1B9AA

Parvalbumin (mutation;d51a, f102w)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
108
structure length
108
Chain Sequence
AFAGVLNDADIAAALEACKAADSFNHKAFFAKVGLTSKSADDVKKAFAIIAQDKSGFIEEDELKLFLQNFKADARALTDGETKTFLKAGDSDGDGKIGVDEWTALVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PARVALBUMIN)
publication title Metal-ion affinity and specificity in EF-hand proteins: coordination geometry and domain plasticity in parvalbumin.
pubmed doi rcsb
source organism Cyprinus carpio
molecule tags Calcium binding protein
total genus 36
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1999-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b9aA00
1UUSA 2E30A 2PRUA 1DVIA 4PE1A 1QVIY 4U8DA 1S26D 1X02A 1KQMB 1EXRA 1IKUA 1J7PA 1Y6WA 1XK4A 1K95A 1IJ6A 2Q91A 3CS1A 2M7NA 2F3ZA 1DGUA 1XFZO 5ER4X 1BODA 1B8CA 1XVJA 2BCAA 5AXIA 1KSMA 1DJGA 1SCMC 3BUMB 2F2OA 1F55A 1S5GY 1UHJA 1KWOC 2L51A 3DVMA 2F3YA 2K7CA 4OV2A 4NQGA 4IL1A 1PSBA 1SL8A 1UHIA 3VROA 1MF8B 3I5GB 3FS7A 1JBAA 1N2DA 2JT3A 4MZLA 2M29A 2D8NA 1LKJA 1QASA 2EGDA 4M2PA 5I2LA 1BT6A 1ZOTB 2HQWA 4HSZA 1E8AA 3DF0A 2LHLA 2LANA 2LLSA 1MQ1A 2BCBA 4NDCA 3K21A 1GGZA 1AP4A 4NDDA 2NCOA 1Y1AA 2MLEC 4N5XA 2BL0B 4M2QA 4D1EA 1QTXA 2KYCA 2M3WA 2KFGA 4ORBB 1LINA 4XJKA 1GQMA 4MZJA 5IBWA 1DJIA 1OMVA 2WNDA 5KTYA 1AJ5A 4YGBB 1BOCA 2LVIA 2H61C 1QX2A 2LVVA 2L4IA 1KK7Z 1NCYA 1BJFA 2WOSA 5HKWA 1CFPA 1A4PA 1TNXA 3A4UB 1SY9A 3JVTB 1AVSA 4PHMA 4N1FA 1SRAA 2JWWA 1J7RA 4A4BA 3WXAA 1B7TZ 1CDLA 3CGAA 4GFTA 3SG5A 1H8BA 2AUCA 1R6PA 1SK6D 1NPQA 1KK8B 2KI4B 3BUOB 4I5NB 2KSPA 4CPVA 1J7QA 2G2BA 3IQOA 1M39A 1SW8A 3LK0A 4PALA 2FCDA 2KOTA 1CFCA 1SCVA 3A8RA 1TCFA 1S5GZ 1G33A 3BXKA 3SG7A 1XFWO 1A29A 1B9AA 3JTDC 1TCOB 2JTTA 1DTLA 2L98A 2M97A 2E6WA 3KO0A 1JSAA 4YGAA 1DJYA 3IF7A 3NXAA 1KSOA 1MR8A 2JQ6A 2K2AA 3PSRA 1FPWA 2ZRTA 2M9GA 1ODBA 1GJYA 1ZUZA 2PASA 3BQ3A 1ALWA 3I5FB 3OP0A 4MRYA 2Y5IA 1KQMC 3OB1B 1FW4A 2KDHA 2OS8B 3EVUA 2AMIA 2K7DA 2KQYA 2ZKMX 3ZNIA 2BKIB 1JFKA 4MRXA 3NSLA 2I18A 1KFUL 3EVVA 3OX6A 2GV5A 1F70A 3WHTB 1DJWA 2I94A 1DJXA 1XK4C 3BUXB 3LK1A 2JU0A 5TNCA 1B1GA 2COLB 2JPTA 3EK7A 1YR5A 2BBNA 1WRKA 3I5GC 1A03A 2Y4QA 2MA2A 3GK4X 2BBMA 3TUYB 3VRQA 1IH0A 1CMGA 1H4BA 5PALA 4JQ0D 1V1GA 2Y1MA 1QV1A 3O78A 1UHKA 1WY9A 4PHJA 1U5IA 2KI6D 3MSEB 2M1UA 1NUBA 1QV0A 3I5IB 1AJ4A 2OTGB 2MJWB 3EK8A 4GGNA 4MEWA 1TN4A 2NCPA 2BL0C 1MWNA 1KCYA 4HRHA 2BECA 2JZIA 2Y1NA 2F33A 2JT8A 2LHIA 4WQ3A 1A2XA 3AKBA 1AK8A 1XFVO 3EVRA 1C7WA 1J1EA 1YRUB 1XYDA 1KK7Y 1L2OB 5KU1A 2BKHB 1TTXA 4MSPA 2M1KB 5CPVA 2CNPA 3SJSA 2KHNA 2O60A 3PN7B 4OKHA 3TDIA 1J1DA 5D7FA 1RTP1 4N1GA 1B7TY 3CTNA 2KBMA 3FWCA 3KPXA 1KK8C 2KI4C 2LP2A 1NIWA 4DRWA 2JOJA 4CFQA 1EH2A 4BY5A 1RWYA 5HYDA 4YI8A 4PE4A 5B8IB 1J55A 1F4QA 2M49B 2ZFDA 2IS9A 4P5OE 1CLMA 1B4CA 1B8RA 1M63B 1EG3A 3GOFA 5K89A 1CLLA 1WRLA 2G9BA 1NYAA 2M7LA 3AAJA 1QIWA 4Q04A 5CSJA 4GGFA 2CBLA 2JTZA 3AKAA 3GK1A 2H2KA 2HF5A 2L2EA 3I5FC 2BE4A 5AANA 4C0KA 4CLNA 2L5XB 2WCFA 2OS8C 5CSFA 5I8NA 4MBEA 1LVCD 1SNLA 1WDCB 1UWOA 2AAOA 2NXQA 2MBXA 1S36A 1KFXS 1SBJA 2EC6B 1TNQA 1FF1A 1C7VA 4GBAA 3O6BA 1FBVA 1NP8A 1OOJA 1UHNA 4FQOA 4HREE 4M2OA 2TN4A 5DKNA 1CTRA 5I2QA 1SL9A 3SIBA 3DF0B 2P6BB 3HCMA 2HPSA 3SG6A 4ETOA 3EK4A 1BMOA 1N0YA 4C0LA 2JC2A 4E68A 2KQ6A 2LAPA 5ER5A 4XJKB 4DS7A 2LV7A 3TUYC 1A75A 2LC5A 4WRIA 2KYFA 4OCIA 3VRNA 1EL4A 5JOLA 2LLUA 1L7ZA 5JJGA 1LA0A 2PVBA 5FYXA 1B8LA 3CR5X 1M45A 4WQ2A 4ZCVA 1YX7A 3I5IC 1XFUO 2OTGC 1B47A 4DIRA 2R2IA 3PLFB 5HKZA 2SCPA 1N65A 2CCMA 1PRWA 2KFHA 5AFPA 2WCEA 2M0RA 2LUXA 1BU3A 1VRKA 1QS7A 1PULA 2K2FA 2LUCA 1WRZA 3LLEA 2LVKA 4JWQA 1L2OC 1G4YR 2JNFA 4P2YB 5CSNA 4A4CA 1YTZC 4HRGA 5BPJA 2ZNEA 3TDUA 1F71A 4YI9A 4AQIA 1CB1A 1AUIB 1KQVA 1M46A 1JWDA 5HLOA 2ZRSA 3PN7C 4MN0A 1BLQA 1PVAA 1ZACA 3DVJA 1PALA 1BG1A 1DF0A 4XYNA 2KGBC 1UURA 3O4YA 1EJ3A 1MXEA 2O5GA 1QATA 3KF9A 5F6TA 1DJHA 3NSOA 2LMUA 1OMRA 1K9PA 1ZMZA 4OVNF 1Y1XA 1DJZA 4R1EA 1CMFA 3I5HB 1QLKA 3AAKA 1YVHA 2MRDA 1NX0A 3ZWHA 2PSRA 1QIVA 4OR9B 1SR6B 1OQPA 1BF5A 1FI5A 1JC2A 5AEQA 1JF2A 1S6IA 2K7OA 1WDCC 2KGRA 3TDZA 3ICBA 2EC6C 1NCXA 1CDPA 2JRFA 5GQQC 3RM1A 3LCPC 2GGZA 3C1VA 2KAYA 2I2RE 1W7JB 3LL8B 4PHKA 1YRTB 1YUTA 2NLNA 1IQ3A 4TNCA 2BCXA 1IQ5A 2CTNA 3OB2B 4L9MA 1V1FA 3DVKA 1K8UA 1SYMA 1U5IB 1M31A 1CKKA 4ORCB 2V53A 3CWGA 1ALVA 2ZNDA 1OE9B 1CM4A 1K94A 3OX5A 4BY4A 5HKYA 3F45A 3JVTC 2MAZA 1C07A 1FI6A 5KSZA 1F8HA 3SG3A 2JXLA 4PHNA 2ZN9A 2WC8A 1J7OA 2FOTA 3BYAA 4USLA 5G08A 2LNKA 3QRXA 1IJ5A 1PVBA 3D0YA 1LA3A 4YGEB 1Q80A 3D10A 1IWQA 1KFXL 3EKHA 1EG4A 1UHHA 2QACA 4I5JA 2LVJA 1PSRA 4F0ZB 1OMDA 3D0YB 1QLSA 1ZFSA 4NDBA 1F54A 1RROA 4MLWA 5CSIA 1LXFC 4PE7A 1DT7B 1IRJA 4QJ5B 3NSKA 1AHRA 2LP3A 3BUWB 4YGCB 4QJ3B 5AERA 1OZOA 2JNXA 3BUNB 1TIZA 1NWDA 1DMOA 2WORA 1SMGA 2KBIA 1K9KA 2JT0A 3BOWA 1XFYO 4PE0A 2LCPA 2JXCA 2ISDA 2FCEA 1QXPA 1SL7A 1UP5A 3VGOA 3SG2A 4DUQA 1NX1A 5I2OA 4GNKB 3PFVA 1K90D 4ICBA 1YVLA 3I5HC 1BR1B 2FJUB 3GK2A 3M0WA 1CDNA 3KEVA 3BOWB 1YURA 1XA5A 2PALA 5DKRA 1S3PA 2HETA 2K8MB 1SR6C 2I7AA 1SPYA 3O2PA 4YGDB 2SASA 3WNXB 4ZCUA 1RK9A 4MZKA 1RFJA 1S1EA 2EHBA 2LMTA 2LM5A 3TS5B 1CFFA 4AOMA 4DCKA 1A75B 1RECA 3DD4A 2RGIA 1K9UA 4ORAB 1JFJA 1Y0VH 1QVIZ 3H4SE 1QJTA 1SKTA 3RLZA 4QJ4B 1QX5B 2Q4UA 1TNPA 2HQ8A 1XFXO 2LE9B 4PCWA 1D1OA 1CLBA 3FWBA 1S6JA 2MHHA 3EKJA 2CXJA 1CM1A 3HX4A 1CDMA 5D69A 2LMVA 3WHUB 1YUSA 2B1UA 2QPTA 1TNWA 1MUXA 3VRPA 2DOQA 1JUOA 1W7IB 2K0JA 1K2HA 1SCMB 3PALA 1TOPA 1GGWA 4YRUA 1KWOB 1NSHA 4C0JA 3NSIA 1IG5A 1YUUA 2K7BA 2L50A 2WCBA 3OHMB 1DGVA 1F4OA 3SG4A 1OZSA 1DF0B 3SIAA 1XO5A 1OSAA 3DVEA 1HQVA 1PK0D 1CFDA 5J3XA 1CNPA 1RJVA 3KHEA 2OPOA 2JULA 4GPLB 2KNEA 2ZN8A 4UPGA 1HT9A 2L4HA 2KFFA 1BR4B 2BE6A 3CR4X 2H61A 3CR2A 1QX7A 4FTGA 4GGFC 2L0PA 2NZ0A 2M8UA 3CLNA 4JPZB 5HLVA 1NCZA 2MLFC 2KI6C 2GGMA 2F2PA 4CIDA 1NX2A 2VRGA 1NX3A 2A4JA 1JF0A 2KAVA 1Y1UA 4MVFA 4PDZA 4I5LB 2PMYA 1K93D 4YBHB 5DKQA 1KFUS 3IQQA 4I5KA 3FIAA 2F8PA 3PM8A 1YX8A 2LLTA 1R2UA 2KAXA 4GAOA 3TZ1A 2K61A 4AQJA 1MXLC 4GUKA 1G8IA 1MHOA 1TRFA 3PATA 1S6CA 1K96A 3TS5C 1WLMA 3VRRA 1WLZA 1IGVA 3JTDB 3E3RA 2CT9A 4CFRA 3CZTX
chains in the Genus database with same CATH superfamily
1UUSA 2E30A 2PRUA 5FI6A 1DVIA 4PE1A 1QVIY 4U8DA 1S26D 1X02A 1KQMB 3R1VA 1EXRA 1IKUA 1J7PA 1Y6WA 1XK4A 1K95A 5FI7A 1IJ6A 2Q91A 3CS1A 3V2LA 2M7NA 2F3ZA 1DGUA 1XFZO 5ER4X 1BODA 1B8CA 1XVJA 2BCAA 5AXIA 1KSMA 1DJGA 1SCMC 2WCKA 3BUMB 2F2OA 1F55A 1S5GY 1UHJA 1KWOC 2L51A 3DVMA 3CZ2A 2F3YA 2K7CA 4OV2A 4NQGA 4IL1A 1PSBA 1SL8A 1UHIA 3VROA 1MF8B 3CDNA 3I5GB 3FS7A 1OOIX 1JBAA 1N2DA 2JT3A 3R72A 4MZLA 2M29A 2D8NA 1LKJA 1QASA 2EGDA 4M2PA 5I2LA 3BJHA 1BT6A 5D3OA 1ZOTB 2HQWA 4HSZA 1E8AA 3DF0A 1OOHA 2LHLA 2LANA 2LLSA 3EG5B 1MQ1A 3PJIA 2BCBA 4NDCA 3K21A 1GGZA 2WC5A 1AP4A 3D77A 4NDDA 2NCOA 1Y1AA 2MLEC 4N5XA 2BL0B 4M2QA 4D1EA 1QTXA 2KYCA 2M3WA 2KFGA 4ORBB 1LINA 4XJKA 1GQMA 4MZJA 3S0EA 1DJIA 1DELA 1OMVA 2WNDA 5IBWA 5KTYA 1AJ5A 4YGBB 1BOCA 2LVIA 2H61C 1QX2A 2LVVA 2L4IA 1KK7Z 1NCYA 1BJFA 2WOSA 5HKWA 1CFPA 1A4PA 1TNXA 3A4UB 1SY9A 3JVTB 1AVSA 4PHMA 4N1FA 1SRAA 2JWWA 1J7RA 4A4BA 3WXAA 1B7TZ 3B86A 1CDLA 3CGAA 4GFTA 3SG5A 1H8BA 2AUCA 1R6PA 3N7HA 1SK6D 3R1PA 1NPQA 1KK8B 2KI4B 3BUOB 4I5NB 2KSPA 4CPVA 1J7QA 2G2BA 3IQOA 1M39A 1SW8A 3LK0A 2BAPA 2FCDA 4PALA 2KOTA 1CFCA 1SCVA 3A8RA 1TCFA 1XFRA 1S5GZ 1G33A 3BXKA 3SG7A 1XFWO 1A29A 1B9AA 3FE6A 3JTDC 1TCOB 2JTTA 1DTLA 2L98A 2M97A 2E6WA 3KO0A 3S0GA 3SS5A 1JSAA 4YGAA 3S0AA 3S0FA 1DJYA 3IF7A 3NXAA 2GTEA 3RZSA 1KSOA 1MR8A 2JQ6A 2K2AA 3PSRA 1FPWA 2ZRTA 2M9GA 1ODBA 1GJYA 1ZUZA 2PASA 3BQ3A 1ALWA 3I5FB 3OP0A 2QEBA 4MRYA 2Y5IA 1KQMC 3OB1B 1FW4A 2FJYA 2KDHA 2OS8B 3EVUA 3DXLA 2AMIA 2K7DA 2KQYA 2ZKMX 3ZNIA 2BKIB 1JFKA 4MRXA 3NSLA 3D75A 2I18A 2KLDA 1KFUL 3EVVA 3CABA 3OX6A 2GV5A 2QEHA 3K1EA 3L47A 1OOFA 1F70A 3WHTB 1DJWA 2I94A 1DJXA 1XK4C 3BUXB 3LK1A 2WCJA 2JU0A 5TNCA 1B1GA 2COLB 2JPTA 3EK7A 1YR5A 2BBNA 1WRKA 3I5GC 1A03A 2Y4QA 2MA2A 3GK4X 1SSEB 2BBMA 3TUYB 3VRQA 1IH0A 3B87A 3L4LA 5PALA 4JQ0D 3UO9A 1V1GA 2Y1MA 1CMGA 1QV1A 1H4BA 3O78A 1UHKA 1WY9A 4PHJA 1U5IA 2KI6D 3MSEB 2M1UA 1NUBA 1QV0A 1QWVA 3I5IB 1AJ4A 1T14A 2MJWB 2OTGB 3EK8A 4GGNA 3L4AA 4MEWA 1TN4A 2NCPA 2BL0C 1MWNA 4IJ7A 4HRHA 1KCYA 2QEOA 2BECA 2JZIA 2Y1NA 3DYEA 2F33A 2JT8A 2LHIA 4WQ3A 1A2XA 3AKBA 1AK8A 1XFVO 3EVRA 1C7WA 1J1EA 1YRUB 1XYDA 1KK7Y 1L2OB 5KU1A 2BKHB 1TTXA 4MSPA 2M1KB 3SS3A 5CPVA 2CNPA 3SJSA 2KHNA 2O60A 3PN7B 4OKHA 1TUZA 1J1DA 5D7FA 1RTP1 4N1GA 1B7TY 3CTNA 2KBMA 1C3ZA 3FWCA 3KPXA 5I94A 1KK8C 2KI4C 2LP2A 1NIWA 4DRWA 2JOJA 3NHTA 4CFQA 1EH2A 4BY5A 1RWYA 5HYDA 4YI8A 4PE4A 5B8IB 1J55A 1F4QA 2M49B 2ZFDA 2IS9A 4P5OE 1CLMA 1B4CA 1B8RA 1M63B 1EG3A 3GOFA 5K89A 1CLLA 1WRLA 2G9BA 1NYAA 2M7LA 2QDIA 3AAJA 1QIWA 4Q04A 5CSJA 4GGFA 2CBLA 2JTZA 3AKAA 3GK1A 2H2KA 2HF5A 2L2EA 3I5FC 2BE4A 5AANA 4C0KA 4CLNA 2L5XB 2WCFA 2OS8C 5CSFA 5I8NA 4MBEA 1LVCD 1SNLA 1WDCB 1UWOA 2AAOA 2NXQA 2MBXA 1S36A 1KFXS 1SBJA 2EC6B 1TNQA 1FF1A 1C7VA 4GBAA 3O6BA 1FBVA 1NP8A 1OOJA 1UHNA 4FQOA 4HREE 4M2OA 2TN4A 5DKNA 1CTRA 3NHIA 5I2QA 1SL9A 3SIBA 3DF0B 2JPOA 2P6BB 3HCMA 2HPSA 3SG6A 3D78A 3CZ1A 4ETOA 3EK4A 1BMOA 1TWOA 1N0YA 3OGNA 4C0LA 2JC2A 4E68A 2KQ6A 2LAPA 5ER5A 4XJKB 4DS7A 2LV7A 3TUYC 1A75A 2LC5A 4WRIA 2KYFA 4OCIA 3VRNA 1EL4A 5JOLA 2LLUA 1L7ZA 5JJGA 1LA0A 2PVBA 5FYXA 1B8LA 3CR5X 1M45A 4WQ2A 1GM0A 4ZCVA 1YX7A 3I5IC 1XFUO 2OTGC 1B47A 4DIRA 2R2IA 3PLFB 5HKZA 2SCPA 1N65A 2CCMA 1PRWA 2KFHA 5AFPA 2WCEA 2M0RA 5EL2A 2LUXA 1OW4A 1BU3A 1VRKA 3D76A 1QS7A 1PULA 2K2FA 2LUCA 1WRZA 1Z4HA 3LLEA 2ERBA 2LVKA 3BFAA 2P71A 3FE8A 4JWQA 1L2OC 1G4YR 2H8VA 2JNFA 4P2YB 5CSNA 4A4CA 1YTZC 4HRGA 1Z2CB 5BPJA 2ZNEA 3TDUA 1F71A 4YI9A 4AQIA 1CB1A 1AUIB 1KQVA 1M46A 1JWDA 5HLOA 2ZRSA 3PN7C 4MN0A 1BLQA 1PVAA 1ZACA 3DVJA 1PALA 5FI2A 1BG1A 1DF0A 4XYNA 2KGBC 1UURA 3O4YA 1EJ3A 1MXEA 2O5GA 1QATA 3KF9A 5F6TA 1DJHA 3NSOA 2LMUA 1OMRA 1K9PA 1ZMZA 2PYQA 3B6XA 4OVNF 1Y1XA 1DJZA 4R1EA 1CMFA 3I5HB 1QLKA 3AAKA 1YVHA 2K60A 2MRDA 3D74A 1DQEA 1IIOA 1NX0A 3ZWHA 2PSRA 1QIVA 3SS4A 4OR9B 1SR6B 1OQPA 1BF5A 1FI5A 1JC2A 5AEQA 2WCMA 1JF2A 1S6IA 2K7OA 1WDCC 2KGRA 3TDZA 3ICBA 2EC6C 1NCXA 1CDPA 2JRFA 5GQQC 3RM1A 3LCPC 2GGZA 3C1VA 2KAYA 2I2RE 1W7JB 3LL8B 4PHKA 1YRTB 1YUTA 2NLNA 1IQ3A 4TNCA 2BCXA 1IQ5A 2CTNA 3OB2B 2KLEA 1V1FA 3DVKA 4L9MA 1K8UA 1SYMA 1U5IB 1M31A 1CKKA 3B7AA 4ORCB 2V53A 3B88A 3CWGA 1ALVA 2PQLA 1OE9B 1CM4A 1K94A 2ZNDA 3OX5A 4BY4A 5HKYA 3F45A 3JVTC 2MAZA 1C07A 1FI6A 5KSZA 1F8HA 3SG3A 3Q8IA 2JXLA 4PHNA 5DICA 2ZN9A 5HL1A 2WC8A 1J7OA 2FOTA 3BYAA 4USLA 5G08A 2LNKA 3QRXA 1IJ5A 1PVBA 2WC6A 3D0YA 1LA3A 4YGEB 1Q80A 3D10A 1IWQA 1KFXL 3EKHA 1EG4A 1UHHA 2QACA 1C3YA 4I5JA 1TUJA 2LVJA 1PSRA 4F0ZB 1OMDA 3D0YB 1QLSA 1ZFSA 4NDBA 3S0BA 1F54A 1RROA 1W9ZA 4MLWA 3S0DA 5CSIA 1LXFC 4PE7A 1DT7B 1IRJA 4QJ5B 3NSKA 1AHRA 2LP3A 3BUWB 3NGVA 4YGCB 4INXA 4QJ3B 5AERA 1OZOA 2JNXA 3BUNB 4PT1A 1TIZA 1NWDA 1DMOA 2WORA 3BFHA 1SMGA 2KBIA 1K9KA 2JT0A 2YGUA 1XFYO 3BOWA 3IVTA 4PE0A 2LCPA 2JXCA 2ISDA 2FCEA 1QXPA 1SL7A 1UP5A 3VGOA 3SG2A 4DUQA 1NX1A 5I2OA 4GNKB 3PFVA 1K90D 4ICBA 1YVLA 3I5HC 1BR1B 2FJUB 3GK2A 3M0WA 1CDNA 3D73A 3KEVA 3BOWB 4INWA 1YURA 1XA5A 3QMEA 1DEKA 2PALA 5DKRA 3R1OA 1S3PA 2HETA 4F7FA 2K8MB 1SR6C 2I7AA 1SPYA 3O2PA 4YGDB 2QEVA 2SASA 3WNXB 4ZCUA 1RK9A 3DY9A 4MZKA 1RFJA 1S1EA 2EHBA 2LMTA 2LM5A 4FQTA 3TS5B 1CFFA 4AOMA 4DCKA 1A75B 1RECA 3DD4A 2RGIA 1K9UA 4ORAB 3TDIA 1JFJA 1Y0VH 1QVIZ 3H4SE 1QJTA 1SKTA 2WCHA 3RLZA 4QJ4B 1QX5B 1DC1A 2P70A 2Q4UA 1TNPA 2HQ8A 1XFXO 2LE9B 4PCWA 1D1OA 1CLBA 3FWBA 1S6JA 2MHHA 3EKJA 2CXJA 1CM1A 3HX4A 3O4XA 1CDMA 5D69A 2LMVA 3WHUB 1YUSA 4KYNA 2WCLA 2B1UA 2QPTA 1TNWA 1MUXA 3VRPA 2DOQA 1JUOA 1W7IB 2K0JA 1K2HA 1SCMB 3PALA 1TOPA 1GGWA 4YRUA 1KWOB 1NSHA 4C0JA 3NSIA 1IG5A 1YUUA 2K7BA 2L50A 2WCBA 3OHMB 1DGVA 1F4OA 3SG4A 1OZSA 1DF0B 3DZTA 1XO5A 2BNXA 3SIAA 1OSAA 3DVEA 4JD9A 1HQVA 1PK0D 1CFDA 1LS8A 5J3XA 1CNPA 1RJVA 3KHEA 2KPHA 2OPOA 2JULA 4GPLB 2KNEA 2ZN8A 4UPGA 1HT9A 1OOGA 2L4HA 2KFFA 1BR4B 2BE6A 3CR4X 2H61A 3CR2A 1QX7A 4FTGA 3BFBA 4JKTA 4GGFC 2L0PA 2NZ0A 2M8UA 3CLNA 2L2CA 4JPZB 5HLVA 1NCZA 2MLFC 4OZDA 2KI6C 2GGMA 2F2PA 3OBVA 3PM2A 4CIDA 1NX2A 2VRGA 1NX3A 2A4JA 1JF0A 2KAVA 1Y1UA 4MVFA 4PDZA 4I5LB 3FE9A 3VB1A 2PMYA 1K93D 4YBHB 3CYZA 1KFUS 3IQQA 4I5KA 5DKQA 3FIAA 2F8PA 3PM8A 1YX8A 2LLTA 1R2UA 2KAXA 4GAOA 3TZ1A 2K61A 4AQJA 1MXLC 1ORGA 4GUKA 1G8IA 3CZ0A 1MHOA 1TRFA 3PATA 1S6CA 1K96A 3TS5C 1WLMA 3VRRA 1WLZA 1IGVA 3JTDB 1P28A 3UNWA 2L5YA 3E3RA 2CT9A 4CFRA 3CZTX
chains in the Genus database with same CATH topology
1UUSA 2E30A 2PRUA 1DVIA 4PE1A 1QVIY 4U8DA 1S26D 1X02A 1KQMB 1EXRA 1IKUA 1J7PA 1Y6WA 1XK4A 1K95A 1IJ6A 2Q91A 3CS1A 2M7NA 2F3ZA 1DGUA 1XFZO 5ER4X 1BODA 1B8CA 1XVJA 2BCAA 5AXIA 1KSMA 1DJGA 1SCMC 3BUMB 2F2OA 1F55A 1S5GY 1UHJA 1KWOC 2L51A 3DVMA 2F3YA 2K7CA 4OV2A 4NQGA 4IL1A 1PSBA 1SL8A 1UHIA 3VROA 1MF8B 3I5GB 3FS7A 1JBAA 1N2DA 2JT3A 4MZLA 2M29A 2D8NA 1LKJA 1QASA 2EGDA 4M2PA 5I2LA 1BT6A 1ZOTB 2HQWA 4HSZA 1E8AA 3DF0A 2LHLA 2LANA 2LLSA 1MQ1A 2BCBA 4NDCA 3K21A 1GGZA 1AP4A 4NDDA 2NCOA 1Y1AA 2MLEC 4N5XA 2BL0B 4M2QA 4D1EA 1QTXA 2KYCA 2M3WA 2KFGA 4ORBB 1LINA 4XJKA 1GQMA 4MZJA 5IBWA 1DJIA 1OMVA 2WNDA 5KTYA 1AJ5A 4YGBB 1BOCA 2LVIA 2H61C 1QX2A 2LVVA 2L4IA 1KK7Z 1NCYA 1BJFA 2WOSA 5HKWA 1CFPA 1A4PA 1TNXA 3A4UB 1SY9A 3JVTB 1AVSA 4PHMA 4N1FA 1SRAA 2JWWA 1J7RA 4A4BA 3WXAA 1B7TZ 1CDLA 3CGAA 4GFTA 3SG5A 1H8BA 2AUCA 1R6PA 1SK6D 1NPQA 1KK8B 2KI4B 3BUOB 4I5NB 2KSPA 4CPVA 1J7QA 2G2BA 3IQOA 1M39A 1SW8A 3LK0A 4PALA 2FCDA 2KOTA 1CFCA 1SCVA 3A8RA 1TCFA 1S5GZ 1G33A 3BXKA 3SG7A 1XFWO 1A29A 1B9AA 3JTDC 1TCOB 2JTTA 1DTLA 2L98A 2M97A 2E6WA 3KO0A 1JSAA 4YGAA 1DJYA 3IF7A 3NXAA 1KSOA 1MR8A 2JQ6A 2K2AA 3PSRA 1FPWA 2ZRTA 2M9GA 1ODBA 1GJYA 1ZUZA 2PASA 3BQ3A 1ALWA 3I5FB 3OP0A 4MRYA 2Y5IA 1KQMC 3OB1B 1FW4A 2KDHA 2OS8B 3EVUA 2AMIA 2K7DA 2KQYA 2ZKMX 3ZNIA 2BKIB 1JFKA 4MRXA 3NSLA 2I18A 1KFUL 3EVVA 3OX6A 2GV5A 1F70A 3WHTB 1DJWA 2I94A 1DJXA 1XK4C 3BUXB 3LK1A 2JU0A 5TNCA 1B1GA 2COLB 2JPTA 3EK7A 1YR5A 2BBNA 1WRKA 3I5GC 1A03A 2Y4QA 2MA2A 3GK4X 2BBMA 3TUYB 3VRQA 1IH0A 1CMGA 1H4BA 5PALA 4JQ0D 1V1GA 2Y1MA 1QV1A 3O78A 1UHKA 1WY9A 4PHJA 1U5IA 2KI6D 3MSEB 2M1UA 1NUBA 1QV0A 3I5IB 1AJ4A 2OTGB 2MJWB 3EK8A 4GGNA 4MEWA 1TN4A 2NCPA 2BL0C 1MWNA 1KCYA 4HRHA 2BECA 2JZIA 2Y1NA 2F33A 2JT8A 2LHIA 4WQ3A 1A2XA 3AKBA 1AK8A 1XFVO 3EVRA 1C7WA 1J1EA 1YRUB 1XYDA 1KK7Y 1L2OB 5KU1A 2BKHB 1TTXA 4MSPA 2M1KB 5CPVA 2CNPA 3SJSA 2KHNA 2O60A 3PN7B 4OKHA 3TDIA 1J1DA 5D7FA 1RTP1 4N1GA 1B7TY 3CTNA 2KBMA 3FWCA 3KPXA 1KK8C 2KI4C 2LP2A 1NIWA 4DRWA 2JOJA 4CFQA 1EH2A 4BY5A 1RWYA 5HYDA 4YI8A 4PE4A 5B8IB 1J55A 1F4QA 2M49B 2ZFDA 2IS9A 4P5OE 1CLMA 1B4CA 1B8RA 1M63B 1EG3A 3GOFA 5K89A 1CLLA 1WRLA 2G9BA 1NYAA 2M7LA 3AAJA 1QIWA 4Q04A 5CSJA 4GGFA 2CBLA 2JTZA 3AKAA 3GK1A 2H2KA 2HF5A 2L2EA 3I5FC 2BE4A 5AANA 4C0KA 4CLNA 2L5XB 2WCFA 2OS8C 5CSFA 5I8NA 4MBEA 1LVCD 1SNLA 1WDCB 1UWOA 2AAOA 2NXQA 2MBXA 1S36A 1KFXS 1SBJA 2EC6B 1TNQA 1FF1A 1C7VA 4GBAA 3O6BA 1FBVA 1NP8A 1OOJA 1UHNA 4FQOA 4HREE 4M2OA 2TN4A 5DKNA 1CTRA 5I2QA 1SL9A 3SIBA 3DF0B 2P6BB 3HCMA 2HPSA 3SG6A 4ETOA 3EK4A 1BMOA 1N0YA 4C0LA 2JC2A 4E68A 2KQ6A 2LAPA 5ER5A 4XJKB 4DS7A 2LV7A 3TUYC 1A75A 2LC5A 4WRIA 2KYFA 4OCIA 3VRNA 1EL4A 5JOLA 2LLUA 1L7ZA 5JJGA 1LA0A 2PVBA 5FYXA 1B8LA 3CR5X 1M45A 4WQ2A 4ZCVA 1YX7A 3I5IC 1XFUO 2OTGC 1B47A 4DIRA 2R2IA 3PLFB 5HKZA 2SCPA 1N65A 2CCMA 1PRWA 2KFHA 5AFPA 2WCEA 2M0RA 2LUXA 1BU3A 1VRKA 1QS7A 1PULA 2K2FA 2LUCA 1WRZA 3LLEA 2LVKA 4JWQA 1L2OC 1G4YR 2JNFA 4P2YB 5CSNA 4A4CA 1YTZC 4HRGA 5BPJA 2ZNEA 3TDUA 1F71A 4YI9A 4AQIA 1CB1A 1AUIB 1KQVA 1M46A 1JWDA 5HLOA 2ZRSA 3PN7C 4MN0A 1BLQA 1PVAA 1ZACA 3DVJA 1PALA 1BG1A 1DF0A 4XYNA 2KGBC 1UURA 3O4YA 1EJ3A 1MXEA 2O5GA 1QATA 3KF9A 5F6TA 1DJHA 3NSOA 2LMUA 1OMRA 1K9PA 1ZMZA 4OVNF 1Y1XA 1DJZA 4R1EA 1CMFA 3I5HB 1QLKA 3AAKA 1YVHA 2MRDA 1NX0A 3ZWHA 2PSRA 1QIVA 4OR9B 1SR6B 1OQPA 1BF5A 1FI5A 1JC2A 5AEQA 1JF2A 1S6IA 2K7OA 1WDCC 2KGRA 3TDZA 3ICBA 2EC6C 1NCXA 1CDPA 2JRFA 5GQQC 3RM1A 3LCPC 2GGZA 3C1VA 2KAYA 2I2RE 1W7JB 3LL8B 4PHKA 1YRTB 1YUTA 2NLNA 1IQ3A 4TNCA 2BCXA 1IQ5A 2CTNA 3OB2B 4L9MA 1V1FA 3DVKA 1K8UA 1SYMA 1U5IB 1M31A 1CKKA 4ORCB 2V53A 3CWGA 1ALVA 2ZNDA 1OE9B 1CM4A 1K94A 3OX5A 4BY4A 5HKYA 3F45A 3JVTC 2MAZA 1C07A 1FI6A 5KSZA 1F8HA 3SG3A 2JXLA 4PHNA 2ZN9A 2WC8A 1J7OA 2FOTA 3BYAA 4USLA 5G08A 2LNKA 3QRXA 1IJ5A 1PVBA 3D0YA 1LA3A 4YGEB 1Q80A 3D10A 1IWQA 1KFXL 3EKHA 1EG4A 1UHHA 2QACA 4I5JA 2LVJA 1PSRA 4F0ZB 1OMDA 3D0YB 1QLSA 1ZFSA 4NDBA 1F54A 1RROA 4MLWA 5CSIA 1LXFC 4PE7A 1DT7B 1IRJA 4QJ5B 3NSKA 1AHRA 2LP3A 3BUWB 4YGCB 4QJ3B 5AERA 1OZOA 2JNXA 3BUNB 1TIZA 1NWDA 1DMOA 2WORA 1SMGA 2KBIA 1K9KA 2JT0A 3BOWA 1XFYO 4PE0A 2LCPA 2JXCA 2ISDA 2FCEA 1QXPA 1SL7A 1UP5A 3VGOA 3SG2A 4DUQA 1NX1A 5I2OA 4GNKB 3PFVA 1K90D 4ICBA 1YVLA 3I5HC 1BR1B 2FJUB 3GK2A 3M0WA 1CDNA 3KEVA 3BOWB 1YURA 1XA5A 2PALA 5DKRA 1S3PA 2HETA 2K8MB 1SR6C 2I7AA 1SPYA 3O2PA 4YGDB 2SASA 3WNXB 4ZCUA 1RK9A 4MZKA 1RFJA 1S1EA 2EHBA 2LMTA 2LM5A 3TS5B 1CFFA 4AOMA 4DCKA 1A75B 1RECA 3DD4A 2RGIA 1K9UA 4ORAB 1JFJA 1Y0VH 1QVIZ 3H4SE 1QJTA 1SKTA 3RLZA 4QJ4B 1QX5B 2Q4UA 1TNPA 2HQ8A 1XFXO 2LE9B 4PCWA 1D1OA 1CLBA 3FWBA 1S6JA 2MHHA 3EKJA 2CXJA 1CM1A 3HX4A 1CDMA 5D69A 2LMVA 3WHUB 1YUSA 2B1UA 2QPTA 1TNWA 1MUXA 3VRPA 2DOQA 1JUOA 1W7IB 2K0JA 1K2HA 1SCMB 3PALA 1TOPA 1GGWA 4YRUA 1KWOB 1NSHA 4C0JA 3NSIA 1IG5A 1YUUA 2K7BA 2L50A 2WCBA 3OHMB 1DGVA 1F4OA 3SG4A 1OZSA 1DF0B 3SIAA 1XO5A 1OSAA 3DVEA 1HQVA 1PK0D 1CFDA 5J3XA 1CNPA 1RJVA 3KHEA 2OPOA 2JULA 4GPLB 2KNEA 2ZN8A 4UPGA 1HT9A 2L4HA 2KFFA 1BR4B 2BE6A 3CR4X 2H61A 3CR2A 1QX7A 4FTGA 4GGFC 2L0PA 2NZ0A 2M8UA 3CLNA 4JPZB 5HLVA 1NCZA 2MLFC 2KI6C 2GGMA 2F2PA 4CIDA 1NX2A 2VRGA 1NX3A 2A4JA 1JF0A 2KAVA 1Y1UA 4MVFA 4PDZA 4I5LB 2PMYA 1K93D 4YBHB 5DKQA 1KFUS 3IQQA 4I5KA 3FIAA 2F8PA 3PM8A 1YX8A 2LLTA 1R2UA 2KAXA 4GAOA 3TZ1A 2K61A 4AQJA 1MXLC 4GUKA 1G8IA 1MHOA 1TRFA 3PATA 1S6CA 1K96A 3TS5C 1WLMA 3VRRA 1WLZA 1IGVA 3JTDB 3E3RA 2CT9A 4CFRA 3CZTX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UUS A;  2E30 A;  2PRU A;  1DVI A;  4PE1 A;  1QVI Y;  4U8D A;  1S26 D;  1X02 A;  1KQM B;  1EXR A;  1IKU A;  1J7P A;  1Y6W A;  1XK4 A;  1K95 A;  1IJ6 A;  2Q91 A;  3CS1 A;  2M7N A;  2F3Z A;  1DGU A;  1XFZ O;  5ER4 X;  1BOD A;  1B8C A;  1XVJ A;  2BCA A;  5AXI A;  1KSM A;  1DJG A;  1SCM C;  3BUM B;  2F2O A;  1F55 A;  1S5G Y;  1UHJ A;  1KWO C;  2L51 A;  3DVM A;  2F3Y A;  2K7C A;  4OV2 A;  4NQG A;  4IL1 A;  1PSB A;  1SL8 A;  1UHI A;  3VRO A;  1MF8 B;  3I5G B;  3FS7 A;  1JBA A;  1N2D A;  2JT3 A;  4MZL A;  2M29 A;  2D8N A;  1LKJ A;  1QAS A;  2EGD A;  4M2P A;  5I2L A;  1BT6 A;  1ZOT B;  2HQW A;  4HSZ A;  1E8A A;  3DF0 A;  2LHL A;  2LAN A;  2LLS A;  1MQ1 A;  2BCB A;  4NDC A;  3K21 A;  1GGZ A;  1AP4 A;  4NDD A;  2NCO A;  1Y1A A;  2MLE C;  4N5X A;  2BL0 B;  4M2Q A;  4D1E A;  1QTX A;  2KYC A;  2M3W A;  2KFG A;  4ORB B;  1LIN A;  4XJK A;  1GQM A;  4MZJ A;  5IBW A;  1DJI A;  1OMV A;  2WND A;  5KTY A;  1AJ5 A;  4YGB B;  1BOC A;  2LVI A;  2H61 C;  1QX2 A;  2LVV A;  2L4I A;  1KK7 Z;  1NCY A;  1BJF A;  2WOS A;  5HKW A;  1CFP A;  1A4P A;  1TNX A;  3A4U B;  1SY9 A;  3JVT B;  1AVS A;  4PHM A;  4N1F A;  1SRA A;  2JWW A;  1J7R A;  4A4B A;  3WXA A;  1B7T Z;  1CDL A;  3CGA A;  4GFT A;  3SG5 A;  1H8B A;  2AUC A;  1R6P A;  1SK6 D;  1NPQ A;  1KK8 B;  2KI4 B;  3BUO B;  4I5N B;  2KSP A;  4CPV A;  1J7Q A;  2G2B A;  3IQO A;  1M39 A;  1SW8 A;  3LK0 A;  4PAL A;  2FCD A;  2KOT A;  1CFC A;  1SCV A;  3A8R A;  1TCF A;  1S5G Z;  1G33 A;  3BXK A;  3SG7 A;  1XFW O;  1A29 A;  1B9A A;  3JTD C;  1TCO B;  2JTT A;  1DTL A;  2L98 A;  2M97 A;  2E6W A;  3KO0 A;  1JSA A;  4YGA A;  1DJY A;  3IF7 A;  3NXA A;  1KSO A;  1MR8 A;  2JQ6 A;  2K2A A;  3PSR A;  1FPW A;  2ZRT A;  2M9G A;  1ODB A;  1GJY A;  1ZUZ A;  2PAS A;  3BQ3 A;  1ALW A;  3I5F B;  3OP0 A;  4MRY A;  2Y5I A;  1KQM C;  3OB1 B;  1FW4 A;  2KDH A;  2OS8 B;  3EVU A;  2AMI A;  2K7D A;  2KQY A;  2ZKM X;  3ZNI A;  2BKI B;  1JFK A;  4MRX A;  3NSL A;  2I18 A;  1KFU L;  3EVV A;  3OX6 A;  2GV5 A;  1F70 A;  3WHT B;  1DJW A;  2I94 A;  1DJX A;  1XK4 C;  3BUX B;  3LK1 A;  2JU0 A;  5TNC A;  1B1G A;  2COL B;  2JPT A;  3EK7 A;  1YR5 A;  2BBN A;  1WRK A;  3I5G C;  1A03 A;  2Y4Q A;  2MA2 A;  3GK4 X;  2BBM A;  3TUY B;  3VRQ A;  1IH0 A;  1CMG A;  1H4B A;  5PAL A;  4JQ0 D;  1V1G A;  2Y1M A;  1QV1 A;  3O78 A;  1UHK A;  1WY9 A;  4PHJ A;  1U5I A;  2KI6 D;  3MSE B;  2M1U A;  1NUB A;  1QV0 A;  3I5I B;  1AJ4 A;  2OTG B;  2MJW B;  3EK8 A;  4GGN A;  4MEW A;  1TN4 A;  2NCP A;  2BL0 C;  1MWN A;  1KCY A;  4HRH A;  2BEC A;  2JZI A;  2Y1N A;  2F33 A;  2JT8 A;  2LHI A;  4WQ3 A;  1A2X A;  3AKB A;  1AK8 A;  1XFV O;  3EVR A;  1C7W A;  1J1E A;  1YRU B;  1XYD A;  1KK7 Y;  1L2O B;  5KU1 A;  2BKH B;  1TTX A;  4MSP A;  2M1K B;  5CPV A;  2CNP A;  3SJS A;  2KHN A;  2O60 A;  3PN7 B;  4OKH A;  3TDI A;  1J1D A;  5D7F A;  1RTP 1;  4N1G A;  1B7T Y;  3CTN A;  2KBM A;  3FWC A;  3KPX A;  1KK8 C;  2KI4 C;  2LP2 A;  1NIW A;  4DRW A;  2JOJ A;  4CFQ A;  1EH2 A;  4BY5 A;  1RWY A;  5HYD A;  4YI8 A;  4PE4 A;  5B8I B;  1J55 A;  1F4Q A;  2M49 B;  2ZFD A;  2IS9 A;  4P5O E;  1CLM A;  1B4C A;  1B8R A;  1M63 B;  1EG3 A;  3GOF A;  5K89 A;  1CLL A;  1WRL A;  2G9B A;  1NYA A;  2M7L A;  3AAJ A;  1QIW A;  4Q04 A;  5CSJ A;  4GGF A;  2CBL A;  2JTZ A;  3AKA A;  3GK1 A;  2H2K A;  2HF5 A;  2L2E A;  3I5F C;  2BE4 A;  5AAN A;  4C0K A;  4CLN A;  2L5X B;  2WCF A;  2OS8 C;  5CSF A;  5I8N A;  4MBE A;  1LVC D;  1SNL A;  1WDC B;  1UWO A;  2AAO A;  2NXQ A;  2MBX A;  1S36 A;  1KFX S;  1SBJ A;  2EC6 B;  1TNQ A;  1FF1 A;  1C7V A;  4GBA A;  3O6B A;  1FBV A;  1NP8 A;  1OOJ A;  1UHN A;  4FQO A;  4HRE E;  4M2O A;  2TN4 A;  5DKN A;  1CTR A;  5I2Q A;  1SL9 A;  3SIB A;  3DF0 B;  2P6B B;  3HCM A;  2HPS A;  3SG6 A;  4ETO A;  3EK4 A;  1BMO A;  1N0Y A;  4C0L A;  2JC2 A;  4E68 A;  2KQ6 A;  2LAP A;  5ER5 A;  4XJK B;  4DS7 A;  2LV7 A;  3TUY C;  1A75 A;  2LC5 A;  4WRI A;  2KYF A;  4OCI A;  3VRN A;  1EL4 A;  5JOL A;  2LLU A;  1L7Z A;  5JJG A;  1LA0 A;  2PVB A;  5FYX A;  1B8L A;  3CR5 X;  1M45 A;  4WQ2 A;  4ZCV A;  1YX7 A;  3I5I C;  1XFU O;  2OTG C;  1B47 A;  4DIR A;  2R2I A;  3PLF B;  5HKZ A;  2SCP A;  1N65 A;  2CCM A;  1PRW A;  2KFH A;  5AFP A;  2WCE A;  2M0R A;  2LUX A;  1BU3 A;  1VRK A;  1QS7 A;  1PUL A;  2K2F A;  2LUC A;  1WRZ A;  3LLE A;  2LVK A;  4JWQ A;  1L2O C;  1G4Y R;  2JNF A;  4P2Y B;  5CSN A;  4A4C A;  1YTZ C;  4HRG A;  5BPJ A;  2ZNE A;  3TDU A;  1F71 A;  4YI9 A;  4AQI A;  1CB1 A;  1AUI B;  1KQV A;  1M46 A;  1JWD A;  5HLO A;  2ZRS A;  3PN7 C;  4MN0 A;  1BLQ A;  1PVA A;  1ZAC A;  3DVJ A;  1PAL A;  1BG1 A;  1DF0 A;  4XYN A;  2KGB C;  1UUR A;  3O4Y A;  1EJ3 A;  1MXE A;  2O5G A;  1QAT A;  3KF9 A;  5F6T A;  1DJH A;  3NSO A;  2LMU A;  1OMR A;  1K9P A;  1ZMZ A;  4OVN F;  1Y1X A;  1DJZ A;  4R1E A;  1CMF A;  3I5H B;  1QLK A;  3AAK A;  1YVH A;  2MRD A;  1NX0 A;  3ZWH A;  2PSR A;  1QIV A;  4OR9 B;  1SR6 B;  1OQP A;  1BF5 A;  1FI5 A;  1JC2 A;  5AEQ A;  1JF2 A;  1S6I A;  2K7O A;  1WDC C;  2KGR A;  3TDZ A;  3ICB A;  2EC6 C;  1NCX A;  1CDP A;  2JRF A;  5GQQ C;  3RM1 A;  3LCP C;  2GGZ A;  3C1V A;  2KAY A;  2I2R E;  1W7J B;  3LL8 B;  4PHK A;  1YRT B;  1YUT A;  2NLN A;  1IQ3 A;  4TNC A;  2BCX A;  1IQ5 A;  2CTN A;  3OB2 B;  4L9M A;  1V1F A;  3DVK A;  1K8U A;  1SYM A;  1U5I B;  1M31 A;  1CKK A;  4ORC B;  2V53 A;  3CWG A;  1ALV A;  2ZND A;  1OE9 B;  1CM4 A;  1K94 A;  3OX5 A;  4BY4 A;  5HKY A;  3F45 A;  3JVT C;  2MAZ A;  1C07 A;  1FI6 A;  5KSZ A;  1F8H A;  3SG3 A;  2JXL A;  4PHN A;  2ZN9 A;  2WC8 A;  1J7O A;  2FOT A;  3BYA A;  4USL A;  5G08 A;  2LNK A;  3QRX A;  1IJ5 A;  1PVB A;  3D0Y A;  1LA3 A;  4YGE B;  1Q80 A;  3D10 A;  1IWQ A;  1KFX L;  3EKH A;  1EG4 A;  1UHH A;  2QAC A;  4I5J A;  2LVJ A;  1PSR A;  4F0Z B;  1OMD A;  3D0Y B;  1QLS A;  1ZFS A;  4NDB A;  1F54 A;  1RRO A;  4MLW A;  5CSI A;  1LXF C;  4PE7 A;  1DT7 B;  1IRJ A;  4QJ5 B;  3NSK A;  1AHR A;  2LP3 A;  3BUW B;  4YGC B;  4QJ3 B;  5AER A;  1OZO A;  2JNX A;  3BUN B;  1TIZ A;  1NWD A;  1DMO A;  2WOR A;  1SMG A;  2KBI A;  1K9K A;  2JT0 A;  3BOW A;  1XFY O;  4PE0 A;  2LCP A;  2JXC A;  2ISD A;  2FCE A;  1QXP A;  1SL7 A;  1UP5 A;  3VGO A;  3SG2 A;  4DUQ A;  1NX1 A;  5I2O A;  4GNK B;  3PFV A;  1K90 D;  4ICB A;  1YVL A;  3I5H C;  1BR1 B;  2FJU B;  3GK2 A;  3M0W A;  1CDN A;  3KEV A;  3BOW B;  1YUR A;  1XA5 A;  2PAL A;  5DKR A;  1S3P A;  2HET A;  2K8M B;  1SR6 C;  2I7A A;  1SPY A;  3O2P A;  4YGD B;  2SAS A;  3WNX B;  4ZCU A;  1RK9 A;  4MZK A;  1RFJ A;  1S1E A;  2EHB A;  2LMT A;  2LM5 A;  3TS5 B;  1CFF A;  4AOM A;  4DCK A;  1A75 B;  1REC A;  3DD4 A;  2RGI A;  1K9U A;  4ORA B;  1JFJ A;  1Y0V H;  1QVI Z;  3H4S E;  1QJT A;  1SKT A;  3RLZ A;  4QJ4 B;  1QX5 B;  2Q4U A;  1TNP A;  2HQ8 A;  1XFX O;  2LE9 B;  4PCW A;  1D1O A;  1CLB A;  3FWB A;  1S6J A;  2MHH A;  3EKJ A;  2CXJ A;  1CM1 A;  3HX4 A;  1CDM A;  5D69 A;  2LMV A;  3WHU B;  1YUS A;  2B1U A;  2QPT A;  1TNW A;  1MUX A;  3VRP A;  2DOQ A;  1JUO A;  1W7I B;  2K0J A;  1K2H A;  1SCM B;  3PAL A;  1TOP A;  1GGW A;  4YRU A;  1KWO B;  1NSH A;  4C0J A;  3NSI A;  1IG5 A;  1YUU A;  2K7B A;  2L50 A;  2WCB A;  3OHM B;  1DGV A;  1F4O A;  3SG4 A;  1OZS A;  1DF0 B;  3SIA A;  1XO5 A;  1OSA A;  3DVE A;  1HQV A;  1PK0 D;  1CFD A;  5J3X A;  1CNP A;  1RJV A;  3KHE A;  2OPO A;  2JUL A;  4GPL B;  2KNE A;  2ZN8 A;  4UPG A;  1HT9 A;  2L4H A;  2KFF A;  1BR4 B;  2BE6 A;  3CR4 X;  2H61 A;  3CR2 A;  1QX7 A;  4FTG A;  4GGF C;  2L0P A;  2NZ0 A;  2M8U A;  3CLN A;  4JPZ B;  5HLV A;  1NCZ A;  2MLF C;  2KI6 C;  2GGM A;  2F2P A;  4CID A;  1NX2 A;  2VRG A;  1NX3 A;  2A4J A;  1JF0 A;  2KAV A;  1Y1U A;  4MVF A;  4PDZ A;  4I5L B;  2PMY A;  1K93 D;  4YBH B;  5DKQ A;  1KFU S;  3IQQ A;  4I5K A;  3FIA A;  2F8P A;  3PM8 A;  1YX8 A;  2LLT A;  1R2U A;  2KAX A;  4GAO A;  3TZ1 A;  2K61 A;  4AQJ A;  1MXL C;  4GUK A;  1G8I A;  1MHO A;  1TRF A;  3PAT A;  1S6C A;  1K96 A;  3TS5 C;  1WLM A;  3VRR A;  1WLZ A;  1IGV A;  3JTD B;  3E3R A;  2CT9 A;  4CFR A;  3CZT X; 
#chains in the Genus database with same CATH topology
 1UUS A;  2E30 A;  2PRU A;  5FI6 A;  1DVI A;  4PE1 A;  1QVI Y;  4U8D A;  1S26 D;  1X02 A;  1KQM B;  3R1V A;  1EXR A;  1IKU A;  1J7P A;  1Y6W A;  1XK4 A;  1K95 A;  5FI7 A;  1IJ6 A;  2Q91 A;  3CS1 A;  3V2L A;  2M7N A;  2F3Z A;  1DGU A;  1XFZ O;  5ER4 X;  1BOD A;  1B8C A;  1XVJ A;  2BCA A;  5AXI A;  1KSM A;  1DJG A;  1SCM C;  2WCK A;  3BUM B;  2F2O A;  1F55 A;  1S5G Y;  1UHJ A;  1KWO C;  2L51 A;  3DVM A;  3CZ2 A;  2F3Y A;  2K7C A;  4OV2 A;  4NQG A;  4IL1 A;  1PSB A;  1SL8 A;  1UHI A;  3VRO A;  1MF8 B;  3CDN A;  3I5G B;  3FS7 A;  1OOI X;  1JBA A;  1N2D A;  2JT3 A;  3R72 A;  4MZL A;  2M29 A;  2D8N A;  1LKJ A;  1QAS A;  2EGD A;  4M2P A;  5I2L A;  3BJH A;  1BT6 A;  5D3O A;  1ZOT B;  2HQW A;  4HSZ A;  1E8A A;  3DF0 A;  1OOH A;  2LHL A;  2LAN A;  2LLS A;  3EG5 B;  1MQ1 A;  3PJI A;  2BCB A;  4NDC A;  3K21 A;  1GGZ A;  2WC5 A;  1AP4 A;  3D77 A;  4NDD A;  2NCO A;  1Y1A A;  2MLE C;  4N5X A;  2BL0 B;  4M2Q A;  4D1E A;  1QTX A;  2KYC A;  2M3W A;  2KFG A;  4ORB B;  1LIN A;  4XJK A;  1GQM A;  4MZJ A;  3S0E A;  1DJI A;  1DEL A;  1OMV A;  2WND A;  5IBW A;  5KTY A;  1AJ5 A;  4YGB B;  1BOC A;  2LVI A;  2H61 C;  1QX2 A;  2LVV A;  2L4I A;  1KK7 Z;  1NCY A;  1BJF A;  2WOS A;  5HKW A;  1CFP A;  1A4P A;  1TNX A;  3A4U B;  1SY9 A;  3JVT B;  1AVS A;  4PHM A;  4N1F A;  1SRA A;  2JWW A;  1J7R A;  4A4B A;  3WXA A;  1B7T Z;  3B86 A;  1CDL A;  3CGA A;  4GFT A;  3SG5 A;  1H8B A;  2AUC A;  1R6P A;  3N7H A;  1SK6 D;  3R1P A;  1NPQ A;  1KK8 B;  2KI4 B;  3BUO B;  4I5N B;  2KSP A;  4CPV A;  1J7Q A;  2G2B A;  3IQO A;  1M39 A;  1SW8 A;  3LK0 A;  2BAP A;  2FCD A;  4PAL A;  2KOT A;  1CFC A;  1SCV A;  3A8R A;  1TCF A;  1XFR A;  1S5G Z;  1G33 A;  3BXK A;  3SG7 A;  1XFW O;  1A29 A;  1B9A A;  3FE6 A;  3JTD C;  1TCO B;  2JTT A;  1DTL A;  2L98 A;  2M97 A;  2E6W A;  3KO0 A;  3S0G A;  3SS5 A;  1JSA A;  4YGA A;  3S0A A;  3S0F A;  1DJY A;  3IF7 A;  3NXA A;  2GTE A;  3RZS A;  1KSO A;  1MR8 A;  2JQ6 A;  2K2A A;  3PSR A;  1FPW A;  2ZRT A;  2M9G A;  1ODB A;  1GJY A;  1ZUZ A;  2PAS A;  3BQ3 A;  1ALW A;  3I5F B;  3OP0 A;  2QEB A;  4MRY A;  2Y5I A;  1KQM C;  3OB1 B;  1FW4 A;  2FJY A;  2KDH A;  2OS8 B;  3EVU A;  3DXL A;  2AMI A;  2K7D A;  2KQY A;  2ZKM X;  3ZNI A;  2BKI B;  1JFK A;  4MRX A;  3NSL A;  3D75 A;  2I18 A;  2KLD A;  1KFU L;  3EVV A;  3CAB A;  3OX6 A;  2GV5 A;  2QEH A;  3K1E A;  3L47 A;  1OOF A;  1F70 A;  3WHT B;  1DJW A;  2I94 A;  1DJX A;  1XK4 C;  3BUX B;  3LK1 A;  2WCJ A;  2JU0 A;  5TNC A;  1B1G A;  2COL B;  2JPT A;  3EK7 A;  1YR5 A;  2BBN A;  1WRK A;  3I5G C;  1A03 A;  2Y4Q A;  2MA2 A;  3GK4 X;  1SSE B;  2BBM A;  3TUY B;  3VRQ A;  1IH0 A;  3B87 A;  3L4L A;  5PAL A;  4JQ0 D;  3UO9 A;  1V1G A;  2Y1M A;  1CMG A;  1QV1 A;  1H4B A;  3O78 A;  1UHK A;  1WY9 A;  4PHJ A;  1U5I A;  2KI6 D;  3MSE B;  2M1U A;  1NUB A;  1QV0 A;  1QWV A;  3I5I B;  1AJ4 A;  1T14 A;  2MJW B;  2OTG B;  3EK8 A;  4GGN A;  3L4A A;  4MEW A;  1TN4 A;  2NCP A;  2BL0 C;  1MWN A;  4IJ7 A;  4HRH A;  1KCY A;  2QEO A;  2BEC A;  2JZI A;  2Y1N A;  3DYE A;  2F33 A;  2JT8 A;  2LHI A;  4WQ3 A;  1A2X A;  3AKB A;  1AK8 A;  1XFV O;  3EVR A;  1C7W A;  1J1E A;  1YRU B;  1XYD A;  1KK7 Y;  1L2O B;  5KU1 A;  2BKH B;  1TTX A;  4MSP A;  2M1K B;  3SS3 A;  5CPV A;  2CNP A;  3SJS A;  2KHN A;  2O60 A;  3PN7 B;  4OKH A;  1TUZ A;  1J1D A;  5D7F A;  1RTP 1;  4N1G A;  1B7T Y;  3CTN A;  2KBM A;  1C3Z A;  3FWC A;  3KPX A;  5I94 A;  1KK8 C;  2KI4 C;  2LP2 A;  1NIW A;  4DRW A;  2JOJ A;  3NHT A;  4CFQ A;  1EH2 A;  4BY5 A;  1RWY A;  5HYD A;  4YI8 A;  4PE4 A;  5B8I B;  1J55 A;  1F4Q A;  2M49 B;  2ZFD A;  2IS9 A;  4P5O E;  1CLM A;  1B4C A;  1B8R A;  1M63 B;  1EG3 A;  3GOF A;  5K89 A;  1CLL A;  1WRL A;  2G9B A;  1NYA A;  2M7L A;  2QDI A;  3AAJ A;  1QIW A;  4Q04 A;  5CSJ A;  4GGF A;  2CBL A;  2JTZ A;  3AKA A;  3GK1 A;  2H2K A;  2HF5 A;  2L2E A;  3I5F C;  2BE4 A;  5AAN A;  4C0K A;  4CLN A;  2L5X B;  2WCF A;  2OS8 C;  5CSF A;  5I8N A;  4MBE A;  1LVC D;  1SNL A;  1WDC B;  1UWO A;  2AAO A;  2NXQ A;  2MBX A;  1S36 A;  1KFX S;  1SBJ A;  2EC6 B;  1TNQ A;  1FF1 A;  1C7V A;  4GBA A;  3O6B A;  1FBV A;  1NP8 A;  1OOJ A;  1UHN A;  4FQO A;  4HRE E;  4M2O A;  2TN4 A;  5DKN A;  1CTR A;  3NHI A;  5I2Q A;  1SL9 A;  3SIB A;  3DF0 B;  2JPO A;  2P6B B;  3HCM A;  2HPS A;  3SG6 A;  3D78 A;  3CZ1 A;  4ETO A;  3EK4 A;  1BMO A;  1TWO A;  1N0Y A;  3OGN A;  4C0L A;  2JC2 A;  4E68 A;  2KQ6 A;  2LAP A;  5ER5 A;  4XJK B;  4DS7 A;  2LV7 A;  3TUY C;  1A75 A;  2LC5 A;  4WRI A;  2KYF A;  4OCI A;  3VRN A;  1EL4 A;  5JOL A;  2LLU A;  1L7Z A;  5JJG A;  1LA0 A;  2PVB A;  5FYX A;  1B8L A;  3CR5 X;  1M45 A;  4WQ2 A;  1GM0 A;  4ZCV A;  1YX7 A;  3I5I C;  1XFU O;  2OTG C;  1B47 A;  4DIR A;  2R2I A;  3PLF B;  5HKZ A;  2SCP A;  1N65 A;  2CCM A;  1PRW A;  2KFH A;  5AFP A;  2WCE A;  2M0R A;  5EL2 A;  2LUX A;  1OW4 A;  1BU3 A;  1VRK A;  3D76 A;  1QS7 A;  1PUL A;  2K2F A;  2LUC A;  1WRZ A;  1Z4H A;  3LLE A;  2ERB A;  2LVK A;  3BFA A;  2P71 A;  3FE8 A;  4JWQ A;  1L2O C;  1G4Y R;  2H8V A;  2JNF A;  4P2Y B;  5CSN A;  4A4C A;  1YTZ C;  4HRG A;  1Z2C B;  5BPJ A;  2ZNE A;  3TDU A;  1F71 A;  4YI9 A;  4AQI A;  1CB1 A;  1AUI B;  1KQV A;  1M46 A;  1JWD A;  5HLO A;  2ZRS A;  3PN7 C;  4MN0 A;  1BLQ A;  1PVA A;  1ZAC A;  3DVJ A;  1PAL A;  5FI2 A;  1BG1 A;  1DF0 A;  4XYN A;  2KGB C;  1UUR A;  3O4Y A;  1EJ3 A;  1MXE A;  2O5G A;  1QAT A;  3KF9 A;  5F6T A;  1DJH A;  3NSO A;  2LMU A;  1OMR A;  1K9P A;  1ZMZ A;  2PYQ A;  3B6X A;  4OVN F;  1Y1X A;  1DJZ A;  4R1E A;  1CMF A;  3I5H B;  1QLK A;  3AAK A;  1YVH A;  2K60 A;  2MRD A;  3D74 A;  1DQE A;  1IIO A;  1NX0 A;  3ZWH A;  2PSR A;  1QIV A;  3SS4 A;  4OR9 B;  1SR6 B;  1OQP A;  1BF5 A;  1FI5 A;  1JC2 A;  5AEQ A;  2WCM A;  1JF2 A;  1S6I A;  2K7O A;  1WDC C;  2KGR A;  3TDZ A;  3ICB A;  2EC6 C;  1NCX A;  1CDP A;  2JRF A;  5GQQ C;  3RM1 A;  3LCP C;  2GGZ A;  3C1V A;  2KAY A;  2I2R E;  1W7J B;  3LL8 B;  4PHK A;  1YRT B;  1YUT A;  2NLN A;  1IQ3 A;  4TNC A;  2BCX A;  1IQ5 A;  2CTN A;  3OB2 B;  2KLE A;  1V1F A;  3DVK A;  4L9M A;  1K8U A;  1SYM A;  1U5I B;  1M31 A;  1CKK A;  3B7A A;  4ORC B;  2V53 A;  3B88 A;  3CWG A;  1ALV A;  2PQL A;  1OE9 B;  1CM4 A;  1K94 A;  2ZND A;  3OX5 A;  4BY4 A;  5HKY A;  3F45 A;  3JVT C;  2MAZ A;  1C07 A;  1FI6 A;  5KSZ A;  1F8H A;  3SG3 A;  3Q8I A;  2JXL A;  4PHN A;  5DIC A;  2ZN9 A;  5HL1 A;  2WC8 A;  1J7O A;  2FOT A;  3BYA A;  4USL A;  5G08 A;  2LNK A;  3QRX A;  1IJ5 A;  1PVB A;  2WC6 A;  3D0Y A;  1LA3 A;  4YGE B;  1Q80 A;  3D10 A;  1IWQ A;  1KFX L;  3EKH A;  1EG4 A;  1UHH A;  2QAC A;  1C3Y A;  4I5J A;  1TUJ A;  2LVJ A;  1PSR A;  4F0Z B;  1OMD A;  3D0Y B;  1QLS A;  1ZFS A;  4NDB A;  3S0B A;  1F54 A;  1RRO A;  1W9Z A;  4MLW A;  3S0D A;  5CSI A;  1LXF C;  4PE7 A;  1DT7 B;  1IRJ A;  4QJ5 B;  3NSK A;  1AHR A;  2LP3 A;  3BUW B;  3NGV A;  4YGC B;  4INX A;  4QJ3 B;  5AER A;  1OZO A;  2JNX A;  3BUN B;  4PT1 A;  1TIZ A;  1NWD A;  1DMO A;  2WOR A;  3BFH A;  1SMG A;  2KBI A;  1K9K A;  2JT0 A;  2YGU A;  1XFY O;  3BOW A;  3IVT A;  4PE0 A;  2LCP A;  2JXC A;  2ISD A;  2FCE A;  1QXP A;  1SL7 A;  1UP5 A;  3VGO A;  3SG2 A;  4DUQ A;  1NX1 A;  5I2O A;  4GNK B;  3PFV A;  1K90 D;  4ICB A;  1YVL A;  3I5H C;  1BR1 B;  2FJU B;  3GK2 A;  3M0W A;  1CDN A;  3D73 A;  3KEV A;  3BOW B;  4INW A;  1YUR A;  1XA5 A;  3QME A;  1DEK A;  2PAL A;  5DKR A;  3R1O A;  1S3P A;  2HET A;  4F7F A;  2K8M B;  1SR6 C;  2I7A A;  1SPY A;  3O2P A;  4YGD B;  2QEV A;  2SAS A;  3WNX B;  4ZCU A;  1RK9 A;  3DY9 A;  4MZK A;  1RFJ A;  1S1E A;  2EHB A;  2LMT A;  2LM5 A;  4FQT A;  3TS5 B;  1CFF A;  4AOM A;  4DCK A;  1A75 B;  1REC A;  3DD4 A;  2RGI A;  1K9U A;  4ORA B;  3TDI A;  1JFJ A;  1Y0V H;  1QVI Z;  3H4S E;  1QJT A;  1SKT A;  2WCH A;  3RLZ A;  4QJ4 B;  1QX5 B;  1DC1 A;  2P70 A;  2Q4U A;  1TNP A;  2HQ8 A;  1XFX O;  2LE9 B;  4PCW A;  1D1O A;  1CLB A;  3FWB A;  1S6J A;  2MHH A;  3EKJ A;  2CXJ A;  1CM1 A;  3HX4 A;  3O4X A;  1CDM A;  5D69 A;  2LMV A;  3WHU B;  1YUS A;  4KYN A;  2WCL A;  2B1U A;  2QPT A;  1TNW A;  1MUX A;  3VRP A;  2DOQ A;  1JUO A;  1W7I B;  2K0J A;  1K2H A;  1SCM B;  3PAL A;  1TOP A;  1GGW A;  4YRU A;  1KWO B;  1NSH A;  4C0J A;  3NSI A;  1IG5 A;  1YUU A;  2K7B A;  2L50 A;  2WCB A;  3OHM B;  1DGV A;  1F4O A;  3SG4 A;  1OZS A;  1DF0 B;  3DZT A;  1XO5 A;  2BNX A;  3SIA A;  1OSA A;  3DVE A;  4JD9 A;  1HQV A;  1PK0 D;  1CFD A;  1LS8 A;  5J3X A;  1CNP A;  1RJV A;  3KHE A;  2KPH A;  2OPO A;  2JUL A;  4GPL B;  2KNE A;  2ZN8 A;  4UPG A;  1HT9 A;  1OOG A;  2L4H A;  2KFF A;  1BR4 B;  2BE6 A;  3CR4 X;  2H61 A;  3CR2 A;  1QX7 A;  4FTG A;  3BFB A;  4JKT A;  4GGF C;  2L0P A;  2NZ0 A;  2M8U A;  3CLN A;  2L2C A;  4JPZ B;  5HLV A;  1NCZ A;  2MLF C;  4OZD A;  2KI6 C;  2GGM A;  2F2P A;  3OBV A;  3PM2 A;  4CID A;  1NX2 A;  2VRG A;  1NX3 A;  2A4J A;  1JF0 A;  2KAV A;  1Y1U A;  4MVF A;  4PDZ A;  4I5L B;  3FE9 A;  3VB1 A;  2PMY A;  1K93 D;  4YBH B;  3CYZ A;  1KFU S;  3IQQ A;  4I5K A;  5DKQ A;  3FIA A;  2F8P A;  3PM8 A;  1YX8 A;  2LLT A;  1R2U A;  2KAX A;  4GAO A;  3TZ1 A;  2K61 A;  4AQJ A;  1MXL C;  1ORG A;  4GUK A;  1G8I A;  3CZ0 A;  1MHO A;  1TRF A;  3PAT A;  1S6C A;  1K96 A;  3TS5 C;  1WLM A;  3VRR A;  1WLZ A;  1IGV A;  3JTD B;  1P28 A;  3UNW A;  2L5Y A;  3E3R A;  2CT9 A;  4CFR A;  3CZT X; 
#chains in the Genus database with same CATH homology
 1UUS A;  2E30 A;  2PRU A;  1DVI A;  4PE1 A;  1QVI Y;  4U8D A;  1S26 D;  1X02 A;  1KQM B;  1EXR A;  1IKU A;  1J7P A;  1Y6W A;  1XK4 A;  1K95 A;  1IJ6 A;  2Q91 A;  3CS1 A;  2M7N A;  2F3Z A;  1DGU A;  1XFZ O;  5ER4 X;  1BOD A;  1B8C A;  1XVJ A;  2BCA A;  5AXI A;  1KSM A;  1DJG A;  1SCM C;  3BUM B;  2F2O A;  1F55 A;  1S5G Y;  1UHJ A;  1KWO C;  2L51 A;  3DVM A;  2F3Y A;  2K7C A;  4OV2 A;  4NQG A;  4IL1 A;  1PSB A;  1SL8 A;  1UHI A;  3VRO A;  1MF8 B;  3I5G B;  3FS7 A;  1JBA A;  1N2D A;  2JT3 A;  4MZL A;  2M29 A;  2D8N A;  1LKJ A;  1QAS A;  2EGD A;  4M2P A;  5I2L A;  1BT6 A;  1ZOT B;  2HQW A;  4HSZ A;  1E8A A;  3DF0 A;  2LHL A;  2LAN A;  2LLS A;  1MQ1 A;  2BCB A;  4NDC A;  3K21 A;  1GGZ A;  1AP4 A;  4NDD A;  2NCO A;  1Y1A A;  2MLE C;  4N5X A;  2BL0 B;  4M2Q A;  4D1E A;  1QTX A;  2KYC A;  2M3W A;  2KFG A;  4ORB B;  1LIN A;  4XJK A;  1GQM A;  4MZJ A;  5IBW A;  1DJI A;  1OMV A;  2WND A;  5KTY A;  1AJ5 A;  4YGB B;  1BOC A;  2LVI A;  2H61 C;  1QX2 A;  2LVV A;  2L4I A;  1KK7 Z;  1NCY A;  1BJF A;  2WOS A;  5HKW A;  1CFP A;  1A4P A;  1TNX A;  3A4U B;  1SY9 A;  3JVT B;  1AVS A;  4PHM A;  4N1F A;  1SRA A;  2JWW A;  1J7R A;  4A4B A;  3WXA A;  1B7T Z;  1CDL A;  3CGA A;  4GFT A;  3SG5 A;  1H8B A;  2AUC A;  1R6P A;  1SK6 D;  1NPQ A;  1KK8 B;  2KI4 B;  3BUO B;  4I5N B;  2KSP A;  4CPV A;  1J7Q A;  2G2B A;  3IQO A;  1M39 A;  1SW8 A;  3LK0 A;  4PAL A;  2FCD A;  2KOT A;  1CFC A;  1SCV A;  3A8R A;  1TCF A;  1S5G Z;  1G33 A;  3BXK A;  3SG7 A;  1XFW O;  1A29 A;  1B9A A;  3JTD C;  1TCO B;  2JTT A;  1DTL A;  2L98 A;  2M97 A;  2E6W A;  3KO0 A;  1JSA A;  4YGA A;  1DJY A;  3IF7 A;  3NXA A;  1KSO A;  1MR8 A;  2JQ6 A;  2K2A A;  3PSR A;  1FPW A;  2ZRT A;  2M9G A;  1ODB A;  1GJY A;  1ZUZ A;  2PAS A;  3BQ3 A;  1ALW A;  3I5F B;  3OP0 A;  4MRY A;  2Y5I A;  1KQM C;  3OB1 B;  1FW4 A;  2KDH A;  2OS8 B;  3EVU A;  2AMI A;  2K7D A;  2KQY A;  2ZKM X;  3ZNI A;  2BKI B;  1JFK A;  4MRX A;  3NSL A;  2I18 A;  1KFU L;  3EVV A;  3OX6 A;  2GV5 A;  1F70 A;  3WHT B;  1DJW A;  2I94 A;  1DJX A;  1XK4 C;  3BUX B;  3LK1 A;  2JU0 A;  5TNC A;  1B1G A;  2COL B;  2JPT A;  3EK7 A;  1YR5 A;  2BBN A;  1WRK A;  3I5G C;  1A03 A;  2Y4Q A;  2MA2 A;  3GK4 X;  2BBM A;  3TUY B;  3VRQ A;  1IH0 A;  1CMG A;  1H4B A;  5PAL A;  4JQ0 D;  1V1G A;  2Y1M A;  1QV1 A;  3O78 A;  1UHK A;  1WY9 A;  4PHJ A;  1U5I A;  2KI6 D;  3MSE B;  2M1U A;  1NUB A;  1QV0 A;  3I5I B;  1AJ4 A;  2OTG B;  2MJW B;  3EK8 A;  4GGN A;  4MEW A;  1TN4 A;  2NCP A;  2BL0 C;  1MWN A;  1KCY A;  4HRH A;  2BEC A;  2JZI A;  2Y1N A;  2F33 A;  2JT8 A;  2LHI A;  4WQ3 A;  1A2X A;  3AKB A;  1AK8 A;  1XFV O;  3EVR A;  1C7W A;  1J1E A;  1YRU B;  1XYD A;  1KK7 Y;  1L2O B;  5KU1 A;  2BKH B;  1TTX A;  4MSP A;  2M1K B;  5CPV A;  2CNP A;  3SJS A;  2KHN A;  2O60 A;  3PN7 B;  4OKH A;  3TDI A;  1J1D A;  5D7F A;  1RTP 1;  4N1G A;  1B7T Y;  3CTN A;  2KBM A;  3FWC A;  3KPX A;  1KK8 C;  2KI4 C;  2LP2 A;  1NIW A;  4DRW A;  2JOJ A;  4CFQ A;  1EH2 A;  4BY5 A;  1RWY A;  5HYD A;  4YI8 A;  4PE4 A;  5B8I B;  1J55 A;  1F4Q A;  2M49 B;  2ZFD A;  2IS9 A;  4P5O E;  1CLM A;  1B4C A;  1B8R A;  1M63 B;  1EG3 A;  3GOF A;  5K89 A;  1CLL A;  1WRL A;  2G9B A;  1NYA A;  2M7L A;  3AAJ A;  1QIW A;  4Q04 A;  5CSJ A;  4GGF A;  2CBL A;  2JTZ A;  3AKA A;  3GK1 A;  2H2K A;  2HF5 A;  2L2E A;  3I5F C;  2BE4 A;  5AAN A;  4C0K A;  4CLN A;  2L5X B;  2WCF A;  2OS8 C;  5CSF A;  5I8N A;  4MBE A;  1LVC D;  1SNL A;  1WDC B;  1UWO A;  2AAO A;  2NXQ A;  2MBX A;  1S36 A;  1KFX S;  1SBJ A;  2EC6 B;  1TNQ A;  1FF1 A;  1C7V A;  4GBA A;  3O6B A;  1FBV A;  1NP8 A;  1OOJ A;  1UHN A;  4FQO A;  4HRE E;  4M2O A;  2TN4 A;  5DKN A;  1CTR A;  5I2Q A;  1SL9 A;  3SIB A;  3DF0 B;  2P6B B;  3HCM A;  2HPS A;  3SG6 A;  4ETO A;  3EK4 A;  1BMO A;  1N0Y A;  4C0L A;  2JC2 A;  4E68 A;  2KQ6 A;  2LAP A;  5ER5 A;  4XJK B;  4DS7 A;  2LV7 A;  3TUY C;  1A75 A;  2LC5 A;  4WRI A;  2KYF A;  4OCI A;  3VRN A;  1EL4 A;  5JOL A;  2LLU A;  1L7Z A;  5JJG A;  1LA0 A;  2PVB A;  5FYX A;  1B8L A;  3CR5 X;  1M45 A;  4WQ2 A;  4ZCV A;  1YX7 A;  3I5I C;  1XFU O;  2OTG C;  1B47 A;  4DIR A;  2R2I A;  3PLF B;  5HKZ A;  2SCP A;  1N65 A;  2CCM A;  1PRW A;  2KFH A;  5AFP A;  2WCE A;  2M0R A;  2LUX A;  1BU3 A;  1VRK A;  1QS7 A;  1PUL A;  2K2F A;  2LUC A;  1WRZ A;  3LLE A;  2LVK A;  4JWQ A;  1L2O C;  1G4Y R;  2JNF A;  4P2Y B;  5CSN A;  4A4C A;  1YTZ C;  4HRG A;  5BPJ A;  2ZNE A;  3TDU A;  1F71 A;  4YI9 A;  4AQI A;  1CB1 A;  1AUI B;  1KQV A;  1M46 A;  1JWD A;  5HLO A;  2ZRS A;  3PN7 C;  4MN0 A;  1BLQ A;  1PVA A;  1ZAC A;  3DVJ A;  1PAL A;  1BG1 A;  1DF0 A;  4XYN A;  2KGB C;  1UUR A;  3O4Y A;  1EJ3 A;  1MXE A;  2O5G A;  1QAT A;  3KF9 A;  5F6T A;  1DJH A;  3NSO A;  2LMU A;  1OMR A;  1K9P A;  1ZMZ A;  4OVN F;  1Y1X A;  1DJZ A;  4R1E A;  1CMF A;  3I5H B;  1QLK A;  3AAK A;  1YVH A;  2MRD A;  1NX0 A;  3ZWH A;  2PSR A;  1QIV A;  4OR9 B;  1SR6 B;  1OQP A;  1BF5 A;  1FI5 A;  1JC2 A;  5AEQ A;  1JF2 A;  1S6I A;  2K7O A;  1WDC C;  2KGR A;  3TDZ A;  3ICB A;  2EC6 C;  1NCX A;  1CDP A;  2JRF A;  5GQQ C;  3RM1 A;  3LCP C;  2GGZ A;  3C1V A;  2KAY A;  2I2R E;  1W7J B;  3LL8 B;  4PHK A;  1YRT B;  1YUT A;  2NLN A;  1IQ3 A;  4TNC A;  2BCX A;  1IQ5 A;  2CTN A;  3OB2 B;  4L9M A;  1V1F A;  3DVK A;  1K8U A;  1SYM A;  1U5I B;  1M31 A;  1CKK A;  4ORC B;  2V53 A;  3CWG A;  1ALV A;  2ZND A;  1OE9 B;  1CM4 A;  1K94 A;  3OX5 A;  4BY4 A;  5HKY A;  3F45 A;  3JVT C;  2MAZ A;  1C07 A;  1FI6 A;  5KSZ A;  1F8H A;  3SG3 A;  2JXL A;  4PHN A;  2ZN9 A;  2WC8 A;  1J7O A;  2FOT A;  3BYA A;  4USL A;  5G08 A;  2LNK A;  3QRX A;  1IJ5 A;  1PVB A;  3D0Y A;  1LA3 A;  4YGE B;  1Q80 A;  3D10 A;  1IWQ A;  1KFX L;  3EKH A;  1EG4 A;  1UHH A;  2QAC A;  4I5J A;  2LVJ A;  1PSR A;  4F0Z B;  1OMD A;  3D0Y B;  1QLS A;  1ZFS A;  4NDB A;  1F54 A;  1RRO A;  4MLW A;  5CSI A;  1LXF C;  4PE7 A;  1DT7 B;  1IRJ A;  4QJ5 B;  3NSK A;  1AHR A;  2LP3 A;  3BUW B;  4YGC B;  4QJ3 B;  5AER A;  1OZO A;  2JNX A;  3BUN B;  1TIZ A;  1NWD A;  1DMO A;  2WOR A;  1SMG A;  2KBI A;  1K9K A;  2JT0 A;  3BOW A;  1XFY O;  4PE0 A;  2LCP A;  2JXC A;  2ISD A;  2FCE A;  1QXP A;  1SL7 A;  1UP5 A;  3VGO A;  3SG2 A;  4DUQ A;  1NX1 A;  5I2O A;  4GNK B;  3PFV A;  1K90 D;  4ICB A;  1YVL A;  3I5H C;  1BR1 B;  2FJU B;  3GK2 A;  3M0W A;  1CDN A;  3KEV A;  3BOW B;  1YUR A;  1XA5 A;  2PAL A;  5DKR A;  1S3P A;  2HET A;  2K8M B;  1SR6 C;  2I7A A;  1SPY A;  3O2P A;  4YGD B;  2SAS A;  3WNX B;  4ZCU A;  1RK9 A;  4MZK A;  1RFJ A;  1S1E A;  2EHB A;  2LMT A;  2LM5 A;  3TS5 B;  1CFF A;  4AOM A;  4DCK A;  1A75 B;  1REC A;  3DD4 A;  2RGI A;  1K9U A;  4ORA B;  1JFJ A;  1Y0V H;  1QVI Z;  3H4S E;  1QJT A;  1SKT A;  3RLZ A;  4QJ4 B;  1QX5 B;  2Q4U A;  1TNP A;  2HQ8 A;  1XFX O;  2LE9 B;  4PCW A;  1D1O A;  1CLB A;  3FWB A;  1S6J A;  2MHH A;  3EKJ A;  2CXJ A;  1CM1 A;  3HX4 A;  1CDM A;  5D69 A;  2LMV A;  3WHU B;  1YUS A;  2B1U A;  2QPT A;  1TNW A;  1MUX A;  3VRP A;  2DOQ A;  1JUO A;  1W7I B;  2K0J A;  1K2H A;  1SCM B;  3PAL A;  1TOP A;  1GGW A;  4YRU A;  1KWO B;  1NSH A;  4C0J A;  3NSI A;  1IG5 A;  1YUU A;  2K7B A;  2L50 A;  2WCB A;  3OHM B;  1DGV A;  1F4O A;  3SG4 A;  1OZS A;  1DF0 B;  3SIA A;  1XO5 A;  1OSA A;  3DVE A;  1HQV A;  1PK0 D;  1CFD A;  5J3X A;  1CNP A;  1RJV A;  3KHE A;  2OPO A;  2JUL A;  4GPL B;  2KNE A;  2ZN8 A;  4UPG A;  1HT9 A;  2L4H A;  2KFF A;  1BR4 B;  2BE6 A;  3CR4 X;  2H61 A;  3CR2 A;  1QX7 A;  4FTG A;  4GGF C;  2L0P A;  2NZ0 A;  2M8U A;  3CLN A;  4JPZ B;  5HLV A;  1NCZ A;  2MLF C;  2KI6 C;  2GGM A;  2F2P A;  4CID A;  1NX2 A;  2VRG A;  1NX3 A;  2A4J A;  1JF0 A;  2KAV A;  1Y1U A;  4MVF A;  4PDZ A;  4I5L B;  2PMY A;  1K93 D;  4YBH B;  5DKQ A;  1KFU S;  3IQQ A;  4I5K A;  3FIA A;  2F8P A;  3PM8 A;  1YX8 A;  2LLT A;  1R2U A;  2KAX A;  4GAO A;  3TZ1 A;  2K61 A;  4AQJ A;  1MXL C;  4GUK A;  1G8I A;  1MHO A;  1TRF A;  3PAT A;  1S6C A;  1K96 A;  3TS5 C;  1WLM A;  3VRR A;  1WLZ A;  1IGV A;  3JTD B;  3E3R A;  2CT9 A;  4CFR A;  3CZT X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...