1JF0A

The crystal structure of obelin from obelia geniculata at 1.82 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
192
structure length
192
Chain Sequence
b'KYAVKLQTDFDNPKWIKRHKFMFDYLDINGNGQITLDEIVSKASDDICKNLGATPAQTQRHQDCVEAFFRGCGLEYGKETKFPEFLEGWKNLANADLAKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGRISGISPSEEDCEKTFQHCDLDNSGELDVDEMTRQHLGFWYTLDPEADGLYGNGVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obelin
publication title The Crystal Structure of Obelin from Obelia geniculata at 1.82 Angstrom Resolution
rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 76
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2001-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jf0A00
3EKJA 1J7RA 1YX8A 5HKYA 5ER5A 1JSAA 4L9MA 5CSIA 1YURA 1KK7Y 3KHEA 1NX1A 5HLVA 3IQQA 1BMOA 1BG1A 2LHLA 4PHMA 1HT9A 2L4IA 3VRQA 1BOCA 1KK8B 1KFUL 4OVNF 4DUQA 2Y1MA 4GGFC 4PE7A 4CPVA 4CIDA 2JULA 2BCXA 4Q04A 2HPSA 1UURA 1YUTA 2LMUA 1XVJA 2ZN9A 2LUXA 4FQOA 3SJSA 1S6IA 4I5KA 4A4BA 4MZJA 1D1OA 3GK1A 1JF0A 1TNPA 1KQMC 1Y1XA 2LE9B 1NX3A 2P6BB 3LK1A 1ZFSA 2JTZA 1SK6D 3ZWHA 2F33A 1DJWA 2TN4A 1UHIA 1WLZA 1A4PA 1SMGA 4M2OA 4JPZB 2K2FA 2CBLA 1CFPA 1F4OA 2NXQA 2NZ0A 4P5OE 1IKUA 1KQMB 1OSAA 4P2YB 4GGFA 2HQ8A 1R6PA 1OMRA 2B1UA 1J7OA 1JFKA 3KO0A 5J3XA 5D7FA 4YGAA 2PVBA 4DS7A 5AFPA 4GUKA 1IJ5A 1SPYA 3FIAA 1TNWA 2ZRSA 3AKAA 2K7CA 1CTRA 4MRYA 2KFHA 1OZSA 1K93D 4PE1A 4TNCA 4A4CA 4ZCUA 4OCIA 4U8DA 2CXJA 2HF5A 1DF0B 3DVKA 1QASA 3CGAA 2M7NA 5I2LA 2QACA 1DJXA 1MF8B 1K9PA 3LCPC 1Y6WA 1JBAA 3TDZA 4F0ZB 2JNFA 2JNXA 1OE9B 1WY9A 2M1UA 3HCMA 1B7TY 2JT8A 4PE4A 2PRUA 3SG5A 1QLSA 4YGDB 3CZTX 3ZNIA 2Q4UA 1RROA 1PSRA 5IBWA 2CT9A 3CTNA 3NSOA 1AUIB 1DF0A 1K95A 1SR6C 2PSRA 4GFTA 4XJKB 5DKRA 3RLZA 3SG4A 5D69A 1S36A 3BXKA 4DIRA 2H2KA 2LMVA 4I5JA 4WQ3A 1UP5A 1QXPA 2ZNEA 3PSRA 3ICBA 4NDCA 2F3ZA 3EK7A 1OZOA 1MXEA 1KCYA 2M3WA 1DJHA 1PK0D 1SNLA 3I5FC 1TCFA 4AOMA 3BYAA 1V1FA 2JXCA 1U5IA 1DTLA 1CLLA 3PATA 2G2BA 3M0WA 2R2IA 3DF0B 1AK8A 1J7QA 1GQMA 1TTXA 1WDCB 1PALA 4E68A 5K89A 4DCKA 1XK4C 1IH0A 2M49B 3CWGA 3OP0A 3BOWA 1W7IB 3TDUA 3I5FB 3BUMB 2KFFA 1CDPA 3DF0A 2F2OA 5AEQA 5JOLA 3KEVA 1YTZC 1GJYA 3BQ3A 1N0YA 5CSJA 1A75B 4JQ0D 4YGBB 2VRGA 3I5HC 4GAOA 1OMVA 4OKHA 5HLOA 5JJGA 1NX0A 1KK8C 1NYAA 1G8IA 2Y1NA 1CFDA 3O4YA 3PM8A 1SL9A 3SG3A 1BLQA 1SCVA 2KHNA 5DKNA 1EG4A 1M39A 2BKHB 1B7TZ 2MAZA 3NSKA 1SYMA 1AVSA 1S6JA 4MRXA 1L7ZA 1K9KA 1BF5A 1B1GA 2BL0B 1PVAA 1G4YR 1A75A 3I5HB 1G33A 1XK4A 1DJGA 2BECA 4R1EA 2LVIA 2GGMA 1B8CA 3PLFB 3WHUB 2KI6C 4WQ2A 2PMYA 5GQQC 1DVIA 2BBMA 1IRJA 1N65A 3DVMA 1YRTB 5HYDA 2LVKA 1X02A 1NIWA 2LV7A 1QS7A 1NCYA 5HKZA 3D0YB 1ZACA 1V1GA 2L0PA 2I18A 1YVHA 5AERA 1BJFA 2MBXA 1L2OB 4CLNA 2M97A 3VRNA 3HX4A 3OHMB 2JZIA 4MLWA 1XFUO 1CDLA 1NUBA 4ZCVA 1JWDA 1SBJA 2MHHA 1K2HA 1J1DA 1DJIA 1LINA 1VRKA 2EGDA 4UPGA 1YVLA 2K8MB 2FJUB 2JT0A 2KGBC 2LLUA 4NDBA 1UHKA 2GV5A 1DT7B 1RECA 1NCZA 1QX7A 1NCXA 4M2QA 1QLKA 2L2EA 4HSZA 4PHNA 1TOPA 4WRIA 1YUUA 2RGIA 1KFXS 5BPJA 2FOTA 1QV0A 2CNPA 1PULA 2HETA 5KSZA 2IS9A 2KI4C 1XFXO 3WHTB 1ODBA 1NP8A 1KK7Z 2LHIA 4AQJA 5CPVA 3RM1A 2K0JA 4GBAA 4YGEB 2CTNA 1NWDA 3PALA 3CS1A 1LKJA 1NPQA 2WCBA 2MJWB 1SKTA 2ZKMX 1QTXA 1S26D 2M29A 1PRWA 3EK4A 1B9AA 3JTDC 3PFVA 2D8NA 1RK9A 1ALVA 1BU3A 1C7WA 1RFJA 2KYFA 1TRFA 4NQGA 2KI4B 4PHJA 2OTGC 1GGWA 1B4CA 3TS5B 1RTP1 3VGOA 2OPOA 1N2DA 2Q91A 3AAKA 4MEWA 1BODA 4DRWA 5KU1A 5I2OA 3F45A 1JC2A 2JPTA 2LANA 3BUWB 1LXFC 4GGNA 1ZUZA 1JF2A 3JTDB 4FTGA 2M1KB 2NLNA 2OTGB 3SG6A 2L50A 3DVEA 2KNEA 1WDCC 2F3YA 3AAJA 4YRUA 2KOTA 3CLNA 1ZMZA 2KGRA 1CFFA 1TCOB 1SRAA 2DOQA 2KBMA 4MBEA 3FWCA 4HRGA 3OB1B 1S3PA 5F6TA 1SW8A 2V53A 3MSEB 1UHHA 2JOJA 4XJKA 1FPWA 1YRUB 1IGVA 3O6BA 3VROA 2K7DA 2WORA 1GGZA 1F8HA 1OOJA 1UHJA 1Y1UA 2E6WA 2JRFA 1XFVO 2KQYA 4I5NB 3VRRA 1IWQA 5KTYA 2PALA 1XFYO 1TNQA 3LK0A 3NSLA 2KAVA 1BT6A 2FCEA 1DGVA 1QX2A 2KYCA 5HKWA 2AAOA 4C0LA 1FI5A 1F4QA 1B8RA 2O60A 2L4HA 4BY5A 1YUSA 2BL0C 1JUOA 3EK8A 3FWBA 1CMGA 1KSMA 1F71A 4MZLA 1CLBA 2KI6D 3VRPA 1K8UA 5CSFA 1UWOA 1KWOC 2CCMA 3IF7A 1CB1A 3AKBA 3DVJA 1FF1A 1TNXA 2BE6A 1K9UA 4MN0A 1KFUS 4OV2A 2M9GA 4I5LB 1QV1A 2M7LA 2KDHA 1Q80A 4NDDA 1MQ1A 2MRDA 4QJ3B 4PE0A 2K2AA 3QRXA 1QX5B 1CNPA 4ORBB 2EHBA 4ORCB 1YX7A 1KWOB 1IQ5A 2JTTA 1WRKA 4YGCB 2OS8C 4YI9A 1K94A 2L5XB 3EVVA 1KQVA 2KSPA 1L2OC 4QJ5B 4USLA 1J1EA 1M31A 3KF9A 4GNKB 1BR4B 1DMOA 2AUCA 4XYNA 4N1FA 3SG7A 1M46A 2L51A 2G9BA 1DJZA 3CR4X 2OS8B 1MHOA 1XYDA 1OMDA 1PSBA 2WNDA 3OX5A 4MZKA 3TUYC 2BE4A 1XO5A 2WCFA 1AHRA 1YR5A 3CR5X 2LC5A 2Y5IA 1A03A 4YBHB 2LP2A 1K90D 2MLFC 3GK4X 1B47A 4N5XA 1J55A 3D0YA 1JFJA 2O5GA 4PCWA 4HREE 3NXAA 3WXAA 5I8NA 5I2QA 1MXLC 2QPTA 2K61A 3NSIA 1BR1B 3I5GC 3GOFA 3TUYB 1EH2A 2EC6C 4PDZA 3O2PA 3I5IC 2SASA 3LL8B 4PALA 2I94A 2ZFDA 2GGZA 4MVFA 3TS5C 1H8BA 1KSOA 2LCPA 3PN7C 1LVCD 1SL8A 2LVVA 1CM4A 4GPLB 2LNKA 1F55A 2L98A 5TNCA 2JC2A 2KQ6A 3DD4A 4C0JA 1FBVA 3I5GB 1IQ3A 2EC6B 3BUXB 1CKKA 1M45A 2NCOA 1S5GY 3I5IB 2F8PA 2A4JA 1MWNA 3JVTC 1XFWO 1C7VA 1EL4A 1MR8A 3PN7B 2HQWA 1CDMA 1NSHA 2ZNDA 3OB2B 1RWYA 1W7JB 2PASA 3FS7A 5AXIA 4C0KA 1Y1AA 2Y4QA 4CFQA 1KFXL 1AP4A 2H61C 2K7OA 4JWQA 5G08A 3O78A 4IL1A 2MA2A 1QVIY 4ICBA 1A29A 1WLMA 1S6CA 1FW4A 3JVTB 1CDNA 2ZN8A 3BUNB 1K96A 2WCEA 3E3RA 3TDIA 1DGUA 4AQIA 4ORAB 2E30A 2LM5A 2KBIA 1CFCA 4CFRA 3D10A 2COLB 3GK2A 2JT3A 1TN4A 3H4SE 3K21A 1SCMC 1QJTA 1TIZA 2K7BA 1IJ6A 3KPXA 3SG2A 5B8IB 1MUXA 2WOSA 1B8LA 2JQ6A 2LUCA 1M63B 1U5IB 3IQOA 2NCPA 3LLEA 1IG5A 2I2RE 3CR2A 2LAPA 4OR9B 4BY4A 1XA5A 2LLSA 1A2XA 5FYXA 2BCBA 1AJ4A 1LA0A 3BUOB 3SIBA 4ETOA 4PHKA 2BKIB 1EG3A 2H61A 1SCMB 3BOWB 1QATA 1SL7A 1NX2A 1Y0VH 1SY9A 2WC8A 2LP3A 3EVUA 2AMIA 2LLTA 2FCDA 2KAYA 1AJ5A 1EXRA 1RJVA 3EVRA 1SR6B 2ISDA 1CLMA 2KFGA 1S5GZ 2JXLA 2SCPA 1XFZO 3EKHA 1EJ3A 2LMTA 4N1GA 3A4UB 3C1VA 3OX6A 5CSNA 2M0RA 3TZ1A 4M2PA 3WNXB 4D1EA 2MLEC 4MSPA 1UHNA 1WRZA 1F70A 1QIVA 1S1EA 4YI8A 1DJYA 1E8AA 5PALA 4QJ4B 1ZOTB 1LA3A 1QVIZ 4HRHA 1H4BA 3SIAA 2LVJA 2M8UA 1PVBA 2KAXA 3A8RA 2F2PA 1CMFA 2ZRTA 2I7AA 1HQVA 5DKQA 2BCAA 1F54A 1UUSA 1WRLA 1QIWA 1OQPA 2JU0A 1J7PA 5AANA 1C07A 1R2UA 5ER4X 2BBNA 1CM1A 2JWWA 1ALWA 1FI6A
chains in the Genus database with same CATH superfamily
3EKJA 1J7RA 1YX8A 3NHIA 5HKYA 5ER5A 1W9ZA 1JSAA 4L9MA 5CSIA 1YURA 1KK7Y 3KHEA 1NX1A 5HLVA 3IQQA 1BMOA 1BG1A 2LHLA 4PHMA 1HT9A 2L4IA 3VRQA 1BOCA 1KK8B 1KFUL 4OVNF 4DUQA 2Y1MA 4GGFC 4PE7A 4CPVA 3DYEA 4CIDA 2JULA 2BCXA 3QMEA 4Q04A 2HPSA 1UURA 1YUTA 2LMUA 1XVJA 2ZN9A 2LUXA 3B6XA 4FQOA 3SJSA 1S6IA 4I5KA 4A4BA 4MZJA 1D1OA 3GK1A 1JF0A 1TNPA 1KQMC 1OW4A 1Y1XA 2LE9B 1NX3A 2P6BB 3LK1A 3S0GA 2YGUA 1ZFSA 2JTZA 3B86A 1SK6D 3SS5A 1DC1A 3ZWHA 2F33A 3CDNA 1DJWA 1XFRA 2TN4A 2L5YA 1UHIA 1WLZA 1A4PA 1SMGA 4M2OA 3D77A 4JPZB 2K2FA 2CBLA 1CFPA 1F4OA 2NXQA 2NZ0A 4P5OE 1IKUA 1KQMB 1OSAA 4P2YB 4GGFA 2HQ8A 1R6PA 1OMRA 2B1UA 3VB1A 1J7OA 1JFKA 2L2CA 3KO0A 5J3XA 2QEHA 5D7FA 4YGAA 2PVBA 4DS7A 5AFPA 4GUKA 1IJ5A 1SPYA 3CYZA 3FIAA 1TNWA 2ZRSA 3B87A 1OOFA 3BFAA 3AKAA 2K7CA 2WC5A 1CTRA 4OZDA 4MRYA 3D75A 2KFHA 1OZSA 1K93D 4PE1A 4TNCA 4A4CA 3OBVA 4ZCUA 4OCIA 4U8DA 3L47A 3R1PA 2CXJA 2HF5A 1DF0B 3DVKA 1QASA 3CGAA 2M7NA 5I2LA 2QACA 1DJXA 1MF8B 1K9PA 3LCPC 5I94A 1Y6WA 1JBAA 3TDZA 4F0ZB 2JNFA 2JNXA 1OE9B 1WY9A 2M1UA 3HCMA 1B7TY 2JT8A 4PE4A 2PRUA 3SG5A 1QLSA 4YGDB 3CZTX 3ZNIA 2Q4UA 1RROA 1PSRA 5IBWA 2CT9A 3CTNA 3NSOA 1AUIB 1DF0A 1K95A 1SR6C 2BNXA 2FJYA 2PSRA 4XJKB 5DKRA 3RLZA 3SG4A 5D69A 1S36A 2PYQA 3BXKA 2H2KA 2LMVA 3D76A 4I5JA 4WQ3A 1UP5A 4DIRA 1QXPA 2ZNEA 3NGVA 3PSRA 3ICBA 4NDCA 2F3ZA 3EK7A 1OZOA 1MXEA 1KCYA 5D3OA 2M3WA 1DJHA 1PK0D 1SNLA 3I5FC 1TCFA 4KYNA 4AOMA 1C3YA 3BYAA 1V1FA 5EL2A 2JXCA 1U5IA 1DTLA 1CLLA 3PATA 2G2BA 3M0WA 2R2IA 3DF0B 1AK8A 1J7QA 1GQMA 2KLDA 1TTXA 1WDCB 1PALA 1TUZA 5K89A 4DCKA 4E68A 2WCJA 3UNWA 1XK4C 2QEVA 3K1EA 2M49B 1IH0A 3CWGA 3OP0A 3BOWA 1W7IB 3TDUA 3I5FB 3BUMB 2KFFA 1CDPA 1SSEB 3DF0A 2F2OA 5AEQA 5JOLA 2GTEA 3KEVA 1YTZC 3S0BA 1GJYA 3BQ3A 1N0YA 5CSJA 1A75B 4JQ0D 4YGBB 2VRGA 3I5HC 4GAOA 1OMVA 4OKHA 5HLOA 5JJGA 1NX0A 1KK8C 1NYAA 1G8IA 2KPHA 1CFDA 2Y1NA 3CZ0A 1SL9A 3O4YA 3PM8A 3SG3A 1BLQA 1SCVA 2KHNA 5DKNA 1EG4A 1M39A 2BKHB 1B7TZ 2MAZA 3BFBA 3NSKA 1SYMA 1AVSA 1S6JA 3BFHA 4MRXA 1L7ZA 1K9KA 3DY9A 1BF5A 1B1GA 1ORGA 2BL0B 3B7AA 1PVAA 1G4YR 2BAPA 1A75A 3I5HB 1G33A 1XK4A 1DJGA 2WCLA 2BECA 3Q8IA 4R1EA 2LVIA 2GGMA 1B8CA 3PLFB 3WHUB 1OOIX 2KI6C 4WQ2A 2PMYA 5GQQC 1DVIA 2BBMA 4IJ7A 1IRJA 1N65A 3DVMA 1YRTB 4FQTA 5HYDA 2LVKA 1X02A 1NIWA 2LV7A 2QEBA 5HL1A 3D73A 1QS7A 1OOHA 1NCYA 5HKZA 3D0YB 1ZACA 1V1GA 2L0PA 1Z2CB 2I18A 4INWA 1YVHA 5AERA 1BJFA 2MBXA 1L2OB 4CLNA 2M97A 3VRNA 3HX4A 3OHMB 2JZIA 4MLWA 1XFUO 1CDLA 1NUBA 4ZCVA 1JWDA 1SBJA 2MHHA 1K2HA 1J1DA 1DJIA 1LINA 1VRKA 2EGDA 4UPGA 1YVLA 2K8MB 2FJUB 3RZSA 2JT0A 2KGBC 2LLUA 4NDBA 1UHKA 2GV5A 1DT7B 1RECA 3V2LA 1NCZA 1QX7A 1NCXA 1TWOA 1QLKA 4M2QA 2L2EA 4HSZA 4PHNA 1TOPA 4WRIA 1YUUA 2RGIA 1KFXS 5BPJA 2WCHA 2FOTA 1QV0A 2CNPA 1PULA 2HETA 5KSZA 2IS9A 2KI4C 1XFXO 3WHTB 1ODBA 1NP8A 1KK7Z 2LHIA 4AQJA 5CPVA 3RM1A 2K0JA 4GBAA 4INXA 4YGEB 2CTNA 1NWDA 3PALA 3CS1A 1LKJA 1NPQA 2WCBA 2MJWB 1SKTA 2ZKMX 1QTXA 3NHTA 1S26D 2M29A 1PRWA 3EK4A 1B9AA 3JTDC 2K60A 3PFVA 2D8NA 1RK9A 1ALVA 1BU3A 1C7WA 1RFJA 2KYFA 1TRFA 3PM2A 4GFTA 4NQGA 2KI4B 4PHJA 2OTGC 1GGWA 1B4CA 3TS5B 1RTP1 3VGOA 2OPOA 1N2DA 2Q91A 3AAKA 3D78A 4MEWA 1BODA 4DRWA 5KU1A 5DICA 5I2OA 3F45A 1JC2A 2JPTA 2LANA 3BUWB 1LXFC 4GGNA 1ZUZA 1JF2A 3JTDB 4FTGA 2M1KB 2NLNA 2OTGB 3SG6A 2L50A 3DVEA 2KNEA 1WDCC 2F3YA 3AAJA 4YRUA 2KOTA 3CLNA 1ZMZA 2KGRA 1CFFA 1TCOB 1SRAA 2DOQA 2KBMA 4MBEA 3FWCA 4HRGA 3OB1B 1S3PA 5F6TA 1SW8A 2V53A 2WCKA 3CABA 3MSEB 1UHHA 2JOJA 4XJKA 1FPWA 1YRUB 1IGVA 3O6BA 3R1VA 3VROA 2K7DA 2WORA 1GGZA 1F8HA 1OOJA 1UHJA 1Y1UA 2E6WA 2JRFA 1XFVO 2KQYA 4I5NB 3VRRA 1IWQA 3R1OA 3R72A 5KTYA 2PALA 1XFYO 1TNQA 3LK0A 3NSLA 2KAVA 1BT6A 2FCEA 1DGVA 1QX2A 2KYCA 5HKWA 2AAOA 4C0LA 1FI5A 1F4QA 1B8RA 2O60A 1DEKA 2P70A 2L4HA 4JD9A 3DXLA 3D74A 1YUSA 2BL0C 4BY5A 2ERBA 1TUJA 1JUOA 3EK8A 3FWBA 1CMGA 1KSMA 1F71A 4MZLA 1CLBA 2KI6D 3VRPA 1K8UA 5CSFA 1UWOA 1KWOC 2CCMA 3IF7A 1Z4HA 1CB1A 3AKBA 3DVJA 1FF1A 1TNXA 2BE6A 1K9UA 4MN0A 1T14A 1KFUS 4OV2A 2M9GA 4I5LB 1QV1A 2QDIA 2KDHA 2M7LA 1Q80A 4NDDA 1MQ1A 2MRDA 4QJ3B 4PE0A 2K2AA 3QRXA 1QX5B 1CNPA 4ORBB 2EHBA 4ORCB 1YX7A 1KWOB 1IQ5A 2JTTA 1WRKA 4YGCB 2OS8C 4YI9A 1K94A 2KLEA 2L5XB 3EVVA 1KQVA 2KSPA 1L2OC 4QJ5B 4USLA 2P71A 1J1EA 1M31A 3KF9A 4GNKB 2WC6A 1BR4B 1DMOA 2AUCA 4XYNA 4N1FA 3SG7A 1M46A 1IIOA 2L51A 2G9BA 1DJZA 3CR4X 2OS8B 1MHOA 1XYDA 1OMDA 1PSBA 2WNDA 3OX5A 4MZKA 3FE8A 3TUYC 2BE4A 1XO5A 2WCFA 1AHRA 1YR5A 3CR5X 2LC5A 2Y5IA 1A03A 4YBHB 2LP2A 1GM0A 1K90D 2MLFC 3GK4X 1B47A 4N5XA 1J55A 3BJHA 3D0YA 3FE9A 1JFJA 2O5GA 4PCWA 4HREE 3NXAA 3WXAA 5I8NA 5I2QA 1MXLC 2QPTA 1P28A 2K61A 3NSIA 3DZTA 1BR1B 3I5GC 3GOFA 3S0DA 3TUYB 1EH2A 2EC6C 4PDZA 3O2PA 3I5IC 2SASA 3LL8B 1QWVA 4PALA 2I94A 2ZFDA 2GGZA 4MVFA 3TS5C 1H8BA 3PJIA 1KSOA 2LCPA 2WCMA 3PN7C 1LVCD 1SL8A 2LVVA 1CM4A 4GPLB 3S0FA 5FI6A 2LNKA 1F55A 2L98A 5TNCA 2JC2A 2KQ6A 3DD4A 3UO9A 1FBVA 3I5GB 4C0JA 1IQ3A 2EC6B 3BUXB 1CKKA 1M45A 2NCOA 1S5GY 3I5IB 2F8PA 2A4JA 1MWNA 3JVTC 1XFWO 1C7VA 1EL4A 1MR8A 3CZ1A 3PN7B 2HQWA 1CDMA 1NSHA 2ZNDA 3L4LA 3OB2B 1C3ZA 1RWYA 1DELA 1W7JB 2PASA 3FS7A 5AXIA 4C0KA 1Y1AA 2Y4QA 3SS3A 4CFQA 1KFXL 1AP4A 2H61C 2K7OA 3FE6A 4JWQA 5G08A 3O78A 4IL1A 2MA2A 3IVTA 1QVIY 5FI2A 4ICBA 1A29A 1WLMA 1S6CA 1FW4A 2QEOA 3JVTB 1CDNA 2ZN8A 3B88A 3BUNB 1K96A 2WCEA 3E3RA 3TDIA 1DGUA 2JPOA 4AQIA 4ORAB 2E30A 2LM5A 2KBIA 1CFCA 4CFRA 3D10A 3OGNA 4F7FA 2COLB 3GK2A 1OOGA 2JT3A 1TN4A 3H4SE 3K21A 1DQEA 1QJTA 1SCMC 1TIZA 2K7BA 1IJ6A 3KPXA 3SG2A 5B8IB 3SS4A 1MUXA 2WOSA 1B8LA 2JQ6A 2LUCA 1M63B 1U5IB 3IQOA 2NCPA 3LLEA 1IG5A 2I2RE 3CR2A 2LAPA 4OR9B 4BY4A 1XA5A 3O4XA 2LLSA 1A2XA 5FYXA 2BCBA 1AJ4A 1LA0A 3BUOB 3SIBA 4ETOA 3S0AA 4PHKA 1LS8A 2BKIB 1EG3A 3S0EA 2H61A 1SCMB 3BOWB 1QATA 1SL7A 1NX2A 1Y0VH 2PQLA 1SY9A 2WC8A 2LP3A 3EVUA 2AMIA 2LLTA 2FCDA 4PT1A 2KAYA 1AJ5A 1EXRA 1RJVA 3EVRA 1SR6B 3L4AA 1CLMA 2ISDA 2KFGA 1S5GZ 2JXLA 2SCPA 1XFZO 3EKHA 1EJ3A 2LMTA 4N1GA 3A4UB 3C1VA 3OX6A 5CSNA 2M0RA 3TZ1A 4M2PA 3WNXB 4D1EA 5FI7A 2MLEC 4MSPA 1UHNA 1WRZA 4JKTA 1F70A 1QIVA 1S1EA 4YI8A 1DJYA 1E8AA 5PALA 4QJ4B 1ZOTB 1LA3A 1QVIZ 2H8VA 4HRHA 1H4BA 3SIAA 2LVJA 2M8UA 1PVBA 2KAXA 3A8RA 2F2PA 1CMFA 2ZRTA 2I7AA 1HQVA 5DKQA 2BCAA 3N7HA 1F54A 1UUSA 1WRLA 3EG5B 1QIWA 3CZ2A 1OQPA 2JU0A 1J7PA 5AANA 1C07A 1R2UA 5ER4X 2BBNA 1CM1A 2JWWA 1ALWA 1FI6A
chains in the Genus database with same CATH topology
3EKJA 1J7RA 1YX8A 5HKYA 5ER5A 1JSAA 4L9MA 5CSIA 1YURA 1KK7Y 3KHEA 1NX1A 5HLVA 3IQQA 1BMOA 1BG1A 2LHLA 4PHMA 1HT9A 2L4IA 3VRQA 1BOCA 1KK8B 1KFUL 4OVNF 4DUQA 2Y1MA 4GGFC 4PE7A 4CPVA 4CIDA 2JULA 2BCXA 4Q04A 2HPSA 1UURA 1YUTA 2LMUA 1XVJA 2ZN9A 2LUXA 4FQOA 3SJSA 1S6IA 4I5KA 4A4BA 4MZJA 1D1OA 3GK1A 1JF0A 1TNPA 1KQMC 1Y1XA 2LE9B 1NX3A 2P6BB 3LK1A 1ZFSA 2JTZA 1SK6D 3ZWHA 2F33A 1DJWA 2TN4A 1UHIA 1WLZA 1A4PA 1SMGA 4M2OA 4JPZB 2K2FA 2CBLA 1CFPA 1F4OA 2NXQA 2NZ0A 4P5OE 1IKUA 1KQMB 1OSAA 4P2YB 4GGFA 2HQ8A 1R6PA 1OMRA 2B1UA 1J7OA 1JFKA 3KO0A 5J3XA 5D7FA 4YGAA 2PVBA 4DS7A 5AFPA 4GUKA 1IJ5A 1SPYA 3FIAA 1TNWA 2ZRSA 3AKAA 2K7CA 1CTRA 4MRYA 2KFHA 1OZSA 1K93D 4PE1A 4TNCA 4A4CA 4ZCUA 4OCIA 4U8DA 2CXJA 2HF5A 1DF0B 3DVKA 1QASA 3CGAA 2M7NA 5I2LA 2QACA 1DJXA 1MF8B 1K9PA 3LCPC 1Y6WA 1JBAA 3TDZA 4F0ZB 2JNFA 2JNXA 1OE9B 1WY9A 2M1UA 3HCMA 1B7TY 2JT8A 4PE4A 2PRUA 3SG5A 1QLSA 4YGDB 3CZTX 3ZNIA 2Q4UA 1RROA 1PSRA 5IBWA 2CT9A 3CTNA 3NSOA 1AUIB 1DF0A 1K95A 1SR6C 2PSRA 4GFTA 4XJKB 5DKRA 3RLZA 3SG4A 5D69A 1S36A 3BXKA 4DIRA 2H2KA 2LMVA 4I5JA 4WQ3A 1UP5A 1QXPA 2ZNEA 3PSRA 3ICBA 4NDCA 2F3ZA 3EK7A 1OZOA 1MXEA 1KCYA 2M3WA 1DJHA 1PK0D 1SNLA 3I5FC 1TCFA 4AOMA 3BYAA 1V1FA 2JXCA 1U5IA 1DTLA 1CLLA 3PATA 2G2BA 3M0WA 2R2IA 3DF0B 1AK8A 1J7QA 1GQMA 1TTXA 1WDCB 1PALA 4E68A 5K89A 4DCKA 1XK4C 1IH0A 2M49B 3CWGA 3OP0A 3BOWA 1W7IB 3TDUA 3I5FB 3BUMB 2KFFA 1CDPA 3DF0A 2F2OA 5AEQA 5JOLA 3KEVA 1YTZC 1GJYA 3BQ3A 1N0YA 5CSJA 1A75B 4JQ0D 4YGBB 2VRGA 3I5HC 4GAOA 1OMVA 4OKHA 5HLOA 5JJGA 1NX0A 1KK8C 1NYAA 1G8IA 2Y1NA 1CFDA 3O4YA 3PM8A 1SL9A 3SG3A 1BLQA 1SCVA 2KHNA 5DKNA 1EG4A 1M39A 2BKHB 1B7TZ 2MAZA 3NSKA 1SYMA 1AVSA 1S6JA 4MRXA 1L7ZA 1K9KA 1BF5A 1B1GA 2BL0B 1PVAA 1G4YR 1A75A 3I5HB 1G33A 1XK4A 1DJGA 2BECA 4R1EA 2LVIA 2GGMA 1B8CA 3PLFB 3WHUB 2KI6C 4WQ2A 2PMYA 5GQQC 1DVIA 2BBMA 1IRJA 1N65A 3DVMA 1YRTB 5HYDA 2LVKA 1X02A 1NIWA 2LV7A 1QS7A 1NCYA 5HKZA 3D0YB 1ZACA 1V1GA 2L0PA 2I18A 1YVHA 5AERA 1BJFA 2MBXA 1L2OB 4CLNA 2M97A 3VRNA 3HX4A 3OHMB 2JZIA 4MLWA 1XFUO 1CDLA 1NUBA 4ZCVA 1JWDA 1SBJA 2MHHA 1K2HA 1J1DA 1DJIA 1LINA 1VRKA 2EGDA 4UPGA 1YVLA 2K8MB 2FJUB 2JT0A 2KGBC 2LLUA 4NDBA 1UHKA 2GV5A 1DT7B 1RECA 1NCZA 1QX7A 1NCXA 4M2QA 1QLKA 2L2EA 4HSZA 4PHNA 1TOPA 4WRIA 1YUUA 2RGIA 1KFXS 5BPJA 2FOTA 1QV0A 2CNPA 1PULA 2HETA 5KSZA 2IS9A 2KI4C 1XFXO 3WHTB 1ODBA 1NP8A 1KK7Z 2LHIA 4AQJA 5CPVA 3RM1A 2K0JA 4GBAA 4YGEB 2CTNA 1NWDA 3PALA 3CS1A 1LKJA 1NPQA 2WCBA 2MJWB 1SKTA 2ZKMX 1QTXA 1S26D 2M29A 1PRWA 3EK4A 1B9AA 3JTDC 3PFVA 2D8NA 1RK9A 1ALVA 1BU3A 1C7WA 1RFJA 2KYFA 1TRFA 4NQGA 2KI4B 4PHJA 2OTGC 1GGWA 1B4CA 3TS5B 1RTP1 3VGOA 2OPOA 1N2DA 2Q91A 3AAKA 4MEWA 1BODA 4DRWA 5KU1A 5I2OA 3F45A 1JC2A 2JPTA 2LANA 3BUWB 1LXFC 4GGNA 1ZUZA 1JF2A 3JTDB 4FTGA 2M1KB 2NLNA 2OTGB 3SG6A 2L50A 3DVEA 2KNEA 1WDCC 2F3YA 3AAJA 4YRUA 2KOTA 3CLNA 1ZMZA 2KGRA 1CFFA 1TCOB 1SRAA 2DOQA 2KBMA 4MBEA 3FWCA 4HRGA 3OB1B 1S3PA 5F6TA 1SW8A 2V53A 3MSEB 1UHHA 2JOJA 4XJKA 1FPWA 1YRUB 1IGVA 3O6BA 3VROA 2K7DA 2WORA 1GGZA 1F8HA 1OOJA 1UHJA 1Y1UA 2E6WA 2JRFA 1XFVO 2KQYA 4I5NB 3VRRA 1IWQA 5KTYA 2PALA 1XFYO 1TNQA 3LK0A 3NSLA 2KAVA 1BT6A 2FCEA 1DGVA 1QX2A 2KYCA 5HKWA 2AAOA 4C0LA 1FI5A 1F4QA 1B8RA 2O60A 2L4HA 4BY5A 1YUSA 2BL0C 1JUOA 3EK8A 3FWBA 1CMGA 1KSMA 1F71A 4MZLA 1CLBA 2KI6D 3VRPA 1K8UA 5CSFA 1UWOA 1KWOC 2CCMA 3IF7A 1CB1A 3AKBA 3DVJA 1FF1A 1TNXA 2BE6A 1K9UA 4MN0A 1KFUS 4OV2A 2M9GA 4I5LB 1QV1A 2M7LA 2KDHA 1Q80A 4NDDA 1MQ1A 2MRDA 4QJ3B 4PE0A 2K2AA 3QRXA 1QX5B 1CNPA 4ORBB 2EHBA 4ORCB 1YX7A 1KWOB 1IQ5A 2JTTA 1WRKA 4YGCB 2OS8C 4YI9A 1K94A 2L5XB 3EVVA 1KQVA 2KSPA 1L2OC 4QJ5B 4USLA 1J1EA 1M31A 3KF9A 4GNKB 1BR4B 1DMOA 2AUCA 4XYNA 4N1FA 3SG7A 1M46A 2L51A 2G9BA 1DJZA 3CR4X 2OS8B 1MHOA 1XYDA 1OMDA 1PSBA 2WNDA 3OX5A 4MZKA 3TUYC 2BE4A 1XO5A 2WCFA 1AHRA 1YR5A 3CR5X 2LC5A 2Y5IA 1A03A 4YBHB 2LP2A 1K90D 2MLFC 3GK4X 1B47A 4N5XA 1J55A 3D0YA 1JFJA 2O5GA 4PCWA 4HREE 3NXAA 3WXAA 5I8NA 5I2QA 1MXLC 2QPTA 2K61A 3NSIA 1BR1B 3I5GC 3GOFA 3TUYB 1EH2A 2EC6C 4PDZA 3O2PA 3I5IC 2SASA 3LL8B 4PALA 2I94A 2ZFDA 2GGZA 4MVFA 3TS5C 1H8BA 1KSOA 2LCPA 3PN7C 1LVCD 1SL8A 2LVVA 1CM4A 4GPLB 2LNKA 1F55A 2L98A 5TNCA 2JC2A 2KQ6A 3DD4A 4C0JA 1FBVA 3I5GB 1IQ3A 2EC6B 3BUXB 1CKKA 1M45A 2NCOA 1S5GY 3I5IB 2F8PA 2A4JA 1MWNA 3JVTC 1XFWO 1C7VA 1EL4A 1MR8A 3PN7B 2HQWA 1CDMA 1NSHA 2ZNDA 3OB2B 1RWYA 1W7JB 2PASA 3FS7A 5AXIA 4C0KA 1Y1AA 2Y4QA 4CFQA 1KFXL 1AP4A 2H61C 2K7OA 4JWQA 5G08A 3O78A 4IL1A 2MA2A 1QVIY 4ICBA 1A29A 1WLMA 1S6CA 1FW4A 3JVTB 1CDNA 2ZN8A 3BUNB 1K96A 2WCEA 3E3RA 3TDIA 1DGUA 4AQIA 4ORAB 2E30A 2LM5A 2KBIA 1CFCA 4CFRA 3D10A 2COLB 3GK2A 2JT3A 1TN4A 3H4SE 3K21A 1SCMC 1QJTA 1TIZA 2K7BA 1IJ6A 3KPXA 3SG2A 5B8IB 1MUXA 2WOSA 1B8LA 2JQ6A 2LUCA 1M63B 1U5IB 3IQOA 2NCPA 3LLEA 1IG5A 2I2RE 3CR2A 2LAPA 4OR9B 4BY4A 1XA5A 2LLSA 1A2XA 5FYXA 2BCBA 1AJ4A 1LA0A 3BUOB 3SIBA 4ETOA 4PHKA 2BKIB 1EG3A 2H61A 1SCMB 3BOWB 1QATA 1SL7A 1NX2A 1Y0VH 1SY9A 2WC8A 2LP3A 3EVUA 2AMIA 2LLTA 2FCDA 2KAYA 1AJ5A 1EXRA 1RJVA 3EVRA 1SR6B 2ISDA 1CLMA 2KFGA 1S5GZ 2JXLA 2SCPA 1XFZO 3EKHA 1EJ3A 2LMTA 4N1GA 3A4UB 3C1VA 3OX6A 5CSNA 2M0RA 3TZ1A 4M2PA 3WNXB 4D1EA 2MLEC 4MSPA 1UHNA 1WRZA 1F70A 1QIVA 1S1EA 4YI8A 1DJYA 1E8AA 5PALA 4QJ4B 1ZOTB 1LA3A 1QVIZ 4HRHA 1H4BA 3SIAA 2LVJA 2M8UA 1PVBA 2KAXA 3A8RA 2F2PA 1CMFA 2ZRTA 2I7AA 1HQVA 5DKQA 2BCAA 1F54A 1UUSA 1WRLA 1QIWA 1OQPA 2JU0A 1J7PA 5AANA 1C07A 1R2UA 5ER4X 2BBNA 1CM1A 2JWWA 1ALWA 1FI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EKJ A;  1J7R A;  1YX8 A;  5HKY A;  5ER5 A;  1JSA A;  4L9M A;  5CSI A;  1YUR A;  1KK7 Y;  3KHE A;  1NX1 A;  5HLV A;  3IQQ A;  1BMO A;  1BG1 A;  2LHL A;  4PHM A;  1HT9 A;  2L4I A;  3VRQ A;  1BOC A;  1KK8 B;  1KFU L;  4OVN F;  4DUQ A;  2Y1M A;  4GGF C;  4PE7 A;  4CPV A;  4CID A;  2JUL A;  2BCX A;  4Q04 A;  2HPS A;  1UUR A;  1YUT A;  2LMU A;  1XVJ A;  2ZN9 A;  2LUX A;  4FQO A;  3SJS A;  1S6I A;  4I5K A;  4A4B A;  4MZJ A;  1D1O A;  3GK1 A;  1JF0 A;  1TNP A;  1KQM C;  1Y1X A;  2LE9 B;  1NX3 A;  2P6B B;  3LK1 A;  1ZFS A;  2JTZ A;  1SK6 D;  3ZWH A;  2F33 A;  1DJW A;  2TN4 A;  1UHI A;  1WLZ A;  1A4P A;  1SMG A;  4M2O A;  4JPZ B;  2K2F A;  2CBL A;  1CFP A;  1F4O A;  2NXQ A;  2NZ0 A;  4P5O E;  1IKU A;  1KQM B;  1OSA A;  4P2Y B;  4GGF A;  2HQ8 A;  1R6P A;  1OMR A;  2B1U A;  1J7O A;  1JFK A;  3KO0 A;  5J3X A;  5D7F A;  4YGA A;  2PVB A;  4DS7 A;  5AFP A;  4GUK A;  1IJ5 A;  1SPY A;  3FIA A;  1TNW A;  2ZRS A;  3AKA A;  2K7C A;  1CTR A;  4MRY A;  2KFH A;  1OZS A;  1K93 D;  4PE1 A;  4TNC A;  4A4C A;  4ZCU A;  4OCI A;  4U8D A;  2CXJ A;  2HF5 A;  1DF0 B;  3DVK A;  1QAS A;  3CGA A;  2M7N A;  5I2L A;  2QAC A;  1DJX A;  1MF8 B;  1K9P A;  3LCP C;  1Y6W A;  1JBA A;  3TDZ A;  4F0Z B;  2JNF A;  2JNX A;  1OE9 B;  1WY9 A;  2M1U A;  3HCM A;  1B7T Y;  2JT8 A;  4PE4 A;  2PRU A;  3SG5 A;  1QLS A;  4YGD B;  3CZT X;  3ZNI A;  2Q4U A;  1RRO A;  1PSR A;  5IBW A;  2CT9 A;  3CTN A;  3NSO A;  1AUI B;  1DF0 A;  1K95 A;  1SR6 C;  2PSR A;  4GFT A;  4XJK B;  5DKR A;  3RLZ A;  3SG4 A;  5D69 A;  1S36 A;  3BXK A;  4DIR A;  2H2K A;  2LMV A;  4I5J A;  4WQ3 A;  1UP5 A;  1QXP A;  2ZNE A;  3PSR A;  3ICB A;  4NDC A;  2F3Z A;  3EK7 A;  1OZO A;  1MXE A;  1KCY A;  2M3W A;  1DJH A;  1PK0 D;  1SNL A;  3I5F C;  1TCF A;  4AOM A;  3BYA A;  1V1F A;  2JXC A;  1U5I A;  1DTL A;  1CLL A;  3PAT A;  2G2B A;  3M0W A;  2R2I A;  3DF0 B;  1AK8 A;  1J7Q A;  1GQM A;  1TTX A;  1WDC B;  1PAL A;  4E68 A;  5K89 A;  4DCK A;  1XK4 C;  1IH0 A;  2M49 B;  3CWG A;  3OP0 A;  3BOW A;  1W7I B;  3TDU A;  3I5F B;  3BUM B;  2KFF A;  1CDP A;  3DF0 A;  2F2O A;  5AEQ A;  5JOL A;  3KEV A;  1YTZ C;  1GJY A;  3BQ3 A;  1N0Y A;  5CSJ A;  1A75 B;  4JQ0 D;  4YGB B;  2VRG A;  3I5H C;  4GAO A;  1OMV A;  4OKH A;  5HLO A;  5JJG A;  1NX0 A;  1KK8 C;  1NYA A;  1G8I A;  2Y1N A;  1CFD A;  3O4Y A;  3PM8 A;  1SL9 A;  3SG3 A;  1BLQ A;  1SCV A;  2KHN A;  5DKN A;  1EG4 A;  1M39 A;  2BKH B;  1B7T Z;  2MAZ A;  3NSK A;  1SYM A;  1AVS A;  1S6J A;  4MRX A;  1L7Z A;  1K9K A;  1BF5 A;  1B1G A;  2BL0 B;  1PVA A;  1G4Y R;  1A75 A;  3I5H B;  1G33 A;  1XK4 A;  1DJG A;  2BEC A;  4R1E A;  2LVI A;  2GGM A;  1B8C A;  3PLF B;  3WHU B;  2KI6 C;  4WQ2 A;  2PMY A;  5GQQ C;  1DVI A;  2BBM A;  1IRJ A;  1N65 A;  3DVM A;  1YRT B;  5HYD A;  2LVK A;  1X02 A;  1NIW A;  2LV7 A;  1QS7 A;  1NCY A;  5HKZ A;  3D0Y B;  1ZAC A;  1V1G A;  2L0P A;  2I18 A;  1YVH A;  5AER A;  1BJF A;  2MBX A;  1L2O B;  4CLN A;  2M97 A;  3VRN A;  3HX4 A;  3OHM B;  2JZI A;  4MLW A;  1XFU O;  1CDL A;  1NUB A;  4ZCV A;  1JWD A;  1SBJ A;  2MHH A;  1K2H A;  1J1D A;  1DJI A;  1LIN A;  1VRK A;  2EGD A;  4UPG A;  1YVL A;  2K8M B;  2FJU B;  2JT0 A;  2KGB C;  2LLU A;  4NDB A;  1UHK A;  2GV5 A;  1DT7 B;  1REC A;  1NCZ A;  1QX7 A;  1NCX A;  4M2Q A;  1QLK A;  2L2E A;  4HSZ A;  4PHN A;  1TOP A;  4WRI A;  1YUU A;  2RGI A;  1KFX S;  5BPJ A;  2FOT A;  1QV0 A;  2CNP A;  1PUL A;  2HET A;  5KSZ A;  2IS9 A;  2KI4 C;  1XFX O;  3WHT B;  1ODB A;  1NP8 A;  1KK7 Z;  2LHI A;  4AQJ A;  5CPV A;  3RM1 A;  2K0J A;  4GBA A;  4YGE B;  2CTN A;  1NWD A;  3PAL A;  3CS1 A;  1LKJ A;  1NPQ A;  2WCB A;  2MJW B;  1SKT A;  2ZKM X;  1QTX A;  1S26 D;  2M29 A;  1PRW A;  3EK4 A;  1B9A A;  3JTD C;  3PFV A;  2D8N A;  1RK9 A;  1ALV A;  1BU3 A;  1C7W A;  1RFJ A;  2KYF A;  1TRF A;  4NQG A;  2KI4 B;  4PHJ A;  2OTG C;  1GGW A;  1B4C A;  3TS5 B;  1RTP 1;  3VGO A;  2OPO A;  1N2D A;  2Q91 A;  3AAK A;  4MEW A;  1BOD A;  4DRW A;  5KU1 A;  5I2O A;  3F45 A;  1JC2 A;  2JPT A;  2LAN A;  3BUW B;  1LXF C;  4GGN A;  1ZUZ A;  1JF2 A;  3JTD B;  4FTG A;  2M1K B;  2NLN A;  2OTG B;  3SG6 A;  2L50 A;  3DVE A;  2KNE A;  1WDC C;  2F3Y A;  3AAJ A;  4YRU A;  2KOT A;  3CLN A;  1ZMZ A;  2KGR A;  1CFF A;  1TCO B;  1SRA A;  2DOQ A;  2KBM A;  4MBE A;  3FWC A;  4HRG A;  3OB1 B;  1S3P A;  5F6T A;  1SW8 A;  2V53 A;  3MSE B;  1UHH A;  2JOJ A;  4XJK A;  1FPW A;  1YRU B;  1IGV A;  3O6B A;  3VRO A;  2K7D A;  2WOR A;  1GGZ A;  1F8H A;  1OOJ A;  1UHJ A;  1Y1U A;  2E6W A;  2JRF A;  1XFV O;  2KQY A;  4I5N B;  3VRR A;  1IWQ A;  5KTY A;  2PAL A;  1XFY O;  1TNQ A;  3LK0 A;  3NSL A;  2KAV A;  1BT6 A;  2FCE A;  1DGV A;  1QX2 A;  2KYC A;  5HKW A;  2AAO A;  4C0L A;  1FI5 A;  1F4Q A;  1B8R A;  2O60 A;  2L4H A;  4BY5 A;  1YUS A;  2BL0 C;  1JUO A;  3EK8 A;  3FWB A;  1CMG A;  1KSM A;  1F71 A;  4MZL A;  1CLB A;  2KI6 D;  3VRP A;  1K8U A;  5CSF A;  1UWO A;  1KWO C;  2CCM A;  3IF7 A;  1CB1 A;  3AKB A;  3DVJ A;  1FF1 A;  1TNX A;  2BE6 A;  1K9U A;  4MN0 A;  1KFU S;  4OV2 A;  2M9G A;  4I5L B;  1QV1 A;  2M7L A;  2KDH A;  1Q80 A;  4NDD A;  1MQ1 A;  2MRD A;  4QJ3 B;  4PE0 A;  2K2A A;  3QRX A;  1QX5 B;  1CNP A;  4ORB B;  2EHB A;  4ORC B;  1YX7 A;  1KWO B;  1IQ5 A;  2JTT A;  1WRK A;  4YGC B;  2OS8 C;  4YI9 A;  1K94 A;  2L5X B;  3EVV A;  1KQV A;  2KSP A;  1L2O C;  4QJ5 B;  4USL A;  1J1E A;  1M31 A;  3KF9 A;  4GNK B;  1BR4 B;  1DMO A;  2AUC A;  4XYN A;  4N1F A;  3SG7 A;  1M46 A;  2L51 A;  2G9B A;  1DJZ A;  3CR4 X;  2OS8 B;  1MHO A;  1XYD A;  1OMD A;  1PSB A;  2WND A;  3OX5 A;  4MZK A;  3TUY C;  2BE4 A;  1XO5 A;  2WCF A;  1AHR A;  1YR5 A;  3CR5 X;  2LC5 A;  2Y5I A;  1A03 A;  4YBH B;  2LP2 A;  1K90 D;  2MLF C;  3GK4 X;  1B47 A;  4N5X A;  1J55 A;  3D0Y A;  1JFJ A;  2O5G A;  4PCW A;  4HRE E;  3NXA A;  3WXA A;  5I8N A;  5I2Q A;  1MXL C;  2QPT A;  2K61 A;  3NSI A;  1BR1 B;  3I5G C;  3GOF A;  3TUY B;  1EH2 A;  2EC6 C;  4PDZ A;  3O2P A;  3I5I C;  2SAS A;  3LL8 B;  4PAL A;  2I94 A;  2ZFD A;  2GGZ A;  4MVF A;  3TS5 C;  1H8B A;  1KSO A;  2LCP A;  3PN7 C;  1LVC D;  1SL8 A;  2LVV A;  1CM4 A;  4GPL B;  2LNK A;  1F55 A;  2L98 A;  5TNC A;  2JC2 A;  2KQ6 A;  3DD4 A;  4C0J A;  1FBV A;  3I5G B;  1IQ3 A;  2EC6 B;  3BUX B;  1CKK A;  1M45 A;  2NCO A;  1S5G Y;  3I5I B;  2F8P A;  2A4J A;  1MWN A;  3JVT C;  1XFW O;  1C7V A;  1EL4 A;  1MR8 A;  3PN7 B;  2HQW A;  1CDM A;  1NSH A;  2ZND A;  3OB2 B;  1RWY A;  1W7J B;  2PAS A;  3FS7 A;  5AXI A;  4C0K A;  1Y1A A;  2Y4Q A;  4CFQ A;  1KFX L;  1AP4 A;  2H61 C;  2K7O A;  4JWQ A;  5G08 A;  3O78 A;  4IL1 A;  2MA2 A;  1QVI Y;  4ICB A;  1A29 A;  1WLM A;  1S6C A;  1FW4 A;  3JVT B;  1CDN A;  2ZN8 A;  3BUN B;  1K96 A;  2WCE A;  3E3R A;  3TDI A;  1DGU A;  4AQI A;  4ORA B;  2E30 A;  2LM5 A;  2KBI A;  1CFC A;  4CFR A;  3D10 A;  2COL B;  3GK2 A;  2JT3 A;  1TN4 A;  3H4S E;  3K21 A;  1SCM C;  1QJT A;  1TIZ A;  2K7B A;  1IJ6 A;  3KPX A;  3SG2 A;  5B8I B;  1MUX A;  2WOS A;  1B8L A;  2JQ6 A;  2LUC A;  1M63 B;  1U5I B;  3IQO A;  2NCP A;  3LLE A;  1IG5 A;  2I2R E;  3CR2 A;  2LAP A;  4OR9 B;  4BY4 A;  1XA5 A;  2LLS A;  1A2X A;  5FYX A;  2BCB A;  1AJ4 A;  1LA0 A;  3BUO B;  3SIB A;  4ETO A;  4PHK A;  2BKI B;  1EG3 A;  2H61 A;  1SCM B;  3BOW B;  1QAT A;  1SL7 A;  1NX2 A;  1Y0V H;  1SY9 A;  2WC8 A;  2LP3 A;  3EVU A;  2AMI A;  2LLT A;  2FCD A;  2KAY A;  1AJ5 A;  1EXR A;  1RJV A;  3EVR A;  1SR6 B;  2ISD A;  1CLM A;  2KFG A;  1S5G Z;  2JXL A;  2SCP A;  1XFZ O;  3EKH A;  1EJ3 A;  2LMT A;  4N1G A;  3A4U B;  3C1V A;  3OX6 A;  5CSN A;  2M0R A;  3TZ1 A;  4M2P A;  3WNX B;  4D1E A;  2MLE C;  4MSP A;  1UHN A;  1WRZ A;  1F70 A;  1QIV A;  1S1E A;  4YI8 A;  1DJY A;  1E8A A;  5PAL A;  4QJ4 B;  1ZOT B;  1LA3 A;  1QVI Z;  4HRH A;  1H4B A;  3SIA A;  2LVJ A;  2M8U A;  1PVB A;  2KAX A;  3A8R A;  2F2P A;  1CMF A;  2ZRT A;  2I7A A;  1HQV A;  5DKQ A;  2BCA A;  1F54 A;  1UUS A;  1WRL A;  1QIW A;  1OQP A;  2JU0 A;  1J7P A;  5AAN A;  1C07 A;  1R2U A;  5ER4 X;  2BBN A;  1CM1 A;  2JWW A;  1ALW A;  1FI6 A; 
#chains in the Genus database with same CATH topology
 3EKJ A;  1J7R A;  1YX8 A;  3NHI A;  5HKY A;  5ER5 A;  1W9Z A;  1JSA A;  4L9M A;  5CSI A;  1YUR A;  1KK7 Y;  3KHE A;  1NX1 A;  5HLV A;  3IQQ A;  1BMO A;  1BG1 A;  2LHL A;  4PHM A;  1HT9 A;  2L4I A;  3VRQ A;  1BOC A;  1KK8 B;  1KFU L;  4OVN F;  4DUQ A;  2Y1M A;  4GGF C;  4PE7 A;  4CPV A;  3DYE A;  4CID A;  2JUL A;  2BCX A;  3QME A;  4Q04 A;  2HPS A;  1UUR A;  1YUT A;  2LMU A;  1XVJ A;  2ZN9 A;  2LUX A;  3B6X A;  4FQO A;  3SJS A;  1S6I A;  4I5K A;  4A4B A;  4MZJ A;  1D1O A;  3GK1 A;  1JF0 A;  1TNP A;  1KQM C;  1OW4 A;  1Y1X A;  2LE9 B;  1NX3 A;  2P6B B;  3LK1 A;  3S0G A;  2YGU A;  1ZFS A;  2JTZ A;  3B86 A;  1SK6 D;  3SS5 A;  1DC1 A;  3ZWH A;  2F33 A;  3CDN A;  1DJW A;  1XFR A;  2TN4 A;  2L5Y A;  1UHI A;  1WLZ A;  1A4P A;  1SMG A;  4M2O A;  3D77 A;  4JPZ B;  2K2F A;  2CBL A;  1CFP A;  1F4O A;  2NXQ A;  2NZ0 A;  4P5O E;  1IKU A;  1KQM B;  1OSA A;  4P2Y B;  4GGF A;  2HQ8 A;  1R6P A;  1OMR A;  2B1U A;  3VB1 A;  1J7O A;  1JFK A;  2L2C A;  3KO0 A;  5J3X A;  2QEH A;  5D7F A;  4YGA A;  2PVB A;  4DS7 A;  5AFP A;  4GUK A;  1IJ5 A;  1SPY A;  3CYZ A;  3FIA A;  1TNW A;  2ZRS A;  3B87 A;  1OOF A;  3BFA A;  3AKA A;  2K7C A;  2WC5 A;  1CTR A;  4OZD A;  4MRY A;  3D75 A;  2KFH A;  1OZS A;  1K93 D;  4PE1 A;  4TNC A;  4A4C A;  3OBV A;  4ZCU A;  4OCI A;  4U8D A;  3L47 A;  3R1P A;  2CXJ A;  2HF5 A;  1DF0 B;  3DVK A;  1QAS A;  3CGA A;  2M7N A;  5I2L A;  2QAC A;  1DJX A;  1MF8 B;  1K9P A;  3LCP C;  5I94 A;  1Y6W A;  1JBA A;  3TDZ A;  4F0Z B;  2JNF A;  2JNX A;  1OE9 B;  1WY9 A;  2M1U A;  3HCM A;  1B7T Y;  2JT8 A;  4PE4 A;  2PRU A;  3SG5 A;  1QLS A;  4YGD B;  3CZT X;  3ZNI A;  2Q4U A;  1RRO A;  1PSR A;  5IBW A;  2CT9 A;  3CTN A;  3NSO A;  1AUI B;  1DF0 A;  1K95 A;  1SR6 C;  2BNX A;  2FJY A;  2PSR A;  4XJK B;  5DKR A;  3RLZ A;  3SG4 A;  5D69 A;  1S36 A;  2PYQ A;  3BXK A;  2H2K A;  2LMV A;  3D76 A;  4I5J A;  4WQ3 A;  1UP5 A;  4DIR A;  1QXP A;  2ZNE A;  3NGV A;  3PSR A;  3ICB A;  4NDC A;  2F3Z A;  3EK7 A;  1OZO A;  1MXE A;  1KCY A;  5D3O A;  2M3W A;  1DJH A;  1PK0 D;  1SNL A;  3I5F C;  1TCF A;  4KYN A;  4AOM A;  1C3Y A;  3BYA A;  1V1F A;  5EL2 A;  2JXC A;  1U5I A;  1DTL A;  1CLL A;  3PAT A;  2G2B A;  3M0W A;  2R2I A;  3DF0 B;  1AK8 A;  1J7Q A;  1GQM A;  2KLD A;  1TTX A;  1WDC B;  1PAL A;  1TUZ A;  5K89 A;  4DCK A;  4E68 A;  2WCJ A;  3UNW A;  1XK4 C;  2QEV A;  3K1E A;  2M49 B;  1IH0 A;  3CWG A;  3OP0 A;  3BOW A;  1W7I B;  3TDU A;  3I5F B;  3BUM B;  2KFF A;  1CDP A;  1SSE B;  3DF0 A;  2F2O A;  5AEQ A;  5JOL A;  2GTE A;  3KEV A;  1YTZ C;  3S0B A;  1GJY A;  3BQ3 A;  1N0Y A;  5CSJ A;  1A75 B;  4JQ0 D;  4YGB B;  2VRG A;  3I5H C;  4GAO A;  1OMV A;  4OKH A;  5HLO A;  5JJG A;  1NX0 A;  1KK8 C;  1NYA A;  1G8I A;  2KPH A;  1CFD A;  2Y1N A;  3CZ0 A;  1SL9 A;  3O4Y A;  3PM8 A;  3SG3 A;  1BLQ A;  1SCV A;  2KHN A;  5DKN A;  1EG4 A;  1M39 A;  2BKH B;  1B7T Z;  2MAZ A;  3BFB A;  3NSK A;  1SYM A;  1AVS A;  1S6J A;  3BFH A;  4MRX A;  1L7Z A;  1K9K A;  3DY9 A;  1BF5 A;  1B1G A;  1ORG A;  2BL0 B;  3B7A A;  1PVA A;  1G4Y R;  2BAP A;  1A75 A;  3I5H B;  1G33 A;  1XK4 A;  1DJG A;  2WCL A;  2BEC A;  3Q8I A;  4R1E A;  2LVI A;  2GGM A;  1B8C A;  3PLF B;  3WHU B;  1OOI X;  2KI6 C;  4WQ2 A;  2PMY A;  5GQQ C;  1DVI A;  2BBM A;  4IJ7 A;  1IRJ A;  1N65 A;  3DVM A;  1YRT B;  4FQT A;  5HYD A;  2LVK A;  1X02 A;  1NIW A;  2LV7 A;  2QEB A;  5HL1 A;  3D73 A;  1QS7 A;  1OOH A;  1NCY A;  5HKZ A;  3D0Y B;  1ZAC A;  1V1G A;  2L0P A;  1Z2C B;  2I18 A;  4INW A;  1YVH A;  5AER A;  1BJF A;  2MBX A;  1L2O B;  4CLN A;  2M97 A;  3VRN A;  3HX4 A;  3OHM B;  2JZI A;  4MLW A;  1XFU O;  1CDL A;  1NUB A;  4ZCV A;  1JWD A;  1SBJ A;  2MHH A;  1K2H A;  1J1D A;  1DJI A;  1LIN A;  1VRK A;  2EGD A;  4UPG A;  1YVL A;  2K8M B;  2FJU B;  3RZS A;  2JT0 A;  2KGB C;  2LLU A;  4NDB A;  1UHK A;  2GV5 A;  1DT7 B;  1REC A;  3V2L A;  1NCZ A;  1QX7 A;  1NCX A;  1TWO A;  1QLK A;  4M2Q A;  2L2E A;  4HSZ A;  4PHN A;  1TOP A;  4WRI A;  1YUU A;  2RGI A;  1KFX S;  5BPJ A;  2WCH A;  2FOT A;  1QV0 A;  2CNP A;  1PUL A;  2HET A;  5KSZ A;  2IS9 A;  2KI4 C;  1XFX O;  3WHT B;  1ODB A;  1NP8 A;  1KK7 Z;  2LHI A;  4AQJ A;  5CPV A;  3RM1 A;  2K0J A;  4GBA A;  4INX A;  4YGE B;  2CTN A;  1NWD A;  3PAL A;  3CS1 A;  1LKJ A;  1NPQ A;  2WCB A;  2MJW B;  1SKT A;  2ZKM X;  1QTX A;  3NHT A;  1S26 D;  2M29 A;  1PRW A;  3EK4 A;  1B9A A;  3JTD C;  2K60 A;  3PFV A;  2D8N A;  1RK9 A;  1ALV A;  1BU3 A;  1C7W A;  1RFJ A;  2KYF A;  1TRF A;  3PM2 A;  4GFT A;  4NQG A;  2KI4 B;  4PHJ A;  2OTG C;  1GGW A;  1B4C A;  3TS5 B;  1RTP 1;  3VGO A;  2OPO A;  1N2D A;  2Q91 A;  3AAK A;  3D78 A;  4MEW A;  1BOD A;  4DRW A;  5KU1 A;  5DIC A;  5I2O A;  3F45 A;  1JC2 A;  2JPT A;  2LAN A;  3BUW B;  1LXF C;  4GGN A;  1ZUZ A;  1JF2 A;  3JTD B;  4FTG A;  2M1K B;  2NLN A;  2OTG B;  3SG6 A;  2L50 A;  3DVE A;  2KNE A;  1WDC C;  2F3Y A;  3AAJ A;  4YRU A;  2KOT A;  3CLN A;  1ZMZ A;  2KGR A;  1CFF A;  1TCO B;  1SRA A;  2DOQ A;  2KBM A;  4MBE A;  3FWC A;  4HRG A;  3OB1 B;  1S3P A;  5F6T A;  1SW8 A;  2V53 A;  2WCK A;  3CAB A;  3MSE B;  1UHH A;  2JOJ A;  4XJK A;  1FPW A;  1YRU B;  1IGV A;  3O6B A;  3R1V A;  3VRO A;  2K7D A;  2WOR A;  1GGZ A;  1F8H A;  1OOJ A;  1UHJ A;  1Y1U A;  2E6W A;  2JRF A;  1XFV O;  2KQY A;  4I5N B;  3VRR A;  1IWQ A;  3R1O A;  3R72 A;  5KTY A;  2PAL A;  1XFY O;  1TNQ A;  3LK0 A;  3NSL A;  2KAV A;  1BT6 A;  2FCE A;  1DGV A;  1QX2 A;  2KYC A;  5HKW A;  2AAO A;  4C0L A;  1FI5 A;  1F4Q A;  1B8R A;  2O60 A;  1DEK A;  2P70 A;  2L4H A;  4JD9 A;  3DXL A;  3D74 A;  1YUS A;  2BL0 C;  4BY5 A;  2ERB A;  1TUJ A;  1JUO A;  3EK8 A;  3FWB A;  1CMG A;  1KSM A;  1F71 A;  4MZL A;  1CLB A;  2KI6 D;  3VRP A;  1K8U A;  5CSF A;  1UWO A;  1KWO C;  2CCM A;  3IF7 A;  1Z4H A;  1CB1 A;  3AKB A;  3DVJ A;  1FF1 A;  1TNX A;  2BE6 A;  1K9U A;  4MN0 A;  1T14 A;  1KFU S;  4OV2 A;  2M9G A;  4I5L B;  1QV1 A;  2QDI A;  2KDH A;  2M7L A;  1Q80 A;  4NDD A;  1MQ1 A;  2MRD A;  4QJ3 B;  4PE0 A;  2K2A A;  3QRX A;  1QX5 B;  1CNP A;  4ORB B;  2EHB A;  4ORC B;  1YX7 A;  1KWO B;  1IQ5 A;  2JTT A;  1WRK A;  4YGC B;  2OS8 C;  4YI9 A;  1K94 A;  2KLE A;  2L5X B;  3EVV A;  1KQV A;  2KSP A;  1L2O C;  4QJ5 B;  4USL A;  2P71 A;  1J1E A;  1M31 A;  3KF9 A;  4GNK B;  2WC6 A;  1BR4 B;  1DMO A;  2AUC A;  4XYN A;  4N1F A;  3SG7 A;  1M46 A;  1IIO A;  2L51 A;  2G9B A;  1DJZ A;  3CR4 X;  2OS8 B;  1MHO A;  1XYD A;  1OMD A;  1PSB A;  2WND A;  3OX5 A;  4MZK A;  3FE8 A;  3TUY C;  2BE4 A;  1XO5 A;  2WCF A;  1AHR A;  1YR5 A;  3CR5 X;  2LC5 A;  2Y5I A;  1A03 A;  4YBH B;  2LP2 A;  1GM0 A;  1K90 D;  2MLF C;  3GK4 X;  1B47 A;  4N5X A;  1J55 A;  3BJH A;  3D0Y A;  3FE9 A;  1JFJ A;  2O5G A;  4PCW A;  4HRE E;  3NXA A;  3WXA A;  5I8N A;  5I2Q A;  1MXL C;  2QPT A;  1P28 A;  2K61 A;  3NSI A;  3DZT A;  1BR1 B;  3I5G C;  3GOF A;  3S0D A;  3TUY B;  1EH2 A;  2EC6 C;  4PDZ A;  3O2P A;  3I5I C;  2SAS A;  3LL8 B;  1QWV A;  4PAL A;  2I94 A;  2ZFD A;  2GGZ A;  4MVF A;  3TS5 C;  1H8B A;  3PJI A;  1KSO A;  2LCP A;  2WCM A;  3PN7 C;  1LVC D;  1SL8 A;  2LVV A;  1CM4 A;  4GPL B;  3S0F A;  5FI6 A;  2LNK A;  1F55 A;  2L98 A;  5TNC A;  2JC2 A;  2KQ6 A;  3DD4 A;  3UO9 A;  1FBV A;  3I5G B;  4C0J A;  1IQ3 A;  2EC6 B;  3BUX B;  1CKK A;  1M45 A;  2NCO A;  1S5G Y;  3I5I B;  2F8P A;  2A4J A;  1MWN A;  3JVT C;  1XFW O;  1C7V A;  1EL4 A;  1MR8 A;  3CZ1 A;  3PN7 B;  2HQW A;  1CDM A;  1NSH A;  2ZND A;  3L4L A;  3OB2 B;  1C3Z A;  1RWY A;  1DEL A;  1W7J B;  2PAS A;  3FS7 A;  5AXI A;  4C0K A;  1Y1A A;  2Y4Q A;  3SS3 A;  4CFQ A;  1KFX L;  1AP4 A;  2H61 C;  2K7O A;  3FE6 A;  4JWQ A;  5G08 A;  3O78 A;  4IL1 A;  2MA2 A;  3IVT A;  1QVI Y;  5FI2 A;  4ICB A;  1A29 A;  1WLM A;  1S6C A;  1FW4 A;  2QEO A;  3JVT B;  1CDN A;  2ZN8 A;  3B88 A;  3BUN B;  1K96 A;  2WCE A;  3E3R A;  3TDI A;  1DGU A;  2JPO A;  4AQI A;  4ORA B;  2E30 A;  2LM5 A;  2KBI A;  1CFC A;  4CFR A;  3D10 A;  3OGN A;  4F7F A;  2COL B;  3GK2 A;  1OOG A;  2JT3 A;  1TN4 A;  3H4S E;  3K21 A;  1DQE A;  1QJT A;  1SCM C;  1TIZ A;  2K7B A;  1IJ6 A;  3KPX A;  3SG2 A;  5B8I B;  3SS4 A;  1MUX A;  2WOS A;  1B8L A;  2JQ6 A;  2LUC A;  1M63 B;  1U5I B;  3IQO A;  2NCP A;  3LLE A;  1IG5 A;  2I2R E;  3CR2 A;  2LAP A;  4OR9 B;  4BY4 A;  1XA5 A;  3O4X A;  2LLS A;  1A2X A;  5FYX A;  2BCB A;  1AJ4 A;  1LA0 A;  3BUO B;  3SIB A;  4ETO A;  3S0A A;  4PHK A;  1LS8 A;  2BKI B;  1EG3 A;  3S0E A;  2H61 A;  1SCM B;  3BOW B;  1QAT A;  1SL7 A;  1NX2 A;  1Y0V H;  2PQL A;  1SY9 A;  2WC8 A;  2LP3 A;  3EVU A;  2AMI A;  2LLT A;  2FCD A;  4PT1 A;  2KAY A;  1AJ5 A;  1EXR A;  1RJV A;  3EVR A;  1SR6 B;  3L4A A;  1CLM A;  2ISD A;  2KFG A;  1S5G Z;  2JXL A;  2SCP A;  1XFZ O;  3EKH A;  1EJ3 A;  2LMT A;  4N1G A;  3A4U B;  3C1V A;  3OX6 A;  5CSN A;  2M0R A;  3TZ1 A;  4M2P A;  3WNX B;  4D1E A;  5FI7 A;  2MLE C;  4MSP A;  1UHN A;  1WRZ A;  4JKT A;  1F70 A;  1QIV A;  1S1E A;  4YI8 A;  1DJY A;  1E8A A;  5PAL A;  4QJ4 B;  1ZOT B;  1LA3 A;  1QVI Z;  2H8V A;  4HRH A;  1H4B A;  3SIA A;  2LVJ A;  2M8U A;  1PVB A;  2KAX A;  3A8R A;  2F2P A;  1CMF A;  2ZRT A;  2I7A A;  1HQV A;  5DKQ A;  2BCA A;  3N7H A;  1F54 A;  1UUS A;  1WRL A;  3EG5 B;  1QIW A;  3CZ2 A;  1OQP A;  2JU0 A;  1J7P A;  5AAN A;  1C07 A;  1R2U A;  5ER4 X;  2BBN A;  1CM1 A;  2JWW A;  1ALW A;  1FI6 A; 
#chains in the Genus database with same CATH homology
 3EKJ A;  1J7R A;  1YX8 A;  5HKY A;  5ER5 A;  1JSA A;  4L9M A;  5CSI A;  1YUR A;  1KK7 Y;  3KHE A;  1NX1 A;  5HLV A;  3IQQ A;  1BMO A;  1BG1 A;  2LHL A;  4PHM A;  1HT9 A;  2L4I A;  3VRQ A;  1BOC A;  1KK8 B;  1KFU L;  4OVN F;  4DUQ A;  2Y1M A;  4GGF C;  4PE7 A;  4CPV A;  4CID A;  2JUL A;  2BCX A;  4Q04 A;  2HPS A;  1UUR A;  1YUT A;  2LMU A;  1XVJ A;  2ZN9 A;  2LUX A;  4FQO A;  3SJS A;  1S6I A;  4I5K A;  4A4B A;  4MZJ A;  1D1O A;  3GK1 A;  1JF0 A;  1TNP A;  1KQM C;  1Y1X A;  2LE9 B;  1NX3 A;  2P6B B;  3LK1 A;  1ZFS A;  2JTZ A;  1SK6 D;  3ZWH A;  2F33 A;  1DJW A;  2TN4 A;  1UHI A;  1WLZ A;  1A4P A;  1SMG A;  4M2O A;  4JPZ B;  2K2F A;  2CBL A;  1CFP A;  1F4O A;  2NXQ A;  2NZ0 A;  4P5O E;  1IKU A;  1KQM B;  1OSA A;  4P2Y B;  4GGF A;  2HQ8 A;  1R6P A;  1OMR A;  2B1U A;  1J7O A;  1JFK A;  3KO0 A;  5J3X A;  5D7F A;  4YGA A;  2PVB A;  4DS7 A;  5AFP A;  4GUK A;  1IJ5 A;  1SPY A;  3FIA A;  1TNW A;  2ZRS A;  3AKA A;  2K7C A;  1CTR A;  4MRY A;  2KFH A;  1OZS A;  1K93 D;  4PE1 A;  4TNC A;  4A4C A;  4ZCU A;  4OCI A;  4U8D A;  2CXJ A;  2HF5 A;  1DF0 B;  3DVK A;  1QAS A;  3CGA A;  2M7N A;  5I2L A;  2QAC A;  1DJX A;  1MF8 B;  1K9P A;  3LCP C;  1Y6W A;  1JBA A;  3TDZ A;  4F0Z B;  2JNF A;  2JNX A;  1OE9 B;  1WY9 A;  2M1U A;  3HCM A;  1B7T Y;  2JT8 A;  4PE4 A;  2PRU A;  3SG5 A;  1QLS A;  4YGD B;  3CZT X;  3ZNI A;  2Q4U A;  1RRO A;  1PSR A;  5IBW A;  2CT9 A;  3CTN A;  3NSO A;  1AUI B;  1DF0 A;  1K95 A;  1SR6 C;  2PSR A;  4GFT A;  4XJK B;  5DKR A;  3RLZ A;  3SG4 A;  5D69 A;  1S36 A;  3BXK A;  4DIR A;  2H2K A;  2LMV A;  4I5J A;  4WQ3 A;  1UP5 A;  1QXP A;  2ZNE A;  3PSR A;  3ICB A;  4NDC A;  2F3Z A;  3EK7 A;  1OZO A;  1MXE A;  1KCY A;  2M3W A;  1DJH A;  1PK0 D;  1SNL A;  3I5F C;  1TCF A;  4AOM A;  3BYA A;  1V1F A;  2JXC A;  1U5I A;  1DTL A;  1CLL A;  3PAT A;  2G2B A;  3M0W A;  2R2I A;  3DF0 B;  1AK8 A;  1J7Q A;  1GQM A;  1TTX A;  1WDC B;  1PAL A;  4E68 A;  5K89 A;  4DCK A;  1XK4 C;  1IH0 A;  2M49 B;  3CWG A;  3OP0 A;  3BOW A;  1W7I B;  3TDU A;  3I5F B;  3BUM B;  2KFF A;  1CDP A;  3DF0 A;  2F2O A;  5AEQ A;  5JOL A;  3KEV A;  1YTZ C;  1GJY A;  3BQ3 A;  1N0Y A;  5CSJ A;  1A75 B;  4JQ0 D;  4YGB B;  2VRG A;  3I5H C;  4GAO A;  1OMV A;  4OKH A;  5HLO A;  5JJG A;  1NX0 A;  1KK8 C;  1NYA A;  1G8I A;  2Y1N A;  1CFD A;  3O4Y A;  3PM8 A;  1SL9 A;  3SG3 A;  1BLQ A;  1SCV A;  2KHN A;  5DKN A;  1EG4 A;  1M39 A;  2BKH B;  1B7T Z;  2MAZ A;  3NSK A;  1SYM A;  1AVS A;  1S6J A;  4MRX A;  1L7Z A;  1K9K A;  1BF5 A;  1B1G A;  2BL0 B;  1PVA A;  1G4Y R;  1A75 A;  3I5H B;  1G33 A;  1XK4 A;  1DJG A;  2BEC A;  4R1E A;  2LVI A;  2GGM A;  1B8C A;  3PLF B;  3WHU B;  2KI6 C;  4WQ2 A;  2PMY A;  5GQQ C;  1DVI A;  2BBM A;  1IRJ A;  1N65 A;  3DVM A;  1YRT B;  5HYD A;  2LVK A;  1X02 A;  1NIW A;  2LV7 A;  1QS7 A;  1NCY A;  5HKZ A;  3D0Y B;  1ZAC A;  1V1G A;  2L0P A;  2I18 A;  1YVH A;  5AER A;  1BJF A;  2MBX A;  1L2O B;  4CLN A;  2M97 A;  3VRN A;  3HX4 A;  3OHM B;  2JZI A;  4MLW A;  1XFU O;  1CDL A;  1NUB A;  4ZCV A;  1JWD A;  1SBJ A;  2MHH A;  1K2H A;  1J1D A;  1DJI A;  1LIN A;  1VRK A;  2EGD A;  4UPG A;  1YVL A;  2K8M B;  2FJU B;  2JT0 A;  2KGB C;  2LLU A;  4NDB A;  1UHK A;  2GV5 A;  1DT7 B;  1REC A;  1NCZ A;  1QX7 A;  1NCX A;  4M2Q A;  1QLK A;  2L2E A;  4HSZ A;  4PHN A;  1TOP A;  4WRI A;  1YUU A;  2RGI A;  1KFX S;  5BPJ A;  2FOT A;  1QV0 A;  2CNP A;  1PUL A;  2HET A;  5KSZ A;  2IS9 A;  2KI4 C;  1XFX O;  3WHT B;  1ODB A;  1NP8 A;  1KK7 Z;  2LHI A;  4AQJ A;  5CPV A;  3RM1 A;  2K0J A;  4GBA A;  4YGE B;  2CTN A;  1NWD A;  3PAL A;  3CS1 A;  1LKJ A;  1NPQ A;  2WCB A;  2MJW B;  1SKT A;  2ZKM X;  1QTX A;  1S26 D;  2M29 A;  1PRW A;  3EK4 A;  1B9A A;  3JTD C;  3PFV A;  2D8N A;  1RK9 A;  1ALV A;  1BU3 A;  1C7W A;  1RFJ A;  2KYF A;  1TRF A;  4NQG A;  2KI4 B;  4PHJ A;  2OTG C;  1GGW A;  1B4C A;  3TS5 B;  1RTP 1;  3VGO A;  2OPO A;  1N2D A;  2Q91 A;  3AAK A;  4MEW A;  1BOD A;  4DRW A;  5KU1 A;  5I2O A;  3F45 A;  1JC2 A;  2JPT A;  2LAN A;  3BUW B;  1LXF C;  4GGN A;  1ZUZ A;  1JF2 A;  3JTD B;  4FTG A;  2M1K B;  2NLN A;  2OTG B;  3SG6 A;  2L50 A;  3DVE A;  2KNE A;  1WDC C;  2F3Y A;  3AAJ A;  4YRU A;  2KOT A;  3CLN A;  1ZMZ A;  2KGR A;  1CFF A;  1TCO B;  1SRA A;  2DOQ A;  2KBM A;  4MBE A;  3FWC A;  4HRG A;  3OB1 B;  1S3P A;  5F6T A;  1SW8 A;  2V53 A;  3MSE B;  1UHH A;  2JOJ A;  4XJK A;  1FPW A;  1YRU B;  1IGV A;  3O6B A;  3VRO A;  2K7D A;  2WOR A;  1GGZ A;  1F8H A;  1OOJ A;  1UHJ A;  1Y1U A;  2E6W A;  2JRF A;  1XFV O;  2KQY A;  4I5N B;  3VRR A;  1IWQ A;  5KTY A;  2PAL A;  1XFY O;  1TNQ A;  3LK0 A;  3NSL A;  2KAV A;  1BT6 A;  2FCE A;  1DGV A;  1QX2 A;  2KYC A;  5HKW A;  2AAO A;  4C0L A;  1FI5 A;  1F4Q A;  1B8R A;  2O60 A;  2L4H A;  4BY5 A;  1YUS A;  2BL0 C;  1JUO A;  3EK8 A;  3FWB A;  1CMG A;  1KSM A;  1F71 A;  4MZL A;  1CLB A;  2KI6 D;  3VRP A;  1K8U A;  5CSF A;  1UWO A;  1KWO C;  2CCM A;  3IF7 A;  1CB1 A;  3AKB A;  3DVJ A;  1FF1 A;  1TNX A;  2BE6 A;  1K9U A;  4MN0 A;  1KFU S;  4OV2 A;  2M9G A;  4I5L B;  1QV1 A;  2M7L A;  2KDH A;  1Q80 A;  4NDD A;  1MQ1 A;  2MRD A;  4QJ3 B;  4PE0 A;  2K2A A;  3QRX A;  1QX5 B;  1CNP A;  4ORB B;  2EHB A;  4ORC B;  1YX7 A;  1KWO B;  1IQ5 A;  2JTT A;  1WRK A;  4YGC B;  2OS8 C;  4YI9 A;  1K94 A;  2L5X B;  3EVV A;  1KQV A;  2KSP A;  1L2O C;  4QJ5 B;  4USL A;  1J1E A;  1M31 A;  3KF9 A;  4GNK B;  1BR4 B;  1DMO A;  2AUC A;  4XYN A;  4N1F A;  3SG7 A;  1M46 A;  2L51 A;  2G9B A;  1DJZ A;  3CR4 X;  2OS8 B;  1MHO A;  1XYD A;  1OMD A;  1PSB A;  2WND A;  3OX5 A;  4MZK A;  3TUY C;  2BE4 A;  1XO5 A;  2WCF A;  1AHR A;  1YR5 A;  3CR5 X;  2LC5 A;  2Y5I A;  1A03 A;  4YBH B;  2LP2 A;  1K90 D;  2MLF C;  3GK4 X;  1B47 A;  4N5X A;  1J55 A;  3D0Y A;  1JFJ A;  2O5G A;  4PCW A;  4HRE E;  3NXA A;  3WXA A;  5I8N A;  5I2Q A;  1MXL C;  2QPT A;  2K61 A;  3NSI A;  1BR1 B;  3I5G C;  3GOF A;  3TUY B;  1EH2 A;  2EC6 C;  4PDZ A;  3O2P A;  3I5I C;  2SAS A;  3LL8 B;  4PAL A;  2I94 A;  2ZFD A;  2GGZ A;  4MVF A;  3TS5 C;  1H8B A;  1KSO A;  2LCP A;  3PN7 C;  1LVC D;  1SL8 A;  2LVV A;  1CM4 A;  4GPL B;  2LNK A;  1F55 A;  2L98 A;  5TNC A;  2JC2 A;  2KQ6 A;  3DD4 A;  4C0J A;  1FBV A;  3I5G B;  1IQ3 A;  2EC6 B;  3BUX B;  1CKK A;  1M45 A;  2NCO A;  1S5G Y;  3I5I B;  2F8P A;  2A4J A;  1MWN A;  3JVT C;  1XFW O;  1C7V A;  1EL4 A;  1MR8 A;  3PN7 B;  2HQW A;  1CDM A;  1NSH A;  2ZND A;  3OB2 B;  1RWY A;  1W7J B;  2PAS A;  3FS7 A;  5AXI A;  4C0K A;  1Y1A A;  2Y4Q A;  4CFQ A;  1KFX L;  1AP4 A;  2H61 C;  2K7O A;  4JWQ A;  5G08 A;  3O78 A;  4IL1 A;  2MA2 A;  1QVI Y;  4ICB A;  1A29 A;  1WLM A;  1S6C A;  1FW4 A;  3JVT B;  1CDN A;  2ZN8 A;  3BUN B;  1K96 A;  2WCE A;  3E3R A;  3TDI A;  1DGU A;  4AQI A;  4ORA B;  2E30 A;  2LM5 A;  2KBI A;  1CFC A;  4CFR A;  3D10 A;  2COL B;  3GK2 A;  2JT3 A;  1TN4 A;  3H4S E;  3K21 A;  1SCM C;  1QJT A;  1TIZ A;  2K7B A;  1IJ6 A;  3KPX A;  3SG2 A;  5B8I B;  1MUX A;  2WOS A;  1B8L A;  2JQ6 A;  2LUC A;  1M63 B;  1U5I B;  3IQO A;  2NCP A;  3LLE A;  1IG5 A;  2I2R E;  3CR2 A;  2LAP A;  4OR9 B;  4BY4 A;  1XA5 A;  2LLS A;  1A2X A;  5FYX A;  2BCB A;  1AJ4 A;  1LA0 A;  3BUO B;  3SIB A;  4ETO A;  4PHK A;  2BKI B;  1EG3 A;  2H61 A;  1SCM B;  3BOW B;  1QAT A;  1SL7 A;  1NX2 A;  1Y0V H;  1SY9 A;  2WC8 A;  2LP3 A;  3EVU A;  2AMI A;  2LLT A;  2FCD A;  2KAY A;  1AJ5 A;  1EXR A;  1RJV A;  3EVR A;  1SR6 B;  2ISD A;  1CLM A;  2KFG A;  1S5G Z;  2JXL A;  2SCP A;  1XFZ O;  3EKH A;  1EJ3 A;  2LMT A;  4N1G A;  3A4U B;  3C1V A;  3OX6 A;  5CSN A;  2M0R A;  3TZ1 A;  4M2P A;  3WNX B;  4D1E A;  2MLE C;  4MSP A;  1UHN A;  1WRZ A;  1F70 A;  1QIV A;  1S1E A;  4YI8 A;  1DJY A;  1E8A A;  5PAL A;  4QJ4 B;  1ZOT B;  1LA3 A;  1QVI Z;  4HRH A;  1H4B A;  3SIA A;  2LVJ A;  2M8U A;  1PVB A;  2KAX A;  3A8R A;  2F2P A;  1CMF A;  2ZRT A;  2I7A A;  1HQV A;  5DKQ A;  2BCA A;  1F54 A;  1UUS A;  1WRL A;  1QIW A;  1OQP A;  2JU0 A;  1J7P A;  5AAN A;  1C07 A;  1R2U A;  5ER4 X;  2BBN A;  1CM1 A;  2JWW A;  1ALW A;  1FI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...