1JF0A

The crystal structure of obelin from obelia geniculata at 1.82 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
192
structure length
192
Chain Sequence
KYAVKLQTDFDNPKWIKRHKFMFDYLDINGNGQITLDEIVSKASDDICKNLGATPAQTQRHQDCVEAFFRGCGLEYGKETKFPEFLEGWKNLANADLAKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGRISGISPSEEDCEKTFQHCDLDNSGELDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obelin
publication title The Crystal Structure of Obelin from Obelia geniculata at 1.82 Angstrom Resolution
rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 76
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2001-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jf0A00
3BXKA 4JWQA 1BU3A 3VRPA 4YGEB 2EHBA 4IL1A 1DGVA 3I5HB 3IQQA 1DTLA 1SR6C 1U5IB 4MEWA 1KK8B 4A4BA 2EGDA 1IGVA 3GK4X 2K7CA 1XFUO 5AERA 5GQQC 1MHOA 1RWYA 1NP8A 1TNQA 4MZJA 4MVFA 1JUOA 5D7FA 2WCEA 1QIVA 5I2QA 1IJ5A 1BLQA 1QX5B 3SG6A 1S26D 1L2OB 3SG3A 2GV5A 2O5GA 2LUXA 2GGMA 5DKNA 4PHKA 1FI5A 1YUSA 2LM5A 3LK0A 1BT6A 1DJYA 1NX3A 2JRFA 5HYDA 1NUBA 1S6JA 1EL4A 2F3ZA 1PRWA 4GAOA 1KFXL 2LAPA 2PMYA 3LK1A 2KNEA 1QJTA 2BCAA 2WCFA 1EG4A 2K2FA 3O4YA 4PE0A 4AOMA 3EK4A 2JWWA 1J7RA 1VRKA 4YGAA 2MLFC 2KDHA 1W7IB 3CZTX 3DVJA 3F45A 3I5IB 4ICBA 4PCWA 1CMGA 4CLNA 5ER4X 1G4YR 3RLZA 1S6IA 1TCOB 3SIBA 4C0KA 1NCZA 3DF0A 4PHMA 2LP3A 1CMFA 1JWDA 4C0JA 4HREE 2F3YA 2P6BB 3QRXA 4WQ3A 2FCEA 2K0JA 1SL9A 4CPVA 1AVSA 1WRKA 1A29A 1Y1XA 2KAXA 3TDIA 4XJKA 4I5LB 1E8AA 1OZSA 1DJGA 2Y5IA 3D10A 1C7VA 1DJXA 2AUCA 2CTNA 1V1FA 3GOFA 1SBJA 1CLMA 1OSAA 1RFJA 1UHIA 3WHUB 2QACA 1BR4B 3ZNIA 1TCFA 2SASA 4C0LA 1MR8A 1K9UA 2LHIA 3DVKA 3E3RA 3OB1B 2O60A 2F2OA 1IQ3A 1OE9B 2CBLA 3NXAA 5HKWA 1DJHA 4GNKB 2KI6C 2F2PA 2L98A 2ISDA 1F70A 4OCIA 2LLSA 2WCBA 1K8UA 2K7DA 4JQ0D 2HETA 1XYDA 1WY9A 1EXRA 1AP4A 3PATA 1A4PA 2VRGA 3GK2A 3D0YA 3NSKA 5HLVA 3EVVA 1S6CA 1G33A 1PALA 3AAKA 3CR2A 4PALA 4QJ3B 2JT8A 1DJIA 2KI4C 4XJKB 1AJ4A 1BMOA 1S1EA 1OOJA 5AANA 3BUMB 2K61A 2QPTA 2ZRSA 3EKHA 1M31A 4HRGA 3CR4X 3KEVA 1UP5A 2V53A 3M0WA 4MBEA 2LLTA 2JPTA 1XVJA 4ETOA 1CLBA 1LA3A 3TUYC 1QASA 4MN0A 1IJ6A 3EVRA 1F55A 2H61C 1R2UA 3VRNA 3SIAA 1IG5A 1SR6B 1NX2A 2MHHA 2BL0C 1BJFA 5IBWA 5K89A 3D0YB 1B8RA 1A03A 2D8NA 2GGZA 2LV7A 3PFVA 3IF7A 3PM8A 4CIDA 2JTTA 1Y6WA 4GGFC 5KU1A 3RM1A 4F0ZB 4R1EA 2CNPA 3KO0A 1CM4A 1MQ1A 1IQ5A 1QS7A 2HF5A 4PDZA 5JJGA 1YVLA 2EC6B 1BOCA 1CLLA 4TNCA 3JTDB 2ZNDA 2FJUB 1NCXA 3JVTB 3EKJA 1QLKA 2ZFDA 2I94A 4PHNA 1K93D 4YGBB 2RGIA 3O2PA 4I5KA 4PE1A 3VRQA 2LNKA 1DF0B 1NYAA 3FWCA 2BCBA 4GBAA 2KOTA 5F6TA 1XFVO 2TN4A 1J55A 2WNDA 2LP2A 4GPLB 1QIWA 2KYCA 1H4BA 1QX7A 1RJVA 1KWOB 2LVJA 1XFXO 2Q91A 1JFJA 1WRLA 2JTZA 2KAVA 4WRIA 2NLNA 4FTGA 1GQMA 1CFCA 2M9GA 1NPQA 1BG1A 1RROA 1KFXS 3GK1A 1N0YA 2L4IA 1CB1A 3I5FC 3O6BA 4N1FA 1UHKA 2BE4A 3VROA 3TDUA 2WOSA 4NDBA 1RK9A 1TTXA 2PVBA 1K9PA 2NZ0A 2OPOA 1H8BA 1PSRA 1GGWA 2LE9B 3NSLA 5B8IB 1WLZA 2F8PA 1LA0A 2E6WA 3BYAA 1TNPA 1XK4C 1K9KA 1MXEA 2CCMA 4ORAB 2SCPA 1M45A 1KK7Y 2MJWB 2ZNEA 2I7AA 3SJSA 4DCKA 1YUTA 3DVMA 1LINA 1N65A 4N1GA 2G9BA 4GGFA 4JPZB 4OKHA 3CTNA 3K21A 2KI4B 1DGUA 3SG4A 2M97A 4MRYA 3I5GC 1KK8C 1SYMA 2BECA 4BY4A 1YVHA 3WXAA 2M1KB 4A4CA 2BE6A 2CT9A 2Q4UA 5I2LA 1DJZA 1UHJA 1QV0A 1SPYA 5ER5A 1L2OC 1G8IA 1ALVA 1GGZA 2M8UA 3SG2A 4MLWA 2PRUA 2K7OA 3TUYB 2K8MB 1ZFSA 3PSRA 2KHNA 4N5XA 1NSHA 2L0PA 1KQVA 2KGBC 1NX0A 2JU0A 4YBHB 1CFFA 4PHJA 3BOWA 1CFPA 3AAJA 1C7WA 3DVEA 4P2YB 1WDCC 1DMOA 3EK8A 5BPJA 2BL0B 1KCYA 1B1GA 1IWQA 3OHMB 3KHEA 3WNXB 2ZN8A 4P5OE 4PE7A 3EVUA 5TNCA 5I8NA 3CLNA 3PN7C 5HKYA 2BKIB 1DJWA 2R2IA 2M3WA 1XFYO 3CGAA 2M0RA 2L5XB 1JSAA 3CR5X 5HLOA 5AXIA 4QJ4B 1Y1UA 1DF0A 1QVIY 1M63B 2DOQA 2HQ8A 1F4QA 1KFUS 2KYFA 1KFUL 1FF1A 2JZIA 1TIZA 1JFKA 1R6PA 4ZCVA 5PALA 4CFRA 2NXQA 1BF5A 1SW8A 1YX7A 3OX5A 2KQYA 3CS1A 1XK4A 1MUXA 4GFTA 5HKZA 3C1VA 1B8LA 4UPGA 3SG5A 4YI8A 1K2HA 2M29A 5KTYA 4NQGA 1JF0A 1PK0D 3BOWB 1QXPA 2M7NA 1A2XA 5I2OA 5KSZA 1PVAA 5J3XA 1KSMA 2OS8C 5CPVA 1ZMZA 1PSBA 2L2EA 4M2QA 1J7OA 1PULA 1TNXA 3KF9A 1SRAA 2L50A 1C07A 1K96A 2KI6D 1TNWA 1AJ5A 1UURA 1RTP1 3I5FB 1HQVA 4ORCB 4DUQA 1CTRA 2MAZA 4BY5A 2MLEC 3TZ1A 1W7JB 4YI9A 1RECA 2JNXA 4I5NB 4L9MA 2I18A 4DS7A 2JQ6A 2KQ6A 2K7BA 1D1OA 1DT7B 3AKBA 3TDZA 1EG3A 2NCPA 5FYXA 1QLSA 3FIAA 1SCMC 2FCDA 1YX8A 4ZCUA 2G2BA 5JOLA 3OB2B 4MZLA 1CDLA 3TS5C 3HCMA 1B9AA 4AQJA 1S3PA 1NIWA 5CSNA 1QV1A 2LVVA 3ZWHA 1F4OA 1UWOA 1X02A 2LC5A 4USLA 1Y1AA 2H2KA 1EJ3A 2OTGC 3VRRA 4FQOA 1CDNA 1NCYA 2KBMA 3I5GB 1JF2A 2B1UA 3MSEB 4HRHA 1M46A 4GGNA 2ZN9A 1LKJA 2BBNA 4HSZA 4OV2A 1SL8A 4DRWA 1OZOA 4CFQA 1XO5A 3DD4A 1SK6D 1J1EA 3AKAA 4MRXA 1Y0VH 1XFZO 2MA2A 2LVIA 1YURA 2H61A 1AHRA 1XA5A 2EC6C 1CDPA 3JTDC 1MXLC 3KPXA 1B7TY 4QJ5B 1KQMC 4DIRA 1NWDA 1KK7Z 3JVTC 1CNPA 1AK8A 1CM1A 1B7TZ 2Y1MA 1WDCB 4U8DA 5CSJA 5AEQA 1YRUB 3BUNB 3I5HC 1L7ZA 2KGRA 2Y1NA 5CSIA 2KFHA 1FBVA 1OQPA 4M2PA 1SY9A 1MF8B 1UHNA 2JNFA 2KSPA 3PN7B 4ORBB 2LUCA 1B8CA 2LHLA 1AUIB 3H4SE 4NDCA 1EH2A 1F54A 5CSFA 1TRFA 2NCOA 1Q80A 2HPSA 1TOPA 1ALWA 4E68A 2FOTA 1YUUA 2MBXA 1KWOC 1YTZC 3IQOA 1QTXA 1B4CA 2KAYA 2BCXA 3SG7A 1CFDA 2JOJA 3A4UB 1YRTB 1GJYA 4YGDB 1J7QA 2LMUA 1OMVA 2JULA 1F8HA 3PLFB 4Q04A 1V1GA 2BBMA 2L51A 2CXJA 3O78A 3I5IC 3CWGA 1ZOTB 2BKHB 1BODA 3BUOB 1IH0A 2MRDA 4MZKA 3PALA 1ZUZA 1K95A 2LMVA 2COLB 2OS8B 2WORA 3BQ3A 5G08A 1FW4A 3NSIA 1TN4A 1CDMA 2LCPA 4AQIA 2M7LA 1LVCD 1WLMA 2JXLA 3DF0B 5AFPA 2I2RE 1QVIZ 2JC2A 2F33A 3BUWB 3LCPC 1FPWA 4YRUA 1K90D 1OMDA 1SL7A 3OX6A 2E30A 2ZRTA 4GUKA 1J7PA 3FWBA 2LMTA 3EK7A 1KSOA 1BR1B 1MWNA 2AAOA 2A4JA 1QATA 4M2OA 1A75A 1LXFC 1N2DA 3BUXB 2Y4QA 4YGCB 1XFWO 1YR5A 1J1DA 1B47A 1SCMB 2ZKMX 4PE4A 4NDDA 2KFFA 3WHTB 2WC8A 1WRZA 2HQWA 4OR9B 5DKQA 1FI6A 3TS5B 1K94A 2AMIA 3HX4A 4OVNF 1U5IA 3A8RA 2LANA 1IKUA 2M49B 2IS9A 4I5JA 1DVIA 2OTGB 1NX1A 1OMRA 1HT9A 1ZACA 2KFGA 5DKRA 1F71A 2LLUA 5D69A 1S36A 3NSOA 1UHHA 2JXCA 1IRJA 3FS7A 1JC2A 3ICBA 1CKKA 1JBAA 2KBIA 3VGOA 4MSPA 2K2AA 4D1EA 1ODBA 1S5GY 4XYNA 1S5GZ 1SMGA 1SNLA 2PALA 2PASA 1SKTA 2L4HA 3LLEA 1SCVA 1UUSA 2M1UA 2JT0A 1M39A 1A75B 1QX2A 2LVKA 2PSRA 3LL8B 1KQMB 3OP0A 1PVBA 2JT3A 4WQ2A
chains in the Genus database with same CATH superfamily
3BXKA 4JWQA 1BU3A 3VRPA 4YGEB 2EHBA 4IL1A 1DGVA 1OOHA 3I5HB 3IQQA 1DTLA 1SR6C 1U5IB 4MEWA 1KK8B 4A4BA 2EGDA 1IGVA 3GK4X 2K7CA 1XFUO 5AERA 5GQQC 1MHOA 1RWYA 1NP8A 1TNQA 4MZJA 4MVFA 1DQEA 1JUOA 5D7FA 2WCEA 1QIVA 5I2QA 1IJ5A 1BLQA 5DICA 1QX5B 3SG6A 1S26D 1L2OB 3SG3A 2GV5A 2O5GA 2LUXA 2GGMA 5DKNA 4PHKA 1FI5A 1YUSA 2LM5A 3O4XA 3LK0A 1BT6A 2P71A 1DJYA 1NX3A 2JRFA 5HYDA 3SS4A 1NUBA 1S6JA 1EL4A 2F3ZA 3FE6A 1PRWA 4GAOA 3DZTA 1KFXL 3S0EA 2LAPA 2PMYA 3LK1A 2KNEA 1QJTA 2BCAA 2WCFA 1EG4A 2K2FA 3O4YA 4PE0A 4AOMA 3EK4A 2JWWA 1J7RA 1VRKA 3L47A 2MLFC 2KDHA 1W7IB 3CZTX 3DVJA 3F45A 3I5IB 4ICBA 4PCWA 3UO9A 1CMGA 4CLNA 5ER4X 1G4YR 3RLZA 1S6IA 1TCOB 3SIBA 4C0KA 2WCMA 1NCZA 3DF0A 4PHMA 2LP3A 1CMFA 1JWDA 4C0JA 4HREE 2F3YA 2P6BB 3QRXA 4WQ3A 2FCEA 2K0JA 1SL9A 4CPVA 4F7FA 1AVSA 1WRKA 1A29A 1Y1XA 2KAXA 3NGVA 3TDIA 3CDNA 4I5LB 1E8AA 4XJKA 1OZSA 1DJGA 2Y5IA 3D10A 1C7VA 1DJXA 2AUCA 2CTNA 1V1FA 3GOFA 1SBJA 1CLMA 1Z4HA 1OSAA 1IIOA 1RFJA 1UHIA 3WHUB 2QACA 1BR4B 3ZNIA 1TCFA 2SASA 4C0LA 1MR8A 2WCKA 1K9UA 2LHIA 3DVKA 3E3RA 3OB1B 2O60A 1OW4A 2F2OA 1OE9B 1IQ3A 2CBLA 3NXAA 3DY9A 5HKWA 1DJHA 4GNKB 3IVTA 2KI6C 2F2PA 3S0DA 2L98A 2ISDA 1F70A 4OCIA 2LLSA 2WCBA 1K8UA 2K7DA 4JQ0D 1GM0A 3K1EA 2HETA 4INWA 1XYDA 1WY9A 1EXRA 1AP4A 3PATA 1A4PA 2VRGA 3GK2A 3D0YA 3NSKA 5HLVA 1OOIX 4JD9A 3EVVA 1LS8A 1S6CA 1G33A 1PALA 3AAKA 3CR2A 4PALA 4QJ3B 2JT8A 1DJIA 2KI4C 4XJKB 1AJ4A 1BMOA 1S1EA 1OOJA 5AANA 1C3YA 3D77A 3BUMB 2K61A 2KLDA 2QPTA 2ZRSA 1M31A 3EKHA 4HRGA 3CR4X 3KEVA 1UP5A 2V53A 3M0WA 4MBEA 2LLTA 2JPTA 1XVJA 4ETOA 1CLBA 1LA3A 3TUYC 1QASA 2QDIA 4IJ7A 4JKTA 2ERBA 4MN0A 1IJ6A 3EVRA 1F55A 1W9ZA 2H61C 1R2UA 3VRNA 3SIAA 1IG5A 1SR6B 2QEVA 1NX2A 2MHHA 2BL0C 2FJYA 1BJFA 5IBWA 2BAPA 5K89A 3D0YB 1B8RA 1A03A 2D8NA 3SS3A 2GGZA 2LV7A 3PFVA 3IF7A 3PM8A 4CIDA 2JTTA 1Y6WA 3Q8IA 1QWVA 4GGFC 5KU1A 3RM1A 3CYZA 4F0ZB 4R1EA 2CNPA 3KO0A 1CM4A 1MQ1A 1IQ5A 1QS7A 2HF5A 4PDZA 5JJGA 1YVLA 2EC6B 1BOCA 1CLLA 4TNCA 3JTDB 2ZNDA 2FJUB 1NCXA 2P70A 3JVTB 3EKJA 1QLKA 2ZFDA 2I94A 4PHNA 1K93D 4YGBB 2RGIA 3O2PA 4I5KA 4PE1A 3VRQA 2LNKA 1DF0B 1NYAA 5FI6A 3FWCA 2BCBA 3V2LA 4GBAA 2KOTA 5F6TA 1XFVO 2TN4A 3S0AA 1J55A 2WNDA 5EL2A 2LP2A 4GPLB 1QIWA 2BNXA 2KYCA 1H4BA 1P28A 1XFRA 1QX7A 1RJVA 1KWOB 2LVJA 1XFXO 2Q91A 2K60A 3BJHA 1JFJA 1WRLA 2JTZA 2KAVA 4WRIA 2NLNA 3B87A 4FTGA 1GQMA 3VB1A 2M9GA 1NPQA 1BG1A 1RROA 1KFXS 1CFCA 3GK1A 1N0YA 2L4IA 3R72A 3I5FC 1CB1A 3O6BA 4N1FA 1UHKA 2BE4A 3BFBA 3VROA 3TDUA 2WOSA 4NDBA 1RK9A 1TTXA 2PVBA 1K9PA 2NZ0A 2OPOA 1H8BA 1PSRA 1GGWA 2LE9B 3NSLA 5B8IB 1WLZA 2F8PA 1LA0A 2E6WA 3BYAA 1TNPA 1XK4C 3L4AA 1K9KA 1MXEA 2CCMA 4ORAB 2SCPA 1M45A 1KK7Y 2MJWB 2ZNEA 2I7AA 3SJSA 4DCKA 1YUTA 3DVMA 2WC5A 3FE9A 1LINA 1C3ZA 1N65A 2QEOA 4OZDA 4N1GA 2G9BA 4GGFA 4JPZB 4OKHA 3CTNA 3K21A 5I94A 4KYNA 2KI4B 3DXLA 1DGUA 3SG4A 2M97A 4MRYA 3I5GC 1KK8C 1SYMA 2BECA 2WCJA 4BY4A 1YVHA 3BFHA 2M1KB 3WXAA 4A4CA 2BE6A 2CT9A 2Q4UA 3D73A 5I2LA 1DJZA 1UHJA 1QV0A 1SPYA 5ER5A 1L2OC 1G8IA 3S0BA 1ALVA 1GGZA 2M8UA 3SG2A 3D78A 4MLWA 2PRUA 3CZ0A 2K7OA 3TUYB 2K8MB 1ZFSA 3PSRA 2KHNA 4N5XA 1NSHA 2L0PA 1KQVA 2KGBC 1NX0A 2JU0A 4YBHB 1CFFA 3S0FA 4PHJA 3BOWA 1CFPA 3AAJA 1C7WA 3DVEA 4P2YB 1WDCC 1DMOA 3EK8A 5BPJA 2BL0B 1KCYA 3CZ1A 1B1GA 1IWQA 3OHMB 3KHEA 3CABA 3WNXB 2ZN8A 3R1PA 4P5OE 4PE7A 3EVUA 5TNCA 5I8NA 3B6XA 3CLNA 3PN7C 5HKYA 2BKIB 1DJWA 2R2IA 2M3WA 1XFYO 3CGAA 2M0RA 2L5XB 2L5YA 3R1OA 1JSAA 3CR5X 5HLOA 5AXIA 4QJ4B 1Y1UA 1DF0A 1QVIY 2KLEA 2JPOA 1M63B 2DOQA 2HQ8A 1F4QA 1KFUS 2KYFA 1KFUL 3SS5A 1FF1A 3UNWA 2JZIA 1TIZA 1JFKA 1R6PA 4ZCVA 5PALA 4CFRA 2NXQA 1BF5A 1SW8A 1YX7A 3OX5A 2KQYA 3CS1A 1XK4A 1MUXA 4GFTA 5HKZA 3C1VA 1B8LA 4UPGA 3SG5A 4YI8A 3R1VA 1K2HA 2M29A 5KTYA 4NQGA 1JF0A 1PK0D 3BOWB 1QXPA 2M7NA 1A2XA 5I2OA 5KSZA 1PVAA 5J3XA 1KSMA 2OS8C 5CPVA 1ZMZA 1PSBA 2L2EA 4M2QA 5D3OA 1PULA 1TNXA 3KF9A 1SRAA 2L50A 1J7OA 1C07A 1K96A 2QEBA 2KI6D 1TNWA 1AJ5A 1UURA 1RTP1 3I5FB 1HQVA 4ORCB 4DUQA 1CTRA 2MAZA 4BY5A 2MLEC 5HL1A 3TZ1A 1W7JB 4YI9A 1RECA 2JNXA 4I5NB 4L9MA 2I18A 4DS7A 2JQ6A 2KQ6A 2K7BA 1D1OA 1DT7B 3AKBA 1SSEB 3TDZA 3B7AA 1EG3A 2NCPA 5FYXA 1QLSA 3FIAA 1SCMC 2FCDA 1YX8A 3D76A 4INXA 4ZCUA 2G2BA 5JOLA 3OB2B 4MZLA 1CDLA 3TS5C 3HCMA 1B9AA 2QEHA 4AQJA 1S3PA 1NIWA 5CSNA 1QV1A 2LVVA 3ZWHA 4FQTA 1F4OA 1UWOA 1X02A 2LC5A 3N7HA 4USLA 3RZSA 1Y1AA 2H2KA 1EJ3A 2OTGC 3VRRA 4FQOA 2GTEA 1CDNA 1NCYA 2KBMA 3I5GB 1JF2A 2B1UA 3MSEB 4HRHA 1OOFA 1M46A 4GGNA 2ZN9A 4YGAA 1LKJA 2BBNA 4HSZA 4OV2A 1SL8A 4DRWA 1OZOA 4CFQA 1XO5A 3DD4A 1SK6D 1J1EA 3AKAA 4MRXA 1Y0VH 1TUZA 3OBVA 1XFZO 2MA2A 2LVIA 1YURA 2H61A 1AHRA 1XA5A 2EC6C 3S0GA 1CDPA 3JTDC 1MXLC 3KPXA 1B7TY 4QJ5B 1Z2CB 2YGUA 1KQMC 4DIRA 1NWDA 1KK7Z 2H8VA 3JVTC 1CNPA 1AK8A 1CM1A 1B7TZ 2Y1MA 1WDCB 1OOGA 1ORGA 4U8DA 5CSJA 5AEQA 1YRUB 3BUNB 3I5HC 1L7ZA 2KGRA 2Y1NA 5CSIA 2KFHA 1FBVA 1OQPA 4M2PA 1SY9A 1MF8B 1UHNA 2JNFA 2KSPA 3PN7B 4ORBB 1TUJA 2LUCA 1B8CA 2LHLA 3NHIA 1AUIB 3H4SE 4NDCA 1EH2A 1F54A 5CSFA 1TRFA 2NCOA 1Q80A 2HPSA 1TOPA 1ALWA 4E68A 2FOTA 1YUUA 3B86A 2MBXA 1KWOC 1YTZC 3IQOA 1QTXA 1DEKA 3QMEA 1B4CA 2KAYA 2BCXA 3SG7A 1CFDA 2JOJA 3BFAA 3A4UB 1YRTB 1GJYA 3PJIA 4YGDB 1J7QA 2LMUA 1OMVA 2JULA 4PT1A 1F8HA 3PLFB 4Q04A 1V1GA 3PM2A 2KPHA 2BBMA 2L51A 2CXJA 3L4LA 3O78A 3I5IC 3CWGA 1ZOTB 2BKHB 1BODA 3BUOB 1IH0A 2MRDA 1DC1A 4MZKA 3PALA 1ZUZA 1K95A 2LMVA 2COLB 2OS8B 2WORA 3BQ3A 5G08A 1FW4A 3NSIA 1TN4A 1CDMA 3D75A 2LCPA 4AQIA 2M7LA 1LVCD 1WLMA 2JXLA 3DF0B 5AFPA 2I2RE 1QVIZ 2JC2A 2F33A 3BUWB 3LCPC 1FPWA 4YRUA 1DELA 1TWOA 1K90D 1OMDA 1SL7A 3OX6A 2E30A 2ZRTA 2WC6A 4GUKA 3FWBA 1J7PA 2LMTA 3EK7A 3FE8A 3OGNA 1KSOA 1BR1B 1MWNA 2AAOA 2A4JA 1QATA 4M2OA 1A75A 1LXFC 1N2DA 3BUXB 2Y4QA 4YGCB 3CZ2A 1XFWO 1YR5A 1J1DA 1B47A 1SCMB 2ZKMX 4PE4A 4NDDA 2KFFA 3WHTB 2WC8A 1WRZA 2HQWA 2L2CA 4OR9B 5DKQA 2PYQA 5FI7A 1FI6A 3TS5B 3B88A 3DYEA 1K94A 2AMIA 3HX4A 4OVNF 1U5IA 3A8RA 2LANA 1IKUA 2M49B 2IS9A 4I5JA 1DVIA 2OTGB 1NX1A 1OMRA 1HT9A 1ZACA 2KFGA 5DKRA 1F71A 2LLUA 5D69A 1S36A 3NSOA 1UHHA 2JXCA 1IRJA 3FS7A 1JC2A 3ICBA 5FI2A 1CKKA 2KBIA 3VGOA 1JBAA 4MSPA 1T14A 2K2AA 4D1EA 1ODBA 1S5GY 4XYNA 2WCLA 1S5GZ 1SMGA 1SNLA 2PALA 2WCHA 3D74A 3EG5B 2PASA 1SKTA 2L4HA 3LLEA 1SCVA 1UUSA 2M1UA 2JT0A 1M39A 1A75B 1QX2A 2LVKA 3NHTA 2PSRA 3LL8B 1KQMB 2PQLA 3OP0A 1PVBA 2JT3A 4WQ2A
chains in the Genus database with same CATH topology
3BXKA 4JWQA 1BU3A 3VRPA 4YGEB 2EHBA 4IL1A 1DGVA 3I5HB 3IQQA 1DTLA 1SR6C 1U5IB 4MEWA 1KK8B 4A4BA 2EGDA 1IGVA 3GK4X 2K7CA 1XFUO 5AERA 5GQQC 1MHOA 1RWYA 1NP8A 1TNQA 4MZJA 4MVFA 1JUOA 5D7FA 2WCEA 1QIVA 5I2QA 1IJ5A 1BLQA 1QX5B 3SG6A 1S26D 1L2OB 3SG3A 2GV5A 2O5GA 2LUXA 2GGMA 5DKNA 4PHKA 1FI5A 1YUSA 2LM5A 3LK0A 1BT6A 1DJYA 1NX3A 2JRFA 5HYDA 1NUBA 1S6JA 1EL4A 2F3ZA 1PRWA 4GAOA 1KFXL 2LAPA 2PMYA 3LK1A 2KNEA 1QJTA 2BCAA 2WCFA 1EG4A 2K2FA 3O4YA 4PE0A 4AOMA 3EK4A 2JWWA 1J7RA 1VRKA 4YGAA 2MLFC 2KDHA 1W7IB 3CZTX 3DVJA 3F45A 3I5IB 4ICBA 4PCWA 1CMGA 4CLNA 5ER4X 1G4YR 3RLZA 1S6IA 1TCOB 3SIBA 4C0KA 1NCZA 3DF0A 4PHMA 2LP3A 1CMFA 1JWDA 4C0JA 4HREE 2F3YA 2P6BB 3QRXA 4WQ3A 2FCEA 2K0JA 1SL9A 4CPVA 1AVSA 1WRKA 1A29A 1Y1XA 2KAXA 3TDIA 4XJKA 4I5LB 1E8AA 1OZSA 1DJGA 2Y5IA 3D10A 1C7VA 1DJXA 2AUCA 2CTNA 1V1FA 3GOFA 1SBJA 1CLMA 1OSAA 1RFJA 1UHIA 3WHUB 2QACA 1BR4B 3ZNIA 1TCFA 2SASA 4C0LA 1MR8A 1K9UA 2LHIA 3DVKA 3E3RA 3OB1B 2O60A 2F2OA 1IQ3A 1OE9B 2CBLA 3NXAA 5HKWA 1DJHA 4GNKB 2KI6C 2F2PA 2L98A 2ISDA 1F70A 4OCIA 2LLSA 2WCBA 1K8UA 2K7DA 4JQ0D 2HETA 1XYDA 1WY9A 1EXRA 1AP4A 3PATA 1A4PA 2VRGA 3GK2A 3D0YA 3NSKA 5HLVA 3EVVA 1S6CA 1G33A 1PALA 3AAKA 3CR2A 4PALA 4QJ3B 2JT8A 1DJIA 2KI4C 4XJKB 1AJ4A 1BMOA 1S1EA 1OOJA 5AANA 3BUMB 2K61A 2QPTA 2ZRSA 3EKHA 1M31A 4HRGA 3CR4X 3KEVA 1UP5A 2V53A 3M0WA 4MBEA 2LLTA 2JPTA 1XVJA 4ETOA 1CLBA 1LA3A 3TUYC 1QASA 4MN0A 1IJ6A 3EVRA 1F55A 2H61C 1R2UA 3VRNA 3SIAA 1IG5A 1SR6B 1NX2A 2MHHA 2BL0C 1BJFA 5IBWA 5K89A 3D0YB 1B8RA 1A03A 2D8NA 2GGZA 2LV7A 3PFVA 3IF7A 3PM8A 4CIDA 2JTTA 1Y6WA 4GGFC 5KU1A 3RM1A 4F0ZB 4R1EA 2CNPA 3KO0A 1CM4A 1MQ1A 1IQ5A 1QS7A 2HF5A 4PDZA 5JJGA 1YVLA 2EC6B 1BOCA 1CLLA 4TNCA 3JTDB 2ZNDA 2FJUB 1NCXA 3JVTB 3EKJA 1QLKA 2ZFDA 2I94A 4PHNA 1K93D 4YGBB 2RGIA 3O2PA 4I5KA 4PE1A 3VRQA 2LNKA 1DF0B 1NYAA 3FWCA 2BCBA 4GBAA 2KOTA 5F6TA 1XFVO 2TN4A 1J55A 2WNDA 2LP2A 4GPLB 1QIWA 2KYCA 1H4BA 1QX7A 1RJVA 1KWOB 2LVJA 1XFXO 2Q91A 1JFJA 1WRLA 2JTZA 2KAVA 4WRIA 2NLNA 4FTGA 1GQMA 1CFCA 2M9GA 1NPQA 1BG1A 1RROA 1KFXS 3GK1A 1N0YA 2L4IA 1CB1A 3I5FC 3O6BA 4N1FA 1UHKA 2BE4A 3VROA 3TDUA 2WOSA 4NDBA 1RK9A 1TTXA 2PVBA 1K9PA 2NZ0A 2OPOA 1H8BA 1PSRA 1GGWA 2LE9B 3NSLA 5B8IB 1WLZA 2F8PA 1LA0A 2E6WA 3BYAA 1TNPA 1XK4C 1K9KA 1MXEA 2CCMA 4ORAB 2SCPA 1M45A 1KK7Y 2MJWB 2ZNEA 2I7AA 3SJSA 4DCKA 1YUTA 3DVMA 1LINA 1N65A 4N1GA 2G9BA 4GGFA 4JPZB 4OKHA 3CTNA 3K21A 2KI4B 1DGUA 3SG4A 2M97A 4MRYA 3I5GC 1KK8C 1SYMA 2BECA 4BY4A 1YVHA 3WXAA 2M1KB 4A4CA 2BE6A 2CT9A 2Q4UA 5I2LA 1DJZA 1UHJA 1QV0A 1SPYA 5ER5A 1L2OC 1G8IA 1ALVA 1GGZA 2M8UA 3SG2A 4MLWA 2PRUA 2K7OA 3TUYB 2K8MB 1ZFSA 3PSRA 2KHNA 4N5XA 1NSHA 2L0PA 1KQVA 2KGBC 1NX0A 2JU0A 4YBHB 1CFFA 4PHJA 3BOWA 1CFPA 3AAJA 1C7WA 3DVEA 4P2YB 1WDCC 1DMOA 3EK8A 5BPJA 2BL0B 1KCYA 1B1GA 1IWQA 3OHMB 3KHEA 3WNXB 2ZN8A 4P5OE 4PE7A 3EVUA 5TNCA 5I8NA 3CLNA 3PN7C 5HKYA 2BKIB 1DJWA 2R2IA 2M3WA 1XFYO 3CGAA 2M0RA 2L5XB 1JSAA 3CR5X 5HLOA 5AXIA 4QJ4B 1Y1UA 1DF0A 1QVIY 1M63B 2DOQA 2HQ8A 1F4QA 1KFUS 2KYFA 1KFUL 1FF1A 2JZIA 1TIZA 1JFKA 1R6PA 4ZCVA 5PALA 4CFRA 2NXQA 1BF5A 1SW8A 1YX7A 3OX5A 2KQYA 3CS1A 1XK4A 1MUXA 4GFTA 5HKZA 3C1VA 1B8LA 4UPGA 3SG5A 4YI8A 1K2HA 2M29A 5KTYA 4NQGA 1JF0A 1PK0D 3BOWB 1QXPA 2M7NA 1A2XA 5I2OA 5KSZA 1PVAA 5J3XA 1KSMA 2OS8C 5CPVA 1ZMZA 1PSBA 2L2EA 4M2QA 1J7OA 1PULA 1TNXA 3KF9A 1SRAA 2L50A 1C07A 1K96A 2KI6D 1TNWA 1AJ5A 1UURA 1RTP1 3I5FB 1HQVA 4ORCB 4DUQA 1CTRA 2MAZA 4BY5A 2MLEC 3TZ1A 1W7JB 4YI9A 1RECA 2JNXA 4I5NB 4L9MA 2I18A 4DS7A 2JQ6A 2KQ6A 2K7BA 1D1OA 1DT7B 3AKBA 3TDZA 1EG3A 2NCPA 5FYXA 1QLSA 3FIAA 1SCMC 2FCDA 1YX8A 4ZCUA 2G2BA 5JOLA 3OB2B 4MZLA 1CDLA 3TS5C 3HCMA 1B9AA 4AQJA 1S3PA 1NIWA 5CSNA 1QV1A 2LVVA 3ZWHA 1F4OA 1UWOA 1X02A 2LC5A 4USLA 1Y1AA 2H2KA 1EJ3A 2OTGC 3VRRA 4FQOA 1CDNA 1NCYA 2KBMA 3I5GB 1JF2A 2B1UA 3MSEB 4HRHA 1M46A 4GGNA 2ZN9A 1LKJA 2BBNA 4HSZA 4OV2A 1SL8A 4DRWA 1OZOA 4CFQA 1XO5A 3DD4A 1SK6D 1J1EA 3AKAA 4MRXA 1Y0VH 1XFZO 2MA2A 2LVIA 1YURA 2H61A 1AHRA 1XA5A 2EC6C 1CDPA 3JTDC 1MXLC 3KPXA 1B7TY 4QJ5B 1KQMC 4DIRA 1NWDA 1KK7Z 3JVTC 1CNPA 1AK8A 1CM1A 1B7TZ 2Y1MA 1WDCB 4U8DA 5CSJA 5AEQA 1YRUB 3BUNB 3I5HC 1L7ZA 2KGRA 2Y1NA 5CSIA 2KFHA 1FBVA 1OQPA 4M2PA 1SY9A 1MF8B 1UHNA 2JNFA 2KSPA 3PN7B 4ORBB 2LUCA 1B8CA 2LHLA 1AUIB 3H4SE 4NDCA 1EH2A 1F54A 5CSFA 1TRFA 2NCOA 1Q80A 2HPSA 1TOPA 1ALWA 4E68A 2FOTA 1YUUA 2MBXA 1KWOC 1YTZC 3IQOA 1QTXA 1B4CA 2KAYA 2BCXA 3SG7A 1CFDA 2JOJA 3A4UB 1YRTB 1GJYA 4YGDB 1J7QA 2LMUA 1OMVA 2JULA 1F8HA 3PLFB 4Q04A 1V1GA 2BBMA 2L51A 2CXJA 3O78A 3I5IC 3CWGA 1ZOTB 2BKHB 1BODA 3BUOB 1IH0A 2MRDA 4MZKA 3PALA 1ZUZA 1K95A 2LMVA 2COLB 2OS8B 2WORA 3BQ3A 5G08A 1FW4A 3NSIA 1TN4A 1CDMA 2LCPA 4AQIA 2M7LA 1LVCD 1WLMA 2JXLA 3DF0B 5AFPA 2I2RE 1QVIZ 2JC2A 2F33A 3BUWB 3LCPC 1FPWA 4YRUA 1K90D 1OMDA 1SL7A 3OX6A 2E30A 2ZRTA 4GUKA 1J7PA 3FWBA 2LMTA 3EK7A 1KSOA 1BR1B 1MWNA 2AAOA 2A4JA 1QATA 4M2OA 1A75A 1LXFC 1N2DA 3BUXB 2Y4QA 4YGCB 1XFWO 1YR5A 1J1DA 1B47A 1SCMB 2ZKMX 4PE4A 4NDDA 2KFFA 3WHTB 2WC8A 1WRZA 2HQWA 4OR9B 5DKQA 1FI6A 3TS5B 1K94A 2AMIA 3HX4A 4OVNF 1U5IA 3A8RA 2LANA 1IKUA 2M49B 2IS9A 4I5JA 1DVIA 2OTGB 1NX1A 1OMRA 1HT9A 1ZACA 2KFGA 5DKRA 1F71A 2LLUA 5D69A 1S36A 3NSOA 1UHHA 2JXCA 1IRJA 3FS7A 1JC2A 3ICBA 1CKKA 1JBAA 2KBIA 3VGOA 4MSPA 2K2AA 4D1EA 1ODBA 1S5GY 4XYNA 1S5GZ 1SMGA 1SNLA 2PALA 2PASA 1SKTA 2L4HA 3LLEA 1SCVA 1UUSA 2M1UA 2JT0A 1M39A 1A75B 1QX2A 2LVKA 2PSRA 3LL8B 1KQMB 3OP0A 1PVBA 2JT3A 4WQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BXK A;  4JWQ A;  1BU3 A;  3VRP A;  4YGE B;  2EHB A;  4IL1 A;  1DGV A;  3I5H B;  3IQQ A;  1DTL A;  1SR6 C;  1U5I B;  4MEW A;  1KK8 B;  4A4B A;  2EGD A;  1IGV A;  3GK4 X;  2K7C A;  1XFU O;  5AER A;  5GQQ C;  1MHO A;  1RWY A;  1NP8 A;  1TNQ A;  4MZJ A;  4MVF A;  1JUO A;  5D7F A;  2WCE A;  1QIV A;  5I2Q A;  1IJ5 A;  1BLQ A;  1QX5 B;  3SG6 A;  1S26 D;  1L2O B;  3SG3 A;  2GV5 A;  2O5G A;  2LUX A;  2GGM A;  5DKN A;  4PHK A;  1FI5 A;  1YUS A;  2LM5 A;  3LK0 A;  1BT6 A;  1DJY A;  1NX3 A;  2JRF A;  5HYD A;  1NUB A;  1S6J A;  1EL4 A;  2F3Z A;  1PRW A;  4GAO A;  1KFX L;  2LAP A;  2PMY A;  3LK1 A;  2KNE A;  1QJT A;  2BCA A;  2WCF A;  1EG4 A;  2K2F A;  3O4Y A;  4PE0 A;  4AOM A;  3EK4 A;  2JWW A;  1J7R A;  1VRK A;  4YGA A;  2MLF C;  2KDH A;  1W7I B;  3CZT X;  3DVJ A;  3F45 A;  3I5I B;  4ICB A;  4PCW A;  1CMG A;  4CLN A;  5ER4 X;  1G4Y R;  3RLZ A;  1S6I A;  1TCO B;  3SIB A;  4C0K A;  1NCZ A;  3DF0 A;  4PHM A;  2LP3 A;  1CMF A;  1JWD A;  4C0J A;  4HRE E;  2F3Y A;  2P6B B;  3QRX A;  4WQ3 A;  2FCE A;  2K0J A;  1SL9 A;  4CPV A;  1AVS A;  1WRK A;  1A29 A;  1Y1X A;  2KAX A;  3TDI A;  4XJK A;  4I5L B;  1E8A A;  1OZS A;  1DJG A;  2Y5I A;  3D10 A;  1C7V A;  1DJX A;  2AUC A;  2CTN A;  1V1F A;  3GOF A;  1SBJ A;  1CLM A;  1OSA A;  1RFJ A;  1UHI A;  3WHU B;  2QAC A;  1BR4 B;  3ZNI A;  1TCF A;  2SAS A;  4C0L A;  1MR8 A;  1K9U A;  2LHI A;  3DVK A;  3E3R A;  3OB1 B;  2O60 A;  2F2O A;  1IQ3 A;  1OE9 B;  2CBL A;  3NXA A;  5HKW A;  1DJH A;  4GNK B;  2KI6 C;  2F2P A;  2L98 A;  2ISD A;  1F70 A;  4OCI A;  2LLS A;  2WCB A;  1K8U A;  2K7D A;  4JQ0 D;  2HET A;  1XYD A;  1WY9 A;  1EXR A;  1AP4 A;  3PAT A;  1A4P A;  2VRG A;  3GK2 A;  3D0Y A;  3NSK A;  5HLV A;  3EVV A;  1S6C A;  1G33 A;  1PAL A;  3AAK A;  3CR2 A;  4PAL A;  4QJ3 B;  2JT8 A;  1DJI A;  2KI4 C;  4XJK B;  1AJ4 A;  1BMO A;  1S1E A;  1OOJ A;  5AAN A;  3BUM B;  2K61 A;  2QPT A;  2ZRS A;  3EKH A;  1M31 A;  4HRG A;  3CR4 X;  3KEV A;  1UP5 A;  2V53 A;  3M0W A;  4MBE A;  2LLT A;  2JPT A;  1XVJ A;  4ETO A;  1CLB A;  1LA3 A;  3TUY C;  1QAS A;  4MN0 A;  1IJ6 A;  3EVR A;  1F55 A;  2H61 C;  1R2U A;  3VRN A;  3SIA A;  1IG5 A;  1SR6 B;  1NX2 A;  2MHH A;  2BL0 C;  1BJF A;  5IBW A;  5K89 A;  3D0Y B;  1B8R A;  1A03 A;  2D8N A;  2GGZ A;  2LV7 A;  3PFV A;  3IF7 A;  3PM8 A;  4CID A;  2JTT A;  1Y6W A;  4GGF C;  5KU1 A;  3RM1 A;  4F0Z B;  4R1E A;  2CNP A;  3KO0 A;  1CM4 A;  1MQ1 A;  1IQ5 A;  1QS7 A;  2HF5 A;  4PDZ A;  5JJG A;  1YVL A;  2EC6 B;  1BOC A;  1CLL A;  4TNC A;  3JTD B;  2ZND A;  2FJU B;  1NCX A;  3JVT B;  3EKJ A;  1QLK A;  2ZFD A;  2I94 A;  4PHN A;  1K93 D;  4YGB B;  2RGI A;  3O2P A;  4I5K A;  4PE1 A;  3VRQ A;  2LNK A;  1DF0 B;  1NYA A;  3FWC A;  2BCB A;  4GBA A;  2KOT A;  5F6T A;  1XFV O;  2TN4 A;  1J55 A;  2WND A;  2LP2 A;  4GPL B;  1QIW A;  2KYC A;  1H4B A;  1QX7 A;  1RJV A;  1KWO B;  2LVJ A;  1XFX O;  2Q91 A;  1JFJ A;  1WRL A;  2JTZ A;  2KAV A;  4WRI A;  2NLN A;  4FTG A;  1GQM A;  1CFC A;  2M9G A;  1NPQ A;  1BG1 A;  1RRO A;  1KFX S;  3GK1 A;  1N0Y A;  2L4I A;  1CB1 A;  3I5F C;  3O6B A;  4N1F A;  1UHK A;  2BE4 A;  3VRO A;  3TDU A;  2WOS A;  4NDB A;  1RK9 A;  1TTX A;  2PVB A;  1K9P A;  2NZ0 A;  2OPO A;  1H8B A;  1PSR A;  1GGW A;  2LE9 B;  3NSL A;  5B8I B;  1WLZ A;  2F8P A;  1LA0 A;  2E6W A;  3BYA A;  1TNP A;  1XK4 C;  1K9K A;  1MXE A;  2CCM A;  4ORA B;  2SCP A;  1M45 A;  1KK7 Y;  2MJW B;  2ZNE A;  2I7A A;  3SJS A;  4DCK A;  1YUT A;  3DVM A;  1LIN A;  1N65 A;  4N1G A;  2G9B A;  4GGF A;  4JPZ B;  4OKH A;  3CTN A;  3K21 A;  2KI4 B;  1DGU A;  3SG4 A;  2M97 A;  4MRY A;  3I5G C;  1KK8 C;  1SYM A;  2BEC A;  4BY4 A;  1YVH A;  3WXA A;  2M1K B;  4A4C A;  2BE6 A;  2CT9 A;  2Q4U A;  5I2L A;  1DJZ A;  1UHJ A;  1QV0 A;  1SPY A;  5ER5 A;  1L2O C;  1G8I A;  1ALV A;  1GGZ A;  2M8U A;  3SG2 A;  4MLW A;  2PRU A;  2K7O A;  3TUY B;  2K8M B;  1ZFS A;  3PSR A;  2KHN A;  4N5X A;  1NSH A;  2L0P A;  1KQV A;  2KGB C;  1NX0 A;  2JU0 A;  4YBH B;  1CFF A;  4PHJ A;  3BOW A;  1CFP A;  3AAJ A;  1C7W A;  3DVE A;  4P2Y B;  1WDC C;  1DMO A;  3EK8 A;  5BPJ A;  2BL0 B;  1KCY A;  1B1G A;  1IWQ A;  3OHM B;  3KHE A;  3WNX B;  2ZN8 A;  4P5O E;  4PE7 A;  3EVU A;  5TNC A;  5I8N A;  3CLN A;  3PN7 C;  5HKY A;  2BKI B;  1DJW A;  2R2I A;  2M3W A;  1XFY O;  3CGA A;  2M0R A;  2L5X B;  1JSA A;  3CR5 X;  5HLO A;  5AXI A;  4QJ4 B;  1Y1U A;  1DF0 A;  1QVI Y;  1M63 B;  2DOQ A;  2HQ8 A;  1F4Q A;  1KFU S;  2KYF A;  1KFU L;  1FF1 A;  2JZI A;  1TIZ A;  1JFK A;  1R6P A;  4ZCV A;  5PAL A;  4CFR A;  2NXQ A;  1BF5 A;  1SW8 A;  1YX7 A;  3OX5 A;  2KQY A;  3CS1 A;  1XK4 A;  1MUX A;  4GFT A;  5HKZ A;  3C1V A;  1B8L A;  4UPG A;  3SG5 A;  4YI8 A;  1K2H A;  2M29 A;  5KTY A;  4NQG A;  1JF0 A;  1PK0 D;  3BOW B;  1QXP A;  2M7N A;  1A2X A;  5I2O A;  5KSZ A;  1PVA A;  5J3X A;  1KSM A;  2OS8 C;  5CPV A;  1ZMZ A;  1PSB A;  2L2E A;  4M2Q A;  1J7O A;  1PUL A;  1TNX A;  3KF9 A;  1SRA A;  2L50 A;  1C07 A;  1K96 A;  2KI6 D;  1TNW A;  1AJ5 A;  1UUR A;  1RTP 1;  3I5F B;  1HQV A;  4ORC B;  4DUQ A;  1CTR A;  2MAZ A;  4BY5 A;  2MLE C;  3TZ1 A;  1W7J B;  4YI9 A;  1REC A;  2JNX A;  4I5N B;  4L9M A;  2I18 A;  4DS7 A;  2JQ6 A;  2KQ6 A;  2K7B A;  1D1O A;  1DT7 B;  3AKB A;  3TDZ A;  1EG3 A;  2NCP A;  5FYX A;  1QLS A;  3FIA A;  1SCM C;  2FCD A;  1YX8 A;  4ZCU A;  2G2B A;  5JOL A;  3OB2 B;  4MZL A;  1CDL A;  3TS5 C;  3HCM A;  1B9A A;  4AQJ A;  1S3P A;  1NIW A;  5CSN A;  1QV1 A;  2LVV A;  3ZWH A;  1F4O A;  1UWO A;  1X02 A;  2LC5 A;  4USL A;  1Y1A A;  2H2K A;  1EJ3 A;  2OTG C;  3VRR A;  4FQO A;  1CDN A;  1NCY A;  2KBM A;  3I5G B;  1JF2 A;  2B1U A;  3MSE B;  4HRH A;  1M46 A;  4GGN A;  2ZN9 A;  1LKJ A;  2BBN A;  4HSZ A;  4OV2 A;  1SL8 A;  4DRW A;  1OZO A;  4CFQ A;  1XO5 A;  3DD4 A;  1SK6 D;  1J1E A;  3AKA A;  4MRX A;  1Y0V H;  1XFZ O;  2MA2 A;  2LVI A;  1YUR A;  2H61 A;  1AHR A;  1XA5 A;  2EC6 C;  1CDP A;  3JTD C;  1MXL C;  3KPX A;  1B7T Y;  4QJ5 B;  1KQM C;  4DIR A;  1NWD A;  1KK7 Z;  3JVT C;  1CNP A;  1AK8 A;  1CM1 A;  1B7T Z;  2Y1M A;  1WDC B;  4U8D A;  5CSJ A;  5AEQ A;  1YRU B;  3BUN B;  3I5H C;  1L7Z A;  2KGR A;  2Y1N A;  5CSI A;  2KFH A;  1FBV A;  1OQP A;  4M2P A;  1SY9 A;  1MF8 B;  1UHN A;  2JNF A;  2KSP A;  3PN7 B;  4ORB B;  2LUC A;  1B8C A;  2LHL A;  1AUI B;  3H4S E;  4NDC A;  1EH2 A;  1F54 A;  5CSF A;  1TRF A;  2NCO A;  1Q80 A;  2HPS A;  1TOP A;  1ALW A;  4E68 A;  2FOT A;  1YUU A;  2MBX A;  1KWO C;  1YTZ C;  3IQO A;  1QTX A;  1B4C A;  2KAY A;  2BCX A;  3SG7 A;  1CFD A;  2JOJ A;  3A4U B;  1YRT B;  1GJY A;  4YGD B;  1J7Q A;  2LMU A;  1OMV A;  2JUL A;  1F8H A;  3PLF B;  4Q04 A;  1V1G A;  2BBM A;  2L51 A;  2CXJ A;  3O78 A;  3I5I C;  3CWG A;  1ZOT B;  2BKH B;  1BOD A;  3BUO B;  1IH0 A;  2MRD A;  4MZK A;  3PAL A;  1ZUZ A;  1K95 A;  2LMV A;  2COL B;  2OS8 B;  2WOR A;  3BQ3 A;  5G08 A;  1FW4 A;  3NSI A;  1TN4 A;  1CDM A;  2LCP A;  4AQI A;  2M7L A;  1LVC D;  1WLM A;  2JXL A;  3DF0 B;  5AFP A;  2I2R E;  1QVI Z;  2JC2 A;  2F33 A;  3BUW B;  3LCP C;  1FPW A;  4YRU A;  1K90 D;  1OMD A;  1SL7 A;  3OX6 A;  2E30 A;  2ZRT A;  4GUK A;  1J7P A;  3FWB A;  2LMT A;  3EK7 A;  1KSO A;  1BR1 B;  1MWN A;  2AAO A;  2A4J A;  1QAT A;  4M2O A;  1A75 A;  1LXF C;  1N2D A;  3BUX B;  2Y4Q A;  4YGC B;  1XFW O;  1YR5 A;  1J1D A;  1B47 A;  1SCM B;  2ZKM X;  4PE4 A;  4NDD A;  2KFF A;  3WHT B;  2WC8 A;  1WRZ A;  2HQW A;  4OR9 B;  5DKQ A;  1FI6 A;  3TS5 B;  1K94 A;  2AMI A;  3HX4 A;  4OVN F;  1U5I A;  3A8R A;  2LAN A;  1IKU A;  2M49 B;  2IS9 A;  4I5J A;  1DVI A;  2OTG B;  1NX1 A;  1OMR A;  1HT9 A;  1ZAC A;  2KFG A;  5DKR A;  1F71 A;  2LLU A;  5D69 A;  1S36 A;  3NSO A;  1UHH A;  2JXC A;  1IRJ A;  3FS7 A;  1JC2 A;  3ICB A;  1CKK A;  1JBA A;  2KBI A;  3VGO A;  4MSP A;  2K2A A;  4D1E A;  1ODB A;  1S5G Y;  4XYN A;  1S5G Z;  1SMG A;  1SNL A;  2PAL A;  2PAS A;  1SKT A;  2L4H A;  3LLE A;  1SCV A;  1UUS A;  2M1U A;  2JT0 A;  1M39 A;  1A75 B;  1QX2 A;  2LVK A;  2PSR A;  3LL8 B;  1KQM B;  3OP0 A;  1PVB A;  2JT3 A;  4WQ2 A; 
#chains in the Genus database with same CATH topology
 3BXK A;  4JWQ A;  1BU3 A;  3VRP A;  4YGE B;  2EHB A;  4IL1 A;  1DGV A;  1OOH A;  3I5H B;  3IQQ A;  1DTL A;  1SR6 C;  1U5I B;  4MEW A;  1KK8 B;  4A4B A;  2EGD A;  1IGV A;  3GK4 X;  2K7C A;  1XFU O;  5AER A;  5GQQ C;  1MHO A;  1RWY A;  1NP8 A;  1TNQ A;  4MZJ A;  4MVF A;  1DQE A;  1JUO A;  5D7F A;  2WCE A;  1QIV A;  5I2Q A;  1IJ5 A;  1BLQ A;  5DIC A;  1QX5 B;  3SG6 A;  1S26 D;  1L2O B;  3SG3 A;  2GV5 A;  2O5G A;  2LUX A;  2GGM A;  5DKN A;  4PHK A;  1FI5 A;  1YUS A;  2LM5 A;  3O4X A;  3LK0 A;  1BT6 A;  2P71 A;  1DJY A;  1NX3 A;  2JRF A;  5HYD A;  3SS4 A;  1NUB A;  1S6J A;  1EL4 A;  2F3Z A;  3FE6 A;  1PRW A;  4GAO A;  3DZT A;  1KFX L;  3S0E A;  2LAP A;  2PMY A;  3LK1 A;  2KNE A;  1QJT A;  2BCA A;  2WCF A;  1EG4 A;  2K2F A;  3O4Y A;  4PE0 A;  4AOM A;  3EK4 A;  2JWW A;  1J7R A;  1VRK A;  3L47 A;  2MLF C;  2KDH A;  1W7I B;  3CZT X;  3DVJ A;  3F45 A;  3I5I B;  4ICB A;  4PCW A;  3UO9 A;  1CMG A;  4CLN A;  5ER4 X;  1G4Y R;  3RLZ A;  1S6I A;  1TCO B;  3SIB A;  4C0K A;  2WCM A;  1NCZ A;  3DF0 A;  4PHM A;  2LP3 A;  1CMF A;  1JWD A;  4C0J A;  4HRE E;  2F3Y A;  2P6B B;  3QRX A;  4WQ3 A;  2FCE A;  2K0J A;  1SL9 A;  4CPV A;  4F7F A;  1AVS A;  1WRK A;  1A29 A;  1Y1X A;  2KAX A;  3NGV A;  3TDI A;  3CDN A;  4I5L B;  1E8A A;  4XJK A;  1OZS A;  1DJG A;  2Y5I A;  3D10 A;  1C7V A;  1DJX A;  2AUC A;  2CTN A;  1V1F A;  3GOF A;  1SBJ A;  1CLM A;  1Z4H A;  1OSA A;  1IIO A;  1RFJ A;  1UHI A;  3WHU B;  2QAC A;  1BR4 B;  3ZNI A;  1TCF A;  2SAS A;  4C0L A;  1MR8 A;  2WCK A;  1K9U A;  2LHI A;  3DVK A;  3E3R A;  3OB1 B;  2O60 A;  1OW4 A;  2F2O A;  1OE9 B;  1IQ3 A;  2CBL A;  3NXA A;  3DY9 A;  5HKW A;  1DJH A;  4GNK B;  3IVT A;  2KI6 C;  2F2P A;  3S0D A;  2L98 A;  2ISD A;  1F70 A;  4OCI A;  2LLS A;  2WCB A;  1K8U A;  2K7D A;  4JQ0 D;  1GM0 A;  3K1E A;  2HET A;  4INW A;  1XYD A;  1WY9 A;  1EXR A;  1AP4 A;  3PAT A;  1A4P A;  2VRG A;  3GK2 A;  3D0Y A;  3NSK A;  5HLV A;  1OOI X;  4JD9 A;  3EVV A;  1LS8 A;  1S6C A;  1G33 A;  1PAL A;  3AAK A;  3CR2 A;  4PAL A;  4QJ3 B;  2JT8 A;  1DJI A;  2KI4 C;  4XJK B;  1AJ4 A;  1BMO A;  1S1E A;  1OOJ A;  5AAN A;  1C3Y A;  3D77 A;  3BUM B;  2K61 A;  2KLD A;  2QPT A;  2ZRS A;  1M31 A;  3EKH A;  4HRG A;  3CR4 X;  3KEV A;  1UP5 A;  2V53 A;  3M0W A;  4MBE A;  2LLT A;  2JPT A;  1XVJ A;  4ETO A;  1CLB A;  1LA3 A;  3TUY C;  1QAS A;  2QDI A;  4IJ7 A;  4JKT A;  2ERB A;  4MN0 A;  1IJ6 A;  3EVR A;  1F55 A;  1W9Z A;  2H61 C;  1R2U A;  3VRN A;  3SIA A;  1IG5 A;  1SR6 B;  2QEV A;  1NX2 A;  2MHH A;  2BL0 C;  2FJY A;  1BJF A;  5IBW A;  2BAP A;  5K89 A;  3D0Y B;  1B8R A;  1A03 A;  2D8N A;  3SS3 A;  2GGZ A;  2LV7 A;  3PFV A;  3IF7 A;  3PM8 A;  4CID A;  2JTT A;  1Y6W A;  3Q8I A;  1QWV A;  4GGF C;  5KU1 A;  3RM1 A;  3CYZ A;  4F0Z B;  4R1E A;  2CNP A;  3KO0 A;  1CM4 A;  1MQ1 A;  1IQ5 A;  1QS7 A;  2HF5 A;  4PDZ A;  5JJG A;  1YVL A;  2EC6 B;  1BOC A;  1CLL A;  4TNC A;  3JTD B;  2ZND A;  2FJU B;  1NCX A;  2P70 A;  3JVT B;  3EKJ A;  1QLK A;  2ZFD A;  2I94 A;  4PHN A;  1K93 D;  4YGB B;  2RGI A;  3O2P A;  4I5K A;  4PE1 A;  3VRQ A;  2LNK A;  1DF0 B;  1NYA A;  5FI6 A;  3FWC A;  2BCB A;  3V2L A;  4GBA A;  2KOT A;  5F6T A;  1XFV O;  2TN4 A;  3S0A A;  1J55 A;  2WND A;  5EL2 A;  2LP2 A;  4GPL B;  1QIW A;  2BNX A;  2KYC A;  1H4B A;  1P28 A;  1XFR A;  1QX7 A;  1RJV A;  1KWO B;  2LVJ A;  1XFX O;  2Q91 A;  2K60 A;  3BJH A;  1JFJ A;  1WRL A;  2JTZ A;  2KAV A;  4WRI A;  2NLN A;  3B87 A;  4FTG A;  1GQM A;  3VB1 A;  2M9G A;  1NPQ A;  1BG1 A;  1RRO A;  1KFX S;  1CFC A;  3GK1 A;  1N0Y A;  2L4I A;  3R72 A;  3I5F C;  1CB1 A;  3O6B A;  4N1F A;  1UHK A;  2BE4 A;  3BFB A;  3VRO A;  3TDU A;  2WOS A;  4NDB A;  1RK9 A;  1TTX A;  2PVB A;  1K9P A;  2NZ0 A;  2OPO A;  1H8B A;  1PSR A;  1GGW A;  2LE9 B;  3NSL A;  5B8I B;  1WLZ A;  2F8P A;  1LA0 A;  2E6W A;  3BYA A;  1TNP A;  1XK4 C;  3L4A A;  1K9K A;  1MXE A;  2CCM A;  4ORA B;  2SCP A;  1M45 A;  1KK7 Y;  2MJW B;  2ZNE A;  2I7A A;  3SJS A;  4DCK A;  1YUT A;  3DVM A;  2WC5 A;  3FE9 A;  1LIN A;  1C3Z A;  1N65 A;  2QEO A;  4OZD A;  4N1G A;  2G9B A;  4GGF A;  4JPZ B;  4OKH A;  3CTN A;  3K21 A;  5I94 A;  4KYN A;  2KI4 B;  3DXL A;  1DGU A;  3SG4 A;  2M97 A;  4MRY A;  3I5G C;  1KK8 C;  1SYM A;  2BEC A;  2WCJ A;  4BY4 A;  1YVH A;  3BFH A;  2M1K B;  3WXA A;  4A4C A;  2BE6 A;  2CT9 A;  2Q4U A;  3D73 A;  5I2L A;  1DJZ A;  1UHJ A;  1QV0 A;  1SPY A;  5ER5 A;  1L2O C;  1G8I A;  3S0B A;  1ALV A;  1GGZ A;  2M8U A;  3SG2 A;  3D78 A;  4MLW A;  2PRU A;  3CZ0 A;  2K7O A;  3TUY B;  2K8M B;  1ZFS A;  3PSR A;  2KHN A;  4N5X A;  1NSH A;  2L0P A;  1KQV A;  2KGB C;  1NX0 A;  2JU0 A;  4YBH B;  1CFF A;  3S0F A;  4PHJ A;  3BOW A;  1CFP A;  3AAJ A;  1C7W A;  3DVE A;  4P2Y B;  1WDC C;  1DMO A;  3EK8 A;  5BPJ A;  2BL0 B;  1KCY A;  3CZ1 A;  1B1G A;  1IWQ A;  3OHM B;  3KHE A;  3CAB A;  3WNX B;  2ZN8 A;  3R1P A;  4P5O E;  4PE7 A;  3EVU A;  5TNC A;  5I8N A;  3B6X A;  3CLN A;  3PN7 C;  5HKY A;  2BKI B;  1DJW A;  2R2I A;  2M3W A;  1XFY O;  3CGA A;  2M0R A;  2L5X B;  2L5Y A;  3R1O A;  1JSA A;  3CR5 X;  5HLO A;  5AXI A;  4QJ4 B;  1Y1U A;  1DF0 A;  1QVI Y;  2KLE A;  2JPO A;  1M63 B;  2DOQ A;  2HQ8 A;  1F4Q A;  1KFU S;  2KYF A;  1KFU L;  3SS5 A;  1FF1 A;  3UNW A;  2JZI A;  1TIZ A;  1JFK A;  1R6P A;  4ZCV A;  5PAL A;  4CFR A;  2NXQ A;  1BF5 A;  1SW8 A;  1YX7 A;  3OX5 A;  2KQY A;  3CS1 A;  1XK4 A;  1MUX A;  4GFT A;  5HKZ A;  3C1V A;  1B8L A;  4UPG A;  3SG5 A;  4YI8 A;  3R1V A;  1K2H A;  2M29 A;  5KTY A;  4NQG A;  1JF0 A;  1PK0 D;  3BOW B;  1QXP A;  2M7N A;  1A2X A;  5I2O A;  5KSZ A;  1PVA A;  5J3X A;  1KSM A;  2OS8 C;  5CPV A;  1ZMZ A;  1PSB A;  2L2E A;  4M2Q A;  5D3O A;  1PUL A;  1TNX A;  3KF9 A;  1SRA A;  2L50 A;  1J7O A;  1C07 A;  1K96 A;  2QEB A;  2KI6 D;  1TNW A;  1AJ5 A;  1UUR A;  1RTP 1;  3I5F B;  1HQV A;  4ORC B;  4DUQ A;  1CTR A;  2MAZ A;  4BY5 A;  2MLE C;  5HL1 A;  3TZ1 A;  1W7J B;  4YI9 A;  1REC A;  2JNX A;  4I5N B;  4L9M A;  2I18 A;  4DS7 A;  2JQ6 A;  2KQ6 A;  2K7B A;  1D1O A;  1DT7 B;  3AKB A;  1SSE B;  3TDZ A;  3B7A A;  1EG3 A;  2NCP A;  5FYX A;  1QLS A;  3FIA A;  1SCM C;  2FCD A;  1YX8 A;  3D76 A;  4INX A;  4ZCU A;  2G2B A;  5JOL A;  3OB2 B;  4MZL A;  1CDL A;  3TS5 C;  3HCM A;  1B9A A;  2QEH A;  4AQJ A;  1S3P A;  1NIW A;  5CSN A;  1QV1 A;  2LVV A;  3ZWH A;  4FQT A;  1F4O A;  1UWO A;  1X02 A;  2LC5 A;  3N7H A;  4USL A;  3RZS A;  1Y1A A;  2H2K A;  1EJ3 A;  2OTG C;  3VRR A;  4FQO A;  2GTE A;  1CDN A;  1NCY A;  2KBM A;  3I5G B;  1JF2 A;  2B1U A;  3MSE B;  4HRH A;  1OOF A;  1M46 A;  4GGN A;  2ZN9 A;  4YGA A;  1LKJ A;  2BBN A;  4HSZ A;  4OV2 A;  1SL8 A;  4DRW A;  1OZO A;  4CFQ A;  1XO5 A;  3DD4 A;  1SK6 D;  1J1E A;  3AKA A;  4MRX A;  1Y0V H;  1TUZ A;  3OBV A;  1XFZ O;  2MA2 A;  2LVI A;  1YUR A;  2H61 A;  1AHR A;  1XA5 A;  2EC6 C;  3S0G A;  1CDP A;  3JTD C;  1MXL C;  3KPX A;  1B7T Y;  4QJ5 B;  1Z2C B;  2YGU A;  1KQM C;  4DIR A;  1NWD A;  1KK7 Z;  2H8V A;  3JVT C;  1CNP A;  1AK8 A;  1CM1 A;  1B7T Z;  2Y1M A;  1WDC B;  1OOG A;  1ORG A;  4U8D A;  5CSJ A;  5AEQ A;  1YRU B;  3BUN B;  3I5H C;  1L7Z A;  2KGR A;  2Y1N A;  5CSI A;  2KFH A;  1FBV A;  1OQP A;  4M2P A;  1SY9 A;  1MF8 B;  1UHN A;  2JNF A;  2KSP A;  3PN7 B;  4ORB B;  1TUJ A;  2LUC A;  1B8C A;  2LHL A;  3NHI A;  1AUI B;  3H4S E;  4NDC A;  1EH2 A;  1F54 A;  5CSF A;  1TRF A;  2NCO A;  1Q80 A;  2HPS A;  1TOP A;  1ALW A;  4E68 A;  2FOT A;  1YUU A;  3B86 A;  2MBX A;  1KWO C;  1YTZ C;  3IQO A;  1QTX A;  1DEK A;  3QME A;  1B4C A;  2KAY A;  2BCX A;  3SG7 A;  1CFD A;  2JOJ A;  3BFA A;  3A4U B;  1YRT B;  1GJY A;  3PJI A;  4YGD B;  1J7Q A;  2LMU A;  1OMV A;  2JUL A;  4PT1 A;  1F8H A;  3PLF B;  4Q04 A;  1V1G A;  3PM2 A;  2KPH A;  2BBM A;  2L51 A;  2CXJ A;  3L4L A;  3O78 A;  3I5I C;  3CWG A;  1ZOT B;  2BKH B;  1BOD A;  3BUO B;  1IH0 A;  2MRD A;  1DC1 A;  4MZK A;  3PAL A;  1ZUZ A;  1K95 A;  2LMV A;  2COL B;  2OS8 B;  2WOR A;  3BQ3 A;  5G08 A;  1FW4 A;  3NSI A;  1TN4 A;  1CDM A;  3D75 A;  2LCP A;  4AQI A;  2M7L A;  1LVC D;  1WLM A;  2JXL A;  3DF0 B;  5AFP A;  2I2R E;  1QVI Z;  2JC2 A;  2F33 A;  3BUW B;  3LCP C;  1FPW A;  4YRU A;  1DEL A;  1TWO A;  1K90 D;  1OMD A;  1SL7 A;  3OX6 A;  2E30 A;  2ZRT A;  2WC6 A;  4GUK A;  3FWB A;  1J7P A;  2LMT A;  3EK7 A;  3FE8 A;  3OGN A;  1KSO A;  1BR1 B;  1MWN A;  2AAO A;  2A4J A;  1QAT A;  4M2O A;  1A75 A;  1LXF C;  1N2D A;  3BUX B;  2Y4Q A;  4YGC B;  3CZ2 A;  1XFW O;  1YR5 A;  1J1D A;  1B47 A;  1SCM B;  2ZKM X;  4PE4 A;  4NDD A;  2KFF A;  3WHT B;  2WC8 A;  1WRZ A;  2HQW A;  2L2C A;  4OR9 B;  5DKQ A;  2PYQ A;  5FI7 A;  1FI6 A;  3TS5 B;  3B88 A;  3DYE A;  1K94 A;  2AMI A;  3HX4 A;  4OVN F;  1U5I A;  3A8R A;  2LAN A;  1IKU A;  2M49 B;  2IS9 A;  4I5J A;  1DVI A;  2OTG B;  1NX1 A;  1OMR A;  1HT9 A;  1ZAC A;  2KFG A;  5DKR A;  1F71 A;  2LLU A;  5D69 A;  1S36 A;  3NSO A;  1UHH A;  2JXC A;  1IRJ A;  3FS7 A;  1JC2 A;  3ICB A;  5FI2 A;  1CKK A;  2KBI A;  3VGO A;  1JBA A;  4MSP A;  1T14 A;  2K2A A;  4D1E A;  1ODB A;  1S5G Y;  4XYN A;  2WCL A;  1S5G Z;  1SMG A;  1SNL A;  2PAL A;  2WCH A;  3D74 A;  3EG5 B;  2PAS A;  1SKT A;  2L4H A;  3LLE A;  1SCV A;  1UUS A;  2M1U A;  2JT0 A;  1M39 A;  1A75 B;  1QX2 A;  2LVK A;  3NHT A;  2PSR A;  3LL8 B;  1KQM B;  2PQL A;  3OP0 A;  1PVB A;  2JT3 A;  4WQ2 A; 
#chains in the Genus database with same CATH homology
 3BXK A;  4JWQ A;  1BU3 A;  3VRP A;  4YGE B;  2EHB A;  4IL1 A;  1DGV A;  3I5H B;  3IQQ A;  1DTL A;  1SR6 C;  1U5I B;  4MEW A;  1KK8 B;  4A4B A;  2EGD A;  1IGV A;  3GK4 X;  2K7C A;  1XFU O;  5AER A;  5GQQ C;  1MHO A;  1RWY A;  1NP8 A;  1TNQ A;  4MZJ A;  4MVF A;  1JUO A;  5D7F A;  2WCE A;  1QIV A;  5I2Q A;  1IJ5 A;  1BLQ A;  1QX5 B;  3SG6 A;  1S26 D;  1L2O B;  3SG3 A;  2GV5 A;  2O5G A;  2LUX A;  2GGM A;  5DKN A;  4PHK A;  1FI5 A;  1YUS A;  2LM5 A;  3LK0 A;  1BT6 A;  1DJY A;  1NX3 A;  2JRF A;  5HYD A;  1NUB A;  1S6J A;  1EL4 A;  2F3Z A;  1PRW A;  4GAO A;  1KFX L;  2LAP A;  2PMY A;  3LK1 A;  2KNE A;  1QJT A;  2BCA A;  2WCF A;  1EG4 A;  2K2F A;  3O4Y A;  4PE0 A;  4AOM A;  3EK4 A;  2JWW A;  1J7R A;  1VRK A;  4YGA A;  2MLF C;  2KDH A;  1W7I B;  3CZT X;  3DVJ A;  3F45 A;  3I5I B;  4ICB A;  4PCW A;  1CMG A;  4CLN A;  5ER4 X;  1G4Y R;  3RLZ A;  1S6I A;  1TCO B;  3SIB A;  4C0K A;  1NCZ A;  3DF0 A;  4PHM A;  2LP3 A;  1CMF A;  1JWD A;  4C0J A;  4HRE E;  2F3Y A;  2P6B B;  3QRX A;  4WQ3 A;  2FCE A;  2K0J A;  1SL9 A;  4CPV A;  1AVS A;  1WRK A;  1A29 A;  1Y1X A;  2KAX A;  3TDI A;  4XJK A;  4I5L B;  1E8A A;  1OZS A;  1DJG A;  2Y5I A;  3D10 A;  1C7V A;  1DJX A;  2AUC A;  2CTN A;  1V1F A;  3GOF A;  1SBJ A;  1CLM A;  1OSA A;  1RFJ A;  1UHI A;  3WHU B;  2QAC A;  1BR4 B;  3ZNI A;  1TCF A;  2SAS A;  4C0L A;  1MR8 A;  1K9U A;  2LHI A;  3DVK A;  3E3R A;  3OB1 B;  2O60 A;  2F2O A;  1IQ3 A;  1OE9 B;  2CBL A;  3NXA A;  5HKW A;  1DJH A;  4GNK B;  2KI6 C;  2F2P A;  2L98 A;  2ISD A;  1F70 A;  4OCI A;  2LLS A;  2WCB A;  1K8U A;  2K7D A;  4JQ0 D;  2HET A;  1XYD A;  1WY9 A;  1EXR A;  1AP4 A;  3PAT A;  1A4P A;  2VRG A;  3GK2 A;  3D0Y A;  3NSK A;  5HLV A;  3EVV A;  1S6C A;  1G33 A;  1PAL A;  3AAK A;  3CR2 A;  4PAL A;  4QJ3 B;  2JT8 A;  1DJI A;  2KI4 C;  4XJK B;  1AJ4 A;  1BMO A;  1S1E A;  1OOJ A;  5AAN A;  3BUM B;  2K61 A;  2QPT A;  2ZRS A;  3EKH A;  1M31 A;  4HRG A;  3CR4 X;  3KEV A;  1UP5 A;  2V53 A;  3M0W A;  4MBE A;  2LLT A;  2JPT A;  1XVJ A;  4ETO A;  1CLB A;  1LA3 A;  3TUY C;  1QAS A;  4MN0 A;  1IJ6 A;  3EVR A;  1F55 A;  2H61 C;  1R2U A;  3VRN A;  3SIA A;  1IG5 A;  1SR6 B;  1NX2 A;  2MHH A;  2BL0 C;  1BJF A;  5IBW A;  5K89 A;  3D0Y B;  1B8R A;  1A03 A;  2D8N A;  2GGZ A;  2LV7 A;  3PFV A;  3IF7 A;  3PM8 A;  4CID A;  2JTT A;  1Y6W A;  4GGF C;  5KU1 A;  3RM1 A;  4F0Z B;  4R1E A;  2CNP A;  3KO0 A;  1CM4 A;  1MQ1 A;  1IQ5 A;  1QS7 A;  2HF5 A;  4PDZ A;  5JJG A;  1YVL A;  2EC6 B;  1BOC A;  1CLL A;  4TNC A;  3JTD B;  2ZND A;  2FJU B;  1NCX A;  3JVT B;  3EKJ A;  1QLK A;  2ZFD A;  2I94 A;  4PHN A;  1K93 D;  4YGB B;  2RGI A;  3O2P A;  4I5K A;  4PE1 A;  3VRQ A;  2LNK A;  1DF0 B;  1NYA A;  3FWC A;  2BCB A;  4GBA A;  2KOT A;  5F6T A;  1XFV O;  2TN4 A;  1J55 A;  2WND A;  2LP2 A;  4GPL B;  1QIW A;  2KYC A;  1H4B A;  1QX7 A;  1RJV A;  1KWO B;  2LVJ A;  1XFX O;  2Q91 A;  1JFJ A;  1WRL A;  2JTZ A;  2KAV A;  4WRI A;  2NLN A;  4FTG A;  1GQM A;  1CFC A;  2M9G A;  1NPQ A;  1BG1 A;  1RRO A;  1KFX S;  3GK1 A;  1N0Y A;  2L4I A;  1CB1 A;  3I5F C;  3O6B A;  4N1F A;  1UHK A;  2BE4 A;  3VRO A;  3TDU A;  2WOS A;  4NDB A;  1RK9 A;  1TTX A;  2PVB A;  1K9P A;  2NZ0 A;  2OPO A;  1H8B A;  1PSR A;  1GGW A;  2LE9 B;  3NSL A;  5B8I B;  1WLZ A;  2F8P A;  1LA0 A;  2E6W A;  3BYA A;  1TNP A;  1XK4 C;  1K9K A;  1MXE A;  2CCM A;  4ORA B;  2SCP A;  1M45 A;  1KK7 Y;  2MJW B;  2ZNE A;  2I7A A;  3SJS A;  4DCK A;  1YUT A;  3DVM A;  1LIN A;  1N65 A;  4N1G A;  2G9B A;  4GGF A;  4JPZ B;  4OKH A;  3CTN A;  3K21 A;  2KI4 B;  1DGU A;  3SG4 A;  2M97 A;  4MRY A;  3I5G C;  1KK8 C;  1SYM A;  2BEC A;  4BY4 A;  1YVH A;  3WXA A;  2M1K B;  4A4C A;  2BE6 A;  2CT9 A;  2Q4U A;  5I2L A;  1DJZ A;  1UHJ A;  1QV0 A;  1SPY A;  5ER5 A;  1L2O C;  1G8I A;  1ALV A;  1GGZ A;  2M8U A;  3SG2 A;  4MLW A;  2PRU A;  2K7O A;  3TUY B;  2K8M B;  1ZFS A;  3PSR A;  2KHN A;  4N5X A;  1NSH A;  2L0P A;  1KQV A;  2KGB C;  1NX0 A;  2JU0 A;  4YBH B;  1CFF A;  4PHJ A;  3BOW A;  1CFP A;  3AAJ A;  1C7W A;  3DVE A;  4P2Y B;  1WDC C;  1DMO A;  3EK8 A;  5BPJ A;  2BL0 B;  1KCY A;  1B1G A;  1IWQ A;  3OHM B;  3KHE A;  3WNX B;  2ZN8 A;  4P5O E;  4PE7 A;  3EVU A;  5TNC A;  5I8N A;  3CLN A;  3PN7 C;  5HKY A;  2BKI B;  1DJW A;  2R2I A;  2M3W A;  1XFY O;  3CGA A;  2M0R A;  2L5X B;  1JSA A;  3CR5 X;  5HLO A;  5AXI A;  4QJ4 B;  1Y1U A;  1DF0 A;  1QVI Y;  1M63 B;  2DOQ A;  2HQ8 A;  1F4Q A;  1KFU S;  2KYF A;  1KFU L;  1FF1 A;  2JZI A;  1TIZ A;  1JFK A;  1R6P A;  4ZCV A;  5PAL A;  4CFR A;  2NXQ A;  1BF5 A;  1SW8 A;  1YX7 A;  3OX5 A;  2KQY A;  3CS1 A;  1XK4 A;  1MUX A;  4GFT A;  5HKZ A;  3C1V A;  1B8L A;  4UPG A;  3SG5 A;  4YI8 A;  1K2H A;  2M29 A;  5KTY A;  4NQG A;  1JF0 A;  1PK0 D;  3BOW B;  1QXP A;  2M7N A;  1A2X A;  5I2O A;  5KSZ A;  1PVA A;  5J3X A;  1KSM A;  2OS8 C;  5CPV A;  1ZMZ A;  1PSB A;  2L2E A;  4M2Q A;  1J7O A;  1PUL A;  1TNX A;  3KF9 A;  1SRA A;  2L50 A;  1C07 A;  1K96 A;  2KI6 D;  1TNW A;  1AJ5 A;  1UUR A;  1RTP 1;  3I5F B;  1HQV A;  4ORC B;  4DUQ A;  1CTR A;  2MAZ A;  4BY5 A;  2MLE C;  3TZ1 A;  1W7J B;  4YI9 A;  1REC A;  2JNX A;  4I5N B;  4L9M A;  2I18 A;  4DS7 A;  2JQ6 A;  2KQ6 A;  2K7B A;  1D1O A;  1DT7 B;  3AKB A;  3TDZ A;  1EG3 A;  2NCP A;  5FYX A;  1QLS A;  3FIA A;  1SCM C;  2FCD A;  1YX8 A;  4ZCU A;  2G2B A;  5JOL A;  3OB2 B;  4MZL A;  1CDL A;  3TS5 C;  3HCM A;  1B9A A;  4AQJ A;  1S3P A;  1NIW A;  5CSN A;  1QV1 A;  2LVV A;  3ZWH A;  1F4O A;  1UWO A;  1X02 A;  2LC5 A;  4USL A;  1Y1A A;  2H2K A;  1EJ3 A;  2OTG C;  3VRR A;  4FQO A;  1CDN A;  1NCY A;  2KBM A;  3I5G B;  1JF2 A;  2B1U A;  3MSE B;  4HRH A;  1M46 A;  4GGN A;  2ZN9 A;  1LKJ A;  2BBN A;  4HSZ A;  4OV2 A;  1SL8 A;  4DRW A;  1OZO A;  4CFQ A;  1XO5 A;  3DD4 A;  1SK6 D;  1J1E A;  3AKA A;  4MRX A;  1Y0V H;  1XFZ O;  2MA2 A;  2LVI A;  1YUR A;  2H61 A;  1AHR A;  1XA5 A;  2EC6 C;  1CDP A;  3JTD C;  1MXL C;  3KPX A;  1B7T Y;  4QJ5 B;  1KQM C;  4DIR A;  1NWD A;  1KK7 Z;  3JVT C;  1CNP A;  1AK8 A;  1CM1 A;  1B7T Z;  2Y1M A;  1WDC B;  4U8D A;  5CSJ A;  5AEQ A;  1YRU B;  3BUN B;  3I5H C;  1L7Z A;  2KGR A;  2Y1N A;  5CSI A;  2KFH A;  1FBV A;  1OQP A;  4M2P A;  1SY9 A;  1MF8 B;  1UHN A;  2JNF A;  2KSP A;  3PN7 B;  4ORB B;  2LUC A;  1B8C A;  2LHL A;  1AUI B;  3H4S E;  4NDC A;  1EH2 A;  1F54 A;  5CSF A;  1TRF A;  2NCO A;  1Q80 A;  2HPS A;  1TOP A;  1ALW A;  4E68 A;  2FOT A;  1YUU A;  2MBX A;  1KWO C;  1YTZ C;  3IQO A;  1QTX A;  1B4C A;  2KAY A;  2BCX A;  3SG7 A;  1CFD A;  2JOJ A;  3A4U B;  1YRT B;  1GJY A;  4YGD B;  1J7Q A;  2LMU A;  1OMV A;  2JUL A;  1F8H A;  3PLF B;  4Q04 A;  1V1G A;  2BBM A;  2L51 A;  2CXJ A;  3O78 A;  3I5I C;  3CWG A;  1ZOT B;  2BKH B;  1BOD A;  3BUO B;  1IH0 A;  2MRD A;  4MZK A;  3PAL A;  1ZUZ A;  1K95 A;  2LMV A;  2COL B;  2OS8 B;  2WOR A;  3BQ3 A;  5G08 A;  1FW4 A;  3NSI A;  1TN4 A;  1CDM A;  2LCP A;  4AQI A;  2M7L A;  1LVC D;  1WLM A;  2JXL A;  3DF0 B;  5AFP A;  2I2R E;  1QVI Z;  2JC2 A;  2F33 A;  3BUW B;  3LCP C;  1FPW A;  4YRU A;  1K90 D;  1OMD A;  1SL7 A;  3OX6 A;  2E30 A;  2ZRT A;  4GUK A;  1J7P A;  3FWB A;  2LMT A;  3EK7 A;  1KSO A;  1BR1 B;  1MWN A;  2AAO A;  2A4J A;  1QAT A;  4M2O A;  1A75 A;  1LXF C;  1N2D A;  3BUX B;  2Y4Q A;  4YGC B;  1XFW O;  1YR5 A;  1J1D A;  1B47 A;  1SCM B;  2ZKM X;  4PE4 A;  4NDD A;  2KFF A;  3WHT B;  2WC8 A;  1WRZ A;  2HQW A;  4OR9 B;  5DKQ A;  1FI6 A;  3TS5 B;  1K94 A;  2AMI A;  3HX4 A;  4OVN F;  1U5I A;  3A8R A;  2LAN A;  1IKU A;  2M49 B;  2IS9 A;  4I5J A;  1DVI A;  2OTG B;  1NX1 A;  1OMR A;  1HT9 A;  1ZAC A;  2KFG A;  5DKR A;  1F71 A;  2LLU A;  5D69 A;  1S36 A;  3NSO A;  1UHH A;  2JXC A;  1IRJ A;  3FS7 A;  1JC2 A;  3ICB A;  1CKK A;  1JBA A;  2KBI A;  3VGO A;  4MSP A;  2K2A A;  4D1E A;  1ODB A;  1S5G Y;  4XYN A;  1S5G Z;  1SMG A;  1SNL A;  2PAL A;  2PAS A;  1SKT A;  2L4H A;  3LLE A;  1SCV A;  1UUS A;  2M1U A;  2JT0 A;  1M39 A;  1A75 B;  1QX2 A;  2LVK A;  2PSR A;  3LL8 B;  1KQM B;  3OP0 A;  1PVB A;  2JT3 A;  4WQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...