4DUQA

The structure of ca2+-loaded s100a2 at 1.3a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
88
Chain Sequence
SSSLEQALAVLVTTFHKYSSQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMSNDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of Ca2+-loaded S100A2 at 1.3- angstrom resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Protein S100-A2
total genus 35
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4duqA00
2LMTA 2BL0C 1SPYA 2MA2A 2BKHB 1CLMA 1WY9A 2LVKA 1NSHA 2Q4UA 1JFJA 1SCMC 3OX5A 1NX0A 2KYFA 1CDLA 2KAVA 4F0ZB 1JSAA 1NP8A 3O4YA 3I5FB 4PHMA 2G2BA 1V1GA 1EH2A 1QVIZ 2G9BA 2LNKA 1NWDA 2F2OA 1TCOB 1U5IA 1CFPA 2HETA 1W7JB 1IWQA 2KBIA 1QV0A 3AKAA 3I5FC 1KK7Y 1G8IA 2KHNA 4MZJA 1S5GZ 1A03A 3I5IB 3SG4A 1XFXO 2JXLA 2KFHA 3K21A 3I5HB 1Y1AA 3O2PA 5HKWA 1HQVA 1BMOA 5FYXA 1X02A 3TUYC 2QPTA 2TN4A 4DUQA 3EVUA 1B8RA 1LA0A 1LVCD 1YUSA 1MWNA 5JJGA 1EXRA 4FQOA 4ZCUA 2KFFA 2EHBA 1BR4B 2B1UA 5IBWA 4WQ2A 2D8NA 1LINA 1GQMA 4N5XA 1QTXA 1J7RA 2H2KA 1EJ3A 1FF1A 1A2XA 1WRLA 2OS8C 4E68A 4HSZA 1MXEA 1YUUA 2NCPA 1A75A 1PVBA 3SG5A 3ZNIA 2F2PA 1J7QA 1G4YR 1PK0D 2A4JA 5GQQC 1S6JA 1M46A 2K8MB 2V53A 3EVRA 4USLA 1SYMA 1KFUS 1NCZA 1HT9A 2JNFA 2NCOA 3IF7A 5BPJA 5CSNA 2H61A 1Y6WA 1S6IA 2ZKMX 3GK4X 4PDZA 1OZOA 1GJYA 2SASA 1SMGA 3DF0A 1FPWA 4GAOA 1F71A 1PRWA 2PRUA 3FIAA 1JF0A 1TNPA 2I94A 3KPXA 4MEWA 1SKTA 2K7DA 1MF8B 3SIBA 1B1GA 4GGNA 4N1GA 1KCYA 1SR6C 2AMIA 1G33A 2K61A 4MSPA 1ALWA 1TCFA 4YRUA 1N0YA 1S36A 5HLVA 2O5GA 2EC6B 1SR6B 4I5LB 3NSLA 1SY9A 1NUBA 3ICBA 1WDCB 3GK2A 2H61C 2HQ8A 3NXAA 3D0YA 2FCEA 2Y4QA 5AEQA 4M2QA 4YBHB 1XVJA 4A4CA 3BUNB 4YGDB 3O78A 3D0YB 2KI6C 3PM8A 1DT7B 1RECA 4N1FA 3H4SE 1S6CA 2F3YA 3KF9A 4BY4A 1IJ6A 4OV2A 1C7WA 4HRHA 2KI6D 2LLTA 4MBEA 3DVMA 1IJ5A 2KBMA 3WNXB 3JTDB 4CLNA 1YURA 4PHKA 4PE7A 3MSEB 1K96A 2LVIA 1YX8A 2PVBA 3BUOB 5ER4X 3BQ3A 2LVVA 4FTGA 2KI4B 4HREE 2JT3A 2OTGC 3SIAA 2BE6A 1OMVA 2BBNA 2OS8B 1L2OB 5KTYA 1F4QA 1SK6D 4C0KA 3A8RA 3DF0B 1AVSA 3FS7A 3SJSA 4ZCVA 2MLFC 2PSRA 4CFRA 4CFQA 1PALA 1V1FA 3LK1A 4ORCB 2LE9B 1JC2A 1JFKA 4DCKA 3TUYB 1BU3A 3SG6A 1AUIB 3TS5C 3EK4A 2ZN8A 1CDMA 4M2PA 1YUTA 2KNEA 1WDCC 2WCBA 2LAPA 2VRGA 2FJUB 3PLFB 4BY5A 4D1EA 2LHLA 1XFZO 2JTTA 3EKHA 3VRNA 3EK7A 1JF2A 5CSFA 2LCPA 2AAOA 3KO0A 3PSRA 4OVNF 3NSIA 1OSAA 1KFUL 3PATA 4I5NB 3SG7A 1S5GY 2L4HA 1XYDA 2JTZA 2PALA 1AJ4A 1M45A 2CCMA 1K9UA 1PSRA 1TNWA 1QVIY 5DKQA 2MBXA 1YRUB 1R2UA 3VRRA 3BUXB 3VROA 1J1DA 1K90D 1H4BA 3FWBA 3CZTX 2LUXA 5DKNA 4CIDA 3CTNA 1OZSA 2F33A 2FOTA 4WRIA 1CM4A 4OCIA 5PALA 4UPGA 5CSJA 1FI5A 4WQ3A 3M0WA 2Y5IA 5D7FA 4ETOA 2I2RE 1KSOA 3BUWB 1DJHA 2L50A 5I2QA 1CLBA 4NDCA 2KAXA 3LCPC 1CMGA 4NQGA 1TN4A 1DF0B 2K2AA 4NDBA 2KI4C 1NIWA 1OQPA 3DVKA 3PN7C 1KSMA 4GFTA 4PHJA 3LLEA 4Q04A 1QASA 1PULA 3FWCA 4U8DA 2K7CA 1AP4A 1AJ5A 4HRGA 1N65A 1JBAA 1TNQA 1B7TZ 2JWWA 1RFJA 1SNLA 1XFWO 3QRXA 1CFDA 2LUCA 2ZRTA 1CM1A 1J55A 1M39A 1SW8A 2LVJA 2IS9A 1YTZC 1SCVA 1SL8A 1XFVO 2I18A 1GGWA 2GGZA 4M2OA 1OE9B 1CDNA 1OOJA 2KYCA 3JVTB 4ICBA 4XYNA 1BT6A 2M0RA 1FW4A 3I5GB 4YGCB 4MZLA 1XFYO 3CLNA 1UURA 2OTGB 3SG3A 1U5IB 1RJVA 1F70A 2M1UA 1SL7A 2WOSA 2MLEC 1YR5A 1ZOTB 2M49B 3AAKA 1JWDA 2JOJA 1D1OA 1CMFA 1IKUA 1B8CA 1CFCA 2WCFA 4I5KA 2CT9A 1IQ3A 3BOWB 1DF0A 1CB1A 2GV5A 1DJIA 2M7LA 1DJYA 2F8PA 1R6PA 2DOQA 1DJXA 2KAYA 2NZ0A 1M31A 3GK1A 1IQ5A 5KU1A 3GOFA 5I2OA 1B9AA 1UP5A 3TS5B 4P5OE 1NX3A 2LP3A 1WLZA 1B8LA 3KHEA 1J1EA 1KFXS 2JRFA 3TDZA 2L51A 2HF5A 3BUMB 4GNKB 2M9GA 2MHHA 1AK8A 2MRDA 1QIWA 2R2IA 2WC8A 3CR4X 2KFGA 2L5XB 4I5JA 1FBVA 1M63B 1MR8A 2KOTA 2ZFDA 4DIRA 1TIZA 5K89A 1EL4A 2JULA 2QACA 2M1KB 3EKJA 1GGZA 1XA5A 4PE0A 1FI6A 1UHKA 5DKRA 1NYAA 3JTDC 1TRFA 2GGMA 2PMYA 2M97A 2Y1MA 4OKHA 5HKZA 1NX1A 2WCEA 2ZN9A 2M8UA 1QLSA 1ZUZA 4ORBB 4MZKA 3BYAA 1F8HA 2LMVA 4PCWA 1QIVA 3HCMA 4C0LA 1C07A 1BJFA 3SG2A 1A29A 1QXPA 1PVAA 1CKKA 1MQ1A 1RK9A 2PASA 3ZWHA 1WLMA 2L2EA 4L9MA 4JPZB 5AANA 3OHMB 2FCDA 2LHIA 2K0JA 1KQVA 1A4PA 1UUSA 1YVLA 2WNDA 4OR9B 4DS7A 1DMOA 3NSKA 3LK0A 2Q91A 1EG4A 1TNXA 2E30A 3VGOA 3VRPA 1RTP1 2KSPA 1J7OA 1DGVA 4TNCA 2MJWB 5CSIA 1KFXL 1IRJA 3WXAA 3AKBA 1PSBA 1JUOA 2ZNEA 4PALA 3PALA 4GGFA 5G08A 1RROA 1W7IB 2L0PA 1K93D 1Y0VH 5I8NA 5HYDA 4IL1A 1KQMB 1XFUO 1C7VA 2BL0B 4GUKA 1TTXA 2BBMA 4QJ4B 1K94A 1Y1XA 2K7BA 2CTNA 3IQQA 5AERA 4PHNA 4R1EA 2I7AA 1E8AA 1ODBA 3CR5X 2M7NA 4XJKB 3OB1B 1BOCA 3DD4A 2KGRA 2L4IA 1BLQA 2ZNDA 1QJTA 3TZ1A 5HKYA 5B8IB 2HPSA 2JZIA 1B47A 1KK8B 1BODA 3BXKA 2RGIA 1A75B 1XK4C 1YVHA 1QX5B 1LXFC 1IH0A 2ISDA 4PE1A 4YGEB 3PFVA 2LC5A 2ZRSA 5I2LA 1QS7A 2WORA 1NX2A 1UWOA 1NPQA 2BKIB 2JXCA 4GBAA 3WHUB 1DJWA 3NSOA 1DTLA 2M29A 4NDDA 4XJKA 1EG3A 2KQYA 1OMDA 1UHNA 2M3WA 4YI9A 2BCBA 2Y1NA 4MVFA 3JVTC 2MAZA 3EK8A 1CNPA 2LP2A 3I5GC 1IGVA 1B7TY 4YGBB 3C1VA 1UHJA 3I5IC 5HLOA 1S3PA 5AFPA 1BG1A 2K7OA 2LV7A 1UHIA 1DJGA 4MLWA 2EGDA 2JU0A 4MRXA 1J7PA 2BCXA 4C0JA 2LMUA 5JOLA 1CTRA 1WRZA 1QX7A 2JNXA 2JT0A 3VRQA 3CWGA 1XK4A 3TDIA 3DVEA 2BCAA 2F3ZA 5TNCA 1B4CA 5D69A 3DVJA 3PN7B 1NCYA 1MHOA 1DJZA 2K2FA 1DVIA 2JQ6A 1YRTB 2JC2A 2BECA 3WHTB 2AUCA 2JPTA 2E6WA 3CGAA 1S26D 1IG5A 1K9PA 3OX6A 3RM1A 1ZMZA 4A4BA 1Y1UA 1VRKA 3E3RA 4AQIA 4P2YB 2O60A 2L98A 1L2OC 2HQWA 1S1EA 4QJ3B 1LA3A 1LKJA 3LL8B 3BOWA 3OP0A 3AAJA 3IQOA 2EC6C 4PE4A 1H8BA 1NCXA 2KQ6A 5AXIA 2NXQA 1SCMB 2SCPA 1QLKA 1KWOB 1CDPA 3CR2A 2KGBC 4AOMA 1BR1B 1CLLA 3F45A 5KSZA 2CNPA 3TDUA 1L7ZA 1QATA 5J3XA 1CFFA 1ZFSA 1BF5A 4YGAA 1K2HA 1F55A 1MUXA 1ZACA 3EVVA 1MXLC 2BE4A 3O6BA 4MRYA 1XO5A 3A4UB 1UHHA 3RLZA 3I5HC 1KK7Z 2KDHA 2OPOA 2LM5A 4YI8A 1YX7A 1K8UA 1Q80A 2LLSA 5CPVA 1AHRA 3OB2B 4QJ5B 5F6TA 4JWQA 1SL9A 3D10A 3KEVA 4ORAB 4CPVA 1ALVA 1F4OA 2LLUA 4AQJA 1OMRA 1KWOC 2COLB 1SBJA 3HX4A 2JT8A 4GGFC 1DGUA 5ER5A 3CS1A 4MN0A 4DRWA 1F54A 2NLNA 1QX2A 1RWYA 1KK8C 1N2DA 2LANA 1K9KA 4GPLB 2P6BB 2CXJA 1QV1A 4JQ0D 1SRAA 1WRKA 1K95A 1TOPA 1KQMC 2CBLA
chains in the Genus database with same CATH superfamily
2LMTA 2BL0C 3OGNA 1SPYA 2MA2A 2BKHB 1CLMA 1WY9A 2LVKA 1NSHA 2Q4UA 3R1PA 1JFJA 1SCMC 3CYZA 1NX0A 2KYFA 3OX5A 1CDLA 2KAVA 4F0ZB 1JSAA 1NP8A 3O4YA 3I5FB 4PHMA 2G2BA 1V1GA 1EH2A 1W9ZA 1QVIZ 2G9BA 2LNKA 1NWDA 2F2OA 1TCOB 1U5IA 1CFPA 2HETA 1W7JB 1IWQA 2KBIA 1QV0A 3AKAA 3I5FC 1KK7Y 1G8IA 2WCJA 2KHNA 4MZJA 1S5GZ 1A03A 2WC5A 3I5IB 3SG4A 1XFXO 2JXLA 2KFHA 3K21A 3I5HB 1Y1AA 3O2PA 3R1OA 5HKWA 1HQVA 1BMOA 3DZTA 1X02A 3FE6A 5FYXA 3TUYC 2QPTA 2TN4A 4DUQA 3EVUA 1B8RA 1LA0A 1TWOA 1LVCD 1YUSA 1MWNA 5JJGA 1EXRA 4FQOA 4ZCUA 2KFFA 2EHBA 1BR4B 2B1UA 5IBWA 4WQ2A 3RZSA 2D8NA 1LINA 1GQMA 4N5XA 1QTXA 1J7RA 2H2KA 1EJ3A 1FF1A 1A2XA 1WRLA 2FJYA 2OS8C 4E68A 4HSZA 3DY9A 1MXEA 1YUUA 2NCPA 1A75A 1PVBA 3SG5A 3ZNIA 2F2PA 1J7QA 1OOFA 1G4YR 1PK0D 2A4JA 5GQQC 1S6JA 3S0AA 1M46A 3S0FA 3BFAA 2K8MB 2V53A 3EVRA 4USLA 4INWA 1SYMA 1KFUS 3OBVA 1NCZA 1HT9A 2JNFA 2NCOA 3IF7A 3D77A 5BPJA 4OZDA 5CSNA 3N7HA 2H61A 1OW4A 1Y6WA 1S6IA 2ZKMX 3GK4X 3FE8A 4PDZA 1OZOA 3R72A 1GJYA 1P28A 2SASA 5HL1A 1SMGA 3DF0A 3B6XA 2QEHA 4GAOA 1FPWA 1F71A 1PRWA 2PRUA 5D3OA 3FIAA 1JF0A 1TNPA 2I94A 3KPXA 4MEWA 2ERBA 1SKTA 2K7DA 1MF8B 3SIBA 1B1GA 4GGNA 4N1GA 1KCYA 1IIOA 1SR6C 2AMIA 1G33A 2K61A 4MSPA 1DQEA 1ALWA 1TCFA 2QEVA 4YRUA 1N0YA 1S36A 5HLVA 2O5GA 2EC6B 1SR6B 4I5LB 3NSLA 1SY9A 1NUBA 3ICBA 1WDCB 3GK2A 2H61C 2HQ8A 3NXAA 3D0YA 1OOGA 2FCEA 2Y4QA 5AEQA 4M2QA 1GM0A 4YBHB 1XVJA 4A4CA 3BUNB 4YGDB 3O78A 3SS3A 3D0YB 2KI6C 3PM8A 1DT7B 1RECA 4N1FA 3H4SE 1S6CA 2F3YA 3KF9A 4BY4A 1IJ6A 4OV2A 1C7WA 1TUZA 3BFHA 2KI6D 2LLTA 4HRHA 4MBEA 5FI2A 3DVMA 1IJ5A 2KBMA 3WNXB 3JTDB 4CLNA 1YURA 4PHKA 3DYEA 4PE7A 3MSEB 1K96A 2LVIA 1YX8A 2PVBA 3BUOB 5ER4X 3BQ3A 2WCLA 2LVVA 4FTGA 2KI4B 3DXLA 3EG5B 2JT3A 2OTGC 4HREE 4FQTA 2BE6A 1OMVA 2BBNA 2OS8B 3SIAA 1L2OB 5KTYA 1F4QA 3PM2A 2PQLA 1SK6D 4C0KA 3A8RA 3DF0B 1AVSA 3FS7A 3SJSA 4ZCVA 2MLFC 2PSRA 4CFRA 2WC6A 4CFQA 1PALA 1V1FA 3LK1A 4ORCB 2LE9B 1JC2A 1JFKA 4DCKA 3TUYB 1BU3A 4JD9A 3SG6A 1AUIB 3TS5C 3EK4A 2ZN8A 1CDMA 4M2PA 1YUTA 2KNEA 1WDCC 2QEOA 2LAPA 2VRGA 2FJUB 2WCBA 3PLFB 4BY5A 2LHLA 2QDIA 1XFZO 4D1EA 2JTTA 3EKHA 3VRNA 3EK7A 1JF2A 5CSFA 2LCPA 2AAOA 3KO0A 3PSRA 3Q8IA 3NHTA 4OVNF 1DELA 1OSAA 1KFUL 3NSIA 3PATA 4I5NB 1S5GY 3SG7A 2L4HA 1XYDA 2JTZA 2PALA 1AJ4A 1M45A 2CCMA 1Z2CB 1K9UA 1PSRA 1TNWA 1QVIY 5DKQA 2MBXA 1YRUB 1R2UA 3VRRA 3BUXB 3PJIA 3VROA 1C3YA 1J1DA 1K90D 1H4BA 3FWBA 3CZTX 2LUXA 5DKNA 4CIDA 3CTNA 3CZ2A 3NHIA 1OZSA 2F33A 2FOTA 4WRIA 1CM4A 4OCIA 5PALA 4UPGA 5CSJA 1FI5A 4WQ3A 3M0WA 2Y5IA 5D7FA 4ETOA 3D73A 2I2RE 1KSOA 3BUWB 1DJHA 2L50A 5I2QA 1CLBA 4NDCA 2KAXA 3LCPC 1CMGA 4NQGA 1TN4A 1DF0B 2K2AA 4NDBA 2KI4C 3CZ0A 1NIWA 1OQPA 3DVKA 3PN7C 1KSMA 4GFTA 4PHJA 3LLEA 4Q04A 1QASA 1PULA 3FWCA 3IVTA 2K7CA 4U8DA 1AJ5A 1AP4A 4HRGA 1C3ZA 1N65A 1JBAA 1TNQA 3UNWA 3FE9A 1B7TZ 2JWWA 1RFJA 1SNLA 1XFWO 3QRXA 1CFDA 2LUCA 2ZRTA 1CM1A 1J55A 1M39A 1SW8A 2LVJA 2IS9A 1YTZC 1SCVA 1SL8A 1XFVO 2I18A 1GGWA 2GGZA 4M2OA 1OE9B 1QWVA 1CDNA 1OOJA 3QMEA 4INXA 2KYCA 3JVTB 4ICBA 4XYNA 1BT6A 2M0RA 1FW4A 3I5GB 4YGCB 4MZLA 1XFYO 3CLNA 1UURA 2OTGB 3SG3A 1U5IB 1RJVA 1F70A 2M1UA 1SL7A 2WOSA 2MLEC 1YR5A 1ZOTB 3D76A 2M49B 3AAKA 1JWDA 2JOJA 1D1OA 1CMFA 1IKUA 1B8CA 1CFCA 3B87A 2WCFA 4I5KA 2CT9A 1IQ3A 3BOWB 1DF0A 1CB1A 2GV5A 1DJIA 2M7LA 3L4LA 1DJYA 2F8PA 1R6PA 2DOQA 1DJXA 2KAYA 2NZ0A 1M31A 3GK1A 2BAPA 1IQ5A 2PYQA 5KU1A 3GOFA 5I2OA 1B9AA 1UP5A 3TS5B 2K60A 4P5OE 1NX3A 2LP3A 1WLZA 1B8LA 3CABA 3R1VA 3UO9A 3KHEA 1J1EA 1KFXS 2JRFA 3TDZA 2L51A 2HF5A 3BUMB 4GNKB 2M9GA 2MHHA 1AK8A 2MRDA 1QIWA 2R2IA 2WC8A 3CR4X 2KFGA 2L5XB 4I5JA 1FBVA 1M63B 1MR8A 2KOTA 2ZFDA 4DIRA 1TIZA 5K89A 1EL4A 2JULA 2QACA 2M1KB 3EKJA 1GGZA 1XA5A 4PE0A 2KPHA 1FI6A 1UHKA 5DKRA 1NYAA 3JTDC 1TRFA 2GGMA 2PMYA 2M97A 2Y1MA 4OKHA 5HKZA 1NX1A 2WCMA 2WCEA 2ZN9A 2M8UA 1QLSA 1ZUZA 3L47A 3S0GA 4ORBB 4MZKA 3NGVA 3BYAA 1F8HA 2LMVA 4PCWA 1QIVA 3HCMA 4C0LA 1C07A 1BJFA 3SG2A 1A29A 1QXPA 1PVAA 2L2CA 1CKKA 1MQ1A 1RK9A 2PASA 3ZWHA 1WLMA 3V2LA 2L2EA 2H8VA 4L9MA 4JPZB 5AANA 3OHMB 2FCDA 2LHIA 2K0JA 1KQVA 1A4PA 1UUSA 1YVLA 2WNDA 4OR9B 4DS7A 1DMOA 3NSKA 3LK0A 2Q91A 1EG4A 1TNXA 2E30A 2P71A 3VGOA 1RTP1 2KSPA 3VRPA 1DGVA 4TNCA 1J7OA 2MJWB 5CSIA 1KFXL 1IRJA 3WXAA 3AKBA 1PSBA 1JUOA 2ZNEA 4PALA 3PALA 4GGFA 5G08A 1RROA 1W7IB 2L0PA 1K93D 1T14A 1Y0VH 5I8NA 1OOIX 5HYDA 4IL1A 1KQMB 1XFUO 1C7VA 2BL0B 4GUKA 1TTXA 2BBMA 4QJ4B 1K94A 3O4XA 1Y1XA 2K7BA 2CTNA 3IQQA 5AERA 4PHNA 4R1EA 2I7AA 4F7FA 1E8AA 1ODBA 3CR5X 2M7NA 2JPOA 4XJKB 3OB1B 1BOCA 3DD4A 2KGRA 2L4IA 4KYNA 1BLQA 2ZNDA 1QJTA 3TZ1A 5HKYA 5B8IB 2HPSA 2JZIA 1B47A 1KK8B 1BODA 2BNXA 2RGIA 3BXKA 1A75B 2YGUA 3B86A 1XK4C 1YVHA 1DEKA 1LXFC 1QX5B 1IH0A 2ISDA 4PE1A 4YGEB 3PFVA 2LC5A 2ZRSA 5I2LA 1QS7A 2WORA 1NX2A 1UWOA 1NPQA 2BKIB 2JXCA 4GBAA 3WHUB 3CZ1A 1DJWA 3NSOA 1DTLA 2M29A 4NDDA 1ORGA 1EG3A 2KQYA 4XJKA 1OMDA 1UHNA 2M3WA 4YI9A 2BCBA 2Y1NA 3K1EA 4MVFA 3JVTC 2MAZA 3EK8A 3L4AA 1CNPA 2LP2A 3I5GC 1IGVA 1B7TY 4YGBB 3C1VA 1UHJA 3D78A 3I5IC 5HLOA 1S3PA 5AFPA 1XFRA 5I94A 1BG1A 2K7OA 2LV7A 1UHIA 1DJGA 4MLWA 2EGDA 2JU0A 2QEBA 4MRXA 1J7PA 2BCXA 4C0JA 2LMUA 4IJ7A 1CTRA 1WRZA 5JOLA 1QX7A 2JNXA 2JT0A 3VRQA 5FI7A 3CWGA 1XK4A 2WCHA 3TDIA 3CDNA 3SS5A 4PT1A 3DVEA 2BCAA 3D75A 1SSEB 2F3ZA 5TNCA 1B4CA 5D69A 3DVJA 3PN7B 1NCYA 1MHOA 1DJZA 2K2FA 1DVIA 3S0EA 2L5YA 2JQ6A 1YRTB 2JC2A 2BECA 3WHTB 2AUCA 2JPTA 3B88A 2E6WA 3S0DA 3CGAA 1S26D 1IG5A 5EL2A 1K9PA 3OX6A 3RM1A 1ZMZA 3D74A 4A4BA 1Y1UA 1VRKA 3E3RA 3SS4A 4P2YB 4AQIA 2O60A 2L98A 2GTEA 1OOHA 3BJHA 1L2OC 2HQWA 2KLDA 1S1EA 4QJ3B 1TUJA 1LA3A 1LKJA 3LL8B 3BOWA 3OP0A 3AAJA 3IQOA 2EC6C 4PE4A 1H8BA 1NCXA 2KQ6A 5AXIA 2KLEA 2NXQA 3VB1A 1SCMB 2SCPA 1QLKA 1KWOB 1CDPA 3CR2A 2KGBC 3S0BA 4AOMA 1BR1B 1CLLA 3F45A 5KSZA 2CNPA 3TDUA 1L7ZA 1QATA 5J3XA 1CFFA 1ZFSA 1BF5A 3BFBA 2WCKA 4YGAA 1K2HA 1F55A 1MUXA 1ZACA 3EVVA 1MXLC 2BE4A 3O6BA 4MRYA 1XO5A 3A4UB 1UHHA 3RLZA 3I5HC 1KK7Z 2KDHA 2OPOA 2LM5A 4YI8A 1YX7A 1K8UA 1Q80A 2LLSA 5CPVA 1AHRA 3B7AA 3OB2B 4QJ5B 1DC1A 5F6TA 4JWQA 1SL9A 3D10A 3KEVA 4ORAB 4CPVA 1ALVA 1F4OA 2LLUA 2P70A 1OMRA 4AQJA 1KWOC 2COLB 1SBJA 3HX4A 2JT8A 4GGFC 1DGUA 5ER5A 3CS1A 4MN0A 5FI6A 4DRWA 1F54A 2NLNA 1QX2A 1RWYA 1KK8C 1N2DA 1LS8A 2LANA 5DICA 1K9KA 4GPLB 2P6BB 4JKTA 2CXJA 1QV1A 4JQ0D 1SRAA 1WRKA 1K95A 1Z4HA 1TOPA 1KQMC 2CBLA
chains in the Genus database with same CATH topology
2LMTA 2BL0C 1SPYA 2MA2A 2BKHB 1CLMA 1WY9A 2LVKA 1NSHA 2Q4UA 1JFJA 1SCMC 3OX5A 1NX0A 2KYFA 1CDLA 2KAVA 4F0ZB 1JSAA 1NP8A 3O4YA 3I5FB 4PHMA 2G2BA 1V1GA 1EH2A 1QVIZ 2G9BA 2LNKA 1NWDA 2F2OA 1TCOB 1U5IA 1CFPA 2HETA 1W7JB 1IWQA 2KBIA 1QV0A 3AKAA 3I5FC 1KK7Y 1G8IA 2KHNA 4MZJA 1S5GZ 1A03A 3I5IB 3SG4A 1XFXO 2JXLA 2KFHA 3K21A 3I5HB 1Y1AA 3O2PA 5HKWA 1HQVA 1BMOA 5FYXA 1X02A 3TUYC 2QPTA 2TN4A 4DUQA 3EVUA 1B8RA 1LA0A 1LVCD 1YUSA 1MWNA 5JJGA 1EXRA 4FQOA 4ZCUA 2KFFA 2EHBA 1BR4B 2B1UA 5IBWA 4WQ2A 2D8NA 1LINA 1GQMA 4N5XA 1QTXA 1J7RA 2H2KA 1EJ3A 1FF1A 1A2XA 1WRLA 2OS8C 4E68A 4HSZA 1MXEA 1YUUA 2NCPA 1A75A 1PVBA 3SG5A 3ZNIA 2F2PA 1J7QA 1G4YR 1PK0D 2A4JA 5GQQC 1S6JA 1M46A 2K8MB 2V53A 3EVRA 4USLA 1SYMA 1KFUS 1NCZA 1HT9A 2JNFA 2NCOA 3IF7A 5BPJA 5CSNA 2H61A 1Y6WA 1S6IA 2ZKMX 3GK4X 4PDZA 1OZOA 1GJYA 2SASA 1SMGA 3DF0A 1FPWA 4GAOA 1F71A 1PRWA 2PRUA 3FIAA 1JF0A 1TNPA 2I94A 3KPXA 4MEWA 1SKTA 2K7DA 1MF8B 3SIBA 1B1GA 4GGNA 4N1GA 1KCYA 1SR6C 2AMIA 1G33A 2K61A 4MSPA 1ALWA 1TCFA 4YRUA 1N0YA 1S36A 5HLVA 2O5GA 2EC6B 1SR6B 4I5LB 3NSLA 1SY9A 1NUBA 3ICBA 1WDCB 3GK2A 2H61C 2HQ8A 3NXAA 3D0YA 2FCEA 2Y4QA 5AEQA 4M2QA 4YBHB 1XVJA 4A4CA 3BUNB 4YGDB 3O78A 3D0YB 2KI6C 3PM8A 1DT7B 1RECA 4N1FA 3H4SE 1S6CA 2F3YA 3KF9A 4BY4A 1IJ6A 4OV2A 1C7WA 4HRHA 2KI6D 2LLTA 4MBEA 3DVMA 1IJ5A 2KBMA 3WNXB 3JTDB 4CLNA 1YURA 4PHKA 4PE7A 3MSEB 1K96A 2LVIA 1YX8A 2PVBA 3BUOB 5ER4X 3BQ3A 2LVVA 4FTGA 2KI4B 4HREE 2JT3A 2OTGC 3SIAA 2BE6A 1OMVA 2BBNA 2OS8B 1L2OB 5KTYA 1F4QA 1SK6D 4C0KA 3A8RA 3DF0B 1AVSA 3FS7A 3SJSA 4ZCVA 2MLFC 2PSRA 4CFRA 4CFQA 1PALA 1V1FA 3LK1A 4ORCB 2LE9B 1JC2A 1JFKA 4DCKA 3TUYB 1BU3A 3SG6A 1AUIB 3TS5C 3EK4A 2ZN8A 1CDMA 4M2PA 1YUTA 2KNEA 1WDCC 2WCBA 2LAPA 2VRGA 2FJUB 3PLFB 4BY5A 4D1EA 2LHLA 1XFZO 2JTTA 3EKHA 3VRNA 3EK7A 1JF2A 5CSFA 2LCPA 2AAOA 3KO0A 3PSRA 4OVNF 3NSIA 1OSAA 1KFUL 3PATA 4I5NB 3SG7A 1S5GY 2L4HA 1XYDA 2JTZA 2PALA 1AJ4A 1M45A 2CCMA 1K9UA 1PSRA 1TNWA 1QVIY 5DKQA 2MBXA 1YRUB 1R2UA 3VRRA 3BUXB 3VROA 1J1DA 1K90D 1H4BA 3FWBA 3CZTX 2LUXA 5DKNA 4CIDA 3CTNA 1OZSA 2F33A 2FOTA 4WRIA 1CM4A 4OCIA 5PALA 4UPGA 5CSJA 1FI5A 4WQ3A 3M0WA 2Y5IA 5D7FA 4ETOA 2I2RE 1KSOA 3BUWB 1DJHA 2L50A 5I2QA 1CLBA 4NDCA 2KAXA 3LCPC 1CMGA 4NQGA 1TN4A 1DF0B 2K2AA 4NDBA 2KI4C 1NIWA 1OQPA 3DVKA 3PN7C 1KSMA 4GFTA 4PHJA 3LLEA 4Q04A 1QASA 1PULA 3FWCA 4U8DA 2K7CA 1AP4A 1AJ5A 4HRGA 1N65A 1JBAA 1TNQA 1B7TZ 2JWWA 1RFJA 1SNLA 1XFWO 3QRXA 1CFDA 2LUCA 2ZRTA 1CM1A 1J55A 1M39A 1SW8A 2LVJA 2IS9A 1YTZC 1SCVA 1SL8A 1XFVO 2I18A 1GGWA 2GGZA 4M2OA 1OE9B 1CDNA 1OOJA 2KYCA 3JVTB 4ICBA 4XYNA 1BT6A 2M0RA 1FW4A 3I5GB 4YGCB 4MZLA 1XFYO 3CLNA 1UURA 2OTGB 3SG3A 1U5IB 1RJVA 1F70A 2M1UA 1SL7A 2WOSA 2MLEC 1YR5A 1ZOTB 2M49B 3AAKA 1JWDA 2JOJA 1D1OA 1CMFA 1IKUA 1B8CA 1CFCA 2WCFA 4I5KA 2CT9A 1IQ3A 3BOWB 1DF0A 1CB1A 2GV5A 1DJIA 2M7LA 1DJYA 2F8PA 1R6PA 2DOQA 1DJXA 2KAYA 2NZ0A 1M31A 3GK1A 1IQ5A 5KU1A 3GOFA 5I2OA 1B9AA 1UP5A 3TS5B 4P5OE 1NX3A 2LP3A 1WLZA 1B8LA 3KHEA 1J1EA 1KFXS 2JRFA 3TDZA 2L51A 2HF5A 3BUMB 4GNKB 2M9GA 2MHHA 1AK8A 2MRDA 1QIWA 2R2IA 2WC8A 3CR4X 2KFGA 2L5XB 4I5JA 1FBVA 1M63B 1MR8A 2KOTA 2ZFDA 4DIRA 1TIZA 5K89A 1EL4A 2JULA 2QACA 2M1KB 3EKJA 1GGZA 1XA5A 4PE0A 1FI6A 1UHKA 5DKRA 1NYAA 3JTDC 1TRFA 2GGMA 2PMYA 2M97A 2Y1MA 4OKHA 5HKZA 1NX1A 2WCEA 2ZN9A 2M8UA 1QLSA 1ZUZA 4ORBB 4MZKA 3BYAA 1F8HA 2LMVA 4PCWA 1QIVA 3HCMA 4C0LA 1C07A 1BJFA 3SG2A 1A29A 1QXPA 1PVAA 1CKKA 1MQ1A 1RK9A 2PASA 3ZWHA 1WLMA 2L2EA 4L9MA 4JPZB 5AANA 3OHMB 2FCDA 2LHIA 2K0JA 1KQVA 1A4PA 1UUSA 1YVLA 2WNDA 4OR9B 4DS7A 1DMOA 3NSKA 3LK0A 2Q91A 1EG4A 1TNXA 2E30A 3VGOA 3VRPA 1RTP1 2KSPA 1J7OA 1DGVA 4TNCA 2MJWB 5CSIA 1KFXL 1IRJA 3WXAA 3AKBA 1PSBA 1JUOA 2ZNEA 4PALA 3PALA 4GGFA 5G08A 1RROA 1W7IB 2L0PA 1K93D 1Y0VH 5I8NA 5HYDA 4IL1A 1KQMB 1XFUO 1C7VA 2BL0B 4GUKA 1TTXA 2BBMA 4QJ4B 1K94A 1Y1XA 2K7BA 2CTNA 3IQQA 5AERA 4PHNA 4R1EA 2I7AA 1E8AA 1ODBA 3CR5X 2M7NA 4XJKB 3OB1B 1BOCA 3DD4A 2KGRA 2L4IA 1BLQA 2ZNDA 1QJTA 3TZ1A 5HKYA 5B8IB 2HPSA 2JZIA 1B47A 1KK8B 1BODA 3BXKA 2RGIA 1A75B 1XK4C 1YVHA 1QX5B 1LXFC 1IH0A 2ISDA 4PE1A 4YGEB 3PFVA 2LC5A 2ZRSA 5I2LA 1QS7A 2WORA 1NX2A 1UWOA 1NPQA 2BKIB 2JXCA 4GBAA 3WHUB 1DJWA 3NSOA 1DTLA 2M29A 4NDDA 4XJKA 1EG3A 2KQYA 1OMDA 1UHNA 2M3WA 4YI9A 2BCBA 2Y1NA 4MVFA 3JVTC 2MAZA 3EK8A 1CNPA 2LP2A 3I5GC 1IGVA 1B7TY 4YGBB 3C1VA 1UHJA 3I5IC 5HLOA 1S3PA 5AFPA 1BG1A 2K7OA 2LV7A 1UHIA 1DJGA 4MLWA 2EGDA 2JU0A 4MRXA 1J7PA 2BCXA 4C0JA 2LMUA 5JOLA 1CTRA 1WRZA 1QX7A 2JNXA 2JT0A 3VRQA 3CWGA 1XK4A 3TDIA 3DVEA 2BCAA 2F3ZA 5TNCA 1B4CA 5D69A 3DVJA 3PN7B 1NCYA 1MHOA 1DJZA 2K2FA 1DVIA 2JQ6A 1YRTB 2JC2A 2BECA 3WHTB 2AUCA 2JPTA 2E6WA 3CGAA 1S26D 1IG5A 1K9PA 3OX6A 3RM1A 1ZMZA 4A4BA 1Y1UA 1VRKA 3E3RA 4AQIA 4P2YB 2O60A 2L98A 1L2OC 2HQWA 1S1EA 4QJ3B 1LA3A 1LKJA 3LL8B 3BOWA 3OP0A 3AAJA 3IQOA 2EC6C 4PE4A 1H8BA 1NCXA 2KQ6A 5AXIA 2NXQA 1SCMB 2SCPA 1QLKA 1KWOB 1CDPA 3CR2A 2KGBC 4AOMA 1BR1B 1CLLA 3F45A 5KSZA 2CNPA 3TDUA 1L7ZA 1QATA 5J3XA 1CFFA 1ZFSA 1BF5A 4YGAA 1K2HA 1F55A 1MUXA 1ZACA 3EVVA 1MXLC 2BE4A 3O6BA 4MRYA 1XO5A 3A4UB 1UHHA 3RLZA 3I5HC 1KK7Z 2KDHA 2OPOA 2LM5A 4YI8A 1YX7A 1K8UA 1Q80A 2LLSA 5CPVA 1AHRA 3OB2B 4QJ5B 5F6TA 4JWQA 1SL9A 3D10A 3KEVA 4ORAB 4CPVA 1ALVA 1F4OA 2LLUA 4AQJA 1OMRA 1KWOC 2COLB 1SBJA 3HX4A 2JT8A 4GGFC 1DGUA 5ER5A 3CS1A 4MN0A 4DRWA 1F54A 2NLNA 1QX2A 1RWYA 1KK8C 1N2DA 2LANA 1K9KA 4GPLB 2P6BB 2CXJA 1QV1A 4JQ0D 1SRAA 1WRKA 1K95A 1TOPA 1KQMC 2CBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMT A;  2BL0 C;  1SPY A;  2MA2 A;  2BKH B;  1CLM A;  1WY9 A;  2LVK A;  1NSH A;  2Q4U A;  1JFJ A;  1SCM C;  3OX5 A;  1NX0 A;  2KYF A;  1CDL A;  2KAV A;  4F0Z B;  1JSA A;  1NP8 A;  3O4Y A;  3I5F B;  4PHM A;  2G2B A;  1V1G A;  1EH2 A;  1QVI Z;  2G9B A;  2LNK A;  1NWD A;  2F2O A;  1TCO B;  1U5I A;  1CFP A;  2HET A;  1W7J B;  1IWQ A;  2KBI A;  1QV0 A;  3AKA A;  3I5F C;  1KK7 Y;  1G8I A;  2KHN A;  4MZJ A;  1S5G Z;  1A03 A;  3I5I B;  3SG4 A;  1XFX O;  2JXL A;  2KFH A;  3K21 A;  3I5H B;  1Y1A A;  3O2P A;  5HKW A;  1HQV A;  1BMO A;  5FYX A;  1X02 A;  3TUY C;  2QPT A;  2TN4 A;  4DUQ A;  3EVU A;  1B8R A;  1LA0 A;  1LVC D;  1YUS A;  1MWN A;  5JJG A;  1EXR A;  4FQO A;  4ZCU A;  2KFF A;  2EHB A;  1BR4 B;  2B1U A;  5IBW A;  4WQ2 A;  2D8N A;  1LIN A;  1GQM A;  4N5X A;  1QTX A;  1J7R A;  2H2K A;  1EJ3 A;  1FF1 A;  1A2X A;  1WRL A;  2OS8 C;  4E68 A;  4HSZ A;  1MXE A;  1YUU A;  2NCP A;  1A75 A;  1PVB A;  3SG5 A;  3ZNI A;  2F2P A;  1J7Q A;  1G4Y R;  1PK0 D;  2A4J A;  5GQQ C;  1S6J A;  1M46 A;  2K8M B;  2V53 A;  3EVR A;  4USL A;  1SYM A;  1KFU S;  1NCZ A;  1HT9 A;  2JNF A;  2NCO A;  3IF7 A;  5BPJ A;  5CSN A;  2H61 A;  1Y6W A;  1S6I A;  2ZKM X;  3GK4 X;  4PDZ A;  1OZO A;  1GJY A;  2SAS A;  1SMG A;  3DF0 A;  1FPW A;  4GAO A;  1F71 A;  1PRW A;  2PRU A;  3FIA A;  1JF0 A;  1TNP A;  2I94 A;  3KPX A;  4MEW A;  1SKT A;  2K7D A;  1MF8 B;  3SIB A;  1B1G A;  4GGN A;  4N1G A;  1KCY A;  1SR6 C;  2AMI A;  1G33 A;  2K61 A;  4MSP A;  1ALW A;  1TCF A;  4YRU A;  1N0Y A;  1S36 A;  5HLV A;  2O5G A;  2EC6 B;  1SR6 B;  4I5L B;  3NSL A;  1SY9 A;  1NUB A;  3ICB A;  1WDC B;  3GK2 A;  2H61 C;  2HQ8 A;  3NXA A;  3D0Y A;  2FCE A;  2Y4Q A;  5AEQ A;  4M2Q A;  4YBH B;  1XVJ A;  4A4C A;  3BUN B;  4YGD B;  3O78 A;  3D0Y B;  2KI6 C;  3PM8 A;  1DT7 B;  1REC A;  4N1F A;  3H4S E;  1S6C A;  2F3Y A;  3KF9 A;  4BY4 A;  1IJ6 A;  4OV2 A;  1C7W A;  4HRH A;  2KI6 D;  2LLT A;  4MBE A;  3DVM A;  1IJ5 A;  2KBM A;  3WNX B;  3JTD B;  4CLN A;  1YUR A;  4PHK A;  4PE7 A;  3MSE B;  1K96 A;  2LVI A;  1YX8 A;  2PVB A;  3BUO B;  5ER4 X;  3BQ3 A;  2LVV A;  4FTG A;  2KI4 B;  4HRE E;  2JT3 A;  2OTG C;  3SIA A;  2BE6 A;  1OMV A;  2BBN A;  2OS8 B;  1L2O B;  5KTY A;  1F4Q A;  1SK6 D;  4C0K A;  3A8R A;  3DF0 B;  1AVS A;  3FS7 A;  3SJS A;  4ZCV A;  2MLF C;  2PSR A;  4CFR A;  4CFQ A;  1PAL A;  1V1F A;  3LK1 A;  4ORC B;  2LE9 B;  1JC2 A;  1JFK A;  4DCK A;  3TUY B;  1BU3 A;  3SG6 A;  1AUI B;  3TS5 C;  3EK4 A;  2ZN8 A;  1CDM A;  4M2P A;  1YUT A;  2KNE A;  1WDC C;  2WCB A;  2LAP A;  2VRG A;  2FJU B;  3PLF B;  4BY5 A;  4D1E A;  2LHL A;  1XFZ O;  2JTT A;  3EKH A;  3VRN A;  3EK7 A;  1JF2 A;  5CSF A;  2LCP A;  2AAO A;  3KO0 A;  3PSR A;  4OVN F;  3NSI A;  1OSA A;  1KFU L;  3PAT A;  4I5N B;  3SG7 A;  1S5G Y;  2L4H A;  1XYD A;  2JTZ A;  2PAL A;  1AJ4 A;  1M45 A;  2CCM A;  1K9U A;  1PSR A;  1TNW A;  1QVI Y;  5DKQ A;  2MBX A;  1YRU B;  1R2U A;  3VRR A;  3BUX B;  3VRO A;  1J1D A;  1K90 D;  1H4B A;  3FWB A;  3CZT X;  2LUX A;  5DKN A;  4CID A;  3CTN A;  1OZS A;  2F33 A;  2FOT A;  4WRI A;  1CM4 A;  4OCI A;  5PAL A;  4UPG A;  5CSJ A;  1FI5 A;  4WQ3 A;  3M0W A;  2Y5I A;  5D7F A;  4ETO A;  2I2R E;  1KSO A;  3BUW B;  1DJH A;  2L50 A;  5I2Q A;  1CLB A;  4NDC A;  2KAX A;  3LCP C;  1CMG A;  4NQG A;  1TN4 A;  1DF0 B;  2K2A A;  4NDB A;  2KI4 C;  1NIW A;  1OQP A;  3DVK A;  3PN7 C;  1KSM A;  4GFT A;  4PHJ A;  3LLE A;  4Q04 A;  1QAS A;  1PUL A;  3FWC A;  4U8D A;  2K7C A;  1AP4 A;  1AJ5 A;  4HRG A;  1N65 A;  1JBA A;  1TNQ A;  1B7T Z;  2JWW A;  1RFJ A;  1SNL A;  1XFW O;  3QRX A;  1CFD A;  2LUC A;  2ZRT A;  1CM1 A;  1J55 A;  1M39 A;  1SW8 A;  2LVJ A;  2IS9 A;  1YTZ C;  1SCV A;  1SL8 A;  1XFV O;  2I18 A;  1GGW A;  2GGZ A;  4M2O A;  1OE9 B;  1CDN A;  1OOJ A;  2KYC A;  3JVT B;  4ICB A;  4XYN A;  1BT6 A;  2M0R A;  1FW4 A;  3I5G B;  4YGC B;  4MZL A;  1XFY O;  3CLN A;  1UUR A;  2OTG B;  3SG3 A;  1U5I B;  1RJV A;  1F70 A;  2M1U A;  1SL7 A;  2WOS A;  2MLE C;  1YR5 A;  1ZOT B;  2M49 B;  3AAK A;  1JWD A;  2JOJ A;  1D1O A;  1CMF A;  1IKU A;  1B8C A;  1CFC A;  2WCF A;  4I5K A;  2CT9 A;  1IQ3 A;  3BOW B;  1DF0 A;  1CB1 A;  2GV5 A;  1DJI A;  2M7L A;  1DJY A;  2F8P A;  1R6P A;  2DOQ A;  1DJX A;  2KAY A;  2NZ0 A;  1M31 A;  3GK1 A;  1IQ5 A;  5KU1 A;  3GOF A;  5I2O A;  1B9A A;  1UP5 A;  3TS5 B;  4P5O E;  1NX3 A;  2LP3 A;  1WLZ A;  1B8L A;  3KHE A;  1J1E A;  1KFX S;  2JRF A;  3TDZ A;  2L51 A;  2HF5 A;  3BUM B;  4GNK B;  2M9G A;  2MHH A;  1AK8 A;  2MRD A;  1QIW A;  2R2I A;  2WC8 A;  3CR4 X;  2KFG A;  2L5X B;  4I5J A;  1FBV A;  1M63 B;  1MR8 A;  2KOT A;  2ZFD A;  4DIR A;  1TIZ A;  5K89 A;  1EL4 A;  2JUL A;  2QAC A;  2M1K B;  3EKJ A;  1GGZ A;  1XA5 A;  4PE0 A;  1FI6 A;  1UHK A;  5DKR A;  1NYA A;  3JTD C;  1TRF A;  2GGM A;  2PMY A;  2M97 A;  2Y1M A;  4OKH A;  5HKZ A;  1NX1 A;  2WCE A;  2ZN9 A;  2M8U A;  1QLS A;  1ZUZ A;  4ORB B;  4MZK A;  3BYA A;  1F8H A;  2LMV A;  4PCW A;  1QIV A;  3HCM A;  4C0L A;  1C07 A;  1BJF A;  3SG2 A;  1A29 A;  1QXP A;  1PVA A;  1CKK A;  1MQ1 A;  1RK9 A;  2PAS A;  3ZWH A;  1WLM A;  2L2E A;  4L9M A;  4JPZ B;  5AAN A;  3OHM B;  2FCD A;  2LHI A;  2K0J A;  1KQV A;  1A4P A;  1UUS A;  1YVL A;  2WND A;  4OR9 B;  4DS7 A;  1DMO A;  3NSK A;  3LK0 A;  2Q91 A;  1EG4 A;  1TNX A;  2E30 A;  3VGO A;  3VRP A;  1RTP 1;  2KSP A;  1J7O A;  1DGV A;  4TNC A;  2MJW B;  5CSI A;  1KFX L;  1IRJ A;  3WXA A;  3AKB A;  1PSB A;  1JUO A;  2ZNE A;  4PAL A;  3PAL A;  4GGF A;  5G08 A;  1RRO A;  1W7I B;  2L0P A;  1K93 D;  1Y0V H;  5I8N A;  5HYD A;  4IL1 A;  1KQM B;  1XFU O;  1C7V A;  2BL0 B;  4GUK A;  1TTX A;  2BBM A;  4QJ4 B;  1K94 A;  1Y1X A;  2K7B A;  2CTN A;  3IQQ A;  5AER A;  4PHN A;  4R1E A;  2I7A A;  1E8A A;  1ODB A;  3CR5 X;  2M7N A;  4XJK B;  3OB1 B;  1BOC A;  3DD4 A;  2KGR A;  2L4I A;  1BLQ A;  2ZND A;  1QJT A;  3TZ1 A;  5HKY A;  5B8I B;  2HPS A;  2JZI A;  1B47 A;  1KK8 B;  1BOD A;  3BXK A;  2RGI A;  1A75 B;  1XK4 C;  1YVH A;  1QX5 B;  1LXF C;  1IH0 A;  2ISD A;  4PE1 A;  4YGE B;  3PFV A;  2LC5 A;  2ZRS A;  5I2L A;  1QS7 A;  2WOR A;  1NX2 A;  1UWO A;  1NPQ A;  2BKI B;  2JXC A;  4GBA A;  3WHU B;  1DJW A;  3NSO A;  1DTL A;  2M29 A;  4NDD A;  4XJK A;  1EG3 A;  2KQY A;  1OMD A;  1UHN A;  2M3W A;  4YI9 A;  2BCB A;  2Y1N A;  4MVF A;  3JVT C;  2MAZ A;  3EK8 A;  1CNP A;  2LP2 A;  3I5G C;  1IGV A;  1B7T Y;  4YGB B;  3C1V A;  1UHJ A;  3I5I C;  5HLO A;  1S3P A;  5AFP A;  1BG1 A;  2K7O A;  2LV7 A;  1UHI A;  1DJG A;  4MLW A;  2EGD A;  2JU0 A;  4MRX A;  1J7P A;  2BCX A;  4C0J A;  2LMU A;  5JOL A;  1CTR A;  1WRZ A;  1QX7 A;  2JNX A;  2JT0 A;  3VRQ A;  3CWG A;  1XK4 A;  3TDI A;  3DVE A;  2BCA A;  2F3Z A;  5TNC A;  1B4C A;  5D69 A;  3DVJ A;  3PN7 B;  1NCY A;  1MHO A;  1DJZ A;  2K2F A;  1DVI A;  2JQ6 A;  1YRT B;  2JC2 A;  2BEC A;  3WHT B;  2AUC A;  2JPT A;  2E6W A;  3CGA A;  1S26 D;  1IG5 A;  1K9P A;  3OX6 A;  3RM1 A;  1ZMZ A;  4A4B A;  1Y1U A;  1VRK A;  3E3R A;  4AQI A;  4P2Y B;  2O60 A;  2L98 A;  1L2O C;  2HQW A;  1S1E A;  4QJ3 B;  1LA3 A;  1LKJ A;  3LL8 B;  3BOW A;  3OP0 A;  3AAJ A;  3IQO A;  2EC6 C;  4PE4 A;  1H8B A;  1NCX A;  2KQ6 A;  5AXI A;  2NXQ A;  1SCM B;  2SCP A;  1QLK A;  1KWO B;  1CDP A;  3CR2 A;  2KGB C;  4AOM A;  1BR1 B;  1CLL A;  3F45 A;  5KSZ A;  2CNP A;  3TDU A;  1L7Z A;  1QAT A;  5J3X A;  1CFF A;  1ZFS A;  1BF5 A;  4YGA A;  1K2H A;  1F55 A;  1MUX A;  1ZAC A;  3EVV A;  1MXL C;  2BE4 A;  3O6B A;  4MRY A;  1XO5 A;  3A4U B;  1UHH A;  3RLZ A;  3I5H C;  1KK7 Z;  2KDH A;  2OPO A;  2LM5 A;  4YI8 A;  1YX7 A;  1K8U A;  1Q80 A;  2LLS A;  5CPV A;  1AHR A;  3OB2 B;  4QJ5 B;  5F6T A;  4JWQ A;  1SL9 A;  3D10 A;  3KEV A;  4ORA B;  4CPV A;  1ALV A;  1F4O A;  2LLU A;  4AQJ A;  1OMR A;  1KWO C;  2COL B;  1SBJ A;  3HX4 A;  2JT8 A;  4GGF C;  1DGU A;  5ER5 A;  3CS1 A;  4MN0 A;  4DRW A;  1F54 A;  2NLN A;  1QX2 A;  1RWY A;  1KK8 C;  1N2D A;  2LAN A;  1K9K A;  4GPL B;  2P6B B;  2CXJ A;  1QV1 A;  4JQ0 D;  1SRA A;  1WRK A;  1K95 A;  1TOP A;  1KQM C;  2CBL A; 
#chains in the Genus database with same CATH topology
 2LMT A;  2BL0 C;  3OGN A;  1SPY A;  2MA2 A;  2BKH B;  1CLM A;  1WY9 A;  2LVK A;  1NSH A;  2Q4U A;  3R1P A;  1JFJ A;  1SCM C;  3CYZ A;  1NX0 A;  2KYF A;  3OX5 A;  1CDL A;  2KAV A;  4F0Z B;  1JSA A;  1NP8 A;  3O4Y A;  3I5F B;  4PHM A;  2G2B A;  1V1G A;  1EH2 A;  1W9Z A;  1QVI Z;  2G9B A;  2LNK A;  1NWD A;  2F2O A;  1TCO B;  1U5I A;  1CFP A;  2HET A;  1W7J B;  1IWQ A;  2KBI A;  1QV0 A;  3AKA A;  3I5F C;  1KK7 Y;  1G8I A;  2WCJ A;  2KHN A;  4MZJ A;  1S5G Z;  1A03 A;  2WC5 A;  3I5I B;  3SG4 A;  1XFX O;  2JXL A;  2KFH A;  3K21 A;  3I5H B;  1Y1A A;  3O2P A;  3R1O A;  5HKW A;  1HQV A;  1BMO A;  3DZT A;  1X02 A;  3FE6 A;  5FYX A;  3TUY C;  2QPT A;  2TN4 A;  4DUQ A;  3EVU A;  1B8R A;  1LA0 A;  1TWO A;  1LVC D;  1YUS A;  1MWN A;  5JJG A;  1EXR A;  4FQO A;  4ZCU A;  2KFF A;  2EHB A;  1BR4 B;  2B1U A;  5IBW A;  4WQ2 A;  3RZS A;  2D8N A;  1LIN A;  1GQM A;  4N5X A;  1QTX A;  1J7R A;  2H2K A;  1EJ3 A;  1FF1 A;  1A2X A;  1WRL A;  2FJY A;  2OS8 C;  4E68 A;  4HSZ A;  3DY9 A;  1MXE A;  1YUU A;  2NCP A;  1A75 A;  1PVB A;  3SG5 A;  3ZNI A;  2F2P A;  1J7Q A;  1OOF A;  1G4Y R;  1PK0 D;  2A4J A;  5GQQ C;  1S6J A;  3S0A A;  1M46 A;  3S0F A;  3BFA A;  2K8M B;  2V53 A;  3EVR A;  4USL A;  4INW A;  1SYM A;  1KFU S;  3OBV A;  1NCZ A;  1HT9 A;  2JNF A;  2NCO A;  3IF7 A;  3D77 A;  5BPJ A;  4OZD A;  5CSN A;  3N7H A;  2H61 A;  1OW4 A;  1Y6W A;  1S6I A;  2ZKM X;  3GK4 X;  3FE8 A;  4PDZ A;  1OZO A;  3R72 A;  1GJY A;  1P28 A;  2SAS A;  5HL1 A;  1SMG A;  3DF0 A;  3B6X A;  2QEH A;  4GAO A;  1FPW A;  1F71 A;  1PRW A;  2PRU A;  5D3O A;  3FIA A;  1JF0 A;  1TNP A;  2I94 A;  3KPX A;  4MEW A;  2ERB A;  1SKT A;  2K7D A;  1MF8 B;  3SIB A;  1B1G A;  4GGN A;  4N1G A;  1KCY A;  1IIO A;  1SR6 C;  2AMI A;  1G33 A;  2K61 A;  4MSP A;  1DQE A;  1ALW A;  1TCF A;  2QEV A;  4YRU A;  1N0Y A;  1S36 A;  5HLV A;  2O5G A;  2EC6 B;  1SR6 B;  4I5L B;  3NSL A;  1SY9 A;  1NUB A;  3ICB A;  1WDC B;  3GK2 A;  2H61 C;  2HQ8 A;  3NXA A;  3D0Y A;  1OOG A;  2FCE A;  2Y4Q A;  5AEQ A;  4M2Q A;  1GM0 A;  4YBH B;  1XVJ A;  4A4C A;  3BUN B;  4YGD B;  3O78 A;  3SS3 A;  3D0Y B;  2KI6 C;  3PM8 A;  1DT7 B;  1REC A;  4N1F A;  3H4S E;  1S6C A;  2F3Y A;  3KF9 A;  4BY4 A;  1IJ6 A;  4OV2 A;  1C7W A;  1TUZ A;  3BFH A;  2KI6 D;  2LLT A;  4HRH A;  4MBE A;  5FI2 A;  3DVM A;  1IJ5 A;  2KBM A;  3WNX B;  3JTD B;  4CLN A;  1YUR A;  4PHK A;  3DYE A;  4PE7 A;  3MSE B;  1K96 A;  2LVI A;  1YX8 A;  2PVB A;  3BUO B;  5ER4 X;  3BQ3 A;  2WCL A;  2LVV A;  4FTG A;  2KI4 B;  3DXL A;  3EG5 B;  2JT3 A;  2OTG C;  4HRE E;  4FQT A;  2BE6 A;  1OMV A;  2BBN A;  2OS8 B;  3SIA A;  1L2O B;  5KTY A;  1F4Q A;  3PM2 A;  2PQL A;  1SK6 D;  4C0K A;  3A8R A;  3DF0 B;  1AVS A;  3FS7 A;  3SJS A;  4ZCV A;  2MLF C;  2PSR A;  4CFR A;  2WC6 A;  4CFQ A;  1PAL A;  1V1F A;  3LK1 A;  4ORC B;  2LE9 B;  1JC2 A;  1JFK A;  4DCK A;  3TUY B;  1BU3 A;  4JD9 A;  3SG6 A;  1AUI B;  3TS5 C;  3EK4 A;  2ZN8 A;  1CDM A;  4M2P A;  1YUT A;  2KNE A;  1WDC C;  2QEO A;  2LAP A;  2VRG A;  2FJU B;  2WCB A;  3PLF B;  4BY5 A;  2LHL A;  2QDI A;  1XFZ O;  4D1E A;  2JTT A;  3EKH A;  3VRN A;  3EK7 A;  1JF2 A;  5CSF A;  2LCP A;  2AAO A;  3KO0 A;  3PSR A;  3Q8I A;  3NHT A;  4OVN F;  1DEL A;  1OSA A;  1KFU L;  3NSI A;  3PAT A;  4I5N B;  1S5G Y;  3SG7 A;  2L4H A;  1XYD A;  2JTZ A;  2PAL A;  1AJ4 A;  1M45 A;  2CCM A;  1Z2C B;  1K9U A;  1PSR A;  1TNW A;  1QVI Y;  5DKQ A;  2MBX A;  1YRU B;  1R2U A;  3VRR A;  3BUX B;  3PJI A;  3VRO A;  1C3Y A;  1J1D A;  1K90 D;  1H4B A;  3FWB A;  3CZT X;  2LUX A;  5DKN A;  4CID A;  3CTN A;  3CZ2 A;  3NHI A;  1OZS A;  2F33 A;  2FOT A;  4WRI A;  1CM4 A;  4OCI A;  5PAL A;  4UPG A;  5CSJ A;  1FI5 A;  4WQ3 A;  3M0W A;  2Y5I A;  5D7F A;  4ETO A;  3D73 A;  2I2R E;  1KSO A;  3BUW B;  1DJH A;  2L50 A;  5I2Q A;  1CLB A;  4NDC A;  2KAX A;  3LCP C;  1CMG A;  4NQG A;  1TN4 A;  1DF0 B;  2K2A A;  4NDB A;  2KI4 C;  3CZ0 A;  1NIW A;  1OQP A;  3DVK A;  3PN7 C;  1KSM A;  4GFT A;  4PHJ A;  3LLE A;  4Q04 A;  1QAS A;  1PUL A;  3FWC A;  3IVT A;  2K7C A;  4U8D A;  1AJ5 A;  1AP4 A;  4HRG A;  1C3Z A;  1N65 A;  1JBA A;  1TNQ A;  3UNW A;  3FE9 A;  1B7T Z;  2JWW A;  1RFJ A;  1SNL A;  1XFW O;  3QRX A;  1CFD A;  2LUC A;  2ZRT A;  1CM1 A;  1J55 A;  1M39 A;  1SW8 A;  2LVJ A;  2IS9 A;  1YTZ C;  1SCV A;  1SL8 A;  1XFV O;  2I18 A;  1GGW A;  2GGZ A;  4M2O A;  1OE9 B;  1QWV A;  1CDN A;  1OOJ A;  3QME A;  4INX A;  2KYC A;  3JVT B;  4ICB A;  4XYN A;  1BT6 A;  2M0R A;  1FW4 A;  3I5G B;  4YGC B;  4MZL A;  1XFY O;  3CLN A;  1UUR A;  2OTG B;  3SG3 A;  1U5I B;  1RJV A;  1F70 A;  2M1U A;  1SL7 A;  2WOS A;  2MLE C;  1YR5 A;  1ZOT B;  3D76 A;  2M49 B;  3AAK A;  1JWD A;  2JOJ A;  1D1O A;  1CMF A;  1IKU A;  1B8C A;  1CFC A;  3B87 A;  2WCF A;  4I5K A;  2CT9 A;  1IQ3 A;  3BOW B;  1DF0 A;  1CB1 A;  2GV5 A;  1DJI A;  2M7L A;  3L4L A;  1DJY A;  2F8P A;  1R6P A;  2DOQ A;  1DJX A;  2KAY A;  2NZ0 A;  1M31 A;  3GK1 A;  2BAP A;  1IQ5 A;  2PYQ A;  5KU1 A;  3GOF A;  5I2O A;  1B9A A;  1UP5 A;  3TS5 B;  2K60 A;  4P5O E;  1NX3 A;  2LP3 A;  1WLZ A;  1B8L A;  3CAB A;  3R1V A;  3UO9 A;  3KHE A;  1J1E A;  1KFX S;  2JRF A;  3TDZ A;  2L51 A;  2HF5 A;  3BUM B;  4GNK B;  2M9G A;  2MHH A;  1AK8 A;  2MRD A;  1QIW A;  2R2I A;  2WC8 A;  3CR4 X;  2KFG A;  2L5X B;  4I5J A;  1FBV A;  1M63 B;  1MR8 A;  2KOT A;  2ZFD A;  4DIR A;  1TIZ A;  5K89 A;  1EL4 A;  2JUL A;  2QAC A;  2M1K B;  3EKJ A;  1GGZ A;  1XA5 A;  4PE0 A;  2KPH A;  1FI6 A;  1UHK A;  5DKR A;  1NYA A;  3JTD C;  1TRF A;  2GGM A;  2PMY A;  2M97 A;  2Y1M A;  4OKH A;  5HKZ A;  1NX1 A;  2WCM A;  2WCE A;  2ZN9 A;  2M8U A;  1QLS A;  1ZUZ A;  3L47 A;  3S0G A;  4ORB B;  4MZK A;  3NGV A;  3BYA A;  1F8H A;  2LMV A;  4PCW A;  1QIV A;  3HCM A;  4C0L A;  1C07 A;  1BJF A;  3SG2 A;  1A29 A;  1QXP A;  1PVA A;  2L2C A;  1CKK A;  1MQ1 A;  1RK9 A;  2PAS A;  3ZWH A;  1WLM A;  3V2L A;  2L2E A;  2H8V A;  4L9M A;  4JPZ B;  5AAN A;  3OHM B;  2FCD A;  2LHI A;  2K0J A;  1KQV A;  1A4P A;  1UUS A;  1YVL A;  2WND A;  4OR9 B;  4DS7 A;  1DMO A;  3NSK A;  3LK0 A;  2Q91 A;  1EG4 A;  1TNX A;  2E30 A;  2P71 A;  3VGO A;  1RTP 1;  2KSP A;  3VRP A;  1DGV A;  4TNC A;  1J7O A;  2MJW B;  5CSI A;  1KFX L;  1IRJ A;  3WXA A;  3AKB A;  1PSB A;  1JUO A;  2ZNE A;  4PAL A;  3PAL A;  4GGF A;  5G08 A;  1RRO A;  1W7I B;  2L0P A;  1K93 D;  1T14 A;  1Y0V H;  5I8N A;  1OOI X;  5HYD A;  4IL1 A;  1KQM B;  1XFU O;  1C7V A;  2BL0 B;  4GUK A;  1TTX A;  2BBM A;  4QJ4 B;  1K94 A;  3O4X A;  1Y1X A;  2K7B A;  2CTN A;  3IQQ A;  5AER A;  4PHN A;  4R1E A;  2I7A A;  4F7F A;  1E8A A;  1ODB A;  3CR5 X;  2M7N A;  2JPO A;  4XJK B;  3OB1 B;  1BOC A;  3DD4 A;  2KGR A;  2L4I A;  4KYN A;  1BLQ A;  2ZND A;  1QJT A;  3TZ1 A;  5HKY A;  5B8I B;  2HPS A;  2JZI A;  1B47 A;  1KK8 B;  1BOD A;  2BNX A;  2RGI A;  3BXK A;  1A75 B;  2YGU A;  3B86 A;  1XK4 C;  1YVH A;  1DEK A;  1LXF C;  1QX5 B;  1IH0 A;  2ISD A;  4PE1 A;  4YGE B;  3PFV A;  2LC5 A;  2ZRS A;  5I2L A;  1QS7 A;  2WOR A;  1NX2 A;  1UWO A;  1NPQ A;  2BKI B;  2JXC A;  4GBA A;  3WHU B;  3CZ1 A;  1DJW A;  3NSO A;  1DTL A;  2M29 A;  4NDD A;  1ORG A;  1EG3 A;  2KQY A;  4XJK A;  1OMD A;  1UHN A;  2M3W A;  4YI9 A;  2BCB A;  2Y1N A;  3K1E A;  4MVF A;  3JVT C;  2MAZ A;  3EK8 A;  3L4A A;  1CNP A;  2LP2 A;  3I5G C;  1IGV A;  1B7T Y;  4YGB B;  3C1V A;  1UHJ A;  3D78 A;  3I5I C;  5HLO A;  1S3P A;  5AFP A;  1XFR A;  5I94 A;  1BG1 A;  2K7O A;  2LV7 A;  1UHI A;  1DJG A;  4MLW A;  2EGD A;  2JU0 A;  2QEB A;  4MRX A;  1J7P A;  2BCX A;  4C0J A;  2LMU A;  4IJ7 A;  1CTR A;  1WRZ A;  5JOL A;  1QX7 A;  2JNX A;  2JT0 A;  3VRQ A;  5FI7 A;  3CWG A;  1XK4 A;  2WCH A;  3TDI A;  3CDN A;  3SS5 A;  4PT1 A;  3DVE A;  2BCA A;  3D75 A;  1SSE B;  2F3Z A;  5TNC A;  1B4C A;  5D69 A;  3DVJ A;  3PN7 B;  1NCY A;  1MHO A;  1DJZ A;  2K2F A;  1DVI A;  3S0E A;  2L5Y A;  2JQ6 A;  1YRT B;  2JC2 A;  2BEC A;  3WHT B;  2AUC A;  2JPT A;  3B88 A;  2E6W A;  3S0D A;  3CGA A;  1S26 D;  1IG5 A;  5EL2 A;  1K9P A;  3OX6 A;  3RM1 A;  1ZMZ A;  3D74 A;  4A4B A;  1Y1U A;  1VRK A;  3E3R A;  3SS4 A;  4P2Y B;  4AQI A;  2O60 A;  2L98 A;  2GTE A;  1OOH A;  3BJH A;  1L2O C;  2HQW A;  2KLD A;  1S1E A;  4QJ3 B;  1TUJ A;  1LA3 A;  1LKJ A;  3LL8 B;  3BOW A;  3OP0 A;  3AAJ A;  3IQO A;  2EC6 C;  4PE4 A;  1H8B A;  1NCX A;  2KQ6 A;  5AXI A;  2KLE A;  2NXQ A;  3VB1 A;  1SCM B;  2SCP A;  1QLK A;  1KWO B;  1CDP A;  3CR2 A;  2KGB C;  3S0B A;  4AOM A;  1BR1 B;  1CLL A;  3F45 A;  5KSZ A;  2CNP A;  3TDU A;  1L7Z A;  1QAT A;  5J3X A;  1CFF A;  1ZFS A;  1BF5 A;  3BFB A;  2WCK A;  4YGA A;  1K2H A;  1F55 A;  1MUX A;  1ZAC A;  3EVV A;  1MXL C;  2BE4 A;  3O6B A;  4MRY A;  1XO5 A;  3A4U B;  1UHH A;  3RLZ A;  3I5H C;  1KK7 Z;  2KDH A;  2OPO A;  2LM5 A;  4YI8 A;  1YX7 A;  1K8U A;  1Q80 A;  2LLS A;  5CPV A;  1AHR A;  3B7A A;  3OB2 B;  4QJ5 B;  1DC1 A;  5F6T A;  4JWQ A;  1SL9 A;  3D10 A;  3KEV A;  4ORA B;  4CPV A;  1ALV A;  1F4O A;  2LLU A;  2P70 A;  1OMR A;  4AQJ A;  1KWO C;  2COL B;  1SBJ A;  3HX4 A;  2JT8 A;  4GGF C;  1DGU A;  5ER5 A;  3CS1 A;  4MN0 A;  5FI6 A;  4DRW A;  1F54 A;  2NLN A;  1QX2 A;  1RWY A;  1KK8 C;  1N2D A;  1LS8 A;  2LAN A;  5DIC A;  1K9K A;  4GPL B;  2P6B B;  4JKT A;  2CXJ A;  1QV1 A;  4JQ0 D;  1SRA A;  1WRK A;  1K95 A;  1Z4H A;  1TOP A;  1KQM C;  2CBL A; 
#chains in the Genus database with same CATH homology
 2LMT A;  2BL0 C;  1SPY A;  2MA2 A;  2BKH B;  1CLM A;  1WY9 A;  2LVK A;  1NSH A;  2Q4U A;  1JFJ A;  1SCM C;  3OX5 A;  1NX0 A;  2KYF A;  1CDL A;  2KAV A;  4F0Z B;  1JSA A;  1NP8 A;  3O4Y A;  3I5F B;  4PHM A;  2G2B A;  1V1G A;  1EH2 A;  1QVI Z;  2G9B A;  2LNK A;  1NWD A;  2F2O A;  1TCO B;  1U5I A;  1CFP A;  2HET A;  1W7J B;  1IWQ A;  2KBI A;  1QV0 A;  3AKA A;  3I5F C;  1KK7 Y;  1G8I A;  2KHN A;  4MZJ A;  1S5G Z;  1A03 A;  3I5I B;  3SG4 A;  1XFX O;  2JXL A;  2KFH A;  3K21 A;  3I5H B;  1Y1A A;  3O2P A;  5HKW A;  1HQV A;  1BMO A;  5FYX A;  1X02 A;  3TUY C;  2QPT A;  2TN4 A;  4DUQ A;  3EVU A;  1B8R A;  1LA0 A;  1LVC D;  1YUS A;  1MWN A;  5JJG A;  1EXR A;  4FQO A;  4ZCU A;  2KFF A;  2EHB A;  1BR4 B;  2B1U A;  5IBW A;  4WQ2 A;  2D8N A;  1LIN A;  1GQM A;  4N5X A;  1QTX A;  1J7R A;  2H2K A;  1EJ3 A;  1FF1 A;  1A2X A;  1WRL A;  2OS8 C;  4E68 A;  4HSZ A;  1MXE A;  1YUU A;  2NCP A;  1A75 A;  1PVB A;  3SG5 A;  3ZNI A;  2F2P A;  1J7Q A;  1G4Y R;  1PK0 D;  2A4J A;  5GQQ C;  1S6J A;  1M46 A;  2K8M B;  2V53 A;  3EVR A;  4USL A;  1SYM A;  1KFU S;  1NCZ A;  1HT9 A;  2JNF A;  2NCO A;  3IF7 A;  5BPJ A;  5CSN A;  2H61 A;  1Y6W A;  1S6I A;  2ZKM X;  3GK4 X;  4PDZ A;  1OZO A;  1GJY A;  2SAS A;  1SMG A;  3DF0 A;  1FPW A;  4GAO A;  1F71 A;  1PRW A;  2PRU A;  3FIA A;  1JF0 A;  1TNP A;  2I94 A;  3KPX A;  4MEW A;  1SKT A;  2K7D A;  1MF8 B;  3SIB A;  1B1G A;  4GGN A;  4N1G A;  1KCY A;  1SR6 C;  2AMI A;  1G33 A;  2K61 A;  4MSP A;  1ALW A;  1TCF A;  4YRU A;  1N0Y A;  1S36 A;  5HLV A;  2O5G A;  2EC6 B;  1SR6 B;  4I5L B;  3NSL A;  1SY9 A;  1NUB A;  3ICB A;  1WDC B;  3GK2 A;  2H61 C;  2HQ8 A;  3NXA A;  3D0Y A;  2FCE A;  2Y4Q A;  5AEQ A;  4M2Q A;  4YBH B;  1XVJ A;  4A4C A;  3BUN B;  4YGD B;  3O78 A;  3D0Y B;  2KI6 C;  3PM8 A;  1DT7 B;  1REC A;  4N1F A;  3H4S E;  1S6C A;  2F3Y A;  3KF9 A;  4BY4 A;  1IJ6 A;  4OV2 A;  1C7W A;  4HRH A;  2KI6 D;  2LLT A;  4MBE A;  3DVM A;  1IJ5 A;  2KBM A;  3WNX B;  3JTD B;  4CLN A;  1YUR A;  4PHK A;  4PE7 A;  3MSE B;  1K96 A;  2LVI A;  1YX8 A;  2PVB A;  3BUO B;  5ER4 X;  3BQ3 A;  2LVV A;  4FTG A;  2KI4 B;  4HRE E;  2JT3 A;  2OTG C;  3SIA A;  2BE6 A;  1OMV A;  2BBN A;  2OS8 B;  1L2O B;  5KTY A;  1F4Q A;  1SK6 D;  4C0K A;  3A8R A;  3DF0 B;  1AVS A;  3FS7 A;  3SJS A;  4ZCV A;  2MLF C;  2PSR A;  4CFR A;  4CFQ A;  1PAL A;  1V1F A;  3LK1 A;  4ORC B;  2LE9 B;  1JC2 A;  1JFK A;  4DCK A;  3TUY B;  1BU3 A;  3SG6 A;  1AUI B;  3TS5 C;  3EK4 A;  2ZN8 A;  1CDM A;  4M2P A;  1YUT A;  2KNE A;  1WDC C;  2WCB A;  2LAP A;  2VRG A;  2FJU B;  3PLF B;  4BY5 A;  4D1E A;  2LHL A;  1XFZ O;  2JTT A;  3EKH A;  3VRN A;  3EK7 A;  1JF2 A;  5CSF A;  2LCP A;  2AAO A;  3KO0 A;  3PSR A;  4OVN F;  3NSI A;  1OSA A;  1KFU L;  3PAT A;  4I5N B;  3SG7 A;  1S5G Y;  2L4H A;  1XYD A;  2JTZ A;  2PAL A;  1AJ4 A;  1M45 A;  2CCM A;  1K9U A;  1PSR A;  1TNW A;  1QVI Y;  5DKQ A;  2MBX A;  1YRU B;  1R2U A;  3VRR A;  3BUX B;  3VRO A;  1J1D A;  1K90 D;  1H4B A;  3FWB A;  3CZT X;  2LUX A;  5DKN A;  4CID A;  3CTN A;  1OZS A;  2F33 A;  2FOT A;  4WRI A;  1CM4 A;  4OCI A;  5PAL A;  4UPG A;  5CSJ A;  1FI5 A;  4WQ3 A;  3M0W A;  2Y5I A;  5D7F A;  4ETO A;  2I2R E;  1KSO A;  3BUW B;  1DJH A;  2L50 A;  5I2Q A;  1CLB A;  4NDC A;  2KAX A;  3LCP C;  1CMG A;  4NQG A;  1TN4 A;  1DF0 B;  2K2A A;  4NDB A;  2KI4 C;  1NIW A;  1OQP A;  3DVK A;  3PN7 C;  1KSM A;  4GFT A;  4PHJ A;  3LLE A;  4Q04 A;  1QAS A;  1PUL A;  3FWC A;  4U8D A;  2K7C A;  1AP4 A;  1AJ5 A;  4HRG A;  1N65 A;  1JBA A;  1TNQ A;  1B7T Z;  2JWW A;  1RFJ A;  1SNL A;  1XFW O;  3QRX A;  1CFD A;  2LUC A;  2ZRT A;  1CM1 A;  1J55 A;  1M39 A;  1SW8 A;  2LVJ A;  2IS9 A;  1YTZ C;  1SCV A;  1SL8 A;  1XFV O;  2I18 A;  1GGW A;  2GGZ A;  4M2O A;  1OE9 B;  1CDN A;  1OOJ A;  2KYC A;  3JVT B;  4ICB A;  4XYN A;  1BT6 A;  2M0R A;  1FW4 A;  3I5G B;  4YGC B;  4MZL A;  1XFY O;  3CLN A;  1UUR A;  2OTG B;  3SG3 A;  1U5I B;  1RJV A;  1F70 A;  2M1U A;  1SL7 A;  2WOS A;  2MLE C;  1YR5 A;  1ZOT B;  2M49 B;  3AAK A;  1JWD A;  2JOJ A;  1D1O A;  1CMF A;  1IKU A;  1B8C A;  1CFC A;  2WCF A;  4I5K A;  2CT9 A;  1IQ3 A;  3BOW B;  1DF0 A;  1CB1 A;  2GV5 A;  1DJI A;  2M7L A;  1DJY A;  2F8P A;  1R6P A;  2DOQ A;  1DJX A;  2KAY A;  2NZ0 A;  1M31 A;  3GK1 A;  1IQ5 A;  5KU1 A;  3GOF A;  5I2O A;  1B9A A;  1UP5 A;  3TS5 B;  4P5O E;  1NX3 A;  2LP3 A;  1WLZ A;  1B8L A;  3KHE A;  1J1E A;  1KFX S;  2JRF A;  3TDZ A;  2L51 A;  2HF5 A;  3BUM B;  4GNK B;  2M9G A;  2MHH A;  1AK8 A;  2MRD A;  1QIW A;  2R2I A;  2WC8 A;  3CR4 X;  2KFG A;  2L5X B;  4I5J A;  1FBV A;  1M63 B;  1MR8 A;  2KOT A;  2ZFD A;  4DIR A;  1TIZ A;  5K89 A;  1EL4 A;  2JUL A;  2QAC A;  2M1K B;  3EKJ A;  1GGZ A;  1XA5 A;  4PE0 A;  1FI6 A;  1UHK A;  5DKR A;  1NYA A;  3JTD C;  1TRF A;  2GGM A;  2PMY A;  2M97 A;  2Y1M A;  4OKH A;  5HKZ A;  1NX1 A;  2WCE A;  2ZN9 A;  2M8U A;  1QLS A;  1ZUZ A;  4ORB B;  4MZK A;  3BYA A;  1F8H A;  2LMV A;  4PCW A;  1QIV A;  3HCM A;  4C0L A;  1C07 A;  1BJF A;  3SG2 A;  1A29 A;  1QXP A;  1PVA A;  1CKK A;  1MQ1 A;  1RK9 A;  2PAS A;  3ZWH A;  1WLM A;  2L2E A;  4L9M A;  4JPZ B;  5AAN A;  3OHM B;  2FCD A;  2LHI A;  2K0J A;  1KQV A;  1A4P A;  1UUS A;  1YVL A;  2WND A;  4OR9 B;  4DS7 A;  1DMO A;  3NSK A;  3LK0 A;  2Q91 A;  1EG4 A;  1TNX A;  2E30 A;  3VGO A;  3VRP A;  1RTP 1;  2KSP A;  1J7O A;  1DGV A;  4TNC A;  2MJW B;  5CSI A;  1KFX L;  1IRJ A;  3WXA A;  3AKB A;  1PSB A;  1JUO A;  2ZNE A;  4PAL A;  3PAL A;  4GGF A;  5G08 A;  1RRO A;  1W7I B;  2L0P A;  1K93 D;  1Y0V H;  5I8N A;  5HYD A;  4IL1 A;  1KQM B;  1XFU O;  1C7V A;  2BL0 B;  4GUK A;  1TTX A;  2BBM A;  4QJ4 B;  1K94 A;  1Y1X A;  2K7B A;  2CTN A;  3IQQ A;  5AER A;  4PHN A;  4R1E A;  2I7A A;  1E8A A;  1ODB A;  3CR5 X;  2M7N A;  4XJK B;  3OB1 B;  1BOC A;  3DD4 A;  2KGR A;  2L4I A;  1BLQ A;  2ZND A;  1QJT A;  3TZ1 A;  5HKY A;  5B8I B;  2HPS A;  2JZI A;  1B47 A;  1KK8 B;  1BOD A;  3BXK A;  2RGI A;  1A75 B;  1XK4 C;  1YVH A;  1QX5 B;  1LXF C;  1IH0 A;  2ISD A;  4PE1 A;  4YGE B;  3PFV A;  2LC5 A;  2ZRS A;  5I2L A;  1QS7 A;  2WOR A;  1NX2 A;  1UWO A;  1NPQ A;  2BKI B;  2JXC A;  4GBA A;  3WHU B;  1DJW A;  3NSO A;  1DTL A;  2M29 A;  4NDD A;  4XJK A;  1EG3 A;  2KQY A;  1OMD A;  1UHN A;  2M3W A;  4YI9 A;  2BCB A;  2Y1N A;  4MVF A;  3JVT C;  2MAZ A;  3EK8 A;  1CNP A;  2LP2 A;  3I5G C;  1IGV A;  1B7T Y;  4YGB B;  3C1V A;  1UHJ A;  3I5I C;  5HLO A;  1S3P A;  5AFP A;  1BG1 A;  2K7O A;  2LV7 A;  1UHI A;  1DJG A;  4MLW A;  2EGD A;  2JU0 A;  4MRX A;  1J7P A;  2BCX A;  4C0J A;  2LMU A;  5JOL A;  1CTR A;  1WRZ A;  1QX7 A;  2JNX A;  2JT0 A;  3VRQ A;  3CWG A;  1XK4 A;  3TDI A;  3DVE A;  2BCA A;  2F3Z A;  5TNC A;  1B4C A;  5D69 A;  3DVJ A;  3PN7 B;  1NCY A;  1MHO A;  1DJZ A;  2K2F A;  1DVI A;  2JQ6 A;  1YRT B;  2JC2 A;  2BEC A;  3WHT B;  2AUC A;  2JPT A;  2E6W A;  3CGA A;  1S26 D;  1IG5 A;  1K9P A;  3OX6 A;  3RM1 A;  1ZMZ A;  4A4B A;  1Y1U A;  1VRK A;  3E3R A;  4AQI A;  4P2Y B;  2O60 A;  2L98 A;  1L2O C;  2HQW A;  1S1E A;  4QJ3 B;  1LA3 A;  1LKJ A;  3LL8 B;  3BOW A;  3OP0 A;  3AAJ A;  3IQO A;  2EC6 C;  4PE4 A;  1H8B A;  1NCX A;  2KQ6 A;  5AXI A;  2NXQ A;  1SCM B;  2SCP A;  1QLK A;  1KWO B;  1CDP A;  3CR2 A;  2KGB C;  4AOM A;  1BR1 B;  1CLL A;  3F45 A;  5KSZ A;  2CNP A;  3TDU A;  1L7Z A;  1QAT A;  5J3X A;  1CFF A;  1ZFS A;  1BF5 A;  4YGA A;  1K2H A;  1F55 A;  1MUX A;  1ZAC A;  3EVV A;  1MXL C;  2BE4 A;  3O6B A;  4MRY A;  1XO5 A;  3A4U B;  1UHH A;  3RLZ A;  3I5H C;  1KK7 Z;  2KDH A;  2OPO A;  2LM5 A;  4YI8 A;  1YX7 A;  1K8U A;  1Q80 A;  2LLS A;  5CPV A;  1AHR A;  3OB2 B;  4QJ5 B;  5F6T A;  4JWQ A;  1SL9 A;  3D10 A;  3KEV A;  4ORA B;  4CPV A;  1ALV A;  1F4O A;  2LLU A;  4AQJ A;  1OMR A;  1KWO C;  2COL B;  1SBJ A;  3HX4 A;  2JT8 A;  4GGF C;  1DGU A;  5ER5 A;  3CS1 A;  4MN0 A;  4DRW A;  1F54 A;  2NLN A;  1QX2 A;  1RWY A;  1KK8 C;  1N2D A;  2LAN A;  1K9K A;  4GPL B;  2P6B B;  2CXJ A;  1QV1 A;  4JQ0 D;  1SRA A;  1WRK A;  1K95 A;  1TOP A;  1KQM C;  2CBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...