4N1FA

Crystal structure of f88y obelin mutant from obelia longissima at 2.09 angstrom resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
186
Chain Sequence
AVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQYLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Obelin
publication title Crystal structures of the F88Y obelin mutant before and after bioluminescence provide molecular insight into spectral tuning among hydromedusan photoproteins
pubmed doi rcsb
source organism Obelia longissima
total genus 72
structure length 186
sequence length 190
ec nomenclature
pdb deposition date 2013-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4n1fA00
1FI5A 3RLZA 1JWDA 1CFDA 1JBAA 1IG5A 2ZKMX 1RJVA 2M97A 2KI4B 1CDMA 1V1GA 1WDCB 3WNXB 1Y1XA 5F6TA 1JC2A 4PCWA 4ZCVA 2NCOA 1A2XA 1BT6A 1YRUB 1SYMA 1R2UA 2KSPA 2KGBC 4FTGA 2BL0B 1NWDA 3FWBA 4MRXA 4PE7A 4PE1A 4WRIA 2KBMA 3EVVA 2LP3A 1JFKA 2JULA 3NSKA 5JJGA 1UHHA 5AFPA 4GPLB 4MLWA 1UWOA 1RTP1 2KAVA 1NX3A 2FCEA 2I7AA 5FYXA 2KBIA 4GFTA 2PRUA 1JF0A 2VRGA 4TNCA 4U8DA 1SBJA 5HKZA 1NCYA 2M49B 3C1VA 2LVJA 1DGUA 1SMGA 1IQ5A 2SCPA 2JTTA 2JT8A 4BY5A 1NP8A 3EKHA 1F4OA 3TS5C 1XO5A 3WHTB 2L4IA 1SR6B 3SIAA 1LA3A 1JF2A 1IH0A 2L50A 4WQ2A 3EK8A 1VRKA 4DUQA 1YX7A 4MZLA 1OMVA 2JQ6A 1RFJA 5CPVA 2ISDA 2LE9B 1KFXL 1GGWA 5G08A 1TCOB 3VGOA 3DF0A 3FS7A 5CSFA 1SK6D 1U5IA 3LK1A 1QX2A 1QTXA 2BKHB 4MZJA 2LMTA 4HRGA 1MHOA 4BY4A 1DTLA 4M2QA 1MUXA 2K0JA 2K61A 3M0WA 1CLBA 1XFYO 1UP5A 3WXAA 2Q91A 5DKQA 2H2KA 1UURA 3DVKA 1OSAA 2KNEA 2LUCA 3BUXB 4GUKA 4XJKB 3KPXA 1J55A 2MLEC 3AAKA 1KQMB 4P5OE 3O78A 5HYDA 1CDPA 1QIVA 2JXCA 2LV7A 2PALA 3A8RA 2JT0A 1CMGA 1KFUS 2JPTA 1DJIA 1M45A 3AKAA 2LHIA 1H4BA 1XK4C 1OE9B 4PHNA 4PHMA 1QVIZ 1ZFSA 1A29A 1M46A 1NSHA 1WLZA 5I2OA 1J1DA 4AQJA 3D0YA 3RM1A 2NCPA 2KAYA 1S6CA 4QJ5B 3IF7A 1PSRA 1FBVA 3I5FB 1NX2A 1TN4A 2LVIA 1SCMB 2V53A 3SG2A 1J7PA 1AP4A 1EG3A 2LVVA 5KTYA 3CR5X 1WY9A 4XYNA 4ZCUA 2EC6C 1OMDA 1Y6WA 4ORAB 3TUYB 1C7WA 5PALA 2LUXA 1UHIA 1K96A 3NXAA 2K7CA 1IKUA 1XK4A 1B8LA 1LVCD 1TNPA 1CFPA 1IGVA 2CXJA 2LHLA 1PVBA 3PM8A 1DMOA 2F2PA 2JZIA 5HKYA 3PATA 3I5IC 2LLSA 3CGAA 3O6BA 2JXLA 2ZRSA 2NXQA 2OTGB 1F54A 1CLLA 1UUSA 4PHJA 3JVTC 2ZN8A 2G9BA 2BBMA 1SKTA 1F4QA 1YX8A 1FI6A 1SW8A 5GQQC 3BUMB 3TDUA 2GGMA 2P6BB 4DIRA 4M2PA 2KDHA 3CLNA 5AXIA 1TNWA 3K21A 5KU1A 4C0LA 1PSBA 4IL1A 2KI6D 2K7BA 3EVUA 1K94A 2F2OA 2KGRA 1A75B 2CCMA 2BKIB 1YVLA 1FPWA 3A4UB 2HQ8A 2OPOA 4MRYA 2E30A 1XFUO 5JOLA 1K2HA 2KFGA 2OS8B 2MBXA 1W7IB 4GAOA 2BECA 3EK4A 1QX7A 3OX6A 1YUTA 4MBEA 4AQIA 1BG1A 1ALVA 1WLMA 1NX0A 1L7ZA 5I2QA 1N65A 2WCBA 2PMYA 4OCIA 1CM4A 1GQMA 1DJGA 1S5GY 1F71A 1KSMA 1SCVA 1TRFA 1IWQA 1MF8B 1RECA 1CNPA 1AK8A 3VRPA 4PHKA 2MLFC 3GK1A 1JSAA 2CT9A 3EKJA 1XFZO 1BOCA 1QLKA 1B9AA 1BMOA 1LKJA 1SL7A 2KQYA 2I2RE 2CBLA 1XA5A 2K8MB 2L2EA 1SRAA 4E68A 2B1UA 2R2IA 3DD4A 4ETOA 5ER5A 3D10A 1YR5A 2BE6A 1BJFA 1Y0VH 1IQ3A 1WRKA 1DJZA 3PN7C 1G8IA 2ZN9A 1CDLA 2I94A 1QV1A 2WOSA 1QV0A 3DF0B 4GBAA 1ALWA 1U5IB 2WORA 3OB1B 3IQOA 1OQPA 2KYFA 1TCFA 1K9PA 1QXPA 3TS5B 1LINA 2M29A 4CPVA 4OV2A 2K2AA 2L51A 4CLNA 4YI9A 1JUOA 2FJUB 1B8RA 2CNPA 4JWQA 1M31A 2L4HA 3CS1A 3CWGA 5HKWA 1CKKA 1MQ1A 1J1EA 1EJ3A 5I8NA 3AAJA 1XYDA 2LM5A 2M7LA 4P2YB 1V1FA 1KK8C 4GGFC 5HLVA 1DJHA 3TDZA 4D1EA 1L2OC 2KQ6A 3SIBA 3MSEB 3F45A 1J7QA 1S5GZ 2HF5A 2GGZA 1AVSA 1UHJA 3NSIA 2QPTA 2ZFDA 3BUNB 4OR9B 3NSOA 3O2PA 1F70A 2I18A 3BXKA 1S1EA 1SL9A 2LANA 1K9UA 1K8UA 1NCXA 3I5HC 3E3RA 4OKHA 4PDZA 1B7TY 1C7VA 5K89A 3D0YB 4N1FA 3DVMA 1OMRA 1XFVO 4MVFA 4YGCB 2M9GA 2LMVA 2WCEA 2KHNA 4GGFA 1QATA 1NUBA 1RWYA 1BLQA 1K9KA 4YGAA 2COLB 3ZWHA 1SNLA 2KAXA 3WHUB 4YGDB 3I5GC 1DF0A 5J3XA 1N0YA 2ZNDA 4L9MA 4NDDA 4YI8A 1QIWA 1IJ5A 1N2DA 1CFCA 1LXFC 4XJKA 3TDIA 4NDBA 1DT7B 2PASA 3VRNA 4CFRA 3SG6A 3AKBA 2CTNA 3PLFB 1JFJA 4I5KA 1NPQA 2BBNA 3BOWB 3VROA 2LP2A 4C0KA 1PULA 1EH2A 2BE4A 4DS7A 2BCXA 1KCYA 2EC6B 1IJ6A 4ORBB 1YVHA 1K95A 2DOQA 3OP0A 1ZOTB 1AUIB 1QJTA 1J7RA 1M63B 1PRWA 3OX5A 1KWOC 4NQGA 3SG4A 1QS7A 2Y4QA 3LK0A 2H61C 1S3PA 3I5IB 5AANA 3KEVA 1G4YR 1KFXS 3JTDC 3JVTB 3PALA 4GNKB 2O5GA 2K7OA 2LVKA 2M7NA 3GK4X 1BR1B 2PVBA 1B7TZ 4PE0A 3KF9A 4USLA 3OB2B 1F8HA 1KSOA 2KOTA 1QASA 5ER4X 3BUOB 4HSZA 2A4JA 1KK7Y 2H61A 1OZSA 4NDCA 2LMUA 1Y1UA 3KO0A 1UHNA 3SJSA 2JRFA 1ZUZA 3VRQA 4QJ4B 4WQ3A 1XFWO 1PVAA 5TNCA 2F3YA 1NYAA 1TOPA 3O4YA 4PE4A 1RROA 1CTRA 2WNDA 2NLNA 4M2OA 3PSRA 4DCKA 1B1GA 4DRWA 1MXEA 1TIZA 2KI4C 3SG7A 2WCFA 5BPJA 1BODA 1WDCC 1LA0A 2MRDA 4MZKA 4A4CA 1KFUL 1GGZA 2KFFA 1A75A 1FW4A 2BL0C 1RK9A 2IS9A 4CIDA 3CR2A 1CLMA 2M8UA 1DVIA 1J7OA 3KHEA 2F3ZA 3GK2A 1MWNA 2JT3A 4ICBA 4C0JA 1ODBA 2BCBA 2MJWB 4FQOA 1S6IA 5AERA 1R6PA 5I2LA 5DKRA 3IQQA 2HETA 4N5XA 1YTZC 2F33A 3LL8B 5DKNA 2AUCA 1F55A 1BU3A 1SR6C 2WC8A 2LLUA 4CFQA 1H8BA 2M3WA 1D1OA 1QX5B 1CB1A 4MEWA 3PFVA 2AMIA 1QVIY 2GV5A 3PN7B 1SY9A 1S36A 1MXLC 5KSZA 1FF1A 1A4PA 3GOFA 1CFFA 2BCAA 3SG3A 1W7JB 1KK7Z 1TNQA 2M0RA 1G33A 2F8PA 2HQWA 1X02A 1BR4B 2LAPA 1M39A 5AEQA 4AOMA 1SL8A 2L5XB 3LCPC 1DGVA 2L0PA 2Q4UA 1B4CA 2LNKA 2SASA 1S26D 1YURA 1CMFA 2KI6C 1IRJA 2Y1MA 1K90D 3FWCA 1KK8B 5B8IB 1NX1A 1UHKA 2Y5IA 3H4SE 1KQVA 2TN4A 1TNXA 2LCPA 1L2OB 1KQMC 1PK0D 2JWWA 3SG5A 3TZ1A 3VRRA 1AHRA 1AJ4A 1EG4A 1Y1AA 3EK7A 4I5LB 1NCZA 1DF0B 2MAZA 1OZOA 5CSIA 1GJYA 2JU0A 4A4BA 2L98A 2LC5A 4JQ0D 4F0ZB 3CTNA 3HCMA 3I5HB 2AAOA 3DVEA 1NIWA 3DVJA 4YBHB 2MHHA 1B47A 4MSPA 5D7FA 1WRZA 1A03A 4Q04A 4YRUA 3I5FC 4HREE 2EHBA 2E6WA 1SCMC 2D8NA 3QRXA 2M1KB 4PALA 1C07A 2FCDA 2JNFA 5CSNA 4YGEB 2JTZA 2EGDA 2K2FA 1WRLA 3I5GB 3TUYC 3ICBA 2G2BA 5D69A 1OOJA 3BUWB 2MA2A 1SPYA 5CSJA 3OHMB 1YUSA 1XFXO 2JC2A 1DJXA 1YRTB 1CDNA 3NSLA 2OTGC 2QACA 1ZMZA 4QJ3B 3BYAA 2ZNEA 2KYCA 4HRHA 1AJ5A 3HX4A 2JOJA 4JPZB 1HT9A 4I5JA 3BQ3A 4ORCB 2NZ0A 4MN0A 1HQVA 1EXRA 1ZACA 3ZNIA 4YGBB 1KWOB 1S6JA 1YUUA 1EL4A 3BOWA 1K93D 2K7DA 2KFHA 2M1UA 2O60A 1E8AA 2FOTA 1DJYA 1QLSA 1CM1A 3EVRA 3CZTX 3JTDB 1Q80A 3FIAA 3LLEA 4N1GA 1BF5A 4OVNF 2LLTA 4R1EA 4UPGA 1MR8A 1XVJA 1B8CA 1TTXA 2OS8C 2JNXA 4GGNA 5IBWA 2ZRTA 2PSRA 2Y1NA 3CR4X 2HPSA 2RGIA 5HLOA 1DJWA 4I5NB 1PALA
chains in the Genus database with same CATH superfamily
1FI5A 3OGNA 3RLZA 1JWDA 1CFDA 1JBAA 1IG5A 3R1OA 2ZKMX 2WCKA 1RJVA 2M97A 2KI4B 1CDMA 1V1GA 1WDCB 3WNXB 1Y1XA 5F6TA 1JC2A 4PCWA 4ZCVA 2NCOA 1A2XA 1BT6A 1YRUB 1SYMA 1R2UA 2KSPA 2KGBC 3NGVA 2BL0B 1NWDA 3FWBA 4FTGA 3B86A 4MRXA 4PE7A 2KBMA 3EVVA 4PE1A 2LP3A 1JFKA 2JULA 3NSKA 5JJGA 1UHHA 5AFPA 4GPLB 4MLWA 1UWOA 1RTP1 2KAVA 1NX3A 2FCEA 2I7AA 1LS8A 5FYXA 2KBIA 4GFTA 2PRUA 1JF0A 2VRGA 4TNCA 4U8DA 1Z2CB 3OBVA 1SBJA 1XFRA 5HKZA 1NCYA 3R72A 2M49B 3C1VA 3CABA 2LVJA 1DGUA 1SMGA 1IQ5A 2SCPA 2JTTA 2JT8A 1DQEA 1NP8A 3EKHA 4BY5A 1F4OA 3TS5C 1XO5A 3L4LA 3WHTB 2L4IA 1SR6B 3SIAA 1LA3A 1W9ZA 3CYZA 1JF2A 4INXA 1IH0A 2L50A 3RZSA 4WQ2A 3EK8A 1VRKA 4DUQA 1YX7A 4MZLA 1OMVA 2JQ6A 1RFJA 5CPVA 2ISDA 2LE9B 1KFXL 1GGWA 5G08A 2QEVA 3Q8IA 1TCOB 3VGOA 3DF0A 3D77A 3DY9A 3FS7A 5CSFA 1SK6D 1U5IA 3LK1A 1QX2A 1QTXA 2BKHB 3S0FA 2L2CA 4MZJA 2LMTA 4HRGA 5DICA 1MHOA 4BY4A 1DTLA 4M2QA 1MUXA 2K0JA 2K61A 3M0WA 1CLBA 1XFYO 2FJYA 1UP5A 3WXAA 2Q91A 5DKQA 2H2KA 2WCMA 1UURA 1Z4HA 3DVKA 1OSAA 2KNEA 2LUCA 3BUXB 4GUKA 4XJKB 3KPXA 1J55A 2MLEC 3AAKA 1KQMB 5HL1A 4P5OE 3O78A 5HYDA 1CDPA 1QIVA 2JXCA 2LV7A 2PALA 3A8RA 2JT0A 1CMGA 1KFUS 2JPTA 1DJIA 1M45A 3AKAA 2LHIA 1H4BA 1XK4C 1OE9B 4PHNA 4PHMA 1QVIZ 1ZFSA 1A29A 1M46A 1NSHA 1WLZA 5I2OA 1J1DA 4AQJA 3D0YA 3RM1A 2NCPA 2KAYA 1S6CA 4QJ5B 3IF7A 1PSRA 2WCHA 1FBVA 1IIOA 2QDIA 1NX2A 3I5FB 1TN4A 2LVIA 1SCMB 2V53A 3BFBA 3SG2A 1J7PA 1AP4A 1EG3A 2LVVA 5KTYA 3CR5X 1WY9A 4XYNA 4ZCUA 2EC6C 1OMDA 1Y6WA 4ORAB 3TUYB 1C7WA 5PALA 2LUXA 1UHIA 1K96A 3NXAA 2K7CA 1IKUA 1XK4A 1B8LA 1LVCD 1TNPA 1CFPA 1IGVA 2CXJA 2LHLA 1PVBA 1OOFA 3PM8A 2F2PA 2JZIA 3B87A 5HKYA 3PATA 3I5IC 1DMOA 2LLSA 3CGAA 3O6BA 2JXLA 2ZRSA 2NXQA 2OTGB 1F54A 1CLLA 1UUSA 4PHJA 3JVTC 2ZN8A 2G9BA 1ORGA 2BBMA 1SKTA 1F4QA 1YX8A 1FI6A 1SW8A 5GQQC 3BUMB 3TDUA 2GGMA 4WRIA 2P6BB 4OZDA 4DIRA 4M2PA 2KDHA 3CLNA 5AXIA 1TNWA 3K21A 5KU1A 4C0LA 3DZTA 1PSBA 4IL1A 2KI6D 3B7AA 2K7BA 3EVUA 1K94A 2F2OA 2KGRA 1A75B 2CCMA 1OOGA 3S0BA 2BKIB 1YVLA 1FPWA 3A4UB 2HQ8A 2OPOA 4MRYA 2WC5A 2E30A 1XFUO 5JOLA 1K2HA 2KFGA 2OS8B 2MBXA 2QEOA 1W7IB 3BFAA 4GAOA 2BECA 3EK4A 1QX7A 3S0GA 3OX6A 3R1PA 1YUTA 4MBEA 4AQIA 1BG1A 1ALVA 1WLMA 2KPHA 3L47A 1NX0A 1L7ZA 5I2QA 1N65A 2WCBA 2PMYA 4OCIA 1CM4A 1GQMA 1DC1A 1DJGA 1S5GY 1F71A 3EG5B 1KSMA 1SCVA 1TRFA 1IWQA 1MF8B 1RECA 1CNPA 1AK8A 3VRPA 4PHKA 2MLFC 3GK1A 1JSAA 3O4XA 2CT9A 3EKJA 3CDNA 1XFZO 1BOCA 4FQTA 1QLKA 1B9AA 1BMOA 1LKJA 1SL7A 2KQYA 2I2RE 2CBLA 1XA5A 2K8MB 2L2EA 1SRAA 4E68A 2B1UA 2R2IA 3DD4A 3DYEA 4ETOA 5ER5A 3D10A 1YR5A 2BE6A 1BJFA 1Y0VH 5EL2A 1IQ3A 1WRKA 1DJZA 3PN7C 1G8IA 1OW4A 2ZN9A 1CDLA 2I94A 1QV1A 2WOSA 1QV0A 3DF0B 4KYNA 4GBAA 1ALWA 1U5IB 2WORA 3OB1B 3IQOA 1OQPA 1T14A 2KYFA 1TCFA 1K9PA 1QXPA 3TS5B 1LINA 2M29A 4CPVA 4OV2A 2K2AA 2L51A 4CLNA 3D76A 4YI9A 1JUOA 2FJUB 1B8RA 2CNPA 4JWQA 1M31A 3SS4A 2L4HA 3CS1A 3CWGA 5HKWA 1CKKA 1MQ1A 1J1EA 1EJ3A 5I8NA 3AAJA 1XYDA 2LM5A 4INWA 2M7LA 2GTEA 4P2YB 1V1FA 1KK8C 3SS3A 4GGFC 1TWOA 5HLVA 1DJHA 1GM0A 3TDZA 4D1EA 1L2OC 2KQ6A 3SIBA 3MSEB 3F45A 1J7QA 1S5GZ 2HF5A 2GGZA 1AVSA 4JKTA 3D78A 1UHJA 3NSIA 2QPTA 2ZFDA 3BUNB 4OR9B 3NSOA 3O2PA 1F70A 2I18A 3BXKA 3V2LA 1S1EA 1SL9A 2LANA 1K9UA 1K8UA 1NCXA 3I5HC 3E3RA 4OKHA 4PDZA 1B7TY 1C7VA 5K89A 3D0YB 4N1FA 3DVMA 1OMRA 1XFVO 4MVFA 4YGCB 2M9GA 2LMVA 2WCEA 3IVTA 2KHNA 4GGFA 1QATA 1NUBA 1RWYA 1BLQA 1K9KA 4YGAA 2COLB 3ZWHA 1SNLA 2KAXA 3WHUB 4YGDB 3I5GC 1DF0A 5J3XA 1N0YA 2ZNDA 4L9MA 2BAPA 4NDDA 2P70A 4YI8A 1QIWA 1IJ5A 1N2DA 1CFCA 1LXFC 4XJKA 3TDIA 4NDBA 3PM2A 1DT7B 2PASA 3VRNA 4CFRA 3SG6A 3AKBA 2CTNA 3PLFB 1JFJA 4I5KA 1NPQA 2BBNA 3BOWB 3VROA 2LP2A 4C0KA 1PULA 1EH2A 2BE4A 4DS7A 2BCXA 1KCYA 2EC6B 1IJ6A 4ORBB 1YVHA 1K95A 2DOQA 3OP0A 1ZOTB 1AUIB 1QJTA 1J7RA 1M63B 1PRWA 3N7HA 3OX5A 2H8VA 1KWOC 4NQGA 3SG4A 1QS7A 2Y4QA 3LK0A 2H61C 1S3PA 3I5IB 5AANA 3KEVA 3BJHA 1G4YR 1KFXS 3JTDC 3JVTB 3PALA 4GNKB 3PJIA 2O5GA 2K7OA 2LVKA 2M7NA 3GK4X 1BR1B 2PVBA 1B7TZ 4PE0A 3KF9A 1DELA 4USLA 3OB2B 1F8HA 1KSOA 2KOTA 1QASA 5ER4X 3BUOB 4HSZA 2A4JA 1KK7Y 2H61A 1OZSA 4NDCA 2LMUA 1Y1UA 3KO0A 1UHNA 3FE9A 3SJSA 2JRFA 1ZUZA 3VRQA 4QJ4B 4WQ3A 1QWVA 1XFWO 1PVAA 5TNCA 3S0EA 2F3YA 1NYAA 1TOPA 3O4YA 4PE4A 1RROA 1CTRA 2WNDA 2NLNA 4M2OA 3PSRA 4DCKA 1B1GA 4DRWA 1MXEA 1TIZA 2KI4C 3SG7A 2WCFA 3UNWA 5BPJA 1WDCC 1LA0A 1BODA 2MRDA 4MZKA 4A4CA 1KFUL 1GGZA 2KFFA 1A75A 1FW4A 2BL0C 2PQLA 1RK9A 2KLEA 2IS9A 4CIDA 4IJ7A 3CR2A 5FI2A 1CLMA 2M8UA 1DVIA 1J7OA 3KHEA 2F3ZA 3GK2A 3R1VA 1MWNA 2JT3A 4ICBA 4C0JA 1ODBA 2BCBA 2MJWB 4FQOA 1S6IA 5AERA 1R6PA 5I2LA 1P28A 5DKRA 3IQQA 2HETA 4N5XA 1YTZC 2F33A 3LL8B 5DKNA 2AUCA 1F55A 1BU3A 2BNXA 1SR6C 2WC8A 2WCLA 3VB1A 2LLUA 3L4AA 4CFQA 1H8BA 2M3WA 1D1OA 1QX5B 1CB1A 4MEWA 2P71A 3PFVA 2AMIA 1QVIY 2GV5A 2QEBA 4F7FA 1C3ZA 3PN7B 1SY9A 1S36A 1MXLC 5KSZA 2PYQA 1FF1A 3K1EA 1A4PA 3GOFA 1CFFA 2BCAA 3SG3A 1W7JB 1KK7Z 1TNQA 2M0RA 1G33A 2F8PA 2HQWA 1X02A 1BR4B 2LAPA 3SS5A 1M39A 5AEQA 1OOIX 4AOMA 3QMEA 1SL8A 2L5XB 3LCPC 1DGVA 2L0PA 2Q4UA 1B4CA 2LNKA 2SASA 1S26D 1YURA 2WCJA 3D73A 1CMFA 2KI6C 1IRJA 2Y1MA 1K90D 3CZ1A 1KK8B 3FWCA 5B8IB 1NX1A 1UHKA 2Y5IA 3H4SE 1KQVA 2TN4A 1TNXA 2LCPA 1L2OB 1KQMC 1PK0D 2JWWA 2JPOA 2KLDA 3D74A 3SG5A 3TZ1A 3B6XA 3VRRA 1AHRA 1AJ4A 1EG4A 1Y1AA 3EK7A 4I5LB 1NCZA 1DF0B 2MAZA 1OZOA 5CSIA 1GJYA 2JU0A 4PT1A 2L5YA 2L98A 4A4BA 2LC5A 3UO9A 4JQ0D 4F0ZB 3CTNA 3HCMA 5FI6A 3BFHA 3I5HB 2AAOA 3DVEA 1NIWA 3DVJA 4YBHB 2MHHA 1B47A 4MSPA 5D7FA 1WRZA 1A03A 4Q04A 4YRUA 3I5FC 4HREE 2EHBA 2E6WA 1SCMC 2D8NA 3QRXA 2M1KB 4PALA 1C07A 2K60A 2ERBA 2FCDA 2JNFA 3NHIA 3B88A 5CSNA 2JTZA 4YGEB 2EGDA 3DXLA 2K2FA 1SSEB 1WRLA 3I5GB 5I94A 3TUYC 2YGUA 3ICBA 3NHTA 2G2BA 5D69A 1OOJA 3CZ2A 3BUWB 2MA2A 1SPYA 5CSJA 3D75A 5D3OA 3OHMB 1YUSA 1XFXO 3S0DA 2JC2A 1DJXA 1YRTB 1CDNA 3NSLA 2OTGC 2QACA 1ZMZA 4QJ3B 3BYAA 2ZNEA 2KYCA 4HRHA 1AJ5A 2QEHA 4JD9A 3HX4A 2JOJA 4JPZB 5FI7A 1HT9A 4I5JA 1DEKA 3CZ0A 3BQ3A 3FE8A 4ORCB 3S0AA 2NZ0A 4MN0A 1HQVA 1EXRA 1ZACA 3ZNIA 4YGBB 1KWOB 2WC6A 1S6JA 1YUUA 1EL4A 3BOWA 1K93D 2K7DA 2KFHA 2M1UA 2O60A 1E8AA 1TUJA 1TUZA 2FOTA 1DJYA 1QLSA 1CM1A 3EVRA 3CZTX 3JTDB 1Q80A 3FIAA 3FE6A 3LLEA 4N1GA 4OVNF 1BF5A 2LLTA 4R1EA 4UPGA 1MR8A 1XVJA 1B8CA 1OOHA 1TTXA 2OS8C 2JNXA 4GGNA 5IBWA 2ZRTA 2PSRA 2Y1NA 3CR4X 2HPSA 2RGIA 1C3YA 5HLOA 1DJWA 4I5NB 1PALA
chains in the Genus database with same CATH topology
1FI5A 3RLZA 1JWDA 1CFDA 1JBAA 1IG5A 2ZKMX 1RJVA 2M97A 2KI4B 1CDMA 1V1GA 1WDCB 3WNXB 1Y1XA 5F6TA 1JC2A 4PCWA 4ZCVA 2NCOA 1A2XA 1BT6A 1YRUB 1SYMA 1R2UA 2KSPA 2KGBC 4FTGA 2BL0B 1NWDA 3FWBA 4MRXA 4PE7A 4PE1A 4WRIA 2KBMA 3EVVA 2LP3A 1JFKA 2JULA 3NSKA 5JJGA 1UHHA 5AFPA 4GPLB 4MLWA 1UWOA 1RTP1 2KAVA 1NX3A 2FCEA 2I7AA 5FYXA 2KBIA 4GFTA 2PRUA 1JF0A 2VRGA 4TNCA 4U8DA 1SBJA 5HKZA 1NCYA 2M49B 3C1VA 2LVJA 1DGUA 1SMGA 1IQ5A 2SCPA 2JTTA 2JT8A 4BY5A 1NP8A 3EKHA 1F4OA 3TS5C 1XO5A 3WHTB 2L4IA 1SR6B 3SIAA 1LA3A 1JF2A 1IH0A 2L50A 4WQ2A 3EK8A 1VRKA 4DUQA 1YX7A 4MZLA 1OMVA 2JQ6A 1RFJA 5CPVA 2ISDA 2LE9B 1KFXL 1GGWA 5G08A 1TCOB 3VGOA 3DF0A 3FS7A 5CSFA 1SK6D 1U5IA 3LK1A 1QX2A 1QTXA 2BKHB 4MZJA 2LMTA 4HRGA 1MHOA 4BY4A 1DTLA 4M2QA 1MUXA 2K0JA 2K61A 3M0WA 1CLBA 1XFYO 1UP5A 3WXAA 2Q91A 5DKQA 2H2KA 1UURA 3DVKA 1OSAA 2KNEA 2LUCA 3BUXB 4GUKA 4XJKB 3KPXA 1J55A 2MLEC 3AAKA 1KQMB 4P5OE 3O78A 5HYDA 1CDPA 1QIVA 2JXCA 2LV7A 2PALA 3A8RA 2JT0A 1CMGA 1KFUS 2JPTA 1DJIA 1M45A 3AKAA 2LHIA 1H4BA 1XK4C 1OE9B 4PHNA 4PHMA 1QVIZ 1ZFSA 1A29A 1M46A 1NSHA 1WLZA 5I2OA 1J1DA 4AQJA 3D0YA 3RM1A 2NCPA 2KAYA 1S6CA 4QJ5B 3IF7A 1PSRA 1FBVA 3I5FB 1NX2A 1TN4A 2LVIA 1SCMB 2V53A 3SG2A 1J7PA 1AP4A 1EG3A 2LVVA 5KTYA 3CR5X 1WY9A 4XYNA 4ZCUA 2EC6C 1OMDA 1Y6WA 4ORAB 3TUYB 1C7WA 5PALA 2LUXA 1UHIA 1K96A 3NXAA 2K7CA 1IKUA 1XK4A 1B8LA 1LVCD 1TNPA 1CFPA 1IGVA 2CXJA 2LHLA 1PVBA 3PM8A 1DMOA 2F2PA 2JZIA 5HKYA 3PATA 3I5IC 2LLSA 3CGAA 3O6BA 2JXLA 2ZRSA 2NXQA 2OTGB 1F54A 1CLLA 1UUSA 4PHJA 3JVTC 2ZN8A 2G9BA 2BBMA 1SKTA 1F4QA 1YX8A 1FI6A 1SW8A 5GQQC 3BUMB 3TDUA 2GGMA 2P6BB 4DIRA 4M2PA 2KDHA 3CLNA 5AXIA 1TNWA 3K21A 5KU1A 4C0LA 1PSBA 4IL1A 2KI6D 2K7BA 3EVUA 1K94A 2F2OA 2KGRA 1A75B 2CCMA 2BKIB 1YVLA 1FPWA 3A4UB 2HQ8A 2OPOA 4MRYA 2E30A 1XFUO 5JOLA 1K2HA 2KFGA 2OS8B 2MBXA 1W7IB 4GAOA 2BECA 3EK4A 1QX7A 3OX6A 1YUTA 4MBEA 4AQIA 1BG1A 1ALVA 1WLMA 1NX0A 1L7ZA 5I2QA 1N65A 2WCBA 2PMYA 4OCIA 1CM4A 1GQMA 1DJGA 1S5GY 1F71A 1KSMA 1SCVA 1TRFA 1IWQA 1MF8B 1RECA 1CNPA 1AK8A 3VRPA 4PHKA 2MLFC 3GK1A 1JSAA 2CT9A 3EKJA 1XFZO 1BOCA 1QLKA 1B9AA 1BMOA 1LKJA 1SL7A 2KQYA 2I2RE 2CBLA 1XA5A 2K8MB 2L2EA 1SRAA 4E68A 2B1UA 2R2IA 3DD4A 4ETOA 5ER5A 3D10A 1YR5A 2BE6A 1BJFA 1Y0VH 1IQ3A 1WRKA 1DJZA 3PN7C 1G8IA 2ZN9A 1CDLA 2I94A 1QV1A 2WOSA 1QV0A 3DF0B 4GBAA 1ALWA 1U5IB 2WORA 3OB1B 3IQOA 1OQPA 2KYFA 1TCFA 1K9PA 1QXPA 3TS5B 1LINA 2M29A 4CPVA 4OV2A 2K2AA 2L51A 4CLNA 4YI9A 1JUOA 2FJUB 1B8RA 2CNPA 4JWQA 1M31A 2L4HA 3CS1A 3CWGA 5HKWA 1CKKA 1MQ1A 1J1EA 1EJ3A 5I8NA 3AAJA 1XYDA 2LM5A 2M7LA 4P2YB 1V1FA 1KK8C 4GGFC 5HLVA 1DJHA 3TDZA 4D1EA 1L2OC 2KQ6A 3SIBA 3MSEB 3F45A 1J7QA 1S5GZ 2HF5A 2GGZA 1AVSA 1UHJA 3NSIA 2QPTA 2ZFDA 3BUNB 4OR9B 3NSOA 3O2PA 1F70A 2I18A 3BXKA 1S1EA 1SL9A 2LANA 1K9UA 1K8UA 1NCXA 3I5HC 3E3RA 4OKHA 4PDZA 1B7TY 1C7VA 5K89A 3D0YB 4N1FA 3DVMA 1OMRA 1XFVO 4MVFA 4YGCB 2M9GA 2LMVA 2WCEA 2KHNA 4GGFA 1QATA 1NUBA 1RWYA 1BLQA 1K9KA 4YGAA 2COLB 3ZWHA 1SNLA 2KAXA 3WHUB 4YGDB 3I5GC 1DF0A 5J3XA 1N0YA 2ZNDA 4L9MA 4NDDA 4YI8A 1QIWA 1IJ5A 1N2DA 1CFCA 1LXFC 4XJKA 3TDIA 4NDBA 1DT7B 2PASA 3VRNA 4CFRA 3SG6A 3AKBA 2CTNA 3PLFB 1JFJA 4I5KA 1NPQA 2BBNA 3BOWB 3VROA 2LP2A 4C0KA 1PULA 1EH2A 2BE4A 4DS7A 2BCXA 1KCYA 2EC6B 1IJ6A 4ORBB 1YVHA 1K95A 2DOQA 3OP0A 1ZOTB 1AUIB 1QJTA 1J7RA 1M63B 1PRWA 3OX5A 1KWOC 4NQGA 3SG4A 1QS7A 2Y4QA 3LK0A 2H61C 1S3PA 3I5IB 5AANA 3KEVA 1G4YR 1KFXS 3JTDC 3JVTB 3PALA 4GNKB 2O5GA 2K7OA 2LVKA 2M7NA 3GK4X 1BR1B 2PVBA 1B7TZ 4PE0A 3KF9A 4USLA 3OB2B 1F8HA 1KSOA 2KOTA 1QASA 5ER4X 3BUOB 4HSZA 2A4JA 1KK7Y 2H61A 1OZSA 4NDCA 2LMUA 1Y1UA 3KO0A 1UHNA 3SJSA 2JRFA 1ZUZA 3VRQA 4QJ4B 4WQ3A 1XFWO 1PVAA 5TNCA 2F3YA 1NYAA 1TOPA 3O4YA 4PE4A 1RROA 1CTRA 2WNDA 2NLNA 4M2OA 3PSRA 4DCKA 1B1GA 4DRWA 1MXEA 1TIZA 2KI4C 3SG7A 2WCFA 5BPJA 1BODA 1WDCC 1LA0A 2MRDA 4MZKA 4A4CA 1KFUL 1GGZA 2KFFA 1A75A 1FW4A 2BL0C 1RK9A 2IS9A 4CIDA 3CR2A 1CLMA 2M8UA 1DVIA 1J7OA 3KHEA 2F3ZA 3GK2A 1MWNA 2JT3A 4ICBA 4C0JA 1ODBA 2BCBA 2MJWB 4FQOA 1S6IA 5AERA 1R6PA 5I2LA 5DKRA 3IQQA 2HETA 4N5XA 1YTZC 2F33A 3LL8B 5DKNA 2AUCA 1F55A 1BU3A 1SR6C 2WC8A 2LLUA 4CFQA 1H8BA 2M3WA 1D1OA 1QX5B 1CB1A 4MEWA 3PFVA 2AMIA 1QVIY 2GV5A 3PN7B 1SY9A 1S36A 1MXLC 5KSZA 1FF1A 1A4PA 3GOFA 1CFFA 2BCAA 3SG3A 1W7JB 1KK7Z 1TNQA 2M0RA 1G33A 2F8PA 2HQWA 1X02A 1BR4B 2LAPA 1M39A 5AEQA 4AOMA 1SL8A 2L5XB 3LCPC 1DGVA 2L0PA 2Q4UA 1B4CA 2LNKA 2SASA 1S26D 1YURA 1CMFA 2KI6C 1IRJA 2Y1MA 1K90D 3FWCA 1KK8B 5B8IB 1NX1A 1UHKA 2Y5IA 3H4SE 1KQVA 2TN4A 1TNXA 2LCPA 1L2OB 1KQMC 1PK0D 2JWWA 3SG5A 3TZ1A 3VRRA 1AHRA 1AJ4A 1EG4A 1Y1AA 3EK7A 4I5LB 1NCZA 1DF0B 2MAZA 1OZOA 5CSIA 1GJYA 2JU0A 4A4BA 2L98A 2LC5A 4JQ0D 4F0ZB 3CTNA 3HCMA 3I5HB 2AAOA 3DVEA 1NIWA 3DVJA 4YBHB 2MHHA 1B47A 4MSPA 5D7FA 1WRZA 1A03A 4Q04A 4YRUA 3I5FC 4HREE 2EHBA 2E6WA 1SCMC 2D8NA 3QRXA 2M1KB 4PALA 1C07A 2FCDA 2JNFA 5CSNA 4YGEB 2JTZA 2EGDA 2K2FA 1WRLA 3I5GB 3TUYC 3ICBA 2G2BA 5D69A 1OOJA 3BUWB 2MA2A 1SPYA 5CSJA 3OHMB 1YUSA 1XFXO 2JC2A 1DJXA 1YRTB 1CDNA 3NSLA 2OTGC 2QACA 1ZMZA 4QJ3B 3BYAA 2ZNEA 2KYCA 4HRHA 1AJ5A 3HX4A 2JOJA 4JPZB 1HT9A 4I5JA 3BQ3A 4ORCB 2NZ0A 4MN0A 1HQVA 1EXRA 1ZACA 3ZNIA 4YGBB 1KWOB 1S6JA 1YUUA 1EL4A 3BOWA 1K93D 2K7DA 2KFHA 2M1UA 2O60A 1E8AA 2FOTA 1DJYA 1QLSA 1CM1A 3EVRA 3CZTX 3JTDB 1Q80A 3FIAA 3LLEA 4N1GA 1BF5A 4OVNF 2LLTA 4R1EA 4UPGA 1MR8A 1XVJA 1B8CA 1TTXA 2OS8C 2JNXA 4GGNA 5IBWA 2ZRTA 2PSRA 2Y1NA 3CR4X 2HPSA 2RGIA 5HLOA 1DJWA 4I5NB 1PALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FI5 A;  3RLZ A;  1JWD A;  1CFD A;  1JBA A;  1IG5 A;  2ZKM X;  1RJV A;  2M97 A;  2KI4 B;  1CDM A;  1V1G A;  1WDC B;  3WNX B;  1Y1X A;  5F6T A;  1JC2 A;  4PCW A;  4ZCV A;  2NCO A;  1A2X A;  1BT6 A;  1YRU B;  1SYM A;  1R2U A;  2KSP A;  2KGB C;  4FTG A;  2BL0 B;  1NWD A;  3FWB A;  4MRX A;  4PE7 A;  4PE1 A;  4WRI A;  2KBM A;  3EVV A;  2LP3 A;  1JFK A;  2JUL A;  3NSK A;  5JJG A;  1UHH A;  5AFP A;  4GPL B;  4MLW A;  1UWO A;  1RTP 1;  2KAV A;  1NX3 A;  2FCE A;  2I7A A;  5FYX A;  2KBI A;  4GFT A;  2PRU A;  1JF0 A;  2VRG A;  4TNC A;  4U8D A;  1SBJ A;  5HKZ A;  1NCY A;  2M49 B;  3C1V A;  2LVJ A;  1DGU A;  1SMG A;  1IQ5 A;  2SCP A;  2JTT A;  2JT8 A;  4BY5 A;  1NP8 A;  3EKH A;  1F4O A;  3TS5 C;  1XO5 A;  3WHT B;  2L4I A;  1SR6 B;  3SIA A;  1LA3 A;  1JF2 A;  1IH0 A;  2L50 A;  4WQ2 A;  3EK8 A;  1VRK A;  4DUQ A;  1YX7 A;  4MZL A;  1OMV A;  2JQ6 A;  1RFJ A;  5CPV A;  2ISD A;  2LE9 B;  1KFX L;  1GGW A;  5G08 A;  1TCO B;  3VGO A;  3DF0 A;  3FS7 A;  5CSF A;  1SK6 D;  1U5I A;  3LK1 A;  1QX2 A;  1QTX A;  2BKH B;  4MZJ A;  2LMT A;  4HRG A;  1MHO A;  4BY4 A;  1DTL A;  4M2Q A;  1MUX A;  2K0J A;  2K61 A;  3M0W A;  1CLB A;  1XFY O;  1UP5 A;  3WXA A;  2Q91 A;  5DKQ A;  2H2K A;  1UUR A;  3DVK A;  1OSA A;  2KNE A;  2LUC A;  3BUX B;  4GUK A;  4XJK B;  3KPX A;  1J55 A;  2MLE C;  3AAK A;  1KQM B;  4P5O E;  3O78 A;  5HYD A;  1CDP A;  1QIV A;  2JXC A;  2LV7 A;  2PAL A;  3A8R A;  2JT0 A;  1CMG A;  1KFU S;  2JPT A;  1DJI A;  1M45 A;  3AKA A;  2LHI A;  1H4B A;  1XK4 C;  1OE9 B;  4PHN A;  4PHM A;  1QVI Z;  1ZFS A;  1A29 A;  1M46 A;  1NSH A;  1WLZ A;  5I2O A;  1J1D A;  4AQJ A;  3D0Y A;  3RM1 A;  2NCP A;  2KAY A;  1S6C A;  4QJ5 B;  3IF7 A;  1PSR A;  1FBV A;  3I5F B;  1NX2 A;  1TN4 A;  2LVI A;  1SCM B;  2V53 A;  3SG2 A;  1J7P A;  1AP4 A;  1EG3 A;  2LVV A;  5KTY A;  3CR5 X;  1WY9 A;  4XYN A;  4ZCU A;  2EC6 C;  1OMD A;  1Y6W A;  4ORA B;  3TUY B;  1C7W A;  5PAL A;  2LUX A;  1UHI A;  1K96 A;  3NXA A;  2K7C A;  1IKU A;  1XK4 A;  1B8L A;  1LVC D;  1TNP A;  1CFP A;  1IGV A;  2CXJ A;  2LHL A;  1PVB A;  3PM8 A;  1DMO A;  2F2P A;  2JZI A;  5HKY A;  3PAT A;  3I5I C;  2LLS A;  3CGA A;  3O6B A;  2JXL A;  2ZRS A;  2NXQ A;  2OTG B;  1F54 A;  1CLL A;  1UUS A;  4PHJ A;  3JVT C;  2ZN8 A;  2G9B A;  2BBM A;  1SKT A;  1F4Q A;  1YX8 A;  1FI6 A;  1SW8 A;  5GQQ C;  3BUM B;  3TDU A;  2GGM A;  2P6B B;  4DIR A;  4M2P A;  2KDH A;  3CLN A;  5AXI A;  1TNW A;  3K21 A;  5KU1 A;  4C0L A;  1PSB A;  4IL1 A;  2KI6 D;  2K7B A;  3EVU A;  1K94 A;  2F2O A;  2KGR A;  1A75 B;  2CCM A;  2BKI B;  1YVL A;  1FPW A;  3A4U B;  2HQ8 A;  2OPO A;  4MRY A;  2E30 A;  1XFU O;  5JOL A;  1K2H A;  2KFG A;  2OS8 B;  2MBX A;  1W7I B;  4GAO A;  2BEC A;  3EK4 A;  1QX7 A;  3OX6 A;  1YUT A;  4MBE A;  4AQI A;  1BG1 A;  1ALV A;  1WLM A;  1NX0 A;  1L7Z A;  5I2Q A;  1N65 A;  2WCB A;  2PMY A;  4OCI A;  1CM4 A;  1GQM A;  1DJG A;  1S5G Y;  1F71 A;  1KSM A;  1SCV A;  1TRF A;  1IWQ A;  1MF8 B;  1REC A;  1CNP A;  1AK8 A;  3VRP A;  4PHK A;  2MLF C;  3GK1 A;  1JSA A;  2CT9 A;  3EKJ A;  1XFZ O;  1BOC A;  1QLK A;  1B9A A;  1BMO A;  1LKJ A;  1SL7 A;  2KQY A;  2I2R E;  2CBL A;  1XA5 A;  2K8M B;  2L2E A;  1SRA A;  4E68 A;  2B1U A;  2R2I A;  3DD4 A;  4ETO A;  5ER5 A;  3D10 A;  1YR5 A;  2BE6 A;  1BJF A;  1Y0V H;  1IQ3 A;  1WRK A;  1DJZ A;  3PN7 C;  1G8I A;  2ZN9 A;  1CDL A;  2I94 A;  1QV1 A;  2WOS A;  1QV0 A;  3DF0 B;  4GBA A;  1ALW A;  1U5I B;  2WOR A;  3OB1 B;  3IQO A;  1OQP A;  2KYF A;  1TCF A;  1K9P A;  1QXP A;  3TS5 B;  1LIN A;  2M29 A;  4CPV A;  4OV2 A;  2K2A A;  2L51 A;  4CLN A;  4YI9 A;  1JUO A;  2FJU B;  1B8R A;  2CNP A;  4JWQ A;  1M31 A;  2L4H A;  3CS1 A;  3CWG A;  5HKW A;  1CKK A;  1MQ1 A;  1J1E A;  1EJ3 A;  5I8N A;  3AAJ A;  1XYD A;  2LM5 A;  2M7L A;  4P2Y B;  1V1F A;  1KK8 C;  4GGF C;  5HLV A;  1DJH A;  3TDZ A;  4D1E A;  1L2O C;  2KQ6 A;  3SIB A;  3MSE B;  3F45 A;  1J7Q A;  1S5G Z;  2HF5 A;  2GGZ A;  1AVS A;  1UHJ A;  3NSI A;  2QPT A;  2ZFD A;  3BUN B;  4OR9 B;  3NSO A;  3O2P A;  1F70 A;  2I18 A;  3BXK A;  1S1E A;  1SL9 A;  2LAN A;  1K9U A;  1K8U A;  1NCX A;  3I5H C;  3E3R A;  4OKH A;  4PDZ A;  1B7T Y;  1C7V A;  5K89 A;  3D0Y B;  4N1F A;  3DVM A;  1OMR A;  1XFV O;  4MVF A;  4YGC B;  2M9G A;  2LMV A;  2WCE A;  2KHN A;  4GGF A;  1QAT A;  1NUB A;  1RWY A;  1BLQ A;  1K9K A;  4YGA A;  2COL B;  3ZWH A;  1SNL A;  2KAX A;  3WHU B;  4YGD B;  3I5G C;  1DF0 A;  5J3X A;  1N0Y A;  2ZND A;  4L9M A;  4NDD A;  4YI8 A;  1QIW A;  1IJ5 A;  1N2D A;  1CFC A;  1LXF C;  4XJK A;  3TDI A;  4NDB A;  1DT7 B;  2PAS A;  3VRN A;  4CFR A;  3SG6 A;  3AKB A;  2CTN A;  3PLF B;  1JFJ A;  4I5K A;  1NPQ A;  2BBN A;  3BOW B;  3VRO A;  2LP2 A;  4C0K A;  1PUL A;  1EH2 A;  2BE4 A;  4DS7 A;  2BCX A;  1KCY A;  2EC6 B;  1IJ6 A;  4ORB B;  1YVH A;  1K95 A;  2DOQ A;  3OP0 A;  1ZOT B;  1AUI B;  1QJT A;  1J7R A;  1M63 B;  1PRW A;  3OX5 A;  1KWO C;  4NQG A;  3SG4 A;  1QS7 A;  2Y4Q A;  3LK0 A;  2H61 C;  1S3P A;  3I5I B;  5AAN A;  3KEV A;  1G4Y R;  1KFX S;  3JTD C;  3JVT B;  3PAL A;  4GNK B;  2O5G A;  2K7O A;  2LVK A;  2M7N A;  3GK4 X;  1BR1 B;  2PVB A;  1B7T Z;  4PE0 A;  3KF9 A;  4USL A;  3OB2 B;  1F8H A;  1KSO A;  2KOT A;  1QAS A;  5ER4 X;  3BUO B;  4HSZ A;  2A4J A;  1KK7 Y;  2H61 A;  1OZS A;  4NDC A;  2LMU A;  1Y1U A;  3KO0 A;  1UHN A;  3SJS A;  2JRF A;  1ZUZ A;  3VRQ A;  4QJ4 B;  4WQ3 A;  1XFW O;  1PVA A;  5TNC A;  2F3Y A;  1NYA A;  1TOP A;  3O4Y A;  4PE4 A;  1RRO A;  1CTR A;  2WND A;  2NLN A;  4M2O A;  3PSR A;  4DCK A;  1B1G A;  4DRW A;  1MXE A;  1TIZ A;  2KI4 C;  3SG7 A;  2WCF A;  5BPJ A;  1BOD A;  1WDC C;  1LA0 A;  2MRD A;  4MZK A;  4A4C A;  1KFU L;  1GGZ A;  2KFF A;  1A75 A;  1FW4 A;  2BL0 C;  1RK9 A;  2IS9 A;  4CID A;  3CR2 A;  1CLM A;  2M8U A;  1DVI A;  1J7O A;  3KHE A;  2F3Z A;  3GK2 A;  1MWN A;  2JT3 A;  4ICB A;  4C0J A;  1ODB A;  2BCB A;  2MJW B;  4FQO A;  1S6I A;  5AER A;  1R6P A;  5I2L A;  5DKR A;  3IQQ A;  2HET A;  4N5X A;  1YTZ C;  2F33 A;  3LL8 B;  5DKN A;  2AUC A;  1F55 A;  1BU3 A;  1SR6 C;  2WC8 A;  2LLU A;  4CFQ A;  1H8B A;  2M3W A;  1D1O A;  1QX5 B;  1CB1 A;  4MEW A;  3PFV A;  2AMI A;  1QVI Y;  2GV5 A;  3PN7 B;  1SY9 A;  1S36 A;  1MXL C;  5KSZ A;  1FF1 A;  1A4P A;  3GOF A;  1CFF A;  2BCA A;  3SG3 A;  1W7J B;  1KK7 Z;  1TNQ A;  2M0R A;  1G33 A;  2F8P A;  2HQW A;  1X02 A;  1BR4 B;  2LAP A;  1M39 A;  5AEQ A;  4AOM A;  1SL8 A;  2L5X B;  3LCP C;  1DGV A;  2L0P A;  2Q4U A;  1B4C A;  2LNK A;  2SAS A;  1S26 D;  1YUR A;  1CMF A;  2KI6 C;  1IRJ A;  2Y1M A;  1K90 D;  3FWC A;  1KK8 B;  5B8I B;  1NX1 A;  1UHK A;  2Y5I A;  3H4S E;  1KQV A;  2TN4 A;  1TNX A;  2LCP A;  1L2O B;  1KQM C;  1PK0 D;  2JWW A;  3SG5 A;  3TZ1 A;  3VRR A;  1AHR A;  1AJ4 A;  1EG4 A;  1Y1A A;  3EK7 A;  4I5L B;  1NCZ A;  1DF0 B;  2MAZ A;  1OZO A;  5CSI A;  1GJY A;  2JU0 A;  4A4B A;  2L98 A;  2LC5 A;  4JQ0 D;  4F0Z B;  3CTN A;  3HCM A;  3I5H B;  2AAO A;  3DVE A;  1NIW A;  3DVJ A;  4YBH B;  2MHH A;  1B47 A;  4MSP A;  5D7F A;  1WRZ A;  1A03 A;  4Q04 A;  4YRU A;  3I5F C;  4HRE E;  2EHB A;  2E6W A;  1SCM C;  2D8N A;  3QRX A;  2M1K B;  4PAL A;  1C07 A;  2FCD A;  2JNF A;  5CSN A;  4YGE B;  2JTZ A;  2EGD A;  2K2F A;  1WRL A;  3I5G B;  3TUY C;  3ICB A;  2G2B A;  5D69 A;  1OOJ A;  3BUW B;  2MA2 A;  1SPY A;  5CSJ A;  3OHM B;  1YUS A;  1XFX O;  2JC2 A;  1DJX A;  1YRT B;  1CDN A;  3NSL A;  2OTG C;  2QAC A;  1ZMZ A;  4QJ3 B;  3BYA A;  2ZNE A;  2KYC A;  4HRH A;  1AJ5 A;  3HX4 A;  2JOJ A;  4JPZ B;  1HT9 A;  4I5J A;  3BQ3 A;  4ORC B;  2NZ0 A;  4MN0 A;  1HQV A;  1EXR A;  1ZAC A;  3ZNI A;  4YGB B;  1KWO B;  1S6J A;  1YUU A;  1EL4 A;  3BOW A;  1K93 D;  2K7D A;  2KFH A;  2M1U A;  2O60 A;  1E8A A;  2FOT A;  1DJY A;  1QLS A;  1CM1 A;  3EVR A;  3CZT X;  3JTD B;  1Q80 A;  3FIA A;  3LLE A;  4N1G A;  1BF5 A;  4OVN F;  2LLT A;  4R1E A;  4UPG A;  1MR8 A;  1XVJ A;  1B8C A;  1TTX A;  2OS8 C;  2JNX A;  4GGN A;  5IBW A;  2ZRT A;  2PSR A;  2Y1N A;  3CR4 X;  2HPS A;  2RGI A;  5HLO A;  1DJW A;  4I5N B;  1PAL A; 
#chains in the Genus database with same CATH topology
 1FI5 A;  3OGN A;  3RLZ A;  1JWD A;  1CFD A;  1JBA A;  1IG5 A;  3R1O A;  2ZKM X;  2WCK A;  1RJV A;  2M97 A;  2KI4 B;  1CDM A;  1V1G A;  1WDC B;  3WNX B;  1Y1X A;  5F6T A;  1JC2 A;  4PCW A;  4ZCV A;  2NCO A;  1A2X A;  1BT6 A;  1YRU B;  1SYM A;  1R2U A;  2KSP A;  2KGB C;  3NGV A;  2BL0 B;  1NWD A;  3FWB A;  4FTG A;  3B86 A;  4MRX A;  4PE7 A;  2KBM A;  3EVV A;  4PE1 A;  2LP3 A;  1JFK A;  2JUL A;  3NSK A;  5JJG A;  1UHH A;  5AFP A;  4GPL B;  4MLW A;  1UWO A;  1RTP 1;  2KAV A;  1NX3 A;  2FCE A;  2I7A A;  1LS8 A;  5FYX A;  2KBI A;  4GFT A;  2PRU A;  1JF0 A;  2VRG A;  4TNC A;  4U8D A;  1Z2C B;  3OBV A;  1SBJ A;  1XFR A;  5HKZ A;  1NCY A;  3R72 A;  2M49 B;  3C1V A;  3CAB A;  2LVJ A;  1DGU A;  1SMG A;  1IQ5 A;  2SCP A;  2JTT A;  2JT8 A;  1DQE A;  1NP8 A;  3EKH A;  4BY5 A;  1F4O A;  3TS5 C;  1XO5 A;  3L4L A;  3WHT B;  2L4I A;  1SR6 B;  3SIA A;  1LA3 A;  1W9Z A;  3CYZ A;  1JF2 A;  4INX A;  1IH0 A;  2L50 A;  3RZS A;  4WQ2 A;  3EK8 A;  1VRK A;  4DUQ A;  1YX7 A;  4MZL A;  1OMV A;  2JQ6 A;  1RFJ A;  5CPV A;  2ISD A;  2LE9 B;  1KFX L;  1GGW A;  5G08 A;  2QEV A;  3Q8I A;  1TCO B;  3VGO A;  3DF0 A;  3D77 A;  3DY9 A;  3FS7 A;  5CSF A;  1SK6 D;  1U5I A;  3LK1 A;  1QX2 A;  1QTX A;  2BKH B;  3S0F A;  2L2C A;  4MZJ A;  2LMT A;  4HRG A;  5DIC A;  1MHO A;  4BY4 A;  1DTL A;  4M2Q A;  1MUX A;  2K0J A;  2K61 A;  3M0W A;  1CLB A;  1XFY O;  2FJY A;  1UP5 A;  3WXA A;  2Q91 A;  5DKQ A;  2H2K A;  2WCM A;  1UUR A;  1Z4H A;  3DVK A;  1OSA A;  2KNE A;  2LUC A;  3BUX B;  4GUK A;  4XJK B;  3KPX A;  1J55 A;  2MLE C;  3AAK A;  1KQM B;  5HL1 A;  4P5O E;  3O78 A;  5HYD A;  1CDP A;  1QIV A;  2JXC A;  2LV7 A;  2PAL A;  3A8R A;  2JT0 A;  1CMG A;  1KFU S;  2JPT A;  1DJI A;  1M45 A;  3AKA A;  2LHI A;  1H4B A;  1XK4 C;  1OE9 B;  4PHN A;  4PHM A;  1QVI Z;  1ZFS A;  1A29 A;  1M46 A;  1NSH A;  1WLZ A;  5I2O A;  1J1D A;  4AQJ A;  3D0Y A;  3RM1 A;  2NCP A;  2KAY A;  1S6C A;  4QJ5 B;  3IF7 A;  1PSR A;  2WCH A;  1FBV A;  1IIO A;  2QDI A;  1NX2 A;  3I5F B;  1TN4 A;  2LVI A;  1SCM B;  2V53 A;  3BFB A;  3SG2 A;  1J7P A;  1AP4 A;  1EG3 A;  2LVV A;  5KTY A;  3CR5 X;  1WY9 A;  4XYN A;  4ZCU A;  2EC6 C;  1OMD A;  1Y6W A;  4ORA B;  3TUY B;  1C7W A;  5PAL A;  2LUX A;  1UHI A;  1K96 A;  3NXA A;  2K7C A;  1IKU A;  1XK4 A;  1B8L A;  1LVC D;  1TNP A;  1CFP A;  1IGV A;  2CXJ A;  2LHL A;  1PVB A;  1OOF A;  3PM8 A;  2F2P A;  2JZI A;  3B87 A;  5HKY A;  3PAT A;  3I5I C;  1DMO A;  2LLS A;  3CGA A;  3O6B A;  2JXL A;  2ZRS A;  2NXQ A;  2OTG B;  1F54 A;  1CLL A;  1UUS A;  4PHJ A;  3JVT C;  2ZN8 A;  2G9B A;  1ORG A;  2BBM A;  1SKT A;  1F4Q A;  1YX8 A;  1FI6 A;  1SW8 A;  5GQQ C;  3BUM B;  3TDU A;  2GGM A;  4WRI A;  2P6B B;  4OZD A;  4DIR A;  4M2P A;  2KDH A;  3CLN A;  5AXI A;  1TNW A;  3K21 A;  5KU1 A;  4C0L A;  3DZT A;  1PSB A;  4IL1 A;  2KI6 D;  3B7A A;  2K7B A;  3EVU A;  1K94 A;  2F2O A;  2KGR A;  1A75 B;  2CCM A;  1OOG A;  3S0B A;  2BKI B;  1YVL A;  1FPW A;  3A4U B;  2HQ8 A;  2OPO A;  4MRY A;  2WC5 A;  2E30 A;  1XFU O;  5JOL A;  1K2H A;  2KFG A;  2OS8 B;  2MBX A;  2QEO A;  1W7I B;  3BFA A;  4GAO A;  2BEC A;  3EK4 A;  1QX7 A;  3S0G A;  3OX6 A;  3R1P A;  1YUT A;  4MBE A;  4AQI A;  1BG1 A;  1ALV A;  1WLM A;  2KPH A;  3L47 A;  1NX0 A;  1L7Z A;  5I2Q A;  1N65 A;  2WCB A;  2PMY A;  4OCI A;  1CM4 A;  1GQM A;  1DC1 A;  1DJG A;  1S5G Y;  1F71 A;  3EG5 B;  1KSM A;  1SCV A;  1TRF A;  1IWQ A;  1MF8 B;  1REC A;  1CNP A;  1AK8 A;  3VRP A;  4PHK A;  2MLF C;  3GK1 A;  1JSA A;  3O4X A;  2CT9 A;  3EKJ A;  3CDN A;  1XFZ O;  1BOC A;  4FQT A;  1QLK A;  1B9A A;  1BMO A;  1LKJ A;  1SL7 A;  2KQY A;  2I2R E;  2CBL A;  1XA5 A;  2K8M B;  2L2E A;  1SRA A;  4E68 A;  2B1U A;  2R2I A;  3DD4 A;  3DYE A;  4ETO A;  5ER5 A;  3D10 A;  1YR5 A;  2BE6 A;  1BJF A;  1Y0V H;  5EL2 A;  1IQ3 A;  1WRK A;  1DJZ A;  3PN7 C;  1G8I A;  1OW4 A;  2ZN9 A;  1CDL A;  2I94 A;  1QV1 A;  2WOS A;  1QV0 A;  3DF0 B;  4KYN A;  4GBA A;  1ALW A;  1U5I B;  2WOR A;  3OB1 B;  3IQO A;  1OQP A;  1T14 A;  2KYF A;  1TCF A;  1K9P A;  1QXP A;  3TS5 B;  1LIN A;  2M29 A;  4CPV A;  4OV2 A;  2K2A A;  2L51 A;  4CLN A;  3D76 A;  4YI9 A;  1JUO A;  2FJU B;  1B8R A;  2CNP A;  4JWQ A;  1M31 A;  3SS4 A;  2L4H A;  3CS1 A;  3CWG A;  5HKW A;  1CKK A;  1MQ1 A;  1J1E A;  1EJ3 A;  5I8N A;  3AAJ A;  1XYD A;  2LM5 A;  4INW A;  2M7L A;  2GTE A;  4P2Y B;  1V1F A;  1KK8 C;  3SS3 A;  4GGF C;  1TWO A;  5HLV A;  1DJH A;  1GM0 A;  3TDZ A;  4D1E A;  1L2O C;  2KQ6 A;  3SIB A;  3MSE B;  3F45 A;  1J7Q A;  1S5G Z;  2HF5 A;  2GGZ A;  1AVS A;  4JKT A;  3D78 A;  1UHJ A;  3NSI A;  2QPT A;  2ZFD A;  3BUN B;  4OR9 B;  3NSO A;  3O2P A;  1F70 A;  2I18 A;  3BXK A;  3V2L A;  1S1E A;  1SL9 A;  2LAN A;  1K9U A;  1K8U A;  1NCX A;  3I5H C;  3E3R A;  4OKH A;  4PDZ A;  1B7T Y;  1C7V A;  5K89 A;  3D0Y B;  4N1F A;  3DVM A;  1OMR A;  1XFV O;  4MVF A;  4YGC B;  2M9G A;  2LMV A;  2WCE A;  3IVT A;  2KHN A;  4GGF A;  1QAT A;  1NUB A;  1RWY A;  1BLQ A;  1K9K A;  4YGA A;  2COL B;  3ZWH A;  1SNL A;  2KAX A;  3WHU B;  4YGD B;  3I5G C;  1DF0 A;  5J3X A;  1N0Y A;  2ZND A;  4L9M A;  2BAP A;  4NDD A;  2P70 A;  4YI8 A;  1QIW A;  1IJ5 A;  1N2D A;  1CFC A;  1LXF C;  4XJK A;  3TDI A;  4NDB A;  3PM2 A;  1DT7 B;  2PAS A;  3VRN A;  4CFR A;  3SG6 A;  3AKB A;  2CTN A;  3PLF B;  1JFJ A;  4I5K A;  1NPQ A;  2BBN A;  3BOW B;  3VRO A;  2LP2 A;  4C0K A;  1PUL A;  1EH2 A;  2BE4 A;  4DS7 A;  2BCX A;  1KCY A;  2EC6 B;  1IJ6 A;  4ORB B;  1YVH A;  1K95 A;  2DOQ A;  3OP0 A;  1ZOT B;  1AUI B;  1QJT A;  1J7R A;  1M63 B;  1PRW A;  3N7H A;  3OX5 A;  2H8V A;  1KWO C;  4NQG A;  3SG4 A;  1QS7 A;  2Y4Q A;  3LK0 A;  2H61 C;  1S3P A;  3I5I B;  5AAN A;  3KEV A;  3BJH A;  1G4Y R;  1KFX S;  3JTD C;  3JVT B;  3PAL A;  4GNK B;  3PJI A;  2O5G A;  2K7O A;  2LVK A;  2M7N A;  3GK4 X;  1BR1 B;  2PVB A;  1B7T Z;  4PE0 A;  3KF9 A;  1DEL A;  4USL A;  3OB2 B;  1F8H A;  1KSO A;  2KOT A;  1QAS A;  5ER4 X;  3BUO B;  4HSZ A;  2A4J A;  1KK7 Y;  2H61 A;  1OZS A;  4NDC A;  2LMU A;  1Y1U A;  3KO0 A;  1UHN A;  3FE9 A;  3SJS A;  2JRF A;  1ZUZ A;  3VRQ A;  4QJ4 B;  4WQ3 A;  1QWV A;  1XFW O;  1PVA A;  5TNC A;  3S0E A;  2F3Y A;  1NYA A;  1TOP A;  3O4Y A;  4PE4 A;  1RRO A;  1CTR A;  2WND A;  2NLN A;  4M2O A;  3PSR A;  4DCK A;  1B1G A;  4DRW A;  1MXE A;  1TIZ A;  2KI4 C;  3SG7 A;  2WCF A;  3UNW A;  5BPJ A;  1WDC C;  1LA0 A;  1BOD A;  2MRD A;  4MZK A;  4A4C A;  1KFU L;  1GGZ A;  2KFF A;  1A75 A;  1FW4 A;  2BL0 C;  2PQL A;  1RK9 A;  2KLE A;  2IS9 A;  4CID A;  4IJ7 A;  3CR2 A;  5FI2 A;  1CLM A;  2M8U A;  1DVI A;  1J7O A;  3KHE A;  2F3Z A;  3GK2 A;  3R1V A;  1MWN A;  2JT3 A;  4ICB A;  4C0J A;  1ODB A;  2BCB A;  2MJW B;  4FQO A;  1S6I A;  5AER A;  1R6P A;  5I2L A;  1P28 A;  5DKR A;  3IQQ A;  2HET A;  4N5X A;  1YTZ C;  2F33 A;  3LL8 B;  5DKN A;  2AUC A;  1F55 A;  1BU3 A;  2BNX A;  1SR6 C;  2WC8 A;  2WCL A;  3VB1 A;  2LLU A;  3L4A A;  4CFQ A;  1H8B A;  2M3W A;  1D1O A;  1QX5 B;  1CB1 A;  4MEW A;  2P71 A;  3PFV A;  2AMI A;  1QVI Y;  2GV5 A;  2QEB A;  4F7F A;  1C3Z A;  3PN7 B;  1SY9 A;  1S36 A;  1MXL C;  5KSZ A;  2PYQ A;  1FF1 A;  3K1E A;  1A4P A;  3GOF A;  1CFF A;  2BCA A;  3SG3 A;  1W7J B;  1KK7 Z;  1TNQ A;  2M0R A;  1G33 A;  2F8P A;  2HQW A;  1X02 A;  1BR4 B;  2LAP A;  3SS5 A;  1M39 A;  5AEQ A;  1OOI X;  4AOM A;  3QME A;  1SL8 A;  2L5X B;  3LCP C;  1DGV A;  2L0P A;  2Q4U A;  1B4C A;  2LNK A;  2SAS A;  1S26 D;  1YUR A;  2WCJ A;  3D73 A;  1CMF A;  2KI6 C;  1IRJ A;  2Y1M A;  1K90 D;  3CZ1 A;  1KK8 B;  3FWC A;  5B8I B;  1NX1 A;  1UHK A;  2Y5I A;  3H4S E;  1KQV A;  2TN4 A;  1TNX A;  2LCP A;  1L2O B;  1KQM C;  1PK0 D;  2JWW A;  2JPO A;  2KLD A;  3D74 A;  3SG5 A;  3TZ1 A;  3B6X A;  3VRR A;  1AHR A;  1AJ4 A;  1EG4 A;  1Y1A A;  3EK7 A;  4I5L B;  1NCZ A;  1DF0 B;  2MAZ A;  1OZO A;  5CSI A;  1GJY A;  2JU0 A;  4PT1 A;  2L5Y A;  2L98 A;  4A4B A;  2LC5 A;  3UO9 A;  4JQ0 D;  4F0Z B;  3CTN A;  3HCM A;  5FI6 A;  3BFH A;  3I5H B;  2AAO A;  3DVE A;  1NIW A;  3DVJ A;  4YBH B;  2MHH A;  1B47 A;  4MSP A;  5D7F A;  1WRZ A;  1A03 A;  4Q04 A;  4YRU A;  3I5F C;  4HRE E;  2EHB A;  2E6W A;  1SCM C;  2D8N A;  3QRX A;  2M1K B;  4PAL A;  1C07 A;  2K60 A;  2ERB A;  2FCD A;  2JNF A;  3NHI A;  3B88 A;  5CSN A;  2JTZ A;  4YGE B;  2EGD A;  3DXL A;  2K2F A;  1SSE B;  1WRL A;  3I5G B;  5I94 A;  3TUY C;  2YGU A;  3ICB A;  3NHT A;  2G2B A;  5D69 A;  1OOJ A;  3CZ2 A;  3BUW B;  2MA2 A;  1SPY A;  5CSJ A;  3D75 A;  5D3O A;  3OHM B;  1YUS A;  1XFX O;  3S0D A;  2JC2 A;  1DJX A;  1YRT B;  1CDN A;  3NSL A;  2OTG C;  2QAC A;  1ZMZ A;  4QJ3 B;  3BYA A;  2ZNE A;  2KYC A;  4HRH A;  1AJ5 A;  2QEH A;  4JD9 A;  3HX4 A;  2JOJ A;  4JPZ B;  5FI7 A;  1HT9 A;  4I5J A;  1DEK A;  3CZ0 A;  3BQ3 A;  3FE8 A;  4ORC B;  3S0A A;  2NZ0 A;  4MN0 A;  1HQV A;  1EXR A;  1ZAC A;  3ZNI A;  4YGB B;  1KWO B;  2WC6 A;  1S6J A;  1YUU A;  1EL4 A;  3BOW A;  1K93 D;  2K7D A;  2KFH A;  2M1U A;  2O60 A;  1E8A A;  1TUJ A;  1TUZ A;  2FOT A;  1DJY A;  1QLS A;  1CM1 A;  3EVR A;  3CZT X;  3JTD B;  1Q80 A;  3FIA A;  3FE6 A;  3LLE A;  4N1G A;  4OVN F;  1BF5 A;  2LLT A;  4R1E A;  4UPG A;  1MR8 A;  1XVJ A;  1B8C A;  1OOH A;  1TTX A;  2OS8 C;  2JNX A;  4GGN A;  5IBW A;  2ZRT A;  2PSR A;  2Y1N A;  3CR4 X;  2HPS A;  2RGI A;  1C3Y A;  5HLO A;  1DJW A;  4I5N B;  1PAL A; 
#chains in the Genus database with same CATH homology
 1FI5 A;  3RLZ A;  1JWD A;  1CFD A;  1JBA A;  1IG5 A;  2ZKM X;  1RJV A;  2M97 A;  2KI4 B;  1CDM A;  1V1G A;  1WDC B;  3WNX B;  1Y1X A;  5F6T A;  1JC2 A;  4PCW A;  4ZCV A;  2NCO A;  1A2X A;  1BT6 A;  1YRU B;  1SYM A;  1R2U A;  2KSP A;  2KGB C;  4FTG A;  2BL0 B;  1NWD A;  3FWB A;  4MRX A;  4PE7 A;  4PE1 A;  4WRI A;  2KBM A;  3EVV A;  2LP3 A;  1JFK A;  2JUL A;  3NSK A;  5JJG A;  1UHH A;  5AFP A;  4GPL B;  4MLW A;  1UWO A;  1RTP 1;  2KAV A;  1NX3 A;  2FCE A;  2I7A A;  5FYX A;  2KBI A;  4GFT A;  2PRU A;  1JF0 A;  2VRG A;  4TNC A;  4U8D A;  1SBJ A;  5HKZ A;  1NCY A;  2M49 B;  3C1V A;  2LVJ A;  1DGU A;  1SMG A;  1IQ5 A;  2SCP A;  2JTT A;  2JT8 A;  4BY5 A;  1NP8 A;  3EKH A;  1F4O A;  3TS5 C;  1XO5 A;  3WHT B;  2L4I A;  1SR6 B;  3SIA A;  1LA3 A;  1JF2 A;  1IH0 A;  2L50 A;  4WQ2 A;  3EK8 A;  1VRK A;  4DUQ A;  1YX7 A;  4MZL A;  1OMV A;  2JQ6 A;  1RFJ A;  5CPV A;  2ISD A;  2LE9 B;  1KFX L;  1GGW A;  5G08 A;  1TCO B;  3VGO A;  3DF0 A;  3FS7 A;  5CSF A;  1SK6 D;  1U5I A;  3LK1 A;  1QX2 A;  1QTX A;  2BKH B;  4MZJ A;  2LMT A;  4HRG A;  1MHO A;  4BY4 A;  1DTL A;  4M2Q A;  1MUX A;  2K0J A;  2K61 A;  3M0W A;  1CLB A;  1XFY O;  1UP5 A;  3WXA A;  2Q91 A;  5DKQ A;  2H2K A;  1UUR A;  3DVK A;  1OSA A;  2KNE A;  2LUC A;  3BUX B;  4GUK A;  4XJK B;  3KPX A;  1J55 A;  2MLE C;  3AAK A;  1KQM B;  4P5O E;  3O78 A;  5HYD A;  1CDP A;  1QIV A;  2JXC A;  2LV7 A;  2PAL A;  3A8R A;  2JT0 A;  1CMG A;  1KFU S;  2JPT A;  1DJI A;  1M45 A;  3AKA A;  2LHI A;  1H4B A;  1XK4 C;  1OE9 B;  4PHN A;  4PHM A;  1QVI Z;  1ZFS A;  1A29 A;  1M46 A;  1NSH A;  1WLZ A;  5I2O A;  1J1D A;  4AQJ A;  3D0Y A;  3RM1 A;  2NCP A;  2KAY A;  1S6C A;  4QJ5 B;  3IF7 A;  1PSR A;  1FBV A;  3I5F B;  1NX2 A;  1TN4 A;  2LVI A;  1SCM B;  2V53 A;  3SG2 A;  1J7P A;  1AP4 A;  1EG3 A;  2LVV A;  5KTY A;  3CR5 X;  1WY9 A;  4XYN A;  4ZCU A;  2EC6 C;  1OMD A;  1Y6W A;  4ORA B;  3TUY B;  1C7W A;  5PAL A;  2LUX A;  1UHI A;  1K96 A;  3NXA A;  2K7C A;  1IKU A;  1XK4 A;  1B8L A;  1LVC D;  1TNP A;  1CFP A;  1IGV A;  2CXJ A;  2LHL A;  1PVB A;  3PM8 A;  1DMO A;  2F2P A;  2JZI A;  5HKY A;  3PAT A;  3I5I C;  2LLS A;  3CGA A;  3O6B A;  2JXL A;  2ZRS A;  2NXQ A;  2OTG B;  1F54 A;  1CLL A;  1UUS A;  4PHJ A;  3JVT C;  2ZN8 A;  2G9B A;  2BBM A;  1SKT A;  1F4Q A;  1YX8 A;  1FI6 A;  1SW8 A;  5GQQ C;  3BUM B;  3TDU A;  2GGM A;  2P6B B;  4DIR A;  4M2P A;  2KDH A;  3CLN A;  5AXI A;  1TNW A;  3K21 A;  5KU1 A;  4C0L A;  1PSB A;  4IL1 A;  2KI6 D;  2K7B A;  3EVU A;  1K94 A;  2F2O A;  2KGR A;  1A75 B;  2CCM A;  2BKI B;  1YVL A;  1FPW A;  3A4U B;  2HQ8 A;  2OPO A;  4MRY A;  2E30 A;  1XFU O;  5JOL A;  1K2H A;  2KFG A;  2OS8 B;  2MBX A;  1W7I B;  4GAO A;  2BEC A;  3EK4 A;  1QX7 A;  3OX6 A;  1YUT A;  4MBE A;  4AQI A;  1BG1 A;  1ALV A;  1WLM A;  1NX0 A;  1L7Z A;  5I2Q A;  1N65 A;  2WCB A;  2PMY A;  4OCI A;  1CM4 A;  1GQM A;  1DJG A;  1S5G Y;  1F71 A;  1KSM A;  1SCV A;  1TRF A;  1IWQ A;  1MF8 B;  1REC A;  1CNP A;  1AK8 A;  3VRP A;  4PHK A;  2MLF C;  3GK1 A;  1JSA A;  2CT9 A;  3EKJ A;  1XFZ O;  1BOC A;  1QLK A;  1B9A A;  1BMO A;  1LKJ A;  1SL7 A;  2KQY A;  2I2R E;  2CBL A;  1XA5 A;  2K8M B;  2L2E A;  1SRA A;  4E68 A;  2B1U A;  2R2I A;  3DD4 A;  4ETO A;  5ER5 A;  3D10 A;  1YR5 A;  2BE6 A;  1BJF A;  1Y0V H;  1IQ3 A;  1WRK A;  1DJZ A;  3PN7 C;  1G8I A;  2ZN9 A;  1CDL A;  2I94 A;  1QV1 A;  2WOS A;  1QV0 A;  3DF0 B;  4GBA A;  1ALW A;  1U5I B;  2WOR A;  3OB1 B;  3IQO A;  1OQP A;  2KYF A;  1TCF A;  1K9P A;  1QXP A;  3TS5 B;  1LIN A;  2M29 A;  4CPV A;  4OV2 A;  2K2A A;  2L51 A;  4CLN A;  4YI9 A;  1JUO A;  2FJU B;  1B8R A;  2CNP A;  4JWQ A;  1M31 A;  2L4H A;  3CS1 A;  3CWG A;  5HKW A;  1CKK A;  1MQ1 A;  1J1E A;  1EJ3 A;  5I8N A;  3AAJ A;  1XYD A;  2LM5 A;  2M7L A;  4P2Y B;  1V1F A;  1KK8 C;  4GGF C;  5HLV A;  1DJH A;  3TDZ A;  4D1E A;  1L2O C;  2KQ6 A;  3SIB A;  3MSE B;  3F45 A;  1J7Q A;  1S5G Z;  2HF5 A;  2GGZ A;  1AVS A;  1UHJ A;  3NSI A;  2QPT A;  2ZFD A;  3BUN B;  4OR9 B;  3NSO A;  3O2P A;  1F70 A;  2I18 A;  3BXK A;  1S1E A;  1SL9 A;  2LAN A;  1K9U A;  1K8U A;  1NCX A;  3I5H C;  3E3R A;  4OKH A;  4PDZ A;  1B7T Y;  1C7V A;  5K89 A;  3D0Y B;  4N1F A;  3DVM A;  1OMR A;  1XFV O;  4MVF A;  4YGC B;  2M9G A;  2LMV A;  2WCE A;  2KHN A;  4GGF A;  1QAT A;  1NUB A;  1RWY A;  1BLQ A;  1K9K A;  4YGA A;  2COL B;  3ZWH A;  1SNL A;  2KAX A;  3WHU B;  4YGD B;  3I5G C;  1DF0 A;  5J3X A;  1N0Y A;  2ZND A;  4L9M A;  4NDD A;  4YI8 A;  1QIW A;  1IJ5 A;  1N2D A;  1CFC A;  1LXF C;  4XJK A;  3TDI A;  4NDB A;  1DT7 B;  2PAS A;  3VRN A;  4CFR A;  3SG6 A;  3AKB A;  2CTN A;  3PLF B;  1JFJ A;  4I5K A;  1NPQ A;  2BBN A;  3BOW B;  3VRO A;  2LP2 A;  4C0K A;  1PUL A;  1EH2 A;  2BE4 A;  4DS7 A;  2BCX A;  1KCY A;  2EC6 B;  1IJ6 A;  4ORB B;  1YVH A;  1K95 A;  2DOQ A;  3OP0 A;  1ZOT B;  1AUI B;  1QJT A;  1J7R A;  1M63 B;  1PRW A;  3OX5 A;  1KWO C;  4NQG A;  3SG4 A;  1QS7 A;  2Y4Q A;  3LK0 A;  2H61 C;  1S3P A;  3I5I B;  5AAN A;  3KEV A;  1G4Y R;  1KFX S;  3JTD C;  3JVT B;  3PAL A;  4GNK B;  2O5G A;  2K7O A;  2LVK A;  2M7N A;  3GK4 X;  1BR1 B;  2PVB A;  1B7T Z;  4PE0 A;  3KF9 A;  4USL A;  3OB2 B;  1F8H A;  1KSO A;  2KOT A;  1QAS A;  5ER4 X;  3BUO B;  4HSZ A;  2A4J A;  1KK7 Y;  2H61 A;  1OZS A;  4NDC A;  2LMU A;  1Y1U A;  3KO0 A;  1UHN A;  3SJS A;  2JRF A;  1ZUZ A;  3VRQ A;  4QJ4 B;  4WQ3 A;  1XFW O;  1PVA A;  5TNC A;  2F3Y A;  1NYA A;  1TOP A;  3O4Y A;  4PE4 A;  1RRO A;  1CTR A;  2WND A;  2NLN A;  4M2O A;  3PSR A;  4DCK A;  1B1G A;  4DRW A;  1MXE A;  1TIZ A;  2KI4 C;  3SG7 A;  2WCF A;  5BPJ A;  1BOD A;  1WDC C;  1LA0 A;  2MRD A;  4MZK A;  4A4C A;  1KFU L;  1GGZ A;  2KFF A;  1A75 A;  1FW4 A;  2BL0 C;  1RK9 A;  2IS9 A;  4CID A;  3CR2 A;  1CLM A;  2M8U A;  1DVI A;  1J7O A;  3KHE A;  2F3Z A;  3GK2 A;  1MWN A;  2JT3 A;  4ICB A;  4C0J A;  1ODB A;  2BCB A;  2MJW B;  4FQO A;  1S6I A;  5AER A;  1R6P A;  5I2L A;  5DKR A;  3IQQ A;  2HET A;  4N5X A;  1YTZ C;  2F33 A;  3LL8 B;  5DKN A;  2AUC A;  1F55 A;  1BU3 A;  1SR6 C;  2WC8 A;  2LLU A;  4CFQ A;  1H8B A;  2M3W A;  1D1O A;  1QX5 B;  1CB1 A;  4MEW A;  3PFV A;  2AMI A;  1QVI Y;  2GV5 A;  3PN7 B;  1SY9 A;  1S36 A;  1MXL C;  5KSZ A;  1FF1 A;  1A4P A;  3GOF A;  1CFF A;  2BCA A;  3SG3 A;  1W7J B;  1KK7 Z;  1TNQ A;  2M0R A;  1G33 A;  2F8P A;  2HQW A;  1X02 A;  1BR4 B;  2LAP A;  1M39 A;  5AEQ A;  4AOM A;  1SL8 A;  2L5X B;  3LCP C;  1DGV A;  2L0P A;  2Q4U A;  1B4C A;  2LNK A;  2SAS A;  1S26 D;  1YUR A;  1CMF A;  2KI6 C;  1IRJ A;  2Y1M A;  1K90 D;  3FWC A;  1KK8 B;  5B8I B;  1NX1 A;  1UHK A;  2Y5I A;  3H4S E;  1KQV A;  2TN4 A;  1TNX A;  2LCP A;  1L2O B;  1KQM C;  1PK0 D;  2JWW A;  3SG5 A;  3TZ1 A;  3VRR A;  1AHR A;  1AJ4 A;  1EG4 A;  1Y1A A;  3EK7 A;  4I5L B;  1NCZ A;  1DF0 B;  2MAZ A;  1OZO A;  5CSI A;  1GJY A;  2JU0 A;  4A4B A;  2L98 A;  2LC5 A;  4JQ0 D;  4F0Z B;  3CTN A;  3HCM A;  3I5H B;  2AAO A;  3DVE A;  1NIW A;  3DVJ A;  4YBH B;  2MHH A;  1B47 A;  4MSP A;  5D7F A;  1WRZ A;  1A03 A;  4Q04 A;  4YRU A;  3I5F C;  4HRE E;  2EHB A;  2E6W A;  1SCM C;  2D8N A;  3QRX A;  2M1K B;  4PAL A;  1C07 A;  2FCD A;  2JNF A;  5CSN A;  4YGE B;  2JTZ A;  2EGD A;  2K2F A;  1WRL A;  3I5G B;  3TUY C;  3ICB A;  2G2B A;  5D69 A;  1OOJ A;  3BUW B;  2MA2 A;  1SPY A;  5CSJ A;  3OHM B;  1YUS A;  1XFX O;  2JC2 A;  1DJX A;  1YRT B;  1CDN A;  3NSL A;  2OTG C;  2QAC A;  1ZMZ A;  4QJ3 B;  3BYA A;  2ZNE A;  2KYC A;  4HRH A;  1AJ5 A;  3HX4 A;  2JOJ A;  4JPZ B;  1HT9 A;  4I5J A;  3BQ3 A;  4ORC B;  2NZ0 A;  4MN0 A;  1HQV A;  1EXR A;  1ZAC A;  3ZNI A;  4YGB B;  1KWO B;  1S6J A;  1YUU A;  1EL4 A;  3BOW A;  1K93 D;  2K7D A;  2KFH A;  2M1U A;  2O60 A;  1E8A A;  2FOT A;  1DJY A;  1QLS A;  1CM1 A;  3EVR A;  3CZT X;  3JTD B;  1Q80 A;  3FIA A;  3LLE A;  4N1G A;  1BF5 A;  4OVN F;  2LLT A;  4R1E A;  4UPG A;  1MR8 A;  1XVJ A;  1B8C A;  1TTX A;  2OS8 C;  2JNX A;  4GGN A;  5IBW A;  2ZRT A;  2PSR A;  2Y1N A;  3CR4 X;  2HPS A;  2RGI A;  5HLO A;  1DJW A;  4I5N B;  1PAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...