5DICA

Fatty acid binding protein obp56a from the oral disk of the blowfly phormia regina
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
115
structure length
115
Chain Sequence
b'HLELTEEQKAKVKVHFDECVKQEKVSEEEATKLRNKDYANPTPAMKCFGTCFFEKIGTLKDGVVQEAVVLEKLSPHFGEEKVKAALDKCKNIKGADRCDTGFKIFECFEKAKDEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant-binding protein
publication title In preparation
rcsb
source organism Phormia regina
molecule tags Odorant-binding protein
total genus 44
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 5dicA00
2P71A 4INWA 3BJHA 3D78A 3DZTA 3CZ1A 3B86A 3QMEA 2QDIA 3BFHA 5EL2A 2WCJA 3BFAA 1P28A 1C3ZA 3BFBA 3OGNA 3R1PA 3B88A 3L47A 1OOIX 1XFRA 3B6XA 3Q8IA 3N7HA 3NHTA 2ERBA 1C3YA 3D76A 1T14A 2QEVA 3S0BA 3V2LA 2WCLA 3S0GA 1DQEA 3FE6A 3CABA 3VB1A 2GTEA 1OOHA 3K1EA 1ORGA 2FJYA 1TUJA 2QEBA 3DY9A 3D73A 2PQLA 3NHIA 3R72A 3L4AA 1LS8A 3CYZA 3PJIA 1OW4A 1GM0A 2QEOA 3DYEA 4OZDA 2WCMA 3B7AA 3B87A 2P70A 3CZ2A 3NGVA 5DICA 4JD9A 3R1OA 2KPHA 1QWVA 2WCKA 3FE8A 2WCHA 3L4LA 3S0AA 3S0EA 3D74A 2WC5A 2L2CA 3DXLA 2JPOA 3R1VA 2WC6A 3S0FA 3D77A 3RZSA 4F7FA 4INXA 3FE9A 2H8VA 3S0DA 4PT1A 1OOGA 1OOFA 3CDNA 3D75A 4FQTA 2QEHA 1TWOA 3CZ0A
chains in the Genus database with same CATH superfamily
1XFZO 3BUWB 1UP5A 3D10A 2WOSA 3C1VA 1QTXA 2ZNDA 1SPYA 2JNFA 2M7NA 3PM8A 1PRWA 1DF0A 1DJGA 2AAOA 3RM1A 3CZ1A 3F45A 1NP8A 1DJWA 1YR5A 3QMEA 3CGAA 1FF1A 2QDIA 5F6TA 4PDZA 1CMGA 1KCYA 1DGUA 2KQYA 1Y6WA 4YBHB 1PSBA 3UNWA 1SNLA 2FCEA 3SG6A 5HYDA 2AMIA 3R1PA 3CR2A 1WLZA 5HKWA 1J7OA 2GGZA 3OP0A 2CBLA 2KI6C 3OB1B 4PHJA 1S6IA 2KLDA 1CLLA 3EK4A 2L4HA 3HCMA 2JQ6A 3A8RA 1NCZA 3CLNA 1ALVA 4F0ZB 1ZMZA 4I5JA 5JOLA 1WLMA 2JNXA 1QLSA 2MAZA 2Y5IA 3DF0B 5KU1A 1SCVA 1UHJA 1XFWO 3ICBA 1SRAA 2JT8A 3CR4X 1JUOA 4ORBB 5ER5A 3V2LA 4M2OA 2FCDA 5AFPA 1SYMA 3WHTB 5HL1A 5I8NA 2I7AA 3CWGA 2LVKA 1Y1XA 1WRLA 1DJZA 1OOHA 1A4PA 3BYAA 4HSZA 1NUBA 1CTRA 1ORGA 1UWOA 2CNPA 2LAPA 4A4BA 1OMRA 3DVMA 3D73A 2PQLA 1H4BA 3R72A 1WRZA 3LL8B 3OB2B 1YVHA 2GGMA 2HQWA 5GQQC 3FS7A 4GNKB 5CSNA 4MLWA 3DYEA 1TNWA 3EVRA 2CXJA 3H4SE 1B4CA 1W9ZA 1CDNA 1K8UA 1U5IB 3B7AA 1XA5A 2L0PA 4MZKA 3B87A 1IG5A 1J7PA 1DELA 1OZOA 1S3PA 2OS8B 3NGVA 4PHKA 1QWVA 2LP2A 2JTZA 1S6JA 3EKJA 2OPOA 1MR8A 2L98A 4GGFA 1S36A 1GGZA 3TZ1A 1SBJA 3O4YA 2G2BA 2NZ0A 1EJ3A 3BQ3A 1JSAA 1SL9A 2EGDA 1KWOC 1AUIB 4Q04A 3TS5C 2M3WA 1M45A 3GK1A 2BECA 4OR9B 3ZWHA 1MXEA 3SG2A 3S0FA 2MJWB 1WRKA 4UPGA 2K8MB 2M29A 3E3RA 1D1OA 1CNPA 1CB1A 1KQVA 1QJTA 3TUYB 1A75B 2M49B 1B8CA 3OHMB 1DJHA 1WDCC 1S5GY 1YRUB 1YUTA 2MHHA 1F55A 4C0KA 1YX8A 1K9PA 3I5FC 4MN0A 3VRNA 1OOGA 1R6PA 1RWYA 4QJ4B 4WRIA 1LA3A 1GGWA 2NCPA 1TCFA 1SSEB 2TN4A 3BXKA 2O60A 1LXFC 3I5HC 2LV7A 1YURA 3K21A 1A2XA 1BLQA 1ZUZA 1M46A 2ZRTA 3PN7C 4PCWA 3FWCA 1S1EA 1XK4C 2NLNA 3DZTA 1TCOB 3WHUB 2JT0A 2KGBC 1LKJA 1UHKA 1PALA 4HRHA 2BCAA 2COLB 1KQMC 4C0LA 1C3ZA 1P28A 2K61A 3BFBA 3OGNA 1IJ5A 3GK2A 3RLZA 2L50A 1UUSA 1G4YR 3JVTC 2Q4UA 1JF0A 1TIZA 2E6WA 2JU0A 2PRUA 3B6XA 4N1GA 2F3ZA 5AERA 1XO5A 1Z2CB 4JKTA 1QX2A 2JPTA 2L5XB 3N7HA 4MZJA 4PALA 2BL0C 2ERBA 2QACA 1NCYA 2KLEA 4JWQA 4D1EA 1BOCA 1KSMA 2LCPA 1TUZA 1QX7A 4DS7A 2KSPA 1BODA 2BE4A 1NX0A 3TDIA 3PATA 4YGCB 1IRJA 1KSOA 2KI4C 5B8IB 4YGEB 2H61C 3A4UB 2K7BA 2ZKMX 2WCLA 3KEVA 2K7OA 2A4JA 1OMVA 2KBIA 2GTEA 1AVSA 3K1EA 2B1UA 5I94A 5IBWA 3LK1A 1S5GZ 3ZNIA 1OMDA 3MSEB 3NHIA 1L2OC 3L4AA 1DC1A 4ORAB 1CDPA 4I5NB 4U8DA 1CFFA 3PJIA 1TOPA 2KAYA 5BPJA 3CS1A 1V1GA 3SJSA 1QATA 1K90D 3EVUA 1IH0A 1UHIA 5HLOA 1DTLA 3DVJA 5D3OA 5I2LA 1ZACA 5PALA 1B1GA 1C7WA 2I94A 4E68A 5DICA 4JD9A 3R1OA 1QLKA 1JFKA 1UHNA 1C07A 2KPHA 1TNXA 4PE1A 1QIWA 3O78A 3TDUA 4ZCVA 2DOQA 3I5GC 3PFVA 4ICBA 2LC5A 1QVIY 3EK8A 1OQPA 4KYNA 1F8HA 2NXQA 2BBNA 2LVJA 3DF0A 3OBVA 4IL1A 5TNCA 2M1UA 1B8LA 1RK9A 2ZFDA 1KK7Y 1NIWA 5HLVA 1CLMA 4A4CA 1NYAA 5JJGA 1SCMB 4MBEA 3EG5B 1J1EA 4DCKA 3D77A 5G08A 1CM4A 4PHMA 1H8BA 1WY9A 1IGVA 1Z4HA 4NDCA 4MVFA 2LP3A 3FWBA 1W7JB 1X02A 4GGNA 1SMGA 1NX2A 2KNEA 3KF9A 3LLEA 3FE9A 2MBXA 2JULA 3SS3A 2JOJA 1SCMC 4PT1A 1J7RA 3SIAA 1KWOB 1MF8B 2PASA 1DT7B 3TS5B 3BOWB 1F4OA 5CPVA 4R1EA 3NSIA 4FQTA 1A29A 1RECA 4PE4A 1U5IA 1TWOA 2L5YA 2LNKA 4FTGA 4TNCA 2Q91A 4GBAA 1SR6C 1Y1UA 4BY4A 1LA0A 4OKHA 2OTGC 1WDCB 2V53A 2KDHA 3BJHA 1IKUA 3NSLA 2FOTA 3I5FB 1PVAA 3PALA 4BY5A 1J1DA 3CR5X 1BMOA 4USLA 1EL4A 1CFDA 4GGFC 3UO9A 4YRUA 1M31A 4GFTA 1TNPA 3BFHA 1NPQA 4GPLB 5FYXA 2ZNEA 1FI5A 2CT9A 3I5HB 2WCJA 2KOTA 1AJ4A 1K9KA 4I5KA 1CDLA 1YVLA 2BKIB 4NDDA 2M9GA 2K0JA 3EVVA 1KK8C 4P5OE 3B88A 3PN7B 2LANA 1OOIX 1XFRA 2JT3A 3PM2A 2HF5A 3HX4A 4DRWA 3Q8IA 4HREE 2EC6C 2VRGA 1A75A 2LLSA 5FI7A 3SG7A 1AK8A 1QVIZ 1N65A 2CCMA 4MSPA 1BR1B 1XVJA 2LUCA 1KQMB 1MUXA 4MRXA 1ODBA 2LHIA 3BUMB 2M8UA 2MLFC 1VRKA 2KYCA 4QJ3B 2HQ8A 3KPXA 4AQIA 1UHHA 2L51A 3LCPC 3D76A 1T14A 3JVTB 4MZLA 4C0JA 1KK7Z 2P6BB 2QEVA 2M97A 1YUUA 1XK4A 3NSKA 1SL7A 1K2HA 3VRPA 1AP4A 1IJ6A 3S0GA 1YTZC 2LM5A 3FE6A 3PSRA 3CABA 2PYQA 2BL0B 3CZTX 1QV1A 2YGUA 5AXIA 4YGBB 1ZFSA 1AJ5A 1TUJA 4YGDB 1BF5A 1V1FA 4JQ0D 4MRYA 1CDMA 1LS8A 2SCPA 2LMUA 1S6CA 4OVNF 1EG3A 2KI4B 1GM0A 1DJIA 4DUQA 1SY9A 2MA2A 4CFQA 2SASA 2LUXA 1F4QA 3D0YB 5DKQA 2BE6A 3KHEA 5AANA 1XFUO 2LVVA 4WQ3A 3AKBA 2EHBA 2F3YA 2E30A 3AKAA 4HRGA 4YI8A 1JC2A 1MWNA 3SS5A 1W7IB 1L2OB 1CFPA 2KFGA 1DF0B 1XFYO 2WCHA 3FE8A 3L4LA 5D69A 1F54A 1M39A 2D8NA 4L9MA 1DJXA 1KFUL 2WCEA 1J7QA 2HETA 1YX7A 3D0YA 3IF7A 3I5IC 5K89A 3S0EA 5KSZA 4JPZB 2JXCA 4OCIA 1EXRA 4WQ2A 3DXLA 1NSHA 2JPOA 3OX6A 2BBMA 1L7ZA 2F2PA 4M2PA 3R1VA 4GAOA 1DGVA 3IQQA 5DKRA 2M0RA 1OZSA 1KFXL 3I5GB 2PVBA 2IS9A 4XYNA 1XYDA 3RZSA 1CKKA 1B9AA 3BUXB 1SL8A 2WCFA 4INXA 3KO0A 2LVIA 2MRDA 1B7TY 2FJUB 4NDBA 2KFHA 2H8VA 2KBMA 1JF2A 3GK4X 3S0DA 4CPVA 1OOFA 3O2PA 5CSJA 2F2OA 4YI9A 1G8IA 1RFJA 3VGOA 3D75A 1FI6A 4PE0A 1IIOA 2M7LA 3BUOB 3DD4A 1NWDA 5I2QA 2JTTA 2QEHA 2K7DA 4P2YB 1MHOA 1B47A 1IWQA 2JWWA 2KI6D 2HPSA 2LLUA 1BJFA 1IQ3A 2G9BA 2P71A 4INWA 1SW8A 2KAXA 5CSFA 4ZCUA 3FIAA 3D78A 3WNXB 3VRQA 1RTP1 1LINA 1NX1A 1HT9A 3IQOA 3O6BA 3SS4A 2KYFA 4DIRA 3B86A 4CIDA 1E8AA 2O5GA 1AHRA 5EL2A 3GOFA 1F70A 4YGAA 3BFAA 5FI2A 1SR6B 1DMOA 2LE9B 1CFCA 2OTGB 4XJKB 5J3XA 1M63B 1MQ1A 1XFVO 2NCOA 1OSAA 3L47A 2WCBA 4N1FA 2MLEC 3NSOA 5HKYA 2BKHB 3SG3A 1K96A 2JC2A 3NHTA 1FPWA 2CTNA 4MEWA 2R2IA 1C3YA 2K7CA 1TRFA 3IVTA 4I5LB 2ZN8A 4XJKA 3AAJA 1B8RA 1KK8B 2L4IA 2LMVA 3BOWA 1K93D 1QIVA 3PLFB 3VROA 3S0BA 1UURA 2WC8A 2KGRA 1DQEA 1Q80A 5CSIA 2EC6B 3JTDB 3VB1A 3DVKA 2OS8C 5KTYA 1SKTA 2BAPA 2LLTA 1A03A 4GUKA 2FJYA 1B7TZ 2KFFA 4CLNA 2QEBA 2BCXA 3DY9A 5HKZA 2WNDA 2RGIA 3CYZA 1YUSA 1BU3A 1K95A 2I18A 2JXLA 1JBAA 1PVBA 1R2UA 1OW4A 2LMTA 2Y1NA 1FW4A 2QEOA 3JTDC 1J55A 4OZDA 1QXPA 2Y1MA 2WCMA 1HQVA 3AAKA 1RJVA 1SK6D 3O4XA 1RROA 3QRXA 4N5XA 4NQGA 3TDZA 2JRFA 2P70A 2ZN9A 3EKHA 3SG4A 3CZ2A 2Y4QA 1OOJA 1KFUS 4ETOA 2ISDA 1PK0D 3DVEA 2WCKA 1S26D 1PSRA 1EH2A 2M1KB 1F71A 1FBVA 4FQOA 3NXAA 3S0AA 3TUYC 1GJYA 2KHNA 2H2KA 1JFJA 1YRTB 1ALWA 2QPTA 1TN4A 4QJ5B 1EG4A 2F33A 2L2EA 3CTNA 1KFXS 3D74A 2GV5A 3EK7A 2WC5A 4M2QA 2L2CA 1DEKA 1LVCD 2K2AA 2LHLA 1G33A 2K2FA 1XFXO 4IJ7A 2I2RE 2WC6A 5ER4X 3WXAA 1CMFA 4PHNA 1N0YA 1K94A 2PSRA 2KQ6A 1CM1A 3SG5A 1Y1AA 1DJYA 4F7FA 1TTXA 4PE7A 3I5IB 1K9UA 1DVIA 5FI6A 3VRRA 5I2OA 1GQMA 3M0WA 1PULA 1TNQA 1N2DA 2K60A 3BUNB 4AOMA 3CDNA 2JZIA 1OE9B 1CLBA 2WORA 4AQJA 1BR4B 2H61A 5DKNA 1C7VA 1MXLC 2BNXA 1ZOTB 2KAVA 3OX5A 4OV2A 1QS7A 5D7FA 3SIBA 5AEQA 1QV0A 2PALA 2BCBA 4ORCB 4CFRA 1BG1A 1IQ5A 1BT6A 1Y0VH 1NCXA 2ZRSA 1QASA 1NX3A 2PMYA 1QX5B 3CZ0A 1JWDA 3LK0A 2AUCA 2F8PA
chains in the Genus database with same CATH topology
2P71A 4INWA 3BJHA 3D78A 3DZTA 3CZ1A 3B86A 3QMEA 2QDIA 3BFHA 5EL2A 2WCJA 3BFAA 1P28A 1C3ZA 3BFBA 3OGNA 3R1PA 3B88A 3L47A 1OOIX 1XFRA 3B6XA 3Q8IA 3N7HA 3NHTA 2ERBA 1C3YA 3D76A 1T14A 2QEVA 3S0BA 3V2LA 2WCLA 3S0GA 1DQEA 3FE6A 3CABA 3VB1A 2GTEA 1OOHA 3K1EA 1ORGA 2FJYA 1TUJA 2QEBA 3DY9A 3D73A 2PQLA 3NHIA 3R72A 3L4AA 1LS8A 3CYZA 3PJIA 1OW4A 1GM0A 2QEOA 3DYEA 4OZDA 2WCMA 3B7AA 3B87A 2P70A 3CZ2A 3NGVA 5DICA 4JD9A 3R1OA 2KPHA 1QWVA 2WCKA 3FE8A 2WCHA 3L4LA 3S0AA 3S0EA 3D74A 2WC5A 2L2CA 3DXLA 2JPOA 3R1VA 2WC6A 3S0FA 3D77A 3RZSA 4F7FA 4INXA 3FE9A 2H8VA 3S0DA 4PT1A 1OOGA 1OOFA 3CDNA 3D75A 4FQTA 2QEHA 1TWOA 3CZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P71 A;  4INW A;  3BJH A;  3D78 A;  3DZT A;  3CZ1 A;  3B86 A;  3QME A;  2QDI A;  3BFH A;  5EL2 A;  2WCJ A;  3BFA A;  1P28 A;  1C3Z A;  3BFB A;  3OGN A;  3R1P A;  3B88 A;  3L47 A;  1OOI X;  1XFR A;  3B6X A;  3Q8I A;  3N7H A;  3NHT A;  2ERB A;  1C3Y A;  3D76 A;  1T14 A;  2QEV A;  3S0B A;  3V2L A;  2WCL A;  3S0G A;  1DQE A;  3FE6 A;  3CAB A;  3VB1 A;  2GTE A;  1OOH A;  3K1E A;  1ORG A;  2FJY A;  1TUJ A;  2QEB A;  3DY9 A;  3D73 A;  2PQL A;  3NHI A;  3R72 A;  3L4A A;  1LS8 A;  3CYZ A;  3PJI A;  1OW4 A;  1GM0 A;  2QEO A;  3DYE A;  4OZD A;  2WCM A;  3B7A A;  3B87 A;  2P70 A;  3CZ2 A;  3NGV A;  5DIC A;  4JD9 A;  3R1O A;  2KPH A;  1QWV A;  2WCK A;  3FE8 A;  2WCH A;  3L4L A;  3S0A A;  3S0E A;  3D74 A;  2WC5 A;  2L2C A;  3DXL A;  2JPO A;  3R1V A;  2WC6 A;  3S0F A;  3D77 A;  3RZS A;  4F7F A;  4INX A;  3FE9 A;  2H8V A;  3S0D A;  4PT1 A;  1OOG A;  1OOF A;  3CDN A;  3D75 A;  4FQT A;  2QEH A;  1TWO A;  3CZ0 A; 
#chains in the Genus database with same CATH topology
 1XFZ O;  3BUW B;  1UP5 A;  3D10 A;  2WOS A;  3C1V A;  1QTX A;  2ZND A;  1SPY A;  2JNF A;  2M7N A;  3PM8 A;  1PRW A;  1DF0 A;  1DJG A;  2AAO A;  3RM1 A;  3CZ1 A;  3F45 A;  1NP8 A;  1DJW A;  1YR5 A;  3QME A;  3CGA A;  1FF1 A;  2QDI A;  5F6T A;  4PDZ A;  1CMG A;  1KCY A;  1DGU A;  2KQY A;  1Y6W A;  4YBH B;  1PSB A;  3UNW A;  1SNL A;  2FCE A;  3SG6 A;  5HYD A;  2AMI A;  3R1P A;  3CR2 A;  1WLZ A;  5HKW A;  1J7O A;  2GGZ A;  3OP0 A;  2CBL A;  2KI6 C;  3OB1 B;  4PHJ A;  1S6I A;  2KLD A;  1CLL A;  3EK4 A;  2L4H A;  3HCM A;  2JQ6 A;  3A8R A;  1NCZ A;  3CLN A;  1ALV A;  4F0Z B;  1ZMZ A;  4I5J A;  5JOL A;  1WLM A;  2JNX A;  1QLS A;  2MAZ A;  2Y5I A;  3DF0 B;  5KU1 A;  1SCV A;  1UHJ A;  1XFW O;  3ICB A;  1SRA A;  2JT8 A;  3CR4 X;  1JUO A;  4ORB B;  5ER5 A;  3V2L A;  4M2O A;  2FCD A;  5AFP A;  1SYM A;  3WHT B;  5HL1 A;  5I8N A;  2I7A A;  3CWG A;  2LVK A;  1Y1X A;  1WRL A;  1DJZ A;  1OOH A;  1A4P A;  3BYA A;  4HSZ A;  1NUB A;  1CTR A;  1ORG A;  1UWO A;  2CNP A;  2LAP A;  4A4B A;  1OMR A;  3DVM A;  3D73 A;  2PQL A;  1H4B A;  3R72 A;  1WRZ A;  3LL8 B;  3OB2 B;  1YVH A;  2GGM A;  2HQW A;  5GQQ C;  3FS7 A;  4GNK B;  5CSN A;  4MLW A;  3DYE A;  1TNW A;  3EVR A;  2CXJ A;  3H4S E;  1B4C A;  1W9Z A;  1CDN A;  1K8U A;  1U5I B;  3B7A A;  1XA5 A;  2L0P A;  4MZK A;  3B87 A;  1IG5 A;  1J7P A;  1DEL A;  1OZO A;  1S3P A;  2OS8 B;  3NGV A;  4PHK A;  1QWV A;  2LP2 A;  2JTZ A;  1S6J A;  3EKJ A;  2OPO A;  1MR8 A;  2L98 A;  4GGF A;  1S36 A;  1GGZ A;  3TZ1 A;  1SBJ A;  3O4Y A;  2G2B A;  2NZ0 A;  1EJ3 A;  3BQ3 A;  1JSA A;  1SL9 A;  2EGD A;  1KWO C;  1AUI B;  4Q04 A;  3TS5 C;  2M3W A;  1M45 A;  3GK1 A;  2BEC A;  4OR9 B;  3ZWH A;  1MXE A;  3SG2 A;  3S0F A;  2MJW B;  1WRK A;  4UPG A;  2K8M B;  2M29 A;  3E3R A;  1D1O A;  1CNP A;  1CB1 A;  1KQV A;  1QJT A;  3TUY B;  1A75 B;  2M49 B;  1B8C A;  3OHM B;  1DJH A;  1WDC C;  1S5G Y;  1YRU B;  1YUT A;  2MHH A;  1F55 A;  4C0K A;  1YX8 A;  1K9P A;  3I5F C;  4MN0 A;  3VRN A;  1OOG A;  1R6P A;  1RWY A;  4QJ4 B;  4WRI A;  1LA3 A;  1GGW A;  2NCP A;  1TCF A;  1SSE B;  2TN4 A;  3BXK A;  2O60 A;  1LXF C;  3I5H C;  2LV7 A;  1YUR A;  3K21 A;  1A2X A;  1BLQ A;  1ZUZ A;  1M46 A;  2ZRT A;  3PN7 C;  4PCW A;  3FWC A;  1S1E A;  1XK4 C;  2NLN A;  3DZT A;  1TCO B;  3WHU B;  2JT0 A;  2KGB C;  1LKJ A;  1UHK A;  1PAL A;  4HRH A;  2BCA A;  2COL B;  1KQM C;  4C0L A;  1C3Z A;  1P28 A;  2K61 A;  3BFB A;  3OGN A;  1IJ5 A;  3GK2 A;  3RLZ A;  2L50 A;  1UUS A;  1G4Y R;  3JVT C;  2Q4U A;  1JF0 A;  1TIZ A;  2E6W A;  2JU0 A;  2PRU A;  3B6X A;  4N1G A;  2F3Z A;  5AER A;  1XO5 A;  1Z2C B;  4JKT A;  1QX2 A;  2JPT A;  2L5X B;  3N7H A;  4MZJ A;  4PAL A;  2BL0 C;  2ERB A;  2QAC A;  1NCY A;  2KLE A;  4JWQ A;  4D1E A;  1BOC A;  1KSM A;  2LCP A;  1TUZ A;  1QX7 A;  4DS7 A;  2KSP A;  1BOD A;  2BE4 A;  1NX0 A;  3TDI A;  3PAT A;  4YGC B;  1IRJ A;  1KSO A;  2KI4 C;  5B8I B;  4YGE B;  2H61 C;  3A4U B;  2K7B A;  2ZKM X;  2WCL A;  3KEV A;  2K7O A;  2A4J A;  1OMV A;  2KBI A;  2GTE A;  1AVS A;  3K1E A;  2B1U A;  5I94 A;  5IBW A;  3LK1 A;  1S5G Z;  3ZNI A;  1OMD A;  3MSE B;  3NHI A;  1L2O C;  3L4A A;  1DC1 A;  4ORA B;  1CDP A;  4I5N B;  4U8D A;  1CFF A;  3PJI A;  1TOP A;  2KAY A;  5BPJ A;  3CS1 A;  1V1G A;  3SJS A;  1QAT A;  1K90 D;  3EVU A;  1IH0 A;  1UHI A;  5HLO A;  1DTL A;  3DVJ A;  5D3O A;  5I2L A;  1ZAC A;  5PAL A;  1B1G A;  1C7W A;  2I94 A;  4E68 A;  5DIC A;  4JD9 A;  3R1O A;  1QLK A;  1JFK A;  1UHN A;  1C07 A;  2KPH A;  1TNX A;  4PE1 A;  1QIW A;  3O78 A;  3TDU A;  4ZCV A;  2DOQ A;  3I5G C;  3PFV A;  4ICB A;  2LC5 A;  1QVI Y;  3EK8 A;  1OQP A;  4KYN A;  1F8H A;  2NXQ A;  2BBN A;  2LVJ A;  3DF0 A;  3OBV A;  4IL1 A;  5TNC A;  2M1U A;  1B8L A;  1RK9 A;  2ZFD A;  1KK7 Y;  1NIW A;  5HLV A;  1CLM A;  4A4C A;  1NYA A;  5JJG A;  1SCM B;  4MBE A;  3EG5 B;  1J1E A;  4DCK A;  3D77 A;  5G08 A;  1CM4 A;  4PHM A;  1H8B A;  1WY9 A;  1IGV A;  1Z4H A;  4NDC A;  4MVF A;  2LP3 A;  3FWB A;  1W7J B;  1X02 A;  4GGN A;  1SMG A;  1NX2 A;  2KNE A;  3KF9 A;  3LLE A;  3FE9 A;  2MBX A;  2JUL A;  3SS3 A;  2JOJ A;  1SCM C;  4PT1 A;  1J7R A;  3SIA A;  1KWO B;  1MF8 B;  2PAS A;  1DT7 B;  3TS5 B;  3BOW B;  1F4O A;  5CPV A;  4R1E A;  3NSI A;  4FQT A;  1A29 A;  1REC A;  4PE4 A;  1U5I A;  1TWO A;  2L5Y A;  2LNK A;  4FTG A;  4TNC A;  2Q91 A;  4GBA A;  1SR6 C;  1Y1U A;  4BY4 A;  1LA0 A;  4OKH A;  2OTG C;  1WDC B;  2V53 A;  2KDH A;  3BJH A;  1IKU A;  3NSL A;  2FOT A;  3I5F B;  1PVA A;  3PAL A;  4BY5 A;  1J1D A;  3CR5 X;  1BMO A;  4USL A;  1EL4 A;  1CFD A;  4GGF C;  3UO9 A;  4YRU A;  1M31 A;  4GFT A;  1TNP A;  3BFH A;  1NPQ A;  4GPL B;  5FYX A;  2ZNE A;  1FI5 A;  2CT9 A;  3I5H B;  2WCJ A;  2KOT A;  1AJ4 A;  1K9K A;  4I5K A;  1CDL A;  1YVL A;  2BKI B;  4NDD A;  2M9G A;  2K0J A;  3EVV A;  1KK8 C;  4P5O E;  3B88 A;  3PN7 B;  2LAN A;  1OOI X;  1XFR A;  2JT3 A;  3PM2 A;  2HF5 A;  3HX4 A;  4DRW A;  3Q8I A;  4HRE E;  2EC6 C;  2VRG A;  1A75 A;  2LLS A;  5FI7 A;  3SG7 A;  1AK8 A;  1QVI Z;  1N65 A;  2CCM A;  4MSP A;  1BR1 B;  1XVJ A;  2LUC A;  1KQM B;  1MUX A;  4MRX A;  1ODB A;  2LHI A;  3BUM B;  2M8U A;  2MLF C;  1VRK A;  2KYC A;  4QJ3 B;  2HQ8 A;  3KPX A;  4AQI A;  1UHH A;  2L51 A;  3LCP C;  3D76 A;  1T14 A;  3JVT B;  4MZL A;  4C0J A;  1KK7 Z;  2P6B B;  2QEV A;  2M97 A;  1YUU A;  1XK4 A;  3NSK A;  1SL7 A;  1K2H A;  3VRP A;  1AP4 A;  1IJ6 A;  3S0G A;  1YTZ C;  2LM5 A;  3FE6 A;  3PSR A;  3CAB A;  2PYQ A;  2BL0 B;  3CZT X;  1QV1 A;  2YGU A;  5AXI A;  4YGB B;  1ZFS A;  1AJ5 A;  1TUJ A;  4YGD B;  1BF5 A;  1V1F A;  4JQ0 D;  4MRY A;  1CDM A;  1LS8 A;  2SCP A;  2LMU A;  1S6C A;  4OVN F;  1EG3 A;  2KI4 B;  1GM0 A;  1DJI A;  4DUQ A;  1SY9 A;  2MA2 A;  4CFQ A;  2SAS A;  2LUX A;  1F4Q A;  3D0Y B;  5DKQ A;  2BE6 A;  3KHE A;  5AAN A;  1XFU O;  2LVV A;  4WQ3 A;  3AKB A;  2EHB A;  2F3Y A;  2E30 A;  3AKA A;  4HRG A;  4YI8 A;  1JC2 A;  1MWN A;  3SS5 A;  1W7I B;  1L2O B;  1CFP A;  2KFG A;  1DF0 B;  1XFY O;  2WCH A;  3FE8 A;  3L4L A;  5D69 A;  1F54 A;  1M39 A;  2D8N A;  4L9M A;  1DJX A;  1KFU L;  2WCE A;  1J7Q A;  2HET A;  1YX7 A;  3D0Y A;  3IF7 A;  3I5I C;  5K89 A;  3S0E A;  5KSZ A;  4JPZ B;  2JXC A;  4OCI A;  1EXR A;  4WQ2 A;  3DXL A;  1NSH A;  2JPO A;  3OX6 A;  2BBM A;  1L7Z A;  2F2P A;  4M2P A;  3R1V A;  4GAO A;  1DGV A;  3IQQ A;  5DKR A;  2M0R A;  1OZS A;  1KFX L;  3I5G B;  2PVB A;  2IS9 A;  4XYN A;  1XYD A;  3RZS A;  1CKK A;  1B9A A;  3BUX B;  1SL8 A;  2WCF A;  4INX A;  3KO0 A;  2LVI A;  2MRD A;  1B7T Y;  2FJU B;  4NDB A;  2KFH A;  2H8V A;  2KBM A;  1JF2 A;  3GK4 X;  3S0D A;  4CPV A;  1OOF A;  3O2P A;  5CSJ A;  2F2O A;  4YI9 A;  1G8I A;  1RFJ A;  3VGO A;  3D75 A;  1FI6 A;  4PE0 A;  1IIO A;  2M7L A;  3BUO B;  3DD4 A;  1NWD A;  5I2Q A;  2JTT A;  2QEH A;  2K7D A;  4P2Y B;  1MHO A;  1B47 A;  1IWQ A;  2JWW A;  2KI6 D;  2HPS A;  2LLU A;  1BJF A;  1IQ3 A;  2G9B A;  2P71 A;  4INW A;  1SW8 A;  2KAX A;  5CSF A;  4ZCU A;  3FIA A;  3D78 A;  3WNX B;  3VRQ A;  1RTP 1;  1LIN A;  1NX1 A;  1HT9 A;  3IQO A;  3O6B A;  3SS4 A;  2KYF A;  4DIR A;  3B86 A;  4CID A;  1E8A A;  2O5G A;  1AHR A;  5EL2 A;  3GOF A;  1F70 A;  4YGA A;  3BFA A;  5FI2 A;  1SR6 B;  1DMO A;  2LE9 B;  1CFC A;  2OTG B;  4XJK B;  5J3X A;  1M63 B;  1MQ1 A;  1XFV O;  2NCO A;  1OSA A;  3L47 A;  2WCB A;  4N1F A;  2MLE C;  3NSO A;  5HKY A;  2BKH B;  3SG3 A;  1K96 A;  2JC2 A;  3NHT A;  1FPW A;  2CTN A;  4MEW A;  2R2I A;  1C3Y A;  2K7C A;  1TRF A;  3IVT A;  4I5L B;  2ZN8 A;  4XJK A;  3AAJ A;  1B8R A;  1KK8 B;  2L4I A;  2LMV A;  3BOW A;  1K93 D;  1QIV A;  3PLF B;  3VRO A;  3S0B A;  1UUR A;  2WC8 A;  2KGR A;  1DQE A;  1Q80 A;  5CSI A;  2EC6 B;  3JTD B;  3VB1 A;  3DVK A;  2OS8 C;  5KTY A;  1SKT A;  2BAP A;  2LLT A;  1A03 A;  4GUK A;  2FJY A;  1B7T Z;  2KFF A;  4CLN A;  2QEB A;  2BCX A;  3DY9 A;  5HKZ A;  2WND A;  2RGI A;  3CYZ A;  1YUS A;  1BU3 A;  1K95 A;  2I18 A;  2JXL A;  1JBA A;  1PVB A;  1R2U A;  1OW4 A;  2LMT A;  2Y1N A;  1FW4 A;  2QEO A;  3JTD C;  1J55 A;  4OZD A;  1QXP A;  2Y1M A;  2WCM A;  1HQV A;  3AAK A;  1RJV A;  1SK6 D;  3O4X A;  1RRO A;  3QRX A;  4N5X A;  4NQG A;  3TDZ A;  2JRF A;  2P70 A;  2ZN9 A;  3EKH A;  3SG4 A;  3CZ2 A;  2Y4Q A;  1OOJ A;  1KFU S;  4ETO A;  2ISD A;  1PK0 D;  3DVE A;  2WCK A;  1S26 D;  1PSR A;  1EH2 A;  2M1K B;  1F71 A;  1FBV A;  4FQO A;  3NXA A;  3S0A A;  3TUY C;  1GJY A;  2KHN A;  2H2K A;  1JFJ A;  1YRT B;  1ALW A;  2QPT A;  1TN4 A;  4QJ5 B;  1EG4 A;  2F33 A;  2L2E A;  3CTN A;  1KFX S;  3D74 A;  2GV5 A;  3EK7 A;  2WC5 A;  4M2Q A;  2L2C A;  1DEK A;  1LVC D;  2K2A A;  2LHL A;  1G33 A;  2K2F A;  1XFX O;  4IJ7 A;  2I2R E;  2WC6 A;  5ER4 X;  3WXA A;  1CMF A;  4PHN A;  1N0Y A;  1K94 A;  2PSR A;  2KQ6 A;  1CM1 A;  3SG5 A;  1Y1A A;  1DJY A;  4F7F A;  1TTX A;  4PE7 A;  3I5I B;  1K9U A;  1DVI A;  5FI6 A;  3VRR A;  5I2O A;  1GQM A;  3M0W A;  1PUL A;  1TNQ A;  1N2D A;  2K60 A;  3BUN B;  4AOM A;  3CDN A;  2JZI A;  1OE9 B;  1CLB A;  2WOR A;  4AQJ A;  1BR4 B;  2H61 A;  5DKN A;  1C7V A;  1MXL C;  2BNX A;  1ZOT B;  2KAV A;  3OX5 A;  4OV2 A;  1QS7 A;  5D7F A;  3SIB A;  5AEQ A;  1QV0 A;  2PAL A;  2BCB A;  4ORC B;  4CFR A;  1BG1 A;  1IQ5 A;  1BT6 A;  1Y0V H;  1NCX A;  2ZRS A;  1QAS A;  1NX3 A;  2PMY A;  1QX5 B;  3CZ0 A;  1JWD A;  3LK0 A;  2AUC A;  2F8P A; 
#chains in the Genus database with same CATH homology
 2P71 A;  4INW A;  3BJH A;  3D78 A;  3DZT A;  3CZ1 A;  3B86 A;  3QME A;  2QDI A;  3BFH A;  5EL2 A;  2WCJ A;  3BFA A;  1P28 A;  1C3Z A;  3BFB A;  3OGN A;  3R1P A;  3B88 A;  3L47 A;  1OOI X;  1XFR A;  3B6X A;  3Q8I A;  3N7H A;  3NHT A;  2ERB A;  1C3Y A;  3D76 A;  1T14 A;  2QEV A;  3S0B A;  3V2L A;  2WCL A;  3S0G A;  1DQE A;  3FE6 A;  3CAB A;  3VB1 A;  2GTE A;  1OOH A;  3K1E A;  1ORG A;  2FJY A;  1TUJ A;  2QEB A;  3DY9 A;  3D73 A;  2PQL A;  3NHI A;  3R72 A;  3L4A A;  1LS8 A;  3CYZ A;  3PJI A;  1OW4 A;  1GM0 A;  2QEO A;  3DYE A;  4OZD A;  2WCM A;  3B7A A;  3B87 A;  2P70 A;  3CZ2 A;  3NGV A;  5DIC A;  4JD9 A;  3R1O A;  2KPH A;  1QWV A;  2WCK A;  3FE8 A;  2WCH A;  3L4L A;  3S0A A;  3S0E A;  3D74 A;  2WC5 A;  2L2C A;  3DXL A;  2JPO A;  3R1V A;  2WC6 A;  3S0F A;  3D77 A;  3RZS A;  4F7F A;  4INX A;  3FE9 A;  2H8V A;  3S0D A;  4PT1 A;  1OOG A;  1OOF A;  3CDN A;  3D75 A;  4FQT A;  2QEH A;  1TWO A;  3CZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...