5DICA

Fatty acid binding protein obp56a from the oral disk of the blowfly phormia regina
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
115
structure length
115
Chain Sequence
HLELTEEQKAKVKVHFDECVKQEKVSEEEATKLRNKDYANPTPAMKCFGTCFFEKIGTLKDGVVQEAVVLEKLSPHFGEEKVKAALDKCKNIKGADRCDTGFKIFECFEKAKDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant-binding protein
publication title In preparation
rcsb
source organism Phormia regina
molecule tags Odorant-binding protein
total genus 44
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 5dicA00
4F7FA 4INXA 3L4AA 1LS8A 3K1EA 3D78A 2JPOA 3L47A 5DICA 3DXLA 3CDNA 1TWOA 3CZ1A 3V2LA 3S0AA 3OGNA 3D76A 1OOIX 3RZSA 5EL2A 3D74A 3BJHA 3CYZA 3NHIA 3R1VA 1C3YA 3BFHA 3R1OA 1GM0A 2QEVA 2WCMA 3D73A 3NGVA 2H8VA 2WCKA 2KPHA 3D75A 3B86A 3B7AA 1XFRA 1OOGA 2P71A 2QDIA 3DZTA 4PT1A 1C3ZA 1ORGA 3S0GA 1T14A 3R1PA 3L4LA 3FE8A 2QEHA 3VB1A 3B6XA 2ERBA 3FE9A 3B87A 3CZ0A 2WCJA 4OZDA 3BFBA 2WCLA 2P70A 3S0FA 3QMEA 3S0DA 3N7HA 3DYEA 3D77A 2WC5A 1OOHA 4FQTA 3FE6A 3PJIA 3Q8IA 3CABA 3CZ2A 3S0EA 1OOFA 4JD9A 1DQEA 3B88A 2WCHA 2L2CA 4INWA 2FJYA 1TUJA 2QEBA 2GTEA 1OW4A 3S0BA 3DY9A 2PQLA 3BFAA 2WC6A 1P28A 3R72A 2QEOA 1QWVA 3NHTA
chains in the Genus database with same CATH superfamily
4MZKA 1QLKA 4DRWA 1B8RA 1B8LA 2F2OA 1EG3A 2LNKA 4BY5A 3VRNA 3A4UB 5B8IB 2OS8B 3L4AA 1A2XA 1GQMA 1Y1XA 2PVBA 3PFVA 1WY9A 2BAPA 2JTTA 2KDHA 1MF8B 2MBXA 2BKIB 4Q04A 1S26D 3DF0A 1QIVA 3CDNA 3JTDB 3OB2B 1WRZA 1TWOA 4PHMA 2KLDA 1G33A 1M45A 1Y1AA 3OX6A 4QJ3B 1DVIA 1R6PA 1W7JB 2BE4A 2OS8C 5CPVA 3S0AA 1KK8C 3OGNA 2LCPA 1OOIX 1XO5A 2L2EA 3PSRA 3HX4A 1EG4A 3CLNA 2P6BB 3SG4A 3JTDC 1LXFC 1SK6D 1EXRA 1OE9B 1SPYA 2LHLA 5BPJA 1UHIA 3UO9A 2WOSA 1XK4A 5HYDA 1K93D 3NHIA 4C0LA 1UWOA 3R1OA 1DJZA 3EKHA 4L9MA 1W7IB 1YUSA 1TTXA 2BNXA 5CSIA 3SIAA 2KFHA 3WHTB 3WXAA 1PSRA 2M8UA 5I2LA 1NX0A 3TS5C 4HREE 2LP2A 2OTGB 1SYMA 2Y1MA 2NCPA 1OOGA 4N1FA 1KFXS 2M0RA 3TUYB 2HQ8A 2KFFA 2CTNA 4WQ3A 3CGAA 3S0GA 1T14A 1YRUB 3I5HB 1A4PA 3JVTC 3PALA 1G4YR 1V1FA 1XA5A 2LM5A 3DVMA 2OTGC 5DKRA 2G2BA 3FE9A 1AUIB 1GJYA 3B87A 1OOJA 2KHNA 4OCIA 3TUYC 3OP0A 3GK1A 1MXLC 1UURA 4JPZB 1BT6A 1AP4A 4F0ZB 3SG2A 2D8NA 1DJIA 1L2OB 1TCFA 1EL4A 1XFVO 2BE6A 3BFBA 3TDZA 3VGOA 3FWBA 1SSEB 2KFGA 1EJ3A 3FWCA 1QJTA 3WNXB 1IIOA 3S0DA 2LANA 1GGWA 4I5KA 3LCPC 4YGAA 2K7OA 3BUXB 3DYEA 3PLFB 2MHHA 2I2RE 5AANA 3LL8B 4MVFA 1XFYO 3AAJA 1Y6WA 1NCZA 2Y4QA 1F55A 5HKYA 2WCBA 2JT0A 2BKHB 2HQWA 1CM4A 3I5GC 1DQEA 1AVSA 3CTNA 1QLSA 2WCHA 1QIWA 3O4XA 1CTRA 1SCMB 1OQPA 2FJYA 3VRRA 1TUJA 1S5GY 5I8NA 2M1KB 4GPLB 3K21A 5GQQC 2K7CA 3PM8A 3AKAA 4XJKB 1TRFA 2NCOA 2L51A 1C07A 4JQ0D 1S5GZ 1Y0VH 2JC2A 1PVBA 2BBMA 3ZWHA 3DY9A 2PQLA 3BUOB 2WC6A 1SL8A 1BOCA 2PSRA 4PE1A 5ER4X 1JWDA 2KAVA 3N7HA 3NHTA 1SCMC 2JOJA 3PM2A 1K96A 1J7RA 1K9KA 3D0YB 3SS5A 1CLBA 1SNLA 3I5FC 3K1EA 4PE0A 5DKQA 2JQ6A 2K60A 4OR9B 2KBIA 2Y1NA 3LK0A 4CIDA 3VROA 3DXLA 1N65A 1WLZA 4MZLA 3OB1B 4PE4A 4FQOA 2WC8A 4MEWA 1CLMA 5KU1A 2K7BA 2K7DA 1UP5A 3IQQA 1KK7Y 5AFPA 1FW4A 3MSEB 2K0JA 1ALWA 4KYNA 1DJWA 3O4YA 1A75A 3CZ1A 2O60A 2WCFA 1KK7Z 2KGBC 1QTXA 2I7AA 3FS7A 3IF7A 1HQVA 5FI7A 1JSAA 4PHJA 3D76A 2L0PA 2YGUA 4A4CA 2LUCA 4R1EA 1IQ3A 2BL0C 2Q4UA 4GGFA 5HLVA 2JPTA 1NP8A 1DEKA 2F3YA 1JF2A 3KF9A 4A4BA 4BY4A 5I94A 1WRLA 2LLUA 4MN0A 3CYZA 5ER5A 3R1VA 1KK8B 1NSHA 2MA2A 1C3YA 1AHRA 1M31A 1OSAA 1XYDA 1DMOA 5PALA 2G9BA 1J7PA 2HETA 1TUZA 1CDNA 1F54A 2IS9A 2M29A 1S6CA 1J1DA 1IJ6A 1YURA 3D75A 1DF0A 1K90D 1MQ1A 2KLEA 1E8AA 4PHKA 1SR6C 2P71A 4P5OE 2F3ZA 3DZTA 3IQOA 2ZN8A 4DS7A 2LV7A 4D1EA 2R2IA 1YX7A 2CXJA 2JT8A 3R1PA 3TS5B 5CSJA 1RK9A 1HT9A 2PYQA 2QEHA 4M2PA 1K94A 1DT7B 4CLNA 1Z4HA 1NIWA 1KFUL 2AAOA 2L4IA 3BQ3A 2JULA 1B4CA 3BYAA 3CZ0A 2KQ6A 4AQJA 1RWYA 3AKBA 2AUCA 2CCMA 4ORCB 1NPQA 3VRQA 1S6IA 1M46A 1YR5A 1QS7A 3BUNB 2WNDA 3CWGA 2F2PA 1QV1A 2WCJA 3JVTB 5G08A 1J7OA 2KSPA 1C7WA 1CLLA 3SS4A 1SY9A 3HCMA 3BUMB 2GGZA 2JTZA 3F45A 1ZMZA 3PN7B 1TIZA 2EHBA 3D77A 3ZNIA 1U5IA 1RFJA 1OOHA 3TZ1A 1DTLA 1NCYA 1FF1A 2H61A 2L50A 1OOFA 1W9ZA 1ZUZA 3B88A 1S3PA 1IG5A 1IKUA 3PN7C 1NCXA 2PRUA 3O2PA 3AAKA 4YI8A 4DIRA 2KGRA 2E30A 1BR1B 1J1EA 3SG5A 1DGVA 4N1GA 3M0WA 4DCKA 2BCBA 1XFUO 2V53A 3I5GB 4OVNF 1OW4A 1V1GA 2K61A 3S0BA 4CFRA 4MBEA 3DD4A 2LVVA 4I5LB 1C7VA 4ORBB 1QWVA 1QX2A 1F71A 1OMRA 1VRKA 4P2YB 4MRYA 5K89A 1BG1A 4IJ7A 2CNPA 1XFWO 1JC2A 1UHKA 1MUXA 5FYXA 1TNQA 4INXA 5I2OA 2KOTA 5TNCA 2KYCA 1QX7A 2CBLA 2JU0A 4IL1A 1M39A 3D78A 2JPOA 3L47A 3SIBA 1A03A 2LMUA 5DICA 3VRPA 5HL1A 1RROA 2HPSA 1DJGA 1JF0A 3OBVA 1CB1A 2GV5A 1CDPA 1TCOB 1ZOTB 2M49B 2BCXA 1KFUS 3I5FB 4YGBB 5IBWA 1XFZO 1KSMA 1DELA 2EC6B 2F33A 2MJWB 1SKTA 2KI6D 1KWOC 2JWWA 1Q80A 2QACA 2ZNEA 2LAPA 3KEVA 1R2UA 3RZSA 3CR2A 1LKJA 2BECA 4YGEB 1K2HA 1PK0D 4MLWA 2L4HA 3D10A 1F8HA 1H8BA 5CSNA 4PCWA 4U8DA 2L5YA 3R72A 4NDCA 3CS1A 1SRAA 1NWDA 1CFPA 1NUBA 2COLB 1NYAA 3BJHA 3KO0A 4YI9A 3C1VA 1PVAA 1IRJA 2LVJA 2NXQA 1IQ5A 1K9PA 2PALA 2ZN9A 1GM0A 1YUTA 2EC6C 2QEVA 1B7TY 2MLFC 1WLMA 3DF0B 4E68A 2BL0B 1K95A 2LMTA 3D73A 2KI4C 2KPHA 1B7TZ 2M9GA 3O78A 3EG5B 1JFKA 2NLNA 3B86A 1CMGA 1BODA 1RJVA 1KCYA 3EK8A 3SG3A 2QDIA 3DVEA 3IVTA 4MSPA 1FPWA 1YVHA 4N5XA 1LVCD 1CM1A 1SW8A 4PT1A 2DOQA 5FI6A 1BMOA 4AOMA 1ODBA 2WCEA 3SJSA 3L4LA 3NSOA 5AEQA 2ERBA 4NDDA 1SR6B 1AK8A 1CNPA 3EVUA 3PATA 4GUKA 4HRGA 3TDIA 2ZFDA 5CSFA 2PASA 2K2FA 4JKTA 1CFFA 2LUXA 1OMDA 1QXPA 1OZSA 4PHNA 5AERA 4OZDA 1KSOA 1YTZC 1CMFA 3GK4X 1M63B 2P70A 1RECA 2M1UA 2MRDA 1BU3A 1BR4B 4NDBA 2BCAA 1QVIY 1XK4C 2Q91A 4NQGA 2B1UA 4WQ2A 1EH2A 2LHIA 1SL7A 2JRFA 4GNKB 1U5IB 1IWQA 1QVIZ 1H4BA 2WC5A 2KAYA 4M2OA 1S1EA 2MLEC 4FQTA 3SG7A 1UUSA 3SS3A 3WHUB 1J7QA 2O5GA 2JNXA 3PJIA 1TOPA 1JFJA 3CABA 2LE9B 1DGUA 3CZ2A 3I5IB 3S0EA 3D0YA 4JD9A 2KQYA 3CR5X 4C0JA 2JT3A 1TNXA 1OZOA 5JOLA 4CPVA 3OHMB 5HKWA 2L2CA 1ZACA 2SCPA 3BOWA 1RTP1 1B47A 1UHNA 1WDCB 2H61C 2K8MB 3NSKA 5F6TA 3QRXA 4PDZA 4QJ4B 1SBJA 1B9AA 1J55A 3BUWB 3CZTX 5D7FA 1F70A 1MR8A 1KQVA 3I5IC 4ICBA 2JXCA 4C0KA 1KQMB 3LLEA 5D69A 1FI5A 3BFAA 4MZJA 1IGVA 1TNPA 2SASA 1YVLA 2FOTA 1P28A 3RM1A 1CFDA 2OPOA 4GBAA 2MAZA 4TNCA 2ZNDA 1GGZA 1QV0A 5FI2A 4F7FA 5JJGA 3CR4X 1WDCC 4OV2A 2LVIA 1WRKA 2EGDA 1MWNA 3EK7A 1LS8A 3FIAA 1K8UA 4ZCUA 4WRIA 1UHHA 1KQMC 2A4JA 1A29A 2E6WA 1JUOA 2WORA 3EK4A 4GAOA 4HSZA 2LMVA 3NXAA 5HKZA 3OX5A 3BXKA 3O6BA 2GGMA 2M7LA 1SL9A 4XYNA 2L5XB 3V2LA 1JBAA 4DUQA 2ZKMX 2NZ0A 4I5NB 2LLTA 2M97A 1N2DA 4MRXA 2KAXA 4YGCB 5EL2A 3H4SE 1B1GA 1X02A 2CT9A 1ZFSA 3D74A 2BBNA 2KNEA 1NX2A 1BF5A 1Z2CB 1XFXO 1LA0A 3BFHA 5D3OA 2WCMA 1KWOB 4HRHA 1LA3A 3DVJA 4PE7A 3NGVA 2H8VA 1TNWA 3I5HC 1DJXA 5I2QA 2WCKA 1FI6A 1F4OA 1A75B 2I18A 3B7AA 3SG6A 4JWQA 1XFRA 1MHOA 4OKHA 1B8CA 5AXIA 1YUUA 2LC5A 1LINA 1PULA 1S6JA 1SMGA 2KBMA 4ZCVA 1C3ZA 1ORGA 1CKKA 2VRGA 1IH0A 2KI4B 1L2OC 3FE8A 2Y5IA 1UHJA 1QATA 3VB1A 3B6XA 4CFQA 2FCEA 1FBVA 1CFCA 4GFTA 1CDMA 1Y1UA 1D1OA 1BLQA 1CDLA 1AJ4A 4YRUA 2FCDA 4YGDB 2I94A 4ETOA 2ZRTA 1L7ZA 4GGFC 1DF0B 3GK2A 2K2AA 1QASA 4UPGA 2KYFA 1BJFA 2WCLA 1TN4A 2LVKA 1PSBA 1NX3A 1DJHA 3NSLA 4AQIA 3QMEA 2PMYA 3S0FA 3NSIA 3KPXA 4M2QA 3TDUA 3E3RA 2JNFA 2FJUB 2H2KA 2F8PA 2AMIA 5J3XA 4USLA 2HF5A 4YBHB 1G8IA 2L98A 3EKJA 2ZRSA 3ICBA 3FE6A 1NX1A 2M3WA 3Q8IA 3EVVA 2M7NA 2RGIA 2JZIA 2TN4A 2JXLA 1IJ5A 5KSZA 1QX5B 1ALVA 2KI6C 1K9UA 1KFXL 1MXEA 3BOWB 3UNWA 4GGNA 3DVKA 4ORAB 1YX8A 1XVJA 4INWA 3LK1A 5KTYA 4QJ5B 1SCVA 1PALA 2QPTA 1AJ5A 4PALA 3KHEA 1YRTB 2ISDA 3RLZA 3EVRA 2LP3A 2LLSA 1OMVA 2QEBA 1S36A 4I5JA 5DKNA 1PRWA 1DC1A 4XJKA 5HLOA 2GTEA 1DJYA 1N0YA 3A8RA 1F4QA 4FTGA 2QEOA 3GOFA
chains in the Genus database with same CATH topology
4F7FA 4INXA 3L4AA 1LS8A 3K1EA 3D78A 2JPOA 3L47A 5DICA 3DXLA 3CDNA 1TWOA 3CZ1A 3V2LA 3S0AA 3OGNA 3D76A 1OOIX 3RZSA 5EL2A 3D74A 3BJHA 3CYZA 3NHIA 3R1VA 1C3YA 3BFHA 3R1OA 1GM0A 2QEVA 2WCMA 3D73A 3NGVA 2H8VA 2WCKA 2KPHA 3D75A 3B86A 3B7AA 1XFRA 1OOGA 2P71A 2QDIA 3DZTA 4PT1A 1C3ZA 1ORGA 3S0GA 1T14A 3R1PA 3L4LA 3FE8A 2QEHA 3VB1A 3B6XA 2ERBA 3FE9A 3B87A 3CZ0A 2WCJA 4OZDA 3BFBA 2WCLA 2P70A 3S0FA 3QMEA 3S0DA 3N7HA 3DYEA 3D77A 2WC5A 1OOHA 4FQTA 3FE6A 3PJIA 3Q8IA 3CABA 3CZ2A 3S0EA 1OOFA 4JD9A 1DQEA 3B88A 2WCHA 2L2CA 4INWA 2FJYA 1TUJA 2QEBA 2GTEA 1OW4A 3S0BA 3DY9A 2PQLA 3BFAA 2WC6A 1P28A 3R72A 2QEOA 1QWVA 3NHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7F A;  4INX A;  3L4A A;  1LS8 A;  3K1E A;  3D78 A;  2JPO A;  3L47 A;  5DIC A;  3DXL A;  3CDN A;  1TWO A;  3CZ1 A;  3V2L A;  3S0A A;  3OGN A;  3D76 A;  1OOI X;  3RZS A;  5EL2 A;  3D74 A;  3BJH A;  3CYZ A;  3NHI A;  3R1V A;  1C3Y A;  3BFH A;  3R1O A;  1GM0 A;  2QEV A;  2WCM A;  3D73 A;  3NGV A;  2H8V A;  2WCK A;  2KPH A;  3D75 A;  3B86 A;  3B7A A;  1XFR A;  1OOG A;  2P71 A;  2QDI A;  3DZT A;  4PT1 A;  1C3Z A;  1ORG A;  3S0G A;  1T14 A;  3R1P A;  3L4L A;  3FE8 A;  2QEH A;  3VB1 A;  3B6X A;  2ERB A;  3FE9 A;  3B87 A;  3CZ0 A;  2WCJ A;  4OZD A;  3BFB A;  2WCL A;  2P70 A;  3S0F A;  3QME A;  3S0D A;  3N7H A;  3DYE A;  3D77 A;  2WC5 A;  1OOH A;  4FQT A;  3FE6 A;  3PJI A;  3Q8I A;  3CAB A;  3CZ2 A;  3S0E A;  1OOF A;  4JD9 A;  1DQE A;  3B88 A;  2WCH A;  2L2C A;  4INW A;  2FJY A;  1TUJ A;  2QEB A;  2GTE A;  1OW4 A;  3S0B A;  3DY9 A;  2PQL A;  3BFA A;  2WC6 A;  1P28 A;  3R72 A;  2QEO A;  1QWV A;  3NHT A; 
#chains in the Genus database with same CATH topology
 4MZK A;  1QLK A;  4DRW A;  1B8R A;  1B8L A;  2F2O A;  1EG3 A;  2LNK A;  4BY5 A;  3VRN A;  3A4U B;  5B8I B;  2OS8 B;  3L4A A;  1A2X A;  1GQM A;  1Y1X A;  2PVB A;  3PFV A;  1WY9 A;  2BAP A;  2JTT A;  2KDH A;  1MF8 B;  2MBX A;  2BKI B;  4Q04 A;  1S26 D;  3DF0 A;  1QIV A;  3CDN A;  3JTD B;  3OB2 B;  1WRZ A;  1TWO A;  4PHM A;  2KLD A;  1G33 A;  1M45 A;  1Y1A A;  3OX6 A;  4QJ3 B;  1DVI A;  1R6P A;  1W7J B;  2BE4 A;  2OS8 C;  5CPV A;  3S0A A;  1KK8 C;  3OGN A;  2LCP A;  1OOI X;  1XO5 A;  2L2E A;  3PSR A;  3HX4 A;  1EG4 A;  3CLN A;  2P6B B;  3SG4 A;  3JTD C;  1LXF C;  1SK6 D;  1EXR A;  1OE9 B;  1SPY A;  2LHL A;  5BPJ A;  1UHI A;  3UO9 A;  2WOS A;  1XK4 A;  5HYD A;  1K93 D;  3NHI A;  4C0L A;  1UWO A;  3R1O A;  1DJZ A;  3EKH A;  4L9M A;  1W7I B;  1YUS A;  1TTX A;  2BNX A;  5CSI A;  3SIA A;  2KFH A;  3WHT B;  3WXA A;  1PSR A;  2M8U A;  5I2L A;  1NX0 A;  3TS5 C;  4HRE E;  2LP2 A;  2OTG B;  1SYM A;  2Y1M A;  2NCP A;  1OOG A;  4N1F A;  1KFX S;  2M0R A;  3TUY B;  2HQ8 A;  2KFF A;  2CTN A;  4WQ3 A;  3CGA A;  3S0G A;  1T14 A;  1YRU B;  3I5H B;  1A4P A;  3JVT C;  3PAL A;  1G4Y R;  1V1F A;  1XA5 A;  2LM5 A;  3DVM A;  2OTG C;  5DKR A;  2G2B A;  3FE9 A;  1AUI B;  1GJY A;  3B87 A;  1OOJ A;  2KHN A;  4OCI A;  3TUY C;  3OP0 A;  3GK1 A;  1MXL C;  1UUR A;  4JPZ B;  1BT6 A;  1AP4 A;  4F0Z B;  3SG2 A;  2D8N A;  1DJI A;  1L2O B;  1TCF A;  1EL4 A;  1XFV O;  2BE6 A;  3BFB A;  3TDZ A;  3VGO A;  3FWB A;  1SSE B;  2KFG A;  1EJ3 A;  3FWC A;  1QJT A;  3WNX B;  1IIO A;  3S0D A;  2LAN A;  1GGW A;  4I5K A;  3LCP C;  4YGA A;  2K7O A;  3BUX B;  3DYE A;  3PLF B;  2MHH A;  2I2R E;  5AAN A;  3LL8 B;  4MVF A;  1XFY O;  3AAJ A;  1Y6W A;  1NCZ A;  2Y4Q A;  1F55 A;  5HKY A;  2WCB A;  2JT0 A;  2BKH B;  2HQW A;  1CM4 A;  3I5G C;  1DQE A;  1AVS A;  3CTN A;  1QLS A;  2WCH A;  1QIW A;  3O4X A;  1CTR A;  1SCM B;  1OQP A;  2FJY A;  3VRR A;  1TUJ A;  1S5G Y;  5I8N A;  2M1K B;  4GPL B;  3K21 A;  5GQQ C;  2K7C A;  3PM8 A;  3AKA A;  4XJK B;  1TRF A;  2NCO A;  2L51 A;  1C07 A;  4JQ0 D;  1S5G Z;  1Y0V H;  2JC2 A;  1PVB A;  2BBM A;  3ZWH A;  3DY9 A;  2PQL A;  3BUO B;  2WC6 A;  1SL8 A;  1BOC A;  2PSR A;  4PE1 A;  5ER4 X;  1JWD A;  2KAV A;  3N7H A;  3NHT A;  1SCM C;  2JOJ A;  3PM2 A;  1K96 A;  1J7R A;  1K9K A;  3D0Y B;  3SS5 A;  1CLB A;  1SNL A;  3I5F C;  3K1E A;  4PE0 A;  5DKQ A;  2JQ6 A;  2K60 A;  4OR9 B;  2KBI A;  2Y1N A;  3LK0 A;  4CID A;  3VRO A;  3DXL A;  1N65 A;  1WLZ A;  4MZL A;  3OB1 B;  4PE4 A;  4FQO A;  2WC8 A;  4MEW A;  1CLM A;  5KU1 A;  2K7B A;  2K7D A;  1UP5 A;  3IQQ A;  1KK7 Y;  5AFP A;  1FW4 A;  3MSE B;  2K0J A;  1ALW A;  4KYN A;  1DJW A;  3O4Y A;  1A75 A;  3CZ1 A;  2O60 A;  2WCF A;  1KK7 Z;  2KGB C;  1QTX A;  2I7A A;  3FS7 A;  3IF7 A;  1HQV A;  5FI7 A;  1JSA A;  4PHJ A;  3D76 A;  2L0P A;  2YGU A;  4A4C A;  2LUC A;  4R1E A;  1IQ3 A;  2BL0 C;  2Q4U A;  4GGF A;  5HLV A;  2JPT A;  1NP8 A;  1DEK A;  2F3Y A;  1JF2 A;  3KF9 A;  4A4B A;  4BY4 A;  5I94 A;  1WRL A;  2LLU A;  4MN0 A;  3CYZ A;  5ER5 A;  3R1V A;  1KK8 B;  1NSH A;  2MA2 A;  1C3Y A;  1AHR A;  1M31 A;  1OSA A;  1XYD A;  1DMO A;  5PAL A;  2G9B A;  1J7P A;  2HET A;  1TUZ A;  1CDN A;  1F54 A;  2IS9 A;  2M29 A;  1S6C A;  1J1D A;  1IJ6 A;  1YUR A;  3D75 A;  1DF0 A;  1K90 D;  1MQ1 A;  2KLE A;  1E8A A;  4PHK A;  1SR6 C;  2P71 A;  4P5O E;  2F3Z A;  3DZT A;  3IQO A;  2ZN8 A;  4DS7 A;  2LV7 A;  4D1E A;  2R2I A;  1YX7 A;  2CXJ A;  2JT8 A;  3R1P A;  3TS5 B;  5CSJ A;  1RK9 A;  1HT9 A;  2PYQ A;  2QEH A;  4M2P A;  1K94 A;  1DT7 B;  4CLN A;  1Z4H A;  1NIW A;  1KFU L;  2AAO A;  2L4I A;  3BQ3 A;  2JUL A;  1B4C A;  3BYA A;  3CZ0 A;  2KQ6 A;  4AQJ A;  1RWY A;  3AKB A;  2AUC A;  2CCM A;  4ORC B;  1NPQ A;  3VRQ A;  1S6I A;  1M46 A;  1YR5 A;  1QS7 A;  3BUN B;  2WND A;  3CWG A;  2F2P A;  1QV1 A;  2WCJ A;  3JVT B;  5G08 A;  1J7O A;  2KSP A;  1C7W A;  1CLL A;  3SS4 A;  1SY9 A;  3HCM A;  3BUM B;  2GGZ A;  2JTZ A;  3F45 A;  1ZMZ A;  3PN7 B;  1TIZ A;  2EHB A;  3D77 A;  3ZNI A;  1U5I A;  1RFJ A;  1OOH A;  3TZ1 A;  1DTL A;  1NCY A;  1FF1 A;  2H61 A;  2L50 A;  1OOF A;  1W9Z A;  1ZUZ A;  3B88 A;  1S3P A;  1IG5 A;  1IKU A;  3PN7 C;  1NCX A;  2PRU A;  3O2P A;  3AAK A;  4YI8 A;  4DIR A;  2KGR A;  2E30 A;  1BR1 B;  1J1E A;  3SG5 A;  1DGV A;  4N1G A;  3M0W A;  4DCK A;  2BCB A;  1XFU O;  2V53 A;  3I5G B;  4OVN F;  1OW4 A;  1V1G A;  2K61 A;  3S0B A;  4CFR A;  4MBE A;  3DD4 A;  2LVV A;  4I5L B;  1C7V A;  4ORB B;  1QWV A;  1QX2 A;  1F71 A;  1OMR A;  1VRK A;  4P2Y B;  4MRY A;  5K89 A;  1BG1 A;  4IJ7 A;  2CNP A;  1XFW O;  1JC2 A;  1UHK A;  1MUX A;  5FYX A;  1TNQ A;  4INX A;  5I2O A;  2KOT A;  5TNC A;  2KYC A;  1QX7 A;  2CBL A;  2JU0 A;  4IL1 A;  1M39 A;  3D78 A;  2JPO A;  3L47 A;  3SIB A;  1A03 A;  2LMU A;  5DIC A;  3VRP A;  5HL1 A;  1RRO A;  2HPS A;  1DJG A;  1JF0 A;  3OBV A;  1CB1 A;  2GV5 A;  1CDP A;  1TCO B;  1ZOT B;  2M49 B;  2BCX A;  1KFU S;  3I5F B;  4YGB B;  5IBW A;  1XFZ O;  1KSM A;  1DEL A;  2EC6 B;  2F33 A;  2MJW B;  1SKT A;  2KI6 D;  1KWO C;  2JWW A;  1Q80 A;  2QAC A;  2ZNE A;  2LAP A;  3KEV A;  1R2U A;  3RZS A;  3CR2 A;  1LKJ A;  2BEC A;  4YGE B;  1K2H A;  1PK0 D;  4MLW A;  2L4H A;  3D10 A;  1F8H A;  1H8B A;  5CSN A;  4PCW A;  4U8D A;  2L5Y A;  3R72 A;  4NDC A;  3CS1 A;  1SRA A;  1NWD A;  1CFP A;  1NUB A;  2COL B;  1NYA A;  3BJH A;  3KO0 A;  4YI9 A;  3C1V A;  1PVA A;  1IRJ A;  2LVJ A;  2NXQ A;  1IQ5 A;  1K9P A;  2PAL A;  2ZN9 A;  1GM0 A;  1YUT A;  2EC6 C;  2QEV A;  1B7T Y;  2MLF C;  1WLM A;  3DF0 B;  4E68 A;  2BL0 B;  1K95 A;  2LMT A;  3D73 A;  2KI4 C;  2KPH A;  1B7T Z;  2M9G A;  3O78 A;  3EG5 B;  1JFK A;  2NLN A;  3B86 A;  1CMG A;  1BOD A;  1RJV A;  1KCY A;  3EK8 A;  3SG3 A;  2QDI A;  3DVE A;  3IVT A;  4MSP A;  1FPW A;  1YVH A;  4N5X A;  1LVC D;  1CM1 A;  1SW8 A;  4PT1 A;  2DOQ A;  5FI6 A;  1BMO A;  4AOM A;  1ODB A;  2WCE A;  3SJS A;  3L4L A;  3NSO A;  5AEQ A;  2ERB A;  4NDD A;  1SR6 B;  1AK8 A;  1CNP A;  3EVU A;  3PAT A;  4GUK A;  4HRG A;  3TDI A;  2ZFD A;  5CSF A;  2PAS A;  2K2F A;  4JKT A;  1CFF A;  2LUX A;  1OMD A;  1QXP A;  1OZS A;  4PHN A;  5AER A;  4OZD A;  1KSO A;  1YTZ C;  1CMF A;  3GK4 X;  1M63 B;  2P70 A;  1REC A;  2M1U A;  2MRD A;  1BU3 A;  1BR4 B;  4NDB A;  2BCA A;  1QVI Y;  1XK4 C;  2Q91 A;  4NQG A;  2B1U A;  4WQ2 A;  1EH2 A;  2LHI A;  1SL7 A;  2JRF A;  4GNK B;  1U5I B;  1IWQ A;  1QVI Z;  1H4B A;  2WC5 A;  2KAY A;  4M2O A;  1S1E A;  2MLE C;  4FQT A;  3SG7 A;  1UUS A;  3SS3 A;  3WHU B;  1J7Q A;  2O5G A;  2JNX A;  3PJI A;  1TOP A;  1JFJ A;  3CAB A;  2LE9 B;  1DGU A;  3CZ2 A;  3I5I B;  3S0E A;  3D0Y A;  4JD9 A;  2KQY A;  3CR5 X;  4C0J A;  2JT3 A;  1TNX A;  1OZO A;  5JOL A;  4CPV A;  3OHM B;  5HKW A;  2L2C A;  1ZAC A;  2SCP A;  3BOW A;  1RTP 1;  1B47 A;  1UHN A;  1WDC B;  2H61 C;  2K8M B;  3NSK A;  5F6T A;  3QRX A;  4PDZ A;  4QJ4 B;  1SBJ A;  1B9A A;  1J55 A;  3BUW B;  3CZT X;  5D7F A;  1F70 A;  1MR8 A;  1KQV A;  3I5I C;  4ICB A;  2JXC A;  4C0K A;  1KQM B;  3LLE A;  5D69 A;  1FI5 A;  3BFA A;  4MZJ A;  1IGV A;  1TNP A;  2SAS A;  1YVL A;  2FOT A;  1P28 A;  3RM1 A;  1CFD A;  2OPO A;  4GBA A;  2MAZ A;  4TNC A;  2ZND A;  1GGZ A;  1QV0 A;  5FI2 A;  4F7F A;  5JJG A;  3CR4 X;  1WDC C;  4OV2 A;  2LVI A;  1WRK A;  2EGD A;  1MWN A;  3EK7 A;  1LS8 A;  3FIA A;  1K8U A;  4ZCU A;  4WRI A;  1UHH A;  1KQM C;  2A4J A;  1A29 A;  2E6W A;  1JUO A;  2WOR A;  3EK4 A;  4GAO A;  4HSZ A;  2LMV A;  3NXA A;  5HKZ A;  3OX5 A;  3BXK A;  3O6B A;  2GGM A;  2M7L A;  1SL9 A;  4XYN A;  2L5X B;  3V2L A;  1JBA A;  4DUQ A;  2ZKM X;  2NZ0 A;  4I5N B;  2LLT A;  2M97 A;  1N2D A;  4MRX A;  2KAX A;  4YGC B;  5EL2 A;  3H4S E;  1B1G A;  1X02 A;  2CT9 A;  1ZFS A;  3D74 A;  2BBN A;  2KNE A;  1NX2 A;  1BF5 A;  1Z2C B;  1XFX O;  1LA0 A;  3BFH A;  5D3O A;  2WCM A;  1KWO B;  4HRH A;  1LA3 A;  3DVJ A;  4PE7 A;  3NGV A;  2H8V A;  1TNW A;  3I5H C;  1DJX A;  5I2Q A;  2WCK A;  1FI6 A;  1F4O A;  1A75 B;  2I18 A;  3B7A A;  3SG6 A;  4JWQ A;  1XFR A;  1MHO A;  4OKH A;  1B8C A;  5AXI A;  1YUU A;  2LC5 A;  1LIN A;  1PUL A;  1S6J A;  1SMG A;  2KBM A;  4ZCV A;  1C3Z A;  1ORG A;  1CKK A;  2VRG A;  1IH0 A;  2KI4 B;  1L2O C;  3FE8 A;  2Y5I A;  1UHJ A;  1QAT A;  3VB1 A;  3B6X A;  4CFQ A;  2FCE A;  1FBV A;  1CFC A;  4GFT A;  1CDM A;  1Y1U A;  1D1O A;  1BLQ A;  1CDL A;  1AJ4 A;  4YRU A;  2FCD A;  4YGD B;  2I94 A;  4ETO A;  2ZRT A;  1L7Z A;  4GGF C;  1DF0 B;  3GK2 A;  2K2A A;  1QAS A;  4UPG A;  2KYF A;  1BJF A;  2WCL A;  1TN4 A;  2LVK A;  1PSB A;  1NX3 A;  1DJH A;  3NSL A;  4AQI A;  3QME A;  2PMY A;  3S0F A;  3NSI A;  3KPX A;  4M2Q A;  3TDU A;  3E3R A;  2JNF A;  2FJU B;  2H2K A;  2F8P A;  2AMI A;  5J3X A;  4USL A;  2HF5 A;  4YBH B;  1G8I A;  2L98 A;  3EKJ A;  2ZRS A;  3ICB A;  3FE6 A;  1NX1 A;  2M3W A;  3Q8I A;  3EVV A;  2M7N A;  2RGI A;  2JZI A;  2TN4 A;  2JXL A;  1IJ5 A;  5KSZ A;  1QX5 B;  1ALV A;  2KI6 C;  1K9U A;  1KFX L;  1MXE A;  3BOW B;  3UNW A;  4GGN A;  3DVK A;  4ORA B;  1YX8 A;  1XVJ A;  4INW A;  3LK1 A;  5KTY A;  4QJ5 B;  1SCV A;  1PAL A;  2QPT A;  1AJ5 A;  4PAL A;  3KHE A;  1YRT B;  2ISD A;  3RLZ A;  3EVR A;  2LP3 A;  2LLS A;  1OMV A;  2QEB A;  1S36 A;  4I5J A;  5DKN A;  1PRW A;  1DC1 A;  4XJK A;  5HLO A;  2GTE A;  1DJY A;  1N0Y A;  3A8R A;  1F4Q A;  4FTG A;  2QEO A;  3GOF A; 
#chains in the Genus database with same CATH homology
 4F7F A;  4INX A;  3L4A A;  1LS8 A;  3K1E A;  3D78 A;  2JPO A;  3L47 A;  5DIC A;  3DXL A;  3CDN A;  1TWO A;  3CZ1 A;  3V2L A;  3S0A A;  3OGN A;  3D76 A;  1OOI X;  3RZS A;  5EL2 A;  3D74 A;  3BJH A;  3CYZ A;  3NHI A;  3R1V A;  1C3Y A;  3BFH A;  3R1O A;  1GM0 A;  2QEV A;  2WCM A;  3D73 A;  3NGV A;  2H8V A;  2WCK A;  2KPH A;  3D75 A;  3B86 A;  3B7A A;  1XFR A;  1OOG A;  2P71 A;  2QDI A;  3DZT A;  4PT1 A;  1C3Z A;  1ORG A;  3S0G A;  1T14 A;  3R1P A;  3L4L A;  3FE8 A;  2QEH A;  3VB1 A;  3B6X A;  2ERB A;  3FE9 A;  3B87 A;  3CZ0 A;  2WCJ A;  4OZD A;  3BFB A;  2WCL A;  2P70 A;  3S0F A;  3QME A;  3S0D A;  3N7H A;  3DYE A;  3D77 A;  2WC5 A;  1OOH A;  4FQT A;  3FE6 A;  3PJI A;  3Q8I A;  3CAB A;  3CZ2 A;  3S0E A;  1OOF A;  4JD9 A;  1DQE A;  3B88 A;  2WCH A;  2L2C A;  4INW A;  2FJY A;  1TUJ A;  2QEB A;  2GTE A;  1OW4 A;  3S0B A;  3DY9 A;  2PQL A;  3BFA A;  2WC6 A;  1P28 A;  3R72 A;  2QEO A;  1QWV A;  3NHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...