YUSA 4ZCVA 2BE6A 1TCFA 2KBIA 1KFXS 2E30A 1CDMA 1YURA 1IRJA 2JNFA 2K61A 4R1EA 1IWQA 5CSFA 1K95A 1WRKA 2JXCA 3O78A 3SG4A 1PVAA 1B8LA 1S6CA 3CS1A 4I5KA 3A4UB 3CLNA 5JJGA 3IF7A 2WOSA 2KOTA 4GUKA 5CSIA 2JTTA 1R6PA 4GGFC 3I5IB 1DJIA 1QS7A 1H8BA 2M7LA 1KSMA 2KI6C 3BUWB 1DGUA 4MZJA 4PALA 1EL4A 2M3WA 1KQVA 2KBMA 1JF0A 4GAOA 4PE1A 1UUSA 1K96A 5HKWA 1UHHA 4C0LA 4U8DA 2JT8A 2BL0B 1GJYA 2WNDA 5G08A 1B9AA 3FIAA 3ZNIA 3BOWA 2AUCA 1WRLA 2ZFDA 1SK6D 1QX5B 2ZN9A 2EC6C 3CGAA 3I5HC 2O5GA 2F2OA 3HCMA 1SCVA 1J1EA 3PFVA 4NDDA 5HLOA 2MJWB 1LVCD 4QJ5B 4YI9A 1KFXL 1AHRA 3VRQA 3LCPC 4FQOA 1SR6C 5I8NA 1WLMA 2LM5A 3JVTC 1XFZO 3EKHA 1DTLA 3I5GB 2K2FA 1K9PA 2ZN8A 3F45A 1BT6A 1F4QA 3TDIA 2HF5A 4ORBB 1KFUL 2CNPA 1NX0A 1TNPA 2EGDA 2KQYA 3TS5C 2MRDA 2SCPA 3AAKA 1UHKA 3DF0B 1DJGA 2JNXA 4NQGA 3RLZA 2FOTA 4GGFA 1A4PA 1NCZA 3PSRA 1V1FA 3AKAA 3ICBA 1BF5A 1G4YR 2BKIB 4ZCUA 1F71A 2LMUA 1DJYA 3IQOA 1J7OA 2O60A 1FI6A 1S1EA 2M0RA 1GQMA 4PCWA 2LHIA 1XFWO 1KQMC 1DT7B 2NZ0A 4P5OE 1OMVA 1QLSA 1OSAA 1JWDA 1YUUA 1RROA 4CFQA 1J55A 1QTXA 1KWOB 1PALA 2KSPA 1AVSA 2M7NA 3WHUB 4N5XA 4I5NB 1PSRA 3TUYB 1WDCB 1L7ZA 2LVJA 1BOCA 1G33A 3PN7B 2Y4QA 1F70A 1KK7Z 1L2OC 1SRAA 1TN4A 1ZACA 1PVBA 2LC5A 2LCPA 1G8IA 2A4JA 1M39A 4JQ0D 4WRIA 2FCEA 2M9GA 2F33A 5F6TA 2F3ZA 1QV0A 1S36A 1ZFSA 3GK4X 1PK0D 1NIWA 3OHMB 1DVIA 3BQ3A 2KAXA 1DJWA 1EG3A 2ZKMX 1OMDA 2JQ6A 2LLTA 5KTYA 4MN0A 2L0PA 2WORA 2MHHA 3EK4A 4OCIA 1QIWA 2MAZA 5HYDA 2KYFA 1ZMZA 2F2PA 5CSNA 2Y1NA 1SNLA 4M2OA 1TTXA 4YRUA 3DD4A 3SIBA 3BXKA 3KF9A 3BUXB 2FCDA 5CPVA 3VGOA 3O6BA 1IH0A 2TN4A 4XJKA 2ZNDA 3EVUA 3OX5A 2LVVA 4PHNA 1MHOA 3PM8A 1C7VA 1Q80A 2KGRA 1UHIA 1X02A 4DUQA 2PALA 2K8MB 1RECA 1RK9A 4CLNA 4ORCB 1OMRA 2H2KA 3SIAA 2LAPA 2PVBA 4C0JA 2IS9A 2B1UA 1PULA 1VRKA 1NX3A 3JTDB 1M31A 1DF0B 1NX2A 3OB1B 1BR1B 5DKQA 5I2QA 2DOQA 3LLEA 2D8NA 1KFUS 1NX1A 1SKTA 3I5FB 1A75A 5AANA 2AAOA 2LHLA 2ZNEA 1AP4A 1AJ5A 1MXEA 3WHTB 3MSEB 5AEQA 3KO0A 3FS7A 5I2OA 3AAJA 1UP5A 2F3YA 1BG1A 1QVIZ 4N1FA 1FPWA 2JXLA 1B1GA 1EXRA 5D7FA 5FYXA 1A2XA 2LP2A 4ETOA 1TNXA 3CR5X 4I5JA 1YVLA 4PHJA 2ZRTA 1U5IA 2LUCA 1BODA 2I7AA 2L4HA 1MWNA 1TNQA 1XFUO 1C7WA 2K0JA 1IGVA 1Y0VH 2JWWA 1QVIY 1WY9A 3BUOB 2KI4C 4CIDA 2SASA 2M8UA 1YR5A 2CBLA 1YVHA 3NSIA 1CLMA 1GGWA 1CFDA 1V1GA 3PLFB 5I2LA 5AFPA 1LXFC 2LUXA 3TS5B 1B4CA 1K2HA 1EJ3A 1HQVA 4A4CA 1RTP1 3SG6A 4F0ZB 4C0KA 1NWDA 5CSJA 3LK1A 2RGIA 4HSZA 1ALWA 2WCBA 1F8HA 4YI8A 1MQ1A 2M49B 4TNCA 4CPVA 1J1DA 4MEWA 1K90D 2QACA 4YGDB 1MUXA 4PHMA 4E68A 4PE4A 2E6WA 1KQMB 4UPGA 2L51A 1A75B 2VRGA 5DKNA 3NSOA 1XFXO 1LINA 1MXLC 2KNEA 2LE9B 3GK1A 4HRGA 1CDNA 2NXQA 2HETA 2G9BA 4L9MA 3IQQA 4BY5A 1DGVA 2BL0C 2K7CA 1SW8A 3NSLA 5AERA 2V53A 1L2OB 1TIZA 1CFFA 1H4BA 4MRYA 2LP3A 1OOJA 3CR4X 4JWQA 3EVVA 1KK8C 1U5IB 2I2RE 2WCEA 1CFCA 1CB1A 3BOWB 1AJ4A 4GGNA 1JSAA 1FF1A 2KFFA 1QV1A 2KFHA 1YRTB 1XYDA 1NCXA 2M29A 1FI5A 1B8CA 4USLA 1A03A 2L2EA 1IQ3A 2OTGB 2LVKA 3TZ1A 3NXAA 2JTZA 4WQ3A 1NPQA 1J7QA 1PRWA 4IL1A 1J7PA 1HT9A 3KEVA 1TRFA 2CXJA 4NDCA 3OB2B 1YUTA 1MR8A 2LVIA 1JF2A 3EVRA 3DVMA 2BE4A 4MSPA 4AOMA 1R2UA 1CM4A 5IBWA 1LKJA 1ALVA 4GBAA 3VRRA 5BPJA 1UHJA 2NLNA 1Y1XA 2JC2A 1QLKA 1SYMA 1UHNA 1ZOTB 1CKKA 1Y1UA 3DVEA 4QJ3B 2ISDA 2LLSA 4MRXA 1F55A 2WCFA 3DVJA 3O4YA 4JPZB 4GPLB 2L98A 1A29A 1FW4A 3WXAA 5D69A 2BCXA 3OX6A 1SMGA 4YGBB 4PHKA 2MLEC 1QJTA 3O2PA 5HLVA 5KU1A 2KHNA 2GV5A 5GQQC 1QASA 3TUYC 1KCYA 1F4OA 1K8UA 3WNXB 1CTRA 1W7IB 1YX7A 1Y1AA 1IKUA 4M2QA 5ER5A 1QX7A 4A4BA 3EKJA 3GK2A 4HREE 2K7DA 4YGEB 2BKHB 3SG2A 1K9KA 1S6JA 4GFTA 2OS8C 2Q91A 5JOLA 4MLWA 2PRUA 3PALA 4PE0A 1N0YA 1E8AA 1BR4B 2BECA 4PE7A 2FJUB 3BUNB 2KI4B 1ZUZA 2KGBC 3RM1A 2CTNA 4FTGA 2EC6B 1B47A 3I5HB 4M2PA 2M1KB 3CZTX 1XFYO 1RWYA 1SL7A 4ICBA 5DKRA 1SCMC 2F8PA 4YGAA 5AXIA 1OQPA 4XYNA 1OZOA 1S6IA 1WLZA 2K7OA 3CTNA 1RJVA 5HKYA 2HQ8A 2JULA 1SR6B 1CLLA 3ZWHA 5B8IB 2JOJA 1SY9A 3JVTB 4I5LB 3SG5A 2LV7A 4DIRA 1S26D 3A8RA 1XA5A 2NCPA 3DF0A 1NYAA 3CWGA 3EK8A 5PALA 2H61C 3E3RA 1TNWA 4XJKB 1B7TZ 1DJHA 1LA3A 1JBAA 1D1OA 1KSOA 2R2IA 1M45A 3KPXA 4MVFA 1DMOA 3JTDC 1W7JB 2WC8A 3M0WA 1OE9B 1CLBA 2KAVA 3PATA 1M46A 3I5FC 2CT9A 4CFRA 1FBVA 3K21A 2MBXA 3I5IC 3SG3A 2CCMA 4AQIA 1QIVA 1B7TY 2MA2A 3EK7A 2LMTA 1KK8B 3DVKA 1N65A 1PSBA 1XO5A 2JRFA 4MBEA 3FWBA 4NDBA 4YGCB 3SJSA 1AK8A 2JU0A 1TCOB 2MLFC 2M1UA 5ER4X 2PASA 4BY4A 3C1VA 1CDPA 2COLB 4OKHA 1XFVO 1YRUB 1GGZA 1B8RA 2KDHA 1JUOA 1SBJA 3LL8B 1SPYA 2GGZA 4OV2A 1AUIB 1UURA 2PSRA 3D10A 1OZSA 2AMIA 1K93D 2L50A 2OPOA 4MZLA 4OR9B 1CFPA 1CM1A 1UWOA 1WRZA 4ORAB 4WQ2A 4YBHB 2K2AA 3SG7A 1EH2A 5TNCA 1JFJA 1EG4A 1TOPA 1LA0A 4PDZA 1C07A 5J3XA 4DS7A 1J7RA 3VROA 1IG5A
chains in the Genus database with same CATH superfamily
5K89A 1XK4C 3D0YA 2QEHA 3L47A 1CMGA 1YX8A 3TDUA 4GNKB 2KQ6A 2LANA 3VRNA 4DRWA 4QJ4B 1S5GZ 1CDLA 2GGMA 1IJ5A 1M63B 3D76A 2EHBA 2JPOA 4P2YB 4AQJA 3R1PA 2L5XB 1NCYA 2WCMA 1QWVA 3DY9A 2P6BB 3I5GC 1QX2A 2QPTA 2H61A 3OP0A 1SL8A 3OGNA 3QRXA 2HQWA 2QEVA 2Y5IA 2WC5A 1RFJA 1BJFA 3VRPA 4HRHA 1F54A 1SL9A 1MF8B 1S5GY 3TDZA 1OOIX 1DF0A 1IJ6A 1IQ5A 2LLUA 3H4SE 3KHEA 1JFKA 2G2BA 2Y1MA 3PM2A 3Q8IA 3HX4A 1DJXA 2JT0A 3AKBA 4Q04A 2K7BA 4D1EA 1S3PA 2KI6D 3BUMB 1BLQA 1Y6WA 3CR2A 1CMFA 2I94A 3L4LA 2KYCA 5HKZA 5KSZA 2JPTA 1N2DA 2JT3A 2L4IA 1NUBA 1DC1A 3D77A 2OS8B 3CABA 1BU3A 2LMVA 2Q4UA 1JC2A 1KWOC 4MZKA 2KFGA 1TWOA 2ZRSA 1DJZA 1ODBA 1YTZC 1BMOA 1KK7Y 1XVJA 2BCBA 3GOFA 1NP8A 2BBMA 1CNPA 2NCOA 1K94A 2PMYA 1WDCC 3BJHA 3PN7C 2BCAA 3D0YB 1QXPA 2OTGC 1K9UA 3BYAA 2HPSA 1SCMB 1QATA 3LK0A 4DCKA 3FE8A 1NSHA 2JZIA 2BBNA 3NSKA 4OVNF 4N1GA 1XK4A 2KAYA 2I18A 2M97A 2BAPA 2LNKA 1YUSA 3DYEA 2BE6A 3FWCA 1TCFA 4ZCVA 2KBIA 1KFXS 2E30A 1CDMA 1YURA 1IRJA 2JNFA 3VB1A 3S0FA 2K61A 4R1EA 1IWQA 5CSFA 3B7AA 1K95A 4F7FA 1WRKA 2JXCA 3O78A 3SG4A 3NHTA 1PVAA 1DEKA 1B8LA 1S6CA 3CS1A 4I5KA 3A4UB 3CLNA 4FQTA 5JJGA 3IF7A 2WOSA 2KOTA 3FE9A 4GUKA 5CSIA 2JTTA 3EG5B 1R6PA 4GGFC 3I5IB 1DJIA 1QS7A 1H8BA 2M7LA 1KSMA 2KI6C 3BUWB 1DGUA 4MZJA 4JD9A 4PALA 1EL4A 2M3WA 1KQVA 1OOHA 2KBMA 1JF0A 3O4XA 4GAOA 1UUSA 4PE1A 2L5YA 1K96A 5HKWA 1UHHA 4C0LA 4U8DA 2JT8A 2BL0B 1GJYA 2WNDA 2GTEA 1B9AA 5G08A 3SS3A 3FIAA 3ZNIA 3BOWA 2AUCA 1WRLA 2QEOA 2ZFDA 1SK6D 1QX5B 2ZN9A 2EC6C 3CGAA 3I5HC 2O5GA 2F2OA 3HCMA 1T14A 1SCVA 1J1EA 3PFVA 4NDDA 5HLOA 2MJWB 1W9ZA 1LVCD 2KLDA 4QJ5B 2L2CA 4YI9A 1KFXL 1AHRA 3VRQA 3LCPC 4FQOA 1DELA 1SR6C 1ORGA 5I8NA 1WLMA 2LM5A 3JVTC 1XFZO 3EKHA 1DTLA 3I5GB 2K2FA 1K9PA 2ZN8A 3F45A 1BT6A 1F4QA 3TDIA 3NHIA 2HF5A 4ORBB 1KFUL 2CNPA 1NX0A 1TNPA 2EGDA 2KQYA 3TS5C 2MRDA 2SCPA 3AAKA 1C3YA 1UHKA 3DF0B 1DJGA 2JNXA 4NQGA 3RLZA 2FOTA 3CDNA 4GGFA 1A4PA 1NCZA 3PSRA 1V1FA 3AKAA 3ICBA 1BF5A 1G4YR 3B86A 2BKIB 4ZCUA 4INXA 2H8VA 1F71A 2LMUA 1DJYA 3IQOA 1J7OA 2KLEA 2O60A 1S1EA 2FJYA 1GQMA 2M0RA 2WCHA 4PCWA 2LHIA 1XFWO 3S0GA 1KQMC 1DT7B 2NZ0A 4P5OE 1OMVA 1QLSA 1OSAA 1JWDA 1YUUA 1RROA 4CFQA 1J55A 1QTXA 3BFHA 1KWOB 1PALA 2KSPA 1AVSA 2M7NA 3WHUB 4N5XA 4I5NB 1PSRA 3TUYB 1WDCB 3D75A 1L7ZA 2LVJA 1BOCA 1G33A 3PN7B 2Y4QA 1F70A 1KK7Z 1L2OC 1SRAA 1TN4A 1ZACA 1PVBA 2LC5A 2LCPA 1G8IA 2A4JA 1M39A 4JQ0D 2PYQA 4WRIA 3SS5A 3V2LA 2FCEA 2M9GA 2F33A 3DZTA 5F6TA 2F3ZA 1QV0A 1S36A 1ZFSA 3GK4X 1PK0D 1NIWA 3OHMB 1DVIA 3BQ3A 2KAXA 1DJWA 3N7HA 1EG3A 2ZKMX 1OMDA 2JQ6A 2LLTA 3K1EA 5KTYA 4MN0A 2L0PA 1P28A 2WORA 2MHHA 3EK4A 4OCIA 1QIWA 2MAZA 5HYDA 2KYFA 3OBVA 1ZMZA 2F2PA 5CSNA 2Y1NA 1SNLA 4M2OA 1TTXA 3L4AA 4YRUA 3DD4A 3SIBA 3BXKA 3KF9A 3BUXB 2FCDA 5CPVA 3VGOA 3O6BA 1IH0A 1Z2CB 3S0EA 2TN4A 4XJKA 2ZNDA 3EVUA 3OX5A 2LVVA 4PHNA 1MHOA 3PM8A 1C7VA 1Q80A 2KGRA 1UHIA 1X02A 4DUQA 2PALA 2K8MB 1RECA 1RK9A 4CLNA 4ORCB 1OMRA 2H2KA 3SIAA 2LAPA 2PVBA 4C0JA 2IS9A 2B1UA 1PULA 1VRKA 1NX3A 3JTDB 2WCKA 1M31A 1DF0B 1NX2A 3CYZA 3OB1B 1BR1B 5DKQA 5I2QA 3R72A 2DOQA 3LLEA 2D8NA 1KFUS 1NX1A 1SKTA 3I5FB 1A75A 5AANA 2AAOA 2LHLA 2ZNEA 1AP4A 1AJ5A 1MXEA 3WHTB 3MSEB 5AEQA 3KO0A 3FS7A 5I2OA 3AAJA 1UP5A 2F3YA 1BG1A 1QVIZ 4N1FA 1FPWA 2JXLA 1B1GA 1EXRA 5D7FA 3CZ1A 5FYXA 1A2XA 3IVTA 2LP2A 4ETOA 1TNXA 3CR5X 3R1OA 4I5JA 1YVLA 4PHJA 2ZRTA 1U5IA 2LUCA 1BODA 2I7AA 4OZDA 2L4HA 5DICA 1MWNA 1TNQA 1XFUO 1C7WA 2K0JA 1IGVA 1Y0VH 4KYNA 2JWWA 1QVIY 1WY9A 3BUOB 2KI4C 4CIDA 2SASA 2M8UA 1YR5A 1TUJA 2CBLA 1YVHA 3NSIA 1CLMA 1GGWA 1CFDA 4IJ7A 1V1GA 3PLFB 5I2LA 5AFPA 1LXFC 2LUXA 3D74A 3TS5B 1B4CA 1K2HA 1EJ3A 1HQVA 4A4CA 1RTP1 3SG6A 4F0ZB 4C0KA 1NWDA 5CSJA 1OOGA 3LK1A 2RGIA 4HSZA 1ALWA 2WCBA 5FI2A 1F8HA 4YI8A 1MQ1A 2M49B 4TNCA 4CPVA 1J1DA 4MEWA 1K90D 2QACA 4YGDB 1MUXA 4PHMA 4E68A 4PE4A 2E6WA 1KQMB 4UPGA 2L51A 1A75B 2VRGA 3NGVA 3NSOA 3R1VA 5DKNA 3S0DA 3SS4A 1XFXO 1LINA 1MXLC 2KNEA 2LE9B 3GK1A 4HRGA 1CDNA 2NXQA 3CZ2A 2HETA 2G9BA 5D3OA 4L9MA 3IQQA 5FI6A 4BY5A 1DGVA 2BL0C 2K7CA 1SW8A 3NSLA 5AERA 2V53A 1L2OB 1TIZA 1CFFA 1H4BA 4MRYA 2BNXA 2LP3A 1IIOA 1OOJA 3CR4X 4JWQA 4JKTA 3EVVA 1XFRA 1KK8C 1U5IB 2I2RE 2WCEA 1OOFA 1CFCA 1CB1A 3BOWB 1AJ4A 4GGNA 1JSAA 1FI6A 1FF1A 2KFFA 1QV1A 2KFHA 1YRTB 4PT1A 2QEBA 1XYDA 1NCXA 2M29A 1FI5A 1B8CA 1C3ZA 4USLA 1A03A 2L2EA 2WC6A 3PJIA 2ERBA 2OTGB 1IQ3A 2LVKA 3TZ1A 3NXAA 2JTZA 4WQ3A 1NPQA 1J7QA 1PRWA 4IL1A 1J7PA 2WCLA 1HT9A 3KEVA 1TRFA 2CXJA 4NDCA 3OB2B 1YUTA 3B88A 1MR8A 2LVIA 1JF2A 3CZ0A 3EVRA 1GM0A 3DVMA 2BE4A 4MSPA 4AOMA 1R2UA 1CM4A 5IBWA 1LKJA 1ALVA 4GBAA 1OW4A 3VRRA 5FI7A 5BPJA 1UHJA 2NLNA 1Y1XA 2JC2A 1QLKA 1SYMA 1UHNA 1ZOTB 2PQLA 1Y1UA 3DVEA 1CKKA 4QJ3B 2ISDA 2LLSA 4MRXA 1F55A 2WCFA 3DVJA 3O4YA 4JPZB 4GPLB 1SSEB 2L98A 1A29A 3BFAA 1FW4A 3RZSA 3WXAA 5D69A 2BCXA 3OX6A 1SMGA 4YGBB 2YGUA 2MLEC 1QJTA 3O2PA 4PHKA 5HLVA 5KU1A 1DQEA 2KHNA 2GV5A 5GQQC 1QASA 3TUYC 1KCYA 1F4OA 1K8UA 3WNXB 1CTRA 1W7IB 1YX7A 1Y1AA 1IKUA 4M2QA 5ER5A 1QX7A 3UNWA 4A4BA 3EKJA 3GK2A 4HREE 2K7DA 4YGEB 1TUZA 2BKHB 3SG2A 1K9KA 1S6JA 4GFTA 2OS8C 2Q91A 5JOLA 4MLWA 2PRUA 3PALA 4PE0A 1N0YA 1E8AA 1BR4B 2BECA 3B6XA 4PE7A 2FJUB 3BUNB 2KI4B 1ZUZA 2KGBC 3RM1A 2CTNA 4FTGA 5I94A 2EC6B 1B47A 1Z4HA 3I5HB 4M2PA 2M1KB 3CZTX 1XFYO 3B87A 1RWYA 1SL7A 4ICBA 5DKRA 1SCMC 2F8PA 4YGAA 5AXIA 1OQPA 4XYNA 5HL1A 1OZOA 1S6IA 1WLZA 3S0AA 2K7OA 2KPHA 3CTNA 1RJVA 4INWA 2HQ8A 2JULA 3UO9A 5HKYA 1SR6B 3D78A 1CLLA 3ZWHA 5B8IB 2JOJA 1SY9A 3JVTB 4I5LB 3SG5A 2LV7A 4DIRA 1S26D 3A8RA 1LS8A 1XA5A 2NCPA 3DF0A 1NYAA 2K60A 3CWGA 3EK8A 5PALA 2H61C 3E3RA 1TNWA 4XJKB 1B7TZ 1DJHA 1LA3A 1JBAA 1D1OA 1KSOA 2R2IA 3DXLA 1M45A 3KPXA 4MVFA 1DMOA 3JTDC 1W7JB 2WC8A 3M0WA 1OE9B 3S0BA 1CLBA 2KAVA 3PATA 1M46A 3I5FC 2CT9A 2P70A 4CFRA 1FBVA 3K21A 2MBXA 3I5IC 3SG3A 2CCMA 4AQIA 1QIVA 3QMEA 1B7TY 2MA2A 3EK7A 2LMTA 1KK8B 3DVKA 1N65A 1PSBA 1XO5A 2JRFA 4MBEA 3FWBA 4NDBA 4YGCB 3SJSA 1AK8A 2JU0A 1TCOB 2MLFC 2M1UA 5ER4X 2PASA 4BY4A 3C1VA 1CDPA 2COLB 4OKHA 1XFVO 1YRUB 1GGZA 3BFBA 5EL2A 1B8RA 2KDHA 1JUOA 1SBJA 3LL8B 1SPYA 3FE6A 2GGZA 2QDIA 4OV2A 1AUIB 1UURA 2PSRA 3D10A 1OZSA 2AMIA 1K93D 2L50A 2OPOA 4MZLA 4OR9B 1CFPA 1CM1A 1UWOA 1WRZA 2P71A 2WCJA 4ORAB 3D73A 4WQ2A 2K2AA 4YBHB 3SG7A 5TNCA 1EH2A 1EG4A 1JFJA 1TOPA 1LA0A 4PDZA 1C07A 5J3XA 4DS7A 1J7RA 3VROA 1IG5A
chains in the Genus database with same CATH topology
5K89A 1XK4C 3D0YA 1CMGA 1YX8A 3TDUA 4GNKB 2KQ6A 2LANA 3VRNA 4DRWA 4QJ4B 1S5GZ 1CDLA 2GGMA 1IJ5A 1M63B 2EHBA 4P2YB 4AQJA 2L5XB 1NCYA 2P6BB 3I5GC 1QX2A 2QPTA 2H61A 3OP0A 1SL8A 3QRXA 2HQWA 2Y5IA 1RFJA 1BJFA 3VRPA 4HRHA 1F54A 1SL9A 1MF8B 1S5GY 3TDZA 1DF0A 1IJ6A 1IQ5A 2LLUA 3H4SE 3KHEA 1JFKA 2G2BA 2Y1MA 3HX4A 1DJXA 2JT0A 3AKBA 4Q04A 2K7BA 4D1EA 1S3PA 2KI6D 3BUMB 1BLQA 1Y6WA 3CR2A 1CMFA 2I94A 2KYCA 5HKZA 5KSZA 2JPTA 1N2DA 2JT3A 2L4IA 1NUBA 2OS8B 1BU3A 2LMVA 2Q4UA 1JC2A 1KWOC 4MZKA 2KFGA 2ZRSA 1DJZA 1ODBA 2BCBA 1BMOA 1KK7Y 1YTZC 1XVJA 3GOFA 1NP8A 2BBMA 1CNPA 2NCOA 1K94A 2PMYA 1WDCC 3PN7C 2BCAA 3D0YB 1QXPA 2OTGC 1K9UA 3BYAA 2HPSA 1SCMB 1QATA 3LK0A 4DCKA 1NSHA 2JZIA 2BBNA 3NSKA 4OVNF 4N1GA 1XK4A 2KAYA 2I18A 2M97A 2LNKA 3FWCA 1YUSA 4ZCVA 2BE6A 1TCFA 2KBIA 1KFXS 2E30A 1CDMA 1YURA 1IRJA 2JNFA 2K61A 4R1EA 1IWQA 5CSFA 1K95A 1WRKA 2JXCA 3O78A 3SG4A 1PVAA 1B8LA 1S6CA 3CS1A 4I5KA 3A4UB 3CLNA 5JJGA 3IF7A 2WOSA 2KOTA 4GUKA 5CSIA 2JTTA 1R6PA 4GGFC 3I5IB 1DJIA 1QS7A 1H8BA 2M7LA 1KSMA 2KI6C 3BUWB 1DGUA 4MZJA 4PALA 1EL4A 2M3WA 1KQVA 2KBMA 1JF0A 4GAOA 4PE1A 1UUSA 1K96A 5HKWA 1UHHA 4C0LA 4U8DA 2JT8A 2BL0B 1GJYA 2WNDA 5G08A 1B9AA 3FIAA 3ZNIA 3BOWA 2AUCA 1WRLA 2ZFDA 1SK6D 1QX5B 2ZN9A 2EC6C 3CGAA 3I5HC 2O5GA 2F2OA 3HCMA 1SCVA 1J1EA 3PFVA 4NDDA 5HLOA 2MJWB 1LVCD 4QJ5B 4YI9A 1KFXL 1AHRA 3VRQA 3LCPC 4FQOA 1SR6C 5I8NA 1WLMA 2LM5A 3JVTC 1XFZO 3EKHA 1DTLA 3I5GB 2K2FA 1K9PA 2ZN8A 3F45A 1BT6A 1F4QA 3TDIA 2HF5A 4ORBB 1KFUL 2CNPA 1NX0A 1TNPA 2EGDA 2KQYA 3TS5C 2MRDA 2SCPA 3AAKA 1UHKA 3DF0B 1DJGA 2JNXA 4NQGA 3RLZA 2FOTA 4GGFA 1A4PA 1NCZA 3PSRA 1V1FA 3AKAA 3ICBA 1BF5A 1G4YR 2BKIB 4ZCUA 1F71A 2LMUA 1DJYA 3IQOA 1J7OA 2O60A 1FI6A 1S1EA 2M0RA 1GQMA 4PCWA 2LHIA 1XFWO 1KQMC 1DT7B 2NZ0A 4P5OE 1OMVA 1QLSA 1OSAA 1JWDA 1YUUA 1RROA 4CFQA 1J55A 1QTXA 1KWOB 1PALA 2KSPA 1AVSA 2M7NA 3WHUB 4N5XA 4I5NB 1PSRA 3TUYB 1WDCB 1L7ZA 2LVJA 1BOCA 1G33A 3PN7B 2Y4QA 1F70A 1KK7Z 1L2OC 1SRAA 1TN4A 1ZACA 1PVBA 2LC5A 2LCPA 1G8IA 2A4JA 1M39A 4JQ0D 4WRIA 2FCEA 2M9GA 2F33A 5F6TA 2F3ZA 1QV0A 1S36A 1ZFSA 3GK4X 1PK0D 1NIWA 3OHMB 1DVIA 3BQ3A 2KAXA 1DJWA 1EG3A 2ZKMX 1OMDA 2JQ6A 2LLTA 5KTYA 4MN0A 2L0PA 2WORA 2MHHA 3EK4A 4OCIA 1QIWA 2MAZA 5HYDA 2KYFA 1ZMZA 2F2PA 5CSNA 2Y1NA 1SNLA 4M2OA 1TTXA 4YRUA 3DD4A 3SIBA 3BXKA 3KF9A 3BUXB 2FCDA 5CPVA 3VGOA 3O6BA 1IH0A 2TN4A 4XJKA 2ZNDA 3EVUA 3OX5A 2LVVA 4PHNA 1MHOA 3PM8A 1C7VA 1Q80A 2KGRA 1UHIA 1X02A 4DUQA 2PALA 2K8MB 1RECA 1RK9A 4CLNA 4ORCB 1OMRA 2H2KA 3SIAA 2LAPA 2PVBA 4C0JA 2IS9A 2B1UA 1PULA 1VRKA 1NX3A 3JTDB 1M31A 1DF0B 1NX2A 3OB1B 1BR1B 5DKQA 5I2QA 2DOQA 3LLEA 2D8NA 1KFUS 1NX1A 1SKTA 3I5FB 1A75A 5AANA 2AAOA 2LHLA 2ZNEA 1AP4A 1AJ5A 1MXEA 3WHTB 3MSEB 5AEQA 3KO0A 3FS7A 5I2OA 3AAJA 1UP5A 2F3YA 1BG1A 1QVIZ 4N1FA 1FPWA 2JXLA 1B1GA 1EXRA 5D7FA 5FYXA 1A2XA 2LP2A 4ETOA 1TNXA 3CR5X 4I5JA 1YVLA 4PHJA 2ZRTA 1U5IA 2LUCA 1BODA 2I7AA 2L4HA 1MWNA 1TNQA 1XFUO 1C7WA 2K0JA 1IGVA 1Y0VH 2JWWA 1QVIY 1WY9A 3BUOB 2KI4C 4CIDA 2SASA 2M8UA 1YR5A 2CBLA 1YVHA 3NSIA 1CLMA 1GGWA 1CFDA 1V1GA 3PLFB 5I2LA 5AFPA 1LXFC 2LUXA 3TS5B 1B4CA 1K2HA 1EJ3A 1HQVA 4A4CA 1RTP1 3SG6A 4F0ZB 4C0KA 1NWDA 5CSJA 3LK1A 2RGIA 4HSZA 1ALWA 2WCBA 1F8HA 4YI8A 1MQ1A 2M49B 4TNCA 4CPVA 1J1DA 4MEWA 1K90D 2QACA 4YGDB 1MUXA 4PHMA 4E68A 4PE4A 2E6WA 1KQMB 4UPGA 2L51A 1A75B 2VRGA 5DKNA 3NSOA 1XFXO 1LINA 1MXLC 2KNEA 2LE9B 3GK1A 4HRGA 1CDNA 2NXQA 2HETA 2G9BA 4L9MA 3IQQA 4BY5A 1DGVA 2BL0C 2K7CA 1SW8A 3NSLA 5AERA 2V53A 1L2OB 1TIZA 1CFFA 1H4BA 4MRYA 2LP3A 1OOJA 3CR4X 4JWQA 3EVVA 1KK8C 1U5IB 2I2RE 2WCEA 1CFCA 1CB1A 3BOWB 1AJ4A 4GGNA 1JSAA 1FF1A 2KFFA 1QV1A 2KFHA 1YRTB 1XYDA 1NCXA 2M29A 1FI5A 1B8CA 4USLA 1A03A 2L2EA 1IQ3A 2OTGB 2LVKA 3TZ1A 3NXAA 2JTZA 4WQ3A 1NPQA 1J7QA 1PRWA 4IL1A 1J7PA 1HT9A 3KEVA 1TRFA 2CXJA 4NDCA 3OB2B 1YUTA 1MR8A 2LVIA 1JF2A 3EVRA 3DVMA 2BE4A 4MSPA 4AOMA 1R2UA 1CM4A 5IBWA 1LKJA 1ALVA 4GBAA 3VRRA 5BPJA 1UHJA 2NLNA 1Y1XA 2JC2A 1QLKA 1SYMA 1UHNA 1ZOTB 1CKKA 1Y1UA 3DVEA 4QJ3B 2ISDA 2LLSA 4MRXA 1F55A 2WCFA 3DVJA 3O4YA 4JPZB 4GPLB 2L98A 1A29A 1FW4A 3WXAA 5D69A 2BCXA 3OX6A 1SMGA 4YGBB 4PHKA 2MLEC 1QJTA 3O2PA 5HLVA 5KU1A 2KHNA 2GV5A 5GQQC 1QASA 3TUYC 1KCYA 1F4OA 1K8UA 3WNXB 1CTRA 1W7IB 1YX7A 1Y1AA 1IKUA 4M2QA 5ER5A 1QX7A 4A4BA 3EKJA 3GK2A 4HREE 2K7DA 4YGEB 2BKHB 3SG2A 1K9KA 1S6JA 4GFTA 2OS8C 2Q91A 5JOLA 4MLWA 2PRUA 3PALA 4PE0A 1N0YA 1E8AA 1BR4B 2BECA 4PE7A 2FJUB 3BUNB 2KI4B 1ZUZA 2KGBC 3RM1A 2CTNA 4FTGA 2EC6B 1B47A 3I5HB 4M2PA 2M1KB 3CZTX 1XFYO 1RWYA 1SL7A 4ICBA 5DKRA 1SCMC 2F8PA 4YGAA 5AXIA 1OQPA 4XYNA 1OZOA 1S6IA 1WLZA 2K7OA 3CTNA 1RJVA 5HKYA 2HQ8A 2JULA 1SR6B 1CLLA 3ZWHA 5B8IB 2JOJA 1SY9A 3JVTB 4I5LB 3SG5A 2LV7A 4DIRA 1S26D 3A8RA 1XA5A 2NCPA 3DF0A 1NYAA 3CWGA 3EK8A 5PALA 2H61C 3E3RA 1TNWA 4XJKB 1B7TZ 1DJHA 1LA3A 1JBAA 1D1OA 1KSOA 2R2IA 1M45A 3KPXA 4MVFA 1DMOA 3JTDC 1W7JB 2WC8A 3M0WA 1OE9B 1CLBA 2KAVA 3PATA 1M46A 3I5FC 2CT9A 4CFRA 1FBVA 3K21A 2MBXA 3I5IC 3SG3A 2CCMA 4AQIA 1QIVA 1B7TY 2MA2A 3EK7A 2LMTA 1KK8B 3DVKA 1N65A 1PSBA 1XO5A 2JRFA 4MBEA 3FWBA 4NDBA 4YGCB 3SJSA 1AK8A 2JU0A 1TCOB 2MLFC 2M1UA 5ER4X 2PASA 4BY4A 3C1VA 1CDPA 2COLB 4OKHA 1XFVO 1YRUB 1GGZA 1B8RA 2KDHA 1JUOA 1SBJA 3LL8B 1SPYA 2GGZA 4OV2A 1AUIB 1UURA 2PSRA 3D10A 1OZSA 2AMIA 1K93D 2L50A 2OPOA 4MZLA 4OR9B 1CFPA 1CM1A 1UWOA 1WRZA 4ORAB 4WQ2A 4YBHB 2K2AA 3SG7A 1EH2A 5TNCA 1JFJA 1EG4A 1TOPA 1LA0A 4PDZA 1C07A 5J3XA 4DS7A 1J7RA 3VROA 1IG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K89 A;  1XK4 C;  3D0Y A;  1CMG A;  1YX8 A;  3TDU A;  4GNK B;  2KQ6 A;  2LAN A;  3VRN A;  4DRW A;  4QJ4 B;  1S5G Z;  1CDL A;  2GGM A;  1IJ5 A;  1M63 B;  2EHB A;  4P2Y B;  4AQJ A;  2L5X B;  1NCY A;  2P6B B;  3I5G C;  1QX2 A;  2QPT A;  2H61 A;  3OP0 A;  1SL8 A;  3QRX A;  2HQW A;  2Y5I A;  1RFJ A;  1BJF A;  3VRP A;  4HRH A;  1F54 A;  1SL9 A;  1MF8 B;  1S5G Y;  3TDZ A;  1DF0 A;  1IJ6 A;  1IQ5 A;  2LLU A;  3H4S E;  3KHE A;  1JFK A;  2G2B A;  2Y1M A;  3HX4 A;  1DJX A;  2JT0 A;  3AKB A;  4Q04 A;  2K7B A;  4D1E A;  1S3P A;  2KI6 D;  3BUM B;  1BLQ A;  1Y6W A;  3CR2 A;  1CMF A;  2I94 A;  2KYC A;  5HKZ A;  5KSZ A;  2JPT A;  1N2D A;  2JT3 A;  2L4I A;  1NUB A;  2OS8 B;  1BU3 A;  2LMV A;  2Q4U A;  1JC2 A;  1KWO C;  4MZK A;  2KFG A;  2ZRS A;  1DJZ A;  1ODB A;  2BCB A;  1BMO A;  1KK7 Y;  1YTZ C;  1XVJ A;  3GOF A;  1NP8 A;  2BBM A;  1CNP A;  2NCO A;  1K94 A;  2PMY A;  1WDC C;  3PN7 C;  2BCA A;  3D0Y B;  1QXP A;  2OTG C;  1K9U A;  3BYA A;  2HPS A;  1SCM B;  1QAT A;  3LK0 A;  4DCK A;  1NSH A;  2JZI A;  2BBN A;  3NSK A;  4OVN F;  4N1G A;  1XK4 A;  2KAY A;  2I18 A;  2M97 A;  2LNK A;  3FWC A;  1YUS A;  4ZCV A;  2BE6 A;  1TCF A;  2KBI A;  1KFX S;  2E30 A;  1CDM A;  1YUR A;  1IRJ A;  2JNF A;  2K61 A;  4R1E A;  1IWQ A;  5CSF A;  1K95 A;  1WRK A;  2JXC A;  3O78 A;  3SG4 A;  1PVA A;  1B8L A;  1S6C A;  3CS1 A;  4I5K A;  3A4U B;  3CLN A;  5JJG A;  3IF7 A;  2WOS A;  2KOT A;  4GUK A;  5CSI A;  2JTT A;  1R6P A;  4GGF C;  3I5I B;  1DJI A;  1QS7 A;  1H8B A;  2M7L A;  1KSM A;  2KI6 C;  3BUW B;  1DGU A;  4MZJ A;  4PAL A;  1EL4 A;  2M3W A;  1KQV A;  2KBM A;  1JF0 A;  4GAO A;  4PE1 A;  1UUS A;  1K96 A;  5HKW A;  1UHH A;  4C0L A;  4U8D A;  2JT8 A;  2BL0 B;  1GJY A;  2WND A;  5G08 A;  1B9A A;  3FIA A;  3ZNI A;  3BOW A;  2AUC A;  1WRL A;  2ZFD A;  1SK6 D;  1QX5 B;  2ZN9 A;  2EC6 C;  3CGA A;  3I5H C;  2O5G A;  2F2O A;  3HCM A;  1SCV A;  1J1E A;  3PFV A;  4NDD A;  5HLO A;  2MJW B;  1LVC D;  4QJ5 B;  4YI9 A;  1KFX L;  1AHR A;  3VRQ A;  3LCP C;  4FQO A;  1SR6 C;  5I8N A;  1WLM A;  2LM5 A;  3JVT C;  1XFZ O;  3EKH A;  1DTL A;  3I5G B;  2K2F A;  1K9P A;  2ZN8 A;  3F45 A;  1BT6 A;  1F4Q A;  3TDI A;  2HF5 A;  4ORB B;  1KFU L;  2CNP A;  1NX0 A;  1TNP A;  2EGD A;  2KQY A;  3TS5 C;  2MRD A;  2SCP A;  3AAK A;  1UHK A;  3DF0 B;  1DJG A;  2JNX A;  4NQG A;  3RLZ A;  2FOT A;  4GGF A;  1A4P A;  1NCZ A;  3PSR A;  1V1F A;  3AKA A;  3ICB A;  1BF5 A;  1G4Y R;  2BKI B;  4ZCU A;  1F71 A;  2LMU A;  1DJY A;  3IQO A;  1J7O A;  2O60 A;  1FI6 A;  1S1E A;  2M0R A;  1GQM A;  4PCW A;  2LHI A;  1XFW O;  1KQM C;  1DT7 B;  2NZ0 A;  4P5O E;  1OMV A;  1QLS A;  1OSA A;  1JWD A;  1YUU A;  1RRO A;  4CFQ A;  1J55 A;  1QTX A;  1KWO B;  1PAL A;  2KSP A;  1AVS A;  2M7N A;  3WHU B;  4N5X A;  4I5N B;  1PSR A;  3TUY B;  1WDC B;  1L7Z A;  2LVJ A;  1BOC A;  1G33 A;  3PN7 B;  2Y4Q A;  1F70 A;  1KK7 Z;  1L2O C;  1SRA A;  1TN4 A;  1ZAC A;  1PVB A;  2LC5 A;  2LCP A;  1G8I A;  2A4J A;  1M39 A;  4JQ0 D;  4WRI A;  2FCE A;  2M9G A;  2F33 A;  5F6T A;  2F3Z A;  1QV0 A;  1S36 A;  1ZFS A;  3GK4 X;  1PK0 D;  1NIW A;  3OHM B;  1DVI A;  3BQ3 A;  2KAX A;  1DJW A;  1EG3 A;  2ZKM X;  1OMD A;  2JQ6 A;  2LLT A;  5KTY A;  4MN0 A;  2L0P A;  2WOR A;  2MHH A;  3EK4 A;  4OCI A;  1QIW A;  2MAZ A;  5HYD A;  2KYF A;  1ZMZ A;  2F2P A;  5CSN A;  2Y1N A;  1SNL A;  4M2O A;  1TTX A;  4YRU A;  3DD4 A;  3SIB A;  3BXK A;  3KF9 A;  3BUX B;  2FCD A;  5CPV A;  3VGO A;  3O6B A;  1IH0 A;  2TN4 A;  4XJK A;  2ZND A;  3EVU A;  3OX5 A;  2LVV A;  4PHN A;  1MHO A;  3PM8 A;  1C7V A;  1Q80 A;  2KGR A;  1UHI A;  1X02 A;  4DUQ A;  2PAL A;  2K8M B;  1REC A;  1RK9 A;  4CLN A;  4ORC B;  1OMR A;  2H2K A;  3SIA A;  2LAP A;  2PVB A;  4C0J A;  2IS9 A;  2B1U A;  1PUL A;  1VRK A;  1NX3 A;  3JTD B;  1M31 A;  1DF0 B;  1NX2 A;  3OB1 B;  1BR1 B;  5DKQ A;  5I2Q A;  2DOQ A;  3LLE A;  2D8N A;  1KFU S;  1NX1 A;  1SKT A;  3I5F B;  1A75 A;  5AAN A;  2AAO A;  2LHL A;  2ZNE A;  1AP4 A;  1AJ5 A;  1MXE A;  3WHT B;  3MSE B;  5AEQ A;  3KO0 A;  3FS7 A;  5I2O A;  3AAJ A;  1UP5 A;  2F3Y A;  1BG1 A;  1QVI Z;  4N1F A;  1FPW A;  2JXL A;  1B1G A;  1EXR A;  5D7F A;  5FYX A;  1A2X A;  2LP2 A;  4ETO A;  1TNX A;  3CR5 X;  4I5J A;  1YVL A;  4PHJ A;  2ZRT A;  1U5I A;  2LUC A;  1BOD A;  2I7A A;  2L4H A;  1MWN A;  1TNQ A;  1XFU O;  1C7W A;  2K0J A;  1IGV A;  1Y0V H;  2JWW A;  1QVI Y;  1WY9 A;  3BUO B;  2KI4 C;  4CID A;  2SAS A;  2M8U A;  1YR5 A;  2CBL A;  1YVH A;  3NSI A;  1CLM A;  1GGW A;  1CFD A;  1V1G A;  3PLF B;  5I2L A;  5AFP A;  1LXF C;  2LUX A;  3TS5 B;  1B4C A;  1K2H A;  1EJ3 A;  1HQV A;  4A4C A;  1RTP 1;  3SG6 A;  4F0Z B;  4C0K A;  1NWD A;  5CSJ A;  3LK1 A;  2RGI A;  4HSZ A;  1ALW A;  2WCB A;  1F8H A;  4YI8 A;  1MQ1 A;  2M49 B;  4TNC A;  4CPV A;  1J1D A;  4MEW A;  1K90 D;  2QAC A;  4YGD B;  1MUX A;  4PHM A;  4E68 A;  4PE4 A;  2E6W A;  1KQM B;  4UPG A;  2L51 A;  1A75 B;  2VRG A;  5DKN A;  3NSO A;  1XFX O;  1LIN A;  1MXL C;  2KNE A;  2LE9 B;  3GK1 A;  4HRG A;  1CDN A;  2NXQ A;  2HET A;  2G9B A;  4L9M A;  3IQQ A;  4BY5 A;  1DGV A;  2BL0 C;  2K7C A;  1SW8 A;  3NSL A;  5AER A;  2V53 A;  1L2O B;  1TIZ A;  1CFF A;  1H4B A;  4MRY A;  2LP3 A;  1OOJ A;  3CR4 X;  4JWQ A;  3EVV A;  1KK8 C;  1U5I B;  2I2R E;  2WCE A;  1CFC A;  1CB1 A;  3BOW B;  1AJ4 A;  4GGN A;  1JSA A;  1FF1 A;  2KFF A;  1QV1 A;  2KFH A;  1YRT B;  1XYD A;  1NCX A;  2M29 A;  1FI5 A;  1B8C A;  4USL A;  1A03 A;  2L2E A;  1IQ3 A;  2OTG B;  2LVK A;  3TZ1 A;  3NXA A;  2JTZ A;  4WQ3 A;  1NPQ A;  1J7Q A;  1PRW A;  4IL1 A;  1J7P A;  1HT9 A;  3KEV A;  1TRF A;  2CXJ A;  4NDC A;  3OB2 B;  1YUT A;  1MR8 A;  2LVI A;  1JF2 A;  3EVR A;  3DVM A;  2BE4 A;  4MSP A;  4AOM A;  1R2U A;  1CM4 A;  5IBW A;  1LKJ A;  1ALV A;  4GBA A;  3VRR A;  5BPJ A;  1UHJ A;  2NLN A;  1Y1X A;  2JC2 A;  1QLK A;  1SYM A;  1UHN A;  1ZOT B;  1CKK A;  1Y1U A;  3DVE A;  4QJ3 B;  2ISD A;  2LLS A;  4MRX A;  1F55 A;  2WCF A;  3DVJ A;  3O4Y A;  4JPZ B;  4GPL B;  2L98 A;  1A29 A;  1FW4 A;  3WXA A;  5D69 A;  2BCX A;  3OX6 A;  1SMG A;  4YGB B;  4PHK A;  2MLE C;  1QJT A;  3O2P A;  5HLV A;  5KU1 A;  2KHN A;  2GV5 A;  5GQQ C;  1QAS A;  3TUY C;  1KCY A;  1F4O A;  1K8U A;  3WNX B;  1CTR A;  1W7I B;  1YX7 A;  1Y1A A;  1IKU A;  4M2Q A;  5ER5 A;  1QX7 A;  4A4B A;  3EKJ A;  3GK2 A;  4HRE E;  2K7D A;  4YGE B;  2BKH B;  3SG2 A;  1K9K A;  1S6J A;  4GFT A;  2OS8 C;  2Q91 A;  5JOL A;  4MLW A;  2PRU A;  3PAL A;  4PE0 A;  1N0Y A;  1E8A A;  1BR4 B;  2BEC A;  4PE7 A;  2FJU B;  3BUN B;  2KI4 B;  1ZUZ A;  2KGB C;  3RM1 A;  2CTN A;  4FTG A;  2EC6 B;  1B47 A;  3I5H B;  4M2P A;  2M1K B;  3CZT X;  1XFY O;  1RWY A;  1SL7 A;  4ICB A;  5DKR A;  1SCM C;  2F8P A;  4YGA A;  5AXI A;  1OQP A;  4XYN A;  1OZO A;  1S6I A;  1WLZ A;  2K7O A;  3CTN A;  1RJV A;  5HKY A;  2HQ8 A;  2JUL A;  1SR6 B;  1CLL A;  3ZWH A;  5B8I B;  2JOJ A;  1SY9 A;  3JVT B;  4I5L B;  3SG5 A;  2LV7 A;  4DIR A;  1S26 D;  3A8R A;  1XA5 A;  2NCP A;  3DF0 A;  1NYA A;  3CWG A;  3EK8 A;  5PAL A;  2H61 C;  3E3R A;  1TNW A;  4XJK B;  1B7T Z;  1DJH A;  1LA3 A;  1JBA A;  1D1O A;  1KSO A;  2R2I A;  1M45 A;  3KPX A;  4MVF A;  1DMO A;  3JTD C;  1W7J B;  2WC8 A;  3M0W A;  1OE9 B;  1CLB A;  2KAV A;  3PAT A;  1M46 A;  3I5F C;  2CT9 A;  4CFR A;  1FBV A;  3K21 A;  2MBX A;  3I5I C;  3SG3 A;  2CCM A;  4AQI A;  1QIV A;  1B7T Y;  2MA2 A;  3EK7 A;  2LMT A;  1KK8 B;  3DVK A;  1N65 A;  1PSB A;  1XO5 A;  2JRF A;  4MBE A;  3FWB A;  4NDB A;  4YGC B;  3SJS A;  1AK8 A;  2JU0 A;  1TCO B;  2MLF C;  2M1U A;  5ER4 X;  2PAS A;  4BY4 A;  3C1V A;  1CDP A;  2COL B;  4OKH A;  1XFV O;  1YRU B;  1GGZ A;  1B8R A;  2KDH A;  1JUO A;  1SBJ A;  3LL8 B;  1SPY A;  2GGZ A;  4OV2 A;  1AUI B;  1UUR A;  2PSR A;  3D10 A;  1OZS A;  2AMI A;  1K93 D;  2L50 A;  2OPO A;  4MZL A;  4OR9 B;  1CFP A;  1CM1 A;  1UWO A;  1WRZ A;  4ORA B;  4WQ2 A;  4YBH B;  2K2A A;  3SG7 A;  1EH2 A;  5TNC A;  1JFJ A;  1EG4 A;  1TOP A;  1LA0 A;  4PDZ A;  1C07 A;  5J3X A;  4DS7 A;  1J7R A;  3VRO A;  1IG5 A; 
#chains in the Genus database with same CATH topology
 5K89 A;  1XK4 C;  3D0Y A;  2QEH A;  3L47 A;  1CMG A;  1YX8 A;  3TDU A;  4GNK B;  2KQ6 A;  2LAN A;  3VRN A;  4DRW A;  4QJ4 B;  1S5G Z;  1CDL A;  2GGM A;  1IJ5 A;  1M63 B;  3D76 A;  2EHB A;  2JPO A;  4P2Y B;  4AQJ A;  3R1P A;  2L5X B;  1NCY A;  2WCM A;  1QWV A;  3DY9 A;  2P6B B;  3I5G C;  1QX2 A;  2QPT A;  2H61 A;  3OP0 A;  1SL8 A;  3OGN A;  3QRX A;  2HQW A;  2QEV A;  2Y5I A;  2WC5 A;  1RFJ A;  1BJF A;  3VRP A;  4HRH A;  1F54 A;  1SL9 A;  1MF8 B;  1S5G Y;  3TDZ A;  1OOI X;  1DF0 A;  1IJ6 A;  1IQ5 A;  2LLU A;  3H4S E;  3KHE A;  1JFK A;  2G2B A;  2Y1M A;  3PM2 A;  3Q8I A;  3HX4 A;  1DJX A;  2JT0 A;  3AKB A;  4Q04 A;  2K7B A;  4D1E A;  1S3P A;  2KI6 D;  3BUM B;  1BLQ A;  1Y6W A;  3CR2 A;  1CMF A;  2I94 A;  3L4L A;  2KYC A;  5HKZ A;  5KSZ A;  2JPT A;  1N2D A;  2JT3 A;  2L4I A;  1NUB A;  1DC1 A;  3D77 A;  2OS8 B;  3CAB A;  1BU3 A;  2LMV A;  2Q4U A;  1JC2 A;  1KWO C;  4MZK A;  2KFG A;  1TWO A;  2ZRS A;  1DJZ A;  1ODB A;  1YTZ C;  1BMO A;  1KK7 Y;  1XVJ A;  2BCB A;  3GOF A;  1NP8 A;  2BBM A;  1CNP A;  2NCO A;  1K94 A;  2PMY A;  1WDC C;  3BJH A;  3PN7 C;  2BCA A;  3D0Y B;  1QXP A;  2OTG C;  1K9U A;  3BYA A;  2HPS A;  1SCM B;  1QAT A;  3LK0 A;  4DCK A;  3FE8 A;  1NSH A;  2JZI A;  2BBN A;  3NSK A;  4OVN F;  4N1G A;  1XK4 A;  2KAY A;  2I18 A;  2M97 A;  2BAP A;  2LNK A;  1YUS A;  3DYE A;  2BE6 A;  3FWC A;  1TCF A;  4ZCV A;  2KBI A;  1KFX S;  2E30 A;  1CDM A;  1YUR A;  1IRJ A;  2JNF A;  3VB1 A;  3S0F A;  2K61 A;  4R1E A;  1IWQ A;  5CSF A;  3B7A A;  1K95 A;  4F7F A;  1WRK A;  2JXC A;  3O78 A;  3SG4 A;  3NHT A;  1PVA A;  1DEK A;  1B8L A;  1S6C A;  3CS1 A;  4I5K A;  3A4U B;  3CLN A;  4FQT A;  5JJG A;  3IF7 A;  2WOS A;  2KOT A;  3FE9 A;  4GUK A;  5CSI A;  2JTT A;  3EG5 B;  1R6P A;  4GGF C;  3I5I B;  1DJI A;  1QS7 A;  1H8B A;  2M7L A;  1KSM A;  2KI6 C;  3BUW B;  1DGU A;  4MZJ A;  4JD9 A;  4PAL A;  1EL4 A;  2M3W A;  1KQV A;  1OOH A;  2KBM A;  1JF0 A;  3O4X A;  4GAO A;  1UUS A;  4PE1 A;  2L5Y A;  1K96 A;  5HKW A;  1UHH A;  4C0L A;  4U8D A;  2JT8 A;  2BL0 B;  1GJY A;  2WND A;  2GTE A;  1B9A A;  5G08 A;  3SS3 A;  3FIA A;  3ZNI A;  3BOW A;  2AUC A;  1WRL A;  2QEO A;  2ZFD A;  1SK6 D;  1QX5 B;  2ZN9 A;  2EC6 C;  3CGA A;  3I5H C;  2O5G A;  2F2O A;  3HCM A;  1T14 A;  1SCV A;  1J1E A;  3PFV A;  4NDD A;  5HLO A;  2MJW B;  1W9Z A;  1LVC D;  2KLD A;  4QJ5 B;  2L2C A;  4YI9 A;  1KFX L;  1AHR A;  3VRQ A;  3LCP C;  4FQO A;  1DEL A;  1SR6 C;  1ORG A;  5I8N A;  1WLM A;  2LM5 A;  3JVT C;  1XFZ O;  3EKH A;  1DTL A;  3I5G B;  2K2F A;  1K9P A;  2ZN8 A;  3F45 A;  1BT6 A;  1F4Q A;  3TDI A;  3NHI A;  2HF5 A;  4ORB B;  1KFU L;  2CNP A;  1NX0 A;  1TNP A;  2EGD A;  2KQY A;  3TS5 C;  2MRD A;  2SCP A;  3AAK A;  1C3Y A;  1UHK A;  3DF0 B;  1DJG A;  2JNX A;  4NQG A;  3RLZ A;  2FOT A;  3CDN A;  4GGF A;  1A4P A;  1NCZ A;  3PSR A;  1V1F A;  3AKA A;  3ICB A;  1BF5 A;  1G4Y R;  3B86 A;  2BKI B;  4ZCU A;  4INX A;  2H8V A;  1F71 A;  2LMU A;  1DJY A;  3IQO A;  1J7O A;  2KLE A;  2O60 A;  1S1E A;  2FJY A;  1GQM A;  2M0R A;  2WCH A;  4PCW A;  2LHI A;  1XFW O;  3S0G A;  1KQM C;  1DT7 B;  2NZ0 A;  4P5O E;  1OMV A;  1QLS A;  1OSA A;  1JWD A;  1YUU A;  1RRO A;  4CFQ A;  1J55 A;  1QTX A;  3BFH A;  1KWO B;  1PAL A;  2KSP A;  1AVS A;  2M7N A;  3WHU B;  4N5X A;  4I5N B;  1PSR A;  3TUY B;  1WDC B;  3D75 A;  1L7Z A;  2LVJ A;  1BOC A;  1G33 A;  3PN7 B;  2Y4Q A;  1F70 A;  1KK7 Z;  1L2O C;  1SRA A;  1TN4 A;  1ZAC A;  1PVB A;  2LC5 A;  2LCP A;  1G8I A;  2A4J A;  1M39 A;  4JQ0 D;  2PYQ A;  4WRI A;  3SS5 A;  3V2L A;  2FCE A;  2M9G A;  2F33 A;  3DZT A;  5F6T A;  2F3Z A;  1QV0 A;  1S36 A;  1ZFS A;  3GK4 X;  1PK0 D;  1NIW A;  3OHM B;  1DVI A;  3BQ3 A;  2KAX A;  1DJW A;  3N7H A;  1EG3 A;  2ZKM X;  1OMD A;  2JQ6 A;  2LLT A;  3K1E A;  5KTY A;  4MN0 A;  2L0P A;  1P28 A;  2WOR A;  2MHH A;  3EK4 A;  4OCI A;  1QIW A;  2MAZ A;  5HYD A;  2KYF A;  3OBV A;  1ZMZ A;  2F2P A;  5CSN A;  2Y1N A;  1SNL A;  4M2O A;  1TTX A;  3L4A A;  4YRU A;  3DD4 A;  3SIB A;  3BXK A;  3KF9 A;  3BUX B;  2FCD A;  5CPV A;  3VGO A;  3O6B A;  1IH0 A;  1Z2C B;  3S0E A;  2TN4 A;  4XJK A;  2ZND A;  3EVU A;  3OX5 A;  2LVV A;  4PHN A;  1MHO A;  3PM8 A;  1C7V A;  1Q80 A;  2KGR A;  1UHI A;  1X02 A;  4DUQ A;  2PAL A;  2K8M B;  1REC A;  1RK9 A;  4CLN A;  4ORC B;  1OMR A;  2H2K A;  3SIA A;  2LAP A;  2PVB A;  4C0J A;  2IS9 A;  2B1U A;  1PUL A;  1VRK A;  1NX3 A;  3JTD B;  2WCK A;  1M31 A;  1DF0 B;  1NX2 A;  3CYZ A;  3OB1 B;  1BR1 B;  5DKQ A;  5I2Q A;  3R72 A;  2DOQ A;  3LLE A;  2D8N A;  1KFU S;  1NX1 A;  1SKT A;  3I5F B;  1A75 A;  5AAN A;  2AAO A;  2LHL A;  2ZNE A;  1AP4 A;  1AJ5 A;  1MXE A;  3WHT B;  3MSE B;  5AEQ A;  3KO0 A;  3FS7 A;  5I2O A;  3AAJ A;  1UP5 A;  2F3Y A;  1BG1 A;  1QVI Z;  4N1F A;  1FPW A;  2JXL A;  1B1G A;  1EXR A;  5D7F A;  3CZ1 A;  5FYX A;  1A2X A;  3IVT A;  2LP2 A;  4ETO A;  1TNX A;  3CR5 X;  3R1O A;  4I5J A;  1YVL A;  4PHJ A;  2ZRT A;  1U5I A;  2LUC A;  1BOD A;  2I7A A;  4OZD A;  2L4H A;  5DIC A;  1MWN A;  1TNQ A;  1XFU O;  1C7W A;  2K0J A;  1IGV A;  1Y0V H;  4KYN A;  2JWW A;  1QVI Y;  1WY9 A;  3BUO B;  2KI4 C;  4CID A;  2SAS A;  2M8U A;  1YR5 A;  1TUJ A;  2CBL A;  1YVH A;  3NSI A;  1CLM A;  1GGW A;  1CFD A;  4IJ7 A;  1V1G A;  3PLF B;  5I2L A;  5AFP A;  1LXF C;  2LUX A;  3D74 A;  3TS5 B;  1B4C A;  1K2H A;  1EJ3 A;  1HQV A;  4A4C A;  1RTP 1;  3SG6 A;  4F0Z B;  4C0K A;  1NWD A;  5CSJ A;  1OOG A;  3LK1 A;  2RGI A;  4HSZ A;  1ALW A;  2WCB A;  5FI2 A;  1F8H A;  4YI8 A;  1MQ1 A;  2M49 B;  4TNC A;  4CPV A;  1J1D A;  4MEW A;  1K90 D;  2QAC A;  4YGD B;  1MUX A;  4PHM A;  4E68 A;  4PE4 A;  2E6W A;  1KQM B;  4UPG A;  2L51 A;  1A75 B;  2VRG A;  3NGV A;  3NSO A;  3R1V A;  5DKN A;  3S0D A;  3SS4 A;  1XFX O;  1LIN A;  1MXL C;  2KNE A;  2LE9 B;  3GK1 A;  4HRG A;  1CDN A;  2NXQ A;  3CZ2 A;  2HET A;  2G9B A;  5D3O A;  4L9M A;  3IQQ A;  5FI6 A;  4BY5 A;  1DGV A;  2BL0 C;  2K7C A;  1SW8 A;  3NSL A;  5AER A;  2V53 A;  1L2O B;  1TIZ A;  1CFF A;  1H4B A;  4MRY A;  2BNX A;  2LP3 A;  1IIO A;  1OOJ A;  3CR4 X;  4JWQ A;  4JKT A;  3EVV A;  1XFR A;  1KK8 C;  1U5I B;  2I2R E;  2WCE A;  1OOF A;  1CFC A;  1CB1 A;  3BOW B;  1AJ4 A;  4GGN A;  1JSA A;  1FI6 A;  1FF1 A;  2KFF A;  1QV1 A;  2KFH A;  1YRT B;  4PT1 A;  2QEB A;  1XYD A;  1NCX A;  2M29 A;  1FI5 A;  1B8C A;  1C3Z A;  4USL A;  1A03 A;  2L2E A;  2WC6 A;  3PJI A;  2ERB A;  2OTG B;  1IQ3 A;  2LVK A;  3TZ1 A;  3NXA A;  2JTZ A;  4WQ3 A;  1NPQ A;  1J7Q A;  1PRW A;  4IL1 A;  1J7P A;  2WCL A;  1HT9 A;  3KEV A;  1TRF A;  2CXJ A;  4NDC A;  3OB2 B;  1YUT A;  3B88 A;  1MR8 A;  2LVI A;  1JF2 A;  3CZ0 A;  3EVR A;  1GM0 A;  3DVM A;  2BE4 A;  4MSP A;  4AOM A;  1R2U A;  1CM4 A;  5IBW A;  1LKJ A;  1ALV A;  4GBA A;  1OW4 A;  3VRR A;  5FI7 A;  5BPJ A;  1UHJ A;  2NLN A;  1Y1X A;  2JC2 A;  1QLK A;  1SYM A;  1UHN A;  1ZOT B;  2PQL A;  1Y1U A;  3DVE A;  1CKK A;  4QJ3 B;  2ISD A;  2LLS A;  4MRX A;  1F55 A;  2WCF A;  3DVJ A;  3O4Y A;  4JPZ B;  4GPL B;  1SSE B;  2L98 A;  1A29 A;  3BFA A;  1FW4 A;  3RZS A;  3WXA A;  5D69 A;  2BCX A;  3OX6 A;  1SMG A;  4YGB B;  2YGU A;  2MLE C;  1QJT A;  3O2P A;  4PHK A;  5HLV A;  5KU1 A;  1DQE A;  2KHN A;  2GV5 A;  5GQQ C;  1QAS A;  3TUY C;  1KCY A;  1F4O A;  1K8U A;  3WNX B;  1CTR A;  1W7I B;  1YX7 A;  1Y1A A;  1IKU A;  4M2Q A;  5ER5 A;  1QX7 A;  3UNW A;  4A4B A;  3EKJ A;  3GK2 A;  4HRE E;  2K7D A;  4YGE B;  1TUZ A;  2BKH B;  3SG2 A;  1K9K A;  1S6J A;  4GFT A;  2OS8 C;  2Q91 A;  5JOL A;  4MLW A;  2PRU A;  3PAL A;  4PE0 A;  1N0Y A;  1E8A A;  1BR4 B;  2BEC A;  3B6X A;  4PE7 A;  2FJU B;  3BUN B;  2KI4 B;  1ZUZ A;  2KGB C;  3RM1 A;  2CTN A;  4FTG A;  5I94 A;  2EC6 B;  1B47 A;  1Z4H A;  3I5H B;  4M2P A;  2M1K B;  3CZT X;  1XFY O;  3B87 A;  1RWY A;  1SL7 A;  4ICB A;  5DKR A;  1SCM C;  2F8P A;  4YGA A;  5AXI A;  1OQP A;  4XYN A;  5HL1 A;  1OZO A;  1S6I A;  1WLZ A;  3S0A A;  2K7O A;  2KPH A;  3CTN A;  1RJV A;  4INW A;  2HQ8 A;  2JUL A;  3UO9 A;  5HKY A;  1SR6 B;  3D78 A;  1CLL A;  3ZWH A;  5B8I B;  2JOJ A;  1SY9 A;  3JVT B;  4I5L B;  3SG5 A;  2LV7 A;  4DIR A;  1S26 D;  3A8R A;  1LS8 A;  1XA5 A;  2NCP A;  3DF0 A;  1NYA A;  2K60 A;  3CWG A;  3EK8 A;  5PAL A;  2H61 C;  3E3R A;  1TNW A;  4XJK B;  1B7T Z;  1DJH A;  1LA3 A;  1JBA A;  1D1O A;  1KSO A;  2R2I A;  3DXL A;  1M45 A;  3KPX A;  4MVF A;  1DMO A;  3JTD C;  1W7J B;  2WC8 A;  3M0W A;  1OE9 B;  3S0B A;  1CLB A;  2KAV A;  3PAT A;  1M46 A;  3I5F C;  2CT9 A;  2P70 A;  4CFR A;  1FBV A;  3K21 A;  2MBX A;  3I5I C;  3SG3 A;  2CCM A;  4AQI A;  1QIV A;  3QME A;  1B7T Y;  2MA2 A;  3EK7 A;  2LMT A;  1KK8 B;  3DVK A;  1N65 A;  1PSB A;  1XO5 A;  2JRF A;  4MBE A;  3FWB A;  4NDB A;  4YGC B;  3SJS A;  1AK8 A;  2JU0 A;  1TCO B;  2MLF C;  2M1U A;  5ER4 X;  2PAS A;  4BY4 A;  3C1V A;  1CDP A;  2COL B;  4OKH A;  1XFV O;  1YRU B;  1GGZ A;  3BFB A;  5EL2 A;  1B8R A;  2KDH A;  1JUO A;  1SBJ A;  3LL8 B;  1SPY A;  3FE6 A;  2GGZ A;  2QDI A;  4OV2 A;  1AUI B;  1UUR A;  2PSR A;  3D10 A;  1OZS A;  2AMI A;  1K93 D;  2L50 A;  2OPO A;  4MZL A;  4OR9 B;  1CFP A;  1CM1 A;  1UWO A;  1WRZ A;  2P71 A;  2WCJ A;  4ORA B;  3D73 A;  4WQ2 A;  2K2A A;  4YBH B;  3SG7 A;  5TNC A;  1EH2 A;  1EG4 A;  1JFJ A;  1TOP A;  1LA0 A;  4PDZ A;  1C07 A;  5J3X A;  4DS7 A;  1J7R A;  3VRO A;  1IG5 A; 
#chains in the Genus database with same CATH homology
 5K89 A;  1XK4 C;  3D0Y A;  1CMG A;  1YX8 A;  3TDU A;  4GNK B;  2KQ6 A;  2LAN A;  3VRN A;  4DRW A;  4QJ4 B;  1S5G Z;  1CDL A;  2GGM A;  1IJ5 A;  1M63 B;  2EHB A;  4P2Y B;  4AQJ A;  2L5X B;  1NCY A;  2P6B B;  3I5G C;  1QX2 A;  2QPT A;  2H61 A;  3OP0 A;  1SL8 A;  3QRX A;  2HQW A;  2Y5I A;  1RFJ A;  1BJF A;  3VRP A;  4HRH A;  1F54 A;  1SL9 A;  1MF8 B;  1S5G Y;  3TDZ A;  1DF0 A;  1IJ6 A;  1IQ5 A;  2LLU A;  3H4S E;  3KHE A;  1JFK A;  2G2B A;  2Y1M A;  3HX4 A;  1DJX A;  2JT0 A;  3AKB A;  4Q04 A;  2K7B A;  4D1E A;  1S3P A;  2KI6 D;  3BUM B;  1BLQ A;  1Y6W A;  3CR2 A;  1CMF A;  2I94 A;  2KYC A;  5HKZ A;  5KSZ A;  2JPT A;  1N2D A;  2JT3 A;  2L4I A;  1NUB A;  2OS8 B;  1BU3 A;  2LMV A;  2Q4U A;  1JC2 A;  1KWO C;  4MZK A;  2KFG A;  2ZRS A;  1DJZ A;  1ODB A;  2BCB A;  1BMO A;  1KK7 Y;  1YTZ C;  1XVJ A;  3GOF A;  1NP8 A;  2BBM A;  1CNP A;  2NCO A;  1K94 A;  2PMY A;  1WDC C;  3PN7 C;  2BCA A;  3D0Y B;  1QXP A;  2OTG C;  1K9U A;  3BYA A;  2HPS A;  1SCM B;  1QAT A;  3LK0 A;  4DCK A;  1NSH A;  2JZI A;  2BBN A;  3NSK A;  4OVN F;  4N1G A;  1XK4 A;  2KAY A;  2I18 A;  2M97 A;  2LNK A;  3FWC A;  1YUS A;  4ZCV A;  2BE6 A;  1TCF A;  2KBI A;  1KFX S;  2E30 A;  1CDM A;  1YUR A;  1IRJ A;  2JNF A;  2K61 A;  4R1E A;  1IWQ A;  5CSF A;  1K95 A;  1WRK A;  2JXC A;  3O78 A;  3SG4 A;  1PVA A;  1B8L A;  1S6C A;  3CS1 A;  4I5K A;  3A4U B;  3CLN A;  5JJG A;  3IF7 A;  2WOS A;  2KOT A;  4GUK A;  5CSI A;  2JTT A;  1R6P A;  4GGF C;  3I5I B;  1DJI A;  1QS7 A;  1H8B A;  2M7L A;  1KSM A;  2KI6 C;  3BUW B;  1DGU A;  4MZJ A;  4PAL A;  1EL4 A;  2M3W A;  1KQV A;  2KBM A;  1JF0 A;  4GAO A;  4PE1 A;  1UUS A;  1K96 A;  5HKW A;  1UHH A;  4C0L A;  4U8D A;  2JT8 A;  2BL0 B;  1GJY A;  2WND A;  5G08 A;  1B9A A;  3FIA A;  3ZNI A;  3BOW A;  2AUC A;  1WRL A;  2ZFD A;  1SK6 D;  1QX5 B;  2ZN9 A;  2EC6 C;  3CGA A;  3I5H C;  2O5G A;  2F2O A;  3HCM A;  1SCV A;  1J1E A;  3PFV A;  4NDD A;  5HLO A;  2MJW B;  1LVC D;  4QJ5 B;  4YI9 A;  1KFX L;  1AHR A;  3VRQ A;  3LCP C;  4FQO A;  1SR6 C;  5I8N A;  1WLM A;  2LM5 A;  3JVT C;  1XFZ O;  3EKH A;  1DTL A;  3I5G B;  2K2F A;  1K9P A;  2ZN8 A;  3F45 A;  1BT6 A;  1F4Q A;  3TDI A;  2HF5 A;  4ORB B;  1KFU L;  2CNP A;  1NX0 A;  1TNP A;  2EGD A;  2KQY A;  3TS5 C;  2MRD A;  2SCP A;  3AAK A;  1UHK A;  3DF0 B;  1DJG A;  2JNX A;  4NQG A;  3RLZ A;  2FOT A;  4GGF A;  1A4P A;  1NCZ A;  3PSR A;  1V1F A;  3AKA A;  3ICB A;  1BF5 A;  1G4Y R;  2BKI B;  4ZCU A;  1F71 A;  2LMU A;  1DJY A;  3IQO A;  1J7O A;  2O60 A;  1FI6 A;  1S1E A;  2M0R A;  1GQM A;  4PCW A;  2LHI A;  1XFW O;  1KQM C;  1DT7 B;  2NZ0 A;  4P5O E;  1OMV A;  1QLS A;  1OSA A;  1JWD A;  1YUU A;  1RRO A;  4CFQ A;  1J55 A;  1QTX A;  1KWO B;  1PAL A;  2KSP A;  1AVS A;  2M7N A;  3WHU B;  4N5X A;  4I5N B;  1PSR A;  3TUY B;  1WDC B;  1L7Z A;  2LVJ A;  1BOC A;  1G33 A;  3PN7 B;  2Y4Q A;  1F70 A;  1KK7 Z;  1L2O C;  1SRA A;  1TN4 A;  1ZAC A;  1PVB A;  2LC5 A;  2LCP A;  1G8I A;  2A4J A;  1M39 A;  4JQ0 D;  4WRI A;  2FCE A;  2M9G A;  2F33 A;  5F6T A;  2F3Z A;  1QV0 A;  1S36 A;  1ZFS A;  3GK4 X;  1PK0 D;  1NIW A;  3OHM B;  1DVI A;  3BQ3 A;  2KAX A;  1DJW A;  1EG3 A;  2ZKM X;  1OMD A;  2JQ6 A;  2LLT A;  5KTY A;  4MN0 A;  2L0P A;  2WOR A;  2MHH A;  3EK4 A;  4OCI A;  1QIW A;  2MAZ A;  5HYD A;  2KYF A;  1ZMZ A;  2F2P A;  5CSN A;  2Y1N A;  1SNL A;  4M2O A;  1TTX A;  4YRU A;  3DD4 A;  3SIB A;  3BXK A;  3KF9 A;  3BUX B;  2FCD A;  5CPV A;  3VGO A;  3O6B A;  1IH0 A;  2TN4 A;  4XJK A;  2ZND A;  3EVU A;  3OX5 A;  2LVV A;  4PHN A;  1MHO A;  3PM8 A;  1C7V A;  1Q80 A;  2KGR A;  1UHI A;  1X02 A;  4DUQ A;  2PAL A;  2K8M B;  1REC A;  1RK9 A;  4CLN A;  4ORC B;  1OMR A;  2H2K A;  3SIA A;  2LAP A;  2PVB A;  4C0J A;  2IS9 A;  2B1U A;  1PUL A;  1VRK A;  1NX3 A;  3JTD B;  1M31 A;  1DF0 B;  1NX2 A;  3OB1 B;  1BR1 B;  5DKQ A;  5I2Q A;  2DOQ A;  3LLE A;  2D8N A;  1KFU S;  1NX1 A;  1SKT A;  3I5F B;  1A75 A;  5AAN A;  2AAO A;  2LHL A;  2ZNE A;  1AP4 A;  1AJ5 A;  1MXE A;  3WHT B;  3MSE B;  5AEQ A;  3KO0 A;  3FS7 A;  5I2O A;  3AAJ A;  1UP5 A;  2F3Y A;  1BG1 A;  1QVI Z;  4N1F A;  1FPW A;  2JXL A;  1B1G A;  1EXR A;  5D7F A;  5FYX A;  1A2X A;  2LP2 A;  4ETO A;  1TNX A;  3CR5 X;  4I5J A;  1YVL A;  4PHJ A;  2ZRT A;  1U5I A;  2LUC A;  1BOD A;  2I7A A;  2L4H A;  1MWN A;  1TNQ A;  1XFU O;  1C7W A;  2K0J A;  1IGV A;  1Y0V H;  2JWW A;  1QVI Y;  1WY9 A;  3BUO B;  2KI4 C;  4CID A;  2SAS A;  2M8U A;  1YR5 A;  2CBL A;  1YVH A;  3NSI A;  1CLM A;  1GGW A;  1CFD A;  1V1G A;  3PLF B;  5I2L A;  5AFP A;  1LXF C;  2LUX A;  3TS5 B;  1B4C A;  1K2H A;  1EJ3 A;  1HQV A;  4A4C A;  1RTP 1;  3SG6 A;  4F0Z B;  4C0K A;  1NWD A;  5CSJ A;  3LK1 A;  2RGI A;  4HSZ A;  1ALW A;  2WCB A;  1F8H A;  4YI8 A;  1MQ1 A;  2M49 B;  4TNC A;  4CPV A;  1J1D A;  4MEW A;  1K90 D;  2QAC A;  4YGD B;  1MUX A;  4PHM A;  4E68 A;  4PE4 A;  2E6W A;  1KQM B;  4UPG A;  2L51 A;  1A75 B;  2VRG A;  5DKN A;  3NSO A;  1XFX O;  1LIN A;  1MXL C;  2KNE A;  2LE9 B;  3GK1 A;  4HRG A;  1CDN A;  2NXQ A;  2HET A;  2G9B A;  4L9M A;  3IQQ A;  4BY5 A;  1DGV A;  2BL0 C;  2K7C A;  1SW8 A;  3NSL A;  5AER A;  2V53 A;  1L2O B;  1TIZ A;  1CFF A;  1H4B A;  4MRY A;  2LP3 A;  1OOJ A;  3CR4 X;  4JWQ A;  3EVV A;  1KK8 C;  1U5I B;  2I2R E;  2WCE A;  1CFC A;  1CB1 A;  3BOW B;  1AJ4 A;  4GGN A;  1JSA A;  1FF1 A;  2KFF A;  1QV1 A;  2KFH A;  1YRT B;  1XYD A;  1NCX A;  2M29 A;  1FI5 A;  1B8C A;  4USL A;  1A03 A;  2L2E A;  1IQ3 A;  2OTG B;  2LVK A;  3TZ1 A;  3NXA A;  2JTZ A;  4WQ3 A;  1NPQ A;  1J7Q A;  1PRW A;  4IL1 A;  1J7P A;  1HT9 A;  3KEV A;  1TRF A;  2CXJ A;  4NDC A;  3OB2 B;  1YUT A;  1MR8 A;  2LVI A;  1JF2 A;  3EVR A;  3DVM A;  2BE4 A;  4MSP A;  4AOM A;  1R2U A;  1CM4 A;  5IBW A;  1LKJ A;  1ALV A;  4GBA A;  3VRR A;  5BPJ A;  1UHJ A;  2NLN A;  1Y1X A;  2JC2 A;  1QLK A;  1SYM A;  1UHN A;  1ZOT B;  1CKK A;  1Y1U A;  3DVE A;  4QJ3 B;  2ISD A;  2LLS A;  4MRX A;  1F55 A;  2WCF A;  3DVJ A;  3O4Y A;  4JPZ B;  4GPL B;  2L98 A;  1A29 A;  1FW4 A;  3WXA A;  5D69 A;  2BCX A;  3OX6 A;  1SMG A;  4YGB B;  4PHK A;  2MLE C;  1QJT A;  3O2P A;  5HLV A;  5KU1 A;  2KHN A;  2GV5 A;  5GQQ C;  1QAS A;  3TUY C;  1KCY A;  1F4O A;  1K8U A;  3WNX B;  1CTR A;  1W7I B;  1YX7 A;  1Y1A A;  1IKU A;  4M2Q A;  5ER5 A;  1QX7 A;  4A4B A;  3EKJ A;  3GK2 A;  4HRE E;  2K7D A;  4YGE B;  2BKH B;  3SG2 A;  1K9K A;  1S6J A;  4GFT A;  2OS8 C;  2Q91 A;  5JOL A;  4MLW A;  2PRU A;  3PAL A;  4PE0 A;  1N0Y A;  1E8A A;  1BR4 B;  2BEC A;  4PE7 A;  2FJU B;  3BUN B;  2KI4 B;  1ZUZ A;  2KGB C;  3RM1 A;  2CTN A;  4FTG A;  2EC6 B;  1B47 A;  3I5H B;  4M2P A;  2M1K B;  3CZT X;  1XFY O;  1RWY A;  1SL7 A;  4ICB A;  5DKR A;  1SCM C;  2F8P A;  4YGA A;  5AXI A;  1OQP A;  4XYN A;  1OZO A;  1S6I A;  1WLZ A;  2K7O A;  3CTN A;  1RJV A;  5HKY A;  2HQ8 A;  2JUL A;  1SR6 B;  1CLL A;  3ZWH A;  5B8I B;  2JOJ A;  1SY9 A;  3JVT B;  4I5L B;  3SG5 A;  2LV7 A;  4DIR A;  1S26 D;  3A8R A;  1XA5 A;  2NCP A;  3DF0 A;  1NYA A;  3CWG A;  3EK8 A;  5PAL A;  2H61 C;  3E3R A;  1TNW A;  4XJK B;  1B7T Z;  1DJH A;  1LA3 A;  1JBA A;  1D1O A;  1KSO A;  2R2I A;  1M45 A;  3KPX A;  4MVF A;  1DMO A;  3JTD C;  1W7J B;  2WC8 A;  3M0W A;  1OE9 B;  1CLB A;  2KAV A;  3PAT A;  1M46 A;  3I5F C;  2CT9 A;  4CFR A;  1FBV A;  3K21 A;  2MBX A;  3I5I C;  3SG3 A;  2CCM A;  4AQI A;  1QIV A;  1B7T Y;  2MA2 A;  3EK7 A;  2LMT A;  1KK8 B;  3DVK A;  1N65 A;  1PSB A;  1XO5 A;  2JRF A;  4MBE A;  3FWB A;  4NDB A;  4YGC B;  3SJS A;  1AK8 A;  2JU0 A;  1TCO B;  2MLF C;  2M1U A;  5ER4 X;  2PAS A;  4BY4 A;  3C1V A;  1CDP A;  2COL B;  4OKH A;  1XFV O;  1YRU B;  1GGZ A;  1B8R A;  2KDH A;  1JUO A;  1SBJ A;  3LL8 B;  1SPY A;  2GGZ A;  4OV2 A;  1AUI B;  1UUR A;  2PSR A;  3D10 A;  1OZS A;  2AMI A;  1K93 D;  2L50 A;  2OPO A;  4MZL A;  4OR9 B;  1CFP A;  1CM1 A;  1UWO A;  1WRZ A;  4ORA B;  4WQ2 A;  4YBH B;  2K2A A;  3SG7 A;  1EH2 A;  5TNC A;  1JFJ A;  1EG4 A;  1TOP A;  1LA0 A;  4PDZ A;  1C07 A;  5J3X A;  4DS7 A;  1J7R A;  3VRO A;  1IG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...