1B9AA

Parvalbumin (mutation;d51a, f102w)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
108
structure length
108
Chain Sequence
AFAGVLNDADIAAALEACKAADSFNHKAFFAKVGLTSKSADDVKKAFAIIAQDKSGFIEEDELKLFLQNFKADARALTDGETKTFLKAGDSDGDGKIGVDEWTALVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PARVALBUMIN)
publication title Metal-ion affinity and specificity in EF-hand proteins: coordination geometry and domain plasticity in parvalbumin.
pubmed doi rcsb
source organism Cyprinus carpio
molecule tags Calcium binding protein
total genus 36
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1999-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b9aA00
1JUOA 2FOTA 4M2QA 1JF0A 1MXLC 5AFPA 5FYXA 2FCDA 2I18A 1YX7A 2LUXA 2AAOA 3EKJA 1PALA 2M1KB 3OB2B 2KYCA 1FF1A 1QLKA 1JFKA 3OX6A 4MVFA 1M46A 2CCMA 1XFXO 2BKIB 1NX1A 3PN7C 3SG5A 2Y1MA 2BBNA 2WC8A 4I5LB 1SMGA 1Y1XA 2K7CA 2ZRTA 3PM8A 2LLSA 5PALA 3JTDB 2BL0C 1B7TY 2L0PA 4I5NB 1DT7B 4ZCVA 1CFFA 1K90D 1KWOB 3EK7A 2ZNDA 3LK0A 2CBLA 4PHJA 1MUXA 3KHEA 4XJKA 3OP0A 1LVCD 1SCMC 1UURA 1EG3A 2TN4A 2CTNA 2OTGB 4PCWA 1OMVA 2KQYA 4HREE 1FPWA 1CDMA 1QATA 4YGAA 3WNXB 1S36A 4GAOA 4BY5A 5F6TA 4ORBB 1KK7Z 3PSRA 4JPZB 1YVHA 4DRWA 3KEVA 2BCAA 3PN7B 1YRUB 4NDDA 2JT0A 2O60A 5HKYA 2ZFDA 3SIAA 4MZKA 4UPGA 4PHKA 4YGCB 2LANA 1HT9A 3KF9A 1ZOTB 2LUCA 2F33A 1CDLA 2HQWA 2BL0B 4YGDB 5HKWA 1TNPA 3BYAA 2KAYA 3FIAA 1BLQA 1S3PA 1TOPA 3CZTX 1BOCA 1XFWO 1NX0A 1Y1AA 1XFZO 1QX7A 4M2OA 3CGAA 4QJ3B 1ZMZA 2BBMA 5B8IB 1Y6WA 1A75B 1TCFA 3OHMB 4ICBA 1QIWA 1XK4C 1WRLA 4M2PA 1IJ5A 4AQJA 1F71A 2K61A 1IQ3A 4NDBA 1KQVA 4N5XA 1N2DA 4R1EA 1DJZA 2WCEA 4YGEB 1FI5A 3A4UB 4OR9B 4DUQA 2WNDA 3RLZA 1KQMC 1RJVA 1UWOA 1M31A 3BXKA 1SR6C 3EVUA 4PE1A 2I94A 1CKKA 2KGRA 2LVKA 4A4BA 3FWCA 2JT8A 2KFFA 3DVEA 3GK4X 2B1UA 3NSOA 1ALVA 1AP4A 2CT9A 3AAKA 4QJ5B 2LE9B 2OS8C 2E30A 3HX4A 5I2LA 5DKQA 1CFPA 1XFUO 3VRPA 4FQOA 4GUKA 1QJTA 3H4SE 2LVVA 2G9BA 3DVJA 1XK4A 2COLB 2M3WA 3VROA 2OPOA 1NIWA 1BMOA 1IH0A 1PVBA 1XO5A 2NZ0A 1PRWA 3BUXB 1S6CA 1DJIA 1YX8A 3BUNB 2ZN9A 4P2YB 2F3YA 3DF0B 2M49B 3WHTB 2Y5IA 2K7DA 4YBHB 1OMDA 1KQMB 2LLTA 2MRDA 1SR6B 1SY9A 2HF5A 1KSOA 1KCYA 1IKUA 3SIBA 2KHNA 2KI6D 2IS9A 1M45A 2NLNA 2HQ8A 2KI4C 4GGFA 1F4QA 4WQ2A 1DGVA 2KOTA 1K2HA 5ER4X 2L2EA 4D1EA 2OS8B 4YGBB 1R2UA 2LHLA 1MXEA 1SL7A 1WRZA 4N1FA 2JC2A 4NDCA 1CTRA 1K9UA 3BUWB 2R2IA 1TNXA 1CM1A 2V53A 3K21A 1W7JB 3DVMA 1E8AA 2VRGA 2DOQA 3GOFA 2H2KA 4HRHA 5CSJA 5D7FA 2JOJA 2KFGA 1YR5A 2MJWB 3WXAA 1Y0VH 1EXRA 2HETA 5K89A 2NCOA 1BODA 2JZIA 1KFUS 2K7OA 4AOMA 2LM5A 4XJKB 3NSLA 1KFXL 1YUSA 2GV5A 1K9PA 1MHOA 3TDZA 2KI4B 2O5GA 2NXQA 1OZOA 3EK8A 4XYNA 1S6JA 1AJ5A 3EVRA 2KSPA 1G8IA 1TN4A 2PASA 2SASA 3CLNA 4GFTA 1CLMA 1J55A 3QRXA 1XFVO 1QVIZ 1G33A 3IQQA 2H61A 4PE0A 1BF5A 2I7AA 3BUOB 1A03A 1M63B 1QS7A 2WCBA 2WOSA 3TDUA 1JC2A 3AAJA 3NSKA 1SYMA 3CS1A 1FW4A 4MEWA 1J7OA 1EL4A 1PVAA 3O78A 1NWDA 5HYDA 3PATA 1UHHA 1WLMA 3I5FC 1BJFA 1NCXA 1W7IB 1UHNA 4MN0A 1S26D 1QX2A 4GPLB 1J1DA 1S6IA 1SCVA 2LVIA 3LLEA 3EVVA 1XA5A 2LC5A 3TDIA 3VGOA 2MLFC 4YI9A 1K8UA 2JU0A 2BE6A 2LAPA 2AMIA 3DD4A 1CFCA 1DJYA 3NSIA 2FCEA 4N1GA 2FJUB 2JWWA 1J1EA 1SCMB 3I5HC 4GNKB 3PFVA 2JXCA 1KFUL 5JOLA 1MR8A 2Q91A 5KTYA 2LLUA 1TNQA 4C0JA 1C07A 1N65A 5D69A 2I2RE 4OKHA 1UHIA 3HCMA 4Q04A 2G2BA 3O2PA 3EK4A 3SG3A 3CR4X 1UP5A 5DKNA 1CB1A 1XVJA 1CFDA 1S5GZ 2JTTA 3KPXA 2Q4UA 3I5FB 1QTXA 1SW8A 3E3RA 1G4YR 3LCPC 3VRQA 1YTZC 2LP2A 1GGWA 2KYFA 1TRFA 3C1VA 2ISDA 5KSZA 3PALA 4GGFC 3TZ1A 4MLWA 1XYDA 2KI6C 2Y4QA 4PHMA 3I5HB 4CFRA 4JQ0D 5HLOA 2KAVA 1LA3A 1B8LA 1IWQA 2L51A 1L7ZA 2JNFA 5GQQC 2L50A 1K95A 1U5IA 2BE4A 1RECA 1OQPA 1EG4A 4U8DA 2BKHB 2M0RA 1LA0A 2MA2A 4HRGA 1QASA 1L2OC 1GGZA 5G08A 1JFJA 1CMFA 2EC6C 1DJGA 2KAXA 1NCZA 4YI8A 1F54A 5CPVA 1OZSA 1PSRA 3CR2A 3OB1B 1WY9A 2KBIA 3I5GC 1KFXS 3TS5C 1B47A 1J7RA 1IQ5A 1SKTA 1J7PA 2LP3A 3SG7A 1B8CA 1QVIY 1MF8B 1KK7Y 1NUBA 4CLNA 2M97A 4NQGA 1SK6D 3FS7A 4OVNF 2QPTA 1RROA 5I2QA 1SL9A 2F3ZA 4AQIA 4DIRA 1OSAA 2CXJA 4FTGA 4YRUA 2KBMA 3D0YA 2RGIA 4JWQA 2BCXA 2H61C 2MAZA 4PHNA 1JBAA 1FI6A 5TNCA 2ZRSA 5BPJA 1B9AA 1Y1UA 1IG5A 1DF0A 3DVKA 2K0JA 1SRAA 1L2OB 1DF0B 2JT3A 4MBEA 5AERA 2EC6B 1OOJA 3ZNIA 3AKBA 1DJHA 5AEQA 1ZFSA 1JWDA 1GQMA 4ETOA 1CM4A 4GBAA 4F0ZB 1F4OA 4OCIA 1DTLA 3I5GB 3TUYC 4WQ3A 3EKHA 3TS5B 1B1GA 2KFHA 1RTP1 5HKZA 2K2FA 5ER5A 1BG1A 1F70A 1ODBA 2PALA 4CFQA 2NCPA 2JULA 2AUCA 3BUMB 4C0LA 4I5JA 2F8PA 1S5GY 2CNPA 3MSEB 1A29A 1PK0D 1C7VA 1RFJA 5IBWA 1F8HA 5JJGA 2BECA 4E68A 3SG6A 3AKAA 2JTZA 4ORCB 1F55A 3WHUB 1XFYO 1UHJA 1VRKA 4USLA 2ZN8A 4GGNA 2PVBA 3PLFB 1B4CA 1CNPA 1EH2A 1QXPA 3KO0A 4MRXA 5HLVA 2Y1NA 1KK8C 1DJWA 4IL1A 4OV2A 3GK2A 2KQ6A 1TIZA 2EHBA 3CWGA 3TUYB 2HPSA 3BQ3A 1BU3A 3FWBA 3JVTC 4DCKA 5J3XA 1WRKA 4PDZA 1AJ4A 2QACA 2KDHA 1M39A 1SBJA 1IGVA 1SPYA 2WCFA 4MZLA 4DS7A 3SG4A 1NCYA 5CSNA 2KNEA 2MBXA 1H4BA 1PULA 2ZKMX 2ZNEA 3F45A 1HQVA 2P6BB 2MHHA 3IQOA 1JSAA 1B8RA 5DKRA 2L4IA 1QX5B 2LHIA 3NXAA 5CSIA 2M29A 3A8RA 4MZJA 1NSHA 1DGUA 1CDNA 2WORA 2MLEC 2LMVA 2PMYA 1PSBA 2BCBA 2LNKA 2LV7A 3CTNA 1WLZA 4CPVA 1H8BA 1LXFC 1UUSA 2L4HA 2JNXA 1K93D 1BR4B 3ICBA 1KK8B 1OMRA 3ZWHA 2L5XB 3GK1A 1D1OA 1AK8A 1BR1B 4WRIA 1B7TZ 1CLLA 1A75A 1QV0A 1YVLA 1MWNA 4HSZA 3M0WA 1JF2A 3JVTB 2LMTA 4I5KA 2PRUA 1A4PA 1Q80A 1QV1A 2L98A 2LCPA 2JPTA 5I2OA 2LMUA 3I5IC 3SJSA 1FBVA 2M8UA 3LK1A 4PALA 1WDCC 4ZCUA 3SG2A 4ORAB 1CLBA 2M7NA 1U5IB 3LL8B 2GGMA 5I8NA 1ALWA 1NX3A 1K9KA 2LVJA 4PE7A 4A4CA 1SL8A 1N0YA 1YURA 1J7QA 2E6WA 1V1GA 2GGZA 1NP8A 1C7WA 1ZACA 2SCPA 5AXIA 1SNLA 2A4JA 1YRTB 1NYAA 2EGDA 1V1FA 3BOWA 2M7LA 1TCOB 1IJ6A 3BOWB 3OX5A 4BY4A 5AANA 1TNWA 1AUIB 1CDPA 1MQ1A 3D10A 1RWYA 1A2XA 1BT6A 2JRFA 1ZUZA 5CSFA 4CIDA 1LKJA 4C0KA 2D8NA 1YUUA 4L9MA 2PSRA 1OE9B 1NPQA 1X02A 1YUTA 3O6BA 3I5IB 1LINA 1R6PA 4QJ4B 1TTXA 3DF0A 2JXLA 1QIVA 1WDCB 1AVSA 2F2OA 4MRYA 4MSPA 3RM1A 1KSMA 3D0YB 5KU1A 2JQ6A 1QLSA 1IRJA 4PE4A 1DVIA 3VRNA 1CMGA 1AHRA 2KGBC 4TNCA 1DJXA 2M1UA 1GJYA 3IF7A 3JTDC 2K2AA 3O4YA 3VRRA 1KWOC 2K8MB 1DMOA 2M9GA 4P5OE 1S1EA 1K96A 1UHKA 1EJ3A 1NX2A 2K7BA 2OTGC 2F2PA 3CR5X 1K94A 1RK9A
chains in the Genus database with same CATH superfamily
1JUOA 2FOTA 1DQEA 1JF0A 4M2QA 1MXLC 4PT1A 3S0BA 5AFPA 1QWVA 5FYXA 2FCDA 2I18A 1YX7A 2LUXA 3FE9A 2AAOA 3EKJA 1PALA 2M1KB 3OB2B 2KYCA 1FF1A 3D76A 3O4XA 1QLKA 5FI7A 3NGVA 1JFKA 3OX6A 4MVFA 1M46A 2CCMA 1XFXO 2BKIB 1NX1A 3PN7C 3SG5A 2Y1MA 2BBNA 3L47A 2WC8A 1OOHA 1OOFA 4I5LB 1SMGA 1Y1XA 1C3YA 2K7CA 2ZRTA 3PM8A 2LLSA 5PALA 3JTDB 2BL0C 1B7TY 2L0PA 4I5NB 1DT7B 4ZCVA 1CFFA 1K90D 1KWOB 3EK7A 2PQLA 2ZNDA 2CBLA 3LK0A 1MUXA 1P28A 3KHEA 4PHJA 4XJKA 3OP0A 1LVCD 1SCMC 1UURA 1EG3A 2TN4A 2CTNA 2OTGB 4PCWA 1OMVA 2KQYA 2WCLA 4HREE 1FPWA 3SS3A 1CDMA 1QATA 4YGAA 3WNXB 1S36A 4GAOA 4BY5A 5F6TA 4ORBB 1KK7Z 3PSRA 4JPZB 3UNWA 1YVHA 4DRWA 3OGNA 3DY9A 3KEVA 2BCAA 3PN7B 1YRUB 4NDDA 2JT0A 2O60A 5HKYA 2ZFDA 3SIAA 4MZKA 4UPGA 4PHKA 4YGCB 2LANA 1HT9A 3KF9A 1ZOTB 2LUCA 2WCMA 2F33A 1CDLA 3NHTA 2HQWA 2BL0B 4YGDB 5HKWA 2PYQA 1TNPA 3BYAA 2KAYA 2KLDA 3FIAA 1BLQA 1S3PA 1TOPA 3CZTX 1BOCA 1XFWO 1NX0A 4KYNA 1Y1AA 1XFZO 1QX7A 4M2OA 3CGAA 4QJ3B 1ZMZA 2BBMA 2ERBA 2WCKA 5B8IB 1Y6WA 1A75B 1TCFA 3OHMB 4ICBA 1QIWA 1XK4C 1WRLA 4M2PA 1IJ5A 4AQJA 2GTEA 1F71A 2K61A 3RZSA 1IQ3A 4NDBA 1KQVA 3QMEA 1N2DA 4N5XA 5HL1A 4JD9A 4R1EA 1DJZA 2WCEA 4YGEB 1FI5A 3A4UB 4OR9B 4DUQA 2WNDA 3BFAA 3RLZA 4INXA 1KQMC 1RJVA 1OOIX 1M31A 1UWOA 3BXKA 1SR6C 3EVUA 4PE1A 3BFBA 2I94A 2P70A 1CKKA 2KGRA 2LVKA 3B86A 4A4BA 3FWCA 2JT8A 2KFFA 3DVEA 2WC6A 2B1UA 3GK4X 2L5YA 3NSOA 1ALVA 1AP4A 2CT9A 3AAKA 4QJ5B 2LE9B 2OS8C 2E30A 3HX4A 1SSEB 5I2LA 5DKQA 1CFPA 1XFUO 3VRPA 4FQOA 4GUKA 1QJTA 3H4SE 2LVVA 2G9BA 3DVJA 1XK4A 2COLB 2M3WA 3VROA 4IJ7A 2OPOA 1NIWA 1BMOA 1IH0A 1PVBA 1XO5A 2NZ0A 1PRWA 3BUXB 1S6CA 1DJIA 1YX8A 3BUNB 2ZN9A 4P2YB 2F3YA 3DF0B 2M49B 3CDNA 2Y5IA 3WHTB 3Q8IA 2K7DA 3L4LA 4YBHB 1OMDA 1KQMB 2LLTA 2MRDA 1SR6B 1SY9A 2HF5A 1KSOA 1KCYA 1IKUA 3SIBA 2KHNA 3K1EA 2KI6D 2BNXA 1M45A 2IS9A 2NLNA 2HQ8A 2KI4C 4GGFA 1F4QA 4WQ2A 1DGVA 2KOTA 3NHIA 1K2HA 5ER4X 2L2EA 4D1EA 2OS8B 4YGBB 1R2UA 2LHLA 5FI6A 3N7HA 1MXEA 1SL7A 2WCHA 3CABA 1WRZA 1IIOA 4N1FA 2JC2A 4NDCA 1CTRA 1K9UA 3BUWB 2R2IA 1TNXA 1CM1A 2V53A 3K21A 1W7JB 3DVMA 1E8AA 3D73A 2VRGA 2DOQA 3GOFA 2H2KA 4HRHA 5CSJA 5D7FA 2JOJA 2KFGA 1XFRA 3PM2A 1YR5A 1T14A 2MJWB 3WXAA 1Y0VH 1EXRA 2HETA 5K89A 2NCOA 1BODA 2JZIA 1KFUS 5FI2A 2K7OA 4AOMA 2LM5A 4XJKB 3NSLA 1KFXL 1YUSA 2GV5A 1K9PA 1MHOA 3DXLA 2YGUA 1DELA 2KI4B 3TDZA 2O5GA 2NXQA 1OZOA 3EK8A 4XYNA 1S6JA 1AJ5A 3B6XA 2KSPA 1G8IA 1TN4A 2PASA 3EVRA 2SASA 3CLNA 4GFTA 1CLMA 4INWA 1J55A 3QRXA 1XFVO 1QVIZ 1G33A 3IQQA 2H61A 4PE0A 1BF5A 2I7AA 3BUOB 1A03A 1M63B 1QS7A 2WCBA 2WOSA 3TDUA 1JC2A 1TUZA 3AAJA 2P71A 3NSKA 1SYMA 3CS1A 1FW4A 4MEWA 1J7OA 1EL4A 1PVAA 3O78A 1NWDA 5HYDA 3PATA 1UHHA 1WLMA 3I5FC 1BJFA 1NCXA 1W7IB 1UHNA 4MN0A 3DZTA 1S26D 1TWOA 3S0DA 3FE6A 1QX2A 4GPLB 1J1DA 1S6IA 1SCVA 2LVIA 3LLEA 3EVVA 1XA5A 2LC5A 3TDIA 3VGOA 2MLFC 4YI9A 1K8UA 2JU0A 2BE6A 2LAPA 2AMIA 3DD4A 1CFCA 1DJYA 3NSIA 2FCEA 4N1GA 2FJUB 2JWWA 1J1EA 3D77A 1SCMB 3I5HC 4GNKB 5DICA 3CZ2A 3PFVA 2JXCA 1KFUL 5JOLA 1MR8A 2Q91A 5KTYA 2LLUA 1TNQA 4C0JA 1C07A 1N65A 5D69A 2I2RE 4OKHA 1UHIA 3HCMA 4Q04A 2G2BA 3O2PA 3EK4A 3SG3A 3CR4X 1UP5A 5DKNA 1CB1A 3R1OA 1XVJA 1CFDA 1S5GZ 2JTTA 2KLEA 3KPXA 1TUJA 2Q4UA 3L4AA 3I5FB 1GM0A 3EG5B 1QTXA 1SW8A 3R72A 3E3RA 1G4YR 3LCPC 3VRQA 1YTZC 2LP2A 1GGWA 2KYFA 1TRFA 3CZ1A 3C1VA 2ISDA 5KSZA 3PALA 4GGFC 3TZ1A 4MLWA 1XYDA 2KI6C 5EL2A 2Y4QA 4PHMA 3I5HB 4CFRA 4JQ0D 5HLOA 2KAVA 1LA3A 1B8LA 1IWQA 2L51A 1L7ZA 2JNFA 5GQQC 2L50A 1K95A 1U5IA 2BE4A 1RECA 1OQPA 1EG4A 4U8DA 2BAPA 2BKHB 2M0RA 1LA0A 2JPOA 1OOGA 2QEBA 2MA2A 4HRGA 1QASA 1L2OC 1GGZA 1Z2CB 5G08A 1JFJA 1CMFA 2EC6C 1DJGA 2KAXA 3BJHA 1NCZA 4YI8A 1F54A 5CPVA 1OZSA 1PSRA 3CR2A 3OB1B 1WY9A 3VB1A 2KBIA 3I5GC 1KFXS 3TS5C 1B47A 1J7RA 1IQ5A 1SKTA 1J7PA 3PJIA 2LP3A 3SG7A 1B8CA 1QVIY 1MF8B 1KK7Y 1NUBA 2FJYA 4CLNA 2M97A 4NQGA 3S0AA 1SK6D 3FS7A 4OVNF 2QPTA 5D3OA 1RROA 1Z4HA 5I2QA 1SL9A 2F3ZA 4AQIA 4DIRA 1OSAA 2CXJA 4FTGA 5I94A 4YRUA 2KBMA 3D0YA 3CZ0A 2RGIA 4JWQA 2BCXA 2H61C 2MAZA 4PHNA 1JBAA 1FI6A 4FQTA 5TNCA 2ZRSA 5BPJA 1B9AA 1Y1UA 1IG5A 3DYEA 1DF0A 3DVKA 2K0JA 1SRAA 1L2OB 1DF0B 2JT3A 1DC1A 2K60A 4MBEA 5AERA 2EC6B 1OOJA 3ZNIA 3AKBA 1DJHA 5AEQA 1ZFSA 1JWDA 1C3ZA 1GQMA 4ETOA 1CM4A 4GBAA 4F0ZB 1F4OA 4OCIA 1DTLA 3I5GB 3TUYC 4WQ3A 3EKHA 3TS5B 3OBVA 1B1GA 2KFHA 1OW4A 1RTP1 5HKZA 2WC5A 2K2FA 5ER5A 1BG1A 1F70A 1ODBA 2PALA 4CFQA 3CYZA 2NCPA 2JULA 2AUCA 3B7AA 3BUMB 4C0LA 4I5JA 2F8PA 1S5GY 2CNPA 3MSEB 1A29A 1PK0D 1C7VA 1RFJA 5IBWA 1F8HA 3B87A 2H8VA 1W9ZA 2BECA 3SG6A 3AKAA 2JTZA 4ORCB 5JJGA 4E68A 1F55A 3WHUB 3R1PA 1XFYO 1UHJA 1VRKA 4USLA 2QEOA 3B88A 2ZN8A 4GGNA 2PVBA 3PLFB 3D74A 1B4CA 1CNPA 1EH2A 1QXPA 3KO0A 4MRXA 5HLVA 2L2CA 2Y1NA 1KK8C 1DJWA 4IL1A 4OV2A 3GK2A 2KQ6A 3R1VA 1TIZA 2EHBA 3CWGA 3TUYB 3V2LA 2HPSA 3BQ3A 1BU3A 3FWBA 3JVTC 4DCKA 5J3XA 1WRKA 4PDZA 1AJ4A 2QACA 2KDHA 1M39A 1SBJA 1IGVA 1SPYA 2WCFA 4MZLA 4DS7A 3SG4A 1NCYA 5CSNA 2KNEA 2MBXA 1H4BA 1PULA 2ZKMX 2ZNEA 3F45A 1HQVA 2P6BB 2MHHA 3IQOA 1JSAA 2KPHA 1B8RA 5DKRA 2L4IA 1QX5B 2LHIA 3NXAA 5CSIA 2M29A 3A8RA 4MZJA 1NSHA 3S0EA 1DGUA 1CDNA 2WORA 2MLEC 3SS4A 2LMVA 2PMYA 1PSBA 1ORGA 2BCBA 2LNKA 2LV7A 3CTNA 1WLZA 4CPVA 1H8BA 1LXFC 1UUSA 2L4HA 2JNXA 1K93D 1BR4B 3ICBA 1KK8B 1OMRA 3ZWHA 2L5XB 3GK1A 1D1OA 1AK8A 1BR1B 4WRIA 1B7TZ 1CLLA 1A75A 1QV0A 1YVLA 1MWNA 4HSZA 3M0WA 3SS5A 1JF2A 3JVTB 2LMTA 4I5KA 2PRUA 1A4PA 1Q80A 1QV1A 2L98A 2LCPA 2JPTA 5I2OA 2LMUA 3I5IC 3D78A 3SJSA 1FBVA 2M8UA 3LK1A 4PALA 1WDCC 4ZCUA 2QEHA 2QDIA 3BFHA 3SG2A 4ORAB 1CLBA 3IVTA 2M7NA 1U5IB 2WCJA 3LL8B 2GGMA 5I8NA 1ALWA 1NX3A 1K9KA 2LVJA 4PE7A 4A4CA 1SL8A 4F7FA 1N0YA 1YURA 1LS8A 1J7QA 1DEKA 2E6WA 1V1GA 2GGZA 1NP8A 1C7WA 1ZACA 2SCPA 5AXIA 1SNLA 4OZDA 2A4JA 1YRTB 1NYAA 2EGDA 2QEVA 3UO9A 1V1FA 3BOWA 2M7LA 1TCOB 1IJ6A 3BOWB 3OX5A 4BY4A 5AANA 1TNWA 1AUIB 1CDPA 1MQ1A 3D10A 1RWYA 1A2XA 1BT6A 2JRFA 1ZUZA 5CSFA 4CIDA 1LKJA 4C0KA 2D8NA 1YUUA 4L9MA 2PSRA 1OE9B 1NPQA 1X02A 3S0GA 1YUTA 3O6BA 3I5IB 1LINA 1R6PA 4QJ4B 3FE8A 1TTXA 3DF0A 2JXLA 1QIVA 1WDCB 1AVSA 2F2OA 4MRYA 4MSPA 3RM1A 1KSMA 3D0YB 5KU1A 2JQ6A 1QLSA 1IRJA 4PE4A 1DVIA 3VRNA 1CMGA 1AHRA 2KGBC 4TNCA 1DJXA 2M1UA 1GJYA 3IF7A 3JTDC 2K2AA 3O4YA 3VRRA 3D75A 1KWOC 3S0FA 2K8MB 1DMOA 2M9GA 4P5OE 1S1EA 1K96A 1UHKA 1EJ3A 1NX2A 2K7BA 2OTGC 2F2PA 3CR5X 1K94A 4JKTA 1RK9A
chains in the Genus database with same CATH topology
1JUOA 2FOTA 4M2QA 1JF0A 1MXLC 5AFPA 5FYXA 2FCDA 2I18A 1YX7A 2LUXA 2AAOA 3EKJA 1PALA 2M1KB 3OB2B 2KYCA 1FF1A 1QLKA 1JFKA 3OX6A 4MVFA 1M46A 2CCMA 1XFXO 2BKIB 1NX1A 3PN7C 3SG5A 2Y1MA 2BBNA 2WC8A 4I5LB 1SMGA 1Y1XA 2K7CA 2ZRTA 3PM8A 2LLSA 5PALA 3JTDB 2BL0C 1B7TY 2L0PA 4I5NB 1DT7B 4ZCVA 1CFFA 1K90D 1KWOB 3EK7A 2ZNDA 3LK0A 2CBLA 4PHJA 1MUXA 3KHEA 4XJKA 3OP0A 1LVCD 1SCMC 1UURA 1EG3A 2TN4A 2CTNA 2OTGB 4PCWA 1OMVA 2KQYA 4HREE 1FPWA 1CDMA 1QATA 4YGAA 3WNXB 1S36A 4GAOA 4BY5A 5F6TA 4ORBB 1KK7Z 3PSRA 4JPZB 1YVHA 4DRWA 3KEVA 2BCAA 3PN7B 1YRUB 4NDDA 2JT0A 2O60A 5HKYA 2ZFDA 3SIAA 4MZKA 4UPGA 4PHKA 4YGCB 2LANA 1HT9A 3KF9A 1ZOTB 2LUCA 2F33A 1CDLA 2HQWA 2BL0B 4YGDB 5HKWA 1TNPA 3BYAA 2KAYA 3FIAA 1BLQA 1S3PA 1TOPA 3CZTX 1BOCA 1XFWO 1NX0A 1Y1AA 1XFZO 1QX7A 4M2OA 3CGAA 4QJ3B 1ZMZA 2BBMA 5B8IB 1Y6WA 1A75B 1TCFA 3OHMB 4ICBA 1QIWA 1XK4C 1WRLA 4M2PA 1IJ5A 4AQJA 1F71A 2K61A 1IQ3A 4NDBA 1KQVA 4N5XA 1N2DA 4R1EA 1DJZA 2WCEA 4YGEB 1FI5A 3A4UB 4OR9B 4DUQA 2WNDA 3RLZA 1KQMC 1RJVA 1UWOA 1M31A 3BXKA 1SR6C 3EVUA 4PE1A 2I94A 1CKKA 2KGRA 2LVKA 4A4BA 3FWCA 2JT8A 2KFFA 3DVEA 3GK4X 2B1UA 3NSOA 1ALVA 1AP4A 2CT9A 3AAKA 4QJ5B 2LE9B 2OS8C 2E30A 3HX4A 5I2LA 5DKQA 1CFPA 1XFUO 3VRPA 4FQOA 4GUKA 1QJTA 3H4SE 2LVVA 2G9BA 3DVJA 1XK4A 2COLB 2M3WA 3VROA 2OPOA 1NIWA 1BMOA 1IH0A 1PVBA 1XO5A 2NZ0A 1PRWA 3BUXB 1S6CA 1DJIA 1YX8A 3BUNB 2ZN9A 4P2YB 2F3YA 3DF0B 2M49B 3WHTB 2Y5IA 2K7DA 4YBHB 1OMDA 1KQMB 2LLTA 2MRDA 1SR6B 1SY9A 2HF5A 1KSOA 1KCYA 1IKUA 3SIBA 2KHNA 2KI6D 2IS9A 1M45A 2NLNA 2HQ8A 2KI4C 4GGFA 1F4QA 4WQ2A 1DGVA 2KOTA 1K2HA 5ER4X 2L2EA 4D1EA 2OS8B 4YGBB 1R2UA 2LHLA 1MXEA 1SL7A 1WRZA 4N1FA 2JC2A 4NDCA 1CTRA 1K9UA 3BUWB 2R2IA 1TNXA 1CM1A 2V53A 3K21A 1W7JB 3DVMA 1E8AA 2VRGA 2DOQA 3GOFA 2H2KA 4HRHA 5CSJA 5D7FA 2JOJA 2KFGA 1YR5A 2MJWB 3WXAA 1Y0VH 1EXRA 2HETA 5K89A 2NCOA 1BODA 2JZIA 1KFUS 2K7OA 4AOMA 2LM5A 4XJKB 3NSLA 1KFXL 1YUSA 2GV5A 1K9PA 1MHOA 3TDZA 2KI4B 2O5GA 2NXQA 1OZOA 3EK8A 4XYNA 1S6JA 1AJ5A 3EVRA 2KSPA 1G8IA 1TN4A 2PASA 2SASA 3CLNA 4GFTA 1CLMA 1J55A 3QRXA 1XFVO 1QVIZ 1G33A 3IQQA 2H61A 4PE0A 1BF5A 2I7AA 3BUOB 1A03A 1M63B 1QS7A 2WCBA 2WOSA 3TDUA 1JC2A 3AAJA 3NSKA 1SYMA 3CS1A 1FW4A 4MEWA 1J7OA 1EL4A 1PVAA 3O78A 1NWDA 5HYDA 3PATA 1UHHA 1WLMA 3I5FC 1BJFA 1NCXA 1W7IB 1UHNA 4MN0A 1S26D 1QX2A 4GPLB 1J1DA 1S6IA 1SCVA 2LVIA 3LLEA 3EVVA 1XA5A 2LC5A 3TDIA 3VGOA 2MLFC 4YI9A 1K8UA 2JU0A 2BE6A 2LAPA 2AMIA 3DD4A 1CFCA 1DJYA 3NSIA 2FCEA 4N1GA 2FJUB 2JWWA 1J1EA 1SCMB 3I5HC 4GNKB 3PFVA 2JXCA 1KFUL 5JOLA 1MR8A 2Q91A 5KTYA 2LLUA 1TNQA 4C0JA 1C07A 1N65A 5D69A 2I2RE 4OKHA 1UHIA 3HCMA 4Q04A 2G2BA 3O2PA 3EK4A 3SG3A 3CR4X 1UP5A 5DKNA 1CB1A 1XVJA 1CFDA 1S5GZ 2JTTA 3KPXA 2Q4UA 3I5FB 1QTXA 1SW8A 3E3RA 1G4YR 3LCPC 3VRQA 1YTZC 2LP2A 1GGWA 2KYFA 1TRFA 3C1VA 2ISDA 5KSZA 3PALA 4GGFC 3TZ1A 4MLWA 1XYDA 2KI6C 2Y4QA 4PHMA 3I5HB 4CFRA 4JQ0D 5HLOA 2KAVA 1LA3A 1B8LA 1IWQA 2L51A 1L7ZA 2JNFA 5GQQC 2L50A 1K95A 1U5IA 2BE4A 1RECA 1OQPA 1EG4A 4U8DA 2BKHB 2M0RA 1LA0A 2MA2A 4HRGA 1QASA 1L2OC 1GGZA 5G08A 1JFJA 1CMFA 2EC6C 1DJGA 2KAXA 1NCZA 4YI8A 1F54A 5CPVA 1OZSA 1PSRA 3CR2A 3OB1B 1WY9A 2KBIA 3I5GC 1KFXS 3TS5C 1B47A 1J7RA 1IQ5A 1SKTA 1J7PA 2LP3A 3SG7A 1B8CA 1QVIY 1MF8B 1KK7Y 1NUBA 4CLNA 2M97A 4NQGA 1SK6D 3FS7A 4OVNF 2QPTA 1RROA 5I2QA 1SL9A 2F3ZA 4AQIA 4DIRA 1OSAA 2CXJA 4FTGA 4YRUA 2KBMA 3D0YA 2RGIA 4JWQA 2BCXA 2H61C 2MAZA 4PHNA 1JBAA 1FI6A 5TNCA 2ZRSA 5BPJA 1B9AA 1Y1UA 1IG5A 1DF0A 3DVKA 2K0JA 1SRAA 1L2OB 1DF0B 2JT3A 4MBEA 5AERA 2EC6B 1OOJA 3ZNIA 3AKBA 1DJHA 5AEQA 1ZFSA 1JWDA 1GQMA 4ETOA 1CM4A 4GBAA 4F0ZB 1F4OA 4OCIA 1DTLA 3I5GB 3TUYC 4WQ3A 3EKHA 3TS5B 1B1GA 2KFHA 1RTP1 5HKZA 2K2FA 5ER5A 1BG1A 1F70A 1ODBA 2PALA 4CFQA 2NCPA 2JULA 2AUCA 3BUMB 4C0LA 4I5JA 2F8PA 1S5GY 2CNPA 3MSEB 1A29A 1PK0D 1C7VA 1RFJA 5IBWA 1F8HA 5JJGA 2BECA 4E68A 3SG6A 3AKAA 2JTZA 4ORCB 1F55A 3WHUB 1XFYO 1UHJA 1VRKA 4USLA 2ZN8A 4GGNA 2PVBA 3PLFB 1B4CA 1CNPA 1EH2A 1QXPA 3KO0A 4MRXA 5HLVA 2Y1NA 1KK8C 1DJWA 4IL1A 4OV2A 3GK2A 2KQ6A 1TIZA 2EHBA 3CWGA 3TUYB 2HPSA 3BQ3A 1BU3A 3FWBA 3JVTC 4DCKA 5J3XA 1WRKA 4PDZA 1AJ4A 2QACA 2KDHA 1M39A 1SBJA 1IGVA 1SPYA 2WCFA 4MZLA 4DS7A 3SG4A 1NCYA 5CSNA 2KNEA 2MBXA 1H4BA 1PULA 2ZKMX 2ZNEA 3F45A 1HQVA 2P6BB 2MHHA 3IQOA 1JSAA 1B8RA 5DKRA 2L4IA 1QX5B 2LHIA 3NXAA 5CSIA 2M29A 3A8RA 4MZJA 1NSHA 1DGUA 1CDNA 2WORA 2MLEC 2LMVA 2PMYA 1PSBA 2BCBA 2LNKA 2LV7A 3CTNA 1WLZA 4CPVA 1H8BA 1LXFC 1UUSA 2L4HA 2JNXA 1K93D 1BR4B 3ICBA 1KK8B 1OMRA 3ZWHA 2L5XB 3GK1A 1D1OA 1AK8A 1BR1B 4WRIA 1B7TZ 1CLLA 1A75A 1QV0A 1YVLA 1MWNA 4HSZA 3M0WA 1JF2A 3JVTB 2LMTA 4I5KA 2PRUA 1A4PA 1Q80A 1QV1A 2L98A 2LCPA 2JPTA 5I2OA 2LMUA 3I5IC 3SJSA 1FBVA 2M8UA 3LK1A 4PALA 1WDCC 4ZCUA 3SG2A 4ORAB 1CLBA 2M7NA 1U5IB 3LL8B 2GGMA 5I8NA 1ALWA 1NX3A 1K9KA 2LVJA 4PE7A 4A4CA 1SL8A 1N0YA 1YURA 1J7QA 2E6WA 1V1GA 2GGZA 1NP8A 1C7WA 1ZACA 2SCPA 5AXIA 1SNLA 2A4JA 1YRTB 1NYAA 2EGDA 1V1FA 3BOWA 2M7LA 1TCOB 1IJ6A 3BOWB 3OX5A 4BY4A 5AANA 1TNWA 1AUIB 1CDPA 1MQ1A 3D10A 1RWYA 1A2XA 1BT6A 2JRFA 1ZUZA 5CSFA 4CIDA 1LKJA 4C0KA 2D8NA 1YUUA 4L9MA 2PSRA 1OE9B 1NPQA 1X02A 1YUTA 3O6BA 3I5IB 1LINA 1R6PA 4QJ4B 1TTXA 3DF0A 2JXLA 1QIVA 1WDCB 1AVSA 2F2OA 4MRYA 4MSPA 3RM1A 1KSMA 3D0YB 5KU1A 2JQ6A 1QLSA 1IRJA 4PE4A 1DVIA 3VRNA 1CMGA 1AHRA 2KGBC 4TNCA 1DJXA 2M1UA 1GJYA 3IF7A 3JTDC 2K2AA 3O4YA 3VRRA 1KWOC 2K8MB 1DMOA 2M9GA 4P5OE 1S1EA 1K96A 1UHKA 1EJ3A 1NX2A 2K7BA 2OTGC 2F2PA 3CR5X 1K94A 1RK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JUO A;  2FOT A;  4M2Q A;  1JF0 A;  1MXL C;  5AFP A;  5FYX A;  2FCD A;  2I18 A;  1YX7 A;  2LUX A;  2AAO A;  3EKJ A;  1PAL A;  2M1K B;  3OB2 B;  2KYC A;  1FF1 A;  1QLK A;  1JFK A;  3OX6 A;  4MVF A;  1M46 A;  2CCM A;  1XFX O;  2BKI B;  1NX1 A;  3PN7 C;  3SG5 A;  2Y1M A;  2BBN A;  2WC8 A;  4I5L B;  1SMG A;  1Y1X A;  2K7C A;  2ZRT A;  3PM8 A;  2LLS A;  5PAL A;  3JTD B;  2BL0 C;  1B7T Y;  2L0P A;  4I5N B;  1DT7 B;  4ZCV A;  1CFF A;  1K90 D;  1KWO B;  3EK7 A;  2ZND A;  3LK0 A;  2CBL A;  4PHJ A;  1MUX A;  3KHE A;  4XJK A;  3OP0 A;  1LVC D;  1SCM C;  1UUR A;  1EG3 A;  2TN4 A;  2CTN A;  2OTG B;  4PCW A;  1OMV A;  2KQY A;  4HRE E;  1FPW A;  1CDM A;  1QAT A;  4YGA A;  3WNX B;  1S36 A;  4GAO A;  4BY5 A;  5F6T A;  4ORB B;  1KK7 Z;  3PSR A;  4JPZ B;  1YVH A;  4DRW A;  3KEV A;  2BCA A;  3PN7 B;  1YRU B;  4NDD A;  2JT0 A;  2O60 A;  5HKY A;  2ZFD A;  3SIA A;  4MZK A;  4UPG A;  4PHK A;  4YGC B;  2LAN A;  1HT9 A;  3KF9 A;  1ZOT B;  2LUC A;  2F33 A;  1CDL A;  2HQW A;  2BL0 B;  4YGD B;  5HKW A;  1TNP A;  3BYA A;  2KAY A;  3FIA A;  1BLQ A;  1S3P A;  1TOP A;  3CZT X;  1BOC A;  1XFW O;  1NX0 A;  1Y1A A;  1XFZ O;  1QX7 A;  4M2O A;  3CGA A;  4QJ3 B;  1ZMZ A;  2BBM A;  5B8I B;  1Y6W A;  1A75 B;  1TCF A;  3OHM B;  4ICB A;  1QIW A;  1XK4 C;  1WRL A;  4M2P A;  1IJ5 A;  4AQJ A;  1F71 A;  2K61 A;  1IQ3 A;  4NDB A;  1KQV A;  4N5X A;  1N2D A;  4R1E A;  1DJZ A;  2WCE A;  4YGE B;  1FI5 A;  3A4U B;  4OR9 B;  4DUQ A;  2WND A;  3RLZ A;  1KQM C;  1RJV A;  1UWO A;  1M31 A;  3BXK A;  1SR6 C;  3EVU A;  4PE1 A;  2I94 A;  1CKK A;  2KGR A;  2LVK A;  4A4B A;  3FWC A;  2JT8 A;  2KFF A;  3DVE A;  3GK4 X;  2B1U A;  3NSO A;  1ALV A;  1AP4 A;  2CT9 A;  3AAK A;  4QJ5 B;  2LE9 B;  2OS8 C;  2E30 A;  3HX4 A;  5I2L A;  5DKQ A;  1CFP A;  1XFU O;  3VRP A;  4FQO A;  4GUK A;  1QJT A;  3H4S E;  2LVV A;  2G9B A;  3DVJ A;  1XK4 A;  2COL B;  2M3W A;  3VRO A;  2OPO A;  1NIW A;  1BMO A;  1IH0 A;  1PVB A;  1XO5 A;  2NZ0 A;  1PRW A;  3BUX B;  1S6C A;  1DJI A;  1YX8 A;  3BUN B;  2ZN9 A;  4P2Y B;  2F3Y A;  3DF0 B;  2M49 B;  3WHT B;  2Y5I A;  2K7D A;  4YBH B;  1OMD A;  1KQM B;  2LLT A;  2MRD A;  1SR6 B;  1SY9 A;  2HF5 A;  1KSO A;  1KCY A;  1IKU A;  3SIB A;  2KHN A;  2KI6 D;  2IS9 A;  1M45 A;  2NLN A;  2HQ8 A;  2KI4 C;  4GGF A;  1F4Q A;  4WQ2 A;  1DGV A;  2KOT A;  1K2H A;  5ER4 X;  2L2E A;  4D1E A;  2OS8 B;  4YGB B;  1R2U A;  2LHL A;  1MXE A;  1SL7 A;  1WRZ A;  4N1F A;  2JC2 A;  4NDC A;  1CTR A;  1K9U A;  3BUW B;  2R2I A;  1TNX A;  1CM1 A;  2V53 A;  3K21 A;  1W7J B;  3DVM A;  1E8A A;  2VRG A;  2DOQ A;  3GOF A;  2H2K A;  4HRH A;  5CSJ A;  5D7F A;  2JOJ A;  2KFG A;  1YR5 A;  2MJW B;  3WXA A;  1Y0V H;  1EXR A;  2HET A;  5K89 A;  2NCO A;  1BOD A;  2JZI A;  1KFU S;  2K7O A;  4AOM A;  2LM5 A;  4XJK B;  3NSL A;  1KFX L;  1YUS A;  2GV5 A;  1K9P A;  1MHO A;  3TDZ A;  2KI4 B;  2O5G A;  2NXQ A;  1OZO A;  3EK8 A;  4XYN A;  1S6J A;  1AJ5 A;  3EVR A;  2KSP A;  1G8I A;  1TN4 A;  2PAS A;  2SAS A;  3CLN A;  4GFT A;  1CLM A;  1J55 A;  3QRX A;  1XFV O;  1QVI Z;  1G33 A;  3IQQ A;  2H61 A;  4PE0 A;  1BF5 A;  2I7A A;  3BUO B;  1A03 A;  1M63 B;  1QS7 A;  2WCB A;  2WOS A;  3TDU A;  1JC2 A;  3AAJ A;  3NSK A;  1SYM A;  3CS1 A;  1FW4 A;  4MEW A;  1J7O A;  1EL4 A;  1PVA A;  3O78 A;  1NWD A;  5HYD A;  3PAT A;  1UHH A;  1WLM A;  3I5F C;  1BJF A;  1NCX A;  1W7I B;  1UHN A;  4MN0 A;  1S26 D;  1QX2 A;  4GPL B;  1J1D A;  1S6I A;  1SCV A;  2LVI A;  3LLE A;  3EVV A;  1XA5 A;  2LC5 A;  3TDI A;  3VGO A;  2MLF C;  4YI9 A;  1K8U A;  2JU0 A;  2BE6 A;  2LAP A;  2AMI A;  3DD4 A;  1CFC A;  1DJY A;  3NSI A;  2FCE A;  4N1G A;  2FJU B;  2JWW A;  1J1E A;  1SCM B;  3I5H C;  4GNK B;  3PFV A;  2JXC A;  1KFU L;  5JOL A;  1MR8 A;  2Q91 A;  5KTY A;  2LLU A;  1TNQ A;  4C0J A;  1C07 A;  1N65 A;  5D69 A;  2I2R E;  4OKH A;  1UHI A;  3HCM A;  4Q04 A;  2G2B A;  3O2P A;  3EK4 A;  3SG3 A;  3CR4 X;  1UP5 A;  5DKN A;  1CB1 A;  1XVJ A;  1CFD A;  1S5G Z;  2JTT A;  3KPX A;  2Q4U A;  3I5F B;  1QTX A;  1SW8 A;  3E3R A;  1G4Y R;  3LCP C;  3VRQ A;  1YTZ C;  2LP2 A;  1GGW A;  2KYF A;  1TRF A;  3C1V A;  2ISD A;  5KSZ A;  3PAL A;  4GGF C;  3TZ1 A;  4MLW A;  1XYD A;  2KI6 C;  2Y4Q A;  4PHM A;  3I5H B;  4CFR A;  4JQ0 D;  5HLO A;  2KAV A;  1LA3 A;  1B8L A;  1IWQ A;  2L51 A;  1L7Z A;  2JNF A;  5GQQ C;  2L50 A;  1K95 A;  1U5I A;  2BE4 A;  1REC A;  1OQP A;  1EG4 A;  4U8D A;  2BKH B;  2M0R A;  1LA0 A;  2MA2 A;  4HRG A;  1QAS A;  1L2O C;  1GGZ A;  5G08 A;  1JFJ A;  1CMF A;  2EC6 C;  1DJG A;  2KAX A;  1NCZ A;  4YI8 A;  1F54 A;  5CPV A;  1OZS A;  1PSR A;  3CR2 A;  3OB1 B;  1WY9 A;  2KBI A;  3I5G C;  1KFX S;  3TS5 C;  1B47 A;  1J7R A;  1IQ5 A;  1SKT A;  1J7P A;  2LP3 A;  3SG7 A;  1B8C A;  1QVI Y;  1MF8 B;  1KK7 Y;  1NUB A;  4CLN A;  2M97 A;  4NQG A;  1SK6 D;  3FS7 A;  4OVN F;  2QPT A;  1RRO A;  5I2Q A;  1SL9 A;  2F3Z A;  4AQI A;  4DIR A;  1OSA A;  2CXJ A;  4FTG A;  4YRU A;  2KBM A;  3D0Y A;  2RGI A;  4JWQ A;  2BCX A;  2H61 C;  2MAZ A;  4PHN A;  1JBA A;  1FI6 A;  5TNC A;  2ZRS A;  5BPJ A;  1B9A A;  1Y1U A;  1IG5 A;  1DF0 A;  3DVK A;  2K0J A;  1SRA A;  1L2O B;  1DF0 B;  2JT3 A;  4MBE A;  5AER A;  2EC6 B;  1OOJ A;  3ZNI A;  3AKB A;  1DJH A;  5AEQ A;  1ZFS A;  1JWD A;  1GQM A;  4ETO A;  1CM4 A;  4GBA A;  4F0Z B;  1F4O A;  4OCI A;  1DTL A;  3I5G B;  3TUY C;  4WQ3 A;  3EKH A;  3TS5 B;  1B1G A;  2KFH A;  1RTP 1;  5HKZ A;  2K2F A;  5ER5 A;  1BG1 A;  1F70 A;  1ODB A;  2PAL A;  4CFQ A;  2NCP A;  2JUL A;  2AUC A;  3BUM B;  4C0L A;  4I5J A;  2F8P A;  1S5G Y;  2CNP A;  3MSE B;  1A29 A;  1PK0 D;  1C7V A;  1RFJ A;  5IBW A;  1F8H A;  5JJG A;  2BEC A;  4E68 A;  3SG6 A;  3AKA A;  2JTZ A;  4ORC B;  1F55 A;  3WHU B;  1XFY O;  1UHJ A;  1VRK A;  4USL A;  2ZN8 A;  4GGN A;  2PVB A;  3PLF B;  1B4C A;  1CNP A;  1EH2 A;  1QXP A;  3KO0 A;  4MRX A;  5HLV A;  2Y1N A;  1KK8 C;  1DJW A;  4IL1 A;  4OV2 A;  3GK2 A;  2KQ6 A;  1TIZ A;  2EHB A;  3CWG A;  3TUY B;  2HPS A;  3BQ3 A;  1BU3 A;  3FWB A;  3JVT C;  4DCK A;  5J3X A;  1WRK A;  4PDZ A;  1AJ4 A;  2QAC A;  2KDH A;  1M39 A;  1SBJ A;  1IGV A;  1SPY A;  2WCF A;  4MZL A;  4DS7 A;  3SG4 A;  1NCY A;  5CSN A;  2KNE A;  2MBX A;  1H4B A;  1PUL A;  2ZKM X;  2ZNE A;  3F45 A;  1HQV A;  2P6B B;  2MHH A;  3IQO A;  1JSA A;  1B8R A;  5DKR A;  2L4I A;  1QX5 B;  2LHI A;  3NXA A;  5CSI A;  2M29 A;  3A8R A;  4MZJ A;  1NSH A;  1DGU A;  1CDN A;  2WOR A;  2MLE C;  2LMV A;  2PMY A;  1PSB A;  2BCB A;  2LNK A;  2LV7 A;  3CTN A;  1WLZ A;  4CPV A;  1H8B A;  1LXF C;  1UUS A;  2L4H A;  2JNX A;  1K93 D;  1BR4 B;  3ICB A;  1KK8 B;  1OMR A;  3ZWH A;  2L5X B;  3GK1 A;  1D1O A;  1AK8 A;  1BR1 B;  4WRI A;  1B7T Z;  1CLL A;  1A75 A;  1QV0 A;  1YVL A;  1MWN A;  4HSZ A;  3M0W A;  1JF2 A;  3JVT B;  2LMT A;  4I5K A;  2PRU A;  1A4P A;  1Q80 A;  1QV1 A;  2L98 A;  2LCP A;  2JPT A;  5I2O A;  2LMU A;  3I5I C;  3SJS A;  1FBV A;  2M8U A;  3LK1 A;  4PAL A;  1WDC C;  4ZCU A;  3SG2 A;  4ORA B;  1CLB A;  2M7N A;  1U5I B;  3LL8 B;  2GGM A;  5I8N A;  1ALW A;  1NX3 A;  1K9K A;  2LVJ A;  4PE7 A;  4A4C A;  1SL8 A;  1N0Y A;  1YUR A;  1J7Q A;  2E6W A;  1V1G A;  2GGZ A;  1NP8 A;  1C7W A;  1ZAC A;  2SCP A;  5AXI A;  1SNL A;  2A4J A;  1YRT B;  1NYA A;  2EGD A;  1V1F A;  3BOW A;  2M7L A;  1TCO B;  1IJ6 A;  3BOW B;  3OX5 A;  4BY4 A;  5AAN A;  1TNW A;  1AUI B;  1CDP A;  1MQ1 A;  3D10 A;  1RWY A;  1A2X A;  1BT6 A;  2JRF A;  1ZUZ A;  5CSF A;  4CID A;  1LKJ A;  4C0K A;  2D8N A;  1YUU A;  4L9M A;  2PSR A;  1OE9 B;  1NPQ A;  1X02 A;  1YUT A;  3O6B A;  3I5I B;  1LIN A;  1R6P A;  4QJ4 B;  1TTX A;  3DF0 A;  2JXL A;  1QIV A;  1WDC B;  1AVS A;  2F2O A;  4MRY A;  4MSP A;  3RM1 A;  1KSM A;  3D0Y B;  5KU1 A;  2JQ6 A;  1QLS A;  1IRJ A;  4PE4 A;  1DVI A;  3VRN A;  1CMG A;  1AHR A;  2KGB C;  4TNC A;  1DJX A;  2M1U A;  1GJY A;  3IF7 A;  3JTD C;  2K2A A;  3O4Y A;  3VRR A;  1KWO C;  2K8M B;  1DMO A;  2M9G A;  4P5O E;  1S1E A;  1K96 A;  1UHK A;  1EJ3 A;  1NX2 A;  2K7B A;  2OTG C;  2F2P A;  3CR5 X;  1K94 A;  1RK9 A; 
#chains in the Genus database with same CATH topology
 1JUO A;  2FOT A;  1DQE A;  1JF0 A;  4M2Q A;  1MXL C;  4PT1 A;  3S0B A;  5AFP A;  1QWV A;  5FYX A;  2FCD A;  2I18 A;  1YX7 A;  2LUX A;  3FE9 A;  2AAO A;  3EKJ A;  1PAL A;  2M1K B;  3OB2 B;  2KYC A;  1FF1 A;  3D76 A;  3O4X A;  1QLK A;  5FI7 A;  3NGV A;  1JFK A;  3OX6 A;  4MVF A;  1M46 A;  2CCM A;  1XFX O;  2BKI B;  1NX1 A;  3PN7 C;  3SG5 A;  2Y1M A;  2BBN A;  3L47 A;  2WC8 A;  1OOH A;  1OOF A;  4I5L B;  1SMG A;  1Y1X A;  1C3Y A;  2K7C A;  2ZRT A;  3PM8 A;  2LLS A;  5PAL A;  3JTD B;  2BL0 C;  1B7T Y;  2L0P A;  4I5N B;  1DT7 B;  4ZCV A;  1CFF A;  1K90 D;  1KWO B;  3EK7 A;  2PQL A;  2ZND A;  2CBL A;  3LK0 A;  1MUX A;  1P28 A;  3KHE A;  4PHJ A;  4XJK A;  3OP0 A;  1LVC D;  1SCM C;  1UUR A;  1EG3 A;  2TN4 A;  2CTN A;  2OTG B;  4PCW A;  1OMV A;  2KQY A;  2WCL A;  4HRE E;  1FPW A;  3SS3 A;  1CDM A;  1QAT A;  4YGA A;  3WNX B;  1S36 A;  4GAO A;  4BY5 A;  5F6T A;  4ORB B;  1KK7 Z;  3PSR A;  4JPZ B;  3UNW A;  1YVH A;  4DRW A;  3OGN A;  3DY9 A;  3KEV A;  2BCA A;  3PN7 B;  1YRU B;  4NDD A;  2JT0 A;  2O60 A;  5HKY A;  2ZFD A;  3SIA A;  4MZK A;  4UPG A;  4PHK A;  4YGC B;  2LAN A;  1HT9 A;  3KF9 A;  1ZOT B;  2LUC A;  2WCM A;  2F33 A;  1CDL A;  3NHT A;  2HQW A;  2BL0 B;  4YGD B;  5HKW A;  2PYQ A;  1TNP A;  3BYA A;  2KAY A;  2KLD A;  3FIA A;  1BLQ A;  1S3P A;  1TOP A;  3CZT X;  1BOC A;  1XFW O;  1NX0 A;  4KYN A;  1Y1A A;  1XFZ O;  1QX7 A;  4M2O A;  3CGA A;  4QJ3 B;  1ZMZ A;  2BBM A;  2ERB A;  2WCK A;  5B8I B;  1Y6W A;  1A75 B;  1TCF A;  3OHM B;  4ICB A;  1QIW A;  1XK4 C;  1WRL A;  4M2P A;  1IJ5 A;  4AQJ A;  2GTE A;  1F71 A;  2K61 A;  3RZS A;  1IQ3 A;  4NDB A;  1KQV A;  3QME A;  1N2D A;  4N5X A;  5HL1 A;  4JD9 A;  4R1E A;  1DJZ A;  2WCE A;  4YGE B;  1FI5 A;  3A4U B;  4OR9 B;  4DUQ A;  2WND A;  3BFA A;  3RLZ A;  4INX A;  1KQM C;  1RJV A;  1OOI X;  1M31 A;  1UWO A;  3BXK A;  1SR6 C;  3EVU A;  4PE1 A;  3BFB A;  2I94 A;  2P70 A;  1CKK A;  2KGR A;  2LVK A;  3B86 A;  4A4B A;  3FWC A;  2JT8 A;  2KFF A;  3DVE A;  2WC6 A;  2B1U A;  3GK4 X;  2L5Y A;  3NSO A;  1ALV A;  1AP4 A;  2CT9 A;  3AAK A;  4QJ5 B;  2LE9 B;  2OS8 C;  2E30 A;  3HX4 A;  1SSE B;  5I2L A;  5DKQ A;  1CFP A;  1XFU O;  3VRP A;  4FQO A;  4GUK A;  1QJT A;  3H4S E;  2LVV A;  2G9B A;  3DVJ A;  1XK4 A;  2COL B;  2M3W A;  3VRO A;  4IJ7 A;  2OPO A;  1NIW A;  1BMO A;  1IH0 A;  1PVB A;  1XO5 A;  2NZ0 A;  1PRW A;  3BUX B;  1S6C A;  1DJI A;  1YX8 A;  3BUN B;  2ZN9 A;  4P2Y B;  2F3Y A;  3DF0 B;  2M49 B;  3CDN A;  2Y5I A;  3WHT B;  3Q8I A;  2K7D A;  3L4L A;  4YBH B;  1OMD A;  1KQM B;  2LLT A;  2MRD A;  1SR6 B;  1SY9 A;  2HF5 A;  1KSO A;  1KCY A;  1IKU A;  3SIB A;  2KHN A;  3K1E A;  2KI6 D;  2BNX A;  1M45 A;  2IS9 A;  2NLN A;  2HQ8 A;  2KI4 C;  4GGF A;  1F4Q A;  4WQ2 A;  1DGV A;  2KOT A;  3NHI A;  1K2H A;  5ER4 X;  2L2E A;  4D1E A;  2OS8 B;  4YGB B;  1R2U A;  2LHL A;  5FI6 A;  3N7H A;  1MXE A;  1SL7 A;  2WCH A;  3CAB A;  1WRZ A;  1IIO A;  4N1F A;  2JC2 A;  4NDC A;  1CTR A;  1K9U A;  3BUW B;  2R2I A;  1TNX A;  1CM1 A;  2V53 A;  3K21 A;  1W7J B;  3DVM A;  1E8A A;  3D73 A;  2VRG A;  2DOQ A;  3GOF A;  2H2K A;  4HRH A;  5CSJ A;  5D7F A;  2JOJ A;  2KFG A;  1XFR A;  3PM2 A;  1YR5 A;  1T14 A;  2MJW B;  3WXA A;  1Y0V H;  1EXR A;  2HET A;  5K89 A;  2NCO A;  1BOD A;  2JZI A;  1KFU S;  5FI2 A;  2K7O A;  4AOM A;  2LM5 A;  4XJK B;  3NSL A;  1KFX L;  1YUS A;  2GV5 A;  1K9P A;  1MHO A;  3DXL A;  2YGU A;  1DEL A;  2KI4 B;  3TDZ A;  2O5G A;  2NXQ A;  1OZO A;  3EK8 A;  4XYN A;  1S6J A;  1AJ5 A;  3B6X A;  2KSP A;  1G8I A;  1TN4 A;  2PAS A;  3EVR A;  2SAS A;  3CLN A;  4GFT A;  1CLM A;  4INW A;  1J55 A;  3QRX A;  1XFV O;  1QVI Z;  1G33 A;  3IQQ A;  2H61 A;  4PE0 A;  1BF5 A;  2I7A A;  3BUO B;  1A03 A;  1M63 B;  1QS7 A;  2WCB A;  2WOS A;  3TDU A;  1JC2 A;  1TUZ A;  3AAJ A;  2P71 A;  3NSK A;  1SYM A;  3CS1 A;  1FW4 A;  4MEW A;  1J7O A;  1EL4 A;  1PVA A;  3O78 A;  1NWD A;  5HYD A;  3PAT A;  1UHH A;  1WLM A;  3I5F C;  1BJF A;  1NCX A;  1W7I B;  1UHN A;  4MN0 A;  3DZT A;  1S26 D;  1TWO A;  3S0D A;  3FE6 A;  1QX2 A;  4GPL B;  1J1D A;  1S6I A;  1SCV A;  2LVI A;  3LLE A;  3EVV A;  1XA5 A;  2LC5 A;  3TDI A;  3VGO A;  2MLF C;  4YI9 A;  1K8U A;  2JU0 A;  2BE6 A;  2LAP A;  2AMI A;  3DD4 A;  1CFC A;  1DJY A;  3NSI A;  2FCE A;  4N1G A;  2FJU B;  2JWW A;  1J1E A;  3D77 A;  1SCM B;  3I5H C;  4GNK B;  5DIC A;  3CZ2 A;  3PFV A;  2JXC A;  1KFU L;  5JOL A;  1MR8 A;  2Q91 A;  5KTY A;  2LLU A;  1TNQ A;  4C0J A;  1C07 A;  1N65 A;  5D69 A;  2I2R E;  4OKH A;  1UHI A;  3HCM A;  4Q04 A;  2G2B A;  3O2P A;  3EK4 A;  3SG3 A;  3CR4 X;  1UP5 A;  5DKN A;  1CB1 A;  3R1O A;  1XVJ A;  1CFD A;  1S5G Z;  2JTT A;  2KLE A;  3KPX A;  1TUJ A;  2Q4U A;  3L4A A;  3I5F B;  1GM0 A;  3EG5 B;  1QTX A;  1SW8 A;  3R72 A;  3E3R A;  1G4Y R;  3LCP C;  3VRQ A;  1YTZ C;  2LP2 A;  1GGW A;  2KYF A;  1TRF A;  3CZ1 A;  3C1V A;  2ISD A;  5KSZ A;  3PAL A;  4GGF C;  3TZ1 A;  4MLW A;  1XYD A;  2KI6 C;  5EL2 A;  2Y4Q A;  4PHM A;  3I5H B;  4CFR A;  4JQ0 D;  5HLO A;  2KAV A;  1LA3 A;  1B8L A;  1IWQ A;  2L51 A;  1L7Z A;  2JNF A;  5GQQ C;  2L50 A;  1K95 A;  1U5I A;  2BE4 A;  1REC A;  1OQP A;  1EG4 A;  4U8D A;  2BAP A;  2BKH B;  2M0R A;  1LA0 A;  2JPO A;  1OOG A;  2QEB A;  2MA2 A;  4HRG A;  1QAS A;  1L2O C;  1GGZ A;  1Z2C B;  5G08 A;  1JFJ A;  1CMF A;  2EC6 C;  1DJG A;  2KAX A;  3BJH A;  1NCZ A;  4YI8 A;  1F54 A;  5CPV A;  1OZS A;  1PSR A;  3CR2 A;  3OB1 B;  1WY9 A;  3VB1 A;  2KBI A;  3I5G C;  1KFX S;  3TS5 C;  1B47 A;  1J7R A;  1IQ5 A;  1SKT A;  1J7P A;  3PJI A;  2LP3 A;  3SG7 A;  1B8C A;  1QVI Y;  1MF8 B;  1KK7 Y;  1NUB A;  2FJY A;  4CLN A;  2M97 A;  4NQG A;  3S0A A;  1SK6 D;  3FS7 A;  4OVN F;  2QPT A;  5D3O A;  1RRO A;  1Z4H A;  5I2Q A;  1SL9 A;  2F3Z A;  4AQI A;  4DIR A;  1OSA A;  2CXJ A;  4FTG A;  5I94 A;  4YRU A;  2KBM A;  3D0Y A;  3CZ0 A;  2RGI A;  4JWQ A;  2BCX A;  2H61 C;  2MAZ A;  4PHN A;  1JBA A;  1FI6 A;  4FQT A;  5TNC A;  2ZRS A;  5BPJ A;  1B9A A;  1Y1U A;  1IG5 A;  3DYE A;  1DF0 A;  3DVK A;  2K0J A;  1SRA A;  1L2O B;  1DF0 B;  2JT3 A;  1DC1 A;  2K60 A;  4MBE A;  5AER A;  2EC6 B;  1OOJ A;  3ZNI A;  3AKB A;  1DJH A;  5AEQ A;  1ZFS A;  1JWD A;  1C3Z A;  1GQM A;  4ETO A;  1CM4 A;  4GBA A;  4F0Z B;  1F4O A;  4OCI A;  1DTL A;  3I5G B;  3TUY C;  4WQ3 A;  3EKH A;  3TS5 B;  3OBV A;  1B1G A;  2KFH A;  1OW4 A;  1RTP 1;  5HKZ A;  2WC5 A;  2K2F A;  5ER5 A;  1BG1 A;  1F70 A;  1ODB A;  2PAL A;  4CFQ A;  3CYZ A;  2NCP A;  2JUL A;  2AUC A;  3B7A A;  3BUM B;  4C0L A;  4I5J A;  2F8P A;  1S5G Y;  2CNP A;  3MSE B;  1A29 A;  1PK0 D;  1C7V A;  1RFJ A;  5IBW A;  1F8H A;  3B87 A;  2H8V A;  1W9Z A;  2BEC A;  3SG6 A;  3AKA A;  2JTZ A;  4ORC B;  5JJG A;  4E68 A;  1F55 A;  3WHU B;  3R1P A;  1XFY O;  1UHJ A;  1VRK A;  4USL A;  2QEO A;  3B88 A;  2ZN8 A;  4GGN A;  2PVB A;  3PLF B;  3D74 A;  1B4C A;  1CNP A;  1EH2 A;  1QXP A;  3KO0 A;  4MRX A;  5HLV A;  2L2C A;  2Y1N A;  1KK8 C;  1DJW A;  4IL1 A;  4OV2 A;  3GK2 A;  2KQ6 A;  3R1V A;  1TIZ A;  2EHB A;  3CWG A;  3TUY B;  3V2L A;  2HPS A;  3BQ3 A;  1BU3 A;  3FWB A;  3JVT C;  4DCK A;  5J3X A;  1WRK A;  4PDZ A;  1AJ4 A;  2QAC A;  2KDH A;  1M39 A;  1SBJ A;  1IGV A;  1SPY A;  2WCF A;  4MZL A;  4DS7 A;  3SG4 A;  1NCY A;  5CSN A;  2KNE A;  2MBX A;  1H4B A;  1PUL A;  2ZKM X;  2ZNE A;  3F45 A;  1HQV A;  2P6B B;  2MHH A;  3IQO A;  1JSA A;  2KPH A;  1B8R A;  5DKR A;  2L4I A;  1QX5 B;  2LHI A;  3NXA A;  5CSI A;  2M29 A;  3A8R A;  4MZJ A;  1NSH A;  3S0E A;  1DGU A;  1CDN A;  2WOR A;  2MLE C;  3SS4 A;  2LMV A;  2PMY A;  1PSB A;  1ORG A;  2BCB A;  2LNK A;  2LV7 A;  3CTN A;  1WLZ A;  4CPV A;  1H8B A;  1LXF C;  1UUS A;  2L4H A;  2JNX A;  1K93 D;  1BR4 B;  3ICB A;  1KK8 B;  1OMR A;  3ZWH A;  2L5X B;  3GK1 A;  1D1O A;  1AK8 A;  1BR1 B;  4WRI A;  1B7T Z;  1CLL A;  1A75 A;  1QV0 A;  1YVL A;  1MWN A;  4HSZ A;  3M0W A;  3SS5 A;  1JF2 A;  3JVT B;  2LMT A;  4I5K A;  2PRU A;  1A4P A;  1Q80 A;  1QV1 A;  2L98 A;  2LCP A;  2JPT A;  5I2O A;  2LMU A;  3I5I C;  3D78 A;  3SJS A;  1FBV A;  2M8U A;  3LK1 A;  4PAL A;  1WDC C;  4ZCU A;  2QEH A;  2QDI A;  3BFH A;  3SG2 A;  4ORA B;  1CLB A;  3IVT A;  2M7N A;  1U5I B;  2WCJ A;  3LL8 B;  2GGM A;  5I8N A;  1ALW A;  1NX3 A;  1K9K A;  2LVJ A;  4PE7 A;  4A4C A;  1SL8 A;  4F7F A;  1N0Y A;  1YUR A;  1LS8 A;  1J7Q A;  1DEK A;  2E6W A;  1V1G A;  2GGZ A;  1NP8 A;  1C7W A;  1ZAC A;  2SCP A;  5AXI A;  1SNL A;  4OZD A;  2A4J A;  1YRT B;  1NYA A;  2EGD A;  2QEV A;  3UO9 A;  1V1F A;  3BOW A;  2M7L A;  1TCO B;  1IJ6 A;  3BOW B;  3OX5 A;  4BY4 A;  5AAN A;  1TNW A;  1AUI B;  1CDP A;  1MQ1 A;  3D10 A;  1RWY A;  1A2X A;  1BT6 A;  2JRF A;  1ZUZ A;  5CSF A;  4CID A;  1LKJ A;  4C0K A;  2D8N A;  1YUU A;  4L9M A;  2PSR A;  1OE9 B;  1NPQ A;  1X02 A;  3S0G A;  1YUT A;  3O6B A;  3I5I B;  1LIN A;  1R6P A;  4QJ4 B;  3FE8 A;  1TTX A;  3DF0 A;  2JXL A;  1QIV A;  1WDC B;  1AVS A;  2F2O A;  4MRY A;  4MSP A;  3RM1 A;  1KSM A;  3D0Y B;  5KU1 A;  2JQ6 A;  1QLS A;  1IRJ A;  4PE4 A;  1DVI A;  3VRN A;  1CMG A;  1AHR A;  2KGB C;  4TNC A;  1DJX A;  2M1U A;  1GJY A;  3IF7 A;  3JTD C;  2K2A A;  3O4Y A;  3VRR A;  3D75 A;  1KWO C;  3S0F A;  2K8M B;  1DMO A;  2M9G A;  4P5O E;  1S1E A;  1K96 A;  1UHK A;  1EJ3 A;  1NX2 A;  2K7B A;  2OTG C;  2F2P A;  3CR5 X;  1K94 A;  4JKT A;  1RK9 A; 
#chains in the Genus database with same CATH homology
 1JUO A;  2FOT A;  4M2Q A;  1JF0 A;  1MXL C;  5AFP A;  5FYX A;  2FCD A;  2I18 A;  1YX7 A;  2LUX A;  2AAO A;  3EKJ A;  1PAL A;  2M1K B;  3OB2 B;  2KYC A;  1FF1 A;  1QLK A;  1JFK A;  3OX6 A;  4MVF A;  1M46 A;  2CCM A;  1XFX O;  2BKI B;  1NX1 A;  3PN7 C;  3SG5 A;  2Y1M A;  2BBN A;  2WC8 A;  4I5L B;  1SMG A;  1Y1X A;  2K7C A;  2ZRT A;  3PM8 A;  2LLS A;  5PAL A;  3JTD B;  2BL0 C;  1B7T Y;  2L0P A;  4I5N B;  1DT7 B;  4ZCV A;  1CFF A;  1K90 D;  1KWO B;  3EK7 A;  2ZND A;  3LK0 A;  2CBL A;  4PHJ A;  1MUX A;  3KHE A;  4XJK A;  3OP0 A;  1LVC D;  1SCM C;  1UUR A;  1EG3 A;  2TN4 A;  2CTN A;  2OTG B;  4PCW A;  1OMV A;  2KQY A;  4HRE E;  1FPW A;  1CDM A;  1QAT A;  4YGA A;  3WNX B;  1S36 A;  4GAO A;  4BY5 A;  5F6T A;  4ORB B;  1KK7 Z;  3PSR A;  4JPZ B;  1YVH A;  4DRW A;  3KEV A;  2BCA A;  3PN7 B;  1YRU B;  4NDD A;  2JT0 A;  2O60 A;  5HKY A;  2ZFD A;  3SIA A;  4MZK A;  4UPG A;  4PHK A;  4YGC B;  2LAN A;  1HT9 A;  3KF9 A;  1ZOT B;  2LUC A;  2F33 A;  1CDL A;  2HQW A;  2BL0 B;  4YGD B;  5HKW A;  1TNP A;  3BYA A;  2KAY A;  3FIA A;  1BLQ A;  1S3P A;  1TOP A;  3CZT X;  1BOC A;  1XFW O;  1NX0 A;  1Y1A A;  1XFZ O;  1QX7 A;  4M2O A;  3CGA A;  4QJ3 B;  1ZMZ A;  2BBM A;  5B8I B;  1Y6W A;  1A75 B;  1TCF A;  3OHM B;  4ICB A;  1QIW A;  1XK4 C;  1WRL A;  4M2P A;  1IJ5 A;  4AQJ A;  1F71 A;  2K61 A;  1IQ3 A;  4NDB A;  1KQV A;  4N5X A;  1N2D A;  4R1E A;  1DJZ A;  2WCE A;  4YGE B;  1FI5 A;  3A4U B;  4OR9 B;  4DUQ A;  2WND A;  3RLZ A;  1KQM C;  1RJV A;  1UWO A;  1M31 A;  3BXK A;  1SR6 C;  3EVU A;  4PE1 A;  2I94 A;  1CKK A;  2KGR A;  2LVK A;  4A4B A;  3FWC A;  2JT8 A;  2KFF A;  3DVE A;  3GK4 X;  2B1U A;  3NSO A;  1ALV A;  1AP4 A;  2CT9 A;  3AAK A;  4QJ5 B;  2LE9 B;  2OS8 C;  2E30 A;  3HX4 A;  5I2L A;  5DKQ A;  1CFP A;  1XFU O;  3VRP A;  4FQO A;  4GUK A;  1QJT A;  3H4S E;  2LVV A;  2G9B A;  3DVJ A;  1XK4 A;  2COL B;  2M3W A;  3VRO A;  2OPO A;  1NIW A;  1BMO A;  1IH0 A;  1PVB A;  1XO5 A;  2NZ0 A;  1PRW A;  3BUX B;  1S6C A;  1DJI A;  1YX8 A;  3BUN B;  2ZN9 A;  4P2Y B;  2F3Y A;  3DF0 B;  2M49 B;  3WHT B;  2Y5I A;  2K7D A;  4YBH B;  1OMD A;  1KQM B;  2LLT A;  2MRD A;  1SR6 B;  1SY9 A;  2HF5 A;  1KSO A;  1KCY A;  1IKU A;  3SIB A;  2KHN A;  2KI6 D;  2IS9 A;  1M45 A;  2NLN A;  2HQ8 A;  2KI4 C;  4GGF A;  1F4Q A;  4WQ2 A;  1DGV A;  2KOT A;  1K2H A;  5ER4 X;  2L2E A;  4D1E A;  2OS8 B;  4YGB B;  1R2U A;  2LHL A;  1MXE A;  1SL7 A;  1WRZ A;  4N1F A;  2JC2 A;  4NDC A;  1CTR A;  1K9U A;  3BUW B;  2R2I A;  1TNX A;  1CM1 A;  2V53 A;  3K21 A;  1W7J B;  3DVM A;  1E8A A;  2VRG A;  2DOQ A;  3GOF A;  2H2K A;  4HRH A;  5CSJ A;  5D7F A;  2JOJ A;  2KFG A;  1YR5 A;  2MJW B;  3WXA A;  1Y0V H;  1EXR A;  2HET A;  5K89 A;  2NCO A;  1BOD A;  2JZI A;  1KFU S;  2K7O A;  4AOM A;  2LM5 A;  4XJK B;  3NSL A;  1KFX L;  1YUS A;  2GV5 A;  1K9P A;  1MHO A;  3TDZ A;  2KI4 B;  2O5G A;  2NXQ A;  1OZO A;  3EK8 A;  4XYN A;  1S6J A;  1AJ5 A;  3EVR A;  2KSP A;  1G8I A;  1TN4 A;  2PAS A;  2SAS A;  3CLN A;  4GFT A;  1CLM A;  1J55 A;  3QRX A;  1XFV O;  1QVI Z;  1G33 A;  3IQQ A;  2H61 A;  4PE0 A;  1BF5 A;  2I7A A;  3BUO B;  1A03 A;  1M63 B;  1QS7 A;  2WCB A;  2WOS A;  3TDU A;  1JC2 A;  3AAJ A;  3NSK A;  1SYM A;  3CS1 A;  1FW4 A;  4MEW A;  1J7O A;  1EL4 A;  1PVA A;  3O78 A;  1NWD A;  5HYD A;  3PAT A;  1UHH A;  1WLM A;  3I5F C;  1BJF A;  1NCX A;  1W7I B;  1UHN A;  4MN0 A;  1S26 D;  1QX2 A;  4GPL B;  1J1D A;  1S6I A;  1SCV A;  2LVI A;  3LLE A;  3EVV A;  1XA5 A;  2LC5 A;  3TDI A;  3VGO A;  2MLF C;  4YI9 A;  1K8U A;  2JU0 A;  2BE6 A;  2LAP A;  2AMI A;  3DD4 A;  1CFC A;  1DJY A;  3NSI A;  2FCE A;  4N1G A;  2FJU B;  2JWW A;  1J1E A;  1SCM B;  3I5H C;  4GNK B;  3PFV A;  2JXC A;  1KFU L;  5JOL A;  1MR8 A;  2Q91 A;  5KTY A;  2LLU A;  1TNQ A;  4C0J A;  1C07 A;  1N65 A;  5D69 A;  2I2R E;  4OKH A;  1UHI A;  3HCM A;  4Q04 A;  2G2B A;  3O2P A;  3EK4 A;  3SG3 A;  3CR4 X;  1UP5 A;  5DKN A;  1CB1 A;  1XVJ A;  1CFD A;  1S5G Z;  2JTT A;  3KPX A;  2Q4U A;  3I5F B;  1QTX A;  1SW8 A;  3E3R A;  1G4Y R;  3LCP C;  3VRQ A;  1YTZ C;  2LP2 A;  1GGW A;  2KYF A;  1TRF A;  3C1V A;  2ISD A;  5KSZ A;  3PAL A;  4GGF C;  3TZ1 A;  4MLW A;  1XYD A;  2KI6 C;  2Y4Q A;  4PHM A;  3I5H B;  4CFR A;  4JQ0 D;  5HLO A;  2KAV A;  1LA3 A;  1B8L A;  1IWQ A;  2L51 A;  1L7Z A;  2JNF A;  5GQQ C;  2L50 A;  1K95 A;  1U5I A;  2BE4 A;  1REC A;  1OQP A;  1EG4 A;  4U8D A;  2BKH B;  2M0R A;  1LA0 A;  2MA2 A;  4HRG A;  1QAS A;  1L2O C;  1GGZ A;  5G08 A;  1JFJ A;  1CMF A;  2EC6 C;  1DJG A;  2KAX A;  1NCZ A;  4YI8 A;  1F54 A;  5CPV A;  1OZS A;  1PSR A;  3CR2 A;  3OB1 B;  1WY9 A;  2KBI A;  3I5G C;  1KFX S;  3TS5 C;  1B47 A;  1J7R A;  1IQ5 A;  1SKT A;  1J7P A;  2LP3 A;  3SG7 A;  1B8C A;  1QVI Y;  1MF8 B;  1KK7 Y;  1NUB A;  4CLN A;  2M97 A;  4NQG A;  1SK6 D;  3FS7 A;  4OVN F;  2QPT A;  1RRO A;  5I2Q A;  1SL9 A;  2F3Z A;  4AQI A;  4DIR A;  1OSA A;  2CXJ A;  4FTG A;  4YRU A;  2KBM A;  3D0Y A;  2RGI A;  4JWQ A;  2BCX A;  2H61 C;  2MAZ A;  4PHN A;  1JBA A;  1FI6 A;  5TNC A;  2ZRS A;  5BPJ A;  1B9A A;  1Y1U A;  1IG5 A;  1DF0 A;  3DVK A;  2K0J A;  1SRA A;  1L2O B;  1DF0 B;  2JT3 A;  4MBE A;  5AER A;  2EC6 B;  1OOJ A;  3ZNI A;  3AKB A;  1DJH A;  5AEQ A;  1ZFS A;  1JWD A;  1GQM A;  4ETO A;  1CM4 A;  4GBA A;  4F0Z B;  1F4O A;  4OCI A;  1DTL A;  3I5G B;  3TUY C;  4WQ3 A;  3EKH A;  3TS5 B;  1B1G A;  2KFH A;  1RTP 1;  5HKZ A;  2K2F A;  5ER5 A;  1BG1 A;  1F70 A;  1ODB A;  2PAL A;  4CFQ A;  2NCP A;  2JUL A;  2AUC A;  3BUM B;  4C0L A;  4I5J A;  2F8P A;  1S5G Y;  2CNP A;  3MSE B;  1A29 A;  1PK0 D;  1C7V A;  1RFJ A;  5IBW A;  1F8H A;  5JJG A;  2BEC A;  4E68 A;  3SG6 A;  3AKA A;  2JTZ A;  4ORC B;  1F55 A;  3WHU B;  1XFY O;  1UHJ A;  1VRK A;  4USL A;  2ZN8 A;  4GGN A;  2PVB A;  3PLF B;  1B4C A;  1CNP A;  1EH2 A;  1QXP A;  3KO0 A;  4MRX A;  5HLV A;  2Y1N A;  1KK8 C;  1DJW A;  4IL1 A;  4OV2 A;  3GK2 A;  2KQ6 A;  1TIZ A;  2EHB A;  3CWG A;  3TUY B;  2HPS A;  3BQ3 A;  1BU3 A;  3FWB A;  3JVT C;  4DCK A;  5J3X A;  1WRK A;  4PDZ A;  1AJ4 A;  2QAC A;  2KDH A;  1M39 A;  1SBJ A;  1IGV A;  1SPY A;  2WCF A;  4MZL A;  4DS7 A;  3SG4 A;  1NCY A;  5CSN A;  2KNE A;  2MBX A;  1H4B A;  1PUL A;  2ZKM X;  2ZNE A;  3F45 A;  1HQV A;  2P6B B;  2MHH A;  3IQO A;  1JSA A;  1B8R A;  5DKR A;  2L4I A;  1QX5 B;  2LHI A;  3NXA A;  5CSI A;  2M29 A;  3A8R A;  4MZJ A;  1NSH A;  1DGU A;  1CDN A;  2WOR A;  2MLE C;  2LMV A;  2PMY A;  1PSB A;  2BCB A;  2LNK A;  2LV7 A;  3CTN A;  1WLZ A;  4CPV A;  1H8B A;  1LXF C;  1UUS A;  2L4H A;  2JNX A;  1K93 D;  1BR4 B;  3ICB A;  1KK8 B;  1OMR A;  3ZWH A;  2L5X B;  3GK1 A;  1D1O A;  1AK8 A;  1BR1 B;  4WRI A;  1B7T Z;  1CLL A;  1A75 A;  1QV0 A;  1YVL A;  1MWN A;  4HSZ A;  3M0W A;  1JF2 A;  3JVT B;  2LMT A;  4I5K A;  2PRU A;  1A4P A;  1Q80 A;  1QV1 A;  2L98 A;  2LCP A;  2JPT A;  5I2O A;  2LMU A;  3I5I C;  3SJS A;  1FBV A;  2M8U A;  3LK1 A;  4PAL A;  1WDC C;  4ZCU A;  3SG2 A;  4ORA B;  1CLB A;  2M7N A;  1U5I B;  3LL8 B;  2GGM A;  5I8N A;  1ALW A;  1NX3 A;  1K9K A;  2LVJ A;  4PE7 A;  4A4C A;  1SL8 A;  1N0Y A;  1YUR A;  1J7Q A;  2E6W A;  1V1G A;  2GGZ A;  1NP8 A;  1C7W A;  1ZAC A;  2SCP A;  5AXI A;  1SNL A;  2A4J A;  1YRT B;  1NYA A;  2EGD A;  1V1F A;  3BOW A;  2M7L A;  1TCO B;  1IJ6 A;  3BOW B;  3OX5 A;  4BY4 A;  5AAN A;  1TNW A;  1AUI B;  1CDP A;  1MQ1 A;  3D10 A;  1RWY A;  1A2X A;  1BT6 A;  2JRF A;  1ZUZ A;  5CSF A;  4CID A;  1LKJ A;  4C0K A;  2D8N A;  1YUU A;  4L9M A;  2PSR A;  1OE9 B;  1NPQ A;  1X02 A;  1YUT A;  3O6B A;  3I5I B;  1LIN A;  1R6P A;  4QJ4 B;  1TTX A;  3DF0 A;  2JXL A;  1QIV A;  1WDC B;  1AVS A;  2F2O A;  4MRY A;  4MSP A;  3RM1 A;  1KSM A;  3D0Y B;  5KU1 A;  2JQ6 A;  1QLS A;  1IRJ A;  4PE4 A;  1DVI A;  3VRN A;  1CMG A;  1AHR A;  2KGB C;  4TNC A;  1DJX A;  2M1U A;  1GJY A;  3IF7 A;  3JTD C;  2K2A A;  3O4Y A;  3VRR A;  1KWO C;  2K8M B;  1DMO A;  2M9G A;  4P5O E;  1S1E A;  1K96 A;  1UHK A;  1EJ3 A;  1NX2 A;  2K7B A;  2OTG C;  2F2P A;  3CR5 X;  1K94 A;  1RK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...