4N1FA

Crystal structure of f88y obelin mutant from obelia longissima at 2.09 angstrom resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
186
Chain Sequence
AVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQYLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obelin
publication title Crystal structures of the F88Y obelin mutant before and after bioluminescence provide molecular insight into spectral tuning among hydromedusan photoproteins
pubmed doi rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 72
structure length 186
sequence length 190
ec nomenclature
pdb deposition date 2013-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4n1fA00
1QX5B 1F8HA 3TZ1A 1R6PA 2WCEA 1NWDA 3KEVA 1SKTA 2KAYA 4PDZA 1YRUB 2KDHA 3C1VA 1DGUA 1JSAA 3LCPC 1GJYA 1IG5A 2H2KA 2JULA 3OB1B 1IRJA 1DGVA 1L2OC 2CT9A 1RWYA 1SRAA 2KSPA 3EK4A 1OQPA 2VRGA 4USLA 1B7TZ 1IH0A 2ISDA 1ZUZA 1NX0A 1QJTA 4DS7A 1A75B 3D0YB 1JBAA 1B8LA 3OX6A 3DVJA 1QVIY 1V1FA 1QX2A 1JC2A 1KFUS 1UHHA 4OCIA 3JTDB 1GGZA 4GAOA 4P2YB 1KFXS 1CNPA 2M8UA 4XJKA 1NCXA 1X02A 2I7AA 4BY4A 1TNWA 1YX8A 2BE6A 2MHHA 1DJWA 4ZCVA 4WQ3A 1MXEA 2KI4B 2OPOA 3DF0B 3LK0A 2BL0C 1S6JA 1SL7A 4AQJA 1RTP1 5I2QA 1OZSA 4GUKA 1XFZO 5BPJA 2EC6B 4PE7A 2WOSA 1ALVA 3K21A 2JT8A 1OZOA 3TS5C 1B47A 2ZN8A 3O4YA 2LLUA 2WC8A 1CB1A 4HREE 1K9PA 3PM8A 1CFDA 1SCMC 2K8MB 2QACA 1BJFA 4F0ZB 1UUSA 1RK9A 3A8RA 3CS1A 2CBLA 2K0JA 2JRFA 2JPTA 2KGBC 2LVKA 3IF7A 4N5XA 1HQVA 1SW8A 1LA3A 1TIZA 2QPTA 2KAVA 1HT9A 2NCOA 4L9MA 2LVVA 1KWOC 1R2UA 1J1DA 5I2OA 2JOJA 3EVVA 1UWOA 4ORBB 1TN4A 2M7LA 2NXQA 3ICBA 4N1GA 2LAPA 2KQYA 1QTXA 1XO5A 3CZTX 3DVMA 1K90D 3OX5A 1JFKA 1F70A 4QJ4B 1KFXL 2IS9A 1DJYA 2NCPA 1XK4A 4IL1A 1CTRA 1IQ5A 1A2XA 2LM5A 1N2DA 4I5NB 3PALA 4GFTA 5CPVA 2LNKA 3FWCA 1N65A 3KHEA 1TRFA 4DIRA 3DD4A 1YURA 3SG6A 5I8NA 4JQ0D 1KK8B 1K95A 4YGBB 4QJ3B 1UHNA 1DF0B 1CMGA 4E68A 4MRYA 1ZACA 1XVJA 3BQ3A 1K9KA 1W7JB 2BKHB 1F54A 3BYAA 1OOJA 1QXPA 5CSIA 1U5IA 5AERA 1SY9A 2K7DA 1PALA 4PHMA 1AUIB 1S6IA 3SG5A 2JNFA 5DKNA 3EK8A 2KI6C 1RFJA 4NDCA 1MUXA 4YI9A 4MBEA 4HRHA 5AFPA 1S3PA 2BECA 5KSZA 1M45A 4R1EA 3BOWA 2KNEA 3EVUA 3QRXA 3BUXB 1KSOA 3OHMB 2K2AA 4PE0A 2KFHA 4AOMA 1XYDA 2HQ8A 1UHJA 4MVFA 2JC2A 3BUOB 4PHJA 3CR5X 3VGOA 1SNLA 3PN7C 3H4SE 1S6CA 2M97A 4CLNA 2M0RA 1KQVA 2EGDA 3NSLA 1F4OA 1A75A 2M29A 1SPYA 3NSKA 5IBWA 2LC5A 3F45A 5CSJA 5HLOA 1K2HA 3NSOA 1WRZA 1LKJA 2Y1NA 2OS8C 4CFRA 1PULA 1IJ6A 3GOFA 2BL0B 2L51A 1F4QA 2OTGC 3A4UB 3EKJA 3I5IB 4DUQA 3IQOA 1NUBA 1KQMC 2L4HA 2GV5A 2HF5A 5K89A 4FTGA 1XFYO 2A4JA 1BR4B 2SASA 2KHNA 2Q4UA 3DF0A 2JXLA 1J7OA 1TNXA 3HCMA 3TS5B 1A4PA 1RJVA 3WHUB 3RLZA 1CDNA 5I2LA 1UP5A 2FCEA 1J1EA 3I5FC 1F71A 1QASA 1IKUA 1JF2A 2CNPA 3I5HC 1VRKA 1K94A 3EK7A 4ZCUA 1EG4A 4Q04A 2O60A 2LUXA 3DVEA 4ORCB 4AQIA 1WDCB 2LHLA 4OR9B 5AANA 2MBXA 1CM1A 1KWOB 4C0LA 1YTZC 1IQ3A 4MSPA 1RROA 1Q80A 4OKHA 4YI8A 2K2FA 1NSHA 3IQQA 2KBIA 1Y1XA 1XK4C 1C7WA 2M1UA 5HKYA 3E3RA 2V53A 3JVTC 1G33A 2JTTA 1ZOTB 1C7VA 1MXLC 1KK7Y 1UHIA 3PLFB 4C0JA 4NQGA 2ZN9A 2K7BA 2AUCA 1LINA 3CTNA 4I5KA 3WNXB 1QIWA 1AVSA 1SBJA 1FF1A 1S5GZ 3NSIA 1WY9A 1MQ1A 2O5GA 2HPSA 1IGVA 2KOTA 2KQ6A 1BMOA 1DJGA 3FS7A 4A4BA 2BCBA 3BUWB 1DF0A 1Y6WA 4YGAA 3VRRA 1CDPA 5ER4X 3LL8B 3CR4X 2PRUA 4M2OA 1RECA 1EG3A 3SG4A 1NCYA 1PRWA 1SL8A 2FCDA 4M2QA 3ZNIA 1IWQA 2LE9B 4GGFA 1JWDA 2ZNDA 4D1EA 1KFUL 1C07A 5HYDA 2H61A 1CLBA 3O6BA 1YX7A 1DJHA 2L2EA 1B7TY 1YUUA 3VRPA 1TNPA 2M3WA 2CTNA 4XJKB 2AAOA 2D8NA 2JZIA 1DVIA 3VROA 2JT3A 1N0YA 4ICBA 3PSRA 1SMGA 1WRKA 1NPQA 1QV0A 1KSMA 3JTDC 4MZKA 4CIDA 1PK0D 2NLNA 2OS8B 3AKBA 2JWWA 1K9UA 4PE4A 1PVAA 1YUSA 2OTGB 1PSRA 2M9GA 2WORA 1H4BA 1Y1UA 1OMRA 2ZNEA 1TOPA 1NCZA 1ODBA 1H8BA 3PFVA 2E6WA 3SIAA 3TUYC 1DJXA 2FOTA 1YRTB 2L98A 2P6BB 3KPXA 3FIAA 3NXAA 1A03A 2JQ6A 1QLSA 1S1EA 4ORAB 3RM1A 1B9AA 2NZ0A 1AJ5A 2BKIB 1XFWO 1L2OB 2LVJA 3ZWHA 1BU3A 1DJIA 1OE9B 2F8PA 4MRXA 1EH2A 4P5OE 1K96A 4ETOA 1QATA 1DJZA 1CM4A 1QVIZ 2L5XB 3CGAA 1FBVA 3SG3A 2F33A 1W7IB 1E8AA 2KYCA 1LA0A 3D0YA 1PSBA 4BY5A 2LLSA 2WCBA 2ZFDA 2LANA 4NDDA 1B4CA 4MLWA 2L4IA 2JXCA 1CFCA 4YGCB 5JJGA 2Y4QA 4JWQA 1DMOA 1CMFA 2DOQA 1QS7A 1M63B 2BE4A 2M7NA 1QLKA 2CXJA 1LXFC 3I5GC 1QV1A 5AEQA 2LLTA 1QIVA 2WNDA 1XFXO 4UPGA 1SCMB 1SCVA 4PE1A 5F6TA 3LK1A 1KK8C 4OVNF 4XYNA 1BF5A 4OV2A 4PCWA 2L0PA 3DVKA 4QJ5B 2KBMA 2LMVA 1OSAA 4YGEB 1CDLA 4DRWA 1AP4A 3SG2A 2G9BA 1FI5A 1NYAA 4YRUA 4GPLB 1LVCD 3BOWB 5KTYA 1SYMA 1CKKA 2MLEC 1JF0A 5HLVA 1V1GA 1G4YR 2BCAA 2PALA 4GGFC 4GGNA 4MZJA 4PHKA 1YUTA 4YBHB 1QX7A 1SR6C 2H61C 3FWBA 1WRLA 2KFFA 1MF8B 3CWGA 2WCFA 2ZKMX 2K61A 4HSZA 2BBMA 1YVLA 1BODA 4NDBA 2Y1MA 1J7RA 1G8IA 5B8IB 2KFGA 3O2PA 3VRNA 1WLMA 1JFJA 1XFUO 2GGZA 3BUMB 4I5LB 4DCKA 2ZRTA 5CSFA 3CLNA 1J55A 5KU1A 3OP0A 2E30A 5CSNA 3EVRA 1ALWA 4TNCA 1M46A 2LVIA 4GBAA 4N1FA 1BG1A 1Y0VH 1UHKA 2LMUA 2MRDA 2SCPA 2Q91A 3MSEB 4U8DA 1D1OA 2I94A 1CDMA 1PVBA 1MHOA 3GK2A 2BBNA 3I5IC 1TCFA 3SJSA 1CLMA 2MLFC 3O78A 1MWNA 1EJ3A 1S26D 1OMVA 2KAXA 3TUYB 4FQOA 3CR2A 1FPWA 1XA5A 1XFVO 2PASA 3KO0A 4PHNA 4GNKB 1FI6A 1AJ4A 2LCPA 1K8UA 1SK6D 1UURA 2K7OA 2MJWB 3AAJA 5D69A 3SG7A 1K93D 2I18A 3WHTB 5DKRA 2COLB 1GQMA 1DT7B 1M39A 1B8CA 2LP2A 2ZRSA 3OB2B 2LP3A 5D7FA 1SL9A 1AHRA 1WLZA 2F3YA 3PN7B 3D10A 1NX2A 2F3ZA 2TN4A 1EL4A 4MEWA 4CFQA 4PALA 5DKQA 1YR5A 3AKAA 1WDCC 4A4CA 2KI6D 4WQ2A 2M49B 1ZFSA 3TDIA 5HKWA 1GGWA 2RGIA 1B8RA 1NP8A 2LV7A 2PMYA 2R2IA 5AXIA 5GQQC 1TCOB 2KI4C 1EXRA 1KQMB 3BUNB 1NX1A 3EKHA 4MZLA 3WXAA 1TNQA 2KYFA 2JU0A 2EC6C 3I5GB 4YGDB 3HX4A 4I5JA 3M0WA 1TTXA 2JNXA 1BR1B 3AAKA 4MN0A 2K7CA 2F2OA 1B1GA 4CPVA 2JT0A 1M31A 3PATA 1S5GY 2BCXA 1A29A 3I5FB 2EHBA 3BXKA 4JPZB 1AK8A 1J7QA 1CFPA 2B1UA 3I5HB 5FYXA 4C0KA 3KF9A 1J7PA 2Y5IA 2HETA 2L50A 3LLEA 1MR8A 1IJ5A 2F2PA 1CFFA 3TDUA 2MA2A 2LMTA 2G2BA 2M1KB 5HKZA 1CLLA 5TNCA 1L7ZA 2LUCA 1ZMZA 3GK4X 1NX3A 5ER5A 3VRQA 1SR6B 1NIWA 1YVHA 2HQWA 2GGMA 2I2RE 2PVBA 1JUOA 2PSRA 2LHIA 1BOCA 1Y1AA 2FJUB 4M2PA 1OMDA 1F55A 3JVTB 2KGRA 2AMIA 3TDZA 4WRIA 1KK7Z 1DTLA 3SIBA 5J3XA 1KCYA 5JOLA 2JTZA 5PALA 1FW4A 2MAZA 1S36A 3GK1A 5G08A 1BLQA 2CCMA 1BT6A 1U5IB 4HRGA
chains in the Genus database with same CATH superfamily
1QX5B 2JPOA 3TZ1A 1F8HA 1GM0A 1R6PA 2WCEA 1NWDA 3KEVA 1SKTA 2KAYA 4PDZA 3PJIA 1YRUB 2KDHA 3C1VA 1DGUA 3FE6A 1JSAA 3LCPC 1GJYA 1IG5A 2H2KA 2JULA 3OB1B 1IRJA 1DGVA 1L2OC 1ORGA 1RWYA 1SRAA 2CT9A 2KSPA 2L2CA 2H8VA 3EK4A 1OQPA 2VRGA 4USLA 1B7TZ 1IH0A 2ISDA 1ZUZA 1NX0A 1DC1A 1QJTA 4DS7A 1A75B 3D0YB 1JBAA 1B8LA 3DXLA 3OX6A 3DVJA 1QVIY 1V1FA 4IJ7A 1QX2A 1JC2A 1KFUS 1UHHA 4OCIA 3JTDB 1GGZA 3DZTA 4GAOA 4P2YB 1KFXS 1CNPA 2M8UA 2WCHA 4XJKA 5FI2A 1NCXA 1X02A 1OOGA 2QEVA 2I7AA 3CZ0A 4BY4A 1TNWA 1YX8A 2BE6A 2MHHA 1DJWA 4ZCVA 4WQ3A 1MXEA 2KI4B 2OPOA 3DF0B 3R1VA 3LK0A 2BL0C 1S6JA 1SL7A 3NHIA 1Z4HA 4AQJA 1RTP1 3R1OA 5I2QA 1OZSA 4GUKA 1XFZO 5BPJA 2EC6B 4PE7A 2WOSA 1ALVA 3K21A 2JT8A 1OZOA 3TS5C 1B47A 2ZN8A 3O4YA 2LLUA 2WC8A 1C3YA 4HREE 1CB1A 1K9PA 3PM8A 1CFDA 1SCMC 2K8MB 2QACA 1BJFA 4F0ZB 1UUSA 1RK9A 3A8RA 3CS1A 2CBLA 2GTEA 2K0JA 2JRFA 2JPTA 2KGBC 2LVKA 3IF7A 4N5XA 1HQVA 1SW8A 1LA3A 1TIZA 5I94A 2P71A 2KAVA 1HT9A 2NCOA 2QPTA 4L9MA 2LVVA 1KWOC 1R2UA 1J1DA 5I2OA 2JOJA 3CZ1A 3EVVA 1UWOA 3BJHA 1TN4A 3QMEA 2NXQA 2QEHA 2KLEA 3ICBA 4N1GA 2LAPA 4ORBB 2KQYA 1QTXA 1XO5A 3L47A 3CZTX 3DVMA 1K90D 3OX5A 3S0AA 1JFKA 1F70A 4QJ4B 1KFXL 2IS9A 1DJYA 2NCPA 1XK4A 4IL1A 1CTRA 1IQ5A 1A2XA 2LM5A 1N2DA 4I5NB 3CABA 3PALA 4GFTA 5CPVA 2LNKA 3FWCA 1N65A 3KHEA 1TRFA 4DIRA 3L4LA 3DD4A 1YURA 3SG6A 5I8NA 4JQ0D 1KK8B 1K95A 4YGBB 4QJ3B 1UHNA 1DF0B 1CMGA 4E68A 4MRYA 1ZACA 1XVJA 3BQ3A 1K9KA 1W7JB 2BKHB 1F54A 3UO9A 3BYAA 1OOJA 1QXPA 5CSIA 1U5IA 5AERA 1SY9A 2K7DA 1PALA 4PHMA 1AUIB 1S6IA 3SG5A 2JNFA 5DKNA 3EK8A 2KI6C 1RFJA 4NDCA 1MUXA 4YI9A 4MBEA 4HRHA 5AFPA 1S3PA 2BECA 4INWA 2M7LA 5KSZA 3SS4A 1M45A 4R1EA 3BOWA 2KNEA 3EVUA 3QRXA 3BUXB 1KSOA 3OHMB 2K2AA 4PE0A 2KFHA 4AOMA 1XYDA 2HQ8A 1UHJA 3B86A 4MVFA 2JC2A 3BUOB 4PHJA 4JKTA 3CR5X 3VGOA 1SNLA 3PN7C 3H4SE 1S6CA 2M97A 4CLNA 2M0RA 1KQVA 2EGDA 3NSLA 1F4OA 1A75A 2M29A 1SPYA 3NSKA 5IBWA 2LC5A 4JD9A 3F45A 5CSJA 5DICA 5HLOA 1K2HA 3D76A 3NSOA 1WRZA 1LKJA 2Y1NA 2OS8C 3Q8IA 4CFRA 1PULA 1IJ6A 3OBVA 3GOFA 2BL0B 2L51A 1F4QA 2OTGC 3A4UB 3EKJA 3I5IB 4DUQA 3IQOA 1NUBA 1KQMC 2L4HA 2GV5A 2HF5A 5K89A 4FTGA 3N7HA 1XFYO 2A4JA 1BR4B 2SASA 2KHNA 2Q4UA 3DF0A 2JXLA 1J7OA 1TNXA 3HCMA 3TS5B 1A4PA 1RJVA 3WHUB 3RLZA 1CDNA 5I2LA 5EL2A 3OGNA 1UP5A 2FCEA 1J1EA 3I5FC 1F71A 1QASA 1IKUA 1JF2A 2CNPA 3I5HC 1OOHA 1VRKA 1K94A 3EK7A 4ZCUA 1EG4A 4Q04A 2O60A 2LUXA 3DVEA 4ORCB 4AQIA 1IIOA 1WDCB 2LHLA 4OR9B 5AANA 2MBXA 1CM1A 1KWOB 4C0LA 1YTZC 1LS8A 3R72A 4MSPA 1IQ3A 1RROA 1Q80A 4OKHA 3B6XA 2K2FA 3BFBA 1NSHA 3IQQA 2KBIA 2KPHA 1Y1XA 4YI8A 1XK4C 1C7WA 3S0FA 2M1UA 5D3OA 2WCLA 5HKYA 1OOIX 3E3RA 2V53A 3JVTC 1TUZA 1G33A 2JTTA 1ZOTB 1C7VA 1MXLC 1TUJA 1KK7Y 1UHIA 3PLFB 4C0JA 4NQGA 2ERBA 2ZN9A 2K7BA 2AUCA 1LINA 1OOFA 3CTNA 4I5KA 3WNXB 1QIWA 3D73A 1AVSA 1SBJA 1FF1A 1S5GZ 3CZ2A 3NSIA 1WY9A 1MQ1A 2O5GA 2HPSA 1XFRA 1IGVA 2KOTA 2KQ6A 1BMOA 1DJGA 3FS7A 4A4BA 2BCBA 2FJYA 3BUWB 1DF0A 1Y6WA 4YGAA 3VRRA 1CDPA 5ER4X 3LL8B 3CR4X 2BAPA 2PRUA 4M2OA 1RECA 1EG3A 3SG4A 1NCYA 1PRWA 1SL8A 2FCDA 4M2QA 2PYQA 1IWQA 3ZNIA 3R1PA 2LE9B 4GGFA 1JWDA 2ZNDA 4D1EA 1KFUL 1C07A 5HYDA 2H61A 3CYZA 1CLBA 3O6BA 1YX7A 3B88A 1DJHA 2L2EA 1B7TY 1YUUA 3DYEA 3VRPA 1TNPA 1W9ZA 2M3WA 2CTNA 4XJKB 2AAOA 2D8NA 2JZIA 1DVIA 3VROA 2JT3A 3BFHA 1N0YA 4ICBA 3PSRA 1SMGA 1WRKA 2P70A 3SS5A 1NPQA 1QV0A 1KSMA 2BNXA 3JTDC 1TWOA 4MZKA 4CIDA 1PK0D 2NLNA 2OS8B 3AKBA 2JWWA 2YGUA 3IVTA 1K9UA 4PE4A 1PVAA 1YUSA 2OTGB 1PSRA 2M9GA 2WORA 1H4BA 4F7FA 1Y1UA 1OMRA 2ZNEA 1TOPA 1NCZA 1ODBA 1H8BA 3PFVA 2E6WA 3SIAA 2WCKA 3TUYC 1DJXA 2FOTA 1YRTB 2L98A 2P6BB 3KPXA 3FIAA 3NXAA 3B7AA 1A03A 2JQ6A 1QLSA 1S1EA 4ORAB 3RM1A 1B9AA 2NZ0A 1AJ5A 1T14A 2BKIB 1QWVA 1XFWO 1L2OB 2LVJA 3B87A 2K60A 3S0EA 3ZWHA 1BU3A 1DJIA 1OE9B 2F8PA 4MRXA 1EH2A 3L4AA 4P5OE 1K96A 3BFAA 4ETOA 1QATA 1DJZA 1CM4A 1QVIZ 2L5XB 3CGAA 1FBVA 3SG3A 2F33A 1W7IB 5HL1A 1E8AA 2KYCA 1LA0A 3D0YA 1PSBA 4BY5A 2LLSA 2WCBA 2ZFDA 2LANA 4NDDA 1B4CA 4MLWA 2L4IA 2JXCA 1J7QA 1CFCA 2QEOA 4YGCB 2PQLA 3FE8A 5JJGA 2Y4QA 4JWQA 3V2LA 1CMFA 2DOQA 1DMOA 1DEKA 1QS7A 1M63B 2BE4A 2M7NA 1QLKA 2CXJA 1LXFC 3I5GC 1QV1A 5AEQA 2LLTA 1QIVA 2WNDA 1XFXO 4UPGA 1DELA 1SCMB 2WCJA 1SCVA 4PE1A 5F6TA 3LK1A 1KK8C 4OVNF 4XYNA 1BF5A 4OV2A 4PCWA 2L0PA 3DVKA 4QJ5B 2KBMA 2LMVA 1OSAA 4YGEB 1CDLA 4DRWA 1AP4A 3SG2A 2G9BA 1FI5A 1NYAA 3DY9A 4YRUA 3CDNA 3D78A 4GPLB 1LVCD 3BOWB 5KTYA 1SYMA 1CKKA 2MLEC 4OZDA 1JF0A 5HLVA 1V1GA 1G4YR 2BCAA 2PALA 4GGFC 4GGNA 4MZJA 4PHKA 1YUTA 4YBHB 1QX7A 1SR6C 2H61C 3FWBA 1WRLA 2KFFA 1MF8B 3CWGA 2WCFA 2ZKMX 2K61A 4HSZA 2BBMA 1YVLA 1BODA 4NDBA 2Y1MA 1J7RA 1G8IA 5B8IB 3K1EA 2KFGA 3O2PA 3VRNA 1WLMA 1JFJA 3S0BA 1XFUO 2GGZA 3BUMB 4I5LB 4DCKA 2ZRTA 5CSFA 3CLNA 1J55A 3RZSA 3NHTA 3OP0A 3PM2A 2E30A 5CSNA 3S0DA 3EVRA 1ALWA 5KU1A 4TNCA 1M46A 2LVIA 4GBAA 4N1FA 1BG1A 1Y0VH 1UHKA 2LMUA 2MRDA 2SCPA 1P28A 2Q91A 3MSEB 4U8DA 1D1OA 2I94A 1CDMA 1PVBA 1MHOA 3GK2A 2BBNA 3I5IC 1TCFA 3SJSA 1CLMA 2MLFC 3O78A 1MWNA 1EJ3A 1S26D 1OMVA 2KAXA 4PT1A 4FQOA 3TUYB 3CR2A 1FPWA 1XA5A 1XFVO 2PASA 3KO0A 4PHNA 4GNKB 1FI6A 1AJ4A 3O4XA 3D77A 2LCPA 1K8UA 1SK6D 1UURA 2K7OA 2MJWB 2WC5A 3AAJA 2KLDA 5D69A 1K93D 2I18A 3SG7A 3WHTB 5DKRA 2COLB 1GQMA 1DT7B 1M39A 1B8CA 2LP2A 2ZRSA 3OB2B 4FQTA 2LP3A 2QDIA 5D7FA 1SL9A 1WLZA 1AHRA 2F3YA 3PN7B 3D10A 1NX2A 2F3ZA 2TN4A 1EL4A 4MEWA 3S0GA 4CFQA 4PALA 5DKQA 1YR5A 4INXA 3AKAA 1WDCC 4A4CA 2KI6D 4WQ2A 2M49B 3UNWA 1ZFSA 3TDIA 5HKWA 1GGWA 2WCMA 2RGIA 1B8RA 1NP8A 3D75A 2LV7A 2PMYA 2R2IA 5AXIA 5GQQC 1TCOB 2KI4C 1EXRA 3VB1A 1KQMB 3BUNB 1NX1A 3EKHA 3EG5B 1SSEB 4MZLA 3WXAA 1TNQA 1Z2CB 2KYFA 2JU0A 2EC6C 3I5GB 4YGDB 3HX4A 4I5JA 3M0WA 1TTXA 2JNXA 1BR1B 1DQEA 3AAKA 3NGVA 4MN0A 2K7CA 2F2OA 1B1GA 4CPVA 2QEBA 2JT0A 1M31A 3PATA 1S5GY 1A29A 2BCXA 3I5FB 2EHBA 3BXKA 4JPZB 3D74A 1AK8A 1CFPA 2B1UA 3I5HB 5FYXA 4C0KA 3KF9A 1J7PA 2Y5IA 2HETA 3SS3A 2L50A 3LLEA 5FI6A 1MR8A 1IJ5A 2WC6A 2L5YA 4KYNA 2F2PA 1CFFA 3TDUA 2MA2A 2LMTA 2G2BA 3FE9A 2M1KB 5HKZA 1CLLA 5TNCA 1L7ZA 2LUCA 1OW4A 1ZMZA 3GK4X 1NX3A 5ER5A 3VRQA 1SR6B 1NIWA 1YVHA 2HQWA 2GGMA 2I2RE 2PVBA 1JUOA 2PSRA 2LHIA 1BOCA 1Y1AA 2FJUB 4M2PA 1OMDA 1F55A 3JVTB 2KGRA 2AMIA 3TDZA 4WRIA 1KK7Z 1DTLA 3SIBA 5J3XA 1C3ZA 5JOLA 1KCYA 2JTZA 5PALA 1FW4A 2MAZA 1S36A 5FI7A 3GK1A 5G08A 1BLQA 2CCMA 1BT6A 1U5IB 4HRGA
chains in the Genus database with same CATH topology
1QX5B 1F8HA 3TZ1A 1R6PA 2WCEA 1NWDA 3KEVA 1SKTA 2KAYA 4PDZA 1YRUB 2KDHA 3C1VA 1DGUA 1JSAA 3LCPC 1GJYA 1IG5A 2H2KA 2JULA 3OB1B 1IRJA 1DGVA 1L2OC 2CT9A 1RWYA 1SRAA 2KSPA 3EK4A 1OQPA 2VRGA 4USLA 1B7TZ 1IH0A 2ISDA 1ZUZA 1NX0A 1QJTA 4DS7A 1A75B 3D0YB 1JBAA 1B8LA 3OX6A 3DVJA 1QVIY 1V1FA 1QX2A 1JC2A 1KFUS 1UHHA 4OCIA 3JTDB 1GGZA 4GAOA 4P2YB 1KFXS 1CNPA 2M8UA 4XJKA 1NCXA 1X02A 2I7AA 4BY4A 1TNWA 1YX8A 2BE6A 2MHHA 1DJWA 4ZCVA 4WQ3A 1MXEA 2KI4B 2OPOA 3DF0B 3LK0A 2BL0C 1S6JA 1SL7A 4AQJA 1RTP1 5I2QA 1OZSA 4GUKA 1XFZO 5BPJA 2EC6B 4PE7A 2WOSA 1ALVA 3K21A 2JT8A 1OZOA 3TS5C 1B47A 2ZN8A 3O4YA 2LLUA 2WC8A 1CB1A 4HREE 1K9PA 3PM8A 1CFDA 1SCMC 2K8MB 2QACA 1BJFA 4F0ZB 1UUSA 1RK9A 3A8RA 3CS1A 2CBLA 2K0JA 2JRFA 2JPTA 2KGBC 2LVKA 3IF7A 4N5XA 1HQVA 1SW8A 1LA3A 1TIZA 2QPTA 2KAVA 1HT9A 2NCOA 4L9MA 2LVVA 1KWOC 1R2UA 1J1DA 5I2OA 2JOJA 3EVVA 1UWOA 4ORBB 1TN4A 2M7LA 2NXQA 3ICBA 4N1GA 2LAPA 2KQYA 1QTXA 1XO5A 3CZTX 3DVMA 1K90D 3OX5A 1JFKA 1F70A 4QJ4B 1KFXL 2IS9A 1DJYA 2NCPA 1XK4A 4IL1A 1CTRA 1IQ5A 1A2XA 2LM5A 1N2DA 4I5NB 3PALA 4GFTA 5CPVA 2LNKA 3FWCA 1N65A 3KHEA 1TRFA 4DIRA 3DD4A 1YURA 3SG6A 5I8NA 4JQ0D 1KK8B 1K95A 4YGBB 4QJ3B 1UHNA 1DF0B 1CMGA 4E68A 4MRYA 1ZACA 1XVJA 3BQ3A 1K9KA 1W7JB 2BKHB 1F54A 3BYAA 1OOJA 1QXPA 5CSIA 1U5IA 5AERA 1SY9A 2K7DA 1PALA 4PHMA 1AUIB 1S6IA 3SG5A 2JNFA 5DKNA 3EK8A 2KI6C 1RFJA 4NDCA 1MUXA 4YI9A 4MBEA 4HRHA 5AFPA 1S3PA 2BECA 5KSZA 1M45A 4R1EA 3BOWA 2KNEA 3EVUA 3QRXA 3BUXB 1KSOA 3OHMB 2K2AA 4PE0A 2KFHA 4AOMA 1XYDA 2HQ8A 1UHJA 4MVFA 2JC2A 3BUOB 4PHJA 3CR5X 3VGOA 1SNLA 3PN7C 3H4SE 1S6CA 2M97A 4CLNA 2M0RA 1KQVA 2EGDA 3NSLA 1F4OA 1A75A 2M29A 1SPYA 3NSKA 5IBWA 2LC5A 3F45A 5CSJA 5HLOA 1K2HA 3NSOA 1WRZA 1LKJA 2Y1NA 2OS8C 4CFRA 1PULA 1IJ6A 3GOFA 2BL0B 2L51A 1F4QA 2OTGC 3A4UB 3EKJA 3I5IB 4DUQA 3IQOA 1NUBA 1KQMC 2L4HA 2GV5A 2HF5A 5K89A 4FTGA 1XFYO 2A4JA 1BR4B 2SASA 2KHNA 2Q4UA 3DF0A 2JXLA 1J7OA 1TNXA 3HCMA 3TS5B 1A4PA 1RJVA 3WHUB 3RLZA 1CDNA 5I2LA 1UP5A 2FCEA 1J1EA 3I5FC 1F71A 1QASA 1IKUA 1JF2A 2CNPA 3I5HC 1VRKA 1K94A 3EK7A 4ZCUA 1EG4A 4Q04A 2O60A 2LUXA 3DVEA 4ORCB 4AQIA 1WDCB 2LHLA 4OR9B 5AANA 2MBXA 1CM1A 1KWOB 4C0LA 1YTZC 1IQ3A 4MSPA 1RROA 1Q80A 4OKHA 4YI8A 2K2FA 1NSHA 3IQQA 2KBIA 1Y1XA 1XK4C 1C7WA 2M1UA 5HKYA 3E3RA 2V53A 3JVTC 1G33A 2JTTA 1ZOTB 1C7VA 1MXLC 1KK7Y 1UHIA 3PLFB 4C0JA 4NQGA 2ZN9A 2K7BA 2AUCA 1LINA 3CTNA 4I5KA 3WNXB 1QIWA 1AVSA 1SBJA 1FF1A 1S5GZ 3NSIA 1WY9A 1MQ1A 2O5GA 2HPSA 1IGVA 2KOTA 2KQ6A 1BMOA 1DJGA 3FS7A 4A4BA 2BCBA 3BUWB 1DF0A 1Y6WA 4YGAA 3VRRA 1CDPA 5ER4X 3LL8B 3CR4X 2PRUA 4M2OA 1RECA 1EG3A 3SG4A 1NCYA 1PRWA 1SL8A 2FCDA 4M2QA 3ZNIA 1IWQA 2LE9B 4GGFA 1JWDA 2ZNDA 4D1EA 1KFUL 1C07A 5HYDA 2H61A 1CLBA 3O6BA 1YX7A 1DJHA 2L2EA 1B7TY 1YUUA 3VRPA 1TNPA 2M3WA 2CTNA 4XJKB 2AAOA 2D8NA 2JZIA 1DVIA 3VROA 2JT3A 1N0YA 4ICBA 3PSRA 1SMGA 1WRKA 1NPQA 1QV0A 1KSMA 3JTDC 4MZKA 4CIDA 1PK0D 2NLNA 2OS8B 3AKBA 2JWWA 1K9UA 4PE4A 1PVAA 1YUSA 2OTGB 1PSRA 2M9GA 2WORA 1H4BA 1Y1UA 1OMRA 2ZNEA 1TOPA 1NCZA 1ODBA 1H8BA 3PFVA 2E6WA 3SIAA 3TUYC 1DJXA 2FOTA 1YRTB 2L98A 2P6BB 3KPXA 3FIAA 3NXAA 1A03A 2JQ6A 1QLSA 1S1EA 4ORAB 3RM1A 1B9AA 2NZ0A 1AJ5A 2BKIB 1XFWO 1L2OB 2LVJA 3ZWHA 1BU3A 1DJIA 1OE9B 2F8PA 4MRXA 1EH2A 4P5OE 1K96A 4ETOA 1QATA 1DJZA 1CM4A 1QVIZ 2L5XB 3CGAA 1FBVA 3SG3A 2F33A 1W7IB 1E8AA 2KYCA 1LA0A 3D0YA 1PSBA 4BY5A 2LLSA 2WCBA 2ZFDA 2LANA 4NDDA 1B4CA 4MLWA 2L4IA 2JXCA 1CFCA 4YGCB 5JJGA 2Y4QA 4JWQA 1DMOA 1CMFA 2DOQA 1QS7A 1M63B 2BE4A 2M7NA 1QLKA 2CXJA 1LXFC 3I5GC 1QV1A 5AEQA 2LLTA 1QIVA 2WNDA 1XFXO 4UPGA 1SCMB 1SCVA 4PE1A 5F6TA 3LK1A 1KK8C 4OVNF 4XYNA 1BF5A 4OV2A 4PCWA 2L0PA 3DVKA 4QJ5B 2KBMA 2LMVA 1OSAA 4YGEB 1CDLA 4DRWA 1AP4A 3SG2A 2G9BA 1FI5A 1NYAA 4YRUA 4GPLB 1LVCD 3BOWB 5KTYA 1SYMA 1CKKA 2MLEC 1JF0A 5HLVA 1V1GA 1G4YR 2BCAA 2PALA 4GGFC 4GGNA 4MZJA 4PHKA 1YUTA 4YBHB 1QX7A 1SR6C 2H61C 3FWBA 1WRLA 2KFFA 1MF8B 3CWGA 2WCFA 2ZKMX 2K61A 4HSZA 2BBMA 1YVLA 1BODA 4NDBA 2Y1MA 1J7RA 1G8IA 5B8IB 2KFGA 3O2PA 3VRNA 1WLMA 1JFJA 1XFUO 2GGZA 3BUMB 4I5LB 4DCKA 2ZRTA 5CSFA 3CLNA 1J55A 5KU1A 3OP0A 2E30A 5CSNA 3EVRA 1ALWA 4TNCA 1M46A 2LVIA 4GBAA 4N1FA 1BG1A 1Y0VH 1UHKA 2LMUA 2MRDA 2SCPA 2Q91A 3MSEB 4U8DA 1D1OA 2I94A 1CDMA 1PVBA 1MHOA 3GK2A 2BBNA 3I5IC 1TCFA 3SJSA 1CLMA 2MLFC 3O78A 1MWNA 1EJ3A 1S26D 1OMVA 2KAXA 3TUYB 4FQOA 3CR2A 1FPWA 1XA5A 1XFVO 2PASA 3KO0A 4PHNA 4GNKB 1FI6A 1AJ4A 2LCPA 1K8UA 1SK6D 1UURA 2K7OA 2MJWB 3AAJA 5D69A 3SG7A 1K93D 2I18A 3WHTB 5DKRA 2COLB 1GQMA 1DT7B 1M39A 1B8CA 2LP2A 2ZRSA 3OB2B 2LP3A 5D7FA 1SL9A 1AHRA 1WLZA 2F3YA 3PN7B 3D10A 1NX2A 2F3ZA 2TN4A 1EL4A 4MEWA 4CFQA 4PALA 5DKQA 1YR5A 3AKAA 1WDCC 4A4CA 2KI6D 4WQ2A 2M49B 1ZFSA 3TDIA 5HKWA 1GGWA 2RGIA 1B8RA 1NP8A 2LV7A 2PMYA 2R2IA 5AXIA 5GQQC 1TCOB 2KI4C 1EXRA 1KQMB 3BUNB 1NX1A 3EKHA 4MZLA 3WXAA 1TNQA 2KYFA 2JU0A 2EC6C 3I5GB 4YGDB 3HX4A 4I5JA 3M0WA 1TTXA 2JNXA 1BR1B 3AAKA 4MN0A 2K7CA 2F2OA 1B1GA 4CPVA 2JT0A 1M31A 3PATA 1S5GY 2BCXA 1A29A 3I5FB 2EHBA 3BXKA 4JPZB 1AK8A 1J7QA 1CFPA 2B1UA 3I5HB 5FYXA 4C0KA 3KF9A 1J7PA 2Y5IA 2HETA 2L50A 3LLEA 1MR8A 1IJ5A 2F2PA 1CFFA 3TDUA 2MA2A 2LMTA 2G2BA 2M1KB 5HKZA 1CLLA 5TNCA 1L7ZA 2LUCA 1ZMZA 3GK4X 1NX3A 5ER5A 3VRQA 1SR6B 1NIWA 1YVHA 2HQWA 2GGMA 2I2RE 2PVBA 1JUOA 2PSRA 2LHIA 1BOCA 1Y1AA 2FJUB 4M2PA 1OMDA 1F55A 3JVTB 2KGRA 2AMIA 3TDZA 4WRIA 1KK7Z 1DTLA 3SIBA 5J3XA 1KCYA 5JOLA 2JTZA 5PALA 1FW4A 2MAZA 1S36A 3GK1A 5G08A 1BLQA 2CCMA 1BT6A 1U5IB 4HRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QX5 B;  1F8H A;  3TZ1 A;  1R6P A;  2WCE A;  1NWD A;  3KEV A;  1SKT A;  2KAY A;  4PDZ A;  1YRU B;  2KDH A;  3C1V A;  1DGU A;  1JSA A;  3LCP C;  1GJY A;  1IG5 A;  2H2K A;  2JUL A;  3OB1 B;  1IRJ A;  1DGV A;  1L2O C;  2CT9 A;  1RWY A;  1SRA A;  2KSP A;  3EK4 A;  1OQP A;  2VRG A;  4USL A;  1B7T Z;  1IH0 A;  2ISD A;  1ZUZ A;  1NX0 A;  1QJT A;  4DS7 A;  1A75 B;  3D0Y B;  1JBA A;  1B8L A;  3OX6 A;  3DVJ A;  1QVI Y;  1V1F A;  1QX2 A;  1JC2 A;  1KFU S;  1UHH A;  4OCI A;  3JTD B;  1GGZ A;  4GAO A;  4P2Y B;  1KFX S;  1CNP A;  2M8U A;  4XJK A;  1NCX A;  1X02 A;  2I7A A;  4BY4 A;  1TNW A;  1YX8 A;  2BE6 A;  2MHH A;  1DJW A;  4ZCV A;  4WQ3 A;  1MXE A;  2KI4 B;  2OPO A;  3DF0 B;  3LK0 A;  2BL0 C;  1S6J A;  1SL7 A;  4AQJ A;  1RTP 1;  5I2Q A;  1OZS A;  4GUK A;  1XFZ O;  5BPJ A;  2EC6 B;  4PE7 A;  2WOS A;  1ALV A;  3K21 A;  2JT8 A;  1OZO A;  3TS5 C;  1B47 A;  2ZN8 A;  3O4Y A;  2LLU A;  2WC8 A;  1CB1 A;  4HRE E;  1K9P A;  3PM8 A;  1CFD A;  1SCM C;  2K8M B;  2QAC A;  1BJF A;  4F0Z B;  1UUS A;  1RK9 A;  3A8R A;  3CS1 A;  2CBL A;  2K0J A;  2JRF A;  2JPT A;  2KGB C;  2LVK A;  3IF7 A;  4N5X A;  1HQV A;  1SW8 A;  1LA3 A;  1TIZ A;  2QPT A;  2KAV A;  1HT9 A;  2NCO A;  4L9M A;  2LVV A;  1KWO C;  1R2U A;  1J1D A;  5I2O A;  2JOJ A;  3EVV A;  1UWO A;  4ORB B;  1TN4 A;  2M7L A;  2NXQ A;  3ICB A;  4N1G A;  2LAP A;  2KQY A;  1QTX A;  1XO5 A;  3CZT X;  3DVM A;  1K90 D;  3OX5 A;  1JFK A;  1F70 A;  4QJ4 B;  1KFX L;  2IS9 A;  1DJY A;  2NCP A;  1XK4 A;  4IL1 A;  1CTR A;  1IQ5 A;  1A2X A;  2LM5 A;  1N2D A;  4I5N B;  3PAL A;  4GFT A;  5CPV A;  2LNK A;  3FWC A;  1N65 A;  3KHE A;  1TRF A;  4DIR A;  3DD4 A;  1YUR A;  3SG6 A;  5I8N A;  4JQ0 D;  1KK8 B;  1K95 A;  4YGB B;  4QJ3 B;  1UHN A;  1DF0 B;  1CMG A;  4E68 A;  4MRY A;  1ZAC A;  1XVJ A;  3BQ3 A;  1K9K A;  1W7J B;  2BKH B;  1F54 A;  3BYA A;  1OOJ A;  1QXP A;  5CSI A;  1U5I A;  5AER A;  1SY9 A;  2K7D A;  1PAL A;  4PHM A;  1AUI B;  1S6I A;  3SG5 A;  2JNF A;  5DKN A;  3EK8 A;  2KI6 C;  1RFJ A;  4NDC A;  1MUX A;  4YI9 A;  4MBE A;  4HRH A;  5AFP A;  1S3P A;  2BEC A;  5KSZ A;  1M45 A;  4R1E A;  3BOW A;  2KNE A;  3EVU A;  3QRX A;  3BUX B;  1KSO A;  3OHM B;  2K2A A;  4PE0 A;  2KFH A;  4AOM A;  1XYD A;  2HQ8 A;  1UHJ A;  4MVF A;  2JC2 A;  3BUO B;  4PHJ A;  3CR5 X;  3VGO A;  1SNL A;  3PN7 C;  3H4S E;  1S6C A;  2M97 A;  4CLN A;  2M0R A;  1KQV A;  2EGD A;  3NSL A;  1F4O A;  1A75 A;  2M29 A;  1SPY A;  3NSK A;  5IBW A;  2LC5 A;  3F45 A;  5CSJ A;  5HLO A;  1K2H A;  3NSO A;  1WRZ A;  1LKJ A;  2Y1N A;  2OS8 C;  4CFR A;  1PUL A;  1IJ6 A;  3GOF A;  2BL0 B;  2L51 A;  1F4Q A;  2OTG C;  3A4U B;  3EKJ A;  3I5I B;  4DUQ A;  3IQO A;  1NUB A;  1KQM C;  2L4H A;  2GV5 A;  2HF5 A;  5K89 A;  4FTG A;  1XFY O;  2A4J A;  1BR4 B;  2SAS A;  2KHN A;  2Q4U A;  3DF0 A;  2JXL A;  1J7O A;  1TNX A;  3HCM A;  3TS5 B;  1A4P A;  1RJV A;  3WHU B;  3RLZ A;  1CDN A;  5I2L A;  1UP5 A;  2FCE A;  1J1E A;  3I5F C;  1F71 A;  1QAS A;  1IKU A;  1JF2 A;  2CNP A;  3I5H C;  1VRK A;  1K94 A;  3EK7 A;  4ZCU A;  1EG4 A;  4Q04 A;  2O60 A;  2LUX A;  3DVE A;  4ORC B;  4AQI A;  1WDC B;  2LHL A;  4OR9 B;  5AAN A;  2MBX A;  1CM1 A;  1KWO B;  4C0L A;  1YTZ C;  1IQ3 A;  4MSP A;  1RRO A;  1Q80 A;  4OKH A;  4YI8 A;  2K2F A;  1NSH A;  3IQQ A;  2KBI A;  1Y1X A;  1XK4 C;  1C7W A;  2M1U A;  5HKY A;  3E3R A;  2V53 A;  3JVT C;  1G33 A;  2JTT A;  1ZOT B;  1C7V A;  1MXL C;  1KK7 Y;  1UHI A;  3PLF B;  4C0J A;  4NQG A;  2ZN9 A;  2K7B A;  2AUC A;  1LIN A;  3CTN A;  4I5K A;  3WNX B;  1QIW A;  1AVS A;  1SBJ A;  1FF1 A;  1S5G Z;  3NSI A;  1WY9 A;  1MQ1 A;  2O5G A;  2HPS A;  1IGV A;  2KOT A;  2KQ6 A;  1BMO A;  1DJG A;  3FS7 A;  4A4B A;  2BCB A;  3BUW B;  1DF0 A;  1Y6W A;  4YGA A;  3VRR A;  1CDP A;  5ER4 X;  3LL8 B;  3CR4 X;  2PRU A;  4M2O A;  1REC A;  1EG3 A;  3SG4 A;  1NCY A;  1PRW A;  1SL8 A;  2FCD A;  4M2Q A;  3ZNI A;  1IWQ A;  2LE9 B;  4GGF A;  1JWD A;  2ZND A;  4D1E A;  1KFU L;  1C07 A;  5HYD A;  2H61 A;  1CLB A;  3O6B A;  1YX7 A;  1DJH A;  2L2E A;  1B7T Y;  1YUU A;  3VRP A;  1TNP A;  2M3W A;  2CTN A;  4XJK B;  2AAO A;  2D8N A;  2JZI A;  1DVI A;  3VRO A;  2JT3 A;  1N0Y A;  4ICB A;  3PSR A;  1SMG A;  1WRK A;  1NPQ A;  1QV0 A;  1KSM A;  3JTD C;  4MZK A;  4CID A;  1PK0 D;  2NLN A;  2OS8 B;  3AKB A;  2JWW A;  1K9U A;  4PE4 A;  1PVA A;  1YUS A;  2OTG B;  1PSR A;  2M9G A;  2WOR A;  1H4B A;  1Y1U A;  1OMR A;  2ZNE A;  1TOP A;  1NCZ A;  1ODB A;  1H8B A;  3PFV A;  2E6W A;  3SIA A;  3TUY C;  1DJX A;  2FOT A;  1YRT B;  2L98 A;  2P6B B;  3KPX A;  3FIA A;  3NXA A;  1A03 A;  2JQ6 A;  1QLS A;  1S1E A;  4ORA B;  3RM1 A;  1B9A A;  2NZ0 A;  1AJ5 A;  2BKI B;  1XFW O;  1L2O B;  2LVJ A;  3ZWH A;  1BU3 A;  1DJI A;  1OE9 B;  2F8P A;  4MRX A;  1EH2 A;  4P5O E;  1K96 A;  4ETO A;  1QAT A;  1DJZ A;  1CM4 A;  1QVI Z;  2L5X B;  3CGA A;  1FBV A;  3SG3 A;  2F33 A;  1W7I B;  1E8A A;  2KYC A;  1LA0 A;  3D0Y A;  1PSB A;  4BY5 A;  2LLS A;  2WCB A;  2ZFD A;  2LAN A;  4NDD A;  1B4C A;  4MLW A;  2L4I A;  2JXC A;  1CFC A;  4YGC B;  5JJG A;  2Y4Q A;  4JWQ A;  1DMO A;  1CMF A;  2DOQ A;  1QS7 A;  1M63 B;  2BE4 A;  2M7N A;  1QLK A;  2CXJ A;  1LXF C;  3I5G C;  1QV1 A;  5AEQ A;  2LLT A;  1QIV A;  2WND A;  1XFX O;  4UPG A;  1SCM B;  1SCV A;  4PE1 A;  5F6T A;  3LK1 A;  1KK8 C;  4OVN F;  4XYN A;  1BF5 A;  4OV2 A;  4PCW A;  2L0P A;  3DVK A;  4QJ5 B;  2KBM A;  2LMV A;  1OSA A;  4YGE B;  1CDL A;  4DRW A;  1AP4 A;  3SG2 A;  2G9B A;  1FI5 A;  1NYA A;  4YRU A;  4GPL B;  1LVC D;  3BOW B;  5KTY A;  1SYM A;  1CKK A;  2MLE C;  1JF0 A;  5HLV A;  1V1G A;  1G4Y R;  2BCA A;  2PAL A;  4GGF C;  4GGN A;  4MZJ A;  4PHK A;  1YUT A;  4YBH B;  1QX7 A;  1SR6 C;  2H61 C;  3FWB A;  1WRL A;  2KFF A;  1MF8 B;  3CWG A;  2WCF A;  2ZKM X;  2K61 A;  4HSZ A;  2BBM A;  1YVL A;  1BOD A;  4NDB A;  2Y1M A;  1J7R A;  1G8I A;  5B8I B;  2KFG A;  3O2P A;  3VRN A;  1WLM A;  1JFJ A;  1XFU O;  2GGZ A;  3BUM B;  4I5L B;  4DCK A;  2ZRT A;  5CSF A;  3CLN A;  1J55 A;  5KU1 A;  3OP0 A;  2E30 A;  5CSN A;  3EVR A;  1ALW A;  4TNC A;  1M46 A;  2LVI A;  4GBA A;  4N1F A;  1BG1 A;  1Y0V H;  1UHK A;  2LMU A;  2MRD A;  2SCP A;  2Q91 A;  3MSE B;  4U8D A;  1D1O A;  2I94 A;  1CDM A;  1PVB A;  1MHO A;  3GK2 A;  2BBN A;  3I5I C;  1TCF A;  3SJS A;  1CLM A;  2MLF C;  3O78 A;  1MWN A;  1EJ3 A;  1S26 D;  1OMV A;  2KAX A;  3TUY B;  4FQO A;  3CR2 A;  1FPW A;  1XA5 A;  1XFV O;  2PAS A;  3KO0 A;  4PHN A;  4GNK B;  1FI6 A;  1AJ4 A;  2LCP A;  1K8U A;  1SK6 D;  1UUR A;  2K7O A;  2MJW B;  3AAJ A;  5D69 A;  3SG7 A;  1K93 D;  2I18 A;  3WHT B;  5DKR A;  2COL B;  1GQM A;  1DT7 B;  1M39 A;  1B8C A;  2LP2 A;  2ZRS A;  3OB2 B;  2LP3 A;  5D7F A;  1SL9 A;  1AHR A;  1WLZ A;  2F3Y A;  3PN7 B;  3D10 A;  1NX2 A;  2F3Z A;  2TN4 A;  1EL4 A;  4MEW A;  4CFQ A;  4PAL A;  5DKQ A;  1YR5 A;  3AKA A;  1WDC C;  4A4C A;  2KI6 D;  4WQ2 A;  2M49 B;  1ZFS A;  3TDI A;  5HKW A;  1GGW A;  2RGI A;  1B8R A;  1NP8 A;  2LV7 A;  2PMY A;  2R2I A;  5AXI A;  5GQQ C;  1TCO B;  2KI4 C;  1EXR A;  1KQM B;  3BUN B;  1NX1 A;  3EKH A;  4MZL A;  3WXA A;  1TNQ A;  2KYF A;  2JU0 A;  2EC6 C;  3I5G B;  4YGD B;  3HX4 A;  4I5J A;  3M0W A;  1TTX A;  2JNX A;  1BR1 B;  3AAK A;  4MN0 A;  2K7C A;  2F2O A;  1B1G A;  4CPV A;  2JT0 A;  1M31 A;  3PAT A;  1S5G Y;  2BCX A;  1A29 A;  3I5F B;  2EHB A;  3BXK A;  4JPZ B;  1AK8 A;  1J7Q A;  1CFP A;  2B1U A;  3I5H B;  5FYX A;  4C0K A;  3KF9 A;  1J7P A;  2Y5I A;  2HET A;  2L50 A;  3LLE A;  1MR8 A;  1IJ5 A;  2F2P A;  1CFF A;  3TDU A;  2MA2 A;  2LMT A;  2G2B A;  2M1K B;  5HKZ A;  1CLL A;  5TNC A;  1L7Z A;  2LUC A;  1ZMZ A;  3GK4 X;  1NX3 A;  5ER5 A;  3VRQ A;  1SR6 B;  1NIW A;  1YVH A;  2HQW A;  2GGM A;  2I2R E;  2PVB A;  1JUO A;  2PSR A;  2LHI A;  1BOC A;  1Y1A A;  2FJU B;  4M2P A;  1OMD A;  1F55 A;  3JVT B;  2KGR A;  2AMI A;  3TDZ A;  4WRI A;  1KK7 Z;  1DTL A;  3SIB A;  5J3X A;  1KCY A;  5JOL A;  2JTZ A;  5PAL A;  1FW4 A;  2MAZ A;  1S36 A;  3GK1 A;  5G08 A;  1BLQ A;  2CCM A;  1BT6 A;  1U5I B;  4HRG A; 
#chains in the Genus database with same CATH topology
 1QX5 B;  2JPO A;  3TZ1 A;  1F8H A;  1GM0 A;  1R6P A;  2WCE A;  1NWD A;  3KEV A;  1SKT A;  2KAY A;  4PDZ A;  3PJI A;  1YRU B;  2KDH A;  3C1V A;  1DGU A;  3FE6 A;  1JSA A;  3LCP C;  1GJY A;  1IG5 A;  2H2K A;  2JUL A;  3OB1 B;  1IRJ A;  1DGV A;  1L2O C;  1ORG A;  1RWY A;  1SRA A;  2CT9 A;  2KSP A;  2L2C A;  2H8V A;  3EK4 A;  1OQP A;  2VRG A;  4USL A;  1B7T Z;  1IH0 A;  2ISD A;  1ZUZ A;  1NX0 A;  1DC1 A;  1QJT A;  4DS7 A;  1A75 B;  3D0Y B;  1JBA A;  1B8L A;  3DXL A;  3OX6 A;  3DVJ A;  1QVI Y;  1V1F A;  4IJ7 A;  1QX2 A;  1JC2 A;  1KFU S;  1UHH A;  4OCI A;  3JTD B;  1GGZ A;  3DZT A;  4GAO A;  4P2Y B;  1KFX S;  1CNP A;  2M8U A;  2WCH A;  4XJK A;  5FI2 A;  1NCX A;  1X02 A;  1OOG A;  2QEV A;  2I7A A;  3CZ0 A;  4BY4 A;  1TNW A;  1YX8 A;  2BE6 A;  2MHH A;  1DJW A;  4ZCV A;  4WQ3 A;  1MXE A;  2KI4 B;  2OPO A;  3DF0 B;  3R1V A;  3LK0 A;  2BL0 C;  1S6J A;  1SL7 A;  3NHI A;  1Z4H A;  4AQJ A;  1RTP 1;  3R1O A;  5I2Q A;  1OZS A;  4GUK A;  1XFZ O;  5BPJ A;  2EC6 B;  4PE7 A;  2WOS A;  1ALV A;  3K21 A;  2JT8 A;  1OZO A;  3TS5 C;  1B47 A;  2ZN8 A;  3O4Y A;  2LLU A;  2WC8 A;  1C3Y A;  4HRE E;  1CB1 A;  1K9P A;  3PM8 A;  1CFD A;  1SCM C;  2K8M B;  2QAC A;  1BJF A;  4F0Z B;  1UUS A;  1RK9 A;  3A8R A;  3CS1 A;  2CBL A;  2GTE A;  2K0J A;  2JRF A;  2JPT A;  2KGB C;  2LVK A;  3IF7 A;  4N5X A;  1HQV A;  1SW8 A;  1LA3 A;  1TIZ A;  5I94 A;  2P71 A;  2KAV A;  1HT9 A;  2NCO A;  2QPT A;  4L9M A;  2LVV A;  1KWO C;  1R2U A;  1J1D A;  5I2O A;  2JOJ A;  3CZ1 A;  3EVV A;  1UWO A;  3BJH A;  1TN4 A;  3QME A;  2NXQ A;  2QEH A;  2KLE A;  3ICB A;  4N1G A;  2LAP A;  4ORB B;  2KQY A;  1QTX A;  1XO5 A;  3L47 A;  3CZT X;  3DVM A;  1K90 D;  3OX5 A;  3S0A A;  1JFK A;  1F70 A;  4QJ4 B;  1KFX L;  2IS9 A;  1DJY A;  2NCP A;  1XK4 A;  4IL1 A;  1CTR A;  1IQ5 A;  1A2X A;  2LM5 A;  1N2D A;  4I5N B;  3CAB A;  3PAL A;  4GFT A;  5CPV A;  2LNK A;  3FWC A;  1N65 A;  3KHE A;  1TRF A;  4DIR A;  3L4L A;  3DD4 A;  1YUR A;  3SG6 A;  5I8N A;  4JQ0 D;  1KK8 B;  1K95 A;  4YGB B;  4QJ3 B;  1UHN A;  1DF0 B;  1CMG A;  4E68 A;  4MRY A;  1ZAC A;  1XVJ A;  3BQ3 A;  1K9K A;  1W7J B;  2BKH B;  1F54 A;  3UO9 A;  3BYA A;  1OOJ A;  1QXP A;  5CSI A;  1U5I A;  5AER A;  1SY9 A;  2K7D A;  1PAL A;  4PHM A;  1AUI B;  1S6I A;  3SG5 A;  2JNF A;  5DKN A;  3EK8 A;  2KI6 C;  1RFJ A;  4NDC A;  1MUX A;  4YI9 A;  4MBE A;  4HRH A;  5AFP A;  1S3P A;  2BEC A;  4INW A;  2M7L A;  5KSZ A;  3SS4 A;  1M45 A;  4R1E A;  3BOW A;  2KNE A;  3EVU A;  3QRX A;  3BUX B;  1KSO A;  3OHM B;  2K2A A;  4PE0 A;  2KFH A;  4AOM A;  1XYD A;  2HQ8 A;  1UHJ A;  3B86 A;  4MVF A;  2JC2 A;  3BUO B;  4PHJ A;  4JKT A;  3CR5 X;  3VGO A;  1SNL A;  3PN7 C;  3H4S E;  1S6C A;  2M97 A;  4CLN A;  2M0R A;  1KQV A;  2EGD A;  3NSL A;  1F4O A;  1A75 A;  2M29 A;  1SPY A;  3NSK A;  5IBW A;  2LC5 A;  4JD9 A;  3F45 A;  5CSJ A;  5DIC A;  5HLO A;  1K2H A;  3D76 A;  3NSO A;  1WRZ A;  1LKJ A;  2Y1N A;  2OS8 C;  3Q8I A;  4CFR A;  1PUL A;  1IJ6 A;  3OBV A;  3GOF A;  2BL0 B;  2L51 A;  1F4Q A;  2OTG C;  3A4U B;  3EKJ A;  3I5I B;  4DUQ A;  3IQO A;  1NUB A;  1KQM C;  2L4H A;  2GV5 A;  2HF5 A;  5K89 A;  4FTG A;  3N7H A;  1XFY O;  2A4J A;  1BR4 B;  2SAS A;  2KHN A;  2Q4U A;  3DF0 A;  2JXL A;  1J7O A;  1TNX A;  3HCM A;  3TS5 B;  1A4P A;  1RJV A;  3WHU B;  3RLZ A;  1CDN A;  5I2L A;  5EL2 A;  3OGN A;  1UP5 A;  2FCE A;  1J1E A;  3I5F C;  1F71 A;  1QAS A;  1IKU A;  1JF2 A;  2CNP A;  3I5H C;  1OOH A;  1VRK A;  1K94 A;  3EK7 A;  4ZCU A;  1EG4 A;  4Q04 A;  2O60 A;  2LUX A;  3DVE A;  4ORC B;  4AQI A;  1IIO A;  1WDC B;  2LHL A;  4OR9 B;  5AAN A;  2MBX A;  1CM1 A;  1KWO B;  4C0L A;  1YTZ C;  1LS8 A;  3R72 A;  4MSP A;  1IQ3 A;  1RRO A;  1Q80 A;  4OKH A;  3B6X A;  2K2F A;  3BFB A;  1NSH A;  3IQQ A;  2KBI A;  2KPH A;  1Y1X A;  4YI8 A;  1XK4 C;  1C7W A;  3S0F A;  2M1U A;  5D3O A;  2WCL A;  5HKY A;  1OOI X;  3E3R A;  2V53 A;  3JVT C;  1TUZ A;  1G33 A;  2JTT A;  1ZOT B;  1C7V A;  1MXL C;  1TUJ A;  1KK7 Y;  1UHI A;  3PLF B;  4C0J A;  4NQG A;  2ERB A;  2ZN9 A;  2K7B A;  2AUC A;  1LIN A;  1OOF A;  3CTN A;  4I5K A;  3WNX B;  1QIW A;  3D73 A;  1AVS A;  1SBJ A;  1FF1 A;  1S5G Z;  3CZ2 A;  3NSI A;  1WY9 A;  1MQ1 A;  2O5G A;  2HPS A;  1XFR A;  1IGV A;  2KOT A;  2KQ6 A;  1BMO A;  1DJG A;  3FS7 A;  4A4B A;  2BCB A;  2FJY A;  3BUW B;  1DF0 A;  1Y6W A;  4YGA A;  3VRR A;  1CDP A;  5ER4 X;  3LL8 B;  3CR4 X;  2BAP A;  2PRU A;  4M2O A;  1REC A;  1EG3 A;  3SG4 A;  1NCY A;  1PRW A;  1SL8 A;  2FCD A;  4M2Q A;  2PYQ A;  1IWQ A;  3ZNI A;  3R1P A;  2LE9 B;  4GGF A;  1JWD A;  2ZND A;  4D1E A;  1KFU L;  1C07 A;  5HYD A;  2H61 A;  3CYZ A;  1CLB A;  3O6B A;  1YX7 A;  3B88 A;  1DJH A;  2L2E A;  1B7T Y;  1YUU A;  3DYE A;  3VRP A;  1TNP A;  1W9Z A;  2M3W A;  2CTN A;  4XJK B;  2AAO A;  2D8N A;  2JZI A;  1DVI A;  3VRO A;  2JT3 A;  3BFH A;  1N0Y A;  4ICB A;  3PSR A;  1SMG A;  1WRK A;  2P70 A;  3SS5 A;  1NPQ A;  1QV0 A;  1KSM A;  2BNX A;  3JTD C;  1TWO A;  4MZK A;  4CID A;  1PK0 D;  2NLN A;  2OS8 B;  3AKB A;  2JWW A;  2YGU A;  3IVT A;  1K9U A;  4PE4 A;  1PVA A;  1YUS A;  2OTG B;  1PSR A;  2M9G A;  2WOR A;  1H4B A;  4F7F A;  1Y1U A;  1OMR A;  2ZNE A;  1TOP A;  1NCZ A;  1ODB A;  1H8B A;  3PFV A;  2E6W A;  3SIA A;  2WCK A;  3TUY C;  1DJX A;  2FOT A;  1YRT B;  2L98 A;  2P6B B;  3KPX A;  3FIA A;  3NXA A;  3B7A A;  1A03 A;  2JQ6 A;  1QLS A;  1S1E A;  4ORA B;  3RM1 A;  1B9A A;  2NZ0 A;  1AJ5 A;  1T14 A;  2BKI B;  1QWV A;  1XFW O;  1L2O B;  2LVJ A;  3B87 A;  2K60 A;  3S0E A;  3ZWH A;  1BU3 A;  1DJI A;  1OE9 B;  2F8P A;  4MRX A;  1EH2 A;  3L4A A;  4P5O E;  1K96 A;  3BFA A;  4ETO A;  1QAT A;  1DJZ A;  1CM4 A;  1QVI Z;  2L5X B;  3CGA A;  1FBV A;  3SG3 A;  2F33 A;  1W7I B;  5HL1 A;  1E8A A;  2KYC A;  1LA0 A;  3D0Y A;  1PSB A;  4BY5 A;  2LLS A;  2WCB A;  2ZFD A;  2LAN A;  4NDD A;  1B4C A;  4MLW A;  2L4I A;  2JXC A;  1J7Q A;  1CFC A;  2QEO A;  4YGC B;  2PQL A;  3FE8 A;  5JJG A;  2Y4Q A;  4JWQ A;  3V2L A;  1CMF A;  2DOQ A;  1DMO A;  1DEK A;  1QS7 A;  1M63 B;  2BE4 A;  2M7N A;  1QLK A;  2CXJ A;  1LXF C;  3I5G C;  1QV1 A;  5AEQ A;  2LLT A;  1QIV A;  2WND A;  1XFX O;  4UPG A;  1DEL A;  1SCM B;  2WCJ A;  1SCV A;  4PE1 A;  5F6T A;  3LK1 A;  1KK8 C;  4OVN F;  4XYN A;  1BF5 A;  4OV2 A;  4PCW A;  2L0P A;  3DVK A;  4QJ5 B;  2KBM A;  2LMV A;  1OSA A;  4YGE B;  1CDL A;  4DRW A;  1AP4 A;  3SG2 A;  2G9B A;  1FI5 A;  1NYA A;  3DY9 A;  4YRU A;  3CDN A;  3D78 A;  4GPL B;  1LVC D;  3BOW B;  5KTY A;  1SYM A;  1CKK A;  2MLE C;  4OZD A;  1JF0 A;  5HLV A;  1V1G A;  1G4Y R;  2BCA A;  2PAL A;  4GGF C;  4GGN A;  4MZJ A;  4PHK A;  1YUT A;  4YBH B;  1QX7 A;  1SR6 C;  2H61 C;  3FWB A;  1WRL A;  2KFF A;  1MF8 B;  3CWG A;  2WCF A;  2ZKM X;  2K61 A;  4HSZ A;  2BBM A;  1YVL A;  1BOD A;  4NDB A;  2Y1M A;  1J7R A;  1G8I A;  5B8I B;  3K1E A;  2KFG A;  3O2P A;  3VRN A;  1WLM A;  1JFJ A;  3S0B A;  1XFU O;  2GGZ A;  3BUM B;  4I5L B;  4DCK A;  2ZRT A;  5CSF A;  3CLN A;  1J55 A;  3RZS A;  3NHT A;  3OP0 A;  3PM2 A;  2E30 A;  5CSN A;  3S0D A;  3EVR A;  1ALW A;  5KU1 A;  4TNC A;  1M46 A;  2LVI A;  4GBA A;  4N1F A;  1BG1 A;  1Y0V H;  1UHK A;  2LMU A;  2MRD A;  2SCP A;  1P28 A;  2Q91 A;  3MSE B;  4U8D A;  1D1O A;  2I94 A;  1CDM A;  1PVB A;  1MHO A;  3GK2 A;  2BBN A;  3I5I C;  1TCF A;  3SJS A;  1CLM A;  2MLF C;  3O78 A;  1MWN A;  1EJ3 A;  1S26 D;  1OMV A;  2KAX A;  4PT1 A;  4FQO A;  3TUY B;  3CR2 A;  1FPW A;  1XA5 A;  1XFV O;  2PAS A;  3KO0 A;  4PHN A;  4GNK B;  1FI6 A;  1AJ4 A;  3O4X A;  3D77 A;  2LCP A;  1K8U A;  1SK6 D;  1UUR A;  2K7O A;  2MJW B;  2WC5 A;  3AAJ A;  2KLD A;  5D69 A;  1K93 D;  2I18 A;  3SG7 A;  3WHT B;  5DKR A;  2COL B;  1GQM A;  1DT7 B;  1M39 A;  1B8C A;  2LP2 A;  2ZRS A;  3OB2 B;  4FQT A;  2LP3 A;  2QDI A;  5D7F A;  1SL9 A;  1WLZ A;  1AHR A;  2F3Y A;  3PN7 B;  3D10 A;  1NX2 A;  2F3Z A;  2TN4 A;  1EL4 A;  4MEW A;  3S0G A;  4CFQ A;  4PAL A;  5DKQ A;  1YR5 A;  4INX A;  3AKA A;  1WDC C;  4A4C A;  2KI6 D;  4WQ2 A;  2M49 B;  3UNW A;  1ZFS A;  3TDI A;  5HKW A;  1GGW A;  2WCM A;  2RGI A;  1B8R A;  1NP8 A;  3D75 A;  2LV7 A;  2PMY A;  2R2I A;  5AXI A;  5GQQ C;  1TCO B;  2KI4 C;  1EXR A;  3VB1 A;  1KQM B;  3BUN B;  1NX1 A;  3EKH A;  3EG5 B;  1SSE B;  4MZL A;  3WXA A;  1TNQ A;  1Z2C B;  2KYF A;  2JU0 A;  2EC6 C;  3I5G B;  4YGD B;  3HX4 A;  4I5J A;  3M0W A;  1TTX A;  2JNX A;  1BR1 B;  1DQE A;  3AAK A;  3NGV A;  4MN0 A;  2K7C A;  2F2O A;  1B1G A;  4CPV A;  2QEB A;  2JT0 A;  1M31 A;  3PAT A;  1S5G Y;  1A29 A;  2BCX A;  3I5F B;  2EHB A;  3BXK A;  4JPZ B;  3D74 A;  1AK8 A;  1CFP A;  2B1U A;  3I5H B;  5FYX A;  4C0K A;  3KF9 A;  1J7P A;  2Y5I A;  2HET A;  3SS3 A;  2L50 A;  3LLE A;  5FI6 A;  1MR8 A;  1IJ5 A;  2WC6 A;  2L5Y A;  4KYN A;  2F2P A;  1CFF A;  3TDU A;  2MA2 A;  2LMT A;  2G2B A;  3FE9 A;  2M1K B;  5HKZ A;  1CLL A;  5TNC A;  1L7Z A;  2LUC A;  1OW4 A;  1ZMZ A;  3GK4 X;  1NX3 A;  5ER5 A;  3VRQ A;  1SR6 B;  1NIW A;  1YVH A;  2HQW A;  2GGM A;  2I2R E;  2PVB A;  1JUO A;  2PSR A;  2LHI A;  1BOC A;  1Y1A A;  2FJU B;  4M2P A;  1OMD A;  1F55 A;  3JVT B;  2KGR A;  2AMI A;  3TDZ A;  4WRI A;  1KK7 Z;  1DTL A;  3SIB A;  5J3X A;  1C3Z A;  5JOL A;  1KCY A;  2JTZ A;  5PAL A;  1FW4 A;  2MAZ A;  1S36 A;  5FI7 A;  3GK1 A;  5G08 A;  1BLQ A;  2CCM A;  1BT6 A;  1U5I B;  4HRG A; 
#chains in the Genus database with same CATH homology
 1QX5 B;  1F8H A;  3TZ1 A;  1R6P A;  2WCE A;  1NWD A;  3KEV A;  1SKT A;  2KAY A;  4PDZ A;  1YRU B;  2KDH A;  3C1V A;  1DGU A;  1JSA A;  3LCP C;  1GJY A;  1IG5 A;  2H2K A;  2JUL A;  3OB1 B;  1IRJ A;  1DGV A;  1L2O C;  2CT9 A;  1RWY A;  1SRA A;  2KSP A;  3EK4 A;  1OQP A;  2VRG A;  4USL A;  1B7T Z;  1IH0 A;  2ISD A;  1ZUZ A;  1NX0 A;  1QJT A;  4DS7 A;  1A75 B;  3D0Y B;  1JBA A;  1B8L A;  3OX6 A;  3DVJ A;  1QVI Y;  1V1F A;  1QX2 A;  1JC2 A;  1KFU S;  1UHH A;  4OCI A;  3JTD B;  1GGZ A;  4GAO A;  4P2Y B;  1KFX S;  1CNP A;  2M8U A;  4XJK A;  1NCX A;  1X02 A;  2I7A A;  4BY4 A;  1TNW A;  1YX8 A;  2BE6 A;  2MHH A;  1DJW A;  4ZCV A;  4WQ3 A;  1MXE A;  2KI4 B;  2OPO A;  3DF0 B;  3LK0 A;  2BL0 C;  1S6J A;  1SL7 A;  4AQJ A;  1RTP 1;  5I2Q A;  1OZS A;  4GUK A;  1XFZ O;  5BPJ A;  2EC6 B;  4PE7 A;  2WOS A;  1ALV A;  3K21 A;  2JT8 A;  1OZO A;  3TS5 C;  1B47 A;  2ZN8 A;  3O4Y A;  2LLU A;  2WC8 A;  1CB1 A;  4HRE E;  1K9P A;  3PM8 A;  1CFD A;  1SCM C;  2K8M B;  2QAC A;  1BJF A;  4F0Z B;  1UUS A;  1RK9 A;  3A8R A;  3CS1 A;  2CBL A;  2K0J A;  2JRF A;  2JPT A;  2KGB C;  2LVK A;  3IF7 A;  4N5X A;  1HQV A;  1SW8 A;  1LA3 A;  1TIZ A;  2QPT A;  2KAV A;  1HT9 A;  2NCO A;  4L9M A;  2LVV A;  1KWO C;  1R2U A;  1J1D A;  5I2O A;  2JOJ A;  3EVV A;  1UWO A;  4ORB B;  1TN4 A;  2M7L A;  2NXQ A;  3ICB A;  4N1G A;  2LAP A;  2KQY A;  1QTX A;  1XO5 A;  3CZT X;  3DVM A;  1K90 D;  3OX5 A;  1JFK A;  1F70 A;  4QJ4 B;  1KFX L;  2IS9 A;  1DJY A;  2NCP A;  1XK4 A;  4IL1 A;  1CTR A;  1IQ5 A;  1A2X A;  2LM5 A;  1N2D A;  4I5N B;  3PAL A;  4GFT A;  5CPV A;  2LNK A;  3FWC A;  1N65 A;  3KHE A;  1TRF A;  4DIR A;  3DD4 A;  1YUR A;  3SG6 A;  5I8N A;  4JQ0 D;  1KK8 B;  1K95 A;  4YGB B;  4QJ3 B;  1UHN A;  1DF0 B;  1CMG A;  4E68 A;  4MRY A;  1ZAC A;  1XVJ A;  3BQ3 A;  1K9K A;  1W7J B;  2BKH B;  1F54 A;  3BYA A;  1OOJ A;  1QXP A;  5CSI A;  1U5I A;  5AER A;  1SY9 A;  2K7D A;  1PAL A;  4PHM A;  1AUI B;  1S6I A;  3SG5 A;  2JNF A;  5DKN A;  3EK8 A;  2KI6 C;  1RFJ A;  4NDC A;  1MUX A;  4YI9 A;  4MBE A;  4HRH A;  5AFP A;  1S3P A;  2BEC A;  5KSZ A;  1M45 A;  4R1E A;  3BOW A;  2KNE A;  3EVU A;  3QRX A;  3BUX B;  1KSO A;  3OHM B;  2K2A A;  4PE0 A;  2KFH A;  4AOM A;  1XYD A;  2HQ8 A;  1UHJ A;  4MVF A;  2JC2 A;  3BUO B;  4PHJ A;  3CR5 X;  3VGO A;  1SNL A;  3PN7 C;  3H4S E;  1S6C A;  2M97 A;  4CLN A;  2M0R A;  1KQV A;  2EGD A;  3NSL A;  1F4O A;  1A75 A;  2M29 A;  1SPY A;  3NSK A;  5IBW A;  2LC5 A;  3F45 A;  5CSJ A;  5HLO A;  1K2H A;  3NSO A;  1WRZ A;  1LKJ A;  2Y1N A;  2OS8 C;  4CFR A;  1PUL A;  1IJ6 A;  3GOF A;  2BL0 B;  2L51 A;  1F4Q A;  2OTG C;  3A4U B;  3EKJ A;  3I5I B;  4DUQ A;  3IQO A;  1NUB A;  1KQM C;  2L4H A;  2GV5 A;  2HF5 A;  5K89 A;  4FTG A;  1XFY O;  2A4J A;  1BR4 B;  2SAS A;  2KHN A;  2Q4U A;  3DF0 A;  2JXL A;  1J7O A;  1TNX A;  3HCM A;  3TS5 B;  1A4P A;  1RJV A;  3WHU B;  3RLZ A;  1CDN A;  5I2L A;  1UP5 A;  2FCE A;  1J1E A;  3I5F C;  1F71 A;  1QAS A;  1IKU A;  1JF2 A;  2CNP A;  3I5H C;  1VRK A;  1K94 A;  3EK7 A;  4ZCU A;  1EG4 A;  4Q04 A;  2O60 A;  2LUX A;  3DVE A;  4ORC B;  4AQI A;  1WDC B;  2LHL A;  4OR9 B;  5AAN A;  2MBX A;  1CM1 A;  1KWO B;  4C0L A;  1YTZ C;  1IQ3 A;  4MSP A;  1RRO A;  1Q80 A;  4OKH A;  4YI8 A;  2K2F A;  1NSH A;  3IQQ A;  2KBI A;  1Y1X A;  1XK4 C;  1C7W A;  2M1U A;  5HKY A;  3E3R A;  2V53 A;  3JVT C;  1G33 A;  2JTT A;  1ZOT B;  1C7V A;  1MXL C;  1KK7 Y;  1UHI A;  3PLF B;  4C0J A;  4NQG A;  2ZN9 A;  2K7B A;  2AUC A;  1LIN A;  3CTN A;  4I5K A;  3WNX B;  1QIW A;  1AVS A;  1SBJ A;  1FF1 A;  1S5G Z;  3NSI A;  1WY9 A;  1MQ1 A;  2O5G A;  2HPS A;  1IGV A;  2KOT A;  2KQ6 A;  1BMO A;  1DJG A;  3FS7 A;  4A4B A;  2BCB A;  3BUW B;  1DF0 A;  1Y6W A;  4YGA A;  3VRR A;  1CDP A;  5ER4 X;  3LL8 B;  3CR4 X;  2PRU A;  4M2O A;  1REC A;  1EG3 A;  3SG4 A;  1NCY A;  1PRW A;  1SL8 A;  2FCD A;  4M2Q A;  3ZNI A;  1IWQ A;  2LE9 B;  4GGF A;  1JWD A;  2ZND A;  4D1E A;  1KFU L;  1C07 A;  5HYD A;  2H61 A;  1CLB A;  3O6B A;  1YX7 A;  1DJH A;  2L2E A;  1B7T Y;  1YUU A;  3VRP A;  1TNP A;  2M3W A;  2CTN A;  4XJK B;  2AAO A;  2D8N A;  2JZI A;  1DVI A;  3VRO A;  2JT3 A;  1N0Y A;  4ICB A;  3PSR A;  1SMG A;  1WRK A;  1NPQ A;  1QV0 A;  1KSM A;  3JTD C;  4MZK A;  4CID A;  1PK0 D;  2NLN A;  2OS8 B;  3AKB A;  2JWW A;  1K9U A;  4PE4 A;  1PVA A;  1YUS A;  2OTG B;  1PSR A;  2M9G A;  2WOR A;  1H4B A;  1Y1U A;  1OMR A;  2ZNE A;  1TOP A;  1NCZ A;  1ODB A;  1H8B A;  3PFV A;  2E6W A;  3SIA A;  3TUY C;  1DJX A;  2FOT A;  1YRT B;  2L98 A;  2P6B B;  3KPX A;  3FIA A;  3NXA A;  1A03 A;  2JQ6 A;  1QLS A;  1S1E A;  4ORA B;  3RM1 A;  1B9A A;  2NZ0 A;  1AJ5 A;  2BKI B;  1XFW O;  1L2O B;  2LVJ A;  3ZWH A;  1BU3 A;  1DJI A;  1OE9 B;  2F8P A;  4MRX A;  1EH2 A;  4P5O E;  1K96 A;  4ETO A;  1QAT A;  1DJZ A;  1CM4 A;  1QVI Z;  2L5X B;  3CGA A;  1FBV A;  3SG3 A;  2F33 A;  1W7I B;  1E8A A;  2KYC A;  1LA0 A;  3D0Y A;  1PSB A;  4BY5 A;  2LLS A;  2WCB A;  2ZFD A;  2LAN A;  4NDD A;  1B4C A;  4MLW A;  2L4I A;  2JXC A;  1CFC A;  4YGC B;  5JJG A;  2Y4Q A;  4JWQ A;  1DMO A;  1CMF A;  2DOQ A;  1QS7 A;  1M63 B;  2BE4 A;  2M7N A;  1QLK A;  2CXJ A;  1LXF C;  3I5G C;  1QV1 A;  5AEQ A;  2LLT A;  1QIV A;  2WND A;  1XFX O;  4UPG A;  1SCM B;  1SCV A;  4PE1 A;  5F6T A;  3LK1 A;  1KK8 C;  4OVN F;  4XYN A;  1BF5 A;  4OV2 A;  4PCW A;  2L0P A;  3DVK A;  4QJ5 B;  2KBM A;  2LMV A;  1OSA A;  4YGE B;  1CDL A;  4DRW A;  1AP4 A;  3SG2 A;  2G9B A;  1FI5 A;  1NYA A;  4YRU A;  4GPL B;  1LVC D;  3BOW B;  5KTY A;  1SYM A;  1CKK A;  2MLE C;  1JF0 A;  5HLV A;  1V1G A;  1G4Y R;  2BCA A;  2PAL A;  4GGF C;  4GGN A;  4MZJ A;  4PHK A;  1YUT A;  4YBH B;  1QX7 A;  1SR6 C;  2H61 C;  3FWB A;  1WRL A;  2KFF A;  1MF8 B;  3CWG A;  2WCF A;  2ZKM X;  2K61 A;  4HSZ A;  2BBM A;  1YVL A;  1BOD A;  4NDB A;  2Y1M A;  1J7R A;  1G8I A;  5B8I B;  2KFG A;  3O2P A;  3VRN A;  1WLM A;  1JFJ A;  1XFU O;  2GGZ A;  3BUM B;  4I5L B;  4DCK A;  2ZRT A;  5CSF A;  3CLN A;  1J55 A;  5KU1 A;  3OP0 A;  2E30 A;  5CSN A;  3EVR A;  1ALW A;  4TNC A;  1M46 A;  2LVI A;  4GBA A;  4N1F A;  1BG1 A;  1Y0V H;  1UHK A;  2LMU A;  2MRD A;  2SCP A;  2Q91 A;  3MSE B;  4U8D A;  1D1O A;  2I94 A;  1CDM A;  1PVB A;  1MHO A;  3GK2 A;  2BBN A;  3I5I C;  1TCF A;  3SJS A;  1CLM A;  2MLF C;  3O78 A;  1MWN A;  1EJ3 A;  1S26 D;  1OMV A;  2KAX A;  3TUY B;  4FQO A;  3CR2 A;  1FPW A;  1XA5 A;  1XFV O;  2PAS A;  3KO0 A;  4PHN A;  4GNK B;  1FI6 A;  1AJ4 A;  2LCP A;  1K8U A;  1SK6 D;  1UUR A;  2K7O A;  2MJW B;  3AAJ A;  5D69 A;  3SG7 A;  1K93 D;  2I18 A;  3WHT B;  5DKR A;  2COL B;  1GQM A;  1DT7 B;  1M39 A;  1B8C A;  2LP2 A;  2ZRS A;  3OB2 B;  2LP3 A;  5D7F A;  1SL9 A;  1AHR A;  1WLZ A;  2F3Y A;  3PN7 B;  3D10 A;  1NX2 A;  2F3Z A;  2TN4 A;  1EL4 A;  4MEW A;  4CFQ A;  4PAL A;  5DKQ A;  1YR5 A;  3AKA A;  1WDC C;  4A4C A;  2KI6 D;  4WQ2 A;  2M49 B;  1ZFS A;  3TDI A;  5HKW A;  1GGW A;  2RGI A;  1B8R A;  1NP8 A;  2LV7 A;  2PMY A;  2R2I A;  5AXI A;  5GQQ C;  1TCO B;  2KI4 C;  1EXR A;  1KQM B;  3BUN B;  1NX1 A;  3EKH A;  4MZL A;  3WXA A;  1TNQ A;  2KYF A;  2JU0 A;  2EC6 C;  3I5G B;  4YGD B;  3HX4 A;  4I5J A;  3M0W A;  1TTX A;  2JNX A;  1BR1 B;  3AAK A;  4MN0 A;  2K7C A;  2F2O A;  1B1G A;  4CPV A;  2JT0 A;  1M31 A;  3PAT A;  1S5G Y;  2BCX A;  1A29 A;  3I5F B;  2EHB A;  3BXK A;  4JPZ B;  1AK8 A;  1J7Q A;  1CFP A;  2B1U A;  3I5H B;  5FYX A;  4C0K A;  3KF9 A;  1J7P A;  2Y5I A;  2HET A;  2L50 A;  3LLE A;  1MR8 A;  1IJ5 A;  2F2P A;  1CFF A;  3TDU A;  2MA2 A;  2LMT A;  2G2B A;  2M1K B;  5HKZ A;  1CLL A;  5TNC A;  1L7Z A;  2LUC A;  1ZMZ A;  3GK4 X;  1NX3 A;  5ER5 A;  3VRQ A;  1SR6 B;  1NIW A;  1YVH A;  2HQW A;  2GGM A;  2I2R E;  2PVB A;  1JUO A;  2PSR A;  2LHI A;  1BOC A;  1Y1A A;  2FJU B;  4M2P A;  1OMD A;  1F55 A;  3JVT B;  2KGR A;  2AMI A;  3TDZ A;  4WRI A;  1KK7 Z;  1DTL A;  3SIB A;  5J3X A;  1KCY A;  5JOL A;  2JTZ A;  5PAL A;  1FW4 A;  2MAZ A;  1S36 A;  3GK1 A;  5G08 A;  1BLQ A;  2CCM A;  1BT6 A;  1U5I B;  4HRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...