1JF0A

The crystal structure of obelin from obelia geniculata at 1.82 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
192
structure length
192
Chain Sequence
KYAVKLQTDFDNPKWIKRHKFMFDYLDINGNGQITLDEIVSKASDDICKNLGATPAQTQRHQDCVEAFFRGCGLEYGKETKFPEFLEGWKNLANADLAKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGRISGISPSEEDCEKTFQHCDLDNSGELDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obelin
publication title The Crystal Structure of Obelin from Obelia geniculata at 1.82 Angstrom Resolution
rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 76
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2001-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jf0A00
3D10A 3AKAA 5I2QA 1SL7A 1IGVA 2NZ0A 2EGDA 4PHNA 2M1UA 4AQIA 4GFTA 4MEWA 1UWOA 3BUXB 1MR8A 1K2HA 1BOCA 2PMYA 1SCMB 2K8MB 4GGFA 1ZACA 1SCVA 3EK8A 1JFKA 3K21A 1KSOA 4D1EA 1XFVO 3AKBA 2MBXA 1CM4A 4P2YB 4F0ZB 1NWDA 2KQ6A 1EJ3A 1DF0A 3I5FB 1A75B 2K2AA 2KFGA 2PSRA 3LLEA 1EXRA 1J7QA 4OR9B 1SW8A 1K96A 1AHRA 1SBJA 2M9GA 1K8UA 2BL0C 2JNXA 1QV0A 3SG7A 5I8NA 1C07A 4PE4A 3VRQA 2K2FA 1V1GA 2E6WA 4ETOA 3SIAA 5KU1A 4ZCUA 1KCYA 1DJGA 3IQQA 2ZRTA 5G08A 2LHIA 2KAVA 1R6PA 2BBNA 4DS7A 4TNCA 1YRTB 2QACA 1K95A 4PE1A 1CTRA 1C7VA 1S3PA 3I5GC 2E30A 1N0YA 1CFPA 1LINA 2JQ6A 1E8AA 1UP5A 2FOTA 1BJFA 1OMDA 2VRGA 1A2XA 1EG3A 1AUIB 1PVAA 1XFYO 4MZKA 1L2OC 4IL1A 3BUOB 3I5IB 1YUSA 1A4PA 3BOWB 1YR5A 2KI6D 4PDZA 3O4YA 5CSNA 2LCPA 3BQ3A 1RECA 2G2BA 2K7DA 1FI6A 1RJVA 1AK8A 3I5HC 1J7RA 1LVCD 4WQ3A 2NCPA 1RFJA 1A29A 1U5IA 2H61A 2L50A 3ICBA 4GAOA 3O78A 2BE4A 3PM8A 1SK6D 1TNPA 2K61A 1OZOA 1QIVA 3WHUB 2LC5A 1JF2A 1NX3A 1SNLA 1NCXA 1SL8A 4CPVA 1FPWA 3TUYC 2LUCA 1DVIA 1IG5A 1PRWA 1YUUA 2ZN9A 1JSAA 2V53A 1NX2A 2BCXA 2SCPA 3HX4A 3RM1A 1MF8B 1TNWA 1JFJA 2G9BA 1EG4A 4MN0A 5HLOA 3BUMB 1G4YR 5JJGA 2F2OA 2JPTA 2LHLA 2PVBA 2KNEA 1JC2A 2I94A 3BUWB 3NSLA 1NPQA 1Q80A 1DMOA 2BE6A 1IWQA 4MZLA 1WDCB 5KTYA 4AQJA 3BOWA 3PFVA 2K7OA 1CKKA 2ZRSA 1DTLA 1DT7B 1QX5B 5B8IB 1UHHA 3TS5C 1ALWA 2Q91A 1F4OA 1N65A 1K94A 2EC6B 3DF0B 2M7NA 1RTP1 2KQYA 1YVLA 4MBEA 4PE0A 1K9UA 2JRFA 1TCFA 2LAPA 2K0JA 3BUNB 2LVJA 4USLA 3PLFB 2CBLA 3MSEB 2GGMA 1QV1A 2OPOA 2O5GA 1Y0VH 4GUKA 5D69A 4YRUA 2MJWB 2L4HA 3KEVA 5ER5A 5TNCA 1DJXA 3F45A 1XFZO 1QX2A 4OCIA 1EL4A 1JBAA 3TUYB 1G33A 4N1GA 5AEQA 1IQ3A 4R1EA 4DCKA 1KK8B 5CSFA 4OKHA 1XK4A 1UURA 2M1KB 2BBMA 2LVVA 1QTXA 4GNKB 3O6BA 4CFRA 2LVIA 2L2EA 5HKWA 1IKUA 1CFFA 4PALA 1OMVA 2KDHA 1CMGA 2KFHA 3LL8B 1KQVA 1NUBA 2LLSA 1J7OA 4YGEB 1SPYA 3DVJA 2OTGC 2JXCA 3EVRA 1GQMA 2KAYA 4YI9A 2MA2A 4YGBB 2KSPA 2MRDA 1KQMC 4NDBA 1CB1A 2F3YA 3LK0A 3O2PA 4PCWA 3H4SE 4AOMA 2Y5IA 1TCOB 3OP0A 1KSMA 4XJKA 1ZMZA 3WHTB 1N2DA 2H2KA 2HPSA 2F3ZA 3DD4A 3E3RA 4I5LB 4CIDA 4YI8A 1XFXO 2F2PA 2Y1MA 1LKJA 3SG5A 2HETA 1XFUO 3M0WA 3OX5A 4M2QA 1NX1A 2CXJA 3JTDC 4I5JA 2LLTA 1NYAA 1KWOB 4QJ4B 3NSOA 3QRXA 4NDDA 2KFFA 1JWDA 3PSRA 1CFDA 3GK4X 2K7CA 2M3WA 3GK1A 3DVMA 1B8LA 2BCAA 3A4UB 1ODBA 3SG4A 1CNPA 1JF0A 1MXEA 2MHHA 1H4BA 1XK4C 4ORBB 4N1FA 3VRNA 4MVFA 1IH0A 5F6TA 1LXFC 4JQ0D 2KYFA 2P6BB 4GGFC 3OB2B 2WOSA 2JT0A 1QJTA 1YRUB 1K9PA 1A75A 1J55A 2EHBA 2ZFDA 1BLQA 4MLWA 4PHMA 1XO5A 3IF7A 1Y1AA 1RROA 2LP2A 2LUXA 1DJYA 1BG1A 5K89A 2HQ8A 3CR4X 2NCOA 2O60A 2JULA 2RGIA 3CLNA 1XA5A 3LK1A 4YBHB 1BODA 1GGWA 2F8PA 1M45A 2ZNDA 1CFCA 1BF5A 1B1GA 1TIZA 1QX7A 3FWBA 2M7LA 2BL0B 3BXKA 2A4JA 2LMVA 1A03A 2BKHB 4GBAA 1WRKA 2OS8C 1LA3A 2PALA 1UUSA 2F33A 1TRFA 4C0JA 1DJIA 1CMFA 5J3XA 3OX6A 1HQVA 4HRGA 1MUXA 2WC8A 3PN7C 1FF1A 1IQ5A 3JTDB 3KF9A 5CSIA 1YUTA 2KGBC 1IJ5A 1K9KA 1UHJA 1BT6A 3I5GB 1SKTA 1XVJA 2KHNA 5HYDA 5AXIA 3JVTC 4ORAB 1S5GZ 2COLB 2MLFC 2CT9A 4DIRA 3TDIA 2PRUA 2M8UA 5HKZA 1SCMC 3NXAA 3HCMA 1TTXA 3D0YB 1L2OB 2LM5A 2AUCA 3LCPC 3SIBA 1OSAA 1V1FA 2JU0A 2KBIA 3CGAA 4N5XA 2B1UA 4BY5A 4YGCB 4A4BA 1OQPA 4HSZA 2LVKA 4BY4A 3WXAA 2LMTA 4GGNA 1B9AA 3GOFA 2FJUB 4PHJA 5AERA 3DVKA 1WRZA 1CDMA 2JC2A 1TN4A 2L98A 2H61C 1GJYA 3EK7A 4CLNA 1F70A 3I5HB 4I5NB 4NDCA 4WRIA 1R2UA 2JT8A 2D8NA 5CPVA 1TNQA 1X02A 5DKRA 1L7ZA 2LNKA 5DKNA 1DF0B 1YX8A 1CDPA 1B7TZ 1JUOA 1SL9A 1J1DA 1S6JA 5I2OA 2Q4UA 2CTNA 1J7PA 1S6IA 5KSZA 4L9MA 2HF5A 1XFWO 3EK4A 2DOQA 1AJ5A 1YTZC 2WCEA 1FBVA 2LE9B 3A8RA 3BYAA 2ZKMX 1NSHA 1F4QA 2CNPA 2KI4C 2OS8B 1SMGA 2WORA 1KFXL 3EKHA 1F55A 2WNDA 1B47A 5GQQC 5AFPA 1IJ6A 1OMRA 3FIAA 1NIWA 3CTNA 1TOPA 1YVHA 3I5IC 1S6CA 1KK7Z 1PVBA 3CS1A 1CLLA 3D0YA 2KBMA 1QXPA 5HKYA 2SASA 2MLEC 2MAZA 3DF0A 1DJWA 1ZOTB 1CM1A 1KFUL 1BMOA 3TZ1A 1AJ4A 3JVTB 2FCEA 3SG3A 1S1EA 3TS5B 1F8HA 1G8IA 4C0KA 3KO0A 1SRAA 1QATA 4YGDB 3SG2A 4ICBA 2K7BA 5HLVA 1SR6C 1J1EA 2JOJA 3DVEA 1B8CA 4E68A 1W7IB 2KYCA 4DUQA 1S5GY 1WRLA 2L4IA 1S26D 1U5IB 2I2RE 4MSPA 3SG6A 3CR5X 3CR2A 1DJZA 4PHKA 1F54A 1UHKA 1QIWA 1QVIZ 3FS7A 2LP3A 3C1VA 1D1OA 1ZUZA 1C7WA 2WCBA 2M29A 3NSKA 1YX7A 5IBWA 2Y1NA 4GPLB 2ZN8A 4QJ5B 2AMIA 3EVUA 1WLZA 2I18A 1Y1XA 2JXLA 4ORCB 3OHMB 1ZFSA 4Q04A 2TN4A 1NX0A 1EH2A 1HT9A 1QLKA 1Y6WA 2KAXA 1CLBA 2NXQA 1TNXA 2L0PA 4JWQA 1CDNA 3VRPA 3OB1B 1WDCC 4P5OE 2KI4B 1B7TY 1PK0D 4U8DA 1M46A 2GGZA 2KOTA 4PE7A 1PSBA 2JWWA 1LA0A 4I5KA 1UHNA 1YURA 2OTGB 5PALA 2JTZA 1XYDA 3GK2A 4FTGA 4MRXA 3CWGA 1GGZA 2WCFA 1KQMB 5JOLA 1MXLC 2EC6C 1Y1UA 3KHEA 5DKQA 4CFQA 3WNXB 1OE9B 1SYMA 1QS7A 2L5XB 1WY9A 1NCZA 1AVSA 2M0RA 1K90D 4MRYA 4FQOA 1KK7Y 4YGAA 1SR6B 2JT3A 3TDUA 4XYNA 4MZJA 1H8BA 5D7FA 1BR4B 1KK8C 2LLUA 4QJ3B 3SJSA 1MHOA 5FYXA 1VRKA 1MWNA 1M31A 1S36A 3TDZA 1PALA 1M63B 4HRHA 2ISDA 3EVVA 3RLZA 1NCYA 4JPZB 4C0LA 1KFXS 1WLMA 2PASA 1FW4A 1PULA 2LV7A 1RWYA 3FWCA 1CDLA 2GV5A 3PATA 4ZCVA 3NSIA 1MQ1A 1QLSA 3AAKA 4M2OA 1QVIY 2Y4QA 1M39A 1BU3A 3I5FC 3CZTX 3KPXA 3EKJA 2R2IA 1UHIA 5CSJA 2HQWA 1B4CA 2CCMA 1KFUS 2LMUA 1OOJA 2IS9A 1QASA 3ZNIA 5BPJA 4A4CA 1IRJA 4WQ2A 1OZSA 3VRRA 2QPTA 3ZWHA 1FI5A 2L51A 1DGVA 3IQOA 4HREE 3PALA 5I2LA 4DRWA 4OV2A 4XJKB 2BCBA 1W7JB 4M2PA 4UPGA 1SY9A 2KI6C 1KWOC 2AAOA 1DJHA 2BKIB 1PSRA 4NQGA 2JZIA 2KGRA 1CLMA 3AAJA 1RK9A 3VROA 4OVNF 2M49B 1DGUA 5ER4X 1K93D 2M97A 2NLNA 3VGOA 1AP4A 1BR1B 2JTTA 3PN7B 2BECA 5AANA 1F71A 2JNFA 2FCDA 1NP8A 1B8RA 2I7AA 1ALVA 2LANA 2ZNEA
chains in the Genus database with same CATH superfamily
3D10A 4OZDA 3AKAA 5I2QA 1SL7A 1IGVA 2NZ0A 2EGDA 4PHNA 2M1UA 2QEBA 3D75A 4AQIA 4GFTA 1OW4A 4MEWA 1T14A 1UWOA 1MR8A 3BUXB 3SS5A 1K2HA 3CZ0A 4INXA 1BOCA 2PMYA 1SCMB 2K8MB 5DICA 4GGFA 1ZACA 1SCVA 3EK8A 1JFKA 3K21A 1KSOA 4D1EA 1XFVO 3AKBA 2MBXA 4INWA 1CM4A 4P2YB 4F0ZB 1NWDA 2KQ6A 1EJ3A 1DF0A 3I5FB 1A75B 3OGNA 2K2AA 2KFGA 2PSRA 3LLEA 1EXRA 1J7QA 4OR9B 1SW8A 1K96A 1AHRA 1SBJA 2M9GA 1K8UA 2BL0C 2JNXA 1QV0A 2BAPA 3SG7A 2BNXA 5I8NA 1C07A 4PE4A 3VRQA 2K2FA 1V1GA 2E6WA 4ETOA 5D3OA 3SIAA 5KU1A 4ZCUA 1KCYA 1DJGA 3IQQA 3B87A 2ZRTA 5G08A 2LHIA 2KAVA 3V2LA 1R6PA 2BBNA 4DS7A 4TNCA 1YRTB 2QACA 1K95A 4PE1A 1CTRA 1C7VA 1S3PA 3BJHA 2E30A 1N0YA 3I5GC 1CFPA 1LINA 2JQ6A 1E8AA 1UP5A 3S0GA 2FOTA 3L4LA 1BJFA 1OMDA 2VRGA 1A2XA 1EG3A 1AUIB 1PVAA 1XFYO 2WC6A 3FE6A 1IIOA 3D76A 4MZKA 1L2OC 4IL1A 3BUOB 3I5IB 1YUSA 1A4PA 3BOWB 1TUJA 1YR5A 2KI6D 4PDZA 3O4YA 5CSNA 2LCPA 3BQ3A 1RECA 2G2BA 2K7DA 1FI6A 1RJVA 1AK8A 3I5HC 1J7RA 1LVCD 4WQ3A 2NCPA 3Q8IA 1RFJA 1A29A 1U5IA 2H61A 2L50A 3ICBA 4GAOA 3O78A 2BE4A 3PM8A 1SK6D 1TNPA 2K61A 1OZOA 1QIVA 3WHUB 2LC5A 3CABA 1JF2A 4F7FA 1NX3A 1SNLA 1NCXA 1SL8A 4CPVA 1FPWA 3RZSA 2LUCA 3TUYC 1DVIA 1IG5A 1PRWA 1YUUA 2L5YA 2WCKA 2ZN9A 1JSAA 2V53A 1NX2A 2BCXA 2SCPA 3HX4A 3RM1A 1MF8B 1TNWA 1JFJA 2G9BA 1EG4A 4MN0A 5HLOA 3BUMB 1G4YR 5JJGA 1OOFA 2F2OA 2JPTA 2LHLA 2PVBA 2KNEA 1JC2A 2I94A 3BUWB 3NSLA 1NPQA 1Q80A 1DMOA 3UNWA 2BE6A 1IWQA 4MZLA 1WDCB 5KTYA 4AQJA 2KLDA 5FI6A 3BOWA 3PFVA 2K7OA 1CKKA 2ZRSA 1DTLA 1DT7B 1QX5B 5B8IB 1UHHA 3TS5C 1ALWA 2Q91A 1F4OA 1N65A 1K94A 2GTEA 1ORGA 2EC6B 3DF0B 2M7NA 3SS3A 1RTP1 2KQYA 1YVLA 4MBEA 4PE0A 3D78A 1K9UA 2JRFA 1TCFA 2LAPA 2K0JA 3BUNB 2LVJA 4USLA 3PLFB 2CBLA 3MSEB 2GGMA 1QV1A 2OPOA 2O5GA 3S0EA 1Y0VH 4GUKA 5D69A 1C3ZA 2QEOA 2MJWB 4YRUA 2L4HA 3KEVA 5ER5A 5TNCA 2WC5A 1DJXA 3F45A 1XFZO 1QX2A 4OCIA 1EL4A 1JBAA 3TUYB 1G33A 4N1GA 5AEQA 3B88A 1IQ3A 2WCLA 4R1EA 4DCKA 1KK8B 5CSFA 4OKHA 1XK4A 1UURA 2M1KB 2BBMA 2LVVA 1QTXA 4GNKB 3O6BA 2JPOA 4CFRA 3R72A 2LVIA 2L2EA 2P71A 1Z2CB 5HKWA 1IKUA 1CFFA 4PT1A 4PALA 1OMVA 2KDHA 1CMGA 2KFHA 3LL8B 1KQVA 1NUBA 2LLSA 3EG5B 1J7OA 4YGEB 1SPYA 3DVJA 2OTGC 2JXCA 2K60A 1OOGA 1GQMA 2KAYA 2L2CA 2MA2A 3EVRA 4YI9A 2KSPA 4KYNA 4YGBB 2MRDA 1KQMC 4NDBA 1CB1A 2F3YA 3LK0A 3O2PA 4PCWA 3H4SE 4AOMA 2Y5IA 1TCOB 3OP0A 1KSMA 4XJKA 1ZMZA 3WHTB 1N2DA 3DXLA 2H2KA 2HPSA 2F3ZA 1P28A 3DD4A 3E3RA 4I5LB 4CIDA 1QWVA 4YI8A 1XFXO 2F2PA 2Y1MA 1LKJA 3SG5A 2HETA 1XFUO 3M0WA 3OX5A 4M2QA 3NHIA 1NX1A 2CXJA 3JTDC 4I5JA 2LLTA 3BFBA 1NYAA 1KWOB 1SSEB 4QJ4B 3NSOA 3QRXA 4NDDA 2KFFA 1JWDA 3PSRA 3QMEA 1CFDA 3BFAA 5FI7A 3GK4X 5HL1A 2K7CA 2M3WA 3GK1A 3DVMA 1B8LA 2BCAA 3A4UB 1ODBA 3SG4A 1CNPA 1C3YA 3S0FA 1JF0A 1MXEA 2MHHA 1TUZA 1XK4C 1H4BA 4ORBB 3S0DA 3L47A 4N1FA 3VRNA 4MVFA 1IH0A 4FQTA 5F6TA 1LXFC 4JQ0D 3DY9A 2KYFA 2P6BB 5EL2A 4GGFC 3OB2B 2WOSA 2JT0A 1QJTA 1YRUB 3UO9A 1K9PA 1A75A 1J55A 2EHBA 2ZFDA 1BLQA 3N7HA 4MLWA 4PHMA 1XO5A 3IF7A 1Y1AA 1RROA 2LP2A 2LUXA 1DJYA 3K1EA 1BG1A 5K89A 2HQ8A 3CR4X 2NCOA 2O60A 2JULA 2RGIA 3B6XA 3CLNA 1XA5A 3LK1A 4YBHB 1BODA 1GGWA 2F8PA 1M45A 2ZNDA 1CFCA 1BF5A 1B1GA 1TIZA 1QX7A 3FWBA 2M7LA 2BL0B 3S0AA 3BXKA 3SS4A 2A4JA 3B86A 2LMVA 1A03A 2BKHB 4GBAA 1WRKA 2OS8C 1LA3A 2PALA 1UUSA 2F33A 2QEVA 1TRFA 4C0JA 1DJIA 1CMFA 5J3XA 3OX6A 1HQVA 4HRGA 1MUXA 2WC8A 3PN7C 1DC1A 3OBVA 1IQ5A 3JTDB 3KF9A 3PJIA 5CSIA 3CDNA 1FF1A 2WCMA 1YUTA 2KGBC 4JKTA 1W9ZA 1IJ5A 1K9KA 1UHJA 1BT6A 3I5GB 1SKTA 1XVJA 2FJYA 2KHNA 5HYDA 5AXIA 3JVTC 4ORAB 1S5GZ 2COLB 2MLFC 3R1VA 2CT9A 3D74A 4DIRA 3TDIA 2PRUA 2M8UA 5HKZA 1SCMC 3NXAA 3HCMA 1TTXA 3D0YB 1L2OB 2LM5A 2AUCA 3LCPC 3SIBA 1OSAA 1V1FA 2JU0A 2KBIA 3CGAA 4N5XA 2B1UA 4BY5A 4YGCB 5I94A 4A4BA 1OQPA 4HSZA 2LVKA 4BY4A 3DYEA 2LMTA 3NGVA 4GGNA 1B9AA 3WXAA 3D77A 2FJUB 3GOFA 4PHJA 5AERA 3DVKA 1WRZA 1CDMA 2JC2A 1TN4A 2L98A 2H61C 1GJYA 3EK7A 4CLNA 1F70A 3I5HB 2PYQA 4I5NB 4NDCA 4WRIA 1R2UA 2JT8A 2D8NA 5CPVA 1TNQA 1X02A 5DKRA 1L7ZA 2WCHA 2LNKA 3FE8A 5DKNA 1DF0B 1YX8A 1CDPA 1B7TZ 1JUOA 1SL9A 1J1DA 1S6JA 5I2OA 2Q4UA 2CTNA 1J7PA 1S6IA 5KSZA 4L9MA 2HF5A 1XFWO 3EK4A 2DOQA 1AJ5A 1YTZC 3CYZA 2WCEA 1FBVA 2LE9B 3A8RA 3BYAA 2ZKMX 1NSHA 1F4QA 2CNPA 2KI4C 2OS8B 1SMGA 2WORA 1KFXL 3EKHA 1F55A 2WNDA 3R1PA 1B47A 5GQQC 5AFPA 1IJ6A 1OMRA 3FIAA 1NIWA 3CTNA 1TOPA 3CZ1A 1YVHA 3I5IC 1S6CA 1KK7Z 1PVBA 3CS1A 1CLLA 3D0YA 2KBMA 1QXPA 5HKYA 2SASA 2MLEC 2MAZA 3DF0A 1DJWA 1ZOTB 1CM1A 1KFUL 1BMOA 3TZ1A 1AJ4A 2WCJA 2ERBA 3JVTB 2FCEA 3SG3A 1S1EA 3TS5B 1F8HA 1G8IA 4C0KA 3KO0A 1SRAA 1QATA 4YGDB 3SG2A 4ICBA 3VB1A 2K7BA 5HLVA 1SR6C 1J1EA 2JOJA 3DVEA 1B8CA 1LS8A 4E68A 3IVTA 3O4XA 1W7IB 2KYCA 4DUQA 1S5GY 1WRLA 2L4IA 1S26D 1OOHA 1U5IB 2I2RE 4MSPA 3SG6A 3CR5X 3CR2A 1DJZA 4PHKA 1F54A 1UHKA 1QIWA 1QVIZ 3FS7A 2LP3A 3C1VA 1D1OA 1ZUZA 1C7WA 2WCBA 2M29A 3NSKA 1YX7A 3S0BA 5IBWA 2Y1NA 4GPLB 2ZN8A 4QJ5B 2AMIA 3EVUA 1WLZA 2I18A 1Y1XA 2JXLA 4ORCB 3CZ2A 3OHMB 1ZFSA 3BFHA 4Q04A 2TN4A 1NX0A 1XFRA 1EH2A 1HT9A 1QLKA 1Y6WA 3NHTA 1DEKA 2KAXA 1CLBA 2NXQA 1TNXA 2L0PA 4JWQA 1CDNA 3VRPA 3OB1B 1WDCC 3B7AA 2KI4B 3D73A 4P5OE 1B7TY 1PK0D 4U8DA 1M46A 2GGZA 2KOTA 4PE7A 1PSBA 2JWWA 1LA0A 4I5KA 1UHNA 1YURA 2OTGB 1DQEA 2JTZA 1XYDA 5PALA 2KPHA 3GK2A 4FTGA 4MRXA 3CWGA 1GGZA 2WCFA 1KQMB 5JOLA 1MXLC 2EC6C 1Y1UA 3KHEA 2QEHA 5DKQA 4CFQA 3WNXB 1OE9B 1SYMA 1QS7A 2L5XB 1WY9A 1NCZA 4JD9A 1AVSA 2M0RA 1K90D 4MRYA 4FQOA 1KK7Y 2P70A 2H8VA 3L4AA 4YGAA 1SR6B 2JT3A 3TDUA 4XYNA 4MZJA 1H8BA 1Z4HA 5D7FA 1BR4B 1KK8C 2LLUA 4QJ3B 3SJSA 1MHOA 2YGUA 5FYXA 1VRKA 1MWNA 1M31A 1S36A 2QDIA 1GM0A 3TDZA 3PM2A 1TWOA 1PALA 1M63B 4HRHA 2ISDA 3EVVA 3RLZA 1NCYA 4JPZB 4C0LA 1KFXS 1WLMA 2PASA 1FW4A 1PULA 2LV7A 1RWYA 3FWCA 1CDLA 2GV5A 2KLEA 3PATA 4ZCVA 3NSIA 1MQ1A 1QLSA 3AAKA 3R1OA 4M2OA 1QVIY 2Y4QA 1M39A 1BU3A 3I5FC 3CZTX 3KPXA 3EKJA 2R2IA 3DZTA 1UHIA 5CSJA 2HQWA 1B4CA 2CCMA 1KFUS 2LMUA 1OOJA 2IS9A 1QASA 2PQLA 5FI2A 4IJ7A 3ZNIA 5BPJA 4A4CA 1IRJA 4WQ2A 1OZSA 3VRRA 2QPTA 3ZWHA 1FI5A 2L51A 1DGVA 3IQOA 4HREE 3PALA 5I2LA 4DRWA 3FE9A 4OV2A 4XJKB 2BCBA 1W7JB 4M2PA 4UPGA 1SY9A 2KI6C 1OOIX 1KWOC 2AAOA 1DJHA 2BKIB 1PSRA 4NQGA 2JZIA 2KGRA 1CLMA 1DELA 3AAJA 1RK9A 3VROA 4OVNF 2M49B 1DGUA 5ER4X 1K93D 2M97A 2NLNA 3VGOA 1AP4A 1BR1B 2JTTA 3PN7B 2BECA 5AANA 1F71A 2JNFA 2FCDA 1NP8A 1B8RA 2I7AA 1ALVA 2LANA 2ZNEA
chains in the Genus database with same CATH topology
3D10A 3AKAA 5I2QA 1SL7A 1IGVA 2NZ0A 2EGDA 4PHNA 2M1UA 4AQIA 4GFTA 4MEWA 1UWOA 3BUXB 1MR8A 1K2HA 1BOCA 2PMYA 1SCMB 2K8MB 4GGFA 1ZACA 1SCVA 3EK8A 1JFKA 3K21A 1KSOA 4D1EA 1XFVO 3AKBA 2MBXA 1CM4A 4P2YB 4F0ZB 1NWDA 2KQ6A 1EJ3A 1DF0A 3I5FB 1A75B 2K2AA 2KFGA 2PSRA 3LLEA 1EXRA 1J7QA 4OR9B 1SW8A 1K96A 1AHRA 1SBJA 2M9GA 1K8UA 2BL0C 2JNXA 1QV0A 3SG7A 5I8NA 1C07A 4PE4A 3VRQA 2K2FA 1V1GA 2E6WA 4ETOA 3SIAA 5KU1A 4ZCUA 1KCYA 1DJGA 3IQQA 2ZRTA 5G08A 2LHIA 2KAVA 1R6PA 2BBNA 4DS7A 4TNCA 1YRTB 2QACA 1K95A 4PE1A 1CTRA 1C7VA 1S3PA 3I5GC 2E30A 1N0YA 1CFPA 1LINA 2JQ6A 1E8AA 1UP5A 2FOTA 1BJFA 1OMDA 2VRGA 1A2XA 1EG3A 1AUIB 1PVAA 1XFYO 4MZKA 1L2OC 4IL1A 3BUOB 3I5IB 1YUSA 1A4PA 3BOWB 1YR5A 2KI6D 4PDZA 3O4YA 5CSNA 2LCPA 3BQ3A 1RECA 2G2BA 2K7DA 1FI6A 1RJVA 1AK8A 3I5HC 1J7RA 1LVCD 4WQ3A 2NCPA 1RFJA 1A29A 1U5IA 2H61A 2L50A 3ICBA 4GAOA 3O78A 2BE4A 3PM8A 1SK6D 1TNPA 2K61A 1OZOA 1QIVA 3WHUB 2LC5A 1JF2A 1NX3A 1SNLA 1NCXA 1SL8A 4CPVA 1FPWA 3TUYC 2LUCA 1DVIA 1IG5A 1PRWA 1YUUA 2ZN9A 1JSAA 2V53A 1NX2A 2BCXA 2SCPA 3HX4A 3RM1A 1MF8B 1TNWA 1JFJA 2G9BA 1EG4A 4MN0A 5HLOA 3BUMB 1G4YR 5JJGA 2F2OA 2JPTA 2LHLA 2PVBA 2KNEA 1JC2A 2I94A 3BUWB 3NSLA 1NPQA 1Q80A 1DMOA 2BE6A 1IWQA 4MZLA 1WDCB 5KTYA 4AQJA 3BOWA 3PFVA 2K7OA 1CKKA 2ZRSA 1DTLA 1DT7B 1QX5B 5B8IB 1UHHA 3TS5C 1ALWA 2Q91A 1F4OA 1N65A 1K94A 2EC6B 3DF0B 2M7NA 1RTP1 2KQYA 1YVLA 4MBEA 4PE0A 1K9UA 2JRFA 1TCFA 2LAPA 2K0JA 3BUNB 2LVJA 4USLA 3PLFB 2CBLA 3MSEB 2GGMA 1QV1A 2OPOA 2O5GA 1Y0VH 4GUKA 5D69A 4YRUA 2MJWB 2L4HA 3KEVA 5ER5A 5TNCA 1DJXA 3F45A 1XFZO 1QX2A 4OCIA 1EL4A 1JBAA 3TUYB 1G33A 4N1GA 5AEQA 1IQ3A 4R1EA 4DCKA 1KK8B 5CSFA 4OKHA 1XK4A 1UURA 2M1KB 2BBMA 2LVVA 1QTXA 4GNKB 3O6BA 4CFRA 2LVIA 2L2EA 5HKWA 1IKUA 1CFFA 4PALA 1OMVA 2KDHA 1CMGA 2KFHA 3LL8B 1KQVA 1NUBA 2LLSA 1J7OA 4YGEB 1SPYA 3DVJA 2OTGC 2JXCA 3EVRA 1GQMA 2KAYA 4YI9A 2MA2A 4YGBB 2KSPA 2MRDA 1KQMC 4NDBA 1CB1A 2F3YA 3LK0A 3O2PA 4PCWA 3H4SE 4AOMA 2Y5IA 1TCOB 3OP0A 1KSMA 4XJKA 1ZMZA 3WHTB 1N2DA 2H2KA 2HPSA 2F3ZA 3DD4A 3E3RA 4I5LB 4CIDA 4YI8A 1XFXO 2F2PA 2Y1MA 1LKJA 3SG5A 2HETA 1XFUO 3M0WA 3OX5A 4M2QA 1NX1A 2CXJA 3JTDC 4I5JA 2LLTA 1NYAA 1KWOB 4QJ4B 3NSOA 3QRXA 4NDDA 2KFFA 1JWDA 3PSRA 1CFDA 3GK4X 2K7CA 2M3WA 3GK1A 3DVMA 1B8LA 2BCAA 3A4UB 1ODBA 3SG4A 1CNPA 1JF0A 1MXEA 2MHHA 1H4BA 1XK4C 4ORBB 4N1FA 3VRNA 4MVFA 1IH0A 5F6TA 1LXFC 4JQ0D 2KYFA 2P6BB 4GGFC 3OB2B 2WOSA 2JT0A 1QJTA 1YRUB 1K9PA 1A75A 1J55A 2EHBA 2ZFDA 1BLQA 4MLWA 4PHMA 1XO5A 3IF7A 1Y1AA 1RROA 2LP2A 2LUXA 1DJYA 1BG1A 5K89A 2HQ8A 3CR4X 2NCOA 2O60A 2JULA 2RGIA 3CLNA 1XA5A 3LK1A 4YBHB 1BODA 1GGWA 2F8PA 1M45A 2ZNDA 1CFCA 1BF5A 1B1GA 1TIZA 1QX7A 3FWBA 2M7LA 2BL0B 3BXKA 2A4JA 2LMVA 1A03A 2BKHB 4GBAA 1WRKA 2OS8C 1LA3A 2PALA 1UUSA 2F33A 1TRFA 4C0JA 1DJIA 1CMFA 5J3XA 3OX6A 1HQVA 4HRGA 1MUXA 2WC8A 3PN7C 1FF1A 1IQ5A 3JTDB 3KF9A 5CSIA 1YUTA 2KGBC 1IJ5A 1K9KA 1UHJA 1BT6A 3I5GB 1SKTA 1XVJA 2KHNA 5HYDA 5AXIA 3JVTC 4ORAB 1S5GZ 2COLB 2MLFC 2CT9A 4DIRA 3TDIA 2PRUA 2M8UA 5HKZA 1SCMC 3NXAA 3HCMA 1TTXA 3D0YB 1L2OB 2LM5A 2AUCA 3LCPC 3SIBA 1OSAA 1V1FA 2JU0A 2KBIA 3CGAA 4N5XA 2B1UA 4BY5A 4YGCB 4A4BA 1OQPA 4HSZA 2LVKA 4BY4A 3WXAA 2LMTA 4GGNA 1B9AA 3GOFA 2FJUB 4PHJA 5AERA 3DVKA 1WRZA 1CDMA 2JC2A 1TN4A 2L98A 2H61C 1GJYA 3EK7A 4CLNA 1F70A 3I5HB 4I5NB 4NDCA 4WRIA 1R2UA 2JT8A 2D8NA 5CPVA 1TNQA 1X02A 5DKRA 1L7ZA 2LNKA 5DKNA 1DF0B 1YX8A 1CDPA 1B7TZ 1JUOA 1SL9A 1J1DA 1S6JA 5I2OA 2Q4UA 2CTNA 1J7PA 1S6IA 5KSZA 4L9MA 2HF5A 1XFWO 3EK4A 2DOQA 1AJ5A 1YTZC 2WCEA 1FBVA 2LE9B 3A8RA 3BYAA 2ZKMX 1NSHA 1F4QA 2CNPA 2KI4C 2OS8B 1SMGA 2WORA 1KFXL 3EKHA 1F55A 2WNDA 1B47A 5GQQC 5AFPA 1IJ6A 1OMRA 3FIAA 1NIWA 3CTNA 1TOPA 1YVHA 3I5IC 1S6CA 1KK7Z 1PVBA 3CS1A 1CLLA 3D0YA 2KBMA 1QXPA 5HKYA 2SASA 2MLEC 2MAZA 3DF0A 1DJWA 1ZOTB 1CM1A 1KFUL 1BMOA 3TZ1A 1AJ4A 3JVTB 2FCEA 3SG3A 1S1EA 3TS5B 1F8HA 1G8IA 4C0KA 3KO0A 1SRAA 1QATA 4YGDB 3SG2A 4ICBA 2K7BA 5HLVA 1SR6C 1J1EA 2JOJA 3DVEA 1B8CA 4E68A 1W7IB 2KYCA 4DUQA 1S5GY 1WRLA 2L4IA 1S26D 1U5IB 2I2RE 4MSPA 3SG6A 3CR5X 3CR2A 1DJZA 4PHKA 1F54A 1UHKA 1QIWA 1QVIZ 3FS7A 2LP3A 3C1VA 1D1OA 1ZUZA 1C7WA 2WCBA 2M29A 3NSKA 1YX7A 5IBWA 2Y1NA 4GPLB 2ZN8A 4QJ5B 2AMIA 3EVUA 1WLZA 2I18A 1Y1XA 2JXLA 4ORCB 3OHMB 1ZFSA 4Q04A 2TN4A 1NX0A 1EH2A 1HT9A 1QLKA 1Y6WA 2KAXA 1CLBA 2NXQA 1TNXA 2L0PA 4JWQA 1CDNA 3VRPA 3OB1B 1WDCC 4P5OE 2KI4B 1B7TY 1PK0D 4U8DA 1M46A 2GGZA 2KOTA 4PE7A 1PSBA 2JWWA 1LA0A 4I5KA 1UHNA 1YURA 2OTGB 5PALA 2JTZA 1XYDA 3GK2A 4FTGA 4MRXA 3CWGA 1GGZA 2WCFA 1KQMB 5JOLA 1MXLC 2EC6C 1Y1UA 3KHEA 5DKQA 4CFQA 3WNXB 1OE9B 1SYMA 1QS7A 2L5XB 1WY9A 1NCZA 1AVSA 2M0RA 1K90D 4MRYA 4FQOA 1KK7Y 4YGAA 1SR6B 2JT3A 3TDUA 4XYNA 4MZJA 1H8BA 5D7FA 1BR4B 1KK8C 2LLUA 4QJ3B 3SJSA 1MHOA 5FYXA 1VRKA 1MWNA 1M31A 1S36A 3TDZA 1PALA 1M63B 4HRHA 2ISDA 3EVVA 3RLZA 1NCYA 4JPZB 4C0LA 1KFXS 1WLMA 2PASA 1FW4A 1PULA 2LV7A 1RWYA 3FWCA 1CDLA 2GV5A 3PATA 4ZCVA 3NSIA 1MQ1A 1QLSA 3AAKA 4M2OA 1QVIY 2Y4QA 1M39A 1BU3A 3I5FC 3CZTX 3KPXA 3EKJA 2R2IA 1UHIA 5CSJA 2HQWA 1B4CA 2CCMA 1KFUS 2LMUA 1OOJA 2IS9A 1QASA 3ZNIA 5BPJA 4A4CA 1IRJA 4WQ2A 1OZSA 3VRRA 2QPTA 3ZWHA 1FI5A 2L51A 1DGVA 3IQOA 4HREE 3PALA 5I2LA 4DRWA 4OV2A 4XJKB 2BCBA 1W7JB 4M2PA 4UPGA 1SY9A 2KI6C 1KWOC 2AAOA 1DJHA 2BKIB 1PSRA 4NQGA 2JZIA 2KGRA 1CLMA 3AAJA 1RK9A 3VROA 4OVNF 2M49B 1DGUA 5ER4X 1K93D 2M97A 2NLNA 3VGOA 1AP4A 1BR1B 2JTTA 3PN7B 2BECA 5AANA 1F71A 2JNFA 2FCDA 1NP8A 1B8RA 2I7AA 1ALVA 2LANA 2ZNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D10 A;  3AKA A;  5I2Q A;  1SL7 A;  1IGV A;  2NZ0 A;  2EGD A;  4PHN A;  2M1U A;  4AQI A;  4GFT A;  4MEW A;  1UWO A;  3BUX B;  1MR8 A;  1K2H A;  1BOC A;  2PMY A;  1SCM B;  2K8M B;  4GGF A;  1ZAC A;  1SCV A;  3EK8 A;  1JFK A;  3K21 A;  1KSO A;  4D1E A;  1XFV O;  3AKB A;  2MBX A;  1CM4 A;  4P2Y B;  4F0Z B;  1NWD A;  2KQ6 A;  1EJ3 A;  1DF0 A;  3I5F B;  1A75 B;  2K2A A;  2KFG A;  2PSR A;  3LLE A;  1EXR A;  1J7Q A;  4OR9 B;  1SW8 A;  1K96 A;  1AHR A;  1SBJ A;  2M9G A;  1K8U A;  2BL0 C;  2JNX A;  1QV0 A;  3SG7 A;  5I8N A;  1C07 A;  4PE4 A;  3VRQ A;  2K2F A;  1V1G A;  2E6W A;  4ETO A;  3SIA A;  5KU1 A;  4ZCU A;  1KCY A;  1DJG A;  3IQQ A;  2ZRT A;  5G08 A;  2LHI A;  2KAV A;  1R6P A;  2BBN A;  4DS7 A;  4TNC A;  1YRT B;  2QAC A;  1K95 A;  4PE1 A;  1CTR A;  1C7V A;  1S3P A;  3I5G C;  2E30 A;  1N0Y A;  1CFP A;  1LIN A;  2JQ6 A;  1E8A A;  1UP5 A;  2FOT A;  1BJF A;  1OMD A;  2VRG A;  1A2X A;  1EG3 A;  1AUI B;  1PVA A;  1XFY O;  4MZK A;  1L2O C;  4IL1 A;  3BUO B;  3I5I B;  1YUS A;  1A4P A;  3BOW B;  1YR5 A;  2KI6 D;  4PDZ A;  3O4Y A;  5CSN A;  2LCP A;  3BQ3 A;  1REC A;  2G2B A;  2K7D A;  1FI6 A;  1RJV A;  1AK8 A;  3I5H C;  1J7R A;  1LVC D;  4WQ3 A;  2NCP A;  1RFJ A;  1A29 A;  1U5I A;  2H61 A;  2L50 A;  3ICB A;  4GAO A;  3O78 A;  2BE4 A;  3PM8 A;  1SK6 D;  1TNP A;  2K61 A;  1OZO A;  1QIV A;  3WHU B;  2LC5 A;  1JF2 A;  1NX3 A;  1SNL A;  1NCX A;  1SL8 A;  4CPV A;  1FPW A;  3TUY C;  2LUC A;  1DVI A;  1IG5 A;  1PRW A;  1YUU A;  2ZN9 A;  1JSA A;  2V53 A;  1NX2 A;  2BCX A;  2SCP A;  3HX4 A;  3RM1 A;  1MF8 B;  1TNW A;  1JFJ A;  2G9B A;  1EG4 A;  4MN0 A;  5HLO A;  3BUM B;  1G4Y R;  5JJG A;  2F2O A;  2JPT A;  2LHL A;  2PVB A;  2KNE A;  1JC2 A;  2I94 A;  3BUW B;  3NSL A;  1NPQ A;  1Q80 A;  1DMO A;  2BE6 A;  1IWQ A;  4MZL A;  1WDC B;  5KTY A;  4AQJ A;  3BOW A;  3PFV A;  2K7O A;  1CKK A;  2ZRS A;  1DTL A;  1DT7 B;  1QX5 B;  5B8I B;  1UHH A;  3TS5 C;  1ALW A;  2Q91 A;  1F4O A;  1N65 A;  1K94 A;  2EC6 B;  3DF0 B;  2M7N A;  1RTP 1;  2KQY A;  1YVL A;  4MBE A;  4PE0 A;  1K9U A;  2JRF A;  1TCF A;  2LAP A;  2K0J A;  3BUN B;  2LVJ A;  4USL A;  3PLF B;  2CBL A;  3MSE B;  2GGM A;  1QV1 A;  2OPO A;  2O5G A;  1Y0V H;  4GUK A;  5D69 A;  4YRU A;  2MJW B;  2L4H A;  3KEV A;  5ER5 A;  5TNC A;  1DJX A;  3F45 A;  1XFZ O;  1QX2 A;  4OCI A;  1EL4 A;  1JBA A;  3TUY B;  1G33 A;  4N1G A;  5AEQ A;  1IQ3 A;  4R1E A;  4DCK A;  1KK8 B;  5CSF A;  4OKH A;  1XK4 A;  1UUR A;  2M1K B;  2BBM A;  2LVV A;  1QTX A;  4GNK B;  3O6B A;  4CFR A;  2LVI A;  2L2E A;  5HKW A;  1IKU A;  1CFF A;  4PAL A;  1OMV A;  2KDH A;  1CMG A;  2KFH A;  3LL8 B;  1KQV A;  1NUB A;  2LLS A;  1J7O A;  4YGE B;  1SPY A;  3DVJ A;  2OTG C;  2JXC A;  3EVR A;  1GQM A;  2KAY A;  4YI9 A;  2MA2 A;  4YGB B;  2KSP A;  2MRD A;  1KQM C;  4NDB A;  1CB1 A;  2F3Y A;  3LK0 A;  3O2P A;  4PCW A;  3H4S E;  4AOM A;  2Y5I A;  1TCO B;  3OP0 A;  1KSM A;  4XJK A;  1ZMZ A;  3WHT B;  1N2D A;  2H2K A;  2HPS A;  2F3Z A;  3DD4 A;  3E3R A;  4I5L B;  4CID A;  4YI8 A;  1XFX O;  2F2P A;  2Y1M A;  1LKJ A;  3SG5 A;  2HET A;  1XFU O;  3M0W A;  3OX5 A;  4M2Q A;  1NX1 A;  2CXJ A;  3JTD C;  4I5J A;  2LLT A;  1NYA A;  1KWO B;  4QJ4 B;  3NSO A;  3QRX A;  4NDD A;  2KFF A;  1JWD A;  3PSR A;  1CFD A;  3GK4 X;  2K7C A;  2M3W A;  3GK1 A;  3DVM A;  1B8L A;  2BCA A;  3A4U B;  1ODB A;  3SG4 A;  1CNP A;  1JF0 A;  1MXE A;  2MHH A;  1H4B A;  1XK4 C;  4ORB B;  4N1F A;  3VRN A;  4MVF A;  1IH0 A;  5F6T A;  1LXF C;  4JQ0 D;  2KYF A;  2P6B B;  4GGF C;  3OB2 B;  2WOS A;  2JT0 A;  1QJT A;  1YRU B;  1K9P A;  1A75 A;  1J55 A;  2EHB A;  2ZFD A;  1BLQ A;  4MLW A;  4PHM A;  1XO5 A;  3IF7 A;  1Y1A A;  1RRO A;  2LP2 A;  2LUX A;  1DJY A;  1BG1 A;  5K89 A;  2HQ8 A;  3CR4 X;  2NCO A;  2O60 A;  2JUL A;  2RGI A;  3CLN A;  1XA5 A;  3LK1 A;  4YBH B;  1BOD A;  1GGW A;  2F8P A;  1M45 A;  2ZND A;  1CFC A;  1BF5 A;  1B1G A;  1TIZ A;  1QX7 A;  3FWB A;  2M7L A;  2BL0 B;  3BXK A;  2A4J A;  2LMV A;  1A03 A;  2BKH B;  4GBA A;  1WRK A;  2OS8 C;  1LA3 A;  2PAL A;  1UUS A;  2F33 A;  1TRF A;  4C0J A;  1DJI A;  1CMF A;  5J3X A;  3OX6 A;  1HQV A;  4HRG A;  1MUX A;  2WC8 A;  3PN7 C;  1FF1 A;  1IQ5 A;  3JTD B;  3KF9 A;  5CSI A;  1YUT A;  2KGB C;  1IJ5 A;  1K9K A;  1UHJ A;  1BT6 A;  3I5G B;  1SKT A;  1XVJ A;  2KHN A;  5HYD A;  5AXI A;  3JVT C;  4ORA B;  1S5G Z;  2COL B;  2MLF C;  2CT9 A;  4DIR A;  3TDI A;  2PRU A;  2M8U A;  5HKZ A;  1SCM C;  3NXA A;  3HCM A;  1TTX A;  3D0Y B;  1L2O B;  2LM5 A;  2AUC A;  3LCP C;  3SIB A;  1OSA A;  1V1F A;  2JU0 A;  2KBI A;  3CGA A;  4N5X A;  2B1U A;  4BY5 A;  4YGC B;  4A4B A;  1OQP A;  4HSZ A;  2LVK A;  4BY4 A;  3WXA A;  2LMT A;  4GGN A;  1B9A A;  3GOF A;  2FJU B;  4PHJ A;  5AER A;  3DVK A;  1WRZ A;  1CDM A;  2JC2 A;  1TN4 A;  2L98 A;  2H61 C;  1GJY A;  3EK7 A;  4CLN A;  1F70 A;  3I5H B;  4I5N B;  4NDC A;  4WRI A;  1R2U A;  2JT8 A;  2D8N A;  5CPV A;  1TNQ A;  1X02 A;  5DKR A;  1L7Z A;  2LNK A;  5DKN A;  1DF0 B;  1YX8 A;  1CDP A;  1B7T Z;  1JUO A;  1SL9 A;  1J1D A;  1S6J A;  5I2O A;  2Q4U A;  2CTN A;  1J7P A;  1S6I A;  5KSZ A;  4L9M A;  2HF5 A;  1XFW O;  3EK4 A;  2DOQ A;  1AJ5 A;  1YTZ C;  2WCE A;  1FBV A;  2LE9 B;  3A8R A;  3BYA A;  2ZKM X;  1NSH A;  1F4Q A;  2CNP A;  2KI4 C;  2OS8 B;  1SMG A;  2WOR A;  1KFX L;  3EKH A;  1F55 A;  2WND A;  1B47 A;  5GQQ C;  5AFP A;  1IJ6 A;  1OMR A;  3FIA A;  1NIW A;  3CTN A;  1TOP A;  1YVH A;  3I5I C;  1S6C A;  1KK7 Z;  1PVB A;  3CS1 A;  1CLL A;  3D0Y A;  2KBM A;  1QXP A;  5HKY A;  2SAS A;  2MLE C;  2MAZ A;  3DF0 A;  1DJW A;  1ZOT B;  1CM1 A;  1KFU L;  1BMO A;  3TZ1 A;  1AJ4 A;  3JVT B;  2FCE A;  3SG3 A;  1S1E A;  3TS5 B;  1F8H A;  1G8I A;  4C0K A;  3KO0 A;  1SRA A;  1QAT A;  4YGD B;  3SG2 A;  4ICB A;  2K7B A;  5HLV A;  1SR6 C;  1J1E A;  2JOJ A;  3DVE A;  1B8C A;  4E68 A;  1W7I B;  2KYC A;  4DUQ A;  1S5G Y;  1WRL A;  2L4I A;  1S26 D;  1U5I B;  2I2R E;  4MSP A;  3SG6 A;  3CR5 X;  3CR2 A;  1DJZ A;  4PHK A;  1F54 A;  1UHK A;  1QIW A;  1QVI Z;  3FS7 A;  2LP3 A;  3C1V A;  1D1O A;  1ZUZ A;  1C7W A;  2WCB A;  2M29 A;  3NSK A;  1YX7 A;  5IBW A;  2Y1N A;  4GPL B;  2ZN8 A;  4QJ5 B;  2AMI A;  3EVU A;  1WLZ A;  2I18 A;  1Y1X A;  2JXL A;  4ORC B;  3OHM B;  1ZFS A;  4Q04 A;  2TN4 A;  1NX0 A;  1EH2 A;  1HT9 A;  1QLK A;  1Y6W A;  2KAX A;  1CLB A;  2NXQ A;  1TNX A;  2L0P A;  4JWQ A;  1CDN A;  3VRP A;  3OB1 B;  1WDC C;  4P5O E;  2KI4 B;  1B7T Y;  1PK0 D;  4U8D A;  1M46 A;  2GGZ A;  2KOT A;  4PE7 A;  1PSB A;  2JWW A;  1LA0 A;  4I5K A;  1UHN A;  1YUR A;  2OTG B;  5PAL A;  2JTZ A;  1XYD A;  3GK2 A;  4FTG A;  4MRX A;  3CWG A;  1GGZ A;  2WCF A;  1KQM B;  5JOL A;  1MXL C;  2EC6 C;  1Y1U A;  3KHE A;  5DKQ A;  4CFQ A;  3WNX B;  1OE9 B;  1SYM A;  1QS7 A;  2L5X B;  1WY9 A;  1NCZ A;  1AVS A;  2M0R A;  1K90 D;  4MRY A;  4FQO A;  1KK7 Y;  4YGA A;  1SR6 B;  2JT3 A;  3TDU A;  4XYN A;  4MZJ A;  1H8B A;  5D7F A;  1BR4 B;  1KK8 C;  2LLU A;  4QJ3 B;  3SJS A;  1MHO A;  5FYX A;  1VRK A;  1MWN A;  1M31 A;  1S36 A;  3TDZ A;  1PAL A;  1M63 B;  4HRH A;  2ISD A;  3EVV A;  3RLZ A;  1NCY A;  4JPZ B;  4C0L A;  1KFX S;  1WLM A;  2PAS A;  1FW4 A;  1PUL A;  2LV7 A;  1RWY A;  3FWC A;  1CDL A;  2GV5 A;  3PAT A;  4ZCV A;  3NSI A;  1MQ1 A;  1QLS A;  3AAK A;  4M2O A;  1QVI Y;  2Y4Q A;  1M39 A;  1BU3 A;  3I5F C;  3CZT X;  3KPX A;  3EKJ A;  2R2I A;  1UHI A;  5CSJ A;  2HQW A;  1B4C A;  2CCM A;  1KFU S;  2LMU A;  1OOJ A;  2IS9 A;  1QAS A;  3ZNI A;  5BPJ A;  4A4C A;  1IRJ A;  4WQ2 A;  1OZS A;  3VRR A;  2QPT A;  3ZWH A;  1FI5 A;  2L51 A;  1DGV A;  3IQO A;  4HRE E;  3PAL A;  5I2L A;  4DRW A;  4OV2 A;  4XJK B;  2BCB A;  1W7J B;  4M2P A;  4UPG A;  1SY9 A;  2KI6 C;  1KWO C;  2AAO A;  1DJH A;  2BKI B;  1PSR A;  4NQG A;  2JZI A;  2KGR A;  1CLM A;  3AAJ A;  1RK9 A;  3VRO A;  4OVN F;  2M49 B;  1DGU A;  5ER4 X;  1K93 D;  2M97 A;  2NLN A;  3VGO A;  1AP4 A;  1BR1 B;  2JTT A;  3PN7 B;  2BEC A;  5AAN A;  1F71 A;  2JNF A;  2FCD A;  1NP8 A;  1B8R A;  2I7A A;  1ALV A;  2LAN A;  2ZNE A; 
#chains in the Genus database with same CATH topology
 3D10 A;  4OZD A;  3AKA A;  5I2Q A;  1SL7 A;  1IGV A;  2NZ0 A;  2EGD A;  4PHN A;  2M1U A;  2QEB A;  3D75 A;  4AQI A;  4GFT A;  1OW4 A;  4MEW A;  1T14 A;  1UWO A;  1MR8 A;  3BUX B;  3SS5 A;  1K2H A;  3CZ0 A;  4INX A;  1BOC A;  2PMY A;  1SCM B;  2K8M B;  5DIC A;  4GGF A;  1ZAC A;  1SCV A;  3EK8 A;  1JFK A;  3K21 A;  1KSO A;  4D1E A;  1XFV O;  3AKB A;  2MBX A;  4INW A;  1CM4 A;  4P2Y B;  4F0Z B;  1NWD A;  2KQ6 A;  1EJ3 A;  1DF0 A;  3I5F B;  1A75 B;  3OGN A;  2K2A A;  2KFG A;  2PSR A;  3LLE A;  1EXR A;  1J7Q A;  4OR9 B;  1SW8 A;  1K96 A;  1AHR A;  1SBJ A;  2M9G A;  1K8U A;  2BL0 C;  2JNX A;  1QV0 A;  2BAP A;  3SG7 A;  2BNX A;  5I8N A;  1C07 A;  4PE4 A;  3VRQ A;  2K2F A;  1V1G A;  2E6W A;  4ETO A;  5D3O A;  3SIA A;  5KU1 A;  4ZCU A;  1KCY A;  1DJG A;  3IQQ A;  3B87 A;  2ZRT A;  5G08 A;  2LHI A;  2KAV A;  3V2L A;  1R6P A;  2BBN A;  4DS7 A;  4TNC A;  1YRT B;  2QAC A;  1K95 A;  4PE1 A;  1CTR A;  1C7V A;  1S3P A;  3BJH A;  2E30 A;  1N0Y A;  3I5G C;  1CFP A;  1LIN A;  2JQ6 A;  1E8A A;  1UP5 A;  3S0G A;  2FOT A;  3L4L A;  1BJF A;  1OMD A;  2VRG A;  1A2X A;  1EG3 A;  1AUI B;  1PVA A;  1XFY O;  2WC6 A;  3FE6 A;  1IIO A;  3D76 A;  4MZK A;  1L2O C;  4IL1 A;  3BUO B;  3I5I B;  1YUS A;  1A4P A;  3BOW B;  1TUJ A;  1YR5 A;  2KI6 D;  4PDZ A;  3O4Y A;  5CSN A;  2LCP A;  3BQ3 A;  1REC A;  2G2B A;  2K7D A;  1FI6 A;  1RJV A;  1AK8 A;  3I5H C;  1J7R A;  1LVC D;  4WQ3 A;  2NCP A;  3Q8I A;  1RFJ A;  1A29 A;  1U5I A;  2H61 A;  2L50 A;  3ICB A;  4GAO A;  3O78 A;  2BE4 A;  3PM8 A;  1SK6 D;  1TNP A;  2K61 A;  1OZO A;  1QIV A;  3WHU B;  2LC5 A;  3CAB A;  1JF2 A;  4F7F A;  1NX3 A;  1SNL A;  1NCX A;  1SL8 A;  4CPV A;  1FPW A;  3RZS A;  2LUC A;  3TUY C;  1DVI A;  1IG5 A;  1PRW A;  1YUU A;  2L5Y A;  2WCK A;  2ZN9 A;  1JSA A;  2V53 A;  1NX2 A;  2BCX A;  2SCP A;  3HX4 A;  3RM1 A;  1MF8 B;  1TNW A;  1JFJ A;  2G9B A;  1EG4 A;  4MN0 A;  5HLO A;  3BUM B;  1G4Y R;  5JJG A;  1OOF A;  2F2O A;  2JPT A;  2LHL A;  2PVB A;  2KNE A;  1JC2 A;  2I94 A;  3BUW B;  3NSL A;  1NPQ A;  1Q80 A;  1DMO A;  3UNW A;  2BE6 A;  1IWQ A;  4MZL A;  1WDC B;  5KTY A;  4AQJ A;  2KLD A;  5FI6 A;  3BOW A;  3PFV A;  2K7O A;  1CKK A;  2ZRS A;  1DTL A;  1DT7 B;  1QX5 B;  5B8I B;  1UHH A;  3TS5 C;  1ALW A;  2Q91 A;  1F4O A;  1N65 A;  1K94 A;  2GTE A;  1ORG A;  2EC6 B;  3DF0 B;  2M7N A;  3SS3 A;  1RTP 1;  2KQY A;  1YVL A;  4MBE A;  4PE0 A;  3D78 A;  1K9U A;  2JRF A;  1TCF A;  2LAP A;  2K0J A;  3BUN B;  2LVJ A;  4USL A;  3PLF B;  2CBL A;  3MSE B;  2GGM A;  1QV1 A;  2OPO A;  2O5G A;  3S0E A;  1Y0V H;  4GUK A;  5D69 A;  1C3Z A;  2QEO A;  2MJW B;  4YRU A;  2L4H A;  3KEV A;  5ER5 A;  5TNC A;  2WC5 A;  1DJX A;  3F45 A;  1XFZ O;  1QX2 A;  4OCI A;  1EL4 A;  1JBA A;  3TUY B;  1G33 A;  4N1G A;  5AEQ A;  3B88 A;  1IQ3 A;  2WCL A;  4R1E A;  4DCK A;  1KK8 B;  5CSF A;  4OKH A;  1XK4 A;  1UUR A;  2M1K B;  2BBM A;  2LVV A;  1QTX A;  4GNK B;  3O6B A;  2JPO A;  4CFR A;  3R72 A;  2LVI A;  2L2E A;  2P71 A;  1Z2C B;  5HKW A;  1IKU A;  1CFF A;  4PT1 A;  4PAL A;  1OMV A;  2KDH A;  1CMG A;  2KFH A;  3LL8 B;  1KQV A;  1NUB A;  2LLS A;  3EG5 B;  1J7O A;  4YGE B;  1SPY A;  3DVJ A;  2OTG C;  2JXC A;  2K60 A;  1OOG A;  1GQM A;  2KAY A;  2L2C A;  2MA2 A;  3EVR A;  4YI9 A;  2KSP A;  4KYN A;  4YGB B;  2MRD A;  1KQM C;  4NDB A;  1CB1 A;  2F3Y A;  3LK0 A;  3O2P A;  4PCW A;  3H4S E;  4AOM A;  2Y5I A;  1TCO B;  3OP0 A;  1KSM A;  4XJK A;  1ZMZ A;  3WHT B;  1N2D A;  3DXL A;  2H2K A;  2HPS A;  2F3Z A;  1P28 A;  3DD4 A;  3E3R A;  4I5L B;  4CID A;  1QWV A;  4YI8 A;  1XFX O;  2F2P A;  2Y1M A;  1LKJ A;  3SG5 A;  2HET A;  1XFU O;  3M0W A;  3OX5 A;  4M2Q A;  3NHI A;  1NX1 A;  2CXJ A;  3JTD C;  4I5J A;  2LLT A;  3BFB A;  1NYA A;  1KWO B;  1SSE B;  4QJ4 B;  3NSO A;  3QRX A;  4NDD A;  2KFF A;  1JWD A;  3PSR A;  3QME A;  1CFD A;  3BFA A;  5FI7 A;  3GK4 X;  5HL1 A;  2K7C A;  2M3W A;  3GK1 A;  3DVM A;  1B8L A;  2BCA A;  3A4U B;  1ODB A;  3SG4 A;  1CNP A;  1C3Y A;  3S0F A;  1JF0 A;  1MXE A;  2MHH A;  1TUZ A;  1XK4 C;  1H4B A;  4ORB B;  3S0D A;  3L47 A;  4N1F A;  3VRN A;  4MVF A;  1IH0 A;  4FQT A;  5F6T A;  1LXF C;  4JQ0 D;  3DY9 A;  2KYF A;  2P6B B;  5EL2 A;  4GGF C;  3OB2 B;  2WOS A;  2JT0 A;  1QJT A;  1YRU B;  3UO9 A;  1K9P A;  1A75 A;  1J55 A;  2EHB A;  2ZFD A;  1BLQ A;  3N7H A;  4MLW A;  4PHM A;  1XO5 A;  3IF7 A;  1Y1A A;  1RRO A;  2LP2 A;  2LUX A;  1DJY A;  3K1E A;  1BG1 A;  5K89 A;  2HQ8 A;  3CR4 X;  2NCO A;  2O60 A;  2JUL A;  2RGI A;  3B6X A;  3CLN A;  1XA5 A;  3LK1 A;  4YBH B;  1BOD A;  1GGW A;  2F8P A;  1M45 A;  2ZND A;  1CFC A;  1BF5 A;  1B1G A;  1TIZ A;  1QX7 A;  3FWB A;  2M7L A;  2BL0 B;  3S0A A;  3BXK A;  3SS4 A;  2A4J A;  3B86 A;  2LMV A;  1A03 A;  2BKH B;  4GBA A;  1WRK A;  2OS8 C;  1LA3 A;  2PAL A;  1UUS A;  2F33 A;  2QEV A;  1TRF A;  4C0J A;  1DJI A;  1CMF A;  5J3X A;  3OX6 A;  1HQV A;  4HRG A;  1MUX A;  2WC8 A;  3PN7 C;  1DC1 A;  3OBV A;  1IQ5 A;  3JTD B;  3KF9 A;  3PJI A;  5CSI A;  3CDN A;  1FF1 A;  2WCM A;  1YUT A;  2KGB C;  4JKT A;  1W9Z A;  1IJ5 A;  1K9K A;  1UHJ A;  1BT6 A;  3I5G B;  1SKT A;  1XVJ A;  2FJY A;  2KHN A;  5HYD A;  5AXI A;  3JVT C;  4ORA B;  1S5G Z;  2COL B;  2MLF C;  3R1V A;  2CT9 A;  3D74 A;  4DIR A;  3TDI A;  2PRU A;  2M8U A;  5HKZ A;  1SCM C;  3NXA A;  3HCM A;  1TTX A;  3D0Y B;  1L2O B;  2LM5 A;  2AUC A;  3LCP C;  3SIB A;  1OSA A;  1V1F A;  2JU0 A;  2KBI A;  3CGA A;  4N5X A;  2B1U A;  4BY5 A;  4YGC B;  5I94 A;  4A4B A;  1OQP A;  4HSZ A;  2LVK A;  4BY4 A;  3DYE A;  2LMT A;  3NGV A;  4GGN A;  1B9A A;  3WXA A;  3D77 A;  2FJU B;  3GOF A;  4PHJ A;  5AER A;  3DVK A;  1WRZ A;  1CDM A;  2JC2 A;  1TN4 A;  2L98 A;  2H61 C;  1GJY A;  3EK7 A;  4CLN A;  1F70 A;  3I5H B;  2PYQ A;  4I5N B;  4NDC A;  4WRI A;  1R2U A;  2JT8 A;  2D8N A;  5CPV A;  1TNQ A;  1X02 A;  5DKR A;  1L7Z A;  2WCH A;  2LNK A;  3FE8 A;  5DKN A;  1DF0 B;  1YX8 A;  1CDP A;  1B7T Z;  1JUO A;  1SL9 A;  1J1D A;  1S6J A;  5I2O A;  2Q4U A;  2CTN A;  1J7P A;  1S6I A;  5KSZ A;  4L9M A;  2HF5 A;  1XFW O;  3EK4 A;  2DOQ A;  1AJ5 A;  1YTZ C;  3CYZ A;  2WCE A;  1FBV A;  2LE9 B;  3A8R A;  3BYA A;  2ZKM X;  1NSH A;  1F4Q A;  2CNP A;  2KI4 C;  2OS8 B;  1SMG A;  2WOR A;  1KFX L;  3EKH A;  1F55 A;  2WND A;  3R1P A;  1B47 A;  5GQQ C;  5AFP A;  1IJ6 A;  1OMR A;  3FIA A;  1NIW A;  3CTN A;  1TOP A;  3CZ1 A;  1YVH A;  3I5I C;  1S6C A;  1KK7 Z;  1PVB A;  3CS1 A;  1CLL A;  3D0Y A;  2KBM A;  1QXP A;  5HKY A;  2SAS A;  2MLE C;  2MAZ A;  3DF0 A;  1DJW A;  1ZOT B;  1CM1 A;  1KFU L;  1BMO A;  3TZ1 A;  1AJ4 A;  2WCJ A;  2ERB A;  3JVT B;  2FCE A;  3SG3 A;  1S1E A;  3TS5 B;  1F8H A;  1G8I A;  4C0K A;  3KO0 A;  1SRA A;  1QAT A;  4YGD B;  3SG2 A;  4ICB A;  3VB1 A;  2K7B A;  5HLV A;  1SR6 C;  1J1E A;  2JOJ A;  3DVE A;  1B8C A;  1LS8 A;  4E68 A;  3IVT A;  3O4X A;  1W7I B;  2KYC A;  4DUQ A;  1S5G Y;  1WRL A;  2L4I A;  1S26 D;  1OOH A;  1U5I B;  2I2R E;  4MSP A;  3SG6 A;  3CR5 X;  3CR2 A;  1DJZ A;  4PHK A;  1F54 A;  1UHK A;  1QIW A;  1QVI Z;  3FS7 A;  2LP3 A;  3C1V A;  1D1O A;  1ZUZ A;  1C7W A;  2WCB A;  2M29 A;  3NSK A;  1YX7 A;  3S0B A;  5IBW A;  2Y1N A;  4GPL B;  2ZN8 A;  4QJ5 B;  2AMI A;  3EVU A;  1WLZ A;  2I18 A;  1Y1X A;  2JXL A;  4ORC B;  3CZ2 A;  3OHM B;  1ZFS A;  3BFH A;  4Q04 A;  2TN4 A;  1NX0 A;  1XFR A;  1EH2 A;  1HT9 A;  1QLK A;  1Y6W A;  3NHT A;  1DEK A;  2KAX A;  1CLB A;  2NXQ A;  1TNX A;  2L0P A;  4JWQ A;  1CDN A;  3VRP A;  3OB1 B;  1WDC C;  3B7A A;  2KI4 B;  3D73 A;  4P5O E;  1B7T Y;  1PK0 D;  4U8D A;  1M46 A;  2GGZ A;  2KOT A;  4PE7 A;  1PSB A;  2JWW A;  1LA0 A;  4I5K A;  1UHN A;  1YUR A;  2OTG B;  1DQE A;  2JTZ A;  1XYD A;  5PAL A;  2KPH A;  3GK2 A;  4FTG A;  4MRX A;  3CWG A;  1GGZ A;  2WCF A;  1KQM B;  5JOL A;  1MXL C;  2EC6 C;  1Y1U A;  3KHE A;  2QEH A;  5DKQ A;  4CFQ A;  3WNX B;  1OE9 B;  1SYM A;  1QS7 A;  2L5X B;  1WY9 A;  1NCZ A;  4JD9 A;  1AVS A;  2M0R A;  1K90 D;  4MRY A;  4FQO A;  1KK7 Y;  2P70 A;  2H8V A;  3L4A A;  4YGA A;  1SR6 B;  2JT3 A;  3TDU A;  4XYN A;  4MZJ A;  1H8B A;  1Z4H A;  5D7F A;  1BR4 B;  1KK8 C;  2LLU A;  4QJ3 B;  3SJS A;  1MHO A;  2YGU A;  5FYX A;  1VRK A;  1MWN A;  1M31 A;  1S36 A;  2QDI A;  1GM0 A;  3TDZ A;  3PM2 A;  1TWO A;  1PAL A;  1M63 B;  4HRH A;  2ISD A;  3EVV A;  3RLZ A;  1NCY A;  4JPZ B;  4C0L A;  1KFX S;  1WLM A;  2PAS A;  1FW4 A;  1PUL A;  2LV7 A;  1RWY A;  3FWC A;  1CDL A;  2GV5 A;  2KLE A;  3PAT A;  4ZCV A;  3NSI A;  1MQ1 A;  1QLS A;  3AAK A;  3R1O A;  4M2O A;  1QVI Y;  2Y4Q A;  1M39 A;  1BU3 A;  3I5F C;  3CZT X;  3KPX A;  3EKJ A;  2R2I A;  3DZT A;  1UHI A;  5CSJ A;  2HQW A;  1B4C A;  2CCM A;  1KFU S;  2LMU A;  1OOJ A;  2IS9 A;  1QAS A;  2PQL A;  5FI2 A;  4IJ7 A;  3ZNI A;  5BPJ A;  4A4C A;  1IRJ A;  4WQ2 A;  1OZS A;  3VRR A;  2QPT A;  3ZWH A;  1FI5 A;  2L51 A;  1DGV A;  3IQO A;  4HRE E;  3PAL A;  5I2L A;  4DRW A;  3FE9 A;  4OV2 A;  4XJK B;  2BCB A;  1W7J B;  4M2P A;  4UPG A;  1SY9 A;  2KI6 C;  1OOI X;  1KWO C;  2AAO A;  1DJH A;  2BKI B;  1PSR A;  4NQG A;  2JZI A;  2KGR A;  1CLM A;  1DEL A;  3AAJ A;  1RK9 A;  3VRO A;  4OVN F;  2M49 B;  1DGU A;  5ER4 X;  1K93 D;  2M97 A;  2NLN A;  3VGO A;  1AP4 A;  1BR1 B;  2JTT A;  3PN7 B;  2BEC A;  5AAN A;  1F71 A;  2JNF A;  2FCD A;  1NP8 A;  1B8R A;  2I7A A;  1ALV A;  2LAN A;  2ZNE A; 
#chains in the Genus database with same CATH homology
 3D10 A;  3AKA A;  5I2Q A;  1SL7 A;  1IGV A;  2NZ0 A;  2EGD A;  4PHN A;  2M1U A;  4AQI A;  4GFT A;  4MEW A;  1UWO A;  3BUX B;  1MR8 A;  1K2H A;  1BOC A;  2PMY A;  1SCM B;  2K8M B;  4GGF A;  1ZAC A;  1SCV A;  3EK8 A;  1JFK A;  3K21 A;  1KSO A;  4D1E A;  1XFV O;  3AKB A;  2MBX A;  1CM4 A;  4P2Y B;  4F0Z B;  1NWD A;  2KQ6 A;  1EJ3 A;  1DF0 A;  3I5F B;  1A75 B;  2K2A A;  2KFG A;  2PSR A;  3LLE A;  1EXR A;  1J7Q A;  4OR9 B;  1SW8 A;  1K96 A;  1AHR A;  1SBJ A;  2M9G A;  1K8U A;  2BL0 C;  2JNX A;  1QV0 A;  3SG7 A;  5I8N A;  1C07 A;  4PE4 A;  3VRQ A;  2K2F A;  1V1G A;  2E6W A;  4ETO A;  3SIA A;  5KU1 A;  4ZCU A;  1KCY A;  1DJG A;  3IQQ A;  2ZRT A;  5G08 A;  2LHI A;  2KAV A;  1R6P A;  2BBN A;  4DS7 A;  4TNC A;  1YRT B;  2QAC A;  1K95 A;  4PE1 A;  1CTR A;  1C7V A;  1S3P A;  3I5G C;  2E30 A;  1N0Y A;  1CFP A;  1LIN A;  2JQ6 A;  1E8A A;  1UP5 A;  2FOT A;  1BJF A;  1OMD A;  2VRG A;  1A2X A;  1EG3 A;  1AUI B;  1PVA A;  1XFY O;  4MZK A;  1L2O C;  4IL1 A;  3BUO B;  3I5I B;  1YUS A;  1A4P A;  3BOW B;  1YR5 A;  2KI6 D;  4PDZ A;  3O4Y A;  5CSN A;  2LCP A;  3BQ3 A;  1REC A;  2G2B A;  2K7D A;  1FI6 A;  1RJV A;  1AK8 A;  3I5H C;  1J7R A;  1LVC D;  4WQ3 A;  2NCP A;  1RFJ A;  1A29 A;  1U5I A;  2H61 A;  2L50 A;  3ICB A;  4GAO A;  3O78 A;  2BE4 A;  3PM8 A;  1SK6 D;  1TNP A;  2K61 A;  1OZO A;  1QIV A;  3WHU B;  2LC5 A;  1JF2 A;  1NX3 A;  1SNL A;  1NCX A;  1SL8 A;  4CPV A;  1FPW A;  3TUY C;  2LUC A;  1DVI A;  1IG5 A;  1PRW A;  1YUU A;  2ZN9 A;  1JSA A;  2V53 A;  1NX2 A;  2BCX A;  2SCP A;  3HX4 A;  3RM1 A;  1MF8 B;  1TNW A;  1JFJ A;  2G9B A;  1EG4 A;  4MN0 A;  5HLO A;  3BUM B;  1G4Y R;  5JJG A;  2F2O A;  2JPT A;  2LHL A;  2PVB A;  2KNE A;  1JC2 A;  2I94 A;  3BUW B;  3NSL A;  1NPQ A;  1Q80 A;  1DMO A;  2BE6 A;  1IWQ A;  4MZL A;  1WDC B;  5KTY A;  4AQJ A;  3BOW A;  3PFV A;  2K7O A;  1CKK A;  2ZRS A;  1DTL A;  1DT7 B;  1QX5 B;  5B8I B;  1UHH A;  3TS5 C;  1ALW A;  2Q91 A;  1F4O A;  1N65 A;  1K94 A;  2EC6 B;  3DF0 B;  2M7N A;  1RTP 1;  2KQY A;  1YVL A;  4MBE A;  4PE0 A;  1K9U A;  2JRF A;  1TCF A;  2LAP A;  2K0J A;  3BUN B;  2LVJ A;  4USL A;  3PLF B;  2CBL A;  3MSE B;  2GGM A;  1QV1 A;  2OPO A;  2O5G A;  1Y0V H;  4GUK A;  5D69 A;  4YRU A;  2MJW B;  2L4H A;  3KEV A;  5ER5 A;  5TNC A;  1DJX A;  3F45 A;  1XFZ O;  1QX2 A;  4OCI A;  1EL4 A;  1JBA A;  3TUY B;  1G33 A;  4N1G A;  5AEQ A;  1IQ3 A;  4R1E A;  4DCK A;  1KK8 B;  5CSF A;  4OKH A;  1XK4 A;  1UUR A;  2M1K B;  2BBM A;  2LVV A;  1QTX A;  4GNK B;  3O6B A;  4CFR A;  2LVI A;  2L2E A;  5HKW A;  1IKU A;  1CFF A;  4PAL A;  1OMV A;  2KDH A;  1CMG A;  2KFH A;  3LL8 B;  1KQV A;  1NUB A;  2LLS A;  1J7O A;  4YGE B;  1SPY A;  3DVJ A;  2OTG C;  2JXC A;  3EVR A;  1GQM A;  2KAY A;  4YI9 A;  2MA2 A;  4YGB B;  2KSP A;  2MRD A;  1KQM C;  4NDB A;  1CB1 A;  2F3Y A;  3LK0 A;  3O2P A;  4PCW A;  3H4S E;  4AOM A;  2Y5I A;  1TCO B;  3OP0 A;  1KSM A;  4XJK A;  1ZMZ A;  3WHT B;  1N2D A;  2H2K A;  2HPS A;  2F3Z A;  3DD4 A;  3E3R A;  4I5L B;  4CID A;  4YI8 A;  1XFX O;  2F2P A;  2Y1M A;  1LKJ A;  3SG5 A;  2HET A;  1XFU O;  3M0W A;  3OX5 A;  4M2Q A;  1NX1 A;  2CXJ A;  3JTD C;  4I5J A;  2LLT A;  1NYA A;  1KWO B;  4QJ4 B;  3NSO A;  3QRX A;  4NDD A;  2KFF A;  1JWD A;  3PSR A;  1CFD A;  3GK4 X;  2K7C A;  2M3W A;  3GK1 A;  3DVM A;  1B8L A;  2BCA A;  3A4U B;  1ODB A;  3SG4 A;  1CNP A;  1JF0 A;  1MXE A;  2MHH A;  1H4B A;  1XK4 C;  4ORB B;  4N1F A;  3VRN A;  4MVF A;  1IH0 A;  5F6T A;  1LXF C;  4JQ0 D;  2KYF A;  2P6B B;  4GGF C;  3OB2 B;  2WOS A;  2JT0 A;  1QJT A;  1YRU B;  1K9P A;  1A75 A;  1J55 A;  2EHB A;  2ZFD A;  1BLQ A;  4MLW A;  4PHM A;  1XO5 A;  3IF7 A;  1Y1A A;  1RRO A;  2LP2 A;  2LUX A;  1DJY A;  1BG1 A;  5K89 A;  2HQ8 A;  3CR4 X;  2NCO A;  2O60 A;  2JUL A;  2RGI A;  3CLN A;  1XA5 A;  3LK1 A;  4YBH B;  1BOD A;  1GGW A;  2F8P A;  1M45 A;  2ZND A;  1CFC A;  1BF5 A;  1B1G A;  1TIZ A;  1QX7 A;  3FWB A;  2M7L A;  2BL0 B;  3BXK A;  2A4J A;  2LMV A;  1A03 A;  2BKH B;  4GBA A;  1WRK A;  2OS8 C;  1LA3 A;  2PAL A;  1UUS A;  2F33 A;  1TRF A;  4C0J A;  1DJI A;  1CMF A;  5J3X A;  3OX6 A;  1HQV A;  4HRG A;  1MUX A;  2WC8 A;  3PN7 C;  1FF1 A;  1IQ5 A;  3JTD B;  3KF9 A;  5CSI A;  1YUT A;  2KGB C;  1IJ5 A;  1K9K A;  1UHJ A;  1BT6 A;  3I5G B;  1SKT A;  1XVJ A;  2KHN A;  5HYD A;  5AXI A;  3JVT C;  4ORA B;  1S5G Z;  2COL B;  2MLF C;  2CT9 A;  4DIR A;  3TDI A;  2PRU A;  2M8U A;  5HKZ A;  1SCM C;  3NXA A;  3HCM A;  1TTX A;  3D0Y B;  1L2O B;  2LM5 A;  2AUC A;  3LCP C;  3SIB A;  1OSA A;  1V1F A;  2JU0 A;  2KBI A;  3CGA A;  4N5X A;  2B1U A;  4BY5 A;  4YGC B;  4A4B A;  1OQP A;  4HSZ A;  2LVK A;  4BY4 A;  3WXA A;  2LMT A;  4GGN A;  1B9A A;  3GOF A;  2FJU B;  4PHJ A;  5AER A;  3DVK A;  1WRZ A;  1CDM A;  2JC2 A;  1TN4 A;  2L98 A;  2H61 C;  1GJY A;  3EK7 A;  4CLN A;  1F70 A;  3I5H B;  4I5N B;  4NDC A;  4WRI A;  1R2U A;  2JT8 A;  2D8N A;  5CPV A;  1TNQ A;  1X02 A;  5DKR A;  1L7Z A;  2LNK A;  5DKN A;  1DF0 B;  1YX8 A;  1CDP A;  1B7T Z;  1JUO A;  1SL9 A;  1J1D A;  1S6J A;  5I2O A;  2Q4U A;  2CTN A;  1J7P A;  1S6I A;  5KSZ A;  4L9M A;  2HF5 A;  1XFW O;  3EK4 A;  2DOQ A;  1AJ5 A;  1YTZ C;  2WCE A;  1FBV A;  2LE9 B;  3A8R A;  3BYA A;  2ZKM X;  1NSH A;  1F4Q A;  2CNP A;  2KI4 C;  2OS8 B;  1SMG A;  2WOR A;  1KFX L;  3EKH A;  1F55 A;  2WND A;  1B47 A;  5GQQ C;  5AFP A;  1IJ6 A;  1OMR A;  3FIA A;  1NIW A;  3CTN A;  1TOP A;  1YVH A;  3I5I C;  1S6C A;  1KK7 Z;  1PVB A;  3CS1 A;  1CLL A;  3D0Y A;  2KBM A;  1QXP A;  5HKY A;  2SAS A;  2MLE C;  2MAZ A;  3DF0 A;  1DJW A;  1ZOT B;  1CM1 A;  1KFU L;  1BMO A;  3TZ1 A;  1AJ4 A;  3JVT B;  2FCE A;  3SG3 A;  1S1E A;  3TS5 B;  1F8H A;  1G8I A;  4C0K A;  3KO0 A;  1SRA A;  1QAT A;  4YGD B;  3SG2 A;  4ICB A;  2K7B A;  5HLV A;  1SR6 C;  1J1E A;  2JOJ A;  3DVE A;  1B8C A;  4E68 A;  1W7I B;  2KYC A;  4DUQ A;  1S5G Y;  1WRL A;  2L4I A;  1S26 D;  1U5I B;  2I2R E;  4MSP A;  3SG6 A;  3CR5 X;  3CR2 A;  1DJZ A;  4PHK A;  1F54 A;  1UHK A;  1QIW A;  1QVI Z;  3FS7 A;  2LP3 A;  3C1V A;  1D1O A;  1ZUZ A;  1C7W A;  2WCB A;  2M29 A;  3NSK A;  1YX7 A;  5IBW A;  2Y1N A;  4GPL B;  2ZN8 A;  4QJ5 B;  2AMI A;  3EVU A;  1WLZ A;  2I18 A;  1Y1X A;  2JXL A;  4ORC B;  3OHM B;  1ZFS A;  4Q04 A;  2TN4 A;  1NX0 A;  1EH2 A;  1HT9 A;  1QLK A;  1Y6W A;  2KAX A;  1CLB A;  2NXQ A;  1TNX A;  2L0P A;  4JWQ A;  1CDN A;  3VRP A;  3OB1 B;  1WDC C;  4P5O E;  2KI4 B;  1B7T Y;  1PK0 D;  4U8D A;  1M46 A;  2GGZ A;  2KOT A;  4PE7 A;  1PSB A;  2JWW A;  1LA0 A;  4I5K A;  1UHN A;  1YUR A;  2OTG B;  5PAL A;  2JTZ A;  1XYD A;  3GK2 A;  4FTG A;  4MRX A;  3CWG A;  1GGZ A;  2WCF A;  1KQM B;  5JOL A;  1MXL C;  2EC6 C;  1Y1U A;  3KHE A;  5DKQ A;  4CFQ A;  3WNX B;  1OE9 B;  1SYM A;  1QS7 A;  2L5X B;  1WY9 A;  1NCZ A;  1AVS A;  2M0R A;  1K90 D;  4MRY A;  4FQO A;  1KK7 Y;  4YGA A;  1SR6 B;  2JT3 A;  3TDU A;  4XYN A;  4MZJ A;  1H8B A;  5D7F A;  1BR4 B;  1KK8 C;  2LLU A;  4QJ3 B;  3SJS A;  1MHO A;  5FYX A;  1VRK A;  1MWN A;  1M31 A;  1S36 A;  3TDZ A;  1PAL A;  1M63 B;  4HRH A;  2ISD A;  3EVV A;  3RLZ A;  1NCY A;  4JPZ B;  4C0L A;  1KFX S;  1WLM A;  2PAS A;  1FW4 A;  1PUL A;  2LV7 A;  1RWY A;  3FWC A;  1CDL A;  2GV5 A;  3PAT A;  4ZCV A;  3NSI A;  1MQ1 A;  1QLS A;  3AAK A;  4M2O A;  1QVI Y;  2Y4Q A;  1M39 A;  1BU3 A;  3I5F C;  3CZT X;  3KPX A;  3EKJ A;  2R2I A;  1UHI A;  5CSJ A;  2HQW A;  1B4C A;  2CCM A;  1KFU S;  2LMU A;  1OOJ A;  2IS9 A;  1QAS A;  3ZNI A;  5BPJ A;  4A4C A;  1IRJ A;  4WQ2 A;  1OZS A;  3VRR A;  2QPT A;  3ZWH A;  1FI5 A;  2L51 A;  1DGV A;  3IQO A;  4HRE E;  3PAL A;  5I2L A;  4DRW A;  4OV2 A;  4XJK B;  2BCB A;  1W7J B;  4M2P A;  4UPG A;  1SY9 A;  2KI6 C;  1KWO C;  2AAO A;  1DJH A;  2BKI B;  1PSR A;  4NQG A;  2JZI A;  2KGR A;  1CLM A;  3AAJ A;  1RK9 A;  3VRO A;  4OVN F;  2M49 B;  1DGU A;  5ER4 X;  1K93 D;  2M97 A;  2NLN A;  3VGO A;  1AP4 A;  1BR1 B;  2JTT A;  3PN7 B;  2BEC A;  5AAN A;  1F71 A;  2JNF A;  2FCD A;  1NP8 A;  1B8R A;  2I7A A;  1ALV A;  2LAN A;  2ZNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...