5DICA

Fatty acid binding protein obp56a from the oral disk of the blowfly phormia regina
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
115
structure length
115
Chain Sequence
HLELTEEQKAKVKVHFDECVKQEKVSEEEATKLRNKDYANPTPAMKCFGTCFFEKIGTLKDGVVQEAVVLEKLSPHFGEEKVKAALDKCKNIKGADRCDTGFKIFECFEKAKDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Odorant-binding protein
molecule keywords Odorant-binding protein
publication title In preparation
rcsb
source organism Phormia regina
total genus 44
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 5dicA00
3NHIA 3BFBA 1OOIX 1QWVA 1DQEA 3DXLA 3D76A 3FE9A 1C3ZA 3D75A 5EL2A 3S0DA 3D77A 1GM0A 3CDNA 2QEHA 3R72A 1OOGA 2KPHA 4FQTA 3B86A 3CABA 3RZSA 3NGVA 1TWOA 3N7HA 4F7FA 1XFRA 5DICA 3D78A 2QEVA 3R1VA 3S0BA 3S0FA 3BFHA 3DZTA 3B7AA 3L4AA 1C3YA 3R1OA 3V2LA 4JD9A 1OOFA 4OZDA 3CZ2A 3CZ1A 2WC5A 3B6XA 2GTEA 3S0GA 2L2CA 2QEOA 3D73A 3DYEA 3BJHA 2QEBA 3S0AA 2H8VA 3FE6A 1P28A 3CYZA 4INXA 3L4LA 3R1PA 1OW4A 3NHTA 2WCKA 3DY9A 3CZ0A 3OGNA 1ORGA 2ERBA 2P71A 2P70A 2WCLA 2JPOA 3VB1A 2FJYA 1LS8A 3S0EA 2WCHA 2WCMA 3D74A 2PQLA 2QDIA 3PJIA 4PT1A 1T14A 3B88A 2WCJA 3QMEA 3L47A 1TUJA 2WC6A 3Q8IA 3K1EA 3B87A 4INWA 3FE8A 1OOHA 3BFAA
chains in the Genus database with same CATH superfamily
2CCMA 1TTXA 1KSOA 1PALA 3WNXB 5CSIA 3VGOA 2Q4UA 5AEQA 3BUXB 4N1FA 4ETOA 2OPOA 3DD4A 1DJXA 3M0WA 3E3RA 2LE9B 1OZSA 1L2OC 1KK7Y 4I5NB 4MBEA 2KLDA 3FE9A 3FS7A 4NDCA 5HYDA 2GGZA 2Y4QA 1KQMC 1FPWA 1WDCB 1F4QA 4GGFC 1BU3A 1ZMZA 1XVJA 1KFUL 2IS9A 1SCMC 1PSBA 2D8NA 5HL1A 2AUCA 2WC8A 1B1GA 5HKWA 4DS7A 1AHRA 5GQQC 3I5FB 3IVTA 1IQ3A 4AOMA 2F3ZA 1DJHA 1N0YA 2QEHA 3NSIA 1ALVA 2K60A 5FI2A 2HQ8A 1B47A 2LUCA 2KQ6A 4UPGA 2EGDA 3D0YA 3OP0A 3NGVA 5CSFA 1IH0A 5HKYA 4CFRA 2QEVA 3FIAA 1K9PA 3DZTA 3I5IB 1B8LA 1CTRA 2O5GA 2KYCA 1CDNA 2KYFA 1B8CA 2K61A 1QX7A 3CZTX 3V2LA 2MA2A 1IJ6A 1S26D 4MRXA 1TNPA 1YUSA 3UO9A 2BCBA 5DKQA 3CZ1A 3PN7B 1DF0B 3HCMA 1EG3A 3OHMB 1F71A 3EVVA 2LP2A 4HRGA 2MHHA 3CR2A 1H4BA 1XFWO 4DUQA 1K90D 2QEOA 1CMGA 2LVIA 5HKZA 1EJ3A 4I5LB 1JWDA 3VRPA 1YRTB 3D73A 2LLSA 1RJVA 1NYAA 1UHIA 2KDHA 2MLEC 1NX0A 1WRZA 3EKJA 3JTDC 1F55A 2QEBA 5ER5A 3PATA 4YRUA 3F45A 2MRDA 2ZNDA 1P28A 2GGMA 1AVSA 3O4YA 4YGEB 1TNWA 2CXJA 3CYZA 4OCIA 1S6CA 1CLMA 1KCYA 1QIWA 2Q91A 5KTYA 1CDPA 1PVAA 1MHOA 1TIZA 5ER4X 2KI6D 4HRHA 1J1DA 1PSRA 1SK6D 3EVRA 1CLLA 2A4JA 1OW4A 1SBJA 1YUUA 2BCXA 2OS8B 2L4HA 2M9GA 2WCKA 1J7QA 5B8IB 2M0RA 1B7TY 1ORGA 2KSPA 4U8DA 4M2QA 1QATA 1NX2A 2WCBA 3CTNA 1EL4A 3D0YB 2JC2A 3DVKA 4WQ2A 2KAXA 1M45A 4YI9A 3VB1A 1SL7A 2H2KA 1LS8A 2YGUA 3AAJA 4KYNA 4MZKA 4WRIA 1UHNA 1LVCD 3DVJA 1QASA 2G2BA 3EVUA 4ORAB 2JOJA 2JT0A 2KAYA 1QVIZ 1AK8A 2JTZA 4HSZA 2I2RE 4MLWA 1EG4A 3LK1A 3SS3A 1CM4A 2BE6A 1RTP1 2F33A 2M49B 2O60A 2KFFA 2WC6A 3QRXA 2LMVA 1RWYA 2NZ0A 2LLTA 1DMOA 3VROA 3ZWHA 2LNKA 3BFBA 4C0JA 1OOIX 1TCOB 2QPTA 5JJGA 1TRFA 2KOTA 2NCPA 2BBNA 1QWVA 1G4YR 1DQEA 1XFXO 3LK0A 1SR6C 2B1UA 1NIWA 1CLBA 1S1EA 1SCVA 2L98A 1LKJA 3LCPC 4JWQA 1J55A 1C3ZA 2ZKMX 3KEVA 2JXCA 4YGBB 2M29A 2LUXA 4PE0A 4PCWA 1TOPA 3SG5A 4YGAA 1BJFA 3CS1A 2PASA 1KQVA 1GQMA 1OMVA 1AJ4A 1GJYA 5FI6A 1KWOC 2CTNA 2KGRA 2MLFC 2LAPA 1L2OB 5EL2A 1MR8A 3OX5A 1DEKA 1W7JB 2M7NA 1FI5A 1F54A 1GM0A 1K96A 1KQMB 1F4OA 1OSAA 3R72A 1OOGA 1QTXA 4A4CA 1CDMA 1TNXA 2P6BB 4D1EA 2NXQA 2LMUA 1SCMB 4OVNF 5DKNA 1CNPA 4L9MA 2ZFDA 1DJGA 1K9KA 1NWDA 2LCPA 3IQOA 3TS5C 2LANA 4XJKA 1XFRA 3VRQA 1SRAA 1J7RA 3I5GB 5J3XA 1JBAA 1CM1A 1DELA 1XFVO 1UHHA 1Z4HA 3B7AA 1SMGA 4OR9B 1TCFA 2JT8A 3FWBA 3DF0A 2KI4C 1OOFA 4GAOA 4MZLA 5I94A 4I5KA 1QJTA 1V1FA 4PHKA 3SIAA 2LVJA 1KK8C 2K7OA 1BG1A 1XO5A 2M97A 2Y1MA 4GBAA 3ZNIA 2LVKA 3AKAA 1KFUS 3C1VA 3SG3A 4QJ3B 3I5HC 1V1GA 5DKRA 1AP4A 1QVIY 4IL1A 1EH2A 2BECA 3BUMB 1WLZA 1NX3A 3DYEA 1NPQA 2F3YA 3BJHA 4IJ7A 2LHIA 1IKUA 4OKHA 1Y1AA 2H8VA 1LA3A 2LP3A 2LV7A 1WRKA 4NDDA 4P2YB 1CFDA 1SKTA 4YGDB 2WCFA 3TZ1A 1AUIB 1PK0D 5FYXA 1XYDA 1Y6WA 1C7WA 1QS7A 1CFPA 1S36A 1A29A 4INXA 2LHLA 3WHUB 2HQWA 1JUOA 1C07A 2JT3A 1K2HA 4MN0A 4JPZB 1NX1A 2HF5A 1OMRA 2FCDA 3PFVA 3GOFA 3CZ0A 3OGNA 1WDCC 5K89A 2P71A 2ISDA 5I2LA 2P70A 1UHJA 2WCLA 2L5XB 2ZRTA 1MXLC 3A4UB 1ZOTB 1UWOA 3I5FC 3IF7A 4XJKB 1G8IA 2F2PA 1MWNA 1QV0A 2K2FA 3D74A 4PHNA 1PRWA 2PQLA 5FI7A 1F70A 2F2OA 4GPLB 1CMFA 3O2PA 3TDZA 2M7LA 1ZFSA 1KFXL 2KHNA 1UURA 3B88A 5CSJA 1JSAA 1S5GZ 4C0KA 3DF0B 4PDZA 1QX2A 1HQVA 1TNQA 1H8BA 3Q8IA 2VRGA 5D69A 4INWA 3FE8A 1KFXS 1OOHA 2JU0A 2M1UA 3NHIA 2E6WA 3SS5A 4GGFA 2OTGC 2KQYA 2L2EA 3PM8A 5I2OA 5D7FA 2AAOA 3NXAA 1FW4A 2KAVA 4FQOA 1IJ5A 1RECA 2BL0C 5KSZA 3WHTB 1C7VA 5AERA 1U5IA 1MQ1A 3D76A 1SW8A 1YRUB 4XYNA 3RM1A 5F6TA 2G9BA 3GK2A 3LL8B 1RFJA 1MXEA 2PVBA 1Y0VH 4JKTA 2MBXA 4R1EA 5TNCA 4DRWA 3S0DA 3EK7A 3D77A 1IIOA 3BFAA 4NQGA 1L7ZA 2COLB 4WQ3A 4M2PA 1YX7A 2KPHA 4GFTA 4MEWA 2K7CA 5I8NA 2EC6C 3CABA 1NCZA 4CFQA 3JVTB 2L5YA 3RZSA 2KBMA 1R2UA 2LVVA 4PHJA 4HREE 5KU1A 1HT9A 5DICA 3D78A 3IQQA 2CNPA 1SY9A 4QJ4B 3AAKA 3R1VA 3SIBA 3S0BA 1SL8A 3S0FA 1RROA 2K7BA 3BFHA 1OE9B 2HPSA 1FF1A 3GK1A 4CLNA 3L4AA 3CWGA 4C0LA 1BR4B 1NSHA 1JF0A 1XFYO 3TS5B 2KFHA 1WRLA 4OZDA 2DOQA 3CZ2A 4F0ZB 5BPJA 2JULA 3B6XA 2GTEA 3OBVA 1SNLA 3O78A 4MVFA 3PLFB 1D1OA 4PE1A 2GV5A 1BR1B 2L2CA 3NSOA 3EKHA 1RK9A 1BODA 2PSRA 2FCEA 2I94A 1SL9A 1A03A 1YUTA 1S5GY 2SASA 2NCOA 1DJWA 1U5IB 2JRFA 1IQ5A 1DGUA 2BCAA 3O6BA 4YI8A 3FE6A 4BY4A 3S0AA 1GGWA 1Q80A 5D3OA 2MJWB 3OB2B 3CGAA 1YVLA 1R6PA 4YBHB 3SG4A 2BE4A 2R2IA 1B8RA 1IWQA 2M1KB 1BMOA 2PALA 4BY5A 1NUBA 2K7DA 4M2OA 2FOTA 4GNKB 3L4LA 2L51A 1M46A 1OMDA 2KGBC 3R1PA 1A2XA 1GGZA 1XK4C 2LM5A 1K93D 2ZRSA 1QV1A 1TUZA 4PE4A 3BOWA 2L0PA 4MRYA 3SG7A 1S6IA 2JPOA 1M39A 2AMIA 2KFGA 2K2AA 2NLNA 1JF2A 3PSRA 1J7PA 5CSNA 3FWCA 2FJYA 2JXLA 2SCPA 4AQJA 2WCHA 2WCMA 1B7TZ 1OOJA 5AANA 3TUYC 3TDUA 1S3PA 1BF5A 2QDIA 1JC2A 2I18A 2WOSA 2ZN8A 3CR5X 1T14A 2WCJA 1IG5A 3NSLA 4JQ0D 2LC5A 1YVHA 3JTDB 4PHMA 3QMEA 1CB1A 1F8HA 2PMYA 1DGVA 1TUJA 3ICBA 3OX6A 4DCKA 2BKHB 1B9AA 3I5GC 2H61C 3B87A 3AKBA 2ZNEA 1NCYA 3SS4A 4USLA 4ICBA 4ORCB 4MSPA 1EXRA 1YX8A 3PALA 1JFKA 4NDBA 4GUKA 4I5JA 3GK4X 1CFFA 1Z2CB 3KPXA 1FBVA 1N65A 2K8MB 1IGVA 1LA0A 3BUOB 3DVMA 3DXLA 1CKKA 1W7IB 1LINA 3BUWB 4QJ5B 2Y5IA 2JZIA 1WLMA 3D75A 4MZJA 2OTGB 4CIDA 3K21A 1VRKA 4P5OE 3WXAA 1A75A 2Y1NA 3EG5B 2EHBA 1CDLA 5PALA 2BL0B 2ZN9A 1Y1UA 3KO0A 5IBWA 2JNXA 3SJSA 2L50A 2JWWA 1K95A 1TN4A 3CDNA 1XA5A 4FQTA 1BOCA 2K0JA 5HLOA 1E8AA 3B86A 3CR4X 4CPVA 3CLNA 1QLSA 3BOWB 3I5IC 1ALWA 3OB1B 1TWOA 2PRUA 3N7HA 1UP5A 4GGNA 4N5XA 3KF9A 4F7FA 3O4XA 2KNEA 3PN7C 1DT7B 2WORA 3BXKA 1K94A 3H4SE 1XK4A 1UHKA 2EC6B 1BLQA 1J7OA 2I7AA 4PE7A 1C3YA 1M63B 3R1OA 4DIRA 4JD9A 3EK8A 1SR6B 1CFCA 1KK7Z 2MAZA 1LXFC 2WC5A 2LMTA 3DVEA 1K8UA 1WY9A 3EK4A 3S0GA 1SSEB 1YURA 1QIVA 1DJYA 2JTTA 1AJ5A 2V53A 5JOLA 1SPYA 3VRRA 1ODBA 5AFPA 2PYQA 1K9UA 1KWOB 1OZOA 1SYMA 1DC1A 4YGCB 1PVBA 2KLEA 1YTZC 1MUXA 2H61A 2QACA 3BYAA 5CPVA 4FTGA 2JPTA 1X02A 2OS8C 4AQIA 1B4CA 4Q04A 3BQ3A 3LLEA 1ZUZA 4PALA 2WNDA 5I2QA 1A75B 3A8RA 3MSEB 1DJZA 3SG2A 4N1GA 3KHEA 4ORBB 2CBLA 3HX4A 4OV2A 4A4BA 2FJUB 1G33A 2CT9A 4ZCVA 1DTLA 2L4IA 1QLKA 2BNXA 1N2DA 1XFUO 2JNFA 3NHTA 5AXIA 3DY9A 2BBMA 1JFJA 2HETA 1QX5B 1PULA 2BAPA 2ERBA 4ZCUA 2E30A 2KBIA 2WCEA 2M8UA 5HLVA 3SG6A 2TN4A 2LLUA 1QXPA 2KI4B 1NP8A 2JQ6A 3S0EA 1DJIA 1KK8B 1NCXA 3RLZA 1YR5A 4E68A 2BKIB 3NSKA 1ZACA 3VRNA 3BUNB 5G08A 3PJIA 1Y1XA 1A4PA 4PT1A 3I5HB 1MF8B 2F8PA 3UNWA 3D10A 1W9ZA 1DVIA 1FI6A 3JVTC 2KI6C 1M31A 1KSMA 3TDIA 3L47A 3PM2A 1UUSA 1IRJA 1OQPA 1J1EA 1S6JA 1DF0A 3TUYB 3K1EA 4TNCA 1XFZO 2RGIA 1BT6A 2M3WA
chains in the Genus database with same CATH topology
3NHIA 3BFBA 1OOIX 1QWVA 1DQEA 3DXLA 3D76A 3FE9A 1C3ZA 3D75A 5EL2A 3S0DA 3D77A 1GM0A 3CDNA 2QEHA 3R72A 1OOGA 2KPHA 4FQTA 3B86A 3CABA 3RZSA 3NGVA 1TWOA 3N7HA 4F7FA 1XFRA 5DICA 3D78A 2QEVA 3R1VA 3S0BA 3S0FA 3BFHA 3DZTA 3B7AA 3L4AA 1C3YA 3R1OA 3V2LA 4JD9A 1OOFA 4OZDA 3CZ2A 3CZ1A 2WC5A 3B6XA 2GTEA 3S0GA 2L2CA 2QEOA 3D73A 3DYEA 3BJHA 2QEBA 3S0AA 2H8VA 3FE6A 1P28A 3CYZA 4INXA 3L4LA 3R1PA 1OW4A 3NHTA 2WCKA 3DY9A 3CZ0A 3OGNA 1ORGA 2ERBA 2P71A 2P70A 2WCLA 2JPOA 3VB1A 2FJYA 1LS8A 3S0EA 2WCHA 2WCMA 3D74A 2PQLA 2QDIA 3PJIA 4PT1A 1T14A 3B88A 2WCJA 3QMEA 3L47A 1TUJA 2WC6A 3Q8IA 3K1EA 3B87A 4INWA 3FE8A 1OOHA 3BFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHI A;  3BFB A;  1OOI X;  1QWV A;  1DQE A;  3DXL A;  3D76 A;  3FE9 A;  1C3Z A;  3D75 A;  5EL2 A;  3S0D A;  3D77 A;  1GM0 A;  3CDN A;  2QEH A;  3R72 A;  1OOG A;  2KPH A;  4FQT A;  3B86 A;  3CAB A;  3RZS A;  3NGV A;  1TWO A;  3N7H A;  4F7F A;  1XFR A;  5DIC A;  3D78 A;  2QEV A;  3R1V A;  3S0B A;  3S0F A;  3BFH A;  3DZT A;  3B7A A;  3L4A A;  1C3Y A;  3R1O A;  3V2L A;  4JD9 A;  1OOF A;  4OZD A;  3CZ2 A;  3CZ1 A;  2WC5 A;  3B6X A;  2GTE A;  3S0G A;  2L2C A;  2QEO A;  3D73 A;  3DYE A;  3BJH A;  2QEB A;  3S0A A;  2H8V A;  3FE6 A;  1P28 A;  3CYZ A;  4INX A;  3L4L A;  3R1P A;  1OW4 A;  3NHT A;  2WCK A;  3DY9 A;  3CZ0 A;  3OGN A;  1ORG A;  2ERB A;  2P71 A;  2P70 A;  2WCL A;  2JPO A;  3VB1 A;  2FJY A;  1LS8 A;  3S0E A;  2WCH A;  2WCM A;  3D74 A;  2PQL A;  2QDI A;  3PJI A;  4PT1 A;  1T14 A;  3B88 A;  2WCJ A;  3QME A;  3L47 A;  1TUJ A;  2WC6 A;  3Q8I A;  3K1E A;  3B87 A;  4INW A;  3FE8 A;  1OOH A;  3BFA A; 
#chains in the Genus database with same CATH topology
 2CCM A;  1TTX A;  1KSO A;  1PAL A;  3WNX B;  5CSI A;  3VGO A;  2Q4U A;  5AEQ A;  3BUX B;  4N1F A;  4ETO A;  2OPO A;  3DD4 A;  1DJX A;  3M0W A;  3E3R A;  2LE9 B;  1OZS A;  1L2O C;  1KK7 Y;  4I5N B;  4MBE A;  2KLD A;  3FE9 A;  3FS7 A;  4NDC A;  5HYD A;  2GGZ A;  2Y4Q A;  1KQM C;  1FPW A;  1WDC B;  1F4Q A;  4GGF C;  1BU3 A;  1ZMZ A;  1XVJ A;  1KFU L;  2IS9 A;  1SCM C;  1PSB A;  2D8N A;  5HL1 A;  2AUC A;  2WC8 A;  1B1G A;  5HKW A;  4DS7 A;  1AHR A;  5GQQ C;  3I5F B;  3IVT A;  1IQ3 A;  4AOM A;  2F3Z A;  1DJH A;  1N0Y A;  2QEH A;  3NSI A;  1ALV A;  2K60 A;  5FI2 A;  2HQ8 A;  1B47 A;  2LUC A;  2KQ6 A;  4UPG A;  2EGD A;  3D0Y A;  3OP0 A;  3NGV A;  5CSF A;  1IH0 A;  5HKY A;  4CFR A;  2QEV A;  3FIA A;  1K9P A;  3DZT A;  3I5I B;  1B8L A;  1CTR A;  2O5G A;  2KYC A;  1CDN A;  2KYF A;  1B8C A;  2K61 A;  1QX7 A;  3CZT X;  3V2L A;  2MA2 A;  1IJ6 A;  1S26 D;  4MRX A;  1TNP A;  1YUS A;  3UO9 A;  2BCB A;  5DKQ A;  3CZ1 A;  3PN7 B;  1DF0 B;  3HCM A;  1EG3 A;  3OHM B;  1F71 A;  3EVV A;  2LP2 A;  4HRG A;  2MHH A;  3CR2 A;  1H4B A;  1XFW O;  4DUQ A;  1K90 D;  2QEO A;  1CMG A;  2LVI A;  5HKZ A;  1EJ3 A;  4I5L B;  1JWD A;  3VRP A;  1YRT B;  3D73 A;  2LLS A;  1RJV A;  1NYA A;  1UHI A;  2KDH A;  2MLE C;  1NX0 A;  1WRZ A;  3EKJ A;  3JTD C;  1F55 A;  2QEB A;  5ER5 A;  3PAT A;  4YRU A;  3F45 A;  2MRD A;  2ZND A;  1P28 A;  2GGM A;  1AVS A;  3O4Y A;  4YGE B;  1TNW A;  2CXJ A;  3CYZ A;  4OCI A;  1S6C A;  1CLM A;  1KCY A;  1QIW A;  2Q91 A;  5KTY A;  1CDP A;  1PVA A;  1MHO A;  1TIZ A;  5ER4 X;  2KI6 D;  4HRH A;  1J1D A;  1PSR A;  1SK6 D;  3EVR A;  1CLL A;  2A4J A;  1OW4 A;  1SBJ A;  1YUU A;  2BCX A;  2OS8 B;  2L4H A;  2M9G A;  2WCK A;  1J7Q A;  5B8I B;  2M0R A;  1B7T Y;  1ORG A;  2KSP A;  4U8D A;  4M2Q A;  1QAT A;  1NX2 A;  2WCB A;  3CTN A;  1EL4 A;  3D0Y B;  2JC2 A;  3DVK A;  4WQ2 A;  2KAX A;  1M45 A;  4YI9 A;  3VB1 A;  1SL7 A;  2H2K A;  1LS8 A;  2YGU A;  3AAJ A;  4KYN A;  4MZK A;  4WRI A;  1UHN A;  1LVC D;  3DVJ A;  1QAS A;  2G2B A;  3EVU A;  4ORA B;  2JOJ A;  2JT0 A;  2KAY A;  1QVI Z;  1AK8 A;  2JTZ A;  4HSZ A;  2I2R E;  4MLW A;  1EG4 A;  3LK1 A;  3SS3 A;  1CM4 A;  2BE6 A;  1RTP 1;  2F33 A;  2M49 B;  2O60 A;  2KFF A;  2WC6 A;  3QRX A;  2LMV A;  1RWY A;  2NZ0 A;  2LLT A;  1DMO A;  3VRO A;  3ZWH A;  2LNK A;  3BFB A;  4C0J A;  1OOI X;  1TCO B;  2QPT A;  5JJG A;  1TRF A;  2KOT A;  2NCP A;  2BBN A;  1QWV A;  1G4Y R;  1DQE A;  1XFX O;  3LK0 A;  1SR6 C;  2B1U A;  1NIW A;  1CLB A;  1S1E A;  1SCV A;  2L98 A;  1LKJ A;  3LCP C;  4JWQ A;  1J55 A;  1C3Z A;  2ZKM X;  3KEV A;  2JXC A;  4YGB B;  2M29 A;  2LUX A;  4PE0 A;  4PCW A;  1TOP A;  3SG5 A;  4YGA A;  1BJF A;  3CS1 A;  2PAS A;  1KQV A;  1GQM A;  1OMV A;  1AJ4 A;  1GJY A;  5FI6 A;  1KWO C;  2CTN A;  2KGR A;  2MLF C;  2LAP A;  1L2O B;  5EL2 A;  1MR8 A;  3OX5 A;  1DEK A;  1W7J B;  2M7N A;  1FI5 A;  1F54 A;  1GM0 A;  1K96 A;  1KQM B;  1F4O A;  1OSA A;  3R72 A;  1OOG A;  1QTX A;  4A4C A;  1CDM A;  1TNX A;  2P6B B;  4D1E A;  2NXQ A;  2LMU A;  1SCM B;  4OVN F;  5DKN A;  1CNP A;  4L9M A;  2ZFD A;  1DJG A;  1K9K A;  1NWD A;  2LCP A;  3IQO A;  3TS5 C;  2LAN A;  4XJK A;  1XFR A;  3VRQ A;  1SRA A;  1J7R A;  3I5G B;  5J3X A;  1JBA A;  1CM1 A;  1DEL A;  1XFV O;  1UHH A;  1Z4H A;  3B7A A;  1SMG A;  4OR9 B;  1TCF A;  2JT8 A;  3FWB A;  3DF0 A;  2KI4 C;  1OOF A;  4GAO A;  4MZL A;  5I94 A;  4I5K A;  1QJT A;  1V1F A;  4PHK A;  3SIA A;  2LVJ A;  1KK8 C;  2K7O A;  1BG1 A;  1XO5 A;  2M97 A;  2Y1M A;  4GBA A;  3ZNI A;  2LVK A;  3AKA A;  1KFU S;  3C1V A;  3SG3 A;  4QJ3 B;  3I5H C;  1V1G A;  5DKR A;  1AP4 A;  1QVI Y;  4IL1 A;  1EH2 A;  2BEC A;  3BUM B;  1WLZ A;  1NX3 A;  3DYE A;  1NPQ A;  2F3Y A;  3BJH A;  4IJ7 A;  2LHI A;  1IKU A;  4OKH A;  1Y1A A;  2H8V A;  1LA3 A;  2LP3 A;  2LV7 A;  1WRK A;  4NDD A;  4P2Y B;  1CFD A;  1SKT A;  4YGD B;  2WCF A;  3TZ1 A;  1AUI B;  1PK0 D;  5FYX A;  1XYD A;  1Y6W A;  1C7W A;  1QS7 A;  1CFP A;  1S36 A;  1A29 A;  4INX A;  2LHL A;  3WHU B;  2HQW A;  1JUO A;  1C07 A;  2JT3 A;  1K2H A;  4MN0 A;  4JPZ B;  1NX1 A;  2HF5 A;  1OMR A;  2FCD A;  3PFV A;  3GOF A;  3CZ0 A;  3OGN A;  1WDC C;  5K89 A;  2P71 A;  2ISD A;  5I2L A;  2P70 A;  1UHJ A;  2WCL A;  2L5X B;  2ZRT A;  1MXL C;  3A4U B;  1ZOT B;  1UWO A;  3I5F C;  3IF7 A;  4XJK B;  1G8I A;  2F2P A;  1MWN A;  1QV0 A;  2K2F A;  3D74 A;  4PHN A;  1PRW A;  2PQL A;  5FI7 A;  1F70 A;  2F2O A;  4GPL B;  1CMF A;  3O2P A;  3TDZ A;  2M7L A;  1ZFS A;  1KFX L;  2KHN A;  1UUR A;  3B88 A;  5CSJ A;  1JSA A;  1S5G Z;  4C0K A;  3DF0 B;  4PDZ A;  1QX2 A;  1HQV A;  1TNQ A;  1H8B A;  3Q8I A;  2VRG A;  5D69 A;  4INW A;  3FE8 A;  1KFX S;  1OOH A;  2JU0 A;  2M1U A;  3NHI A;  2E6W A;  3SS5 A;  4GGF A;  2OTG C;  2KQY A;  2L2E A;  3PM8 A;  5I2O A;  5D7F A;  2AAO A;  3NXA A;  1FW4 A;  2KAV A;  4FQO A;  1IJ5 A;  1REC A;  2BL0 C;  5KSZ A;  3WHT B;  1C7V A;  5AER A;  1U5I A;  1MQ1 A;  3D76 A;  1SW8 A;  1YRU B;  4XYN A;  3RM1 A;  5F6T A;  2G9B A;  3GK2 A;  3LL8 B;  1RFJ A;  1MXE A;  2PVB A;  1Y0V H;  4JKT A;  2MBX A;  4R1E A;  5TNC A;  4DRW A;  3S0D A;  3EK7 A;  3D77 A;  1IIO A;  3BFA A;  4NQG A;  1L7Z A;  2COL B;  4WQ3 A;  4M2P A;  1YX7 A;  2KPH A;  4GFT A;  4MEW A;  2K7C A;  5I8N A;  2EC6 C;  3CAB A;  1NCZ A;  4CFQ A;  3JVT B;  2L5Y A;  3RZS A;  2KBM A;  1R2U A;  2LVV A;  4PHJ A;  4HRE E;  5KU1 A;  1HT9 A;  5DIC A;  3D78 A;  3IQQ A;  2CNP A;  1SY9 A;  4QJ4 B;  3AAK A;  3R1V A;  3SIB A;  3S0B A;  1SL8 A;  3S0F A;  1RRO A;  2K7B A;  3BFH A;  1OE9 B;  2HPS A;  1FF1 A;  3GK1 A;  4CLN A;  3L4A A;  3CWG A;  4C0L A;  1BR4 B;  1NSH A;  1JF0 A;  1XFY O;  3TS5 B;  2KFH A;  1WRL A;  4OZD A;  2DOQ A;  3CZ2 A;  4F0Z B;  5BPJ A;  2JUL A;  3B6X A;  2GTE A;  3OBV A;  1SNL A;  3O78 A;  4MVF A;  3PLF B;  1D1O A;  4PE1 A;  2GV5 A;  1BR1 B;  2L2C A;  3NSO A;  3EKH A;  1RK9 A;  1BOD A;  2PSR A;  2FCE A;  2I94 A;  1SL9 A;  1A03 A;  1YUT A;  1S5G Y;  2SAS A;  2NCO A;  1DJW A;  1U5I B;  2JRF A;  1IQ5 A;  1DGU A;  2BCA A;  3O6B A;  4YI8 A;  3FE6 A;  4BY4 A;  3S0A A;  1GGW A;  1Q80 A;  5D3O A;  2MJW B;  3OB2 B;  3CGA A;  1YVL A;  1R6P A;  4YBH B;  3SG4 A;  2BE4 A;  2R2I A;  1B8R A;  1IWQ A;  2M1K B;  1BMO A;  2PAL A;  4BY5 A;  1NUB A;  2K7D A;  4M2O A;  2FOT A;  4GNK B;  3L4L A;  2L51 A;  1M46 A;  1OMD A;  2KGB C;  3R1P A;  1A2X A;  1GGZ A;  1XK4 C;  2LM5 A;  1K93 D;  2ZRS A;  1QV1 A;  1TUZ A;  4PE4 A;  3BOW A;  2L0P A;  4MRY A;  3SG7 A;  1S6I A;  2JPO A;  1M39 A;  2AMI A;  2KFG A;  2K2A A;  2NLN A;  1JF2 A;  3PSR A;  1J7P A;  5CSN A;  3FWC A;  2FJY A;  2JXL A;  2SCP A;  4AQJ A;  2WCH A;  2WCM A;  1B7T Z;  1OOJ A;  5AAN A;  3TUY C;  3TDU A;  1S3P A;  1BF5 A;  2QDI A;  1JC2 A;  2I18 A;  2WOS A;  2ZN8 A;  3CR5 X;  1T14 A;  2WCJ A;  1IG5 A;  3NSL A;  4JQ0 D;  2LC5 A;  1YVH A;  3JTD B;  4PHM A;  3QME A;  1CB1 A;  1F8H A;  2PMY A;  1DGV A;  1TUJ A;  3ICB A;  3OX6 A;  4DCK A;  2BKH B;  1B9A A;  3I5G C;  2H61 C;  3B87 A;  3AKB A;  2ZNE A;  1NCY A;  3SS4 A;  4USL A;  4ICB A;  4ORC B;  4MSP A;  1EXR A;  1YX8 A;  3PAL A;  1JFK A;  4NDB A;  4GUK A;  4I5J A;  3GK4 X;  1CFF A;  1Z2C B;  3KPX A;  1FBV A;  1N65 A;  2K8M B;  1IGV A;  1LA0 A;  3BUO B;  3DVM A;  3DXL A;  1CKK A;  1W7I B;  1LIN A;  3BUW B;  4QJ5 B;  2Y5I A;  2JZI A;  1WLM A;  3D75 A;  4MZJ A;  2OTG B;  4CID A;  3K21 A;  1VRK A;  4P5O E;  3WXA A;  1A75 A;  2Y1N A;  3EG5 B;  2EHB A;  1CDL A;  5PAL A;  2BL0 B;  2ZN9 A;  1Y1U A;  3KO0 A;  5IBW A;  2JNX A;  3SJS A;  2L50 A;  2JWW A;  1K95 A;  1TN4 A;  3CDN A;  1XA5 A;  4FQT A;  1BOC A;  2K0J A;  5HLO A;  1E8A A;  3B86 A;  3CR4 X;  4CPV A;  3CLN A;  1QLS A;  3BOW B;  3I5I C;  1ALW A;  3OB1 B;  1TWO A;  2PRU A;  3N7H A;  1UP5 A;  4GGN A;  4N5X A;  3KF9 A;  4F7F A;  3O4X A;  2KNE A;  3PN7 C;  1DT7 B;  2WOR A;  3BXK A;  1K94 A;  3H4S E;  1XK4 A;  1UHK A;  2EC6 B;  1BLQ A;  1J7O A;  2I7A A;  4PE7 A;  1C3Y A;  1M63 B;  3R1O A;  4DIR A;  4JD9 A;  3EK8 A;  1SR6 B;  1CFC A;  1KK7 Z;  2MAZ A;  1LXF C;  2WC5 A;  2LMT A;  3DVE A;  1K8U A;  1WY9 A;  3EK4 A;  3S0G A;  1SSE B;  1YUR A;  1QIV A;  1DJY A;  2JTT A;  1AJ5 A;  2V53 A;  5JOL A;  1SPY A;  3VRR A;  1ODB A;  5AFP A;  2PYQ A;  1K9U A;  1KWO B;  1OZO A;  1SYM A;  1DC1 A;  4YGC B;  1PVB A;  2KLE A;  1YTZ C;  1MUX A;  2H61 A;  2QAC A;  3BYA A;  5CPV A;  4FTG A;  2JPT A;  1X02 A;  2OS8 C;  4AQI A;  1B4C A;  4Q04 A;  3BQ3 A;  3LLE A;  1ZUZ A;  4PAL A;  2WND A;  5I2Q A;  1A75 B;  3A8R A;  3MSE B;  1DJZ A;  3SG2 A;  4N1G A;  3KHE A;  4ORB B;  2CBL A;  3HX4 A;  4OV2 A;  4A4B A;  2FJU B;  1G33 A;  2CT9 A;  4ZCV A;  1DTL A;  2L4I A;  1QLK A;  2BNX A;  1N2D A;  1XFU O;  2JNF A;  3NHT A;  5AXI A;  3DY9 A;  2BBM A;  1JFJ A;  2HET A;  1QX5 B;  1PUL A;  2BAP A;  2ERB A;  4ZCU A;  2E30 A;  2KBI A;  2WCE A;  2M8U A;  5HLV A;  3SG6 A;  2TN4 A;  2LLU A;  1QXP A;  2KI4 B;  1NP8 A;  2JQ6 A;  3S0E A;  1DJI A;  1KK8 B;  1NCX A;  3RLZ A;  1YR5 A;  4E68 A;  2BKI B;  3NSK A;  1ZAC A;  3VRN A;  3BUN B;  5G08 A;  3PJI A;  1Y1X A;  1A4P A;  4PT1 A;  3I5H B;  1MF8 B;  2F8P A;  3UNW A;  3D10 A;  1W9Z A;  1DVI A;  1FI6 A;  3JVT C;  2KI6 C;  1M31 A;  1KSM A;  3TDI A;  3L47 A;  3PM2 A;  1UUS A;  1IRJ A;  1OQP A;  1J1E A;  1S6J A;  1DF0 A;  3TUY B;  3K1E A;  4TNC A;  1XFZ O;  2RGI A;  1BT6 A;  2M3W A; 
#chains in the Genus database with same CATH homology
 3NHI A;  3BFB A;  1OOI X;  1QWV A;  1DQE A;  3DXL A;  3D76 A;  3FE9 A;  1C3Z A;  3D75 A;  5EL2 A;  3S0D A;  3D77 A;  1GM0 A;  3CDN A;  2QEH A;  3R72 A;  1OOG A;  2KPH A;  4FQT A;  3B86 A;  3CAB A;  3RZS A;  3NGV A;  1TWO A;  3N7H A;  4F7F A;  1XFR A;  5DIC A;  3D78 A;  2QEV A;  3R1V A;  3S0B A;  3S0F A;  3BFH A;  3DZT A;  3B7A A;  3L4A A;  1C3Y A;  3R1O A;  3V2L A;  4JD9 A;  1OOF A;  4OZD A;  3CZ2 A;  3CZ1 A;  2WC5 A;  3B6X A;  2GTE A;  3S0G A;  2L2C A;  2QEO A;  3D73 A;  3DYE A;  3BJH A;  2QEB A;  3S0A A;  2H8V A;  3FE6 A;  1P28 A;  3CYZ A;  4INX A;  3L4L A;  3R1P A;  1OW4 A;  3NHT A;  2WCK A;  3DY9 A;  3CZ0 A;  3OGN A;  1ORG A;  2ERB A;  2P71 A;  2P70 A;  2WCL A;  2JPO A;  3VB1 A;  2FJY A;  1LS8 A;  3S0E A;  2WCH A;  2WCM A;  3D74 A;  2PQL A;  2QDI A;  3PJI A;  4PT1 A;  1T14 A;  3B88 A;  2WCJ A;  3QME A;  3L47 A;  1TUJ A;  2WC6 A;  3Q8I A;  3K1E A;  3B87 A;  4INW A;  3FE8 A;  1OOH A;  3BFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...