4DUQA

The structure of ca2+-loaded s100a2 at 1.3a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
88
Chain Sequence
b'SSSLEQALAVLVTTFHKYSSQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMSNDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A2
molecule tags Metal binding protein
source organism Homo sapiens
publication title The structure of Ca2+-loaded S100A2 at 1.3- angstrom resolution.
pubmed doi rcsb
total genus 35
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4duqA00
3SG3A 2LVIA 2JT0A 1QVIY 1CFPA 3A4UB 2L51A 3DVJA 3OX6A 1BJFA 2MA2A 1K90D 1LA0A 1XK4A 2K2AA 4YGEB 3NXAA 5AANA 1J7QA 4MRYA 1OZOA 2EHBA 3HCMA 4ORAB 1JF0A 1NX2A 2L5XB 5CSNA 1B4CA 1F8HA 1TNPA 2ZFDA 2A4JA 3HX4A 1S6JA 3A8RA 1F54A 1YVHA 5TNCA 4C0LA 1Y1XA 1LINA 2CTNA 1LXFC 2KNEA 3BUWB 3CR2A 1GGZA 1XFYO 3D10A 2ZN8A 4ORCB 1RK9A 4WRIA 1XFWO 2JPTA 1L2OB 1J1DA 2COLB 2JTZA 2JT8A 1R2UA 2KHNA 2BBNA 1DF0A 4OCIA 1XYDA 2BECA 1NCXA 2TN4A 4HREE 3I5GC 5CSFA 2M0RA 2L50A 4QJ4B 4I5JA 5I2LA 2KGBC 2GGMA 1FI5A 4D1EA 1TN4A 2M3WA 4MRXA 2BE6A 1H4BA 2K7BA 3ZWHA 1S5GZ 2BKHB 3JVTB 1EG3A 2O5GA 3KPXA 1NUBA 5D7FA 1ALWA 2KOTA 1A03A 1EL4A 1JBAA 1TOPA 1ZACA 2PMYA 1BU3A 3IF7A 2B1UA 2SASA 1M39A 2JOJA 4TNCA 3BUMB 3WHTB 1UUSA 1V1FA 5HKZA 2MRDA 1NP8A 1CLMA 1MWNA 1FF1A 1K96A 2ZNEA 3O4YA 4FQOA 1B8RA 1G4YR 2BKIB 3DVEA 1DF0B 1CM1A 1F4OA 1UHJA 1M31A 2LCPA 4GGNA 1KK7Z 2BCAA 3OHMB 3E3RA 3VRNA 1YUTA 1DJZA 2VRGA 1B47A 5D69A 1B8CA 1DT7B 3GK4X 1QJTA 2WCBA 2MBXA 1DMOA 1YX8A 3TDIA 1QX7A 1XVJA 2JNFA 2KI6C 2CNPA 1JF2A 3CS1A 1SR6B 3SG6A 3I5FC 1K8UA 1PULA 2KDHA 3PFVA 2HQ8A 4HRGA 1SCVA 4U8DA 4GGFC 2L4IA 1S3PA 1WRZA 2KQ6A 4P2YB 1IQ5A 3M0WA 1SBJA 1S36A 5HKYA 3D0YB 3BUOB 4WQ3A 5AEQA 2L98A 1ZUZA 3PN7B 1QTXA 1NPQA 1PVAA 2EC6C 2FOTA 1A4PA 2G2BA 4PDZA 3TUYC 4PALA 2Y1MA 1DGVA 1UURA 1WDCB 3TS5B 1JSAA 4DUQA 3LL8B 3EK8A 4C0KA 1BG1A 2JXCA 3EKJA 4NDCA 3NSLA 1DJHA 1OSAA 1UWOA 2LE9B 3OB2B 2KAYA 3FWBA 1GJYA 4PE4A 4QJ5B 2JWWA 1WRKA 2I2RE 4MZLA 2BE4A 1BOCA 5I2QA 1SL8A 2K61A 2ZRTA 4C0JA 5KSZA 1OE9B 1BT6A 2LMUA 2OS8B 4XJKB 3OB1B 1K2HA 1TIZA 3IQOA 1CFFA 4AOMA 3KO0A 2FCEA 1SKTA 1CDMA 1AVSA 2ZRSA 3O78A 2LMVA 2QPTA 3I5HB 1G8IA 3NSKA 1B7TY 1YUSA 1KK7Y 2K8MB 4USLA 2LVJA 1KFUS 2AUCA 2LANA 2NLNA 1UHIA 2KGRA 3EK7A 4CLNA 3SG2A 2M8UA 1W7IB 4GFTA 1RECA 3O6BA 1IJ6A 2O60A 1J7RA 4CPVA 2K7DA 2HPSA 5JOLA 2FJUB 4ORBB 3PLFB 1C7WA 2JT3A 3GK2A 1IRJA 4L9MA 1AP4A 1AHRA 1RJVA 2QACA 1K9UA 5HLOA 1C7VA 4DS7A 3LCPC 1ZOTB 3FIAA 3IQQA 4JQ0D 5F6TA 1LKJA 3I5IC 1PSRA 2KFGA 1XO5A 2MLFC 2M7NA 2K2FA 1J55A 1S26D 2Y1NA 3K21A 2ZNDA 4MEWA 3GK1A 4MVFA 2LUXA 3CTNA 3JTDB 1L2OC 1OMVA 4A4CA 1QV0A 1AJ4A 1MXLC 3OX5A 4XJKA 5PALA 2CT9A 2NCPA 1IG5A 2MHHA 1HQVA 1UHKA 2LHLA 3BXKA 1IJ5A 1QATA 2P6BB 4DCKA 1TNXA 2SCPA 4YI8A 3KEVA 1EJ3A 1KK8C 3CR5X 1RROA 4OR9B 5HKWA 2NZ0A 2V53A 4QJ3B 3BOWB 2LLTA 2KI6D 2KFFA 2L0PA 3PN7C 2M9GA 3RM1A 2JXLA 1BR4B 1MUXA 3I5HC 2M7LA 1M46A 2KI4B 2M1KB 3AAKA 4A4BA 4PE7A 4CIDA 1FW4A 1KQMB 2WC8A 4GNKB 1SRAA 4WQ2A 1JWDA 1M63B 1U5IA 2LP3A 4OKHA 4YGAA 1PK0D 4GGFA 3VGOA 1C07A 1CFDA 2KBIA 4DIRA 3EK4A 1PVBA 2CCMA 3QRXA 1F4QA 3JTDC 3MSEB 3FS7A 4PHMA 2EGDA 1KSMA 1A29A 1DTLA 5AFPA 1CKKA 2ZN9A 4CFQA 2LHIA 2F2PA 1IGVA 4PE0A 3I5IB 2M29A 1QX2A 1KSOA 2LUCA 3CGAA 3H4SE 4PCWA 5I2OA 1KWOC 2BL0B 2NCOA 1CNPA 1SCMC 2E6WA 3AKAA 4DRWA 3CWGA 1Q80A 2AMIA 2KSPA 5DKQA 1MHOA 1CFCA 1NCZA 1FBVA 1S1EA 1SPYA 1TNWA 1ZMZA 1OMDA 5BPJA 1D1OA 5G08A 2L2EA 4I5NB 3D0YA 2PALA 1YUUA 5HYDA 4MLWA 2F3YA 1Y0VH 2EC6B 1HT9A 1YR5A 1BR1B 1K95A 3SJSA 3EVRA 2KBMA 4FTGA 4OVNF 4XYNA 2L4HA 2WCEA 4I5LB 3CZTX 2G9BA 4N1GA 2JRFA 5CSIA 1RWYA 4M2OA 2WOSA 2Y5IA 4M2PA 3F45A 1DJIA 1BF5A 1J1EA 1K9KA 1N65A 1EG4A 2PVBA 4Q04A 5DKRA 5JJGA 2OS8C 2AAOA 1YVLA 1M45A 1NX3A 1V1GA 1JUOA 4OV2A 1FI6A 3SIBA 3DVMA 1JFKA 1QX5B 4NQGA 5ER5A 4ZCUA 2R2IA 4NDDA 3NSOA 4YRUA 1IH0A 1ALVA 1N2DA 1NYAA 3VRPA 2BCXA 5I8NA 2IS9A 2KYFA 1IQ3A 4R1EA 2LP2A 1MXEA 1CM4A 1KCYA 2H2KA 3GOFA 3TUYB 3DD4A 1MQ1A 1RFJA 1KQVA 1B7TZ 2OTGB 2PASA 3BQ3A 3PM8A 1S5GY 1WY9A 5CSJA 3AAJA 2HETA 2JNXA 3BUNB 4PHNA 1JFJA 4GUKA 1N0YA 1SR6C 3O2PA 5AERA 1F71A 4PE1A 1K9PA 1XFXO 1NX0A 2BCBA 2KFHA 4YGDB 1TRFA 2I18A 1B9AA 3VROA 1FPWA 3LK0A 1PRWA 1A2XA 2H61C 2KAXA 5CPVA 4AQIA 1CB1A 4I5KA 2LVVA 3VRQA 5J3XA 1TNQA 1WRLA 4GBAA 1H8BA 1SNLA 1OOJA 4GAOA 1KFUL 3TS5C 1TCOB 1QV1A 4AQJA 1R6PA 1DJWA 2K7CA 1Y6WA 1JC2A 3PALA 4BY4A 1QVIZ 2LNKA 2LV7A 3EVVA 1SYMA 1LA3A 1KFXL 1EH2A 1SW8A 4YGCB 1J7OA 2GGZA 1CDPA 2K0JA 2E30A 3EVUA 5AXIA 1PALA 1F70A 2JC2A 5ER4X 1OZSA 1NSHA 4GPLB 3DF0B 3SIAA 1AUIB 3BYAA 3AKBA 4ICBA 3SG7A 1AK8A 1WLZA 3SG4A 1G33A 1NCYA 2F2OA 1S6IA 3CR4X 3TZ1A 5K89A 3TDUA 1Y1AA 2JTTA 1IWQA 3BUXB 2LLSA 1QS7A 1XFVO 3NSIA 5HLVA 4MZKA 5DKNA 3CLNA 1K94A 4N1FA 3EKHA 1PSBA 1DJGA 3ICBA 3LLEA 1DVIA 4MZJA 1X02A 2HQWA 3SG5A 4P5OE 2KYCA 1CDNA 1KQMC 1YTZC 1Y1UA 3RLZA 2ISDA 1YRTB 1XFUO 1DJYA 4E68A 4ZCVA 1SMGA 1QLSA 3ZNIA 1BLQA 2KI4C 2FCDA 3WNXB 2PSRA 1MR8A 2M49B 5KU1A 2CBLA 1BMOA 2OTGC 1TCFA 1S6CA 2LMTA 1SK6D 2JULA 4MBEA 4ETOA 2BL0C 1UP5A 1KK8B 2HF5A 2RGIA 3FWCA 3I5FB 3OP0A 2DOQA 2M1UA 1DGUA 2WORA 1CDLA 1QIWA 1U5IB 1VRKA 4F0ZB 1WLMA 3WXAA 1K93D 2MAZA 4MSPA 2KQYA 2LAPA 4PHKA 2H61A 4IL1A 2MJWB 2NXQA 1B8LA 2GV5A 2JU0A 4N5XA 4YI9A 2ZKMX 4JWQA 2LM5A 2PRUA 1RTP1 2LC5A 2D8NA 1CLBA 4UPGA 1DJXA 3I5GB 2MLEC 3BOWA 2OPOA 3LK1A 2F8PA 3DVKA 1XK4C 1CMGA 5KTYA 1L7ZA 2K7OA 3PATA 1KFXS 2WNDA 1XA5A 1OMRA 1QASA 1A75B 1WDCC 2CXJA 2M97A 4YBHB 3KF9A 4JPZB 2I94A 2LLUA 1YX7A 2F33A 1SCMB 1F55A 5FYXA 1MF8B 3TDZA 1QIVA 4HSZA 1CTRA 1SY9A 1YRUB 4BY5A 2KAVA 1IKUA 4M2QA 1AJ5A 4YGBB 1TTXA 5GQQC 1J7PA 1NWDA 1B1GA 2I7AA 3WHUB 4MN0A 1NIWA 3VRRA 5B8IB 1LVCD 1SL7A 5IBWA 3KHEA 2Y4QA 1OQPA 2F3ZA 2JQ6A 1ODBA 4HRHA 3DF0A 1A75A 2LVKA 4NDBA 1GQMA 1KWOB 2BBMA 4PHJA 2Q91A 1CMFA 1EXRA 2Q4UA 3JVTC 1ZFSA 4CFRA 1YURA 3C1VA 1E8AA 1SL9A 2WCFA 1QLKA 1QXPA 1UHHA 1UHNA 1XFZO 1BODA 1GGWA 3PSRA 2JZIA 1CLLA 1NX1A 1W7JB
chains in the Genus database with same CATH superfamily
3SG3A 3D78A 2LVIA 2JT0A 1QVIY 1CFPA 3A4UB 2L51A 3DVJA 3OX6A 1IIOA 1BJFA 2MA2A 1K90D 1LA0A 1XK4A 2K2AA 4YGEB 3NXAA 5AANA 1J7QA 4MRYA 1OZOA 2EHBA 2QEOA 3HCMA 3OBVA 4ORAB 1JF0A 1NX2A 2L5XB 5CSNA 1B4CA 1F8HA 1TNPA 2ZFDA 2A4JA 3HX4A 1S6JA 3A8RA 1F54A 1YVHA 5TNCA 4C0LA 1Y1XA 1LINA 3R72A 2CTNA 1LXFC 2KNEA 3BUWB 3CR2A 1GGZA 1XFYO 3D10A 2ZN8A 4ORCB 1RK9A 4WRIA 1XFWO 2JPTA 1L2OB 1J1DA 2COLB 2JTZA 2KPHA 3SS4A 3PJIA 2JT8A 1R2UA 2KHNA 2BBNA 1DF0A 4OCIA 3EG5B 1XYDA 2BECA 1NCXA 2TN4A 4HREE 3DY9A 3I5GC 5CSFA 2M0RA 2L50A 4QJ4B 4I5JA 5I2LA 2KGBC 2GGMA 1FI5A 4D1EA 1TN4A 2M3WA 4MRXA 2BE6A 1C3YA 2K7BA 1H4BA 3DXLA 1C3ZA 1S5GZ 1TUJA 2BKHB 3JVTB 3ZWHA 1EG3A 2O5GA 2BAPA 3KPXA 1NUBA 4OZDA 3FE9A 1ALWA 2KOTA 5D7FA 3IVTA 1A03A 1EL4A 1JBAA 1TOPA 1ZACA 2WC6A 2PMYA 1BU3A 3IF7A 2B1UA 2SASA 1M39A 2JOJA 1Z2CB 4TNCA 3B6XA 3BUMB 3OGNA 3WHTB 1UUSA 1V1FA 5HKZA 2MRDA 1NP8A 1CLMA 1MWNA 1FF1A 1K96A 2ZNEA 3O4YA 4FQOA 1B8RA 3NHIA 1G4YR 2BKIB 3DVEA 1DF0B 3SS5A 1CM1A 1F4OA 1UHJA 1M31A 2LCPA 4GGNA 1KK7Z 2BCAA 3OHMB 3E3RA 3VRNA 1YUTA 1DJZA 2VRGA 1B47A 5D69A 3RZSA 1B8CA 1DT7B 3GK4X 1QJTA 2WCBA 2MBXA 3V2LA 1DMOA 3FE6A 1YX8A 3BJHA 3TDIA 1QX7A 1XVJA 2JNFA 2KI6C 2CNPA 1JF2A 3CS1A 1SR6B 3SG6A 3I5FC 1K8UA 1PULA 2KDHA 3PFVA 2HQ8A 4HRGA 1SCVA 4U8DA 4GGFC 2L4IA 1S3PA 1WRZA 2KQ6A 4P2YB 1IQ5A 3M0WA 1SBJA 2WCMA 1S36A 4KYNA 5HKYA 3D0YB 3NHTA 3B88A 3BUOB 4WQ3A 2QEBA 5AEQA 2L98A 1ZUZA 3S0AA 3PN7B 1QTXA 2P71A 1NPQA 1PVAA 2EC6C 2FOTA 1A4PA 2G2BA 4PDZA 3TUYC 4PALA 5I94A 2Y1MA 1DGVA 1UURA 1WDCB 3TS5B 1JSAA 4DUQA 3LL8B 3EK8A 4C0KA 1BG1A 3DZTA 2JXCA 3EKJA 1OOGA 4NDCA 3NSLA 1DJHA 1OSAA 1UWOA 3SS3A 2LE9B 5D3OA 3OB2B 2KAYA 3FWBA 2WCJA 1GJYA 4PE4A 4QJ5B 2JWWA 4IJ7A 1WRKA 2I2RE 3CDNA 4MZLA 2BE4A 1BOCA 5I2QA 1SL8A 2K61A 2ZRTA 3N7HA 4C0JA 5KSZA 2H8VA 5FI7A 1OE9B 1BT6A 2LMUA 2OS8B 4XJKB 3OB1B 3UO9A 1K2HA 1TIZA 4FQTA 3IQOA 1CFFA 4AOMA 3KO0A 2FCEA 1SKTA 1CDMA 1AVSA 2ZRSA 3O78A 2LMVA 2QPTA 3I5HB 1G8IA 3NSKA 1B7TY 1YUSA 1KK7Y 2K8MB 4USLA 4F7FA 1TUZA 2LVJA 1KFUS 2AUCA 2LANA 2NLNA 1UHIA 3CZ1A 2KGRA 2JPOA 3EK7A 4CLNA 3SG2A 2M8UA 1W7IB 4GFTA 1RECA 3O6BA 1IJ6A 1DELA 2O60A 1J7RA 4CPVA 2K7DA 2HPSA 5JOLA 2FJUB 4ORBB 3PLFB 1C7WA 2JT3A 3GK2A 1IRJA 4L9MA 1AP4A 1AHRA 1RJVA 2QACA 1K9UA 5HLOA 1C7VA 4DS7A 3LCPC 1ZOTB 3FIAA 3IQQA 4JQ0D 1Z4HA 5F6TA 1LKJA 3I5IC 1PSRA 2KFGA 1XO5A 2MLFC 2M7NA 2K2FA 1J55A 1S26D 2Y1NA 3K21A 2ZNDA 5DICA 4MEWA 3GK1A 4MVFA 2LUXA 3CTNA 3JTDB 1L2OC 1OMVA 4A4CA 1QV0A 1AJ4A 1MXLC 3OX5A 4XJKA 5PALA 2CT9A 2NCPA 2KLDA 1IG5A 2MHHA 1HQVA 1UHKA 2LHLA 3BXKA 1IJ5A 2KLEA 1QATA 2P6BB 4DCKA 1TNXA 2SCPA 4YI8A 3KEVA 1EJ3A 1KK8C 3CR5X 1RROA 4OR9B 5HKWA 2NZ0A 2V53A 4QJ3B 3BOWB 2LLTA 2KI6D 2KFFA 2L0PA 3PN7C 2M9GA 5HL1A 3SG5A 2P70A 3RM1A 2JXLA 1BR4B 1MUXA 3I5HC 2M7LA 1M46A 2KI4B 2M1KB 3AAKA 4A4BA 4PE7A 4CIDA 1FW4A 1KQMB 2WC8A 4GNKB 1SRAA 4WQ2A 1JWDA 1M63B 1U5IA 2LP3A 4OKHA 4YGAA 1PK0D 4GGFA 3VGOA 1C07A 1CFDA 2KBIA 4DIRA 3EK4A 1PVBA 2CCMA 3QRXA 1F4QA 3B86A 3JTDC 3MSEB 3BFAA 3FS7A 1DEKA 2WCKA 3Q8IA 2EGDA 4PHMA 1KSMA 1A29A 5FI2A 1DTLA 5AFPA 1CKKA 2ZN9A 3S0EA 1W9ZA 4CFQA 2LHIA 2F2PA 1IGVA 4PE0A 3I5IB 2M29A 1QX2A 1KSOA 2LUCA 3CGAA 3H4SE 3FE8A 4PCWA 5I2OA 1KWOC 1OOIX 2BL0B 2NCOA 1CNPA 1SCMC 3L4AA 2E6WA 3AKAA 2BNXA 3CWGA 4DRWA 1Q80A 2AMIA 2KSPA 5DKQA 1MHOA 1CFCA 1NCZA 1FBVA 1S1EA 1SPYA 1TNWA 1ZMZA 1OMDA 5BPJA 1D1OA 5G08A 2L2EA 4I5NB 3D0YA 2PALA 1YUUA 5HYDA 4MLWA 2F3YA 1Y0VH 2EC6B 1HT9A 1OOFA 1YR5A 1BR1B 1K95A 3SJSA 3EVRA 2KBMA 4FTGA 3NGVA 4JD9A 4OVNF 4XYNA 3S0FA 2L4HA 2WCEA 4I5LB 2WCHA 1DC1A 3CZTX 2G9BA 2L5YA 2JRFA 4N1GA 5CSIA 3CYZA 1RWYA 3VB1A 4M2OA 2WOSA 2Y5IA 3BFHA 4M2PA 3F45A 1DJIA 1BF5A 1J1EA 1K9KA 1N65A 1EG4A 2PVBA 4Q04A 5DKRA 5JJGA 2OS8C 2AAOA 2FJYA 1YVLA 1OOHA 3D75A 1M45A 1NX3A 1V1GA 3B7AA 1JUOA 4OV2A 1FI6A 3SIBA 3DVMA 1JFKA 1QX5B 4NQGA 5ER5A 4ZCUA 2R2IA 4NDDA 3NSOA 4YRUA 1IH0A 1ALVA 1N2DA 1NYAA 3VRPA 2BCXA 5I8NA 4PT1A 2IS9A 2KYFA 1IQ3A 4R1EA 2LP2A 1MXEA 1CM4A 1KCYA 2H2KA 3GOFA 3TUYB 3DD4A 1MQ1A 1RFJA 1KQVA 1B7TZ 2OTGB 2PASA 3BQ3A 3PM8A 1S5GY 1WY9A 5CSJA 3AAJA 3CABA 2HETA 3S0BA 2JNXA 3BUNB 4PHNA 1JFJA 4GUKA 1N0YA 1SR6C 3O2PA 5AERA 1F71A 4PE1A 1K9PA 1XFXO 1NX0A 3B87A 2BCBA 4INWA 2KFHA 4YGDB 1TRFA 2I18A 1B9AA 3VROA 1FPWA 1ORGA 3S0DA 3LK0A 1PRWA 2PYQA 1A2XA 2H61C 2KAXA 5CPVA 4AQIA 1CB1A 1T14A 4JKTA 4I5KA 2LVVA 3VRQA 5J3XA 1TNQA 1WRLA 1SSEB 4GBAA 1H8BA 1SNLA 1OOJA 4GAOA 3CZ2A 1KFUL 2WC5A 3TS5C 1TCOB 1QV1A 4AQJA 1R6PA 1DJWA 2K7CA 3D76A 1Y6WA 1JC2A 3PALA 4BY4A 2L2CA 1QVIZ 2LNKA 2LV7A 3EVVA 1SYMA 1LA3A 1KFXL 1EH2A 1SW8A 2PQLA 4YGCB 1J7OA 2GGZA 1CDPA 2K0JA 2E30A 3EVUA 5AXIA 1PALA 3R1VA 1F70A 2JC2A 5ER4X 1OZSA 1NSHA 4GPLB 3DF0B 3SIAA 1AUIB 3BYAA 3AKBA 4ICBA 3SG7A 1AK8A 2YGUA 1WLZA 3SG4A 1G33A 3O4XA 1NCYA 2F2OA 1S6IA 3CR4X 2K60A 3TZ1A 3TDUA 5K89A 1Y1AA 2JTTA 1IWQA 3BUXB 2LLSA 1QS7A 1XFVO 3NSIA 5HLVA 4MZKA 5DKNA 1P28A 3CLNA 1K94A 4N1FA 3EKHA 1PSBA 1DJGA 3ICBA 3LLEA 1DVIA 4MZJA 1X02A 2HQWA 3S0GA 4P5OE 2KYCA 1CDNA 1KQMC 1YTZC 1Y1UA 3RLZA 2ISDA 1YRTB 1XFUO 2ERBA 1DJYA 3BFBA 4E68A 3DYEA 1SMGA 4ZCVA 1QLSA 3ZNIA 1BLQA 2GTEA 2KI4C 2FCDA 1LS8A 3WNXB 2PSRA 1MR8A 2M49B 5KU1A 2CBLA 1BMOA 2OTGC 1TCFA 1S6CA 2LMTA 1SK6D 2JULA 4MBEA 4ETOA 2BL0C 1UP5A 1KK8B 2HF5A 2RGIA 3FWCA 3I5FB 3OP0A 2DOQA 2M1UA 1DGUA 2WORA 1CDLA 1QIWA 1U5IB 1VRKA 3QMEA 4F0ZB 1WLMA 3WXAA 1K93D 2MAZA 4MSPA 2KQYA 2LAPA 3CZ0A 4PHKA 2H61A 4IL1A 2MJWB 2NXQA 1B8LA 2GV5A 2JU0A 3L4LA 4N5XA 3R1PA 4YI9A 2QEVA 2ZKMX 4JWQA 1TWOA 2LM5A 2PRUA 1RTP1 2LC5A 3L47A 2D8NA 1CLBA 5FI6A 4UPGA 1DJXA 3I5GB 1QWVA 2MLEC 3BOWA 2OPOA 3LK1A 2F8PA 3DVKA 1XK4C 1CMGA 5KTYA 3D77A 1L7ZA 2K7OA 3PATA 1KFXS 3R1OA 2WNDA 1XA5A 1OMRA 1QASA 1A75B 1WDCC 1XFRA 2CXJA 2M97A 4YBHB 3KF9A 4JPZB 2I94A 2LLUA 1YX7A 2F33A 1SCMB 1F55A 5FYXA 1MF8B 3D73A 1QIVA 3D74A 3TDZA 4HSZA 1CTRA 1SY9A 1YRUB 4BY5A 2KAVA 1IKUA 4M2QA 1AJ5A 4YGBB 1TTXA 5GQQC 1J7PA 5EL2A 2WCLA 1NWDA 2QEHA 1B1GA 2I7AA 3UNWA 4MN0A 1NIWA 3VRRA 3WHUB 5B8IB 1LVCD 1SL7A 5IBWA 3KHEA 2Y4QA 1OQPA 2F3ZA 2JQ6A 1ODBA 4HRHA 3DF0A 1A75A 2LVKA 4NDBA 1GQMA 1DQEA 1KWOB 2BBMA 2Q91A 4PHJA 1CMFA 1EXRA 2Q4UA 4INXA 1OW4A 3JVTC 1ZFSA 4CFRA 1YURA 3C1VA 3K1EA 1E8AA 1SL9A 2WCFA 1QLKA 1QXPA 1UHHA 1UHNA 1XFZO 1BODA 1GM0A 3PM2A 3PSRA 1GGWA 2JZIA 1CLLA 1NX1A 2QDIA 1W7JB
chains in the Genus database with same CATH topology
3SG3A 2LVIA 2JT0A 1QVIY 1CFPA 3A4UB 2L51A 3DVJA 3OX6A 1BJFA 2MA2A 1K90D 1LA0A 1XK4A 2K2AA 4YGEB 3NXAA 5AANA 1J7QA 4MRYA 1OZOA 2EHBA 3HCMA 4ORAB 1JF0A 1NX2A 2L5XB 5CSNA 1B4CA 1F8HA 1TNPA 2ZFDA 2A4JA 3HX4A 1S6JA 3A8RA 1F54A 1YVHA 5TNCA 4C0LA 1Y1XA 1LINA 2CTNA 1LXFC 2KNEA 3BUWB 3CR2A 1GGZA 1XFYO 3D10A 2ZN8A 4ORCB 1RK9A 4WRIA 1XFWO 2JPTA 1L2OB 1J1DA 2COLB 2JTZA 2JT8A 1R2UA 2KHNA 2BBNA 1DF0A 4OCIA 1XYDA 2BECA 1NCXA 2TN4A 4HREE 3I5GC 5CSFA 2M0RA 2L50A 4QJ4B 4I5JA 5I2LA 2KGBC 2GGMA 1FI5A 4D1EA 1TN4A 2M3WA 4MRXA 2BE6A 1H4BA 2K7BA 3ZWHA 1S5GZ 2BKHB 3JVTB 1EG3A 2O5GA 3KPXA 1NUBA 5D7FA 1ALWA 2KOTA 1A03A 1EL4A 1JBAA 1TOPA 1ZACA 2PMYA 1BU3A 3IF7A 2B1UA 2SASA 1M39A 2JOJA 4TNCA 3BUMB 3WHTB 1UUSA 1V1FA 5HKZA 2MRDA 1NP8A 1CLMA 1MWNA 1FF1A 1K96A 2ZNEA 3O4YA 4FQOA 1B8RA 1G4YR 2BKIB 3DVEA 1DF0B 1CM1A 1F4OA 1UHJA 1M31A 2LCPA 4GGNA 1KK7Z 2BCAA 3OHMB 3E3RA 3VRNA 1YUTA 1DJZA 2VRGA 1B47A 5D69A 1B8CA 1DT7B 3GK4X 1QJTA 2WCBA 2MBXA 1DMOA 1YX8A 3TDIA 1QX7A 1XVJA 2JNFA 2KI6C 2CNPA 1JF2A 3CS1A 1SR6B 3SG6A 3I5FC 1K8UA 1PULA 2KDHA 3PFVA 2HQ8A 4HRGA 1SCVA 4U8DA 4GGFC 2L4IA 1S3PA 1WRZA 2KQ6A 4P2YB 1IQ5A 3M0WA 1SBJA 1S36A 5HKYA 3D0YB 3BUOB 4WQ3A 5AEQA 2L98A 1ZUZA 3PN7B 1QTXA 1NPQA 1PVAA 2EC6C 2FOTA 1A4PA 2G2BA 4PDZA 3TUYC 4PALA 2Y1MA 1DGVA 1UURA 1WDCB 3TS5B 1JSAA 4DUQA 3LL8B 3EK8A 4C0KA 1BG1A 2JXCA 3EKJA 4NDCA 3NSLA 1DJHA 1OSAA 1UWOA 2LE9B 3OB2B 2KAYA 3FWBA 1GJYA 4PE4A 4QJ5B 2JWWA 1WRKA 2I2RE 4MZLA 2BE4A 1BOCA 5I2QA 1SL8A 2K61A 2ZRTA 4C0JA 5KSZA 1OE9B 1BT6A 2LMUA 2OS8B 4XJKB 3OB1B 1K2HA 1TIZA 3IQOA 1CFFA 4AOMA 3KO0A 2FCEA 1SKTA 1CDMA 1AVSA 2ZRSA 3O78A 2LMVA 2QPTA 3I5HB 1G8IA 3NSKA 1B7TY 1YUSA 1KK7Y 2K8MB 4USLA 2LVJA 1KFUS 2AUCA 2LANA 2NLNA 1UHIA 2KGRA 3EK7A 4CLNA 3SG2A 2M8UA 1W7IB 4GFTA 1RECA 3O6BA 1IJ6A 2O60A 1J7RA 4CPVA 2K7DA 2HPSA 5JOLA 2FJUB 4ORBB 3PLFB 1C7WA 2JT3A 3GK2A 1IRJA 4L9MA 1AP4A 1AHRA 1RJVA 2QACA 1K9UA 5HLOA 1C7VA 4DS7A 3LCPC 1ZOTB 3FIAA 3IQQA 4JQ0D 5F6TA 1LKJA 3I5IC 1PSRA 2KFGA 1XO5A 2MLFC 2M7NA 2K2FA 1J55A 1S26D 2Y1NA 3K21A 2ZNDA 4MEWA 3GK1A 4MVFA 2LUXA 3CTNA 3JTDB 1L2OC 1OMVA 4A4CA 1QV0A 1AJ4A 1MXLC 3OX5A 4XJKA 5PALA 2CT9A 2NCPA 1IG5A 2MHHA 1HQVA 1UHKA 2LHLA 3BXKA 1IJ5A 1QATA 2P6BB 4DCKA 1TNXA 2SCPA 4YI8A 3KEVA 1EJ3A 1KK8C 3CR5X 1RROA 4OR9B 5HKWA 2NZ0A 2V53A 4QJ3B 3BOWB 2LLTA 2KI6D 2KFFA 2L0PA 3PN7C 2M9GA 3RM1A 2JXLA 1BR4B 1MUXA 3I5HC 2M7LA 1M46A 2KI4B 2M1KB 3AAKA 4A4BA 4PE7A 4CIDA 1FW4A 1KQMB 2WC8A 4GNKB 1SRAA 4WQ2A 1JWDA 1M63B 1U5IA 2LP3A 4OKHA 4YGAA 1PK0D 4GGFA 3VGOA 1C07A 1CFDA 2KBIA 4DIRA 3EK4A 1PVBA 2CCMA 3QRXA 1F4QA 3JTDC 3MSEB 3FS7A 4PHMA 2EGDA 1KSMA 1A29A 1DTLA 5AFPA 1CKKA 2ZN9A 4CFQA 2LHIA 2F2PA 1IGVA 4PE0A 3I5IB 2M29A 1QX2A 1KSOA 2LUCA 3CGAA 3H4SE 4PCWA 5I2OA 1KWOC 2BL0B 2NCOA 1CNPA 1SCMC 2E6WA 3AKAA 4DRWA 3CWGA 1Q80A 2AMIA 2KSPA 5DKQA 1MHOA 1CFCA 1NCZA 1FBVA 1S1EA 1SPYA 1TNWA 1ZMZA 1OMDA 5BPJA 1D1OA 5G08A 2L2EA 4I5NB 3D0YA 2PALA 1YUUA 5HYDA 4MLWA 2F3YA 1Y0VH 2EC6B 1HT9A 1YR5A 1BR1B 1K95A 3SJSA 3EVRA 2KBMA 4FTGA 4OVNF 4XYNA 2L4HA 2WCEA 4I5LB 3CZTX 2G9BA 4N1GA 2JRFA 5CSIA 1RWYA 4M2OA 2WOSA 2Y5IA 4M2PA 3F45A 1DJIA 1BF5A 1J1EA 1K9KA 1N65A 1EG4A 2PVBA 4Q04A 5DKRA 5JJGA 2OS8C 2AAOA 1YVLA 1M45A 1NX3A 1V1GA 1JUOA 4OV2A 1FI6A 3SIBA 3DVMA 1JFKA 1QX5B 4NQGA 5ER5A 4ZCUA 2R2IA 4NDDA 3NSOA 4YRUA 1IH0A 1ALVA 1N2DA 1NYAA 3VRPA 2BCXA 5I8NA 2IS9A 2KYFA 1IQ3A 4R1EA 2LP2A 1MXEA 1CM4A 1KCYA 2H2KA 3GOFA 3TUYB 3DD4A 1MQ1A 1RFJA 1KQVA 1B7TZ 2OTGB 2PASA 3BQ3A 3PM8A 1S5GY 1WY9A 5CSJA 3AAJA 2HETA 2JNXA 3BUNB 4PHNA 1JFJA 4GUKA 1N0YA 1SR6C 3O2PA 5AERA 1F71A 4PE1A 1K9PA 1XFXO 1NX0A 2BCBA 2KFHA 4YGDB 1TRFA 2I18A 1B9AA 3VROA 1FPWA 3LK0A 1PRWA 1A2XA 2H61C 2KAXA 5CPVA 4AQIA 1CB1A 4I5KA 2LVVA 3VRQA 5J3XA 1TNQA 1WRLA 4GBAA 1H8BA 1SNLA 1OOJA 4GAOA 1KFUL 3TS5C 1TCOB 1QV1A 4AQJA 1R6PA 1DJWA 2K7CA 1Y6WA 1JC2A 3PALA 4BY4A 1QVIZ 2LNKA 2LV7A 3EVVA 1SYMA 1LA3A 1KFXL 1EH2A 1SW8A 4YGCB 1J7OA 2GGZA 1CDPA 2K0JA 2E30A 3EVUA 5AXIA 1PALA 1F70A 2JC2A 5ER4X 1OZSA 1NSHA 4GPLB 3DF0B 3SIAA 1AUIB 3BYAA 3AKBA 4ICBA 3SG7A 1AK8A 1WLZA 3SG4A 1G33A 1NCYA 2F2OA 1S6IA 3CR4X 3TZ1A 5K89A 3TDUA 1Y1AA 2JTTA 1IWQA 3BUXB 2LLSA 1QS7A 1XFVO 3NSIA 5HLVA 4MZKA 5DKNA 3CLNA 1K94A 4N1FA 3EKHA 1PSBA 1DJGA 3ICBA 3LLEA 1DVIA 4MZJA 1X02A 2HQWA 3SG5A 4P5OE 2KYCA 1CDNA 1KQMC 1YTZC 1Y1UA 3RLZA 2ISDA 1YRTB 1XFUO 1DJYA 4E68A 4ZCVA 1SMGA 1QLSA 3ZNIA 1BLQA 2KI4C 2FCDA 3WNXB 2PSRA 1MR8A 2M49B 5KU1A 2CBLA 1BMOA 2OTGC 1TCFA 1S6CA 2LMTA 1SK6D 2JULA 4MBEA 4ETOA 2BL0C 1UP5A 1KK8B 2HF5A 2RGIA 3FWCA 3I5FB 3OP0A 2DOQA 2M1UA 1DGUA 2WORA 1CDLA 1QIWA 1U5IB 1VRKA 4F0ZB 1WLMA 3WXAA 1K93D 2MAZA 4MSPA 2KQYA 2LAPA 4PHKA 2H61A 4IL1A 2MJWB 2NXQA 1B8LA 2GV5A 2JU0A 4N5XA 4YI9A 2ZKMX 4JWQA 2LM5A 2PRUA 1RTP1 2LC5A 2D8NA 1CLBA 4UPGA 1DJXA 3I5GB 2MLEC 3BOWA 2OPOA 3LK1A 2F8PA 3DVKA 1XK4C 1CMGA 5KTYA 1L7ZA 2K7OA 3PATA 1KFXS 2WNDA 1XA5A 1OMRA 1QASA 1A75B 1WDCC 2CXJA 2M97A 4YBHB 3KF9A 4JPZB 2I94A 2LLUA 1YX7A 2F33A 1SCMB 1F55A 5FYXA 1MF8B 3TDZA 1QIVA 4HSZA 1CTRA 1SY9A 1YRUB 4BY5A 2KAVA 1IKUA 4M2QA 1AJ5A 4YGBB 1TTXA 5GQQC 1J7PA 1NWDA 1B1GA 2I7AA 3WHUB 4MN0A 1NIWA 3VRRA 5B8IB 1LVCD 1SL7A 5IBWA 3KHEA 2Y4QA 1OQPA 2F3ZA 2JQ6A 1ODBA 4HRHA 3DF0A 1A75A 2LVKA 4NDBA 1GQMA 1KWOB 2BBMA 4PHJA 2Q91A 1CMFA 1EXRA 2Q4UA 3JVTC 1ZFSA 4CFRA 1YURA 3C1VA 1E8AA 1SL9A 2WCFA 1QLKA 1QXPA 1UHHA 1UHNA 1XFZO 1BODA 1GGWA 3PSRA 2JZIA 1CLLA 1NX1A 1W7JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SG3 A;  2LVI A;  2JT0 A;  1QVI Y;  1CFP A;  3A4U B;  2L51 A;  3DVJ A;  3OX6 A;  1BJF A;  2MA2 A;  1K90 D;  1LA0 A;  1XK4 A;  2K2A A;  4YGE B;  3NXA A;  5AAN A;  1J7Q A;  4MRY A;  1OZO A;  2EHB A;  3HCM A;  4ORA B;  1JF0 A;  1NX2 A;  2L5X B;  5CSN A;  1B4C A;  1F8H A;  1TNP A;  2ZFD A;  2A4J A;  3HX4 A;  1S6J A;  3A8R A;  1F54 A;  1YVH A;  5TNC A;  4C0L A;  1Y1X A;  1LIN A;  2CTN A;  1LXF C;  2KNE A;  3BUW B;  3CR2 A;  1GGZ A;  1XFY O;  3D10 A;  2ZN8 A;  4ORC B;  1RK9 A;  4WRI A;  1XFW O;  2JPT A;  1L2O B;  1J1D A;  2COL B;  2JTZ A;  2JT8 A;  1R2U A;  2KHN A;  2BBN A;  1DF0 A;  4OCI A;  1XYD A;  2BEC A;  1NCX A;  2TN4 A;  4HRE E;  3I5G C;  5CSF A;  2M0R A;  2L50 A;  4QJ4 B;  4I5J A;  5I2L A;  2KGB C;  2GGM A;  1FI5 A;  4D1E A;  1TN4 A;  2M3W A;  4MRX A;  2BE6 A;  1H4B A;  2K7B A;  3ZWH A;  1S5G Z;  2BKH B;  3JVT B;  1EG3 A;  2O5G A;  3KPX A;  1NUB A;  5D7F A;  1ALW A;  2KOT A;  1A03 A;  1EL4 A;  1JBA A;  1TOP A;  1ZAC A;  2PMY A;  1BU3 A;  3IF7 A;  2B1U A;  2SAS A;  1M39 A;  2JOJ A;  4TNC A;  3BUM B;  3WHT B;  1UUS A;  1V1F A;  5HKZ A;  2MRD A;  1NP8 A;  1CLM A;  1MWN A;  1FF1 A;  1K96 A;  2ZNE A;  3O4Y A;  4FQO A;  1B8R A;  1G4Y R;  2BKI B;  3DVE A;  1DF0 B;  1CM1 A;  1F4O A;  1UHJ A;  1M31 A;  2LCP A;  4GGN A;  1KK7 Z;  2BCA A;  3OHM B;  3E3R A;  3VRN A;  1YUT A;  1DJZ A;  2VRG A;  1B47 A;  5D69 A;  1B8C A;  1DT7 B;  3GK4 X;  1QJT A;  2WCB A;  2MBX A;  1DMO A;  1YX8 A;  3TDI A;  1QX7 A;  1XVJ A;  2JNF A;  2KI6 C;  2CNP A;  1JF2 A;  3CS1 A;  1SR6 B;  3SG6 A;  3I5F C;  1K8U A;  1PUL A;  2KDH A;  3PFV A;  2HQ8 A;  4HRG A;  1SCV A;  4U8D A;  4GGF C;  2L4I A;  1S3P A;  1WRZ A;  2KQ6 A;  4P2Y B;  1IQ5 A;  3M0W A;  1SBJ A;  1S36 A;  5HKY A;  3D0Y B;  3BUO B;  4WQ3 A;  5AEQ A;  2L98 A;  1ZUZ A;  3PN7 B;  1QTX A;  1NPQ A;  1PVA A;  2EC6 C;  2FOT A;  1A4P A;  2G2B A;  4PDZ A;  3TUY C;  4PAL A;  2Y1M A;  1DGV A;  1UUR A;  1WDC B;  3TS5 B;  1JSA A;  4DUQ A;  3LL8 B;  3EK8 A;  4C0K A;  1BG1 A;  2JXC A;  3EKJ A;  4NDC A;  3NSL A;  1DJH A;  1OSA A;  1UWO A;  2LE9 B;  3OB2 B;  2KAY A;  3FWB A;  1GJY A;  4PE4 A;  4QJ5 B;  2JWW A;  1WRK A;  2I2R E;  4MZL A;  2BE4 A;  1BOC A;  5I2Q A;  1SL8 A;  2K61 A;  2ZRT A;  4C0J A;  5KSZ A;  1OE9 B;  1BT6 A;  2LMU A;  2OS8 B;  4XJK B;  3OB1 B;  1K2H A;  1TIZ A;  3IQO A;  1CFF A;  4AOM A;  3KO0 A;  2FCE A;  1SKT A;  1CDM A;  1AVS A;  2ZRS A;  3O78 A;  2LMV A;  2QPT A;  3I5H B;  1G8I A;  3NSK A;  1B7T Y;  1YUS A;  1KK7 Y;  2K8M B;  4USL A;  2LVJ A;  1KFU S;  2AUC A;  2LAN A;  2NLN A;  1UHI A;  2KGR A;  3EK7 A;  4CLN A;  3SG2 A;  2M8U A;  1W7I B;  4GFT A;  1REC A;  3O6B A;  1IJ6 A;  2O60 A;  1J7R A;  4CPV A;  2K7D A;  2HPS A;  5JOL A;  2FJU B;  4ORB B;  3PLF B;  1C7W A;  2JT3 A;  3GK2 A;  1IRJ A;  4L9M A;  1AP4 A;  1AHR A;  1RJV A;  2QAC A;  1K9U A;  5HLO A;  1C7V A;  4DS7 A;  3LCP C;  1ZOT B;  3FIA A;  3IQQ A;  4JQ0 D;  5F6T A;  1LKJ A;  3I5I C;  1PSR A;  2KFG A;  1XO5 A;  2MLF C;  2M7N A;  2K2F A;  1J55 A;  1S26 D;  2Y1N A;  3K21 A;  2ZND A;  4MEW A;  3GK1 A;  4MVF A;  2LUX A;  3CTN A;  3JTD B;  1L2O C;  1OMV A;  4A4C A;  1QV0 A;  1AJ4 A;  1MXL C;  3OX5 A;  4XJK A;  5PAL A;  2CT9 A;  2NCP A;  1IG5 A;  2MHH A;  1HQV A;  1UHK A;  2LHL A;  3BXK A;  1IJ5 A;  1QAT A;  2P6B B;  4DCK A;  1TNX A;  2SCP A;  4YI8 A;  3KEV A;  1EJ3 A;  1KK8 C;  3CR5 X;  1RRO A;  4OR9 B;  5HKW A;  2NZ0 A;  2V53 A;  4QJ3 B;  3BOW B;  2LLT A;  2KI6 D;  2KFF A;  2L0P A;  3PN7 C;  2M9G A;  3RM1 A;  2JXL A;  1BR4 B;  1MUX A;  3I5H C;  2M7L A;  1M46 A;  2KI4 B;  2M1K B;  3AAK A;  4A4B A;  4PE7 A;  4CID A;  1FW4 A;  1KQM B;  2WC8 A;  4GNK B;  1SRA A;  4WQ2 A;  1JWD A;  1M63 B;  1U5I A;  2LP3 A;  4OKH A;  4YGA A;  1PK0 D;  4GGF A;  3VGO A;  1C07 A;  1CFD A;  2KBI A;  4DIR A;  3EK4 A;  1PVB A;  2CCM A;  3QRX A;  1F4Q A;  3JTD C;  3MSE B;  3FS7 A;  4PHM A;  2EGD A;  1KSM A;  1A29 A;  1DTL A;  5AFP A;  1CKK A;  2ZN9 A;  4CFQ A;  2LHI A;  2F2P A;  1IGV A;  4PE0 A;  3I5I B;  2M29 A;  1QX2 A;  1KSO A;  2LUC A;  3CGA A;  3H4S E;  4PCW A;  5I2O A;  1KWO C;  2BL0 B;  2NCO A;  1CNP A;  1SCM C;  2E6W A;  3AKA A;  4DRW A;  3CWG A;  1Q80 A;  2AMI A;  2KSP A;  5DKQ A;  1MHO A;  1CFC A;  1NCZ A;  1FBV A;  1S1E A;  1SPY A;  1TNW A;  1ZMZ A;  1OMD A;  5BPJ A;  1D1O A;  5G08 A;  2L2E A;  4I5N B;  3D0Y A;  2PAL A;  1YUU A;  5HYD A;  4MLW A;  2F3Y A;  1Y0V H;  2EC6 B;  1HT9 A;  1YR5 A;  1BR1 B;  1K95 A;  3SJS A;  3EVR A;  2KBM A;  4FTG A;  4OVN F;  4XYN A;  2L4H A;  2WCE A;  4I5L B;  3CZT X;  2G9B A;  4N1G A;  2JRF A;  5CSI A;  1RWY A;  4M2O A;  2WOS A;  2Y5I A;  4M2P A;  3F45 A;  1DJI A;  1BF5 A;  1J1E A;  1K9K A;  1N65 A;  1EG4 A;  2PVB A;  4Q04 A;  5DKR A;  5JJG A;  2OS8 C;  2AAO A;  1YVL A;  1M45 A;  1NX3 A;  1V1G A;  1JUO A;  4OV2 A;  1FI6 A;  3SIB A;  3DVM A;  1JFK A;  1QX5 B;  4NQG A;  5ER5 A;  4ZCU A;  2R2I A;  4NDD A;  3NSO A;  4YRU A;  1IH0 A;  1ALV A;  1N2D A;  1NYA A;  3VRP A;  2BCX A;  5I8N A;  2IS9 A;  2KYF A;  1IQ3 A;  4R1E A;  2LP2 A;  1MXE A;  1CM4 A;  1KCY A;  2H2K A;  3GOF A;  3TUY B;  3DD4 A;  1MQ1 A;  1RFJ A;  1KQV A;  1B7T Z;  2OTG B;  2PAS A;  3BQ3 A;  3PM8 A;  1S5G Y;  1WY9 A;  5CSJ A;  3AAJ A;  2HET A;  2JNX A;  3BUN B;  4PHN A;  1JFJ A;  4GUK A;  1N0Y A;  1SR6 C;  3O2P A;  5AER A;  1F71 A;  4PE1 A;  1K9P A;  1XFX O;  1NX0 A;  2BCB A;  2KFH A;  4YGD B;  1TRF A;  2I18 A;  1B9A A;  3VRO A;  1FPW A;  3LK0 A;  1PRW A;  1A2X A;  2H61 C;  2KAX A;  5CPV A;  4AQI A;  1CB1 A;  4I5K A;  2LVV A;  3VRQ A;  5J3X A;  1TNQ A;  1WRL A;  4GBA A;  1H8B A;  1SNL A;  1OOJ A;  4GAO A;  1KFU L;  3TS5 C;  1TCO B;  1QV1 A;  4AQJ A;  1R6P A;  1DJW A;  2K7C A;  1Y6W A;  1JC2 A;  3PAL A;  4BY4 A;  1QVI Z;  2LNK A;  2LV7 A;  3EVV A;  1SYM A;  1LA3 A;  1KFX L;  1EH2 A;  1SW8 A;  4YGC B;  1J7O A;  2GGZ A;  1CDP A;  2K0J A;  2E30 A;  3EVU A;  5AXI A;  1PAL A;  1F70 A;  2JC2 A;  5ER4 X;  1OZS A;  1NSH A;  4GPL B;  3DF0 B;  3SIA A;  1AUI B;  3BYA A;  3AKB A;  4ICB A;  3SG7 A;  1AK8 A;  1WLZ A;  3SG4 A;  1G33 A;  1NCY A;  2F2O A;  1S6I A;  3CR4 X;  3TZ1 A;  5K89 A;  3TDU A;  1Y1A A;  2JTT A;  1IWQ A;  3BUX B;  2LLS A;  1QS7 A;  1XFV O;  3NSI A;  5HLV A;  4MZK A;  5DKN A;  3CLN A;  1K94 A;  4N1F A;  3EKH A;  1PSB A;  1DJG A;  3ICB A;  3LLE A;  1DVI A;  4MZJ A;  1X02 A;  2HQW A;  3SG5 A;  4P5O E;  2KYC A;  1CDN A;  1KQM C;  1YTZ C;  1Y1U A;  3RLZ A;  2ISD A;  1YRT B;  1XFU O;  1DJY A;  4E68 A;  4ZCV A;  1SMG A;  1QLS A;  3ZNI A;  1BLQ A;  2KI4 C;  2FCD A;  3WNX B;  2PSR A;  1MR8 A;  2M49 B;  5KU1 A;  2CBL A;  1BMO A;  2OTG C;  1TCF A;  1S6C A;  2LMT A;  1SK6 D;  2JUL A;  4MBE A;  4ETO A;  2BL0 C;  1UP5 A;  1KK8 B;  2HF5 A;  2RGI A;  3FWC A;  3I5F B;  3OP0 A;  2DOQ A;  2M1U A;  1DGU A;  2WOR A;  1CDL A;  1QIW A;  1U5I B;  1VRK A;  4F0Z B;  1WLM A;  3WXA A;  1K93 D;  2MAZ A;  4MSP A;  2KQY A;  2LAP A;  4PHK A;  2H61 A;  4IL1 A;  2MJW B;  2NXQ A;  1B8L A;  2GV5 A;  2JU0 A;  4N5X A;  4YI9 A;  2ZKM X;  4JWQ A;  2LM5 A;  2PRU A;  1RTP 1;  2LC5 A;  2D8N A;  1CLB A;  4UPG A;  1DJX A;  3I5G B;  2MLE C;  3BOW A;  2OPO A;  3LK1 A;  2F8P A;  3DVK A;  1XK4 C;  1CMG A;  5KTY A;  1L7Z A;  2K7O A;  3PAT A;  1KFX S;  2WND A;  1XA5 A;  1OMR A;  1QAS A;  1A75 B;  1WDC C;  2CXJ A;  2M97 A;  4YBH B;  3KF9 A;  4JPZ B;  2I94 A;  2LLU A;  1YX7 A;  2F33 A;  1SCM B;  1F55 A;  5FYX A;  1MF8 B;  3TDZ A;  1QIV A;  4HSZ A;  1CTR A;  1SY9 A;  1YRU B;  4BY5 A;  2KAV A;  1IKU A;  4M2Q A;  1AJ5 A;  4YGB B;  1TTX A;  5GQQ C;  1J7P A;  1NWD A;  1B1G A;  2I7A A;  3WHU B;  4MN0 A;  1NIW A;  3VRR A;  5B8I B;  1LVC D;  1SL7 A;  5IBW A;  3KHE A;  2Y4Q A;  1OQP A;  2F3Z A;  2JQ6 A;  1ODB A;  4HRH A;  3DF0 A;  1A75 A;  2LVK A;  4NDB A;  1GQM A;  1KWO B;  2BBM A;  4PHJ A;  2Q91 A;  1CMF A;  1EXR A;  2Q4U A;  3JVT C;  1ZFS A;  4CFR A;  1YUR A;  3C1V A;  1E8A A;  1SL9 A;  2WCF A;  1QLK A;  1QXP A;  1UHH A;  1UHN A;  1XFZ O;  1BOD A;  1GGW A;  3PSR A;  2JZI A;  1CLL A;  1NX1 A;  1W7J B; 
#chains in the Genus database with same CATH topology
 3SG3 A;  3D78 A;  2LVI A;  2JT0 A;  1QVI Y;  1CFP A;  3A4U B;  2L51 A;  3DVJ A;  3OX6 A;  1IIO A;  1BJF A;  2MA2 A;  1K90 D;  1LA0 A;  1XK4 A;  2K2A A;  4YGE B;  3NXA A;  5AAN A;  1J7Q A;  4MRY A;  1OZO A;  2EHB A;  2QEO A;  3HCM A;  3OBV A;  4ORA B;  1JF0 A;  1NX2 A;  2L5X B;  5CSN A;  1B4C A;  1F8H A;  1TNP A;  2ZFD A;  2A4J A;  3HX4 A;  1S6J A;  3A8R A;  1F54 A;  1YVH A;  5TNC A;  4C0L A;  1Y1X A;  1LIN A;  3R72 A;  2CTN A;  1LXF C;  2KNE A;  3BUW B;  3CR2 A;  1GGZ A;  1XFY O;  3D10 A;  2ZN8 A;  4ORC B;  1RK9 A;  4WRI A;  1XFW O;  2JPT A;  1L2O B;  1J1D A;  2COL B;  2JTZ A;  2KPH A;  3SS4 A;  3PJI A;  2JT8 A;  1R2U A;  2KHN A;  2BBN A;  1DF0 A;  4OCI A;  3EG5 B;  1XYD A;  2BEC A;  1NCX A;  2TN4 A;  4HRE E;  3DY9 A;  3I5G C;  5CSF A;  2M0R A;  2L50 A;  4QJ4 B;  4I5J A;  5I2L A;  2KGB C;  2GGM A;  1FI5 A;  4D1E A;  1TN4 A;  2M3W A;  4MRX A;  2BE6 A;  1C3Y A;  2K7B A;  1H4B A;  3DXL A;  1C3Z A;  1S5G Z;  1TUJ A;  2BKH B;  3JVT B;  3ZWH A;  1EG3 A;  2O5G A;  2BAP A;  3KPX A;  1NUB A;  4OZD A;  3FE9 A;  1ALW A;  2KOT A;  5D7F A;  3IVT A;  1A03 A;  1EL4 A;  1JBA A;  1TOP A;  1ZAC A;  2WC6 A;  2PMY A;  1BU3 A;  3IF7 A;  2B1U A;  2SAS A;  1M39 A;  2JOJ A;  1Z2C B;  4TNC A;  3B6X A;  3BUM B;  3OGN A;  3WHT B;  1UUS A;  1V1F A;  5HKZ A;  2MRD A;  1NP8 A;  1CLM A;  1MWN A;  1FF1 A;  1K96 A;  2ZNE A;  3O4Y A;  4FQO A;  1B8R A;  3NHI A;  1G4Y R;  2BKI B;  3DVE A;  1DF0 B;  3SS5 A;  1CM1 A;  1F4O A;  1UHJ A;  1M31 A;  2LCP A;  4GGN A;  1KK7 Z;  2BCA A;  3OHM B;  3E3R A;  3VRN A;  1YUT A;  1DJZ A;  2VRG A;  1B47 A;  5D69 A;  3RZS A;  1B8C A;  1DT7 B;  3GK4 X;  1QJT A;  2WCB A;  2MBX A;  3V2L A;  1DMO A;  3FE6 A;  1YX8 A;  3BJH A;  3TDI A;  1QX7 A;  1XVJ A;  2JNF A;  2KI6 C;  2CNP A;  1JF2 A;  3CS1 A;  1SR6 B;  3SG6 A;  3I5F C;  1K8U A;  1PUL A;  2KDH A;  3PFV A;  2HQ8 A;  4HRG A;  1SCV A;  4U8D A;  4GGF C;  2L4I A;  1S3P A;  1WRZ A;  2KQ6 A;  4P2Y B;  1IQ5 A;  3M0W A;  1SBJ A;  2WCM A;  1S36 A;  4KYN A;  5HKY A;  3D0Y B;  3NHT A;  3B88 A;  3BUO B;  4WQ3 A;  2QEB A;  5AEQ A;  2L98 A;  1ZUZ A;  3S0A A;  3PN7 B;  1QTX A;  2P71 A;  1NPQ A;  1PVA A;  2EC6 C;  2FOT A;  1A4P A;  2G2B A;  4PDZ A;  3TUY C;  4PAL A;  5I94 A;  2Y1M A;  1DGV A;  1UUR A;  1WDC B;  3TS5 B;  1JSA A;  4DUQ A;  3LL8 B;  3EK8 A;  4C0K A;  1BG1 A;  3DZT A;  2JXC A;  3EKJ A;  1OOG A;  4NDC A;  3NSL A;  1DJH A;  1OSA A;  1UWO A;  3SS3 A;  2LE9 B;  5D3O A;  3OB2 B;  2KAY A;  3FWB A;  2WCJ A;  1GJY A;  4PE4 A;  4QJ5 B;  2JWW A;  4IJ7 A;  1WRK A;  2I2R E;  3CDN A;  4MZL A;  2BE4 A;  1BOC A;  5I2Q A;  1SL8 A;  2K61 A;  2ZRT A;  3N7H A;  4C0J A;  5KSZ A;  2H8V A;  5FI7 A;  1OE9 B;  1BT6 A;  2LMU A;  2OS8 B;  4XJK B;  3OB1 B;  3UO9 A;  1K2H A;  1TIZ A;  4FQT A;  3IQO A;  1CFF A;  4AOM A;  3KO0 A;  2FCE A;  1SKT A;  1CDM A;  1AVS A;  2ZRS A;  3O78 A;  2LMV A;  2QPT A;  3I5H B;  1G8I A;  3NSK A;  1B7T Y;  1YUS A;  1KK7 Y;  2K8M B;  4USL A;  4F7F A;  1TUZ A;  2LVJ A;  1KFU S;  2AUC A;  2LAN A;  2NLN A;  1UHI A;  3CZ1 A;  2KGR A;  2JPO A;  3EK7 A;  4CLN A;  3SG2 A;  2M8U A;  1W7I B;  4GFT A;  1REC A;  3O6B A;  1IJ6 A;  1DEL A;  2O60 A;  1J7R A;  4CPV A;  2K7D A;  2HPS A;  5JOL A;  2FJU B;  4ORB B;  3PLF B;  1C7W A;  2JT3 A;  3GK2 A;  1IRJ A;  4L9M A;  1AP4 A;  1AHR A;  1RJV A;  2QAC A;  1K9U A;  5HLO A;  1C7V A;  4DS7 A;  3LCP C;  1ZOT B;  3FIA A;  3IQQ A;  4JQ0 D;  1Z4H A;  5F6T A;  1LKJ A;  3I5I C;  1PSR A;  2KFG A;  1XO5 A;  2MLF C;  2M7N A;  2K2F A;  1J55 A;  1S26 D;  2Y1N A;  3K21 A;  2ZND A;  5DIC A;  4MEW A;  3GK1 A;  4MVF A;  2LUX A;  3CTN A;  3JTD B;  1L2O C;  1OMV A;  4A4C A;  1QV0 A;  1AJ4 A;  1MXL C;  3OX5 A;  4XJK A;  5PAL A;  2CT9 A;  2NCP A;  2KLD A;  1IG5 A;  2MHH A;  1HQV A;  1UHK A;  2LHL A;  3BXK A;  1IJ5 A;  2KLE A;  1QAT A;  2P6B B;  4DCK A;  1TNX A;  2SCP A;  4YI8 A;  3KEV A;  1EJ3 A;  1KK8 C;  3CR5 X;  1RRO A;  4OR9 B;  5HKW A;  2NZ0 A;  2V53 A;  4QJ3 B;  3BOW B;  2LLT A;  2KI6 D;  2KFF A;  2L0P A;  3PN7 C;  2M9G A;  5HL1 A;  3SG5 A;  2P70 A;  3RM1 A;  2JXL A;  1BR4 B;  1MUX A;  3I5H C;  2M7L A;  1M46 A;  2KI4 B;  2M1K B;  3AAK A;  4A4B A;  4PE7 A;  4CID A;  1FW4 A;  1KQM B;  2WC8 A;  4GNK B;  1SRA A;  4WQ2 A;  1JWD A;  1M63 B;  1U5I A;  2LP3 A;  4OKH A;  4YGA A;  1PK0 D;  4GGF A;  3VGO A;  1C07 A;  1CFD A;  2KBI A;  4DIR A;  3EK4 A;  1PVB A;  2CCM A;  3QRX A;  1F4Q A;  3B86 A;  3JTD C;  3MSE B;  3BFA A;  3FS7 A;  1DEK A;  2WCK A;  3Q8I A;  2EGD A;  4PHM A;  1KSM A;  1A29 A;  5FI2 A;  1DTL A;  5AFP A;  1CKK A;  2ZN9 A;  3S0E A;  1W9Z A;  4CFQ A;  2LHI A;  2F2P A;  1IGV A;  4PE0 A;  3I5I B;  2M29 A;  1QX2 A;  1KSO A;  2LUC A;  3CGA A;  3H4S E;  3FE8 A;  4PCW A;  5I2O A;  1KWO C;  1OOI X;  2BL0 B;  2NCO A;  1CNP A;  1SCM C;  3L4A A;  2E6W A;  3AKA A;  2BNX A;  3CWG A;  4DRW A;  1Q80 A;  2AMI A;  2KSP A;  5DKQ A;  1MHO A;  1CFC A;  1NCZ A;  1FBV A;  1S1E A;  1SPY A;  1TNW A;  1ZMZ A;  1OMD A;  5BPJ A;  1D1O A;  5G08 A;  2L2E A;  4I5N B;  3D0Y A;  2PAL A;  1YUU A;  5HYD A;  4MLW A;  2F3Y A;  1Y0V H;  2EC6 B;  1HT9 A;  1OOF A;  1YR5 A;  1BR1 B;  1K95 A;  3SJS A;  3EVR A;  2KBM A;  4FTG A;  3NGV A;  4JD9 A;  4OVN F;  4XYN A;  3S0F A;  2L4H A;  2WCE A;  4I5L B;  2WCH A;  1DC1 A;  3CZT X;  2G9B A;  2L5Y A;  2JRF A;  4N1G A;  5CSI A;  3CYZ A;  1RWY A;  3VB1 A;  4M2O A;  2WOS A;  2Y5I A;  3BFH A;  4M2P A;  3F45 A;  1DJI A;  1BF5 A;  1J1E A;  1K9K A;  1N65 A;  1EG4 A;  2PVB A;  4Q04 A;  5DKR A;  5JJG A;  2OS8 C;  2AAO A;  2FJY A;  1YVL A;  1OOH A;  3D75 A;  1M45 A;  1NX3 A;  1V1G A;  3B7A A;  1JUO A;  4OV2 A;  1FI6 A;  3SIB A;  3DVM A;  1JFK A;  1QX5 B;  4NQG A;  5ER5 A;  4ZCU A;  2R2I A;  4NDD A;  3NSO A;  4YRU A;  1IH0 A;  1ALV A;  1N2D A;  1NYA A;  3VRP A;  2BCX A;  5I8N A;  4PT1 A;  2IS9 A;  2KYF A;  1IQ3 A;  4R1E A;  2LP2 A;  1MXE A;  1CM4 A;  1KCY A;  2H2K A;  3GOF A;  3TUY B;  3DD4 A;  1MQ1 A;  1RFJ A;  1KQV A;  1B7T Z;  2OTG B;  2PAS A;  3BQ3 A;  3PM8 A;  1S5G Y;  1WY9 A;  5CSJ A;  3AAJ A;  3CAB A;  2HET A;  3S0B A;  2JNX A;  3BUN B;  4PHN A;  1JFJ A;  4GUK A;  1N0Y A;  1SR6 C;  3O2P A;  5AER A;  1F71 A;  4PE1 A;  1K9P A;  1XFX O;  1NX0 A;  3B87 A;  2BCB A;  4INW A;  2KFH A;  4YGD B;  1TRF A;  2I18 A;  1B9A A;  3VRO A;  1FPW A;  1ORG A;  3S0D A;  3LK0 A;  1PRW A;  2PYQ A;  1A2X A;  2H61 C;  2KAX A;  5CPV A;  4AQI A;  1CB1 A;  1T14 A;  4JKT A;  4I5K A;  2LVV A;  3VRQ A;  5J3X A;  1TNQ A;  1WRL A;  1SSE B;  4GBA A;  1H8B A;  1SNL A;  1OOJ A;  4GAO A;  3CZ2 A;  1KFU L;  2WC5 A;  3TS5 C;  1TCO B;  1QV1 A;  4AQJ A;  1R6P A;  1DJW A;  2K7C A;  3D76 A;  1Y6W A;  1JC2 A;  3PAL A;  4BY4 A;  2L2C A;  1QVI Z;  2LNK A;  2LV7 A;  3EVV A;  1SYM A;  1LA3 A;  1KFX L;  1EH2 A;  1SW8 A;  2PQL A;  4YGC B;  1J7O A;  2GGZ A;  1CDP A;  2K0J A;  2E30 A;  3EVU A;  5AXI A;  1PAL A;  3R1V A;  1F70 A;  2JC2 A;  5ER4 X;  1OZS A;  1NSH A;  4GPL B;  3DF0 B;  3SIA A;  1AUI B;  3BYA A;  3AKB A;  4ICB A;  3SG7 A;  1AK8 A;  2YGU A;  1WLZ A;  3SG4 A;  1G33 A;  3O4X A;  1NCY A;  2F2O A;  1S6I A;  3CR4 X;  2K60 A;  3TZ1 A;  3TDU A;  5K89 A;  1Y1A A;  2JTT A;  1IWQ A;  3BUX B;  2LLS A;  1QS7 A;  1XFV O;  3NSI A;  5HLV A;  4MZK A;  5DKN A;  1P28 A;  3CLN A;  1K94 A;  4N1F A;  3EKH A;  1PSB A;  1DJG A;  3ICB A;  3LLE A;  1DVI A;  4MZJ A;  1X02 A;  2HQW A;  3S0G A;  4P5O E;  2KYC A;  1CDN A;  1KQM C;  1YTZ C;  1Y1U A;  3RLZ A;  2ISD A;  1YRT B;  1XFU O;  2ERB A;  1DJY A;  3BFB A;  4E68 A;  3DYE A;  1SMG A;  4ZCV A;  1QLS A;  3ZNI A;  1BLQ A;  2GTE A;  2KI4 C;  2FCD A;  1LS8 A;  3WNX B;  2PSR A;  1MR8 A;  2M49 B;  5KU1 A;  2CBL A;  1BMO A;  2OTG C;  1TCF A;  1S6C A;  2LMT A;  1SK6 D;  2JUL A;  4MBE A;  4ETO A;  2BL0 C;  1UP5 A;  1KK8 B;  2HF5 A;  2RGI A;  3FWC A;  3I5F B;  3OP0 A;  2DOQ A;  2M1U A;  1DGU A;  2WOR A;  1CDL A;  1QIW A;  1U5I B;  1VRK A;  3QME A;  4F0Z B;  1WLM A;  3WXA A;  1K93 D;  2MAZ A;  4MSP A;  2KQY A;  2LAP A;  3CZ0 A;  4PHK A;  2H61 A;  4IL1 A;  2MJW B;  2NXQ A;  1B8L A;  2GV5 A;  2JU0 A;  3L4L A;  4N5X A;  3R1P A;  4YI9 A;  2QEV A;  2ZKM X;  4JWQ A;  1TWO A;  2LM5 A;  2PRU A;  1RTP 1;  2LC5 A;  3L47 A;  2D8N A;  1CLB A;  5FI6 A;  4UPG A;  1DJX A;  3I5G B;  1QWV A;  2MLE C;  3BOW A;  2OPO A;  3LK1 A;  2F8P A;  3DVK A;  1XK4 C;  1CMG A;  5KTY A;  3D77 A;  1L7Z A;  2K7O A;  3PAT A;  1KFX S;  3R1O A;  2WND A;  1XA5 A;  1OMR A;  1QAS A;  1A75 B;  1WDC C;  1XFR A;  2CXJ A;  2M97 A;  4YBH B;  3KF9 A;  4JPZ B;  2I94 A;  2LLU A;  1YX7 A;  2F33 A;  1SCM B;  1F55 A;  5FYX A;  1MF8 B;  3D73 A;  1QIV A;  3D74 A;  3TDZ A;  4HSZ A;  1CTR A;  1SY9 A;  1YRU B;  4BY5 A;  2KAV A;  1IKU A;  4M2Q A;  1AJ5 A;  4YGB B;  1TTX A;  5GQQ C;  1J7P A;  5EL2 A;  2WCL A;  1NWD A;  2QEH A;  1B1G A;  2I7A A;  3UNW A;  4MN0 A;  1NIW A;  3VRR A;  3WHU B;  5B8I B;  1LVC D;  1SL7 A;  5IBW A;  3KHE A;  2Y4Q A;  1OQP A;  2F3Z A;  2JQ6 A;  1ODB A;  4HRH A;  3DF0 A;  1A75 A;  2LVK A;  4NDB A;  1GQM A;  1DQE A;  1KWO B;  2BBM A;  2Q91 A;  4PHJ A;  1CMF A;  1EXR A;  2Q4U A;  4INX A;  1OW4 A;  3JVT C;  1ZFS A;  4CFR A;  1YUR A;  3C1V A;  3K1E A;  1E8A A;  1SL9 A;  2WCF A;  1QLK A;  1QXP A;  1UHH A;  1UHN A;  1XFZ O;  1BOD A;  1GM0 A;  3PM2 A;  3PSR A;  1GGW A;  2JZI A;  1CLL A;  1NX1 A;  2QDI A;  1W7J B; 
#chains in the Genus database with same CATH homology
 3SG3 A;  2LVI A;  2JT0 A;  1QVI Y;  1CFP A;  3A4U B;  2L51 A;  3DVJ A;  3OX6 A;  1BJF A;  2MA2 A;  1K90 D;  1LA0 A;  1XK4 A;  2K2A A;  4YGE B;  3NXA A;  5AAN A;  1J7Q A;  4MRY A;  1OZO A;  2EHB A;  3HCM A;  4ORA B;  1JF0 A;  1NX2 A;  2L5X B;  5CSN A;  1B4C A;  1F8H A;  1TNP A;  2ZFD A;  2A4J A;  3HX4 A;  1S6J A;  3A8R A;  1F54 A;  1YVH A;  5TNC A;  4C0L A;  1Y1X A;  1LIN A;  2CTN A;  1LXF C;  2KNE A;  3BUW B;  3CR2 A;  1GGZ A;  1XFY O;  3D10 A;  2ZN8 A;  4ORC B;  1RK9 A;  4WRI A;  1XFW O;  2JPT A;  1L2O B;  1J1D A;  2COL B;  2JTZ A;  2JT8 A;  1R2U A;  2KHN A;  2BBN A;  1DF0 A;  4OCI A;  1XYD A;  2BEC A;  1NCX A;  2TN4 A;  4HRE E;  3I5G C;  5CSF A;  2M0R A;  2L50 A;  4QJ4 B;  4I5J A;  5I2L A;  2KGB C;  2GGM A;  1FI5 A;  4D1E A;  1TN4 A;  2M3W A;  4MRX A;  2BE6 A;  1H4B A;  2K7B A;  3ZWH A;  1S5G Z;  2BKH B;  3JVT B;  1EG3 A;  2O5G A;  3KPX A;  1NUB A;  5D7F A;  1ALW A;  2KOT A;  1A03 A;  1EL4 A;  1JBA A;  1TOP A;  1ZAC A;  2PMY A;  1BU3 A;  3IF7 A;  2B1U A;  2SAS A;  1M39 A;  2JOJ A;  4TNC A;  3BUM B;  3WHT B;  1UUS A;  1V1F A;  5HKZ A;  2MRD A;  1NP8 A;  1CLM A;  1MWN A;  1FF1 A;  1K96 A;  2ZNE A;  3O4Y A;  4FQO A;  1B8R A;  1G4Y R;  2BKI B;  3DVE A;  1DF0 B;  1CM1 A;  1F4O A;  1UHJ A;  1M31 A;  2LCP A;  4GGN A;  1KK7 Z;  2BCA A;  3OHM B;  3E3R A;  3VRN A;  1YUT A;  1DJZ A;  2VRG A;  1B47 A;  5D69 A;  1B8C A;  1DT7 B;  3GK4 X;  1QJT A;  2WCB A;  2MBX A;  1DMO A;  1YX8 A;  3TDI A;  1QX7 A;  1XVJ A;  2JNF A;  2KI6 C;  2CNP A;  1JF2 A;  3CS1 A;  1SR6 B;  3SG6 A;  3I5F C;  1K8U A;  1PUL A;  2KDH A;  3PFV A;  2HQ8 A;  4HRG A;  1SCV A;  4U8D A;  4GGF C;  2L4I A;  1S3P A;  1WRZ A;  2KQ6 A;  4P2Y B;  1IQ5 A;  3M0W A;  1SBJ A;  1S36 A;  5HKY A;  3D0Y B;  3BUO B;  4WQ3 A;  5AEQ A;  2L98 A;  1ZUZ A;  3PN7 B;  1QTX A;  1NPQ A;  1PVA A;  2EC6 C;  2FOT A;  1A4P A;  2G2B A;  4PDZ A;  3TUY C;  4PAL A;  2Y1M A;  1DGV A;  1UUR A;  1WDC B;  3TS5 B;  1JSA A;  4DUQ A;  3LL8 B;  3EK8 A;  4C0K A;  1BG1 A;  2JXC A;  3EKJ A;  4NDC A;  3NSL A;  1DJH A;  1OSA A;  1UWO A;  2LE9 B;  3OB2 B;  2KAY A;  3FWB A;  1GJY A;  4PE4 A;  4QJ5 B;  2JWW A;  1WRK A;  2I2R E;  4MZL A;  2BE4 A;  1BOC A;  5I2Q A;  1SL8 A;  2K61 A;  2ZRT A;  4C0J A;  5KSZ A;  1OE9 B;  1BT6 A;  2LMU A;  2OS8 B;  4XJK B;  3OB1 B;  1K2H A;  1TIZ A;  3IQO A;  1CFF A;  4AOM A;  3KO0 A;  2FCE A;  1SKT A;  1CDM A;  1AVS A;  2ZRS A;  3O78 A;  2LMV A;  2QPT A;  3I5H B;  1G8I A;  3NSK A;  1B7T Y;  1YUS A;  1KK7 Y;  2K8M B;  4USL A;  2LVJ A;  1KFU S;  2AUC A;  2LAN A;  2NLN A;  1UHI A;  2KGR A;  3EK7 A;  4CLN A;  3SG2 A;  2M8U A;  1W7I B;  4GFT A;  1REC A;  3O6B A;  1IJ6 A;  2O60 A;  1J7R A;  4CPV A;  2K7D A;  2HPS A;  5JOL A;  2FJU B;  4ORB B;  3PLF B;  1C7W A;  2JT3 A;  3GK2 A;  1IRJ A;  4L9M A;  1AP4 A;  1AHR A;  1RJV A;  2QAC A;  1K9U A;  5HLO A;  1C7V A;  4DS7 A;  3LCP C;  1ZOT B;  3FIA A;  3IQQ A;  4JQ0 D;  5F6T A;  1LKJ A;  3I5I C;  1PSR A;  2KFG A;  1XO5 A;  2MLF C;  2M7N A;  2K2F A;  1J55 A;  1S26 D;  2Y1N A;  3K21 A;  2ZND A;  4MEW A;  3GK1 A;  4MVF A;  2LUX A;  3CTN A;  3JTD B;  1L2O C;  1OMV A;  4A4C A;  1QV0 A;  1AJ4 A;  1MXL C;  3OX5 A;  4XJK A;  5PAL A;  2CT9 A;  2NCP A;  1IG5 A;  2MHH A;  1HQV A;  1UHK A;  2LHL A;  3BXK A;  1IJ5 A;  1QAT A;  2P6B B;  4DCK A;  1TNX A;  2SCP A;  4YI8 A;  3KEV A;  1EJ3 A;  1KK8 C;  3CR5 X;  1RRO A;  4OR9 B;  5HKW A;  2NZ0 A;  2V53 A;  4QJ3 B;  3BOW B;  2LLT A;  2KI6 D;  2KFF A;  2L0P A;  3PN7 C;  2M9G A;  3RM1 A;  2JXL A;  1BR4 B;  1MUX A;  3I5H C;  2M7L A;  1M46 A;  2KI4 B;  2M1K B;  3AAK A;  4A4B A;  4PE7 A;  4CID A;  1FW4 A;  1KQM B;  2WC8 A;  4GNK B;  1SRA A;  4WQ2 A;  1JWD A;  1M63 B;  1U5I A;  2LP3 A;  4OKH A;  4YGA A;  1PK0 D;  4GGF A;  3VGO A;  1C07 A;  1CFD A;  2KBI A;  4DIR A;  3EK4 A;  1PVB A;  2CCM A;  3QRX A;  1F4Q A;  3JTD C;  3MSE B;  3FS7 A;  4PHM A;  2EGD A;  1KSM A;  1A29 A;  1DTL A;  5AFP A;  1CKK A;  2ZN9 A;  4CFQ A;  2LHI A;  2F2P A;  1IGV A;  4PE0 A;  3I5I B;  2M29 A;  1QX2 A;  1KSO A;  2LUC A;  3CGA A;  3H4S E;  4PCW A;  5I2O A;  1KWO C;  2BL0 B;  2NCO A;  1CNP A;  1SCM C;  2E6W A;  3AKA A;  4DRW A;  3CWG A;  1Q80 A;  2AMI A;  2KSP A;  5DKQ A;  1MHO A;  1CFC A;  1NCZ A;  1FBV A;  1S1E A;  1SPY A;  1TNW A;  1ZMZ A;  1OMD A;  5BPJ A;  1D1O A;  5G08 A;  2L2E A;  4I5N B;  3D0Y A;  2PAL A;  1YUU A;  5HYD A;  4MLW A;  2F3Y A;  1Y0V H;  2EC6 B;  1HT9 A;  1YR5 A;  1BR1 B;  1K95 A;  3SJS A;  3EVR A;  2KBM A;  4FTG A;  4OVN F;  4XYN A;  2L4H A;  2WCE A;  4I5L B;  3CZT X;  2G9B A;  4N1G A;  2JRF A;  5CSI A;  1RWY A;  4M2O A;  2WOS A;  2Y5I A;  4M2P A;  3F45 A;  1DJI A;  1BF5 A;  1J1E A;  1K9K A;  1N65 A;  1EG4 A;  2PVB A;  4Q04 A;  5DKR A;  5JJG A;  2OS8 C;  2AAO A;  1YVL A;  1M45 A;  1NX3 A;  1V1G A;  1JUO A;  4OV2 A;  1FI6 A;  3SIB A;  3DVM A;  1JFK A;  1QX5 B;  4NQG A;  5ER5 A;  4ZCU A;  2R2I A;  4NDD A;  3NSO A;  4YRU A;  1IH0 A;  1ALV A;  1N2D A;  1NYA A;  3VRP A;  2BCX A;  5I8N A;  2IS9 A;  2KYF A;  1IQ3 A;  4R1E A;  2LP2 A;  1MXE A;  1CM4 A;  1KCY A;  2H2K A;  3GOF A;  3TUY B;  3DD4 A;  1MQ1 A;  1RFJ A;  1KQV A;  1B7T Z;  2OTG B;  2PAS A;  3BQ3 A;  3PM8 A;  1S5G Y;  1WY9 A;  5CSJ A;  3AAJ A;  2HET A;  2JNX A;  3BUN B;  4PHN A;  1JFJ A;  4GUK A;  1N0Y A;  1SR6 C;  3O2P A;  5AER A;  1F71 A;  4PE1 A;  1K9P A;  1XFX O;  1NX0 A;  2BCB A;  2KFH A;  4YGD B;  1TRF A;  2I18 A;  1B9A A;  3VRO A;  1FPW A;  3LK0 A;  1PRW A;  1A2X A;  2H61 C;  2KAX A;  5CPV A;  4AQI A;  1CB1 A;  4I5K A;  2LVV A;  3VRQ A;  5J3X A;  1TNQ A;  1WRL A;  4GBA A;  1H8B A;  1SNL A;  1OOJ A;  4GAO A;  1KFU L;  3TS5 C;  1TCO B;  1QV1 A;  4AQJ A;  1R6P A;  1DJW A;  2K7C A;  1Y6W A;  1JC2 A;  3PAL A;  4BY4 A;  1QVI Z;  2LNK A;  2LV7 A;  3EVV A;  1SYM A;  1LA3 A;  1KFX L;  1EH2 A;  1SW8 A;  4YGC B;  1J7O A;  2GGZ A;  1CDP A;  2K0J A;  2E30 A;  3EVU A;  5AXI A;  1PAL A;  1F70 A;  2JC2 A;  5ER4 X;  1OZS A;  1NSH A;  4GPL B;  3DF0 B;  3SIA A;  1AUI B;  3BYA A;  3AKB A;  4ICB A;  3SG7 A;  1AK8 A;  1WLZ A;  3SG4 A;  1G33 A;  1NCY A;  2F2O A;  1S6I A;  3CR4 X;  3TZ1 A;  5K89 A;  3TDU A;  1Y1A A;  2JTT A;  1IWQ A;  3BUX B;  2LLS A;  1QS7 A;  1XFV O;  3NSI A;  5HLV A;  4MZK A;  5DKN A;  3CLN A;  1K94 A;  4N1F A;  3EKH A;  1PSB A;  1DJG A;  3ICB A;  3LLE A;  1DVI A;  4MZJ A;  1X02 A;  2HQW A;  3SG5 A;  4P5O E;  2KYC A;  1CDN A;  1KQM C;  1YTZ C;  1Y1U A;  3RLZ A;  2ISD A;  1YRT B;  1XFU O;  1DJY A;  4E68 A;  4ZCV A;  1SMG A;  1QLS A;  3ZNI A;  1BLQ A;  2KI4 C;  2FCD A;  3WNX B;  2PSR A;  1MR8 A;  2M49 B;  5KU1 A;  2CBL A;  1BMO A;  2OTG C;  1TCF A;  1S6C A;  2LMT A;  1SK6 D;  2JUL A;  4MBE A;  4ETO A;  2BL0 C;  1UP5 A;  1KK8 B;  2HF5 A;  2RGI A;  3FWC A;  3I5F B;  3OP0 A;  2DOQ A;  2M1U A;  1DGU A;  2WOR A;  1CDL A;  1QIW A;  1U5I B;  1VRK A;  4F0Z B;  1WLM A;  3WXA A;  1K93 D;  2MAZ A;  4MSP A;  2KQY A;  2LAP A;  4PHK A;  2H61 A;  4IL1 A;  2MJW B;  2NXQ A;  1B8L A;  2GV5 A;  2JU0 A;  4N5X A;  4YI9 A;  2ZKM X;  4JWQ A;  2LM5 A;  2PRU A;  1RTP 1;  2LC5 A;  2D8N A;  1CLB A;  4UPG A;  1DJX A;  3I5G B;  2MLE C;  3BOW A;  2OPO A;  3LK1 A;  2F8P A;  3DVK A;  1XK4 C;  1CMG A;  5KTY A;  1L7Z A;  2K7O A;  3PAT A;  1KFX S;  2WND A;  1XA5 A;  1OMR A;  1QAS A;  1A75 B;  1WDC C;  2CXJ A;  2M97 A;  4YBH B;  3KF9 A;  4JPZ B;  2I94 A;  2LLU A;  1YX7 A;  2F33 A;  1SCM B;  1F55 A;  5FYX A;  1MF8 B;  3TDZ A;  1QIV A;  4HSZ A;  1CTR A;  1SY9 A;  1YRU B;  4BY5 A;  2KAV A;  1IKU A;  4M2Q A;  1AJ5 A;  4YGB B;  1TTX A;  5GQQ C;  1J7P A;  1NWD A;  1B1G A;  2I7A A;  3WHU B;  4MN0 A;  1NIW A;  3VRR A;  5B8I B;  1LVC D;  1SL7 A;  5IBW A;  3KHE A;  2Y4Q A;  1OQP A;  2F3Z A;  2JQ6 A;  1ODB A;  4HRH A;  3DF0 A;  1A75 A;  2LVK A;  4NDB A;  1GQM A;  1KWO B;  2BBM A;  4PHJ A;  2Q91 A;  1CMF A;  1EXR A;  2Q4U A;  3JVT C;  1ZFS A;  4CFR A;  1YUR A;  3C1V A;  1E8A A;  1SL9 A;  2WCF A;  1QLK A;  1QXP A;  1UHH A;  1UHN A;  1XFZ O;  1BOD A;  1GGW A;  3PSR A;  2JZI A;  1CLL A;  1NX1 A;  1W7J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...