4N1FA

Crystal structure of f88y obelin mutant from obelia longissima at 2.09 angstrom resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
186
Chain Sequence
AVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQYLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the F88Y obelin mutant before and after bioluminescence provide molecular insight into spectral tuning among hydromedusan photoproteins
pubmed doi rcsb
source organism Obelia longissima
molecule tags Luminescent protein
molecule keywords Obelin
total genus 72
structure length 186
sequence length 190
ec nomenclature
pdb deposition date 2013-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4n1fA00
1DJZA 1N0YA 1CB1A 5CSJA 3AAKA 1C7VA 3LK0A 3BUNB 2ZFDA 1J1EA 1A03A 1F8HA 2ZN9A 1DF0A 1KSOA 2L50A 2KOTA 1ZACA 3CR4X 1TNWA 4PE7A 1BU3A 3TZ1A 1QXPA 3CLNA 1XK4A 2L0PA 4YI8A 3TS5B 3NSKA 1KK7Z 2JQ6A 2K0JA 1F55A 3D0YA 5JJGA 3CZTX 2FCDA 2JTZA 4CPVA 2Q4UA 2M9GA 1WDCC 4XYNA 4YRUA 3WXAA 1W7IB 2ZRTA 1B8CA 2JULA 1FBVA 2K7DA 1OQPA 4AOMA 1FI6A 3DVJA 1MXEA 1QLSA 2BL0C 2L4HA 3CR5X 1F4QA 1EXRA 2LHLA 1OMVA 3VROA 4N1FA 1G8IA 2EGDA 3SIBA 1BJFA 1D1OA 1LA3A 1UHIA 3BUWB 3IF7A 1DJGA 2MBXA 1TTXA 5DKRA 3EKHA 3AKAA 2AMIA 4PHMA 3SG4A 3EK4A 1TCFA 1WDCB 2KBIA 3BOWB 2AUCA 1KFUL 1SYMA 2BCBA 1F71A 3CWGA 2ZKMX 1FF1A 4HRGA 3RLZA 2KYFA 1CDLA 1TOPA 2L5XB 3I5HC 5BPJA 4HRHA 3PFVA 2SASA 4ORAB 1X02A 2LMTA 1CM4A 2L4IA 1SY9A 3GK4X 4PE0A 1BODA 1KCYA 1IJ6A 1G33A 5HKWA 3I5FB 1J7OA 1OSAA 1H4BA 5CPVA 1KQMB 1FW4A 2BKHB 3PSRA 5G08A 5PALA 1KQMC 1KK8B 1B8RA 2I7AA 4PHJA 1CNPA 1NUBA 4GPLB 1CLLA 1SKTA 3HX4A 1KQVA 1EG4A 2PALA 2AAOA 3BUXB 4TNCA 2KSPA 3O2PA 2M1KB 4QJ4B 1U5IB 3FWCA 2JT8A 4MZJA 1S6CA 1B7TZ 1NX0A 2HF5A 3OX6A 2MJWB 1QIWA 1ALWA 1H8BA 5HLVA 2OPOA 3C1VA 4XJKA 2A4JA 2KAVA 1UWOA 1JFKA 1G4YR 2K7BA 4PDZA 2ISDA 2JT0A 4D1EA 3DD4A 1PK0D 2FOTA 3AAJA 4M2OA 1IJ5A 1QVIY 3LL8B 4R1EA 3WHUB 1JF0A 1XFVO 3BYAA 1AP4A 4GBAA 1B9AA 2HETA 2LVJA 4U8DA 3WHTB 1ALVA 3BXKA 3DF0B 3LCPC 4MSPA 1Y0VH 1LINA 2PRUA 3NSOA 4A4CA 4JWQA 1PSRA 1ZFSA 2KI6D 1BT6A 2LLUA 1RECA 1J1DA 1C07A 2EC6C 1M45A 4UPGA 4JPZB 1IQ5A 3IQQA 4MEWA 5K89A 2MA2A 1KK7Y 3TUYB 2BBNA 5J3XA 3DVEA 1NP8A 2CNPA 1OMRA 1TIZA 2LUXA 1QLKA 3I5FC 2NLNA 3OP0A 1ODBA 1ZUZA 2L2EA 1J7QA 3GK1A 1SNLA 1PSBA 4L9MA 3OB2B 3A8RA 1XO5A 3D0YB 3FWBA 1LA0A 1KK8C 1AK8A 2BKIB 4ORCB 3PALA 1OMDA 1QJTA 5TNCA 1TN4A 1C7WA 2LC5A 4QJ5B 1CLBA 2E6WA 2K2FA 4CFRA 2I2RE 2F3ZA 2IS9A 1PVAA 2LVKA 3M0WA 1QVIZ 4HREE 2M1UA 3ICBA 2Y1MA 1DVIA 3SG7A 2WCFA 1GGZA 1B7TY 1JBAA 4YI9A 1F54A 1V1FA 3I5GC 4PHKA 2M0RA 4NDCA 5I2OA 1MHOA 2BBMA 1NIWA 1CTRA 1RFJA 1XFYO 3A4UB 1DJHA 2GV5A 4PE4A 1DJYA 1WRZA 1AHRA 1TNXA 2QACA 5ER4X 1DJIA 1K93D 1Q80A 2HQ8A 2M49B 5AERA 2F2OA 5DKQA 1BMOA 1ZOTB 4ORBB 3TDZA 1HT9A 2K7CA 1XVJA 3QRXA 3I5GB 4DUQA 4OKHA 1TCOB 1MQ1A 1S3PA 4N5XA 5KU1A 2V53A 2M7NA 4C0LA 3SIAA 2KGRA 2WCBA 1CKKA 1LKJA 1CFPA 2G9BA 2OTGC 1RK9A 1WRLA 1JFJA 5HKYA 1YUSA 4YGBB 5ER5A 2JPTA 3DVKA 3TS5C 1IG5A 1CDNA 2G2BA 2FCEA 1XFWO 1YVHA 1SCMC 4M2PA 4F0ZB 4I5KA 1CLMA 2HPSA 5HLOA 2Y5IA 1QX2A 1YUTA 2JNXA 2LV7A 2WC8A 1J55A 1A75B 3DVMA 4JQ0D 3CR2A 3NXAA 2H61C 1LVCD 1WLZA 1CFDA 5KSZA 3SJSA 1CDMA 2NZ0A 4MRXA 3HCMA 5AFPA 1TNQA 5I2QA 1N2DA 1IRJA 1Y6WA 4I5NB 1NCYA 3KF9A 2BL0B 1OZSA 3WNXB 1CDPA 5DKNA 3I5HB 1S1EA 3VRNA 1MF8B 1MXLC 4BY4A 1SL9A 2PASA 1UHHA 2JU0A 3BUMB 3PLFB 1U5IA 1K8UA 1KFUS 3OHMB 4PCWA 4ETOA 1EH2A 3EKJA 1Y1UA 3D10A 4DS7A 1QATA 1SW8A 1K94A 1BOCA 4WQ3A 3JVTB 2OS8C 3SG5A 2RGIA 3JVTC 1DF0B 2LP2A 1SL8A 1NX2A 1MR8A 1XFZO 1OE9B 3H4SE 4CIDA 5IBWA 4MLWA 1F4OA 2F33A 3CTNA 4USLA 1K96A 1B8LA 1R6PA 1B4CA 2CXJA 5F6TA 2VRGA 4FTGA 2PVBA 2I18A 1RTP1 4A4BA 4MN0A 4YGAA 2MLFC 2JZIA 4OCIA 2D8NA 3O6BA 1F70A 1E8AA 1PRWA 2KAYA 1YUUA 2KI4B 4MVFA 3TDUA 2JXCA 1FI5A 1QX7A 5D69A 1NWDA 4ICBA 1SCMB 1K9UA 2KBMA 4YGDB 4DIRA 2JWWA 1VRKA 3EVUA 2ZNEA 4GFTA 1S6IA 1XFXO 1IKUA 4HSZA 3O78A 1SR6C 1WRKA 1IH0A 2CCMA 1YX8A 4GGFA 2JTTA 1DTLA 3JTDB 1WY9A 1IGVA 2JXLA 2M97A 2Q91A 3JTDC 1UUSA 1TNPA 1SK6D 4I5JA 1B1GA 2LMUA 2JNFA 1NCZA 2LHIA 1S26D 1BR1B 4WRIA 1SCVA 2P6BB 2ZN8A 5I2LA 1K95A 4CLNA 4ZCVA 2F8PA 1JF2A 2M7LA 3VGOA 1YTZC 1DJWA 2F3YA 3KEVA 4Q04A 3VRRA 1RROA 1CMFA 2WNDA 2I94A 4NQGA 4AQJA 3KPXA 2R2IA 5HKZA 1KFXS 1W7JB 3FS7A 1BLQA 1NYAA 4ZCUA 3SG3A 5GQQC 3O4YA 2LANA 1RJVA 2CT9A 2KYCA 2K61A 3AKBA 2KI4C 2BCAA 4MZKA 2QPTA 3OX5A 1BG1A 1K9PA 1A2XA 1AVSA 1N65A 1S36A 1V1GA 4OV2A 1S6JA 1DT7B 2KFHA 4C0KA 2K8MB 3BOWA 2O60A 1YVLA 1M46A 4IL1A 1A4PA 2BE4A 5AANA 1UP5A 2FJUB 1RWYA 2LMVA 5D7FA 1S5GY 1NPQA 4GGNA 4DRWA 1ZMZA 2SCPA 3GK2A 1EJ3A 1SRAA 2HQWA 1XK4C 3EVRA 3TDIA 3GOFA 4MRYA 1KSMA 5HYDA 2M29A 4AQIA 4NDDA 3PATA 2KQYA 2H61A 1Y1AA 5JOLA 1JC2A 1QV0A 1B47A 2M3WA 3BQ3A 4YGEB 2KQ6A 2KGBC 1UHNA 2JOJA 1L2OC 2LM5A 4FQOA 5AEQA 2JC2A 4PHNA 5FYXA 1DGVA 2KNEA 1KWOB 1UURA 2KFGA 2L98A 5CSNA 2OTGB 3NSLA 3ZWHA 3TUYC 4CFQA 4PALA 1TRFA 2NCOA 3BUOB 2LUCA 2PMYA 3KHEA 1OZOA 2LNKA 1IQ3A 4P5OE 1A29A 1XA5A 3I5IB 3OB1B 3SG6A 1J7RA 4GNKB 3DF0A 2EHBA 3ZNIA 2DOQA 4MZLA 3LK1A 4GAOA 2KHNA 3PM8A 1L2OB 4YGCB 1CFFA 2F2PA 2K7OA 1SBJA 1YR5A 1DJXA 1CFCA 1QS7A 2KFFA 1M39A 3SG2A 2E30A 2PSRA 1DGUA 1OOJA 4GGFC 5CSIA 3NSIA 1K2HA 1YX7A 2WOSA 4YBHB 2COLB 4BY5A 3F45A 2K2AA 1XYDA 1YURA 1QV1A 1R2UA 4XJKB 4OR9B 1PULA 1QX5B 2LE9B 1CMGA 1L7ZA 3VRPA 3IQOA 1QIVA 4QJ3B 5AXIA 2NCPA 1JWDA 1KWOC 1LXFC 4PE1A 2EC6B 2B1UA 2MLEC 3EK8A 3LLEA 3VRQA 4M2QA 3KO0A 2Y4QA 1SMGA 2MHHA 1PALA 1S5GZ 1MWNA 4C0JA 1KFXL 3I5IC 1CM1A 5I8NA 1XFUO 1WLMA 1QASA 1NCXA 4MBEA 1GQMA 4WQ2A 1MUXA 2LAPA 2NXQA 1FPWA 1J7PA 1AUIB 1NX1A 1NX3A 3CS1A 1AJ5A 5KTYA 4GUKA 1PVBA 2LCPA 2M8UA 2LVVA 2JT3A 2Y1NA 1YRUB 3MSEB 4I5LB 3EK7A 1IWQA 3E3RA 2CTNA 4P2YB 1EG3A 1SL7A 2LP3A 2WCEA 1EL4A 3FIAA 5CSFA 1BF5A 4NDBA 1GJYA 2KDHA 3K21A 2O5GA 1JUOA 2BE6A 2ZRSA 5B8IB 2TN4A 1DMOA 1UHKA 2WORA 1YRTB 1QTXA 2CBLA 3PN7C 2LLTA 1SPYA 2LVIA 1HQVA 2ZNDA 4DCKA 2KI6C 2LLSA 3PN7B 1Y1XA 1AJ4A 2H2KA 2MAZA 1A75A 4N1GA 4OVNF 2BCXA 2OS8B 2GGMA 1JSAA 1K9KA 3RM1A 2GGZA 2BECA 1M31A 1BR4B 2JRFA 1GGWA 2MRDA 3CGAA 1NSHA 2L51A 1K90D 1UHJA 4E68A 3EVVA 2KAXA 1M63B 1SR6B
chains in the Genus database with same CATH superfamily
1DJZA 1N0YA 3S0FA 1CB1A 5CSJA 3AAKA 1C7VA 3LK0A 3BUNB 2ZFDA 1J1EA 1A03A 1F8HA 2ZN9A 1DF0A 1KSOA 2L50A 1TUZA 1ZACA 2KOTA 3CR4X 3B6XA 1TNWA 4PE7A 1BU3A 3TZ1A 1QXPA 3CLNA 1XK4A 2L0PA 4YI8A 3L4LA 3TS5B 3NSKA 3D77A 1KK7Z 2JQ6A 2K0JA 1F55A 3D0YA 3BJHA 5JJGA 3CZTX 2FCDA 2JTZA 1LS8A 1Z2CB 4CPVA 2Q4UA 2M9GA 1WDCC 2FJYA 4XYNA 4YRUA 3WXAA 1W7IB 2ZRTA 1B8CA 2JULA 3S0GA 1FBVA 2K7DA 2WCHA 1TUJA 1OQPA 4FQTA 4AOMA 1CMFA 1FI6A 3DVJA 2PYQA 1MXEA 1QLSA 2BL0C 2L4HA 3CR5X 1F4QA 1EXRA 5FI6A 2LHLA 1OMVA 3VROA 4N1FA 1G8IA 2EGDA 3SIBA 1BJFA 1D1OA 1LA3A 1UHIA 3BUWB 2WCJA 1DJGA 3IF7A 2MBXA 1TTXA 5DKRA 3EKHA 3AKAA 2AMIA 3Q8IA 4PHMA 3EK4A 1TCFA 1WDCB 3SG4A 2KBIA 3BOWB 2AUCA 1KFUL 2QEVA 1SYMA 2BCBA 1F71A 3CWGA 2ZKMX 1FF1A 4HRGA 3RLZA 1OOIX 2WCLA 2KYFA 3UNWA 1CDLA 1TOPA 5DICA 2L5XB 3I5HC 5BPJA 4HRHA 3PFVA 2SASA 4ORAB 1X02A 2LMTA 1CM4A 2L4IA 1SY9A 3GK4X 4PE0A 4F7FA 1BODA 1KCYA 1IJ6A 1G33A 3EG5B 3I5FB 5HKWA 1OSAA 4PT1A 1J7OA 5CPVA 1H4BA 3S0EA 2L5YA 1KQMB 1FW4A 2BKHB 3UO9A 3PSRA 5G08A 5PALA 1KQMC 1KK8B 1B8RA 2I7AA 4PHJA 1CNPA 1NUBA 4GPLB 1CLLA 1SKTA 3HX4A 1KQVA 1EG4A 2PALA 2AAOA 3BUXB 4TNCA 2WC6A 2KSPA 3O2PA 3SS4A 2M1KB 4QJ4B 1U5IB 3FWCA 2QEOA 2JT8A 4MZJA 1S6CA 1B7TZ 1NX0A 2HF5A 3OX6A 2MJWB 1OOHA 1QIWA 1ALWA 1H8BA 5HLVA 2OPOA 3C1VA 4XJKA 2A4JA 2KAVA 3DYEA 1UWOA 1JFKA 1G4YR 2K7BA 4PDZA 2ISDA 2JT0A 4D1EA 3DD4A 4KYNA 1PK0D 2FOTA 3AAJA 4M2OA 1IJ5A 1QVIY 3LL8B 4R1EA 3WHUB 1JF0A 3FE6A 1XFVO 3BYAA 1AP4A 4GBAA 1B9AA 2HETA 2LVJA 4U8DA 3WHTB 1ALVA 3BXKA 1DEKA 3DF0B 3LCPC 4MSPA 1Y0VH 1LINA 1TWOA 2PRUA 3CDNA 3NSOA 4A4CA 1OOGA 4JWQA 1PSRA 1ZFSA 2KI6D 1BT6A 2LLUA 1RECA 1J1DA 1C07A 2EC6C 1M45A 4UPGA 5D3OA 4JPZB 3FE9A 1IQ5A 2QDIA 3BFHA 3IQQA 4MEWA 5K89A 2MA2A 1KK7Y 3TUYB 2QEHA 2BBNA 3SS5A 3R1VA 5J3XA 3DVEA 1NP8A 2CNPA 1OMRA 1TIZA 2LUXA 1QLKA 3I5FC 2NLNA 3OP0A 1ODBA 1ZUZA 2L2EA 1J7QA 3GK1A 1SNLA 1PSBA 4L9MA 3OB2B 3A8RA 1XO5A 3D0YB 3FWBA 1LA0A 1KK8C 1AK8A 2BKIB 4ORCB 2ERBA 3PALA 1OMDA 1QJTA 5TNCA 1TN4A 1C7WA 2LC5A 2KLDA 4QJ5B 1CLBA 2E6WA 2K2FA 4CFRA 2I2RE 2F3ZA 2IS9A 1PVAA 2LVKA 3B86A 4INWA 3SS3A 1OW4A 1QVIZ 3M0WA 2M1UA 4HREE 3ICBA 2Y1MA 1DELA 1DVIA 3N7HA 3SG7A 2WCFA 1GGZA 1B7TY 1JBAA 4YI9A 1F54A 1V1FA 3I5GC 3RZSA 3OGNA 4PHKA 2M0RA 4NDCA 5I2OA 1MHOA 2BBMA 4OZDA 1NIWA 1CTRA 1RFJA 1XFYO 3A4UB 1DJHA 2GV5A 4PE4A 1DJYA 1WRZA 1AHRA 1TNXA 2QACA 4JD9A 5ER4X 1DJIA 1K93D 1Q80A 2HQ8A 5KSZA 2M49B 5AERA 2F2OA 5DKQA 4INXA 1BMOA 1ZOTB 4ORBB 3TDZA 1HT9A 2K7CA 1XVJA 3QRXA 3I5GB 4DUQA 4OKHA 1TCOB 2YGUA 3PJIA 1MQ1A 1S3PA 4N5XA 5KU1A 2V53A 2M7NA 4C0LA 3SIAA 2KGRA 2WCBA 1CKKA 1LKJA 1CFPA 1SSEB 2G9BA 2OTGC 1RK9A 1WRLA 1JFJA 5HKYA 1YUSA 4YGBB 5ER5A 2JPTA 3DVKA 1GM0A 3TS5C 1IG5A 1CDNA 2G2BA 2K60A 2FCEA 1XFWO 1YVHA 1SCMC 1DC1A 4M2PA 4F0ZB 4I5KA 1IIOA 1CLMA 2HPSA 5HLOA 2Y5IA 1QX2A 1YUTA 2JNXA 2LV7A 2WC8A 1J55A 1A75B 3DVMA 4JQ0D 3CR2A 3NXAA 3R1OA 3QMEA 1LVCD 1WLZA 2H61C 1CFDA 2WCMA 3NHTA 3SJSA 1CDMA 2NZ0A 4MRXA 3HCMA 5AFPA 1TNQA 3PM2A 1N2DA 4IJ7A 1IRJA 1Y6WA 4I5NB 1NCYA 3KF9A 2BL0B 1OZSA 3WNXB 1CDPA 5DKNA 3BFAA 3I5HB 1S1EA 3VRNA 1MF8B 1MXLC 3NGVA 1SL9A 2PASA 4BY4A 1QWVA 1UHHA 2JU0A 3BUMB 3PLFB 1U5IA 1K8UA 1KFUS 3OHMB 2KPHA 4PCWA 4ETOA 1C3YA 1EH2A 3EKJA 1Y1UA 3D10A 3D75A 4DS7A 1QATA 1SW8A 1K94A 1BOCA 4WQ3A 3JVTB 2OS8C 3SG5A 2RGIA 3JVTC 1DF0B 3K1EA 2LP2A 1SL8A 1NX2A 1MR8A 1XFZO 1OE9B 3H4SE 4CIDA 5IBWA 4MLWA 1F4OA 2F33A 3CTNA 4USLA 1K96A 1B8LA 1R6PA 3V2LA 2CXJA 5F6TA 2VRGA 1B4CA 4FTGA 2PVBA 2I18A 1RTP1 4A4BA 4MN0A 2BNXA 4YGAA 2MLFC 2JZIA 3B88A 4OCIA 2D8NA 3O6BA 1F70A 1E8AA 1PRWA 1T14A 1YUUA 2KAYA 2KI4B 4MVFA 3TDUA 2JXCA 1FI5A 1QX7A 5D69A 1NWDA 4ICBA 1SCMB 1K9UA 2KBMA 4YGDB 4DIRA 2JWWA 2P71A 1VRKA 3EVUA 2ZNEA 4GFTA 1S6IA 1XFXO 3CZ1A 1IKUA 4HSZA 3O78A 1SR6C 1WRKA 1IH0A 2CCMA 3CYZA 1YX8A 3CZ2A 4GGFA 2JTTA 1DTLA 3JTDB 1WY9A 1IGVA 2JXLA 2M97A 2Q91A 3JTDC 3VB1A 1UUSA 1TNPA 5HL1A 1SK6D 4I5JA 1B1GA 2LMUA 2JNFA 3D78A 1NCZA 2LHIA 1S26D 1BR1B 4WRIA 1SCVA 2P6BB 2ZN8A 5I2LA 1K95A 4CLNA 4ZCVA 2F8PA 1JF2A 2M7LA 3VGOA 1YTZC 1DJWA 2F3YA 3B7AA 3KEVA 4Q04A 1RROA 3VRRA 2WNDA 2I94A 3CABA 4NQGA 4AQJA 3KPXA 2R2IA 5I2QA 1W9ZA 5HKZA 1KFXS 1W7JB 3FS7A 1BLQA 1NYAA 4ZCUA 3SG3A 5GQQC 3L4AA 3O4YA 1P28A 2LANA 2WCKA 1RJVA 2CT9A 2KYCA 2P70A 2K61A 3AKBA 3L47A 2KI4C 2BCAA 4MZKA 2QPTA 3OX5A 1BG1A 1K9PA 1A2XA 1AVSA 1N65A 1S36A 1V1GA 2PQLA 4OV2A 1S6JA 1DT7B 2KFHA 4C0KA 2K8MB 3BOWA 2O60A 1YVLA 1M46A 4IL1A 1A4PA 2BE4A 5AANA 1UP5A 2FJUB 1RWYA 2LMVA 5D7FA 1S5GY 1NPQA 4GGNA 2JPOA 4DRWA 1ZMZA 2BAPA 2SCPA 3O4XA 3GK2A 1EJ3A 1SRAA 2HQWA 4JKTA 1XK4C 3S0DA 3EVRA 3TDIA 3GOFA 4MRYA 1KSMA 5HYDA 1Z4HA 2M29A 4AQIA 3S0AA 4NDDA 3PATA 2KQYA 2H61A 1Y1AA 5JOLA 1JC2A 1QV0A 1DQEA 1B47A 2M3WA 3BQ3A 4YGEB 2KQ6A 2KGBC 1UHNA 1C3ZA 2JOJA 1L2OC 2LM5A 4FQOA 5AEQA 2JC2A 4PHNA 5FYXA 1DGVA 2KNEA 1KWOB 1UURA 2KFGA 5I94A 2L98A 5CSNA 2OTGB 2GTEA 3NSLA 3ZWHA 3TUYC 4CFQA 4PALA 1TRFA 2NCOA 3BFBA 3BUOB 2LUCA 2PMYA 3KHEA 1OZOA 2LNKA 1IQ3A 4P5OE 1A29A 1XA5A 3I5IB 3OB1B 3SG6A 1J7RA 4GNKB 3DF0A 2EHBA 3ZNIA 2DOQA 4MZLA 3LK1A 4GAOA 2KHNA 3DXLA 1L2OB 3PM8A 4YGCB 1CFFA 3FE8A 2F2PA 3IVTA 2K7OA 1SBJA 1YR5A 1DJXA 1CFCA 1QS7A 2KFFA 1M39A 3SG2A 3S0BA 2E30A 2PSRA 1DGUA 3R1PA 3CZ0A 1OOJA 4GGFC 5CSIA 3NSIA 1K2HA 1YX7A 2WOSA 4YBHB 2COLB 4BY5A 3F45A 2K2AA 1XYDA 1YURA 1QV1A 1R2UA 2H8VA 4XJKB 4OR9B 1PULA 1QX5B 2LE9B 1CMGA 1L7ZA 3VRPA 3IQOA 1QIVA 4QJ3B 5AXIA 2NCPA 1JWDA 1KWOC 1LXFC 4PE1A 2EC6B 2B1UA 3NHIA 2MLEC 3EK8A 3LLEA 3D73A 3VRQA 4M2QA 3KO0A 2Y4QA 3DY9A 1SMGA 2MHHA 1PALA 1S5GZ 3OBVA 1MWNA 4C0JA 1KFXL 3I5IC 1CM1A 5I8NA 1XFUO 5FI7A 1WLMA 1QASA 1NCXA 4MBEA 1GQMA 4WQ2A 1MUXA 2LAPA 2NXQA 5EL2A 1J7PA 1FPWA 1AUIB 1NX1A 1NX3A 3CS1A 1AJ5A 5KTYA 4GUKA 1PVBA 2LCPA 2M8UA 2LVVA 2JT3A 2Y1NA 1YRUB 3DZTA 3MSEB 4I5LB 3EK7A 1IWQA 3D76A 3E3RA 2CTNA 4P2YB 1EG3A 1SL7A 3B87A 2LP3A 5FI2A 2WCEA 1EL4A 3FIAA 3R72A 5CSFA 1BF5A 4NDBA 1OOFA 1GJYA 2KDHA 3K21A 2L2CA 2O5GA 1JUOA 2BE6A 2ZRSA 5B8IB 2TN4A 1DMOA 1UHKA 2WORA 2QEBA 1YRTB 1QTXA 2CBLA 3PN7C 2LLTA 1SPYA 2LVIA 1HQVA 2ZNDA 4DCKA 2KI6C 2LLSA 3PN7B 1Y1XA 1AJ4A 2H2KA 2KLEA 1A75A 2MAZA 4N1GA 2BCXA 2WC5A 3D74A 4OVNF 2OS8B 2GGMA 1JSAA 1ORGA 1K9KA 3RM1A 2GGZA 2BECA 1XFRA 1M31A 1BR4B 2JRFA 1GGWA 2MRDA 3CGAA 1NSHA 2L51A 1K90D 1UHJA 4E68A 3EVVA 2KAXA 1M63B 1SR6B
chains in the Genus database with same CATH topology
1DJZA 1N0YA 1CB1A 5CSJA 3AAKA 1C7VA 3LK0A 3BUNB 2ZFDA 1J1EA 1A03A 1F8HA 2ZN9A 1DF0A 1KSOA 2L50A 2KOTA 1ZACA 3CR4X 1TNWA 4PE7A 1BU3A 3TZ1A 1QXPA 3CLNA 1XK4A 2L0PA 4YI8A 3TS5B 3NSKA 1KK7Z 2JQ6A 2K0JA 1F55A 3D0YA 5JJGA 3CZTX 2FCDA 2JTZA 4CPVA 2Q4UA 2M9GA 1WDCC 4XYNA 4YRUA 3WXAA 1W7IB 2ZRTA 1B8CA 2JULA 1FBVA 2K7DA 1OQPA 4AOMA 1FI6A 3DVJA 1MXEA 1QLSA 2BL0C 2L4HA 3CR5X 1F4QA 1EXRA 2LHLA 1OMVA 3VROA 4N1FA 1G8IA 2EGDA 3SIBA 1BJFA 1D1OA 1LA3A 1UHIA 3BUWB 3IF7A 1DJGA 2MBXA 1TTXA 5DKRA 3EKHA 3AKAA 2AMIA 4PHMA 3SG4A 3EK4A 1TCFA 1WDCB 2KBIA 3BOWB 2AUCA 1KFUL 1SYMA 2BCBA 1F71A 3CWGA 2ZKMX 1FF1A 4HRGA 3RLZA 2KYFA 1CDLA 1TOPA 2L5XB 3I5HC 5BPJA 4HRHA 3PFVA 2SASA 4ORAB 1X02A 2LMTA 1CM4A 2L4IA 1SY9A 3GK4X 4PE0A 1BODA 1KCYA 1IJ6A 1G33A 5HKWA 3I5FB 1J7OA 1OSAA 1H4BA 5CPVA 1KQMB 1FW4A 2BKHB 3PSRA 5G08A 5PALA 1KQMC 1KK8B 1B8RA 2I7AA 4PHJA 1CNPA 1NUBA 4GPLB 1CLLA 1SKTA 3HX4A 1KQVA 1EG4A 2PALA 2AAOA 3BUXB 4TNCA 2KSPA 3O2PA 2M1KB 4QJ4B 1U5IB 3FWCA 2JT8A 4MZJA 1S6CA 1B7TZ 1NX0A 2HF5A 3OX6A 2MJWB 1QIWA 1ALWA 1H8BA 5HLVA 2OPOA 3C1VA 4XJKA 2A4JA 2KAVA 1UWOA 1JFKA 1G4YR 2K7BA 4PDZA 2ISDA 2JT0A 4D1EA 3DD4A 1PK0D 2FOTA 3AAJA 4M2OA 1IJ5A 1QVIY 3LL8B 4R1EA 3WHUB 1JF0A 1XFVO 3BYAA 1AP4A 4GBAA 1B9AA 2HETA 2LVJA 4U8DA 3WHTB 1ALVA 3BXKA 3DF0B 3LCPC 4MSPA 1Y0VH 1LINA 2PRUA 3NSOA 4A4CA 4JWQA 1PSRA 1ZFSA 2KI6D 1BT6A 2LLUA 1RECA 1J1DA 1C07A 2EC6C 1M45A 4UPGA 4JPZB 1IQ5A 3IQQA 4MEWA 5K89A 2MA2A 1KK7Y 3TUYB 2BBNA 5J3XA 3DVEA 1NP8A 2CNPA 1OMRA 1TIZA 2LUXA 1QLKA 3I5FC 2NLNA 3OP0A 1ODBA 1ZUZA 2L2EA 1J7QA 3GK1A 1SNLA 1PSBA 4L9MA 3OB2B 3A8RA 1XO5A 3D0YB 3FWBA 1LA0A 1KK8C 1AK8A 2BKIB 4ORCB 3PALA 1OMDA 1QJTA 5TNCA 1TN4A 1C7WA 2LC5A 4QJ5B 1CLBA 2E6WA 2K2FA 4CFRA 2I2RE 2F3ZA 2IS9A 1PVAA 2LVKA 3M0WA 1QVIZ 4HREE 2M1UA 3ICBA 2Y1MA 1DVIA 3SG7A 2WCFA 1GGZA 1B7TY 1JBAA 4YI9A 1F54A 1V1FA 3I5GC 4PHKA 2M0RA 4NDCA 5I2OA 1MHOA 2BBMA 1NIWA 1CTRA 1RFJA 1XFYO 3A4UB 1DJHA 2GV5A 4PE4A 1DJYA 1WRZA 1AHRA 1TNXA 2QACA 5ER4X 1DJIA 1K93D 1Q80A 2HQ8A 2M49B 5AERA 2F2OA 5DKQA 1BMOA 1ZOTB 4ORBB 3TDZA 1HT9A 2K7CA 1XVJA 3QRXA 3I5GB 4DUQA 4OKHA 1TCOB 1MQ1A 1S3PA 4N5XA 5KU1A 2V53A 2M7NA 4C0LA 3SIAA 2KGRA 2WCBA 1CKKA 1LKJA 1CFPA 2G9BA 2OTGC 1RK9A 1WRLA 1JFJA 5HKYA 1YUSA 4YGBB 5ER5A 2JPTA 3DVKA 3TS5C 1IG5A 1CDNA 2G2BA 2FCEA 1XFWO 1YVHA 1SCMC 4M2PA 4F0ZB 4I5KA 1CLMA 2HPSA 5HLOA 2Y5IA 1QX2A 1YUTA 2JNXA 2LV7A 2WC8A 1J55A 1A75B 3DVMA 4JQ0D 3CR2A 3NXAA 2H61C 1LVCD 1WLZA 1CFDA 5KSZA 3SJSA 1CDMA 2NZ0A 4MRXA 3HCMA 5AFPA 1TNQA 5I2QA 1N2DA 1IRJA 1Y6WA 4I5NB 1NCYA 3KF9A 2BL0B 1OZSA 3WNXB 1CDPA 5DKNA 3I5HB 1S1EA 3VRNA 1MF8B 1MXLC 4BY4A 1SL9A 2PASA 1UHHA 2JU0A 3BUMB 3PLFB 1U5IA 1K8UA 1KFUS 3OHMB 4PCWA 4ETOA 1EH2A 3EKJA 1Y1UA 3D10A 4DS7A 1QATA 1SW8A 1K94A 1BOCA 4WQ3A 3JVTB 2OS8C 3SG5A 2RGIA 3JVTC 1DF0B 2LP2A 1SL8A 1NX2A 1MR8A 1XFZO 1OE9B 3H4SE 4CIDA 5IBWA 4MLWA 1F4OA 2F33A 3CTNA 4USLA 1K96A 1B8LA 1R6PA 1B4CA 2CXJA 5F6TA 2VRGA 4FTGA 2PVBA 2I18A 1RTP1 4A4BA 4MN0A 4YGAA 2MLFC 2JZIA 4OCIA 2D8NA 3O6BA 1F70A 1E8AA 1PRWA 2KAYA 1YUUA 2KI4B 4MVFA 3TDUA 2JXCA 1FI5A 1QX7A 5D69A 1NWDA 4ICBA 1SCMB 1K9UA 2KBMA 4YGDB 4DIRA 2JWWA 1VRKA 3EVUA 2ZNEA 4GFTA 1S6IA 1XFXO 1IKUA 4HSZA 3O78A 1SR6C 1WRKA 1IH0A 2CCMA 1YX8A 4GGFA 2JTTA 1DTLA 3JTDB 1WY9A 1IGVA 2JXLA 2M97A 2Q91A 3JTDC 1UUSA 1TNPA 1SK6D 4I5JA 1B1GA 2LMUA 2JNFA 1NCZA 2LHIA 1S26D 1BR1B 4WRIA 1SCVA 2P6BB 2ZN8A 5I2LA 1K95A 4CLNA 4ZCVA 2F8PA 1JF2A 2M7LA 3VGOA 1YTZC 1DJWA 2F3YA 3KEVA 4Q04A 3VRRA 1RROA 1CMFA 2WNDA 2I94A 4NQGA 4AQJA 3KPXA 2R2IA 5HKZA 1KFXS 1W7JB 3FS7A 1BLQA 1NYAA 4ZCUA 3SG3A 5GQQC 3O4YA 2LANA 1RJVA 2CT9A 2KYCA 2K61A 3AKBA 2KI4C 2BCAA 4MZKA 2QPTA 3OX5A 1BG1A 1K9PA 1A2XA 1AVSA 1N65A 1S36A 1V1GA 4OV2A 1S6JA 1DT7B 2KFHA 4C0KA 2K8MB 3BOWA 2O60A 1YVLA 1M46A 4IL1A 1A4PA 2BE4A 5AANA 1UP5A 2FJUB 1RWYA 2LMVA 5D7FA 1S5GY 1NPQA 4GGNA 4DRWA 1ZMZA 2SCPA 3GK2A 1EJ3A 1SRAA 2HQWA 1XK4C 3EVRA 3TDIA 3GOFA 4MRYA 1KSMA 5HYDA 2M29A 4AQIA 4NDDA 3PATA 2KQYA 2H61A 1Y1AA 5JOLA 1JC2A 1QV0A 1B47A 2M3WA 3BQ3A 4YGEB 2KQ6A 2KGBC 1UHNA 2JOJA 1L2OC 2LM5A 4FQOA 5AEQA 2JC2A 4PHNA 5FYXA 1DGVA 2KNEA 1KWOB 1UURA 2KFGA 2L98A 5CSNA 2OTGB 3NSLA 3ZWHA 3TUYC 4CFQA 4PALA 1TRFA 2NCOA 3BUOB 2LUCA 2PMYA 3KHEA 1OZOA 2LNKA 1IQ3A 4P5OE 1A29A 1XA5A 3I5IB 3OB1B 3SG6A 1J7RA 4GNKB 3DF0A 2EHBA 3ZNIA 2DOQA 4MZLA 3LK1A 4GAOA 2KHNA 3PM8A 1L2OB 4YGCB 1CFFA 2F2PA 2K7OA 1SBJA 1YR5A 1DJXA 1CFCA 1QS7A 2KFFA 1M39A 3SG2A 2E30A 2PSRA 1DGUA 1OOJA 4GGFC 5CSIA 3NSIA 1K2HA 1YX7A 2WOSA 4YBHB 2COLB 4BY5A 3F45A 2K2AA 1XYDA 1YURA 1QV1A 1R2UA 4XJKB 4OR9B 1PULA 1QX5B 2LE9B 1CMGA 1L7ZA 3VRPA 3IQOA 1QIVA 4QJ3B 5AXIA 2NCPA 1JWDA 1KWOC 1LXFC 4PE1A 2EC6B 2B1UA 2MLEC 3EK8A 3LLEA 3VRQA 4M2QA 3KO0A 2Y4QA 1SMGA 2MHHA 1PALA 1S5GZ 1MWNA 4C0JA 1KFXL 3I5IC 1CM1A 5I8NA 1XFUO 1WLMA 1QASA 1NCXA 4MBEA 1GQMA 4WQ2A 1MUXA 2LAPA 2NXQA 1FPWA 1J7PA 1AUIB 1NX1A 1NX3A 3CS1A 1AJ5A 5KTYA 4GUKA 1PVBA 2LCPA 2M8UA 2LVVA 2JT3A 2Y1NA 1YRUB 3MSEB 4I5LB 3EK7A 1IWQA 3E3RA 2CTNA 4P2YB 1EG3A 1SL7A 2LP3A 2WCEA 1EL4A 3FIAA 5CSFA 1BF5A 4NDBA 1GJYA 2KDHA 3K21A 2O5GA 1JUOA 2BE6A 2ZRSA 5B8IB 2TN4A 1DMOA 1UHKA 2WORA 1YRTB 1QTXA 2CBLA 3PN7C 2LLTA 1SPYA 2LVIA 1HQVA 2ZNDA 4DCKA 2KI6C 2LLSA 3PN7B 1Y1XA 1AJ4A 2H2KA 2MAZA 1A75A 4N1GA 4OVNF 2BCXA 2OS8B 2GGMA 1JSAA 1K9KA 3RM1A 2GGZA 2BECA 1M31A 1BR4B 2JRFA 1GGWA 2MRDA 3CGAA 1NSHA 2L51A 1K90D 1UHJA 4E68A 3EVVA 2KAXA 1M63B 1SR6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJZ A;  1N0Y A;  1CB1 A;  5CSJ A;  3AAK A;  1C7V A;  3LK0 A;  3BUN B;  2ZFD A;  1J1E A;  1A03 A;  1F8H A;  2ZN9 A;  1DF0 A;  1KSO A;  2L50 A;  2KOT A;  1ZAC A;  3CR4 X;  1TNW A;  4PE7 A;  1BU3 A;  3TZ1 A;  1QXP A;  3CLN A;  1XK4 A;  2L0P A;  4YI8 A;  3TS5 B;  3NSK A;  1KK7 Z;  2JQ6 A;  2K0J A;  1F55 A;  3D0Y A;  5JJG A;  3CZT X;  2FCD A;  2JTZ A;  4CPV A;  2Q4U A;  2M9G A;  1WDC C;  4XYN A;  4YRU A;  3WXA A;  1W7I B;  2ZRT A;  1B8C A;  2JUL A;  1FBV A;  2K7D A;  1OQP A;  4AOM A;  1FI6 A;  3DVJ A;  1MXE A;  1QLS A;  2BL0 C;  2L4H A;  3CR5 X;  1F4Q A;  1EXR A;  2LHL A;  1OMV A;  3VRO A;  4N1F A;  1G8I A;  2EGD A;  3SIB A;  1BJF A;  1D1O A;  1LA3 A;  1UHI A;  3BUW B;  3IF7 A;  1DJG A;  2MBX A;  1TTX A;  5DKR A;  3EKH A;  3AKA A;  2AMI A;  4PHM A;  3SG4 A;  3EK4 A;  1TCF A;  1WDC B;  2KBI A;  3BOW B;  2AUC A;  1KFU L;  1SYM A;  2BCB A;  1F71 A;  3CWG A;  2ZKM X;  1FF1 A;  4HRG A;  3RLZ A;  2KYF A;  1CDL A;  1TOP A;  2L5X B;  3I5H C;  5BPJ A;  4HRH A;  3PFV A;  2SAS A;  4ORA B;  1X02 A;  2LMT A;  1CM4 A;  2L4I A;  1SY9 A;  3GK4 X;  4PE0 A;  1BOD A;  1KCY A;  1IJ6 A;  1G33 A;  5HKW A;  3I5F B;  1J7O A;  1OSA A;  1H4B A;  5CPV A;  1KQM B;  1FW4 A;  2BKH B;  3PSR A;  5G08 A;  5PAL A;  1KQM C;  1KK8 B;  1B8R A;  2I7A A;  4PHJ A;  1CNP A;  1NUB A;  4GPL B;  1CLL A;  1SKT A;  3HX4 A;  1KQV A;  1EG4 A;  2PAL A;  2AAO A;  3BUX B;  4TNC A;  2KSP A;  3O2P A;  2M1K B;  4QJ4 B;  1U5I B;  3FWC A;  2JT8 A;  4MZJ A;  1S6C A;  1B7T Z;  1NX0 A;  2HF5 A;  3OX6 A;  2MJW B;  1QIW A;  1ALW A;  1H8B A;  5HLV A;  2OPO A;  3C1V A;  4XJK A;  2A4J A;  2KAV A;  1UWO A;  1JFK A;  1G4Y R;  2K7B A;  4PDZ A;  2ISD A;  2JT0 A;  4D1E A;  3DD4 A;  1PK0 D;  2FOT A;  3AAJ A;  4M2O A;  1IJ5 A;  1QVI Y;  3LL8 B;  4R1E A;  3WHU B;  1JF0 A;  1XFV O;  3BYA A;  1AP4 A;  4GBA A;  1B9A A;  2HET A;  2LVJ A;  4U8D A;  3WHT B;  1ALV A;  3BXK A;  3DF0 B;  3LCP C;  4MSP A;  1Y0V H;  1LIN A;  2PRU A;  3NSO A;  4A4C A;  4JWQ A;  1PSR A;  1ZFS A;  2KI6 D;  1BT6 A;  2LLU A;  1REC A;  1J1D A;  1C07 A;  2EC6 C;  1M45 A;  4UPG A;  4JPZ B;  1IQ5 A;  3IQQ A;  4MEW A;  5K89 A;  2MA2 A;  1KK7 Y;  3TUY B;  2BBN A;  5J3X A;  3DVE A;  1NP8 A;  2CNP A;  1OMR A;  1TIZ A;  2LUX A;  1QLK A;  3I5F C;  2NLN A;  3OP0 A;  1ODB A;  1ZUZ A;  2L2E A;  1J7Q A;  3GK1 A;  1SNL A;  1PSB A;  4L9M A;  3OB2 B;  3A8R A;  1XO5 A;  3D0Y B;  3FWB A;  1LA0 A;  1KK8 C;  1AK8 A;  2BKI B;  4ORC B;  3PAL A;  1OMD A;  1QJT A;  5TNC A;  1TN4 A;  1C7W A;  2LC5 A;  4QJ5 B;  1CLB A;  2E6W A;  2K2F A;  4CFR A;  2I2R E;  2F3Z A;  2IS9 A;  1PVA A;  2LVK A;  3M0W A;  1QVI Z;  4HRE E;  2M1U A;  3ICB A;  2Y1M A;  1DVI A;  3SG7 A;  2WCF A;  1GGZ A;  1B7T Y;  1JBA A;  4YI9 A;  1F54 A;  1V1F A;  3I5G C;  4PHK A;  2M0R A;  4NDC A;  5I2O A;  1MHO A;  2BBM A;  1NIW A;  1CTR A;  1RFJ A;  1XFY O;  3A4U B;  1DJH A;  2GV5 A;  4PE4 A;  1DJY A;  1WRZ A;  1AHR A;  1TNX A;  2QAC A;  5ER4 X;  1DJI A;  1K93 D;  1Q80 A;  2HQ8 A;  2M49 B;  5AER A;  2F2O A;  5DKQ A;  1BMO A;  1ZOT B;  4ORB B;  3TDZ A;  1HT9 A;  2K7C A;  1XVJ A;  3QRX A;  3I5G B;  4DUQ A;  4OKH A;  1TCO B;  1MQ1 A;  1S3P A;  4N5X A;  5KU1 A;  2V53 A;  2M7N A;  4C0L A;  3SIA A;  2KGR A;  2WCB A;  1CKK A;  1LKJ A;  1CFP A;  2G9B A;  2OTG C;  1RK9 A;  1WRL A;  1JFJ A;  5HKY A;  1YUS A;  4YGB B;  5ER5 A;  2JPT A;  3DVK A;  3TS5 C;  1IG5 A;  1CDN A;  2G2B A;  2FCE A;  1XFW O;  1YVH A;  1SCM C;  4M2P A;  4F0Z B;  4I5K A;  1CLM A;  2HPS A;  5HLO A;  2Y5I A;  1QX2 A;  1YUT A;  2JNX A;  2LV7 A;  2WC8 A;  1J55 A;  1A75 B;  3DVM A;  4JQ0 D;  3CR2 A;  3NXA A;  2H61 C;  1LVC D;  1WLZ A;  1CFD A;  5KSZ A;  3SJS A;  1CDM A;  2NZ0 A;  4MRX A;  3HCM A;  5AFP A;  1TNQ A;  5I2Q A;  1N2D A;  1IRJ A;  1Y6W A;  4I5N B;  1NCY A;  3KF9 A;  2BL0 B;  1OZS A;  3WNX B;  1CDP A;  5DKN A;  3I5H B;  1S1E A;  3VRN A;  1MF8 B;  1MXL C;  4BY4 A;  1SL9 A;  2PAS A;  1UHH A;  2JU0 A;  3BUM B;  3PLF B;  1U5I A;  1K8U A;  1KFU S;  3OHM B;  4PCW A;  4ETO A;  1EH2 A;  3EKJ A;  1Y1U A;  3D10 A;  4DS7 A;  1QAT A;  1SW8 A;  1K94 A;  1BOC A;  4WQ3 A;  3JVT B;  2OS8 C;  3SG5 A;  2RGI A;  3JVT C;  1DF0 B;  2LP2 A;  1SL8 A;  1NX2 A;  1MR8 A;  1XFZ O;  1OE9 B;  3H4S E;  4CID A;  5IBW A;  4MLW A;  1F4O A;  2F33 A;  3CTN A;  4USL A;  1K96 A;  1B8L A;  1R6P A;  1B4C A;  2CXJ A;  5F6T A;  2VRG A;  4FTG A;  2PVB A;  2I18 A;  1RTP 1;  4A4B A;  4MN0 A;  4YGA A;  2MLF C;  2JZI A;  4OCI A;  2D8N A;  3O6B A;  1F70 A;  1E8A A;  1PRW A;  2KAY A;  1YUU A;  2KI4 B;  4MVF A;  3TDU A;  2JXC A;  1FI5 A;  1QX7 A;  5D69 A;  1NWD A;  4ICB A;  1SCM B;  1K9U A;  2KBM A;  4YGD B;  4DIR A;  2JWW A;  1VRK A;  3EVU A;  2ZNE A;  4GFT A;  1S6I A;  1XFX O;  1IKU A;  4HSZ A;  3O78 A;  1SR6 C;  1WRK A;  1IH0 A;  2CCM A;  1YX8 A;  4GGF A;  2JTT A;  1DTL A;  3JTD B;  1WY9 A;  1IGV A;  2JXL A;  2M97 A;  2Q91 A;  3JTD C;  1UUS A;  1TNP A;  1SK6 D;  4I5J A;  1B1G A;  2LMU A;  2JNF A;  1NCZ A;  2LHI A;  1S26 D;  1BR1 B;  4WRI A;  1SCV A;  2P6B B;  2ZN8 A;  5I2L A;  1K95 A;  4CLN A;  4ZCV A;  2F8P A;  1JF2 A;  2M7L A;  3VGO A;  1YTZ C;  1DJW A;  2F3Y A;  3KEV A;  4Q04 A;  3VRR A;  1RRO A;  1CMF A;  2WND A;  2I94 A;  4NQG A;  4AQJ A;  3KPX A;  2R2I A;  5HKZ A;  1KFX S;  1W7J B;  3FS7 A;  1BLQ A;  1NYA A;  4ZCU A;  3SG3 A;  5GQQ C;  3O4Y A;  2LAN A;  1RJV A;  2CT9 A;  2KYC A;  2K61 A;  3AKB A;  2KI4 C;  2BCA A;  4MZK A;  2QPT A;  3OX5 A;  1BG1 A;  1K9P A;  1A2X A;  1AVS A;  1N65 A;  1S36 A;  1V1G A;  4OV2 A;  1S6J A;  1DT7 B;  2KFH A;  4C0K A;  2K8M B;  3BOW A;  2O60 A;  1YVL A;  1M46 A;  4IL1 A;  1A4P A;  2BE4 A;  5AAN A;  1UP5 A;  2FJU B;  1RWY A;  2LMV A;  5D7F A;  1S5G Y;  1NPQ A;  4GGN A;  4DRW A;  1ZMZ A;  2SCP A;  3GK2 A;  1EJ3 A;  1SRA A;  2HQW A;  1XK4 C;  3EVR A;  3TDI A;  3GOF A;  4MRY A;  1KSM A;  5HYD A;  2M29 A;  4AQI A;  4NDD A;  3PAT A;  2KQY A;  2H61 A;  1Y1A A;  5JOL A;  1JC2 A;  1QV0 A;  1B47 A;  2M3W A;  3BQ3 A;  4YGE B;  2KQ6 A;  2KGB C;  1UHN A;  2JOJ A;  1L2O C;  2LM5 A;  4FQO A;  5AEQ A;  2JC2 A;  4PHN A;  5FYX A;  1DGV A;  2KNE A;  1KWO B;  1UUR A;  2KFG A;  2L98 A;  5CSN A;  2OTG B;  3NSL A;  3ZWH A;  3TUY C;  4CFQ A;  4PAL A;  1TRF A;  2NCO A;  3BUO B;  2LUC A;  2PMY A;  3KHE A;  1OZO A;  2LNK A;  1IQ3 A;  4P5O E;  1A29 A;  1XA5 A;  3I5I B;  3OB1 B;  3SG6 A;  1J7R A;  4GNK B;  3DF0 A;  2EHB A;  3ZNI A;  2DOQ A;  4MZL A;  3LK1 A;  4GAO A;  2KHN A;  3PM8 A;  1L2O B;  4YGC B;  1CFF A;  2F2P A;  2K7O A;  1SBJ A;  1YR5 A;  1DJX A;  1CFC A;  1QS7 A;  2KFF A;  1M39 A;  3SG2 A;  2E30 A;  2PSR A;  1DGU A;  1OOJ A;  4GGF C;  5CSI A;  3NSI A;  1K2H A;  1YX7 A;  2WOS A;  4YBH B;  2COL B;  4BY5 A;  3F45 A;  2K2A A;  1XYD A;  1YUR A;  1QV1 A;  1R2U A;  4XJK B;  4OR9 B;  1PUL A;  1QX5 B;  2LE9 B;  1CMG A;  1L7Z A;  3VRP A;  3IQO A;  1QIV A;  4QJ3 B;  5AXI A;  2NCP A;  1JWD A;  1KWO C;  1LXF C;  4PE1 A;  2EC6 B;  2B1U A;  2MLE C;  3EK8 A;  3LLE A;  3VRQ A;  4M2Q A;  3KO0 A;  2Y4Q A;  1SMG A;  2MHH A;  1PAL A;  1S5G Z;  1MWN A;  4C0J A;  1KFX L;  3I5I C;  1CM1 A;  5I8N A;  1XFU O;  1WLM A;  1QAS A;  1NCX A;  4MBE A;  1GQM A;  4WQ2 A;  1MUX A;  2LAP A;  2NXQ A;  1FPW A;  1J7P A;  1AUI B;  1NX1 A;  1NX3 A;  3CS1 A;  1AJ5 A;  5KTY A;  4GUK A;  1PVB A;  2LCP A;  2M8U A;  2LVV A;  2JT3 A;  2Y1N A;  1YRU B;  3MSE B;  4I5L B;  3EK7 A;  1IWQ A;  3E3R A;  2CTN A;  4P2Y B;  1EG3 A;  1SL7 A;  2LP3 A;  2WCE A;  1EL4 A;  3FIA A;  5CSF A;  1BF5 A;  4NDB A;  1GJY A;  2KDH A;  3K21 A;  2O5G A;  1JUO A;  2BE6 A;  2ZRS A;  5B8I B;  2TN4 A;  1DMO A;  1UHK A;  2WOR A;  1YRT B;  1QTX A;  2CBL A;  3PN7 C;  2LLT A;  1SPY A;  2LVI A;  1HQV A;  2ZND A;  4DCK A;  2KI6 C;  2LLS A;  3PN7 B;  1Y1X A;  1AJ4 A;  2H2K A;  2MAZ A;  1A75 A;  4N1G A;  4OVN F;  2BCX A;  2OS8 B;  2GGM A;  1JSA A;  1K9K A;  3RM1 A;  2GGZ A;  2BEC A;  1M31 A;  1BR4 B;  2JRF A;  1GGW A;  2MRD A;  3CGA A;  1NSH A;  2L51 A;  1K90 D;  1UHJ A;  4E68 A;  3EVV A;  2KAX A;  1M63 B;  1SR6 B; 
#chains in the Genus database with same CATH topology
 1DJZ A;  1N0Y A;  3S0F A;  1CB1 A;  5CSJ A;  3AAK A;  1C7V A;  3LK0 A;  3BUN B;  2ZFD A;  1J1E A;  1A03 A;  1F8H A;  2ZN9 A;  1DF0 A;  1KSO A;  2L50 A;  1TUZ A;  1ZAC A;  2KOT A;  3CR4 X;  3B6X A;  1TNW A;  4PE7 A;  1BU3 A;  3TZ1 A;  1QXP A;  3CLN A;  1XK4 A;  2L0P A;  4YI8 A;  3L4L A;  3TS5 B;  3NSK A;  3D77 A;  1KK7 Z;  2JQ6 A;  2K0J A;  1F55 A;  3D0Y A;  3BJH A;  5JJG A;  3CZT X;  2FCD A;  2JTZ A;  1LS8 A;  1Z2C B;  4CPV A;  2Q4U A;  2M9G A;  1WDC C;  2FJY A;  4XYN A;  4YRU A;  3WXA A;  1W7I B;  2ZRT A;  1B8C A;  2JUL A;  3S0G A;  1FBV A;  2K7D A;  2WCH A;  1TUJ A;  1OQP A;  4FQT A;  4AOM A;  1CMF A;  1FI6 A;  3DVJ A;  2PYQ A;  1MXE A;  1QLS A;  2BL0 C;  2L4H A;  3CR5 X;  1F4Q A;  1EXR A;  5FI6 A;  2LHL A;  1OMV A;  3VRO A;  4N1F A;  1G8I A;  2EGD A;  3SIB A;  1BJF A;  1D1O A;  1LA3 A;  1UHI A;  3BUW B;  2WCJ A;  1DJG A;  3IF7 A;  2MBX A;  1TTX A;  5DKR A;  3EKH A;  3AKA A;  2AMI A;  3Q8I A;  4PHM A;  3EK4 A;  1TCF A;  1WDC B;  3SG4 A;  2KBI A;  3BOW B;  2AUC A;  1KFU L;  2QEV A;  1SYM A;  2BCB A;  1F71 A;  3CWG A;  2ZKM X;  1FF1 A;  4HRG A;  3RLZ A;  1OOI X;  2WCL A;  2KYF A;  3UNW A;  1CDL A;  1TOP A;  5DIC A;  2L5X B;  3I5H C;  5BPJ A;  4HRH A;  3PFV A;  2SAS A;  4ORA B;  1X02 A;  2LMT A;  1CM4 A;  2L4I A;  1SY9 A;  3GK4 X;  4PE0 A;  4F7F A;  1BOD A;  1KCY A;  1IJ6 A;  1G33 A;  3EG5 B;  3I5F B;  5HKW A;  1OSA A;  4PT1 A;  1J7O A;  5CPV A;  1H4B A;  3S0E A;  2L5Y A;  1KQM B;  1FW4 A;  2BKH B;  3UO9 A;  3PSR A;  5G08 A;  5PAL A;  1KQM C;  1KK8 B;  1B8R A;  2I7A A;  4PHJ A;  1CNP A;  1NUB A;  4GPL B;  1CLL A;  1SKT A;  3HX4 A;  1KQV A;  1EG4 A;  2PAL A;  2AAO A;  3BUX B;  4TNC A;  2WC6 A;  2KSP A;  3O2P A;  3SS4 A;  2M1K B;  4QJ4 B;  1U5I B;  3FWC A;  2QEO A;  2JT8 A;  4MZJ A;  1S6C A;  1B7T Z;  1NX0 A;  2HF5 A;  3OX6 A;  2MJW B;  1OOH A;  1QIW A;  1ALW A;  1H8B A;  5HLV A;  2OPO A;  3C1V A;  4XJK A;  2A4J A;  2KAV A;  3DYE A;  1UWO A;  1JFK A;  1G4Y R;  2K7B A;  4PDZ A;  2ISD A;  2JT0 A;  4D1E A;  3DD4 A;  4KYN A;  1PK0 D;  2FOT A;  3AAJ A;  4M2O A;  1IJ5 A;  1QVI Y;  3LL8 B;  4R1E A;  3WHU B;  1JF0 A;  3FE6 A;  1XFV O;  3BYA A;  1AP4 A;  4GBA A;  1B9A A;  2HET A;  2LVJ A;  4U8D A;  3WHT B;  1ALV A;  3BXK A;  1DEK A;  3DF0 B;  3LCP C;  4MSP A;  1Y0V H;  1LIN A;  1TWO A;  2PRU A;  3CDN A;  3NSO A;  4A4C A;  1OOG A;  4JWQ A;  1PSR A;  1ZFS A;  2KI6 D;  1BT6 A;  2LLU A;  1REC A;  1J1D A;  1C07 A;  2EC6 C;  1M45 A;  4UPG A;  5D3O A;  4JPZ B;  3FE9 A;  1IQ5 A;  2QDI A;  3BFH A;  3IQQ A;  4MEW A;  5K89 A;  2MA2 A;  1KK7 Y;  3TUY B;  2QEH A;  2BBN A;  3SS5 A;  3R1V A;  5J3X A;  3DVE A;  1NP8 A;  2CNP A;  1OMR A;  1TIZ A;  2LUX A;  1QLK A;  3I5F C;  2NLN A;  3OP0 A;  1ODB A;  1ZUZ A;  2L2E A;  1J7Q A;  3GK1 A;  1SNL A;  1PSB A;  4L9M A;  3OB2 B;  3A8R A;  1XO5 A;  3D0Y B;  3FWB A;  1LA0 A;  1KK8 C;  1AK8 A;  2BKI B;  4ORC B;  2ERB A;  3PAL A;  1OMD A;  1QJT A;  5TNC A;  1TN4 A;  1C7W A;  2LC5 A;  2KLD A;  4QJ5 B;  1CLB A;  2E6W A;  2K2F A;  4CFR A;  2I2R E;  2F3Z A;  2IS9 A;  1PVA A;  2LVK A;  3B86 A;  4INW A;  3SS3 A;  1OW4 A;  1QVI Z;  3M0W A;  2M1U A;  4HRE E;  3ICB A;  2Y1M A;  1DEL A;  1DVI A;  3N7H A;  3SG7 A;  2WCF A;  1GGZ A;  1B7T Y;  1JBA A;  4YI9 A;  1F54 A;  1V1F A;  3I5G C;  3RZS A;  3OGN A;  4PHK A;  2M0R A;  4NDC A;  5I2O A;  1MHO A;  2BBM A;  4OZD A;  1NIW A;  1CTR A;  1RFJ A;  1XFY O;  3A4U B;  1DJH A;  2GV5 A;  4PE4 A;  1DJY A;  1WRZ A;  1AHR A;  1TNX A;  2QAC A;  4JD9 A;  5ER4 X;  1DJI A;  1K93 D;  1Q80 A;  2HQ8 A;  5KSZ A;  2M49 B;  5AER A;  2F2O A;  5DKQ A;  4INX A;  1BMO A;  1ZOT B;  4ORB B;  3TDZ A;  1HT9 A;  2K7C A;  1XVJ A;  3QRX A;  3I5G B;  4DUQ A;  4OKH A;  1TCO B;  2YGU A;  3PJI A;  1MQ1 A;  1S3P A;  4N5X A;  5KU1 A;  2V53 A;  2M7N A;  4C0L A;  3SIA A;  2KGR A;  2WCB A;  1CKK A;  1LKJ A;  1CFP A;  1SSE B;  2G9B A;  2OTG C;  1RK9 A;  1WRL A;  1JFJ A;  5HKY A;  1YUS A;  4YGB B;  5ER5 A;  2JPT A;  3DVK A;  1GM0 A;  3TS5 C;  1IG5 A;  1CDN A;  2G2B A;  2K60 A;  2FCE A;  1XFW O;  1YVH A;  1SCM C;  1DC1 A;  4M2P A;  4F0Z B;  4I5K A;  1IIO A;  1CLM A;  2HPS A;  5HLO A;  2Y5I A;  1QX2 A;  1YUT A;  2JNX A;  2LV7 A;  2WC8 A;  1J55 A;  1A75 B;  3DVM A;  4JQ0 D;  3CR2 A;  3NXA A;  3R1O A;  3QME A;  1LVC D;  1WLZ A;  2H61 C;  1CFD A;  2WCM A;  3NHT A;  3SJS A;  1CDM A;  2NZ0 A;  4MRX A;  3HCM A;  5AFP A;  1TNQ A;  3PM2 A;  1N2D A;  4IJ7 A;  1IRJ A;  1Y6W A;  4I5N B;  1NCY A;  3KF9 A;  2BL0 B;  1OZS A;  3WNX B;  1CDP A;  5DKN A;  3BFA A;  3I5H B;  1S1E A;  3VRN A;  1MF8 B;  1MXL C;  3NGV A;  1SL9 A;  2PAS A;  4BY4 A;  1QWV A;  1UHH A;  2JU0 A;  3BUM B;  3PLF B;  1U5I A;  1K8U A;  1KFU S;  3OHM B;  2KPH A;  4PCW A;  4ETO A;  1C3Y A;  1EH2 A;  3EKJ A;  1Y1U A;  3D10 A;  3D75 A;  4DS7 A;  1QAT A;  1SW8 A;  1K94 A;  1BOC A;  4WQ3 A;  3JVT B;  2OS8 C;  3SG5 A;  2RGI A;  3JVT C;  1DF0 B;  3K1E A;  2LP2 A;  1SL8 A;  1NX2 A;  1MR8 A;  1XFZ O;  1OE9 B;  3H4S E;  4CID A;  5IBW A;  4MLW A;  1F4O A;  2F33 A;  3CTN A;  4USL A;  1K96 A;  1B8L A;  1R6P A;  3V2L A;  2CXJ A;  5F6T A;  2VRG A;  1B4C A;  4FTG A;  2PVB A;  2I18 A;  1RTP 1;  4A4B A;  4MN0 A;  2BNX A;  4YGA A;  2MLF C;  2JZI A;  3B88 A;  4OCI A;  2D8N A;  3O6B A;  1F70 A;  1E8A A;  1PRW A;  1T14 A;  1YUU A;  2KAY A;  2KI4 B;  4MVF A;  3TDU A;  2JXC A;  1FI5 A;  1QX7 A;  5D69 A;  1NWD A;  4ICB A;  1SCM B;  1K9U A;  2KBM A;  4YGD B;  4DIR A;  2JWW A;  2P71 A;  1VRK A;  3EVU A;  2ZNE A;  4GFT A;  1S6I A;  1XFX O;  3CZ1 A;  1IKU A;  4HSZ A;  3O78 A;  1SR6 C;  1WRK A;  1IH0 A;  2CCM A;  3CYZ A;  1YX8 A;  3CZ2 A;  4GGF A;  2JTT A;  1DTL A;  3JTD B;  1WY9 A;  1IGV A;  2JXL A;  2M97 A;  2Q91 A;  3JTD C;  3VB1 A;  1UUS A;  1TNP A;  5HL1 A;  1SK6 D;  4I5J A;  1B1G A;  2LMU A;  2JNF A;  3D78 A;  1NCZ A;  2LHI A;  1S26 D;  1BR1 B;  4WRI A;  1SCV A;  2P6B B;  2ZN8 A;  5I2L A;  1K95 A;  4CLN A;  4ZCV A;  2F8P A;  1JF2 A;  2M7L A;  3VGO A;  1YTZ C;  1DJW A;  2F3Y A;  3B7A A;  3KEV A;  4Q04 A;  1RRO A;  3VRR A;  2WND A;  2I94 A;  3CAB A;  4NQG A;  4AQJ A;  3KPX A;  2R2I A;  5I2Q A;  1W9Z A;  5HKZ A;  1KFX S;  1W7J B;  3FS7 A;  1BLQ A;  1NYA A;  4ZCU A;  3SG3 A;  5GQQ C;  3L4A A;  3O4Y A;  1P28 A;  2LAN A;  2WCK A;  1RJV A;  2CT9 A;  2KYC A;  2P70 A;  2K61 A;  3AKB A;  3L47 A;  2KI4 C;  2BCA A;  4MZK A;  2QPT A;  3OX5 A;  1BG1 A;  1K9P A;  1A2X A;  1AVS A;  1N65 A;  1S36 A;  1V1G A;  2PQL A;  4OV2 A;  1S6J A;  1DT7 B;  2KFH A;  4C0K A;  2K8M B;  3BOW A;  2O60 A;  1YVL A;  1M46 A;  4IL1 A;  1A4P A;  2BE4 A;  5AAN A;  1UP5 A;  2FJU B;  1RWY A;  2LMV A;  5D7F A;  1S5G Y;  1NPQ A;  4GGN A;  2JPO A;  4DRW A;  1ZMZ A;  2BAP A;  2SCP A;  3O4X A;  3GK2 A;  1EJ3 A;  1SRA A;  2HQW A;  4JKT A;  1XK4 C;  3S0D A;  3EVR A;  3TDI A;  3GOF A;  4MRY A;  1KSM A;  5HYD A;  1Z4H A;  2M29 A;  4AQI A;  3S0A A;  4NDD A;  3PAT A;  2KQY A;  2H61 A;  1Y1A A;  5JOL A;  1JC2 A;  1QV0 A;  1DQE A;  1B47 A;  2M3W A;  3BQ3 A;  4YGE B;  2KQ6 A;  2KGB C;  1UHN A;  1C3Z A;  2JOJ A;  1L2O C;  2LM5 A;  4FQO A;  5AEQ A;  2JC2 A;  4PHN A;  5FYX A;  1DGV A;  2KNE A;  1KWO B;  1UUR A;  2KFG A;  5I94 A;  2L98 A;  5CSN A;  2OTG B;  2GTE A;  3NSL A;  3ZWH A;  3TUY C;  4CFQ A;  4PAL A;  1TRF A;  2NCO A;  3BFB A;  3BUO B;  2LUC A;  2PMY A;  3KHE A;  1OZO A;  2LNK A;  1IQ3 A;  4P5O E;  1A29 A;  1XA5 A;  3I5I B;  3OB1 B;  3SG6 A;  1J7R A;  4GNK B;  3DF0 A;  2EHB A;  3ZNI A;  2DOQ A;  4MZL A;  3LK1 A;  4GAO A;  2KHN A;  3DXL A;  1L2O B;  3PM8 A;  4YGC B;  1CFF A;  3FE8 A;  2F2P A;  3IVT A;  2K7O A;  1SBJ A;  1YR5 A;  1DJX A;  1CFC A;  1QS7 A;  2KFF A;  1M39 A;  3SG2 A;  3S0B A;  2E30 A;  2PSR A;  1DGU A;  3R1P A;  3CZ0 A;  1OOJ A;  4GGF C;  5CSI A;  3NSI A;  1K2H A;  1YX7 A;  2WOS A;  4YBH B;  2COL B;  4BY5 A;  3F45 A;  2K2A A;  1XYD A;  1YUR A;  1QV1 A;  1R2U A;  2H8V A;  4XJK B;  4OR9 B;  1PUL A;  1QX5 B;  2LE9 B;  1CMG A;  1L7Z A;  3VRP A;  3IQO A;  1QIV A;  4QJ3 B;  5AXI A;  2NCP A;  1JWD A;  1KWO C;  1LXF C;  4PE1 A;  2EC6 B;  2B1U A;  3NHI A;  2MLE C;  3EK8 A;  3LLE A;  3D73 A;  3VRQ A;  4M2Q A;  3KO0 A;  2Y4Q A;  3DY9 A;  1SMG A;  2MHH A;  1PAL A;  1S5G Z;  3OBV A;  1MWN A;  4C0J A;  1KFX L;  3I5I C;  1CM1 A;  5I8N A;  1XFU O;  5FI7 A;  1WLM A;  1QAS A;  1NCX A;  4MBE A;  1GQM A;  4WQ2 A;  1MUX A;  2LAP A;  2NXQ A;  5EL2 A;  1J7P A;  1FPW A;  1AUI B;  1NX1 A;  1NX3 A;  3CS1 A;  1AJ5 A;  5KTY A;  4GUK A;  1PVB A;  2LCP A;  2M8U A;  2LVV A;  2JT3 A;  2Y1N A;  1YRU B;  3DZT A;  3MSE B;  4I5L B;  3EK7 A;  1IWQ A;  3D76 A;  3E3R A;  2CTN A;  4P2Y B;  1EG3 A;  1SL7 A;  3B87 A;  2LP3 A;  5FI2 A;  2WCE A;  1EL4 A;  3FIA A;  3R72 A;  5CSF A;  1BF5 A;  4NDB A;  1OOF A;  1GJY A;  2KDH A;  3K21 A;  2L2C A;  2O5G A;  1JUO A;  2BE6 A;  2ZRS A;  5B8I B;  2TN4 A;  1DMO A;  1UHK A;  2WOR A;  2QEB A;  1YRT B;  1QTX A;  2CBL A;  3PN7 C;  2LLT A;  1SPY A;  2LVI A;  1HQV A;  2ZND A;  4DCK A;  2KI6 C;  2LLS A;  3PN7 B;  1Y1X A;  1AJ4 A;  2H2K A;  2KLE A;  1A75 A;  2MAZ A;  4N1G A;  2BCX A;  2WC5 A;  3D74 A;  4OVN F;  2OS8 B;  2GGM A;  1JSA A;  1ORG A;  1K9K A;  3RM1 A;  2GGZ A;  2BEC A;  1XFR A;  1M31 A;  1BR4 B;  2JRF A;  1GGW A;  2MRD A;  3CGA A;  1NSH A;  2L51 A;  1K90 D;  1UHJ A;  4E68 A;  3EVV A;  2KAX A;  1M63 B;  1SR6 B; 
#chains in the Genus database with same CATH homology
 1DJZ A;  1N0Y A;  1CB1 A;  5CSJ A;  3AAK A;  1C7V A;  3LK0 A;  3BUN B;  2ZFD A;  1J1E A;  1A03 A;  1F8H A;  2ZN9 A;  1DF0 A;  1KSO A;  2L50 A;  2KOT A;  1ZAC A;  3CR4 X;  1TNW A;  4PE7 A;  1BU3 A;  3TZ1 A;  1QXP A;  3CLN A;  1XK4 A;  2L0P A;  4YI8 A;  3TS5 B;  3NSK A;  1KK7 Z;  2JQ6 A;  2K0J A;  1F55 A;  3D0Y A;  5JJG A;  3CZT X;  2FCD A;  2JTZ A;  4CPV A;  2Q4U A;  2M9G A;  1WDC C;  4XYN A;  4YRU A;  3WXA A;  1W7I B;  2ZRT A;  1B8C A;  2JUL A;  1FBV A;  2K7D A;  1OQP A;  4AOM A;  1FI6 A;  3DVJ A;  1MXE A;  1QLS A;  2BL0 C;  2L4H A;  3CR5 X;  1F4Q A;  1EXR A;  2LHL A;  1OMV A;  3VRO A;  4N1F A;  1G8I A;  2EGD A;  3SIB A;  1BJF A;  1D1O A;  1LA3 A;  1UHI A;  3BUW B;  3IF7 A;  1DJG A;  2MBX A;  1TTX A;  5DKR A;  3EKH A;  3AKA A;  2AMI A;  4PHM A;  3SG4 A;  3EK4 A;  1TCF A;  1WDC B;  2KBI A;  3BOW B;  2AUC A;  1KFU L;  1SYM A;  2BCB A;  1F71 A;  3CWG A;  2ZKM X;  1FF1 A;  4HRG A;  3RLZ A;  2KYF A;  1CDL A;  1TOP A;  2L5X B;  3I5H C;  5BPJ A;  4HRH A;  3PFV A;  2SAS A;  4ORA B;  1X02 A;  2LMT A;  1CM4 A;  2L4I A;  1SY9 A;  3GK4 X;  4PE0 A;  1BOD A;  1KCY A;  1IJ6 A;  1G33 A;  5HKW A;  3I5F B;  1J7O A;  1OSA A;  1H4B A;  5CPV A;  1KQM B;  1FW4 A;  2BKH B;  3PSR A;  5G08 A;  5PAL A;  1KQM C;  1KK8 B;  1B8R A;  2I7A A;  4PHJ A;  1CNP A;  1NUB A;  4GPL B;  1CLL A;  1SKT A;  3HX4 A;  1KQV A;  1EG4 A;  2PAL A;  2AAO A;  3BUX B;  4TNC A;  2KSP A;  3O2P A;  2M1K B;  4QJ4 B;  1U5I B;  3FWC A;  2JT8 A;  4MZJ A;  1S6C A;  1B7T Z;  1NX0 A;  2HF5 A;  3OX6 A;  2MJW B;  1QIW A;  1ALW A;  1H8B A;  5HLV A;  2OPO A;  3C1V A;  4XJK A;  2A4J A;  2KAV A;  1UWO A;  1JFK A;  1G4Y R;  2K7B A;  4PDZ A;  2ISD A;  2JT0 A;  4D1E A;  3DD4 A;  1PK0 D;  2FOT A;  3AAJ A;  4M2O A;  1IJ5 A;  1QVI Y;  3LL8 B;  4R1E A;  3WHU B;  1JF0 A;  1XFV O;  3BYA A;  1AP4 A;  4GBA A;  1B9A A;  2HET A;  2LVJ A;  4U8D A;  3WHT B;  1ALV A;  3BXK A;  3DF0 B;  3LCP C;  4MSP A;  1Y0V H;  1LIN A;  2PRU A;  3NSO A;  4A4C A;  4JWQ A;  1PSR A;  1ZFS A;  2KI6 D;  1BT6 A;  2LLU A;  1REC A;  1J1D A;  1C07 A;  2EC6 C;  1M45 A;  4UPG A;  4JPZ B;  1IQ5 A;  3IQQ A;  4MEW A;  5K89 A;  2MA2 A;  1KK7 Y;  3TUY B;  2BBN A;  5J3X A;  3DVE A;  1NP8 A;  2CNP A;  1OMR A;  1TIZ A;  2LUX A;  1QLK A;  3I5F C;  2NLN A;  3OP0 A;  1ODB A;  1ZUZ A;  2L2E A;  1J7Q A;  3GK1 A;  1SNL A;  1PSB A;  4L9M A;  3OB2 B;  3A8R A;  1XO5 A;  3D0Y B;  3FWB A;  1LA0 A;  1KK8 C;  1AK8 A;  2BKI B;  4ORC B;  3PAL A;  1OMD A;  1QJT A;  5TNC A;  1TN4 A;  1C7W A;  2LC5 A;  4QJ5 B;  1CLB A;  2E6W A;  2K2F A;  4CFR A;  2I2R E;  2F3Z A;  2IS9 A;  1PVA A;  2LVK A;  3M0W A;  1QVI Z;  4HRE E;  2M1U A;  3ICB A;  2Y1M A;  1DVI A;  3SG7 A;  2WCF A;  1GGZ A;  1B7T Y;  1JBA A;  4YI9 A;  1F54 A;  1V1F A;  3I5G C;  4PHK A;  2M0R A;  4NDC A;  5I2O A;  1MHO A;  2BBM A;  1NIW A;  1CTR A;  1RFJ A;  1XFY O;  3A4U B;  1DJH A;  2GV5 A;  4PE4 A;  1DJY A;  1WRZ A;  1AHR A;  1TNX A;  2QAC A;  5ER4 X;  1DJI A;  1K93 D;  1Q80 A;  2HQ8 A;  2M49 B;  5AER A;  2F2O A;  5DKQ A;  1BMO A;  1ZOT B;  4ORB B;  3TDZ A;  1HT9 A;  2K7C A;  1XVJ A;  3QRX A;  3I5G B;  4DUQ A;  4OKH A;  1TCO B;  1MQ1 A;  1S3P A;  4N5X A;  5KU1 A;  2V53 A;  2M7N A;  4C0L A;  3SIA A;  2KGR A;  2WCB A;  1CKK A;  1LKJ A;  1CFP A;  2G9B A;  2OTG C;  1RK9 A;  1WRL A;  1JFJ A;  5HKY A;  1YUS A;  4YGB B;  5ER5 A;  2JPT A;  3DVK A;  3TS5 C;  1IG5 A;  1CDN A;  2G2B A;  2FCE A;  1XFW O;  1YVH A;  1SCM C;  4M2P A;  4F0Z B;  4I5K A;  1CLM A;  2HPS A;  5HLO A;  2Y5I A;  1QX2 A;  1YUT A;  2JNX A;  2LV7 A;  2WC8 A;  1J55 A;  1A75 B;  3DVM A;  4JQ0 D;  3CR2 A;  3NXA A;  2H61 C;  1LVC D;  1WLZ A;  1CFD A;  5KSZ A;  3SJS A;  1CDM A;  2NZ0 A;  4MRX A;  3HCM A;  5AFP A;  1TNQ A;  5I2Q A;  1N2D A;  1IRJ A;  1Y6W A;  4I5N B;  1NCY A;  3KF9 A;  2BL0 B;  1OZS A;  3WNX B;  1CDP A;  5DKN A;  3I5H B;  1S1E A;  3VRN A;  1MF8 B;  1MXL C;  4BY4 A;  1SL9 A;  2PAS A;  1UHH A;  2JU0 A;  3BUM B;  3PLF B;  1U5I A;  1K8U A;  1KFU S;  3OHM B;  4PCW A;  4ETO A;  1EH2 A;  3EKJ A;  1Y1U A;  3D10 A;  4DS7 A;  1QAT A;  1SW8 A;  1K94 A;  1BOC A;  4WQ3 A;  3JVT B;  2OS8 C;  3SG5 A;  2RGI A;  3JVT C;  1DF0 B;  2LP2 A;  1SL8 A;  1NX2 A;  1MR8 A;  1XFZ O;  1OE9 B;  3H4S E;  4CID A;  5IBW A;  4MLW A;  1F4O A;  2F33 A;  3CTN A;  4USL A;  1K96 A;  1B8L A;  1R6P A;  1B4C A;  2CXJ A;  5F6T A;  2VRG A;  4FTG A;  2PVB A;  2I18 A;  1RTP 1;  4A4B A;  4MN0 A;  4YGA A;  2MLF C;  2JZI A;  4OCI A;  2D8N A;  3O6B A;  1F70 A;  1E8A A;  1PRW A;  2KAY A;  1YUU A;  2KI4 B;  4MVF A;  3TDU A;  2JXC A;  1FI5 A;  1QX7 A;  5D69 A;  1NWD A;  4ICB A;  1SCM B;  1K9U A;  2KBM A;  4YGD B;  4DIR A;  2JWW A;  1VRK A;  3EVU A;  2ZNE A;  4GFT A;  1S6I A;  1XFX O;  1IKU A;  4HSZ A;  3O78 A;  1SR6 C;  1WRK A;  1IH0 A;  2CCM A;  1YX8 A;  4GGF A;  2JTT A;  1DTL A;  3JTD B;  1WY9 A;  1IGV A;  2JXL A;  2M97 A;  2Q91 A;  3JTD C;  1UUS A;  1TNP A;  1SK6 D;  4I5J A;  1B1G A;  2LMU A;  2JNF A;  1NCZ A;  2LHI A;  1S26 D;  1BR1 B;  4WRI A;  1SCV A;  2P6B B;  2ZN8 A;  5I2L A;  1K95 A;  4CLN A;  4ZCV A;  2F8P A;  1JF2 A;  2M7L A;  3VGO A;  1YTZ C;  1DJW A;  2F3Y A;  3KEV A;  4Q04 A;  3VRR A;  1RRO A;  1CMF A;  2WND A;  2I94 A;  4NQG A;  4AQJ A;  3KPX A;  2R2I A;  5HKZ A;  1KFX S;  1W7J B;  3FS7 A;  1BLQ A;  1NYA A;  4ZCU A;  3SG3 A;  5GQQ C;  3O4Y A;  2LAN A;  1RJV A;  2CT9 A;  2KYC A;  2K61 A;  3AKB A;  2KI4 C;  2BCA A;  4MZK A;  2QPT A;  3OX5 A;  1BG1 A;  1K9P A;  1A2X A;  1AVS A;  1N65 A;  1S36 A;  1V1G A;  4OV2 A;  1S6J A;  1DT7 B;  2KFH A;  4C0K A;  2K8M B;  3BOW A;  2O60 A;  1YVL A;  1M46 A;  4IL1 A;  1A4P A;  2BE4 A;  5AAN A;  1UP5 A;  2FJU B;  1RWY A;  2LMV A;  5D7F A;  1S5G Y;  1NPQ A;  4GGN A;  4DRW A;  1ZMZ A;  2SCP A;  3GK2 A;  1EJ3 A;  1SRA A;  2HQW A;  1XK4 C;  3EVR A;  3TDI A;  3GOF A;  4MRY A;  1KSM A;  5HYD A;  2M29 A;  4AQI A;  4NDD A;  3PAT A;  2KQY A;  2H61 A;  1Y1A A;  5JOL A;  1JC2 A;  1QV0 A;  1B47 A;  2M3W A;  3BQ3 A;  4YGE B;  2KQ6 A;  2KGB C;  1UHN A;  2JOJ A;  1L2O C;  2LM5 A;  4FQO A;  5AEQ A;  2JC2 A;  4PHN A;  5FYX A;  1DGV A;  2KNE A;  1KWO B;  1UUR A;  2KFG A;  2L98 A;  5CSN A;  2OTG B;  3NSL A;  3ZWH A;  3TUY C;  4CFQ A;  4PAL A;  1TRF A;  2NCO A;  3BUO B;  2LUC A;  2PMY A;  3KHE A;  1OZO A;  2LNK A;  1IQ3 A;  4P5O E;  1A29 A;  1XA5 A;  3I5I B;  3OB1 B;  3SG6 A;  1J7R A;  4GNK B;  3DF0 A;  2EHB A;  3ZNI A;  2DOQ A;  4MZL A;  3LK1 A;  4GAO A;  2KHN A;  3PM8 A;  1L2O B;  4YGC B;  1CFF A;  2F2P A;  2K7O A;  1SBJ A;  1YR5 A;  1DJX A;  1CFC A;  1QS7 A;  2KFF A;  1M39 A;  3SG2 A;  2E30 A;  2PSR A;  1DGU A;  1OOJ A;  4GGF C;  5CSI A;  3NSI A;  1K2H A;  1YX7 A;  2WOS A;  4YBH B;  2COL B;  4BY5 A;  3F45 A;  2K2A A;  1XYD A;  1YUR A;  1QV1 A;  1R2U A;  4XJK B;  4OR9 B;  1PUL A;  1QX5 B;  2LE9 B;  1CMG A;  1L7Z A;  3VRP A;  3IQO A;  1QIV A;  4QJ3 B;  5AXI A;  2NCP A;  1JWD A;  1KWO C;  1LXF C;  4PE1 A;  2EC6 B;  2B1U A;  2MLE C;  3EK8 A;  3LLE A;  3VRQ A;  4M2Q A;  3KO0 A;  2Y4Q A;  1SMG A;  2MHH A;  1PAL A;  1S5G Z;  1MWN A;  4C0J A;  1KFX L;  3I5I C;  1CM1 A;  5I8N A;  1XFU O;  1WLM A;  1QAS A;  1NCX A;  4MBE A;  1GQM A;  4WQ2 A;  1MUX A;  2LAP A;  2NXQ A;  1FPW A;  1J7P A;  1AUI B;  1NX1 A;  1NX3 A;  3CS1 A;  1AJ5 A;  5KTY A;  4GUK A;  1PVB A;  2LCP A;  2M8U A;  2LVV A;  2JT3 A;  2Y1N A;  1YRU B;  3MSE B;  4I5L B;  3EK7 A;  1IWQ A;  3E3R A;  2CTN A;  4P2Y B;  1EG3 A;  1SL7 A;  2LP3 A;  2WCE A;  1EL4 A;  3FIA A;  5CSF A;  1BF5 A;  4NDB A;  1GJY A;  2KDH A;  3K21 A;  2O5G A;  1JUO A;  2BE6 A;  2ZRS A;  5B8I B;  2TN4 A;  1DMO A;  1UHK A;  2WOR A;  1YRT B;  1QTX A;  2CBL A;  3PN7 C;  2LLT A;  1SPY A;  2LVI A;  1HQV A;  2ZND A;  4DCK A;  2KI6 C;  2LLS A;  3PN7 B;  1Y1X A;  1AJ4 A;  2H2K A;  2MAZ A;  1A75 A;  4N1G A;  4OVN F;  2BCX A;  2OS8 B;  2GGM A;  1JSA A;  1K9K A;  3RM1 A;  2GGZ A;  2BEC A;  1M31 A;  1BR4 B;  2JRF A;  1GGW A;  2MRD A;  3CGA A;  1NSH A;  2L51 A;  1K90 D;  1UHJ A;  4E68 A;  3EVV A;  2KAX A;  1M63 B;  1SR6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...