1JF0A

The crystal structure of obelin from obelia geniculata at 1.82 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
192
structure length
192
Chain Sequence
KYAVKLQTDFDNPKWIKRHKFMFDYLDINGNGQITLDEIVSKASDDICKNLGATPAQTQRHQDCVEAFFRGCGLEYGKETKFPEFLEGWKNLANADLAKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGRISGISPSEEDCEKTFQHCDLDNSGELDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Obelin
publication title The Crystal Structure of Obelin from Obelia geniculata at 1.82 Angstrom Resolution
rcsb
source organism Obelia longissima
total genus 76
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2001-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jf0A00
1YX8A 2Y1MA 1KSOA 1YURA 3DVMA 4DRWA 1SY9A 4ZCVA 1IJ5A 2LCPA 1LXFC 4OCIA 1F8HA 2KNEA 1DJHA 5K89A 4YRUA 1QX7A 1WLMA 2O60A 3ZNIA 3CR2A 4PE1A 2LAPA 1QIVA 4HSZA 1TIZA 1CLMA 5FYXA 1ODBA 5DKNA 4UPGA 2BCAA 1FBVA 2F33A 1V1GA 3NXAA 1B1GA 1YUUA 1CDPA 1QVIZ 1X02A 4PHNA 1JF2A 1FI5A 4OV2A 1J7RA 3AKBA 3I5IB 1BODA 3WNXB 4BY4A 2F3ZA 1NCXA 1WDCB 4YI8A 1EXRA 1IQ3A 1OZOA 2KGBC 2Y4QA 2KBMA 4DCKA 2RGIA 3JVTC 1RROA 3I5FC 4YGAA 2CNPA 3QRXA 2EC6B 1ZUZA 3TUYC 1EH2A 2KYFA 4YGDB 4DUQA 1MXLC 2KAYA 1NP8A 3GK4X 3VRNA 3WHUB 5CSIA 1DJGA 3CS1A 2KI4B 2CCMA 4ETOA 2M7NA 4ORBB 4ZCUA 3SG5A 1ALVA 1A75A 1L2OC 1U5IB 3LK1A 5JOLA 1FW4A 2LMTA 2F3YA 2L2EA 2IS9A 2ZNDA 1WRLA 4CFRA 3C1VA 3NSOA 1EJ3A 1TNXA 2K61A 3BXKA 1F4OA 1XK4A 1DJZA 4MSPA 1Y6WA 2LP2A 1PSRA 2L50A 2OTGC 2JT0A 3SJSA 2JT8A 3CTNA 4MBEA 1PVBA 5HLOA 1GJYA 2B1UA 2L0PA 2NZ0A 4DS7A 1UWOA 2JWWA 1DJWA 3I5HC 2PASA 4WRIA 1MUXA 1D1OA 2MA2A 1OE9B 1ZMZA 3KO0A 2KQ6A 2SASA 1LINA 1KQMB 1HT9A 5HKZA 3VRQA 2HETA 3DVKA 2O5GA 1RK9A 1ZOTB 2JPTA 1IGVA 1OSAA 2E6WA 1MQ1A 1KFUL 1NCYA 1QASA 1RECA 1XVJA 1DTLA 2BBNA 1SW8A 3H4SE 1CB1A 1QLSA 2BKHB 3IQOA 4GUKA 2P6BB 1BOCA 2CXJA 1B8RA 1E8AA 1TNWA 1CFFA 1AUIB 1SRAA 4MN0A 1SNLA 1DGVA 2H2KA 2LANA 1F71A 5AXIA 1PK0D 4E68A 1PALA 1GGZA 1SKTA 1IG5A 2DOQA 1A29A 1CLLA 3A4UB 2JNFA 3TDZA 4DIRA 1IKUA 2KOTA 4PE0A 1A2XA 1B7TY 3SIAA 1TOPA 2KBIA 5DKRA 4GGFC 1UHKA 3JVTB 1JC2A 2JRFA 2L5XB 3I5FB 4CLNA 1UHHA 4JQ0D 5I2LA 1LA0A 3EK8A 3TUYB 1DF0B 3EVVA 4N1FA 2FJUB 3VROA 1OMVA 2K8MB 4MRYA 4AQJA 2OPOA 2HQWA 2L4HA 4R1EA 1WLZA 1XO5A 3D10A 1S3PA 3IF7A 3BOWB 1HQVA 2LM5A 2MLFC 4CPVA 3DF0A 2F2OA 1Q80A 5KTYA 1XFZO 2AUCA 2PVBA 1SBJA 4Q04A 1K2HA 1L2OB 1YRTB 4ORCB 2WCEA 2ZN8A 2OS8C 2QACA 1V1FA 3FS7A 2E30A 1NSHA 1IQ5A 3PSRA 5B8IB 1CFCA 1XFXO 4F0ZB 1PULA 1OZSA 2KFFA 1DJYA 4I5JA 1TN4A 2ZN9A 2OTGB 4MVFA 5CSJA 1XFUO 2BL0C 1H8BA 1F54A 1CFDA 1SYMA 3OHMB 3TS5C 2K7DA 1WY9A 2LV7A 2M1UA 4GBAA 3I5HB 1KFUS 3AAJA 4NDCA 1NIWA 3BUMB 3RLZA 2BE4A 2L51A 1RFJA 4PHKA 4M2QA 3TZ1A 3BYAA 5JJGA 4NDBA 4GPLB 4OR9B 3OB2B 2JULA 2LVKA 1G4YR 1YR5A 1NX2A 1PSBA 2M49B 3BQ3A 1K96A 1S26D 1Y1XA 4YGCB 2K7BA 1IWQA 3K21A 1EL4A 3O6BA 1DMOA 2Q4UA 5BPJA 3PM8A 2WC8A 2K2AA 3PN7C 2HF5A 2JTZA 2KYCA 3BOWA 4HREE 1A03A 4D1EA 1CMFA 1GQMA 3DVJA 1S6JA 1W7JB 3CR4X 1FPWA 2NCPA 1C07A 4L9MA 1WRKA 1JFKA 4YGEB 2AAOA 1R2UA 1QATA 1QV0A 3ICBA 4AOMA 2F2PA 1BT6A 2LVIA 2H61C 3KHEA 1N2DA 3E3RA 1KSMA 2LLSA 4FTGA 1LA3A 5G08A 3SG3A 2JXCA 4C0LA 5HKYA 1H4BA 2KAXA 5DKQA 1NYAA 1S6IA 3TDIA 1SPYA 3CR5X 2ZFDA 3O2PA 4QJ4B 1SR6C 1XFWO 4N1GA 1C7WA 2LP3A 3LL8B 1NX0A 2BKIB 2JU0A 1JSAA 5J3XA 1S36A 2BECA 2MRDA 3NSIA 5AEQA 5HYDA 2QPTA 1NWDA 3O78A 1YRUB 3NSKA 1BR1B 2LLTA 3AAKA 1A4PA 2KI6C 2M1KB 1YUTA 1K8UA 1LKJA 1BU3A 2M29A 1OMRA 3KPXA 3OX6A 2I18A 1CDMA 1SK6D 2G2BA 2HQ8A 2OS8B 3EK4A 5CSFA 1AJ4A 5GQQC 4YGBB 1YTZC 2GGZA 2JNXA 2JXLA 1C7VA 2LE9B 4WQ2A 1CDNA 1UP5A 1PVAA 2BL0B 1QS7A 1MF8B 3CWGA 4GFTA 3SIBA 3SG7A 3TS5B 4AQIA 2MBXA 2ZRSA 4A4BA 1YVHA 4I5LB 1U5IA 2KI6D 4N5XA 1MHOA 1QX2A 2GGMA 1XK4C 2JC2A 1TCFA 1B8LA 4MZKA 2G9BA 1DVIA 1MXEA 1M46A 3EKJA 5HKWA 1DT7B 5IBWA 4TNCA 1J1DA 1BG1A 5AERA 2K7OA 1K95A 3BUNB 1F4QA 4MRXA 1IRJA 1AVSA 1Y1UA 2WORA 2M9GA 1YVLA 1R6PA 3PN7B 2A4JA 4IL1A 1M63B 2BCBA 5I2QA 1KK8C 3BUWB 1B8CA 1DJIA 4OVNF 2MHHA 4YBHB 3DD4A 3HCMA 1CMGA 1J55A 1SMGA 3JTDC 3SG2A 1NX3A 2NCOA 5AANA 3BUOB 1QVIY 1UHIA 2Y1NA 1NUBA 2ISDA 1QX5B 2KDHA 2WCFA 1QV1A 2L98A 1QJTA 1MR8A 2LC5A 3HX4A 1OQPA 2KGRA 5PALA 3SG4A 1KFXL 1SR6B 3IQQA 4PHMA 1RJVA 5F6TA 2M3WA 5CSNA 2PALA 2BE6A 2PRUA 3CLNA 4MZJA 3TDUA 1Y0VH 4USLA 1KQVA 2LVVA 1TNPA 2ZKMX 1J7PA 3PLFB 5KU1A 1RTP1 1JWDA 1JFJA 3VRRA 4GGNA 3WXAA 1W7IB 1BJFA 1GGWA 4PHJA 1XA5A 1K9PA 1XYDA 1S5GY 3GK2A 2CBLA 1BR4B 2EHBA 2JT3A 3EVRA 4ICBA 2KHNA 2FCDA 2COLB 1KQMC 1CKKA 3EVUA 4ORAB 1BF5A 1UHJA 2D8NA 3VGOA 1S1EA 1QLKA 5D7FA 1AP4A 4U8DA 1B47A 1CTRA 1SCVA 1DF0A 3DVEA 3FIAA 2M97A 3KEVA 1XFYO 2Q91A 2V53A 2HPSA 1F55A 2ZRTA 1B7TZ 1AJ5A 1J1EA 2GV5A 2LVJA 2LUXA 3A8RA 2H61A 1SL8A 2NXQA 3RM1A 1A75B 1PRWA 1JUOA 1LVCD 3I5GC 5D69A 1VRKA 1UUSA 1TTXA 3EKHA 1K9KA 5CPVA 1EG4A 2WCBA 2K7CA 1M45A 1MWNA 4OKHA 5HLVA 2PMYA 1CNPA 4GNKB 3SG6A 1SL7A 3PFVA 2JZIA 2JOJA 4MEWA 4NQGA 1SCMC 2CT9A 1XFVO 2M0RA 4QJ3B 5I8NA 1M39A 4WQ3A 2WNDA 1BLQA 5ER4X 3AKAA 1NPQA 1KK8B 3EK7A 1DGUA 1KFXS 3JTDB 3MSEB 2KFGA 4PALA 2F8PA 1QIWA 1KWOC 2AMIA 2LMVA 2TN4A 4JPZB 2EGDA 4C0KA 4C0JA 1F70A 2JTTA 2FCEA 1K9UA 4QJ5B 2LUCA 1FI6A 1S5GZ 3BUXB 1CLBA 4JWQA 4XJKB 1TRFA 1J7OA 3O4YA 1TNQA 1K94A 1YX7A 2PSRA 1N65A 3LCPC 1SL9A 2M7LA 4I5KA 4P5OE 1IH0A 1EG3A 1M31A 2ZNEA 3M0WA 1OOJA 1S6CA 2I2RE 1JBAA 2MAZA 1UHNA 2WOSA 1J7QA 1KK7Y 1CM4A 2LHLA 1NX1A 2L4IA 2LMUA 1CDLA 1Y1AA 1BMOA 3GK1A 3OX5A 2I94A 2LLUA 3D0YB 1FF1A 4M2OA 4P2YB 2NLNA 1NCZA 2BBMA 2K2FA 2R2IA 2KAVA 4HRHA 4GGFA 2LHIA 3WHTB 4A4CA 5AFPA 2FOTA 1TCOB 1KCYA 1JF0A 4PDZA 5KSZA 3ZWHA 3I5IC 1YUSA 1ZACA 4MZLA 3LK0A 3DF0B 1WDCC 3GOFA 5TNCA 4PE7A 2VRGA 1K93D 1L7ZA 1WRZA 4CIDA 4XJKA 3I5GB 1OMDA 2KQYA 3KF9A 2M8UA 4BY5A 4FQOA 3PALA 2EC6C 1QTXA 1QXPA 3CZTX 1B9AA 2BCXA 5ER5A 2Y5IA 3OP0A 1UURA 4CFQA 2SCPA 4XYNA 1AK8A 2MJWB 1CM1A 5I2OA 1B4CA 2KI4C 4PCWA 4PE4A 1AHRA 1K90D 3VRPA 1SCMB 1IJ6A 1ALWA 1DJXA 3PATA 1ZFSA 1N0YA 3CGAA 4YI9A 2MLEC 2KFHA 3OB1B 3D0YA 4HRGA 2JQ6A 4I5NB 4M2PA 3LLEA 2KSPA 1G8IA 2I7AA 2LNKA 3F45A 1KK7Z 3FWBA 1RWYA 1KWOB 2CTNA 4GAOA 1CFPA 3FWCA 4MLWA 3NSLA 4NDDA 1G33A 2K0JA
chains in the Genus database with same CATH superfamily
1YX8A 2Y1MA 1KSOA 2QEBA 5FI2A 1YURA 3DVMA 4DRWA 1SY9A 4ZCVA 1OW4A 1IJ5A 2LCPA 1LXFC 4OCIA 1F8HA 2KNEA 1DJHA 3DYEA 5K89A 4YRUA 1QX7A 1WLMA 2O60A 3S0FA 3ZNIA 3CR2A 4PE1A 2LAPA 1QIVA 4HSZA 1TIZA 1CLMA 5FYXA 1ODBA 5DKNA 4UPGA 2BCAA 3UNWA 1FBVA 2F33A 1V1GA 3NXAA 3OBVA 5DICA 1B1GA 1YUUA 1CDPA 1QVIZ 1X02A 2PQLA 1JF2A 3EG5B 4OV2A 4PHNA 1FI5A 1J7RA 3AKBA 3I5IB 1BODA 3WNXB 3CABA 3B87A 4BY4A 2F3ZA 3DZTA 1NCXA 1WDCB 4YI8A 1EXRA 1IQ3A 1OZOA 3VB1A 2KGBC 2Y4QA 2KBMA 4DCKA 2RGIA 3JVTC 3D75A 2ERBA 1RROA 3I5FC 4YGAA 2CNPA 3QRXA 2EC6B 3B86A 1ZUZA 3TUYC 1EH2A 2KYFA 4YGDB 4DUQA 1MXLC 3SS3A 2KAYA 1NP8A 3GK4X 3VRNA 3WHUB 5CSIA 1DJGA 3CS1A 2KI4B 3CYZA 2CCMA 4ETOA 3DY9A 2M7NA 4ORBB 4ZCUA 3SG5A 1ALVA 1A75A 1L2OC 1SSEB 1U5IB 3LK1A 5JOLA 1FW4A 2LMTA 2F3YA 2L2EA 2IS9A 2ZNDA 1WRLA 4CFRA 3C1VA 3NSOA 1EJ3A 1TNXA 2K61A 3BXKA 1F4OA 3D77A 1XK4A 1DJZA 4MSPA 1Y6WA 2LP2A 1PSRA 2L50A 2OTGC 2JT0A 3SJSA 2JT8A 3CTNA 4FQTA 1PVBA 4MBEA 5HLOA 1GJYA 2B1UA 2L0PA 2NZ0A 3PM2A 1UWOA 2JWWA 4DS7A 1DJWA 3I5HC 2PASA 4WRIA 1MUXA 1D1OA 2MA2A 1OE9B 1ZMZA 3KO0A 2KQ6A 2SASA 1LINA 3D73A 1KQMB 2WCHA 1HT9A 5HKZA 3VRQA 2HETA 3DVKA 2O5GA 1RK9A 1ZOTB 2JPTA 3K1EA 1IGVA 1OSAA 2E6WA 1MQ1A 1XFRA 1KFUL 1NCYA 1QASA 1RECA 1XVJA 1DTLA 2BBNA 1SW8A 3H4SE 1CB1A 1QLSA 2BKHB 3IQOA 4GUKA 2P6BB 1BOCA 3BFAA 2CXJA 1B8RA 2WC5A 1E8AA 1TNWA 1CFFA 1AUIB 1SRAA 4MN0A 2WC6A 3S0EA 1SNLA 1DGVA 2H2KA 2LANA 1F71A 3L47A 3R1PA 5AXIA 1PK0D 4E68A 1PALA 1GGZA 1SKTA 1IG5A 1GM0A 5I94A 2DOQA 1A29A 1CLLA 3A4UB 2JNFA 3TDZA 4DIRA 1IKUA 2KOTA 4INWA 1A2XA 1B7TY 4PE0A 1TOPA 2KBIA 3SIAA 5DKRA 4GGFC 1UHKA 3N7HA 3JVTB 1JC2A 1DELA 2JRFA 2KPHA 2L5XB 3I5FB 4CLNA 1UHHA 4JQ0D 5I2LA 3S0BA 1LA0A 3EK8A 3TUYB 3RZSA 1DF0B 3EVVA 4N1FA 2FJUB 3VROA 1OMVA 2K8MB 4MRYA 4AQJA 2OPOA 2HQWA 2L4HA 4R1EA 2P71A 1WLZA 1XO5A 3D10A 1S3PA 3IF7A 3O4XA 3BOWB 1HQVA 2LM5A 2MLFC 4CPVA 3DF0A 2F2OA 3DXLA 1Q80A 5KTYA 1XFZO 2AUCA 1TUZA 2PVBA 1SBJA 4Q04A 3UO9A 1K2HA 1L2OB 1YRTB 4ORCB 2WCEA 2QEVA 2OS8C 2ZN8A 3B6XA 2QACA 5FI6A 1V1FA 3CZ0A 3FS7A 2E30A 1NSHA 1IQ5A 3PSRA 5B8IB 1CFCA 1XFXO 4F0ZB 1PULA 1OZSA 2FJYA 2KFFA 1DJYA 4I5JA 1TN4A 2ZN9A 2OTGB 4MVFA 5CSJA 1XFUO 2BL0C 1H8BA 1F54A 1CFDA 1SYMA 3OHMB 3TS5C 2K7DA 1WY9A 2LV7A 2M1UA 4GBAA 3I5HB 1KFUS 3AAJA 1QWVA 4NDCA 1NIWA 3BUMB 3RLZA 2BE4A 2L51A 4KYNA 1RFJA 4PHKA 4M2QA 3TZ1A 3BYAA 1LS8A 4NDBA 3S0GA 3D78A 4GPLB 3OB2B 4OR9B 5JJGA 2JULA 2LVKA 1G4YR 1YR5A 1NX2A 1PSBA 2M49B 3BQ3A 1K96A 1S26D 1OOHA 1Y1XA 2K7BA 4YGCB 1OOGA 1IWQA 3SS5A 3K21A 1EL4A 3O6BA 1DMOA 2Q4UA 1C3YA 5BPJA 3PM8A 2WC8A 2K2AA 3PN7C 2HF5A 2JTZA 2KYCA 3BOWA 4HREE 1A03A 4D1EA 1CMFA 1GQMA 3DVJA 1S6JA 1W7JB 3CR4X 1FPWA 5EL2A 2NCPA 1C07A 4L9MA 1WRKA 3R1OA 1JFKA 4YGEB 2AAOA 1R2UA 1QATA 1QV0A 3ICBA 4AOMA 2F2PA 1BT6A 2LVIA 2H61C 3KHEA 1N2DA 3E3RA 1KSMA 3B88A 2LLSA 4FTGA 1LA3A 5G08A 3SG3A 2JXCA 4C0LA 5HKYA 1H4BA 2KAXA 5DKQA 1NYAA 1Z2CB 1S6IA 3TDIA 1SPYA 3CR5X 2ZFDA 3O2PA 4QJ4B 1SR6C 1XFWO 4N1GA 1C7WA 2LP3A 3LL8B 1NX0A 2BKIB 2JU0A 1JSAA 5J3XA 1S36A 2BECA 2MRDA 3NSIA 4INXA 5AEQA 5HYDA 2QPTA 1NWDA 3O78A 1YRUB 3NSKA 3S0AA 1BR1B 2LLTA 3AAKA 1A4PA 2KI6C 2M1KB 1YUTA 1K8UA 1LKJA 1BU3A 2M29A 1OMRA 3KPXA 3OX6A 2I18A 1CDMA 1SK6D 3NHTA 2G2BA 2HQ8A 2OS8B 2P70A 2QEHA 3EK4A 5CSFA 3NHIA 1AJ4A 1OOFA 5GQQC 4YGBB 1YTZC 2GGZA 2JNXA 2JXLA 1C7VA 3BFHA 3IVTA 2LE9B 3OGNA 4WQ2A 1CDNA 1UP5A 1PVAA 2BL0B 1QS7A 1MF8B 3CWGA 4GFTA 3SIBA 3SG7A 3TS5B 4AQIA 2MBXA 2KLDA 2ZRSA 4A4BA 1YVHA 4I5LB 3FE9A 1U5IA 2KI6D 4N5XA 1MHOA 1QX2A 2GGMA 1XK4C 2JC2A 3V2LA 1TCFA 1B8LA 4MZKA 2G9BA 1DVIA 1MXEA 1M46A 3EKJA 5HKWA 1DT7B 2L2CA 5IBWA 4TNCA 1J1DA 1BG1A 3R1VA 2GTEA 2K7OA 5AERA 1K95A 1C3ZA 3BUNB 1F4QA 4MRXA 1IRJA 1AVSA 1Y1UA 2WORA 2M9GA 1YVLA 1R6PA 3PN7B 2A4JA 4IL1A 1M63B 2BCBA 5I2QA 1KK8C 3BUWB 1B8CA 1DJIA 4OVNF 2MHHA 3FE6A 4YBHB 3DD4A 3HCMA 1CMGA 1OOIX 1J55A 1SMGA 2H8VA 3JTDC 3SG2A 1NX3A 2NCOA 5AANA 3BUOB 1QVIY 1UHIA 1TWOA 2BNXA 2Y1NA 1NUBA 2ISDA 1QX5B 2KDHA 2WCFA 3SS4A 1QV1A 2L98A 1QJTA 1MR8A 2LC5A 3HX4A 1OQPA 2KGRA 5PALA 3SG4A 1KFXL 1SR6B 3IQQA 4PHMA 1RJVA 5F6TA 2M3WA 5CSNA 2PALA 4IJ7A 3BFBA 2BE6A 2PRUA 3CLNA 4MZJA 3TDUA 1Y0VH 4USLA 1KQVA 2LVVA 1TNPA 2ZKMX 1J7PA 3PLFB 5KU1A 1RTP1 1JWDA 1JFJA 3VRRA 4GGNA 3B7AA 3WXAA 1W7IB 1BJFA 3NGVA 1GGWA 4PHJA 1XA5A 1K9PA 1XYDA 1S5GY 3GK2A 2CBLA 1BR4B 2EHBA 2JT3A 3EVRA 4ICBA 3CDNA 2KHNA 2FCDA 2COLB 1KQMC 1CKKA 3EVUA 3R72A 4ORAB 1UHJA 2D8NA 3FE8A 1S1EA 1QLKA 5D7FA 3VGOA 1DC1A 4U8DA 3L4AA 1B47A 1CTRA 1SCVA 1DF0A 3DVEA 3FIAA 2M97A 3KEVA 1XFYO 2Q91A 2V53A 4F7FA 2HPSA 1F55A 2YGUA 2ZRTA 3CZ2A 1B7TZ 1AJ5A 1J1EA 2GV5A 2LVJA 2QEOA 4PT1A 2LUXA 3A8RA 2H61A 1SL8A 2NXQA 3RM1A 1A75B 1PRWA 1JUOA 1LVCD 3I5GC 5D69A 1VRKA 3Q8IA 1UUSA 1TTXA 3EKHA 1K9KA 5CPVA 1EG4A 2WCBA 2WCMA 2K7CA 3D76A 1W9ZA 1M45A 1MWNA 4OKHA 2JPOA 2PMYA 5HLVA 1CNPA 3PJIA 4GNKB 3SG6A 5D3OA 1SL7A 3PFVA 1DQEA 2JZIA 2JOJA 4MEWA 4NQGA 3S0DA 1SCMC 2CT9A 1XFVO 2M0RA 4QJ3B 5I8NA 1M39A 1ORGA 4WQ3A 2WNDA 1BLQA 1T14A 5ER4X 3AKAA 1NPQA 1KK8B 3EK7A 1DGUA 1KFXS 4JD9A 3JTDB 3MSEB 2KFGA 4PALA 2F8PA 1QIWA 1KWOC 2AMIA 2LMVA 2TN4A 4JPZB 1P28A 2EGDA 4C0KA 1DEKA 2JTTA 4C0JA 2FCEA 1K9UA 4QJ5B 3QMEA 2LUCA 1FI6A 1S5GZ 3BUXB 1CLBA 4JKTA 4JWQA 1TRFA 4XJKB 1J7OA 3O4YA 1TNQA 1AP4A 1K94A 1YX7A 2PSRA 1N65A 3LCPC 2WCKA 1SL9A 2M7LA 4I5KA 2KLEA 4P5OE 1EG3A 1IH0A 1M31A 2ZNEA 3M0WA 1OOJA 1S6CA 2I2RE 1JBAA 2MAZA 1UHNA 2WOSA 1J7QA 2QDIA 1KK7Y 1CM4A 2LHLA 2WCJA 1NX1A 2BAPA 2L4IA 2LMUA 1CDLA 1Y1AA 1BMOA 3GK1A 3OX5A 1F70A 2I94A 2LLUA 3D0YB 1FF1A 4M2OA 4P2YB 2NLNA 1TUJA 1NCZA 2BBMA 2K2FA 2R2IA 2KAVA 4HRHA 4GGFA 2LHIA 3WHTB 4A4CA 2L5YA 2FOTA 1TCOB 5AFPA 1KCYA 1JF0A 1BF5A 4PDZA 5KSZA 3ZWHA 3I5IC 3L4LA 1YUSA 1ZACA 4MZLA 3LK0A 3DF0B 5FI7A 1WDCC 3GOFA 5HL1A 5TNCA 4PE7A 2VRGA 1K93D 1L7ZA 1WRZA 1IIOA 4CIDA 2PYQA 3I5GB 4XJKA 1OMDA 2KQYA 3KF9A 2M8UA 4BY5A 4FQOA 3PALA 2EC6C 4OZDA 1QTXA 1QXPA 3CZTX 1B9AA 2BCXA 5ER5A 2Y5IA 3OP0A 1UURA 4CFQA 2SCPA 4XYNA 1AK8A 2MJWB 1CM1A 5I2OA 1B4CA 2KI4C 4PCWA 4PE4A 1AHRA 2K60A 1K90D 3VRPA 1SCMB 1IJ6A 1ALWA 1DJXA 3PATA 1ZFSA 1N0YA 3CGAA 4YI9A 2MLEC 2KFHA 3OB1B 3D0YA 4HRGA 2JQ6A 4I5NB 4M2PA 3LLEA 1Z4HA 2KSPA 3D74A 1G8IA 2I7AA 2LNKA 3F45A 1KK7Z 3FWBA 1RWYA 1KWOB 3CZ1A 2WCLA 2CTNA 4GAOA 1CFPA 3BJHA 3FWCA 4MLWA 3NSLA 4NDDA 1G33A 2K0JA
chains in the Genus database with same CATH topology
1YX8A 2Y1MA 1KSOA 1YURA 3DVMA 4DRWA 1SY9A 4ZCVA 1IJ5A 2LCPA 1LXFC 4OCIA 1F8HA 2KNEA 1DJHA 5K89A 4YRUA 1QX7A 1WLMA 2O60A 3ZNIA 3CR2A 4PE1A 2LAPA 1QIVA 4HSZA 1TIZA 1CLMA 5FYXA 1ODBA 5DKNA 4UPGA 2BCAA 1FBVA 2F33A 1V1GA 3NXAA 1B1GA 1YUUA 1CDPA 1QVIZ 1X02A 4PHNA 1JF2A 1FI5A 4OV2A 1J7RA 3AKBA 3I5IB 1BODA 3WNXB 4BY4A 2F3ZA 1NCXA 1WDCB 4YI8A 1EXRA 1IQ3A 1OZOA 2KGBC 2Y4QA 2KBMA 4DCKA 2RGIA 3JVTC 1RROA 3I5FC 4YGAA 2CNPA 3QRXA 2EC6B 1ZUZA 3TUYC 1EH2A 2KYFA 4YGDB 4DUQA 1MXLC 2KAYA 1NP8A 3GK4X 3VRNA 3WHUB 5CSIA 1DJGA 3CS1A 2KI4B 2CCMA 4ETOA 2M7NA 4ORBB 4ZCUA 3SG5A 1ALVA 1A75A 1L2OC 1U5IB 3LK1A 5JOLA 1FW4A 2LMTA 2F3YA 2L2EA 2IS9A 2ZNDA 1WRLA 4CFRA 3C1VA 3NSOA 1EJ3A 1TNXA 2K61A 3BXKA 1F4OA 1XK4A 1DJZA 4MSPA 1Y6WA 2LP2A 1PSRA 2L50A 2OTGC 2JT0A 3SJSA 2JT8A 3CTNA 4MBEA 1PVBA 5HLOA 1GJYA 2B1UA 2L0PA 2NZ0A 4DS7A 1UWOA 2JWWA 1DJWA 3I5HC 2PASA 4WRIA 1MUXA 1D1OA 2MA2A 1OE9B 1ZMZA 3KO0A 2KQ6A 2SASA 1LINA 1KQMB 1HT9A 5HKZA 3VRQA 2HETA 3DVKA 2O5GA 1RK9A 1ZOTB 2JPTA 1IGVA 1OSAA 2E6WA 1MQ1A 1KFUL 1NCYA 1QASA 1RECA 1XVJA 1DTLA 2BBNA 1SW8A 3H4SE 1CB1A 1QLSA 2BKHB 3IQOA 4GUKA 2P6BB 1BOCA 2CXJA 1B8RA 1E8AA 1TNWA 1CFFA 1AUIB 1SRAA 4MN0A 1SNLA 1DGVA 2H2KA 2LANA 1F71A 5AXIA 1PK0D 4E68A 1PALA 1GGZA 1SKTA 1IG5A 2DOQA 1A29A 1CLLA 3A4UB 2JNFA 3TDZA 4DIRA 1IKUA 2KOTA 4PE0A 1A2XA 1B7TY 3SIAA 1TOPA 2KBIA 5DKRA 4GGFC 1UHKA 3JVTB 1JC2A 2JRFA 2L5XB 3I5FB 4CLNA 1UHHA 4JQ0D 5I2LA 1LA0A 3EK8A 3TUYB 1DF0B 3EVVA 4N1FA 2FJUB 3VROA 1OMVA 2K8MB 4MRYA 4AQJA 2OPOA 2HQWA 2L4HA 4R1EA 1WLZA 1XO5A 3D10A 1S3PA 3IF7A 3BOWB 1HQVA 2LM5A 2MLFC 4CPVA 3DF0A 2F2OA 1Q80A 5KTYA 1XFZO 2AUCA 2PVBA 1SBJA 4Q04A 1K2HA 1L2OB 1YRTB 4ORCB 2WCEA 2ZN8A 2OS8C 2QACA 1V1FA 3FS7A 2E30A 1NSHA 1IQ5A 3PSRA 5B8IB 1CFCA 1XFXO 4F0ZB 1PULA 1OZSA 2KFFA 1DJYA 4I5JA 1TN4A 2ZN9A 2OTGB 4MVFA 5CSJA 1XFUO 2BL0C 1H8BA 1F54A 1CFDA 1SYMA 3OHMB 3TS5C 2K7DA 1WY9A 2LV7A 2M1UA 4GBAA 3I5HB 1KFUS 3AAJA 4NDCA 1NIWA 3BUMB 3RLZA 2BE4A 2L51A 1RFJA 4PHKA 4M2QA 3TZ1A 3BYAA 5JJGA 4NDBA 4GPLB 4OR9B 3OB2B 2JULA 2LVKA 1G4YR 1YR5A 1NX2A 1PSBA 2M49B 3BQ3A 1K96A 1S26D 1Y1XA 4YGCB 2K7BA 1IWQA 3K21A 1EL4A 3O6BA 1DMOA 2Q4UA 5BPJA 3PM8A 2WC8A 2K2AA 3PN7C 2HF5A 2JTZA 2KYCA 3BOWA 4HREE 1A03A 4D1EA 1CMFA 1GQMA 3DVJA 1S6JA 1W7JB 3CR4X 1FPWA 2NCPA 1C07A 4L9MA 1WRKA 1JFKA 4YGEB 2AAOA 1R2UA 1QATA 1QV0A 3ICBA 4AOMA 2F2PA 1BT6A 2LVIA 2H61C 3KHEA 1N2DA 3E3RA 1KSMA 2LLSA 4FTGA 1LA3A 5G08A 3SG3A 2JXCA 4C0LA 5HKYA 1H4BA 2KAXA 5DKQA 1NYAA 1S6IA 3TDIA 1SPYA 3CR5X 2ZFDA 3O2PA 4QJ4B 1SR6C 1XFWO 4N1GA 1C7WA 2LP3A 3LL8B 1NX0A 2BKIB 2JU0A 1JSAA 5J3XA 1S36A 2BECA 2MRDA 3NSIA 5AEQA 5HYDA 2QPTA 1NWDA 3O78A 1YRUB 3NSKA 1BR1B 2LLTA 3AAKA 1A4PA 2KI6C 2M1KB 1YUTA 1K8UA 1LKJA 1BU3A 2M29A 1OMRA 3KPXA 3OX6A 2I18A 1CDMA 1SK6D 2G2BA 2HQ8A 2OS8B 3EK4A 5CSFA 1AJ4A 5GQQC 4YGBB 1YTZC 2GGZA 2JNXA 2JXLA 1C7VA 2LE9B 4WQ2A 1CDNA 1UP5A 1PVAA 2BL0B 1QS7A 1MF8B 3CWGA 4GFTA 3SIBA 3SG7A 3TS5B 4AQIA 2MBXA 2ZRSA 4A4BA 1YVHA 4I5LB 1U5IA 2KI6D 4N5XA 1MHOA 1QX2A 2GGMA 1XK4C 2JC2A 1TCFA 1B8LA 4MZKA 2G9BA 1DVIA 1MXEA 1M46A 3EKJA 5HKWA 1DT7B 5IBWA 4TNCA 1J1DA 1BG1A 5AERA 2K7OA 1K95A 3BUNB 1F4QA 4MRXA 1IRJA 1AVSA 1Y1UA 2WORA 2M9GA 1YVLA 1R6PA 3PN7B 2A4JA 4IL1A 1M63B 2BCBA 5I2QA 1KK8C 3BUWB 1B8CA 1DJIA 4OVNF 2MHHA 4YBHB 3DD4A 3HCMA 1CMGA 1J55A 1SMGA 3JTDC 3SG2A 1NX3A 2NCOA 5AANA 3BUOB 1QVIY 1UHIA 2Y1NA 1NUBA 2ISDA 1QX5B 2KDHA 2WCFA 1QV1A 2L98A 1QJTA 1MR8A 2LC5A 3HX4A 1OQPA 2KGRA 5PALA 3SG4A 1KFXL 1SR6B 3IQQA 4PHMA 1RJVA 5F6TA 2M3WA 5CSNA 2PALA 2BE6A 2PRUA 3CLNA 4MZJA 3TDUA 1Y0VH 4USLA 1KQVA 2LVVA 1TNPA 2ZKMX 1J7PA 3PLFB 5KU1A 1RTP1 1JWDA 1JFJA 3VRRA 4GGNA 3WXAA 1W7IB 1BJFA 1GGWA 4PHJA 1XA5A 1K9PA 1XYDA 1S5GY 3GK2A 2CBLA 1BR4B 2EHBA 2JT3A 3EVRA 4ICBA 2KHNA 2FCDA 2COLB 1KQMC 1CKKA 3EVUA 4ORAB 1BF5A 1UHJA 2D8NA 3VGOA 1S1EA 1QLKA 5D7FA 1AP4A 4U8DA 1B47A 1CTRA 1SCVA 1DF0A 3DVEA 3FIAA 2M97A 3KEVA 1XFYO 2Q91A 2V53A 2HPSA 1F55A 2ZRTA 1B7TZ 1AJ5A 1J1EA 2GV5A 2LVJA 2LUXA 3A8RA 2H61A 1SL8A 2NXQA 3RM1A 1A75B 1PRWA 1JUOA 1LVCD 3I5GC 5D69A 1VRKA 1UUSA 1TTXA 3EKHA 1K9KA 5CPVA 1EG4A 2WCBA 2K7CA 1M45A 1MWNA 4OKHA 5HLVA 2PMYA 1CNPA 4GNKB 3SG6A 1SL7A 3PFVA 2JZIA 2JOJA 4MEWA 4NQGA 1SCMC 2CT9A 1XFVO 2M0RA 4QJ3B 5I8NA 1M39A 4WQ3A 2WNDA 1BLQA 5ER4X 3AKAA 1NPQA 1KK8B 3EK7A 1DGUA 1KFXS 3JTDB 3MSEB 2KFGA 4PALA 2F8PA 1QIWA 1KWOC 2AMIA 2LMVA 2TN4A 4JPZB 2EGDA 4C0KA 4C0JA 1F70A 2JTTA 2FCEA 1K9UA 4QJ5B 2LUCA 1FI6A 1S5GZ 3BUXB 1CLBA 4JWQA 4XJKB 1TRFA 1J7OA 3O4YA 1TNQA 1K94A 1YX7A 2PSRA 1N65A 3LCPC 1SL9A 2M7LA 4I5KA 4P5OE 1IH0A 1EG3A 1M31A 2ZNEA 3M0WA 1OOJA 1S6CA 2I2RE 1JBAA 2MAZA 1UHNA 2WOSA 1J7QA 1KK7Y 1CM4A 2LHLA 1NX1A 2L4IA 2LMUA 1CDLA 1Y1AA 1BMOA 3GK1A 3OX5A 2I94A 2LLUA 3D0YB 1FF1A 4M2OA 4P2YB 2NLNA 1NCZA 2BBMA 2K2FA 2R2IA 2KAVA 4HRHA 4GGFA 2LHIA 3WHTB 4A4CA 5AFPA 2FOTA 1TCOB 1KCYA 1JF0A 4PDZA 5KSZA 3ZWHA 3I5IC 1YUSA 1ZACA 4MZLA 3LK0A 3DF0B 1WDCC 3GOFA 5TNCA 4PE7A 2VRGA 1K93D 1L7ZA 1WRZA 4CIDA 4XJKA 3I5GB 1OMDA 2KQYA 3KF9A 2M8UA 4BY5A 4FQOA 3PALA 2EC6C 1QTXA 1QXPA 3CZTX 1B9AA 2BCXA 5ER5A 2Y5IA 3OP0A 1UURA 4CFQA 2SCPA 4XYNA 1AK8A 2MJWB 1CM1A 5I2OA 1B4CA 2KI4C 4PCWA 4PE4A 1AHRA 1K90D 3VRPA 1SCMB 1IJ6A 1ALWA 1DJXA 3PATA 1ZFSA 1N0YA 3CGAA 4YI9A 2MLEC 2KFHA 3OB1B 3D0YA 4HRGA 2JQ6A 4I5NB 4M2PA 3LLEA 2KSPA 1G8IA 2I7AA 2LNKA 3F45A 1KK7Z 3FWBA 1RWYA 1KWOB 2CTNA 4GAOA 1CFPA 3FWCA 4MLWA 3NSLA 4NDDA 1G33A 2K0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YX8 A;  2Y1M A;  1KSO A;  1YUR A;  3DVM A;  4DRW A;  1SY9 A;  4ZCV A;  1IJ5 A;  2LCP A;  1LXF C;  4OCI A;  1F8H A;  2KNE A;  1DJH A;  5K89 A;  4YRU A;  1QX7 A;  1WLM A;  2O60 A;  3ZNI A;  3CR2 A;  4PE1 A;  2LAP A;  1QIV A;  4HSZ A;  1TIZ A;  1CLM A;  5FYX A;  1ODB A;  5DKN A;  4UPG A;  2BCA A;  1FBV A;  2F33 A;  1V1G A;  3NXA A;  1B1G A;  1YUU A;  1CDP A;  1QVI Z;  1X02 A;  4PHN A;  1JF2 A;  1FI5 A;  4OV2 A;  1J7R A;  3AKB A;  3I5I B;  1BOD A;  3WNX B;  4BY4 A;  2F3Z A;  1NCX A;  1WDC B;  4YI8 A;  1EXR A;  1IQ3 A;  1OZO A;  2KGB C;  2Y4Q A;  2KBM A;  4DCK A;  2RGI A;  3JVT C;  1RRO A;  3I5F C;  4YGA A;  2CNP A;  3QRX A;  2EC6 B;  1ZUZ A;  3TUY C;  1EH2 A;  2KYF A;  4YGD B;  4DUQ A;  1MXL C;  2KAY A;  1NP8 A;  3GK4 X;  3VRN A;  3WHU B;  5CSI A;  1DJG A;  3CS1 A;  2KI4 B;  2CCM A;  4ETO A;  2M7N A;  4ORB B;  4ZCU A;  3SG5 A;  1ALV A;  1A75 A;  1L2O C;  1U5I B;  3LK1 A;  5JOL A;  1FW4 A;  2LMT A;  2F3Y A;  2L2E A;  2IS9 A;  2ZND A;  1WRL A;  4CFR A;  3C1V A;  3NSO A;  1EJ3 A;  1TNX A;  2K61 A;  3BXK A;  1F4O A;  1XK4 A;  1DJZ A;  4MSP A;  1Y6W A;  2LP2 A;  1PSR A;  2L50 A;  2OTG C;  2JT0 A;  3SJS A;  2JT8 A;  3CTN A;  4MBE A;  1PVB A;  5HLO A;  1GJY A;  2B1U A;  2L0P A;  2NZ0 A;  4DS7 A;  1UWO A;  2JWW A;  1DJW A;  3I5H C;  2PAS A;  4WRI A;  1MUX A;  1D1O A;  2MA2 A;  1OE9 B;  1ZMZ A;  3KO0 A;  2KQ6 A;  2SAS A;  1LIN A;  1KQM B;  1HT9 A;  5HKZ A;  3VRQ A;  2HET A;  3DVK A;  2O5G A;  1RK9 A;  1ZOT B;  2JPT A;  1IGV A;  1OSA A;  2E6W A;  1MQ1 A;  1KFU L;  1NCY A;  1QAS A;  1REC A;  1XVJ A;  1DTL A;  2BBN A;  1SW8 A;  3H4S E;  1CB1 A;  1QLS A;  2BKH B;  3IQO A;  4GUK A;  2P6B B;  1BOC A;  2CXJ A;  1B8R A;  1E8A A;  1TNW A;  1CFF A;  1AUI B;  1SRA A;  4MN0 A;  1SNL A;  1DGV A;  2H2K A;  2LAN A;  1F71 A;  5AXI A;  1PK0 D;  4E68 A;  1PAL A;  1GGZ A;  1SKT A;  1IG5 A;  2DOQ A;  1A29 A;  1CLL A;  3A4U B;  2JNF A;  3TDZ A;  4DIR A;  1IKU A;  2KOT A;  4PE0 A;  1A2X A;  1B7T Y;  3SIA A;  1TOP A;  2KBI A;  5DKR A;  4GGF C;  1UHK A;  3JVT B;  1JC2 A;  2JRF A;  2L5X B;  3I5F B;  4CLN A;  1UHH A;  4JQ0 D;  5I2L A;  1LA0 A;  3EK8 A;  3TUY B;  1DF0 B;  3EVV A;  4N1F A;  2FJU B;  3VRO A;  1OMV A;  2K8M B;  4MRY A;  4AQJ A;  2OPO A;  2HQW A;  2L4H A;  4R1E A;  1WLZ A;  1XO5 A;  3D10 A;  1S3P A;  3IF7 A;  3BOW B;  1HQV A;  2LM5 A;  2MLF C;  4CPV A;  3DF0 A;  2F2O A;  1Q80 A;  5KTY A;  1XFZ O;  2AUC A;  2PVB A;  1SBJ A;  4Q04 A;  1K2H A;  1L2O B;  1YRT B;  4ORC B;  2WCE A;  2ZN8 A;  2OS8 C;  2QAC A;  1V1F A;  3FS7 A;  2E30 A;  1NSH A;  1IQ5 A;  3PSR A;  5B8I B;  1CFC A;  1XFX O;  4F0Z B;  1PUL A;  1OZS A;  2KFF A;  1DJY A;  4I5J A;  1TN4 A;  2ZN9 A;  2OTG B;  4MVF A;  5CSJ A;  1XFU O;  2BL0 C;  1H8B A;  1F54 A;  1CFD A;  1SYM A;  3OHM B;  3TS5 C;  2K7D A;  1WY9 A;  2LV7 A;  2M1U A;  4GBA A;  3I5H B;  1KFU S;  3AAJ A;  4NDC A;  1NIW A;  3BUM B;  3RLZ A;  2BE4 A;  2L51 A;  1RFJ A;  4PHK A;  4M2Q A;  3TZ1 A;  3BYA A;  5JJG A;  4NDB A;  4GPL B;  4OR9 B;  3OB2 B;  2JUL A;  2LVK A;  1G4Y R;  1YR5 A;  1NX2 A;  1PSB A;  2M49 B;  3BQ3 A;  1K96 A;  1S26 D;  1Y1X A;  4YGC B;  2K7B A;  1IWQ A;  3K21 A;  1EL4 A;  3O6B A;  1DMO A;  2Q4U A;  5BPJ A;  3PM8 A;  2WC8 A;  2K2A A;  3PN7 C;  2HF5 A;  2JTZ A;  2KYC A;  3BOW A;  4HRE E;  1A03 A;  4D1E A;  1CMF A;  1GQM A;  3DVJ A;  1S6J A;  1W7J B;  3CR4 X;  1FPW A;  2NCP A;  1C07 A;  4L9M A;  1WRK A;  1JFK A;  4YGE B;  2AAO A;  1R2U A;  1QAT A;  1QV0 A;  3ICB A;  4AOM A;  2F2P A;  1BT6 A;  2LVI A;  2H61 C;  3KHE A;  1N2D A;  3E3R A;  1KSM A;  2LLS A;  4FTG A;  1LA3 A;  5G08 A;  3SG3 A;  2JXC A;  4C0L A;  5HKY A;  1H4B A;  2KAX A;  5DKQ A;  1NYA A;  1S6I A;  3TDI A;  1SPY A;  3CR5 X;  2ZFD A;  3O2P A;  4QJ4 B;  1SR6 C;  1XFW O;  4N1G A;  1C7W A;  2LP3 A;  3LL8 B;  1NX0 A;  2BKI B;  2JU0 A;  1JSA A;  5J3X A;  1S36 A;  2BEC A;  2MRD A;  3NSI A;  5AEQ A;  5HYD A;  2QPT A;  1NWD A;  3O78 A;  1YRU B;  3NSK A;  1BR1 B;  2LLT A;  3AAK A;  1A4P A;  2KI6 C;  2M1K B;  1YUT A;  1K8U A;  1LKJ A;  1BU3 A;  2M29 A;  1OMR A;  3KPX A;  3OX6 A;  2I18 A;  1CDM A;  1SK6 D;  2G2B A;  2HQ8 A;  2OS8 B;  3EK4 A;  5CSF A;  1AJ4 A;  5GQQ C;  4YGB B;  1YTZ C;  2GGZ A;  2JNX A;  2JXL A;  1C7V A;  2LE9 B;  4WQ2 A;  1CDN A;  1UP5 A;  1PVA A;  2BL0 B;  1QS7 A;  1MF8 B;  3CWG A;  4GFT A;  3SIB A;  3SG7 A;  3TS5 B;  4AQI A;  2MBX A;  2ZRS A;  4A4B A;  1YVH A;  4I5L B;  1U5I A;  2KI6 D;  4N5X A;  1MHO A;  1QX2 A;  2GGM A;  1XK4 C;  2JC2 A;  1TCF A;  1B8L A;  4MZK A;  2G9B A;  1DVI A;  1MXE A;  1M46 A;  3EKJ A;  5HKW A;  1DT7 B;  5IBW A;  4TNC A;  1J1D A;  1BG1 A;  5AER A;  2K7O A;  1K95 A;  3BUN B;  1F4Q A;  4MRX A;  1IRJ A;  1AVS A;  1Y1U A;  2WOR A;  2M9G A;  1YVL A;  1R6P A;  3PN7 B;  2A4J A;  4IL1 A;  1M63 B;  2BCB A;  5I2Q A;  1KK8 C;  3BUW B;  1B8C A;  1DJI A;  4OVN F;  2MHH A;  4YBH B;  3DD4 A;  3HCM A;  1CMG A;  1J55 A;  1SMG A;  3JTD C;  3SG2 A;  1NX3 A;  2NCO A;  5AAN A;  3BUO B;  1QVI Y;  1UHI A;  2Y1N A;  1NUB A;  2ISD A;  1QX5 B;  2KDH A;  2WCF A;  1QV1 A;  2L98 A;  1QJT A;  1MR8 A;  2LC5 A;  3HX4 A;  1OQP A;  2KGR A;  5PAL A;  3SG4 A;  1KFX L;  1SR6 B;  3IQQ A;  4PHM A;  1RJV A;  5F6T A;  2M3W A;  5CSN A;  2PAL A;  2BE6 A;  2PRU A;  3CLN A;  4MZJ A;  3TDU A;  1Y0V H;  4USL A;  1KQV A;  2LVV A;  1TNP A;  2ZKM X;  1J7P A;  3PLF B;  5KU1 A;  1RTP 1;  1JWD A;  1JFJ A;  3VRR A;  4GGN A;  3WXA A;  1W7I B;  1BJF A;  1GGW A;  4PHJ A;  1XA5 A;  1K9P A;  1XYD A;  1S5G Y;  3GK2 A;  2CBL A;  1BR4 B;  2EHB A;  2JT3 A;  3EVR A;  4ICB A;  2KHN A;  2FCD A;  2COL B;  1KQM C;  1CKK A;  3EVU A;  4ORA B;  1BF5 A;  1UHJ A;  2D8N A;  3VGO A;  1S1E A;  1QLK A;  5D7F A;  1AP4 A;  4U8D A;  1B47 A;  1CTR A;  1SCV A;  1DF0 A;  3DVE A;  3FIA A;  2M97 A;  3KEV A;  1XFY O;  2Q91 A;  2V53 A;  2HPS A;  1F55 A;  2ZRT A;  1B7T Z;  1AJ5 A;  1J1E A;  2GV5 A;  2LVJ A;  2LUX A;  3A8R A;  2H61 A;  1SL8 A;  2NXQ A;  3RM1 A;  1A75 B;  1PRW A;  1JUO A;  1LVC D;  3I5G C;  5D69 A;  1VRK A;  1UUS A;  1TTX A;  3EKH A;  1K9K A;  5CPV A;  1EG4 A;  2WCB A;  2K7C A;  1M45 A;  1MWN A;  4OKH A;  5HLV A;  2PMY A;  1CNP A;  4GNK B;  3SG6 A;  1SL7 A;  3PFV A;  2JZI A;  2JOJ A;  4MEW A;  4NQG A;  1SCM C;  2CT9 A;  1XFV O;  2M0R A;  4QJ3 B;  5I8N A;  1M39 A;  4WQ3 A;  2WND A;  1BLQ A;  5ER4 X;  3AKA A;  1NPQ A;  1KK8 B;  3EK7 A;  1DGU A;  1KFX S;  3JTD B;  3MSE B;  2KFG A;  4PAL A;  2F8P A;  1QIW A;  1KWO C;  2AMI A;  2LMV A;  2TN4 A;  4JPZ B;  2EGD A;  4C0K A;  4C0J A;  1F70 A;  2JTT A;  2FCE A;  1K9U A;  4QJ5 B;  2LUC A;  1FI6 A;  1S5G Z;  3BUX B;  1CLB A;  4JWQ A;  4XJK B;  1TRF A;  1J7O A;  3O4Y A;  1TNQ A;  1K94 A;  1YX7 A;  2PSR A;  1N65 A;  3LCP C;  1SL9 A;  2M7L A;  4I5K A;  4P5O E;  1IH0 A;  1EG3 A;  1M31 A;  2ZNE A;  3M0W A;  1OOJ A;  1S6C A;  2I2R E;  1JBA A;  2MAZ A;  1UHN A;  2WOS A;  1J7Q A;  1KK7 Y;  1CM4 A;  2LHL A;  1NX1 A;  2L4I A;  2LMU A;  1CDL A;  1Y1A A;  1BMO A;  3GK1 A;  3OX5 A;  2I94 A;  2LLU A;  3D0Y B;  1FF1 A;  4M2O A;  4P2Y B;  2NLN A;  1NCZ A;  2BBM A;  2K2F A;  2R2I A;  2KAV A;  4HRH A;  4GGF A;  2LHI A;  3WHT B;  4A4C A;  5AFP A;  2FOT A;  1TCO B;  1KCY A;  1JF0 A;  4PDZ A;  5KSZ A;  3ZWH A;  3I5I C;  1YUS A;  1ZAC A;  4MZL A;  3LK0 A;  3DF0 B;  1WDC C;  3GOF A;  5TNC A;  4PE7 A;  2VRG A;  1K93 D;  1L7Z A;  1WRZ A;  4CID A;  4XJK A;  3I5G B;  1OMD A;  2KQY A;  3KF9 A;  2M8U A;  4BY5 A;  4FQO A;  3PAL A;  2EC6 C;  1QTX A;  1QXP A;  3CZT X;  1B9A A;  2BCX A;  5ER5 A;  2Y5I A;  3OP0 A;  1UUR A;  4CFQ A;  2SCP A;  4XYN A;  1AK8 A;  2MJW B;  1CM1 A;  5I2O A;  1B4C A;  2KI4 C;  4PCW A;  4PE4 A;  1AHR A;  1K90 D;  3VRP A;  1SCM B;  1IJ6 A;  1ALW A;  1DJX A;  3PAT A;  1ZFS A;  1N0Y A;  3CGA A;  4YI9 A;  2MLE C;  2KFH A;  3OB1 B;  3D0Y A;  4HRG A;  2JQ6 A;  4I5N B;  4M2P A;  3LLE A;  2KSP A;  1G8I A;  2I7A A;  2LNK A;  3F45 A;  1KK7 Z;  3FWB A;  1RWY A;  1KWO B;  2CTN A;  4GAO A;  1CFP A;  3FWC A;  4MLW A;  3NSL A;  4NDD A;  1G33 A;  2K0J A; 
#chains in the Genus database with same CATH topology
 1YX8 A;  2Y1M A;  1KSO A;  2QEB A;  5FI2 A;  1YUR A;  3DVM A;  4DRW A;  1SY9 A;  4ZCV A;  1OW4 A;  1IJ5 A;  2LCP A;  1LXF C;  4OCI A;  1F8H A;  2KNE A;  1DJH A;  3DYE A;  5K89 A;  4YRU A;  1QX7 A;  1WLM A;  2O60 A;  3S0F A;  3ZNI A;  3CR2 A;  4PE1 A;  2LAP A;  1QIV A;  4HSZ A;  1TIZ A;  1CLM A;  5FYX A;  1ODB A;  5DKN A;  4UPG A;  2BCA A;  3UNW A;  1FBV A;  2F33 A;  1V1G A;  3NXA A;  3OBV A;  5DIC A;  1B1G A;  1YUU A;  1CDP A;  1QVI Z;  1X02 A;  2PQL A;  1JF2 A;  3EG5 B;  4OV2 A;  4PHN A;  1FI5 A;  1J7R A;  3AKB A;  3I5I B;  1BOD A;  3WNX B;  3CAB A;  3B87 A;  4BY4 A;  2F3Z A;  3DZT A;  1NCX A;  1WDC B;  4YI8 A;  1EXR A;  1IQ3 A;  1OZO A;  3VB1 A;  2KGB C;  2Y4Q A;  2KBM A;  4DCK A;  2RGI A;  3JVT C;  3D75 A;  2ERB A;  1RRO A;  3I5F C;  4YGA A;  2CNP A;  3QRX A;  2EC6 B;  3B86 A;  1ZUZ A;  3TUY C;  1EH2 A;  2KYF A;  4YGD B;  4DUQ A;  1MXL C;  3SS3 A;  2KAY A;  1NP8 A;  3GK4 X;  3VRN A;  3WHU B;  5CSI A;  1DJG A;  3CS1 A;  2KI4 B;  3CYZ A;  2CCM A;  4ETO A;  3DY9 A;  2M7N A;  4ORB B;  4ZCU A;  3SG5 A;  1ALV A;  1A75 A;  1L2O C;  1SSE B;  1U5I B;  3LK1 A;  5JOL A;  1FW4 A;  2LMT A;  2F3Y A;  2L2E A;  2IS9 A;  2ZND A;  1WRL A;  4CFR A;  3C1V A;  3NSO A;  1EJ3 A;  1TNX A;  2K61 A;  3BXK A;  1F4O A;  3D77 A;  1XK4 A;  1DJZ A;  4MSP A;  1Y6W A;  2LP2 A;  1PSR A;  2L50 A;  2OTG C;  2JT0 A;  3SJS A;  2JT8 A;  3CTN A;  4FQT A;  1PVB A;  4MBE A;  5HLO A;  1GJY A;  2B1U A;  2L0P A;  2NZ0 A;  3PM2 A;  1UWO A;  2JWW A;  4DS7 A;  1DJW A;  3I5H C;  2PAS A;  4WRI A;  1MUX A;  1D1O A;  2MA2 A;  1OE9 B;  1ZMZ A;  3KO0 A;  2KQ6 A;  2SAS A;  1LIN A;  3D73 A;  1KQM B;  2WCH A;  1HT9 A;  5HKZ A;  3VRQ A;  2HET A;  3DVK A;  2O5G A;  1RK9 A;  1ZOT B;  2JPT A;  3K1E A;  1IGV A;  1OSA A;  2E6W A;  1MQ1 A;  1XFR A;  1KFU L;  1NCY A;  1QAS A;  1REC A;  1XVJ A;  1DTL A;  2BBN A;  1SW8 A;  3H4S E;  1CB1 A;  1QLS A;  2BKH B;  3IQO A;  4GUK A;  2P6B B;  1BOC A;  3BFA A;  2CXJ A;  1B8R A;  2WC5 A;  1E8A A;  1TNW A;  1CFF A;  1AUI B;  1SRA A;  4MN0 A;  2WC6 A;  3S0E A;  1SNL A;  1DGV A;  2H2K A;  2LAN A;  1F71 A;  3L47 A;  3R1P A;  5AXI A;  1PK0 D;  4E68 A;  1PAL A;  1GGZ A;  1SKT A;  1IG5 A;  1GM0 A;  5I94 A;  2DOQ A;  1A29 A;  1CLL A;  3A4U B;  2JNF A;  3TDZ A;  4DIR A;  1IKU A;  2KOT A;  4INW A;  1A2X A;  1B7T Y;  4PE0 A;  1TOP A;  2KBI A;  3SIA A;  5DKR A;  4GGF C;  1UHK A;  3N7H A;  3JVT B;  1JC2 A;  1DEL A;  2JRF A;  2KPH A;  2L5X B;  3I5F B;  4CLN A;  1UHH A;  4JQ0 D;  5I2L A;  3S0B A;  1LA0 A;  3EK8 A;  3TUY B;  3RZS A;  1DF0 B;  3EVV A;  4N1F A;  2FJU B;  3VRO A;  1OMV A;  2K8M B;  4MRY A;  4AQJ A;  2OPO A;  2HQW A;  2L4H A;  4R1E A;  2P71 A;  1WLZ A;  1XO5 A;  3D10 A;  1S3P A;  3IF7 A;  3O4X A;  3BOW B;  1HQV A;  2LM5 A;  2MLF C;  4CPV A;  3DF0 A;  2F2O A;  3DXL A;  1Q80 A;  5KTY A;  1XFZ O;  2AUC A;  1TUZ A;  2PVB A;  1SBJ A;  4Q04 A;  3UO9 A;  1K2H A;  1L2O B;  1YRT B;  4ORC B;  2WCE A;  2QEV A;  2OS8 C;  2ZN8 A;  3B6X A;  2QAC A;  5FI6 A;  1V1F A;  3CZ0 A;  3FS7 A;  2E30 A;  1NSH A;  1IQ5 A;  3PSR A;  5B8I B;  1CFC A;  1XFX O;  4F0Z B;  1PUL A;  1OZS A;  2FJY A;  2KFF A;  1DJY A;  4I5J A;  1TN4 A;  2ZN9 A;  2OTG B;  4MVF A;  5CSJ A;  1XFU O;  2BL0 C;  1H8B A;  1F54 A;  1CFD A;  1SYM A;  3OHM B;  3TS5 C;  2K7D A;  1WY9 A;  2LV7 A;  2M1U A;  4GBA A;  3I5H B;  1KFU S;  3AAJ A;  1QWV A;  4NDC A;  1NIW A;  3BUM B;  3RLZ A;  2BE4 A;  2L51 A;  4KYN A;  1RFJ A;  4PHK A;  4M2Q A;  3TZ1 A;  3BYA A;  1LS8 A;  4NDB A;  3S0G A;  3D78 A;  4GPL B;  3OB2 B;  4OR9 B;  5JJG A;  2JUL A;  2LVK A;  1G4Y R;  1YR5 A;  1NX2 A;  1PSB A;  2M49 B;  3BQ3 A;  1K96 A;  1S26 D;  1OOH A;  1Y1X A;  2K7B A;  4YGC B;  1OOG A;  1IWQ A;  3SS5 A;  3K21 A;  1EL4 A;  3O6B A;  1DMO A;  2Q4U A;  1C3Y A;  5BPJ A;  3PM8 A;  2WC8 A;  2K2A A;  3PN7 C;  2HF5 A;  2JTZ A;  2KYC A;  3BOW A;  4HRE E;  1A03 A;  4D1E A;  1CMF A;  1GQM A;  3DVJ A;  1S6J A;  1W7J B;  3CR4 X;  1FPW A;  5EL2 A;  2NCP A;  1C07 A;  4L9M A;  1WRK A;  3R1O A;  1JFK A;  4YGE B;  2AAO A;  1R2U A;  1QAT A;  1QV0 A;  3ICB A;  4AOM A;  2F2P A;  1BT6 A;  2LVI A;  2H61 C;  3KHE A;  1N2D A;  3E3R A;  1KSM A;  3B88 A;  2LLS A;  4FTG A;  1LA3 A;  5G08 A;  3SG3 A;  2JXC A;  4C0L A;  5HKY A;  1H4B A;  2KAX A;  5DKQ A;  1NYA A;  1Z2C B;  1S6I A;  3TDI A;  1SPY A;  3CR5 X;  2ZFD A;  3O2P A;  4QJ4 B;  1SR6 C;  1XFW O;  4N1G A;  1C7W A;  2LP3 A;  3LL8 B;  1NX0 A;  2BKI B;  2JU0 A;  1JSA A;  5J3X A;  1S36 A;  2BEC A;  2MRD A;  3NSI A;  4INX A;  5AEQ A;  5HYD A;  2QPT A;  1NWD A;  3O78 A;  1YRU B;  3NSK A;  3S0A A;  1BR1 B;  2LLT A;  3AAK A;  1A4P A;  2KI6 C;  2M1K B;  1YUT A;  1K8U A;  1LKJ A;  1BU3 A;  2M29 A;  1OMR A;  3KPX A;  3OX6 A;  2I18 A;  1CDM A;  1SK6 D;  3NHT A;  2G2B A;  2HQ8 A;  2OS8 B;  2P70 A;  2QEH A;  3EK4 A;  5CSF A;  3NHI A;  1AJ4 A;  1OOF A;  5GQQ C;  4YGB B;  1YTZ C;  2GGZ A;  2JNX A;  2JXL A;  1C7V A;  3BFH A;  3IVT A;  2LE9 B;  3OGN A;  4WQ2 A;  1CDN A;  1UP5 A;  1PVA A;  2BL0 B;  1QS7 A;  1MF8 B;  3CWG A;  4GFT A;  3SIB A;  3SG7 A;  3TS5 B;  4AQI A;  2MBX A;  2KLD A;  2ZRS A;  4A4B A;  1YVH A;  4I5L B;  3FE9 A;  1U5I A;  2KI6 D;  4N5X A;  1MHO A;  1QX2 A;  2GGM A;  1XK4 C;  2JC2 A;  3V2L A;  1TCF A;  1B8L A;  4MZK A;  2G9B A;  1DVI A;  1MXE A;  1M46 A;  3EKJ A;  5HKW A;  1DT7 B;  2L2C A;  5IBW A;  4TNC A;  1J1D A;  1BG1 A;  3R1V A;  2GTE A;  2K7O A;  5AER A;  1K95 A;  1C3Z A;  3BUN B;  1F4Q A;  4MRX A;  1IRJ A;  1AVS A;  1Y1U A;  2WOR A;  2M9G A;  1YVL A;  1R6P A;  3PN7 B;  2A4J A;  4IL1 A;  1M63 B;  2BCB A;  5I2Q A;  1KK8 C;  3BUW B;  1B8C A;  1DJI A;  4OVN F;  2MHH A;  3FE6 A;  4YBH B;  3DD4 A;  3HCM A;  1CMG A;  1OOI X;  1J55 A;  1SMG A;  2H8V A;  3JTD C;  3SG2 A;  1NX3 A;  2NCO A;  5AAN A;  3BUO B;  1QVI Y;  1UHI A;  1TWO A;  2BNX A;  2Y1N A;  1NUB A;  2ISD A;  1QX5 B;  2KDH A;  2WCF A;  3SS4 A;  1QV1 A;  2L98 A;  1QJT A;  1MR8 A;  2LC5 A;  3HX4 A;  1OQP A;  2KGR A;  5PAL A;  3SG4 A;  1KFX L;  1SR6 B;  3IQQ A;  4PHM A;  1RJV A;  5F6T A;  2M3W A;  5CSN A;  2PAL A;  4IJ7 A;  3BFB A;  2BE6 A;  2PRU A;  3CLN A;  4MZJ A;  3TDU A;  1Y0V H;  4USL A;  1KQV A;  2LVV A;  1TNP A;  2ZKM X;  1J7P A;  3PLF B;  5KU1 A;  1RTP 1;  1JWD A;  1JFJ A;  3VRR A;  4GGN A;  3B7A A;  3WXA A;  1W7I B;  1BJF A;  3NGV A;  1GGW A;  4PHJ A;  1XA5 A;  1K9P A;  1XYD A;  1S5G Y;  3GK2 A;  2CBL A;  1BR4 B;  2EHB A;  2JT3 A;  3EVR A;  4ICB A;  3CDN A;  2KHN A;  2FCD A;  2COL B;  1KQM C;  1CKK A;  3EVU A;  3R72 A;  4ORA B;  1UHJ A;  2D8N A;  3FE8 A;  1S1E A;  1QLK A;  5D7F A;  3VGO A;  1DC1 A;  4U8D A;  3L4A A;  1B47 A;  1CTR A;  1SCV A;  1DF0 A;  3DVE A;  3FIA A;  2M97 A;  3KEV A;  1XFY O;  2Q91 A;  2V53 A;  4F7F A;  2HPS A;  1F55 A;  2YGU A;  2ZRT A;  3CZ2 A;  1B7T Z;  1AJ5 A;  1J1E A;  2GV5 A;  2LVJ A;  2QEO A;  4PT1 A;  2LUX A;  3A8R A;  2H61 A;  1SL8 A;  2NXQ A;  3RM1 A;  1A75 B;  1PRW A;  1JUO A;  1LVC D;  3I5G C;  5D69 A;  1VRK A;  3Q8I A;  1UUS A;  1TTX A;  3EKH A;  1K9K A;  5CPV A;  1EG4 A;  2WCB A;  2WCM A;  2K7C A;  3D76 A;  1W9Z A;  1M45 A;  1MWN A;  4OKH A;  2JPO A;  2PMY A;  5HLV A;  1CNP A;  3PJI A;  4GNK B;  3SG6 A;  5D3O A;  1SL7 A;  3PFV A;  1DQE A;  2JZI A;  2JOJ A;  4MEW A;  4NQG A;  3S0D A;  1SCM C;  2CT9 A;  1XFV O;  2M0R A;  4QJ3 B;  5I8N A;  1M39 A;  1ORG A;  4WQ3 A;  2WND A;  1BLQ A;  1T14 A;  5ER4 X;  3AKA A;  1NPQ A;  1KK8 B;  3EK7 A;  1DGU A;  1KFX S;  4JD9 A;  3JTD B;  3MSE B;  2KFG A;  4PAL A;  2F8P A;  1QIW A;  1KWO C;  2AMI A;  2LMV A;  2TN4 A;  4JPZ B;  1P28 A;  2EGD A;  4C0K A;  1DEK A;  2JTT A;  4C0J A;  2FCE A;  1K9U A;  4QJ5 B;  3QME A;  2LUC A;  1FI6 A;  1S5G Z;  3BUX B;  1CLB A;  4JKT A;  4JWQ A;  1TRF A;  4XJK B;  1J7O A;  3O4Y A;  1TNQ A;  1AP4 A;  1K94 A;  1YX7 A;  2PSR A;  1N65 A;  3LCP C;  2WCK A;  1SL9 A;  2M7L A;  4I5K A;  2KLE A;  4P5O E;  1EG3 A;  1IH0 A;  1M31 A;  2ZNE A;  3M0W A;  1OOJ A;  1S6C A;  2I2R E;  1JBA A;  2MAZ A;  1UHN A;  2WOS A;  1J7Q A;  2QDI A;  1KK7 Y;  1CM4 A;  2LHL A;  2WCJ A;  1NX1 A;  2BAP A;  2L4I A;  2LMU A;  1CDL A;  1Y1A A;  1BMO A;  3GK1 A;  3OX5 A;  1F70 A;  2I94 A;  2LLU A;  3D0Y B;  1FF1 A;  4M2O A;  4P2Y B;  2NLN A;  1TUJ A;  1NCZ A;  2BBM A;  2K2F A;  2R2I A;  2KAV A;  4HRH A;  4GGF A;  2LHI A;  3WHT B;  4A4C A;  2L5Y A;  2FOT A;  1TCO B;  5AFP A;  1KCY A;  1JF0 A;  1BF5 A;  4PDZ A;  5KSZ A;  3ZWH A;  3I5I C;  3L4L A;  1YUS A;  1ZAC A;  4MZL A;  3LK0 A;  3DF0 B;  5FI7 A;  1WDC C;  3GOF A;  5HL1 A;  5TNC A;  4PE7 A;  2VRG A;  1K93 D;  1L7Z A;  1WRZ A;  1IIO A;  4CID A;  2PYQ A;  3I5G B;  4XJK A;  1OMD A;  2KQY A;  3KF9 A;  2M8U A;  4BY5 A;  4FQO A;  3PAL A;  2EC6 C;  4OZD A;  1QTX A;  1QXP A;  3CZT X;  1B9A A;  2BCX A;  5ER5 A;  2Y5I A;  3OP0 A;  1UUR A;  4CFQ A;  2SCP A;  4XYN A;  1AK8 A;  2MJW B;  1CM1 A;  5I2O A;  1B4C A;  2KI4 C;  4PCW A;  4PE4 A;  1AHR A;  2K60 A;  1K90 D;  3VRP A;  1SCM B;  1IJ6 A;  1ALW A;  1DJX A;  3PAT A;  1ZFS A;  1N0Y A;  3CGA A;  4YI9 A;  2MLE C;  2KFH A;  3OB1 B;  3D0Y A;  4HRG A;  2JQ6 A;  4I5N B;  4M2P A;  3LLE A;  1Z4H A;  2KSP A;  3D74 A;  1G8I A;  2I7A A;  2LNK A;  3F45 A;  1KK7 Z;  3FWB A;  1RWY A;  1KWO B;  3CZ1 A;  2WCL A;  2CTN A;  4GAO A;  1CFP A;  3BJH A;  3FWC A;  4MLW A;  3NSL A;  4NDD A;  1G33 A;  2K0J A; 
#chains in the Genus database with same CATH homology
 1YX8 A;  2Y1M A;  1KSO A;  1YUR A;  3DVM A;  4DRW A;  1SY9 A;  4ZCV A;  1IJ5 A;  2LCP A;  1LXF C;  4OCI A;  1F8H A;  2KNE A;  1DJH A;  5K89 A;  4YRU A;  1QX7 A;  1WLM A;  2O60 A;  3ZNI A;  3CR2 A;  4PE1 A;  2LAP A;  1QIV A;  4HSZ A;  1TIZ A;  1CLM A;  5FYX A;  1ODB A;  5DKN A;  4UPG A;  2BCA A;  1FBV A;  2F33 A;  1V1G A;  3NXA A;  1B1G A;  1YUU A;  1CDP A;  1QVI Z;  1X02 A;  4PHN A;  1JF2 A;  1FI5 A;  4OV2 A;  1J7R A;  3AKB A;  3I5I B;  1BOD A;  3WNX B;  4BY4 A;  2F3Z A;  1NCX A;  1WDC B;  4YI8 A;  1EXR A;  1IQ3 A;  1OZO A;  2KGB C;  2Y4Q A;  2KBM A;  4DCK A;  2RGI A;  3JVT C;  1RRO A;  3I5F C;  4YGA A;  2CNP A;  3QRX A;  2EC6 B;  1ZUZ A;  3TUY C;  1EH2 A;  2KYF A;  4YGD B;  4DUQ A;  1MXL C;  2KAY A;  1NP8 A;  3GK4 X;  3VRN A;  3WHU B;  5CSI A;  1DJG A;  3CS1 A;  2KI4 B;  2CCM A;  4ETO A;  2M7N A;  4ORB B;  4ZCU A;  3SG5 A;  1ALV A;  1A75 A;  1L2O C;  1U5I B;  3LK1 A;  5JOL A;  1FW4 A;  2LMT A;  2F3Y A;  2L2E A;  2IS9 A;  2ZND A;  1WRL A;  4CFR A;  3C1V A;  3NSO A;  1EJ3 A;  1TNX A;  2K61 A;  3BXK A;  1F4O A;  1XK4 A;  1DJZ A;  4MSP A;  1Y6W A;  2LP2 A;  1PSR A;  2L50 A;  2OTG C;  2JT0 A;  3SJS A;  2JT8 A;  3CTN A;  4MBE A;  1PVB A;  5HLO A;  1GJY A;  2B1U A;  2L0P A;  2NZ0 A;  4DS7 A;  1UWO A;  2JWW A;  1DJW A;  3I5H C;  2PAS A;  4WRI A;  1MUX A;  1D1O A;  2MA2 A;  1OE9 B;  1ZMZ A;  3KO0 A;  2KQ6 A;  2SAS A;  1LIN A;  1KQM B;  1HT9 A;  5HKZ A;  3VRQ A;  2HET A;  3DVK A;  2O5G A;  1RK9 A;  1ZOT B;  2JPT A;  1IGV A;  1OSA A;  2E6W A;  1MQ1 A;  1KFU L;  1NCY A;  1QAS A;  1REC A;  1XVJ A;  1DTL A;  2BBN A;  1SW8 A;  3H4S E;  1CB1 A;  1QLS A;  2BKH B;  3IQO A;  4GUK A;  2P6B B;  1BOC A;  2CXJ A;  1B8R A;  1E8A A;  1TNW A;  1CFF A;  1AUI B;  1SRA A;  4MN0 A;  1SNL A;  1DGV A;  2H2K A;  2LAN A;  1F71 A;  5AXI A;  1PK0 D;  4E68 A;  1PAL A;  1GGZ A;  1SKT A;  1IG5 A;  2DOQ A;  1A29 A;  1CLL A;  3A4U B;  2JNF A;  3TDZ A;  4DIR A;  1IKU A;  2KOT A;  4PE0 A;  1A2X A;  1B7T Y;  3SIA A;  1TOP A;  2KBI A;  5DKR A;  4GGF C;  1UHK A;  3JVT B;  1JC2 A;  2JRF A;  2L5X B;  3I5F B;  4CLN A;  1UHH A;  4JQ0 D;  5I2L A;  1LA0 A;  3EK8 A;  3TUY B;  1DF0 B;  3EVV A;  4N1F A;  2FJU B;  3VRO A;  1OMV A;  2K8M B;  4MRY A;  4AQJ A;  2OPO A;  2HQW A;  2L4H A;  4R1E A;  1WLZ A;  1XO5 A;  3D10 A;  1S3P A;  3IF7 A;  3BOW B;  1HQV A;  2LM5 A;  2MLF C;  4CPV A;  3DF0 A;  2F2O A;  1Q80 A;  5KTY A;  1XFZ O;  2AUC A;  2PVB A;  1SBJ A;  4Q04 A;  1K2H A;  1L2O B;  1YRT B;  4ORC B;  2WCE A;  2ZN8 A;  2OS8 C;  2QAC A;  1V1F A;  3FS7 A;  2E30 A;  1NSH A;  1IQ5 A;  3PSR A;  5B8I B;  1CFC A;  1XFX O;  4F0Z B;  1PUL A;  1OZS A;  2KFF A;  1DJY A;  4I5J A;  1TN4 A;  2ZN9 A;  2OTG B;  4MVF A;  5CSJ A;  1XFU O;  2BL0 C;  1H8B A;  1F54 A;  1CFD A;  1SYM A;  3OHM B;  3TS5 C;  2K7D A;  1WY9 A;  2LV7 A;  2M1U A;  4GBA A;  3I5H B;  1KFU S;  3AAJ A;  4NDC A;  1NIW A;  3BUM B;  3RLZ A;  2BE4 A;  2L51 A;  1RFJ A;  4PHK A;  4M2Q A;  3TZ1 A;  3BYA A;  5JJG A;  4NDB A;  4GPL B;  4OR9 B;  3OB2 B;  2JUL A;  2LVK A;  1G4Y R;  1YR5 A;  1NX2 A;  1PSB A;  2M49 B;  3BQ3 A;  1K96 A;  1S26 D;  1Y1X A;  4YGC B;  2K7B A;  1IWQ A;  3K21 A;  1EL4 A;  3O6B A;  1DMO A;  2Q4U A;  5BPJ A;  3PM8 A;  2WC8 A;  2K2A A;  3PN7 C;  2HF5 A;  2JTZ A;  2KYC A;  3BOW A;  4HRE E;  1A03 A;  4D1E A;  1CMF A;  1GQM A;  3DVJ A;  1S6J A;  1W7J B;  3CR4 X;  1FPW A;  2NCP A;  1C07 A;  4L9M A;  1WRK A;  1JFK A;  4YGE B;  2AAO A;  1R2U A;  1QAT A;  1QV0 A;  3ICB A;  4AOM A;  2F2P A;  1BT6 A;  2LVI A;  2H61 C;  3KHE A;  1N2D A;  3E3R A;  1KSM A;  2LLS A;  4FTG A;  1LA3 A;  5G08 A;  3SG3 A;  2JXC A;  4C0L A;  5HKY A;  1H4B A;  2KAX A;  5DKQ A;  1NYA A;  1S6I A;  3TDI A;  1SPY A;  3CR5 X;  2ZFD A;  3O2P A;  4QJ4 B;  1SR6 C;  1XFW O;  4N1G A;  1C7W A;  2LP3 A;  3LL8 B;  1NX0 A;  2BKI B;  2JU0 A;  1JSA A;  5J3X A;  1S36 A;  2BEC A;  2MRD A;  3NSI A;  5AEQ A;  5HYD A;  2QPT A;  1NWD A;  3O78 A;  1YRU B;  3NSK A;  1BR1 B;  2LLT A;  3AAK A;  1A4P A;  2KI6 C;  2M1K B;  1YUT A;  1K8U A;  1LKJ A;  1BU3 A;  2M29 A;  1OMR A;  3KPX A;  3OX6 A;  2I18 A;  1CDM A;  1SK6 D;  2G2B A;  2HQ8 A;  2OS8 B;  3EK4 A;  5CSF A;  1AJ4 A;  5GQQ C;  4YGB B;  1YTZ C;  2GGZ A;  2JNX A;  2JXL A;  1C7V A;  2LE9 B;  4WQ2 A;  1CDN A;  1UP5 A;  1PVA A;  2BL0 B;  1QS7 A;  1MF8 B;  3CWG A;  4GFT A;  3SIB A;  3SG7 A;  3TS5 B;  4AQI A;  2MBX A;  2ZRS A;  4A4B A;  1YVH A;  4I5L B;  1U5I A;  2KI6 D;  4N5X A;  1MHO A;  1QX2 A;  2GGM A;  1XK4 C;  2JC2 A;  1TCF A;  1B8L A;  4MZK A;  2G9B A;  1DVI A;  1MXE A;  1M46 A;  3EKJ A;  5HKW A;  1DT7 B;  5IBW A;  4TNC A;  1J1D A;  1BG1 A;  5AER A;  2K7O A;  1K95 A;  3BUN B;  1F4Q A;  4MRX A;  1IRJ A;  1AVS A;  1Y1U A;  2WOR A;  2M9G A;  1YVL A;  1R6P A;  3PN7 B;  2A4J A;  4IL1 A;  1M63 B;  2BCB A;  5I2Q A;  1KK8 C;  3BUW B;  1B8C A;  1DJI A;  4OVN F;  2MHH A;  4YBH B;  3DD4 A;  3HCM A;  1CMG A;  1J55 A;  1SMG A;  3JTD C;  3SG2 A;  1NX3 A;  2NCO A;  5AAN A;  3BUO B;  1QVI Y;  1UHI A;  2Y1N A;  1NUB A;  2ISD A;  1QX5 B;  2KDH A;  2WCF A;  1QV1 A;  2L98 A;  1QJT A;  1MR8 A;  2LC5 A;  3HX4 A;  1OQP A;  2KGR A;  5PAL A;  3SG4 A;  1KFX L;  1SR6 B;  3IQQ A;  4PHM A;  1RJV A;  5F6T A;  2M3W A;  5CSN A;  2PAL A;  2BE6 A;  2PRU A;  3CLN A;  4MZJ A;  3TDU A;  1Y0V H;  4USL A;  1KQV A;  2LVV A;  1TNP A;  2ZKM X;  1J7P A;  3PLF B;  5KU1 A;  1RTP 1;  1JWD A;  1JFJ A;  3VRR A;  4GGN A;  3WXA A;  1W7I B;  1BJF A;  1GGW A;  4PHJ A;  1XA5 A;  1K9P A;  1XYD A;  1S5G Y;  3GK2 A;  2CBL A;  1BR4 B;  2EHB A;  2JT3 A;  3EVR A;  4ICB A;  2KHN A;  2FCD A;  2COL B;  1KQM C;  1CKK A;  3EVU A;  4ORA B;  1BF5 A;  1UHJ A;  2D8N A;  3VGO A;  1S1E A;  1QLK A;  5D7F A;  1AP4 A;  4U8D A;  1B47 A;  1CTR A;  1SCV A;  1DF0 A;  3DVE A;  3FIA A;  2M97 A;  3KEV A;  1XFY O;  2Q91 A;  2V53 A;  2HPS A;  1F55 A;  2ZRT A;  1B7T Z;  1AJ5 A;  1J1E A;  2GV5 A;  2LVJ A;  2LUX A;  3A8R A;  2H61 A;  1SL8 A;  2NXQ A;  3RM1 A;  1A75 B;  1PRW A;  1JUO A;  1LVC D;  3I5G C;  5D69 A;  1VRK A;  1UUS A;  1TTX A;  3EKH A;  1K9K A;  5CPV A;  1EG4 A;  2WCB A;  2K7C A;  1M45 A;  1MWN A;  4OKH A;  5HLV A;  2PMY A;  1CNP A;  4GNK B;  3SG6 A;  1SL7 A;  3PFV A;  2JZI A;  2JOJ A;  4MEW A;  4NQG A;  1SCM C;  2CT9 A;  1XFV O;  2M0R A;  4QJ3 B;  5I8N A;  1M39 A;  4WQ3 A;  2WND A;  1BLQ A;  5ER4 X;  3AKA A;  1NPQ A;  1KK8 B;  3EK7 A;  1DGU A;  1KFX S;  3JTD B;  3MSE B;  2KFG A;  4PAL A;  2F8P A;  1QIW A;  1KWO C;  2AMI A;  2LMV A;  2TN4 A;  4JPZ B;  2EGD A;  4C0K A;  4C0J A;  1F70 A;  2JTT A;  2FCE A;  1K9U A;  4QJ5 B;  2LUC A;  1FI6 A;  1S5G Z;  3BUX B;  1CLB A;  4JWQ A;  4XJK B;  1TRF A;  1J7O A;  3O4Y A;  1TNQ A;  1K94 A;  1YX7 A;  2PSR A;  1N65 A;  3LCP C;  1SL9 A;  2M7L A;  4I5K A;  4P5O E;  1IH0 A;  1EG3 A;  1M31 A;  2ZNE A;  3M0W A;  1OOJ A;  1S6C A;  2I2R E;  1JBA A;  2MAZ A;  1UHN A;  2WOS A;  1J7Q A;  1KK7 Y;  1CM4 A;  2LHL A;  1NX1 A;  2L4I A;  2LMU A;  1CDL A;  1Y1A A;  1BMO A;  3GK1 A;  3OX5 A;  2I94 A;  2LLU A;  3D0Y B;  1FF1 A;  4M2O A;  4P2Y B;  2NLN A;  1NCZ A;  2BBM A;  2K2F A;  2R2I A;  2KAV A;  4HRH A;  4GGF A;  2LHI A;  3WHT B;  4A4C A;  5AFP A;  2FOT A;  1TCO B;  1KCY A;  1JF0 A;  4PDZ A;  5KSZ A;  3ZWH A;  3I5I C;  1YUS A;  1ZAC A;  4MZL A;  3LK0 A;  3DF0 B;  1WDC C;  3GOF A;  5TNC A;  4PE7 A;  2VRG A;  1K93 D;  1L7Z A;  1WRZ A;  4CID A;  4XJK A;  3I5G B;  1OMD A;  2KQY A;  3KF9 A;  2M8U A;  4BY5 A;  4FQO A;  3PAL A;  2EC6 C;  1QTX A;  1QXP A;  3CZT X;  1B9A A;  2BCX A;  5ER5 A;  2Y5I A;  3OP0 A;  1UUR A;  4CFQ A;  2SCP A;  4XYN A;  1AK8 A;  2MJW B;  1CM1 A;  5I2O A;  1B4C A;  2KI4 C;  4PCW A;  4PE4 A;  1AHR A;  1K90 D;  3VRP A;  1SCM B;  1IJ6 A;  1ALW A;  1DJX A;  3PAT A;  1ZFS A;  1N0Y A;  3CGA A;  4YI9 A;  2MLE C;  2KFH A;  3OB1 B;  3D0Y A;  4HRG A;  2JQ6 A;  4I5N B;  4M2P A;  3LLE A;  2KSP A;  1G8I A;  2I7A A;  2LNK A;  3F45 A;  1KK7 Z;  3FWB A;  1RWY A;  1KWO B;  2CTN A;  4GAO A;  1CFP A;  3FWC A;  4MLW A;  3NSL A;  4NDD A;  1G33 A;  2K0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...