4DUQA

The structure of ca2+-loaded s100a2 at 1.3a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
88
Chain Sequence
SSSLEQALAVLVTTFHKYSSQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMSNDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A2
publication title The structure of Ca2+-loaded S100A2 at 1.3- angstrom resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 35
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4duqA00
2BE6A 3TZ1A 2KOTA 4MZJA 3QRXA 2Q4UA 2LMUA 4M2OA 1FF1A 1J7RA 3HX4A 3GK4X 1SR6B 5AERA 2BBNA 2M29A 1GGWA 1EL4A 1JWDA 2BKHB 5FYXA 1G8IA 5CSFA 3F45A 1DJGA 2KHNA 2EC6B 1K93D 2CT9A 3EVRA 2I18A 2JPTA 3A4UB 1QX5B 4NDDA 2AMIA 3GOFA 4ORBB 4YGEB 2KNEA 1K90D 3JTDB 1XFWO 2JU0A 2O60A 2AUCA 1EJ3A 1GGZA 2LANA 3KPXA 1A75A 3CLNA 2K8MB 3TS5B 2L4IA 1LXFC 4MEWA 1BLQA 1M63B 1NX1A 1SRAA 4IL1A 3SJSA 2KBIA 4QJ3B 2KGRA 1WDCB 4YGBB 5I2LA 1ALWA 1A03A 4C0JA 4MVFA 1IG5A 1KFUS 1CM1A 1ALVA 2FOTA 2MAZA 1X02A 3IQOA 1MQ1A 1KK7Y 3AKAA 4GGFA 1JBAA 2LC5A 1BR1B 3EKJA 3BYAA 1QASA 1QX7A 2PSRA 2NCOA 1CTRA 2Y1NA 1NIWA 4YI8A 1TNWA 3LK0A 1CDMA 2KBMA 3CR4X 1IH0A 1DJHA 5ER4X 1AHRA 1KFXL 4D1EA 3DVMA 4YRUA 2KSPA 2ISDA 3I5IB 1CFCA 1BR4B 1NCZA 2LV7A 3EK4A 1B8CA 4PE1A 3O2PA 1WLZA 2K7CA 1B1GA 1K9UA 2ZNEA 2ZRSA 1S5GZ 1F71A 2CBLA 1YUUA 1J7OA 1B9AA 1GJYA 1EXRA 1FI5A 4HSZA 3CWGA 3FWBA 4JQ0D 1CFPA 3EVUA 1WRKA 1SR6C 1IJ6A 3VRQA 1NP8A 4ZCVA 2K7DA 1XK4C 1TOPA 2Y1MA 2I7AA 1KSOA 2EC6C 1UUSA 3D10A 1UHJA 3KEVA 1K96A 2QPTA 1XFVO 2M7NA 1JC2A 2NCPA 4N1GA 2OS8C 4CFQA 1QJTA 1VRKA 1FBVA 4GAOA 1K9PA 1TN4A 4GFTA 4A4CA 1B47A 1XYDA 1QLKA 1MXLC 1SY9A 5DKRA 4MRXA 3LL8B 1Y0VH 2BL0C 1XFXO 3HCMA 2WCFA 3TS5C 1HT9A 2M9GA 1JFKA 3OB1B 3PFVA 2K0JA 2Q91A 2M1KB 4L9MA 4PHJA 1DF0A 1GQMA 2F3YA 1AP4A 2MBXA 2WCBA 4ICBA 5JOLA 1NCXA 2LMVA 2KFHA 1YX8A 4CFRA 3JVTB 2K61A 5ER5A 1XFUO 1LA3A 4AQJA 1AVSA 1B4CA 3OX6A 1MHOA 5CSIA 1RROA 3EK8A 3IQQA 3TUYB 2LP3A 3SG4A 4QJ5B 4NDBA 2K7OA 2MRDA 1S1EA 2JWWA 4PHMA 3EVVA 1TCFA 1JUOA 2F8PA 2M7LA 1MR8A 2PALA 1S3PA 1XK4A 2EGDA 5HLOA 2MJWB 2G9BA 1CM4A 4E68A 1SBJA 3FWCA 2LLSA 2JC2A 1DJWA 4XJKB 1SCVA 4GNKB 4CIDA 4AQIA 1SK6D 5BPJA 5KSZA 2MHHA 4DRWA 2BCAA 3SG5A 1TCOB 1KWOB 3GK1A 4JPZB 4PDZA 4PE7A 1U5IB 1CDPA 3LCPC 3DF0B 1ODBA 1EH2A 4A4BA 3BOWB 2OS8B 3AAKA 1KSMA 4U8DA 1XFYO 5I2OA 3CGAA 1S5GY 1JF2A 1PULA 3OX5A 1IRJA 2FJUB 2LHIA 2PMYA 2H61C 1N2DA 1QVIZ 3PALA 2HETA 2TN4A 2NLNA 3BUOB 2BL0B 4QJ4B 1B8RA 2I94A 1QLSA 1JF0A 3I5GC 2F2PA 1AJ5A 2WOSA 4OCIA 1V1FA 1YURA 1MUXA 2M49B 4I5JA 2KQYA 1OMVA 3VRNA 1B8LA 1YRUB 2H2KA 3VRRA 2CTNA 5CSJA 1C7VA 2L50A 2R2IA 1DT7B 1PK0D 3DVKA 4NQGA 1S6JA 2HQWA 3CTNA 1CLMA 2KFFA 3M0WA 3FIAA 4YBHB 2MLEC 1F8HA 1WLMA 1YUSA 2LLTA 2Y4QA 2JZIA 1QIVA 1M31A 4WQ3A 1QX2A 3SG3A 1K95A 1UURA 1SL8A 1CB1A 3JVTC 2B1UA 3NXAA 4ORCB 3WXAA 1WRZA 2ZFDA 1FW4A 1BU3A 5GQQC 4PALA 2M8UA 1XA5A 1TIZA 2BCBA 5AXIA 3TUYC 1C7WA 2JQ6A 2PVBA 1OMDA 1UHIA 3PM8A 1PALA 2NZ0A 3IF7A 1HQVA 2LLUA 1IQ5A 2HPSA 3O78A 2JNFA 1XVJA 5IBWA 2HQ8A 1H8BA 3NSIA 5HKWA 1E8AA 1YRTB 2M97A 2MA2A 2WC8A 2BCXA 5DKQA 4C0LA 2LP2A 4PCWA 4YGAA 1BF5A 3BUNB 3PLFB 4Q04A 2SASA 1KWOC 1QXPA 1UWOA 2JT3A 2MLFC 1CDNA 3TDIA 3VROA 5I8NA 1FI6A 1UHKA 3BUWB 3PSRA 1NCYA 3K21A 1TRFA 4OKHA 4USLA 2I2RE 2K2AA 3I5GB 4FQOA 4YGDB 1QV1A 1V1GA 1MWNA 3DD4A 1RECA 4ZCUA 1SCMB 2E30A 3AKBA 2LCPA 1Q80A 4M2QA 4XYNA 1NX0A 2BE4A 4ORAB 5F6TA 1EG3A 2F3ZA 4M2PA 3O4YA 2JTTA 2KDHA 1NSHA 4DUQA 1ZOTB 2JNXA 2WNDA 1SYMA 1M46A 1QVIY 1RFJA 1WRLA 4MZKA 1RWYA 1YR5A 2FCDA 3H4SE 1MF8B 1W7JB 1JSAA 5JJGA 2F2OA 2VRGA 2CNPA 3CZTX 1YTZC 2M0RA 3CR5X 1KFXS 2V53A 2WCEA 2BBMA 1NWDA 1OOJA 1IQ3A 1F70A 5KTYA 2COLB 1DJXA 4I5NB 2LNKA 1D1OA 1L7ZA 1LKJA 4XJKA 3BUMB 3CS1A 2AAOA 1KK8B 1UHHA 1NPQA 1OZSA 2F33A 3A8RA 3SG6A 1KFUL 1NX3A 2A4JA 2SCPA 1LVCD 3BXKA 1CMFA 3D0YB 1S6IA 1CNPA 2PASA 4F0ZB 3FS7A 1K94A 1RK9A 1U5IA 2KYFA 3DF0A 3SG2A 2JOJA 2L5XB 1SKTA 2LMTA 3BOWA 3NSLA 2JRFA 1IKUA 1OSAA 1YX7A 1ZACA 4YGCB 4PHNA 1SPYA 2M1UA 2E6WA 1CLLA 1PVBA 1TNXA 1S6CA 1DJZA 1EG4A 2NXQA 4R1EA 2LVKA 1DJIA 1BODA 2OTGB 3LK1A 2LVJA 4I5LB 1M39A 1DVIA 2CXJA 5KU1A 4UPGA 3GK2A 5B8IB 1BT6A 1XO5A 1K9KA 2JXCA 1OE9B 2OPOA 1CKKA 1SCMC 1AUIB 5DKNA 1SNLA 4MRYA 1TNQA 3DVEA 2KI4B 2KYCA 2ZN9A 1S36A 2KQ6A 1DTLA 1OMRA 1Y1AA 4I5KA 1J7QA 1CDLA 1QIWA 2ZN8A 1ZMZA 4C0KA 1WY9A 2HF5A 2CCMA 1L2OC 3EK7A 3WNXB 5HYDA 2LUXA 2GGMA 5G08A 3LLEA 1JFJA 1H4BA 1NX2A 2GV5A 3E3RA 3I5FB 5AEQA 1G4YR 2LAPA 2Y5IA 5TNCA 2LVVA 1F55A 2LE9B 1Y6WA 3VRPA 3NSKA 2KAVA 4MZLA 1K8UA 1NYAA 4CPVA 1A75B 4FTGA 1Y1UA 4MBEA 4GPLB 2KAYA 1UHNA 2K7BA 2G2BA 1QTXA 3DVJA 3RLZA 4YI9A 3ZNIA 5I2QA 3OB2B 1B7TZ 1N0YA 1FPWA 2RGIA 2LHLA 3PN7B 1W7IB 1KK8C 1RJVA 1C07A 1R2UA 1DGUA 4JWQA 3KF9A 3C1VA 5D69A 1LINA 2FCEA 4ETOA 1J1EA 2JT0A 3AAJA 4CLNA 1J7PA 4BY4A 1CLBA 4P5OE 2H61A 3SG7A 4HRGA 2K2FA 4GUKA 3SIBA 1CFDA 3ZWHA 3ICBA 4WRIA 1K2HA 4P2YB 1BMOA 3CR2A 1DJYA 2L98A 4TNCA 1PSRA 1S26D 2KI6C 2QACA 3O6BA 1IWQA 1A29A 1R6PA 2GGZA 2JTZA 2ZKMX 2LM5A 2ZNDA 4GGNA 4PHKA 1DMOA 3I5HC 2OTGC 4HRHA 1KQMC 4GBAA 1QV0A 4MN0A 1BJFA 4MSPA 1M45A 1N65A 3BUXB 3EKHA 4AOMA 1IGVA 2P6BB 3WHUB 2JULA 2WORA 1PSBA 1KQVA 1UP5A 1OZOA 2IS9A 2JT8A 2L4HA 4MLWA 1DGVA 4OV2A 1ZFSA 5CSNA 1SMGA 2KI4C 1CFFA 1YVLA 2DOQA 1CMGA 1OQPA 1TTXA 1L2OB 4N5XA 2L51A 1AK8A 1KK7Z 3JTDC 2O5GA 5PALA 4PE0A 2D8NA 2KGBC 1TNPA 3VGOA 1RTP1 1SL7A 3OP0A 5CPVA 3I5FC 4OR9B 2PRUA 3NSOA 2BKIB 1F54A 2JXLA 5AFPA 3MSEB 2EHBA 1ZUZA 3OHMB 3SIAA 1YVHA 1WDCC 3D0YA 1BG1A 2ZRTA 5J3XA 2L0PA 2L2EA 1XFZO 1PVAA 4PE4A 5HKZA 2BECA 1F4OA 4DIRA 1QS7A 1YUTA 4DCKA 4DS7A 2LVIA 4N1FA 5K89A 1Y1XA 1A2XA 3PN7C 1MXEA 3PATA 3RM1A 1DF0B 1PRWA 1SL9A 3TDZA 1KCYA 1J1DA 3KHEA 3WHTB 5HKYA 3TDUA 1LA0A 4GGFC 5D7FA 1A4PA 1QATA 1BOCA 1NUBA 4OVNF 4BY5A 1B7TY 3BQ3A 4HREE 4WQ2A 5HLVA 5AANA 1SW8A 2KAXA 2LUCA 1AJ4A 3I5HB 3I5IC 1J55A 1G33A 1IJ5A 1F4QA 4NDCA 3KO0A 2M3WA 1KQMB 2KFGA 2KI6D
chains in the Genus database with same CATH superfamily
2BE6A 3TZ1A 2KOTA 4MZJA 3QRXA 2Q4UA 2LMUA 4M2OA 1FF1A 1J7RA 3HX4A 3GK4X 1SR6B 5AERA 2BBNA 2M29A 1GGWA 1EL4A 2P71A 1JWDA 2BKHB 5FYXA 1G8IA 5CSFA 3F45A 1DJGA 2KHNA 2EC6B 1K93D 2CT9A 3EVRA 2I18A 3BFHA 2JPTA 5HL1A 3D76A 3A4UB 1QX5B 4NDDA 1IIOA 2AMIA 3GOFA 4ORBB 4YGEB 2KNEA 3CZ0A 1K90D 3CZ1A 1XFWO 2JU0A 1XFRA 3CABA 2O60A 2AUCA 3JTDB 3PM2A 3S0GA 1EJ3A 1GGZA 2LANA 3D77A 1A75A 3CLNA 2K8MB 2WCJA 3KPXA 2L4IA 1LXFC 4MEWA 3TS5B 1BLQA 1M63B 1NX1A 1SRAA 4IL1A 3SJSA 2KBIA 2L5YA 4QJ3B 2KGRA 1WDCB 4YGBB 5I2LA 1ALWA 3CDNA 5I94A 1A03A 4C0JA 4MVFA 1IG5A 1KFUS 1CM1A 1SSEB 1ALVA 2FOTA 2MAZA 1X02A 3IQOA 1MQ1A 1KK7Y 3AKAA 4GGFA 3PJIA 1JBAA 2LC5A 1BR1B 3EKJA 3FE8A 3BYAA 1QASA 1QX7A 2PSRA 2NCOA 1CTRA 2Y1NA 3V2LA 1NIWA 4YI8A 1TNWA 3CYZA 3LK0A 1CDMA 2KBMA 3CR4X 1IH0A 2PYQA 1DJHA 5ER4X 1AHRA 1KFXL 3B88A 4D1EA 3DVMA 4YRUA 2KSPA 2ISDA 3I5IB 1CFCA 1BR4B 1NCZA 2LV7A 3EK4A 1B8CA 4PE1A 3O2PA 1WLZA 2K7CA 1B1GA 1K9UA 1Z2CB 2ZNEA 2ZRSA 1S5GZ 1F71A 2CBLA 2QEOA 1YUUA 1J7OA 1B9AA 1GJYA 1EXRA 1FI5A 4HSZA 3CWGA 3FWBA 3Q8IA 4JQ0D 1CFPA 3EVUA 3L4LA 1WRKA 1SR6C 1IJ6A 3VRQA 1NP8A 1QWVA 4ZCVA 2K7DA 1XK4C 1TOPA 2Y1MA 2I7AA 1KSOA 3D73A 2EC6C 1UUSA 3D10A 1UHJA 3KEVA 1K96A 2QPTA 1XFVO 2M7NA 3N7HA 1JC2A 2NCPA 2L2CA 4N1GA 2OS8C 3D75A 4CFQA 1QJTA 3UNWA 1VRKA 1FBVA 4GAOA 1K9PA 1OOIX 1TN4A 4GFTA 4A4CA 1B47A 1XYDA 5EL2A 1QLKA 1MXLC 1SY9A 5DKRA 5FI6A 3S0BA 4MRXA 3LL8B 1Y0VH 2BL0C 2WCHA 1XFXO 3HCMA 2WCFA 3TS5C 1HT9A 2M9GA 1TWOA 1JFKA 4JKTA 3OB1B 3PFVA 2K0JA 2Q91A 2M1KB 4L9MA 5DICA 4PHJA 1DF0A 3R1PA 1GQMA 2F3YA 3VB1A 2QEBA 2MBXA 1AP4A 2WCBA 4ICBA 5JOLA 1NCXA 2LMVA 2KFHA 1YX8A 4CFRA 3JVTB 2K61A 3BFAA 5ER5A 1XFUO 3DZTA 1LA3A 4AQJA 1AVSA 1B4CA 3OX6A 1MHOA 5CSIA 1RROA 3EK8A 3IQQA 3TUYB 2LP3A 3SG4A 4QJ5B 4NDBA 2K7OA 2MRDA 1S1EA 2JWWA 4PHMA 3EVVA 1TCFA 1JUOA 2F8PA 2M7LA 1MR8A 2PALA 1S3PA 1XK4A 2EGDA 2P70A 2MJWB 2G9BA 1CM4A 5HLOA 1SBJA 4E68A 3FWCA 2LLSA 2JC2A 1DJWA 2WCKA 4XJKB 1SCVA 3FE9A 4GNKB 4CIDA 4AQIA 3L47A 1SK6D 5BPJA 5KSZA 2MHHA 4DRWA 2BCAA 3SG5A 1TCOB 1KWOB 3GK1A 4JPZB 4PDZA 4PE7A 1U5IB 1CDPA 3LCPC 3DF0B 1ODBA 1EH2A 4A4BA 3BOWB 2OS8B 3AAKA 1KSMA 3R1OA 1XFYO 4U8DA 5I2OA 3CGAA 1S5GY 1JF2A 1PULA 3OX5A 1IRJA 2FJUB 2LHIA 3B86A 2WC5A 2PMYA 3D74A 2H61C 1N2DA 1QVIZ 3NGVA 2HETA 3NHIA 3PALA 2TN4A 2NLNA 3BUOB 3O4XA 2BL0B 4QJ4B 1B8RA 2I94A 1QLSA 1JF0A 3I5GC 2F2PA 2QEVA 1AJ5A 2WOSA 4OCIA 1V1FA 1YURA 1MUXA 2M49B 3R1VA 2KQYA 4I5JA 1OMVA 3VRNA 1B8LA 1YRUB 2H2KA 3L4AA 2CTNA 5CSJA 3VRRA 2L50A 1C7VA 2R2IA 1DT7B 1PK0D 3DVKA 4NQGA 1S6JA 4INWA 2HQWA 3CTNA 1CLMA 1OOFA 2KFFA 3FIAA 3M0WA 2MLEC 2JPOA 4YBHB 1F8HA 1WLMA 4FQTA 1YUSA 2LLTA 2Y4QA 2JZIA 1QIVA 1M31A 3CZ2A 1QX2A 4WQ3A 3SG3A 1K95A 1UURA 1GM0A 1SL8A 1CB1A 3JVTC 3OGNA 2B1UA 3NXAA 4ORCB 3WXAA 1WRZA 2ZFDA 2KLDA 1FW4A 1BU3A 5GQQC 2BNXA 4PALA 2M8UA 1XA5A 1TIZA 2BCBA 5AXIA 3TUYC 3SS3A 1C7WA 2JQ6A 2PVBA 1OMDA 1UHIA 3PM8A 1PALA 2NZ0A 3IF7A 1HQVA 2LLUA 2WCLA 1IQ5A 2HPSA 1Z4HA 2JNFA 1XVJA 3DYEA 2HQ8A 3O78A 3S0EA 5IBWA 3NSIA 5HKWA 1OOHA 1H8BA 1E8AA 1YRTB 2M97A 2MA2A 3K1EA 2WC8A 2BCXA 5DKQA 4C0LA 2LP2A 1OOGA 3FE6A 4PCWA 4YGAA 1BF5A 3BUNB 3PLFB 4Q04A 2SASA 1KWOC 1QXPA 1UWOA 2JT3A 2MLFC 1CDNA 3TDIA 3VROA 3BFBA 5I8NA 2ERBA 1FI6A 3QMEA 1UHKA 3BUWB 3PSRA 1NCYA 3K21A 1TRFA 2WC6A 4OKHA 2I2RE 2K2AA 3I5GB 4FQOA 4USLA 1QV1A 1V1GA 1MWNA 3DD4A 1RECA 3DXLA 4ZCUA 1SCMB 2E30A 2KPHA 2LCPA 1Q80A 3AKBA 4M2QA 4XYNA 2FJYA 3UO9A 1NX0A 2BE4A 4ORAB 5F6TA 1EG3A 2F3ZA 4M2PA 3O4YA 2JTTA 2KDHA 1NSHA 4DUQA 1ZOTB 2JNXA 2WNDA 1SYMA 1M46A 3BJHA 1QVIY 1RFJA 1WRLA 3S0FA 4MZKA 1RWYA 1YR5A 2FCDA 3H4SE 1MF8B 1W7JB 1JSAA 5JJGA 2F2OA 2YGUA 2VRGA 2CNPA 3CZTX 1YTZC 2M0RA 3CR5X 1KFXS 2V53A 2WCEA 2BBMA 1NWDA 1OOJA 1TUJA 1IQ3A 1F70A 5KTYA 3S0AA 2COLB 1DJXA 4I5NB 2LNKA 1D1OA 1L7ZA 1LKJA 4XJKA 5FI2A 3BUMB 3CS1A 2AAOA 1KK8B 1UHHA 1NPQA 1OZSA 2F33A 3A8RA 3SG6A 1KFUL 1NX3A 2A4JA 2SCPA 1LVCD 3BXKA 1CMFA 3D0YB 1S6IA 1CNPA 2PASA 4F0ZB 3FS7A 1K94A 1RK9A 1U5IA 2KYFA 3DF0A 3R72A 2JOJA 3SG2A 1DC1A 2L5XB 1SKTA 2LMTA 3BOWA 3D78A 3NSLA 2JRFA 1IKUA 4KYNA 1OSAA 1YX7A 1ZACA 4YGCB 3B7AA 4PHNA 1SPYA 2M1UA 2E6WA 1CLLA 1DELA 1PVBA 1TNXA 3B6XA 1S6CA 1DJZA 1EG4A 2NXQA 4R1EA 2LVKA 1DJIA 1BODA 2OTGB 3LK1A 2LVJA 4I5LB 1M39A 1DVIA 2BAPA 2CXJA 5KU1A 4UPGA 1OW4A 3GK2A 5B8IB 1BT6A 1XO5A 1C3ZA 1K9KA 2JXCA 3S0DA 1OE9B 2OPOA 1CKKA 1SCMC 2K60A 1AUIB 5DKNA 1SNLA 4MRYA 1TNQA 3DVEA 2KI4B 2KYCA 2ZN9A 1S36A 2KQ6A 1DTLA 4IJ7A 1DQEA 1OMRA 1Y1AA 4F7FA 2QEHA 4I5KA 1CDLA 1J7QA 2PQLA 1QIWA 2ZN8A 1ZMZA 3EG5B 1WY9A 4C0KA 2HF5A 2CCMA 1L2OC 3EK7A 3WNXB 5HYDA 2LUXA 2GGMA 5G08A 3LLEA 3RZSA 1JFJA 1H4BA 1NX2A 2GV5A 3E3RA 3I5FB 5AEQA 1G4YR 2LAPA 2Y5IA 5TNCA 2LVVA 1F55A 2LE9B 1Y6WA 3VRPA 2WCMA 3NSKA 2KAVA 4MZLA 1K8UA 1NYAA 1P28A 1A75B 4FTGA 4CPVA 1Y1UA 4MBEA 4GPLB 2KAYA 1UHNA 2K7BA 2G2BA 1QTXA 3DVJA 3RLZA 4YI9A 3ZNIA 5I2QA 4PT1A 3OB2B 1B7TZ 1N0YA 1LS8A 1FPWA 2RGIA 2LHLA 3PN7B 1W7IB 1KK8C 1RJVA 1C07A 1R2UA 1DGUA 4JWQA 3KF9A 3C1VA 5D69A 1LINA 2FCEA 2H8VA 3B87A 3OBVA 1J1EA 4ETOA 2JT0A 3AAJA 4YGDB 4CLNA 2QDIA 5FI7A 1J7PA 4JD9A 4BY4A 1CLBA 4P5OE 2H61A 3SG7A 4HRGA 2K2FA 4GUKA 2KLEA 3SIBA 1CFDA 3ZWHA 3ICBA 4WRIA 1K2HA 4P2YB 1BMOA 3CR2A 1DJYA 2L98A 4TNCA 1PSRA 1S26D 2KI6C 2QACA 3O6BA 1IWQA 1A29A 1DEKA 1R6PA 2GGZA 2JTZA 2ZKMX 4INXA 2LM5A 2ZNDA 4GGNA 4PHKA 1DMOA 3I5HC 2OTGC 4HRHA 1KQMC 4GBAA 1QV0A 4MN0A 1BJFA 4MSPA 1M45A 1N65A 3NHTA 3BUXB 3EKHA 4AOMA 1IGVA 2P6BB 3WHUB 2JULA 2WORA 1PSBA 1KQVA 1UP5A 1OZOA 2IS9A 2JT8A 2L4HA 4MLWA 1DGVA 4OV2A 1ZFSA 4OZDA 1SMGA 2KI4C 5CSNA 1CFFA 3IVTA 1YVLA 2DOQA 1CMGA 1OQPA 1TTXA 1L2OB 1ORGA 4N5XA 2L51A 1AK8A 5D3OA 1KK7Z 3JTDC 2O5GA 5PALA 4PE0A 2D8NA 2KGBC 1TNPA 3VGOA 1RTP1 1SL7A 3OP0A 1T14A 5CPVA 3I5FC 4OR9B 2PRUA 3NSOA 2BKIB 1F54A 2JXLA 2GTEA 3DY9A 5AFPA 3MSEB 2EHBA 1ZUZA 3OHMB 3SIAA 1YVHA 1WDCC 3D0YA 3SS4A 2ZRTA 1BG1A 5J3XA 2L0PA 2L2EA 1XFZO 1PVAA 4PE4A 5HKZA 2BECA 1F4OA 4DIRA 1QS7A 1YUTA 4DCKA 4DS7A 2LVIA 4N1FA 5K89A 1Y1XA 3SS5A 1A2XA 3PN7C 1MXEA 3PATA 3RM1A 1DF0B 1PRWA 1SL9A 3TDZA 1KCYA 1J1DA 3KHEA 3WHTB 5HKYA 3TDUA 1LA0A 4GGFC 5D7FA 1A4PA 1QATA 1BOCA 1NUBA 4OVNF 4BY5A 1B7TY 3BQ3A 1TUZA 4HREE 4WQ2A 5HLVA 5AANA 1SW8A 2KAXA 2LUCA 1AJ4A 3I5HB 3I5IC 1J55A 1G33A 1IJ5A 1F4QA 4NDCA 1W9ZA 3KO0A 1C3YA 2M3WA 1KQMB 2KFGA 2KI6D
chains in the Genus database with same CATH topology
2BE6A 3TZ1A 2KOTA 4MZJA 3QRXA 2Q4UA 2LMUA 4M2OA 1FF1A 1J7RA 3HX4A 3GK4X 1SR6B 5AERA 2BBNA 2M29A 1GGWA 1EL4A 1JWDA 2BKHB 5FYXA 1G8IA 5CSFA 3F45A 1DJGA 2KHNA 2EC6B 1K93D 2CT9A 3EVRA 2I18A 2JPTA 3A4UB 1QX5B 4NDDA 2AMIA 3GOFA 4ORBB 4YGEB 2KNEA 1K90D 3JTDB 1XFWO 2JU0A 2O60A 2AUCA 1EJ3A 1GGZA 2LANA 3KPXA 1A75A 3CLNA 2K8MB 3TS5B 2L4IA 1LXFC 4MEWA 1BLQA 1M63B 1NX1A 1SRAA 4IL1A 3SJSA 2KBIA 4QJ3B 2KGRA 1WDCB 4YGBB 5I2LA 1ALWA 1A03A 4C0JA 4MVFA 1IG5A 1KFUS 1CM1A 1ALVA 2FOTA 2MAZA 1X02A 3IQOA 1MQ1A 1KK7Y 3AKAA 4GGFA 1JBAA 2LC5A 1BR1B 3EKJA 3BYAA 1QASA 1QX7A 2PSRA 2NCOA 1CTRA 2Y1NA 1NIWA 4YI8A 1TNWA 3LK0A 1CDMA 2KBMA 3CR4X 1IH0A 1DJHA 5ER4X 1AHRA 1KFXL 4D1EA 3DVMA 4YRUA 2KSPA 2ISDA 3I5IB 1CFCA 1BR4B 1NCZA 2LV7A 3EK4A 1B8CA 4PE1A 3O2PA 1WLZA 2K7CA 1B1GA 1K9UA 2ZNEA 2ZRSA 1S5GZ 1F71A 2CBLA 1YUUA 1J7OA 1B9AA 1GJYA 1EXRA 1FI5A 4HSZA 3CWGA 3FWBA 4JQ0D 1CFPA 3EVUA 1WRKA 1SR6C 1IJ6A 3VRQA 1NP8A 4ZCVA 2K7DA 1XK4C 1TOPA 2Y1MA 2I7AA 1KSOA 2EC6C 1UUSA 3D10A 1UHJA 3KEVA 1K96A 2QPTA 1XFVO 2M7NA 1JC2A 2NCPA 4N1GA 2OS8C 4CFQA 1QJTA 1VRKA 1FBVA 4GAOA 1K9PA 1TN4A 4GFTA 4A4CA 1B47A 1XYDA 1QLKA 1MXLC 1SY9A 5DKRA 4MRXA 3LL8B 1Y0VH 2BL0C 1XFXO 3HCMA 2WCFA 3TS5C 1HT9A 2M9GA 1JFKA 3OB1B 3PFVA 2K0JA 2Q91A 2M1KB 4L9MA 4PHJA 1DF0A 1GQMA 2F3YA 1AP4A 2MBXA 2WCBA 4ICBA 5JOLA 1NCXA 2LMVA 2KFHA 1YX8A 4CFRA 3JVTB 2K61A 5ER5A 1XFUO 1LA3A 4AQJA 1AVSA 1B4CA 3OX6A 1MHOA 5CSIA 1RROA 3EK8A 3IQQA 3TUYB 2LP3A 3SG4A 4QJ5B 4NDBA 2K7OA 2MRDA 1S1EA 2JWWA 4PHMA 3EVVA 1TCFA 1JUOA 2F8PA 2M7LA 1MR8A 2PALA 1S3PA 1XK4A 2EGDA 5HLOA 2MJWB 2G9BA 1CM4A 4E68A 1SBJA 3FWCA 2LLSA 2JC2A 1DJWA 4XJKB 1SCVA 4GNKB 4CIDA 4AQIA 1SK6D 5BPJA 5KSZA 2MHHA 4DRWA 2BCAA 3SG5A 1TCOB 1KWOB 3GK1A 4JPZB 4PDZA 4PE7A 1U5IB 1CDPA 3LCPC 3DF0B 1ODBA 1EH2A 4A4BA 3BOWB 2OS8B 3AAKA 1KSMA 4U8DA 1XFYO 5I2OA 3CGAA 1S5GY 1JF2A 1PULA 3OX5A 1IRJA 2FJUB 2LHIA 2PMYA 2H61C 1N2DA 1QVIZ 3PALA 2HETA 2TN4A 2NLNA 3BUOB 2BL0B 4QJ4B 1B8RA 2I94A 1QLSA 1JF0A 3I5GC 2F2PA 1AJ5A 2WOSA 4OCIA 1V1FA 1YURA 1MUXA 2M49B 4I5JA 2KQYA 1OMVA 3VRNA 1B8LA 1YRUB 2H2KA 3VRRA 2CTNA 5CSJA 1C7VA 2L50A 2R2IA 1DT7B 1PK0D 3DVKA 4NQGA 1S6JA 2HQWA 3CTNA 1CLMA 2KFFA 3M0WA 3FIAA 4YBHB 2MLEC 1F8HA 1WLMA 1YUSA 2LLTA 2Y4QA 2JZIA 1QIVA 1M31A 4WQ3A 1QX2A 3SG3A 1K95A 1UURA 1SL8A 1CB1A 3JVTC 2B1UA 3NXAA 4ORCB 3WXAA 1WRZA 2ZFDA 1FW4A 1BU3A 5GQQC 4PALA 2M8UA 1XA5A 1TIZA 2BCBA 5AXIA 3TUYC 1C7WA 2JQ6A 2PVBA 1OMDA 1UHIA 3PM8A 1PALA 2NZ0A 3IF7A 1HQVA 2LLUA 1IQ5A 2HPSA 3O78A 2JNFA 1XVJA 5IBWA 2HQ8A 1H8BA 3NSIA 5HKWA 1E8AA 1YRTB 2M97A 2MA2A 2WC8A 2BCXA 5DKQA 4C0LA 2LP2A 4PCWA 4YGAA 1BF5A 3BUNB 3PLFB 4Q04A 2SASA 1KWOC 1QXPA 1UWOA 2JT3A 2MLFC 1CDNA 3TDIA 3VROA 5I8NA 1FI6A 1UHKA 3BUWB 3PSRA 1NCYA 3K21A 1TRFA 4OKHA 4USLA 2I2RE 2K2AA 3I5GB 4FQOA 4YGDB 1QV1A 1V1GA 1MWNA 3DD4A 1RECA 4ZCUA 1SCMB 2E30A 3AKBA 2LCPA 1Q80A 4M2QA 4XYNA 1NX0A 2BE4A 4ORAB 5F6TA 1EG3A 2F3ZA 4M2PA 3O4YA 2JTTA 2KDHA 1NSHA 4DUQA 1ZOTB 2JNXA 2WNDA 1SYMA 1M46A 1QVIY 1RFJA 1WRLA 4MZKA 1RWYA 1YR5A 2FCDA 3H4SE 1MF8B 1W7JB 1JSAA 5JJGA 2F2OA 2VRGA 2CNPA 3CZTX 1YTZC 2M0RA 3CR5X 1KFXS 2V53A 2WCEA 2BBMA 1NWDA 1OOJA 1IQ3A 1F70A 5KTYA 2COLB 1DJXA 4I5NB 2LNKA 1D1OA 1L7ZA 1LKJA 4XJKA 3BUMB 3CS1A 2AAOA 1KK8B 1UHHA 1NPQA 1OZSA 2F33A 3A8RA 3SG6A 1KFUL 1NX3A 2A4JA 2SCPA 1LVCD 3BXKA 1CMFA 3D0YB 1S6IA 1CNPA 2PASA 4F0ZB 3FS7A 1K94A 1RK9A 1U5IA 2KYFA 3DF0A 3SG2A 2JOJA 2L5XB 1SKTA 2LMTA 3BOWA 3NSLA 2JRFA 1IKUA 1OSAA 1YX7A 1ZACA 4YGCB 4PHNA 1SPYA 2M1UA 2E6WA 1CLLA 1PVBA 1TNXA 1S6CA 1DJZA 1EG4A 2NXQA 4R1EA 2LVKA 1DJIA 1BODA 2OTGB 3LK1A 2LVJA 4I5LB 1M39A 1DVIA 2CXJA 5KU1A 4UPGA 3GK2A 5B8IB 1BT6A 1XO5A 1K9KA 2JXCA 1OE9B 2OPOA 1CKKA 1SCMC 1AUIB 5DKNA 1SNLA 4MRYA 1TNQA 3DVEA 2KI4B 2KYCA 2ZN9A 1S36A 2KQ6A 1DTLA 1OMRA 1Y1AA 4I5KA 1J7QA 1CDLA 1QIWA 2ZN8A 1ZMZA 4C0KA 1WY9A 2HF5A 2CCMA 1L2OC 3EK7A 3WNXB 5HYDA 2LUXA 2GGMA 5G08A 3LLEA 1JFJA 1H4BA 1NX2A 2GV5A 3E3RA 3I5FB 5AEQA 1G4YR 2LAPA 2Y5IA 5TNCA 2LVVA 1F55A 2LE9B 1Y6WA 3VRPA 3NSKA 2KAVA 4MZLA 1K8UA 1NYAA 4CPVA 1A75B 4FTGA 1Y1UA 4MBEA 4GPLB 2KAYA 1UHNA 2K7BA 2G2BA 1QTXA 3DVJA 3RLZA 4YI9A 3ZNIA 5I2QA 3OB2B 1B7TZ 1N0YA 1FPWA 2RGIA 2LHLA 3PN7B 1W7IB 1KK8C 1RJVA 1C07A 1R2UA 1DGUA 4JWQA 3KF9A 3C1VA 5D69A 1LINA 2FCEA 4ETOA 1J1EA 2JT0A 3AAJA 4CLNA 1J7PA 4BY4A 1CLBA 4P5OE 2H61A 3SG7A 4HRGA 2K2FA 4GUKA 3SIBA 1CFDA 3ZWHA 3ICBA 4WRIA 1K2HA 4P2YB 1BMOA 3CR2A 1DJYA 2L98A 4TNCA 1PSRA 1S26D 2KI6C 2QACA 3O6BA 1IWQA 1A29A 1R6PA 2GGZA 2JTZA 2ZKMX 2LM5A 2ZNDA 4GGNA 4PHKA 1DMOA 3I5HC 2OTGC 4HRHA 1KQMC 4GBAA 1QV0A 4MN0A 1BJFA 4MSPA 1M45A 1N65A 3BUXB 3EKHA 4AOMA 1IGVA 2P6BB 3WHUB 2JULA 2WORA 1PSBA 1KQVA 1UP5A 1OZOA 2IS9A 2JT8A 2L4HA 4MLWA 1DGVA 4OV2A 1ZFSA 5CSNA 1SMGA 2KI4C 1CFFA 1YVLA 2DOQA 1CMGA 1OQPA 1TTXA 1L2OB 4N5XA 2L51A 1AK8A 1KK7Z 3JTDC 2O5GA 5PALA 4PE0A 2D8NA 2KGBC 1TNPA 3VGOA 1RTP1 1SL7A 3OP0A 5CPVA 3I5FC 4OR9B 2PRUA 3NSOA 2BKIB 1F54A 2JXLA 5AFPA 3MSEB 2EHBA 1ZUZA 3OHMB 3SIAA 1YVHA 1WDCC 3D0YA 1BG1A 2ZRTA 5J3XA 2L0PA 2L2EA 1XFZO 1PVAA 4PE4A 5HKZA 2BECA 1F4OA 4DIRA 1QS7A 1YUTA 4DCKA 4DS7A 2LVIA 4N1FA 5K89A 1Y1XA 1A2XA 3PN7C 1MXEA 3PATA 3RM1A 1DF0B 1PRWA 1SL9A 3TDZA 1KCYA 1J1DA 3KHEA 3WHTB 5HKYA 3TDUA 1LA0A 4GGFC 5D7FA 1A4PA 1QATA 1BOCA 1NUBA 4OVNF 4BY5A 1B7TY 3BQ3A 4HREE 4WQ2A 5HLVA 5AANA 1SW8A 2KAXA 2LUCA 1AJ4A 3I5HB 3I5IC 1J55A 1G33A 1IJ5A 1F4QA 4NDCA 3KO0A 2M3WA 1KQMB 2KFGA 2KI6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BE6 A;  3TZ1 A;  2KOT A;  4MZJ A;  3QRX A;  2Q4U A;  2LMU A;  4M2O A;  1FF1 A;  1J7R A;  3HX4 A;  3GK4 X;  1SR6 B;  5AER A;  2BBN A;  2M29 A;  1GGW A;  1EL4 A;  1JWD A;  2BKH B;  5FYX A;  1G8I A;  5CSF A;  3F45 A;  1DJG A;  2KHN A;  2EC6 B;  1K93 D;  2CT9 A;  3EVR A;  2I18 A;  2JPT A;  3A4U B;  1QX5 B;  4NDD A;  2AMI A;  3GOF A;  4ORB B;  4YGE B;  2KNE A;  1K90 D;  3JTD B;  1XFW O;  2JU0 A;  2O60 A;  2AUC A;  1EJ3 A;  1GGZ A;  2LAN A;  3KPX A;  1A75 A;  3CLN A;  2K8M B;  3TS5 B;  2L4I A;  1LXF C;  4MEW A;  1BLQ A;  1M63 B;  1NX1 A;  1SRA A;  4IL1 A;  3SJS A;  2KBI A;  4QJ3 B;  2KGR A;  1WDC B;  4YGB B;  5I2L A;  1ALW A;  1A03 A;  4C0J A;  4MVF A;  1IG5 A;  1KFU S;  1CM1 A;  1ALV A;  2FOT A;  2MAZ A;  1X02 A;  3IQO A;  1MQ1 A;  1KK7 Y;  3AKA A;  4GGF A;  1JBA A;  2LC5 A;  1BR1 B;  3EKJ A;  3BYA A;  1QAS A;  1QX7 A;  2PSR A;  2NCO A;  1CTR A;  2Y1N A;  1NIW A;  4YI8 A;  1TNW A;  3LK0 A;  1CDM A;  2KBM A;  3CR4 X;  1IH0 A;  1DJH A;  5ER4 X;  1AHR A;  1KFX L;  4D1E A;  3DVM A;  4YRU A;  2KSP A;  2ISD A;  3I5I B;  1CFC A;  1BR4 B;  1NCZ A;  2LV7 A;  3EK4 A;  1B8C A;  4PE1 A;  3O2P A;  1WLZ A;  2K7C A;  1B1G A;  1K9U A;  2ZNE A;  2ZRS A;  1S5G Z;  1F71 A;  2CBL A;  1YUU A;  1J7O A;  1B9A A;  1GJY A;  1EXR A;  1FI5 A;  4HSZ A;  3CWG A;  3FWB A;  4JQ0 D;  1CFP A;  3EVU A;  1WRK A;  1SR6 C;  1IJ6 A;  3VRQ A;  1NP8 A;  4ZCV A;  2K7D A;  1XK4 C;  1TOP A;  2Y1M A;  2I7A A;  1KSO A;  2EC6 C;  1UUS A;  3D10 A;  1UHJ A;  3KEV A;  1K96 A;  2QPT A;  1XFV O;  2M7N A;  1JC2 A;  2NCP A;  4N1G A;  2OS8 C;  4CFQ A;  1QJT A;  1VRK A;  1FBV A;  4GAO A;  1K9P A;  1TN4 A;  4GFT A;  4A4C A;  1B47 A;  1XYD A;  1QLK A;  1MXL C;  1SY9 A;  5DKR A;  4MRX A;  3LL8 B;  1Y0V H;  2BL0 C;  1XFX O;  3HCM A;  2WCF A;  3TS5 C;  1HT9 A;  2M9G A;  1JFK A;  3OB1 B;  3PFV A;  2K0J A;  2Q91 A;  2M1K B;  4L9M A;  4PHJ A;  1DF0 A;  1GQM A;  2F3Y A;  1AP4 A;  2MBX A;  2WCB A;  4ICB A;  5JOL A;  1NCX A;  2LMV A;  2KFH A;  1YX8 A;  4CFR A;  3JVT B;  2K61 A;  5ER5 A;  1XFU O;  1LA3 A;  4AQJ A;  1AVS A;  1B4C A;  3OX6 A;  1MHO A;  5CSI A;  1RRO A;  3EK8 A;  3IQQ A;  3TUY B;  2LP3 A;  3SG4 A;  4QJ5 B;  4NDB A;  2K7O A;  2MRD A;  1S1E A;  2JWW A;  4PHM A;  3EVV A;  1TCF A;  1JUO A;  2F8P A;  2M7L A;  1MR8 A;  2PAL A;  1S3P A;  1XK4 A;  2EGD A;  5HLO A;  2MJW B;  2G9B A;  1CM4 A;  4E68 A;  1SBJ A;  3FWC A;  2LLS A;  2JC2 A;  1DJW A;  4XJK B;  1SCV A;  4GNK B;  4CID A;  4AQI A;  1SK6 D;  5BPJ A;  5KSZ A;  2MHH A;  4DRW A;  2BCA A;  3SG5 A;  1TCO B;  1KWO B;  3GK1 A;  4JPZ B;  4PDZ A;  4PE7 A;  1U5I B;  1CDP A;  3LCP C;  3DF0 B;  1ODB A;  1EH2 A;  4A4B A;  3BOW B;  2OS8 B;  3AAK A;  1KSM A;  4U8D A;  1XFY O;  5I2O A;  3CGA A;  1S5G Y;  1JF2 A;  1PUL A;  3OX5 A;  1IRJ A;  2FJU B;  2LHI A;  2PMY A;  2H61 C;  1N2D A;  1QVI Z;  3PAL A;  2HET A;  2TN4 A;  2NLN A;  3BUO B;  2BL0 B;  4QJ4 B;  1B8R A;  2I94 A;  1QLS A;  1JF0 A;  3I5G C;  2F2P A;  1AJ5 A;  2WOS A;  4OCI A;  1V1F A;  1YUR A;  1MUX A;  2M49 B;  4I5J A;  2KQY A;  1OMV A;  3VRN A;  1B8L A;  1YRU B;  2H2K A;  3VRR A;  2CTN A;  5CSJ A;  1C7V A;  2L50 A;  2R2I A;  1DT7 B;  1PK0 D;  3DVK A;  4NQG A;  1S6J A;  2HQW A;  3CTN A;  1CLM A;  2KFF A;  3M0W A;  3FIA A;  4YBH B;  2MLE C;  1F8H A;  1WLM A;  1YUS A;  2LLT A;  2Y4Q A;  2JZI A;  1QIV A;  1M31 A;  4WQ3 A;  1QX2 A;  3SG3 A;  1K95 A;  1UUR A;  1SL8 A;  1CB1 A;  3JVT C;  2B1U A;  3NXA A;  4ORC B;  3WXA A;  1WRZ A;  2ZFD A;  1FW4 A;  1BU3 A;  5GQQ C;  4PAL A;  2M8U A;  1XA5 A;  1TIZ A;  2BCB A;  5AXI A;  3TUY C;  1C7W A;  2JQ6 A;  2PVB A;  1OMD A;  1UHI A;  3PM8 A;  1PAL A;  2NZ0 A;  3IF7 A;  1HQV A;  2LLU A;  1IQ5 A;  2HPS A;  3O78 A;  2JNF A;  1XVJ A;  5IBW A;  2HQ8 A;  1H8B A;  3NSI A;  5HKW A;  1E8A A;  1YRT B;  2M97 A;  2MA2 A;  2WC8 A;  2BCX A;  5DKQ A;  4C0L A;  2LP2 A;  4PCW A;  4YGA A;  1BF5 A;  3BUN B;  3PLF B;  4Q04 A;  2SAS A;  1KWO C;  1QXP A;  1UWO A;  2JT3 A;  2MLF C;  1CDN A;  3TDI A;  3VRO A;  5I8N A;  1FI6 A;  1UHK A;  3BUW B;  3PSR A;  1NCY A;  3K21 A;  1TRF A;  4OKH A;  4USL A;  2I2R E;  2K2A A;  3I5G B;  4FQO A;  4YGD B;  1QV1 A;  1V1G A;  1MWN A;  3DD4 A;  1REC A;  4ZCU A;  1SCM B;  2E30 A;  3AKB A;  2LCP A;  1Q80 A;  4M2Q A;  4XYN A;  1NX0 A;  2BE4 A;  4ORA B;  5F6T A;  1EG3 A;  2F3Z A;  4M2P A;  3O4Y A;  2JTT A;  2KDH A;  1NSH A;  4DUQ A;  1ZOT B;  2JNX A;  2WND A;  1SYM A;  1M46 A;  1QVI Y;  1RFJ A;  1WRL A;  4MZK A;  1RWY A;  1YR5 A;  2FCD A;  3H4S E;  1MF8 B;  1W7J B;  1JSA A;  5JJG A;  2F2O A;  2VRG A;  2CNP A;  3CZT X;  1YTZ C;  2M0R A;  3CR5 X;  1KFX S;  2V53 A;  2WCE A;  2BBM A;  1NWD A;  1OOJ A;  1IQ3 A;  1F70 A;  5KTY A;  2COL B;  1DJX A;  4I5N B;  2LNK A;  1D1O A;  1L7Z A;  1LKJ A;  4XJK A;  3BUM B;  3CS1 A;  2AAO A;  1KK8 B;  1UHH A;  1NPQ A;  1OZS A;  2F33 A;  3A8R A;  3SG6 A;  1KFU L;  1NX3 A;  2A4J A;  2SCP A;  1LVC D;  3BXK A;  1CMF A;  3D0Y B;  1S6I A;  1CNP A;  2PAS A;  4F0Z B;  3FS7 A;  1K94 A;  1RK9 A;  1U5I A;  2KYF A;  3DF0 A;  3SG2 A;  2JOJ A;  2L5X B;  1SKT A;  2LMT A;  3BOW A;  3NSL A;  2JRF A;  1IKU A;  1OSA A;  1YX7 A;  1ZAC A;  4YGC B;  4PHN A;  1SPY A;  2M1U A;  2E6W A;  1CLL A;  1PVB A;  1TNX A;  1S6C A;  1DJZ A;  1EG4 A;  2NXQ A;  4R1E A;  2LVK A;  1DJI A;  1BOD A;  2OTG B;  3LK1 A;  2LVJ A;  4I5L B;  1M39 A;  1DVI A;  2CXJ A;  5KU1 A;  4UPG A;  3GK2 A;  5B8I B;  1BT6 A;  1XO5 A;  1K9K A;  2JXC A;  1OE9 B;  2OPO A;  1CKK A;  1SCM C;  1AUI B;  5DKN A;  1SNL A;  4MRY A;  1TNQ A;  3DVE A;  2KI4 B;  2KYC A;  2ZN9 A;  1S36 A;  2KQ6 A;  1DTL A;  1OMR A;  1Y1A A;  4I5K A;  1J7Q A;  1CDL A;  1QIW A;  2ZN8 A;  1ZMZ A;  4C0K A;  1WY9 A;  2HF5 A;  2CCM A;  1L2O C;  3EK7 A;  3WNX B;  5HYD A;  2LUX A;  2GGM A;  5G08 A;  3LLE A;  1JFJ A;  1H4B A;  1NX2 A;  2GV5 A;  3E3R A;  3I5F B;  5AEQ A;  1G4Y R;  2LAP A;  2Y5I A;  5TNC A;  2LVV A;  1F55 A;  2LE9 B;  1Y6W A;  3VRP A;  3NSK A;  2KAV A;  4MZL A;  1K8U A;  1NYA A;  4CPV A;  1A75 B;  4FTG A;  1Y1U A;  4MBE A;  4GPL B;  2KAY A;  1UHN A;  2K7B A;  2G2B A;  1QTX A;  3DVJ A;  3RLZ A;  4YI9 A;  3ZNI A;  5I2Q A;  3OB2 B;  1B7T Z;  1N0Y A;  1FPW A;  2RGI A;  2LHL A;  3PN7 B;  1W7I B;  1KK8 C;  1RJV A;  1C07 A;  1R2U A;  1DGU A;  4JWQ A;  3KF9 A;  3C1V A;  5D69 A;  1LIN A;  2FCE A;  4ETO A;  1J1E A;  2JT0 A;  3AAJ A;  4CLN A;  1J7P A;  4BY4 A;  1CLB A;  4P5O E;  2H61 A;  3SG7 A;  4HRG A;  2K2F A;  4GUK A;  3SIB A;  1CFD A;  3ZWH A;  3ICB A;  4WRI A;  1K2H A;  4P2Y B;  1BMO A;  3CR2 A;  1DJY A;  2L98 A;  4TNC A;  1PSR A;  1S26 D;  2KI6 C;  2QAC A;  3O6B A;  1IWQ A;  1A29 A;  1R6P A;  2GGZ A;  2JTZ A;  2ZKM X;  2LM5 A;  2ZND A;  4GGN A;  4PHK A;  1DMO A;  3I5H C;  2OTG C;  4HRH A;  1KQM C;  4GBA A;  1QV0 A;  4MN0 A;  1BJF A;  4MSP A;  1M45 A;  1N65 A;  3BUX B;  3EKH A;  4AOM A;  1IGV A;  2P6B B;  3WHU B;  2JUL A;  2WOR A;  1PSB A;  1KQV A;  1UP5 A;  1OZO A;  2IS9 A;  2JT8 A;  2L4H A;  4MLW A;  1DGV A;  4OV2 A;  1ZFS A;  5CSN A;  1SMG A;  2KI4 C;  1CFF A;  1YVL A;  2DOQ A;  1CMG A;  1OQP A;  1TTX A;  1L2O B;  4N5X A;  2L51 A;  1AK8 A;  1KK7 Z;  3JTD C;  2O5G A;  5PAL A;  4PE0 A;  2D8N A;  2KGB C;  1TNP A;  3VGO A;  1RTP 1;  1SL7 A;  3OP0 A;  5CPV A;  3I5F C;  4OR9 B;  2PRU A;  3NSO A;  2BKI B;  1F54 A;  2JXL A;  5AFP A;  3MSE B;  2EHB A;  1ZUZ A;  3OHM B;  3SIA A;  1YVH A;  1WDC C;  3D0Y A;  1BG1 A;  2ZRT A;  5J3X A;  2L0P A;  2L2E A;  1XFZ O;  1PVA A;  4PE4 A;  5HKZ A;  2BEC A;  1F4O A;  4DIR A;  1QS7 A;  1YUT A;  4DCK A;  4DS7 A;  2LVI A;  4N1F A;  5K89 A;  1Y1X A;  1A2X A;  3PN7 C;  1MXE A;  3PAT A;  3RM1 A;  1DF0 B;  1PRW A;  1SL9 A;  3TDZ A;  1KCY A;  1J1D A;  3KHE A;  3WHT B;  5HKY A;  3TDU A;  1LA0 A;  4GGF C;  5D7F A;  1A4P A;  1QAT A;  1BOC A;  1NUB A;  4OVN F;  4BY5 A;  1B7T Y;  3BQ3 A;  4HRE E;  4WQ2 A;  5HLV A;  5AAN A;  1SW8 A;  2KAX A;  2LUC A;  1AJ4 A;  3I5H B;  3I5I C;  1J55 A;  1G33 A;  1IJ5 A;  1F4Q A;  4NDC A;  3KO0 A;  2M3W A;  1KQM B;  2KFG A;  2KI6 D; 
#chains in the Genus database with same CATH topology
 2BE6 A;  3TZ1 A;  2KOT A;  4MZJ A;  3QRX A;  2Q4U A;  2LMU A;  4M2O A;  1FF1 A;  1J7R A;  3HX4 A;  3GK4 X;  1SR6 B;  5AER A;  2BBN A;  2M29 A;  1GGW A;  1EL4 A;  2P71 A;  1JWD A;  2BKH B;  5FYX A;  1G8I A;  5CSF A;  3F45 A;  1DJG A;  2KHN A;  2EC6 B;  1K93 D;  2CT9 A;  3EVR A;  2I18 A;  3BFH A;  2JPT A;  5HL1 A;  3D76 A;  3A4U B;  1QX5 B;  4NDD A;  1IIO A;  2AMI A;  3GOF A;  4ORB B;  4YGE B;  2KNE A;  3CZ0 A;  1K90 D;  3CZ1 A;  1XFW O;  2JU0 A;  1XFR A;  3CAB A;  2O60 A;  2AUC A;  3JTD B;  3PM2 A;  3S0G A;  1EJ3 A;  1GGZ A;  2LAN A;  3D77 A;  1A75 A;  3CLN A;  2K8M B;  2WCJ A;  3KPX A;  2L4I A;  1LXF C;  4MEW A;  3TS5 B;  1BLQ A;  1M63 B;  1NX1 A;  1SRA A;  4IL1 A;  3SJS A;  2KBI A;  2L5Y A;  4QJ3 B;  2KGR A;  1WDC B;  4YGB B;  5I2L A;  1ALW A;  3CDN A;  5I94 A;  1A03 A;  4C0J A;  4MVF A;  1IG5 A;  1KFU S;  1CM1 A;  1SSE B;  1ALV A;  2FOT A;  2MAZ A;  1X02 A;  3IQO A;  1MQ1 A;  1KK7 Y;  3AKA A;  4GGF A;  3PJI A;  1JBA A;  2LC5 A;  1BR1 B;  3EKJ A;  3FE8 A;  3BYA A;  1QAS A;  1QX7 A;  2PSR A;  2NCO A;  1CTR A;  2Y1N A;  3V2L A;  1NIW A;  4YI8 A;  1TNW A;  3CYZ A;  3LK0 A;  1CDM A;  2KBM A;  3CR4 X;  1IH0 A;  2PYQ A;  1DJH A;  5ER4 X;  1AHR A;  1KFX L;  3B88 A;  4D1E A;  3DVM A;  4YRU A;  2KSP A;  2ISD A;  3I5I B;  1CFC A;  1BR4 B;  1NCZ A;  2LV7 A;  3EK4 A;  1B8C A;  4PE1 A;  3O2P A;  1WLZ A;  2K7C A;  1B1G A;  1K9U A;  1Z2C B;  2ZNE A;  2ZRS A;  1S5G Z;  1F71 A;  2CBL A;  2QEO A;  1YUU A;  1J7O A;  1B9A A;  1GJY A;  1EXR A;  1FI5 A;  4HSZ A;  3CWG A;  3FWB A;  3Q8I A;  4JQ0 D;  1CFP A;  3EVU A;  3L4L A;  1WRK A;  1SR6 C;  1IJ6 A;  3VRQ A;  1NP8 A;  1QWV A;  4ZCV A;  2K7D A;  1XK4 C;  1TOP A;  2Y1M A;  2I7A A;  1KSO A;  3D73 A;  2EC6 C;  1UUS A;  3D10 A;  1UHJ A;  3KEV A;  1K96 A;  2QPT A;  1XFV O;  2M7N A;  3N7H A;  1JC2 A;  2NCP A;  2L2C A;  4N1G A;  2OS8 C;  3D75 A;  4CFQ A;  1QJT A;  3UNW A;  1VRK A;  1FBV A;  4GAO A;  1K9P A;  1OOI X;  1TN4 A;  4GFT A;  4A4C A;  1B47 A;  1XYD A;  5EL2 A;  1QLK A;  1MXL C;  1SY9 A;  5DKR A;  5FI6 A;  3S0B A;  4MRX A;  3LL8 B;  1Y0V H;  2BL0 C;  2WCH A;  1XFX O;  3HCM A;  2WCF A;  3TS5 C;  1HT9 A;  2M9G A;  1TWO A;  1JFK A;  4JKT A;  3OB1 B;  3PFV A;  2K0J A;  2Q91 A;  2M1K B;  4L9M A;  5DIC A;  4PHJ A;  1DF0 A;  3R1P A;  1GQM A;  2F3Y A;  3VB1 A;  2QEB A;  2MBX A;  1AP4 A;  2WCB A;  4ICB A;  5JOL A;  1NCX A;  2LMV A;  2KFH A;  1YX8 A;  4CFR A;  3JVT B;  2K61 A;  3BFA A;  5ER5 A;  1XFU O;  3DZT A;  1LA3 A;  4AQJ A;  1AVS A;  1B4C A;  3OX6 A;  1MHO A;  5CSI A;  1RRO A;  3EK8 A;  3IQQ A;  3TUY B;  2LP3 A;  3SG4 A;  4QJ5 B;  4NDB A;  2K7O A;  2MRD A;  1S1E A;  2JWW A;  4PHM A;  3EVV A;  1TCF A;  1JUO A;  2F8P A;  2M7L A;  1MR8 A;  2PAL A;  1S3P A;  1XK4 A;  2EGD A;  2P70 A;  2MJW B;  2G9B A;  1CM4 A;  5HLO A;  1SBJ A;  4E68 A;  3FWC A;  2LLS A;  2JC2 A;  1DJW A;  2WCK A;  4XJK B;  1SCV A;  3FE9 A;  4GNK B;  4CID A;  4AQI A;  3L47 A;  1SK6 D;  5BPJ A;  5KSZ A;  2MHH A;  4DRW A;  2BCA A;  3SG5 A;  1TCO B;  1KWO B;  3GK1 A;  4JPZ B;  4PDZ A;  4PE7 A;  1U5I B;  1CDP A;  3LCP C;  3DF0 B;  1ODB A;  1EH2 A;  4A4B A;  3BOW B;  2OS8 B;  3AAK A;  1KSM A;  3R1O A;  1XFY O;  4U8D A;  5I2O A;  3CGA A;  1S5G Y;  1JF2 A;  1PUL A;  3OX5 A;  1IRJ A;  2FJU B;  2LHI A;  3B86 A;  2WC5 A;  2PMY A;  3D74 A;  2H61 C;  1N2D A;  1QVI Z;  3NGV A;  2HET A;  3NHI A;  3PAL A;  2TN4 A;  2NLN A;  3BUO B;  3O4X A;  2BL0 B;  4QJ4 B;  1B8R A;  2I94 A;  1QLS A;  1JF0 A;  3I5G C;  2F2P A;  2QEV A;  1AJ5 A;  2WOS A;  4OCI A;  1V1F A;  1YUR A;  1MUX A;  2M49 B;  3R1V A;  2KQY A;  4I5J A;  1OMV A;  3VRN A;  1B8L A;  1YRU B;  2H2K A;  3L4A A;  2CTN A;  5CSJ A;  3VRR A;  2L50 A;  1C7V A;  2R2I A;  1DT7 B;  1PK0 D;  3DVK A;  4NQG A;  1S6J A;  4INW A;  2HQW A;  3CTN A;  1CLM A;  1OOF A;  2KFF A;  3FIA A;  3M0W A;  2MLE C;  2JPO A;  4YBH B;  1F8H A;  1WLM A;  4FQT A;  1YUS A;  2LLT A;  2Y4Q A;  2JZI A;  1QIV A;  1M31 A;  3CZ2 A;  1QX2 A;  4WQ3 A;  3SG3 A;  1K95 A;  1UUR A;  1GM0 A;  1SL8 A;  1CB1 A;  3JVT C;  3OGN A;  2B1U A;  3NXA A;  4ORC B;  3WXA A;  1WRZ A;  2ZFD A;  2KLD A;  1FW4 A;  1BU3 A;  5GQQ C;  2BNX A;  4PAL A;  2M8U A;  1XA5 A;  1TIZ A;  2BCB A;  5AXI A;  3TUY C;  3SS3 A;  1C7W A;  2JQ6 A;  2PVB A;  1OMD A;  1UHI A;  3PM8 A;  1PAL A;  2NZ0 A;  3IF7 A;  1HQV A;  2LLU A;  2WCL A;  1IQ5 A;  2HPS A;  1Z4H A;  2JNF A;  1XVJ A;  3DYE A;  2HQ8 A;  3O78 A;  3S0E A;  5IBW A;  3NSI A;  5HKW A;  1OOH A;  1H8B A;  1E8A A;  1YRT B;  2M97 A;  2MA2 A;  3K1E A;  2WC8 A;  2BCX A;  5DKQ A;  4C0L A;  2LP2 A;  1OOG A;  3FE6 A;  4PCW A;  4YGA A;  1BF5 A;  3BUN B;  3PLF B;  4Q04 A;  2SAS A;  1KWO C;  1QXP A;  1UWO A;  2JT3 A;  2MLF C;  1CDN A;  3TDI A;  3VRO A;  3BFB A;  5I8N A;  2ERB A;  1FI6 A;  3QME A;  1UHK A;  3BUW B;  3PSR A;  1NCY A;  3K21 A;  1TRF A;  2WC6 A;  4OKH A;  2I2R E;  2K2A A;  3I5G B;  4FQO A;  4USL A;  1QV1 A;  1V1G A;  1MWN A;  3DD4 A;  1REC A;  3DXL A;  4ZCU A;  1SCM B;  2E30 A;  2KPH A;  2LCP A;  1Q80 A;  3AKB A;  4M2Q A;  4XYN A;  2FJY A;  3UO9 A;  1NX0 A;  2BE4 A;  4ORA B;  5F6T A;  1EG3 A;  2F3Z A;  4M2P A;  3O4Y A;  2JTT A;  2KDH A;  1NSH A;  4DUQ A;  1ZOT B;  2JNX A;  2WND A;  1SYM A;  1M46 A;  3BJH A;  1QVI Y;  1RFJ A;  1WRL A;  3S0F A;  4MZK A;  1RWY A;  1YR5 A;  2FCD A;  3H4S E;  1MF8 B;  1W7J B;  1JSA A;  5JJG A;  2F2O A;  2YGU A;  2VRG A;  2CNP A;  3CZT X;  1YTZ C;  2M0R A;  3CR5 X;  1KFX S;  2V53 A;  2WCE A;  2BBM A;  1NWD A;  1OOJ A;  1TUJ A;  1IQ3 A;  1F70 A;  5KTY A;  3S0A A;  2COL B;  1DJX A;  4I5N B;  2LNK A;  1D1O A;  1L7Z A;  1LKJ A;  4XJK A;  5FI2 A;  3BUM B;  3CS1 A;  2AAO A;  1KK8 B;  1UHH A;  1NPQ A;  1OZS A;  2F33 A;  3A8R A;  3SG6 A;  1KFU L;  1NX3 A;  2A4J A;  2SCP A;  1LVC D;  3BXK A;  1CMF A;  3D0Y B;  1S6I A;  1CNP A;  2PAS A;  4F0Z B;  3FS7 A;  1K94 A;  1RK9 A;  1U5I A;  2KYF A;  3DF0 A;  3R72 A;  2JOJ A;  3SG2 A;  1DC1 A;  2L5X B;  1SKT A;  2LMT A;  3BOW A;  3D78 A;  3NSL A;  2JRF A;  1IKU A;  4KYN A;  1OSA A;  1YX7 A;  1ZAC A;  4YGC B;  3B7A A;  4PHN A;  1SPY A;  2M1U A;  2E6W A;  1CLL A;  1DEL A;  1PVB A;  1TNX A;  3B6X A;  1S6C A;  1DJZ A;  1EG4 A;  2NXQ A;  4R1E A;  2LVK A;  1DJI A;  1BOD A;  2OTG B;  3LK1 A;  2LVJ A;  4I5L B;  1M39 A;  1DVI A;  2BAP A;  2CXJ A;  5KU1 A;  4UPG A;  1OW4 A;  3GK2 A;  5B8I B;  1BT6 A;  1XO5 A;  1C3Z A;  1K9K A;  2JXC A;  3S0D A;  1OE9 B;  2OPO A;  1CKK A;  1SCM C;  2K60 A;  1AUI B;  5DKN A;  1SNL A;  4MRY A;  1TNQ A;  3DVE A;  2KI4 B;  2KYC A;  2ZN9 A;  1S36 A;  2KQ6 A;  1DTL A;  4IJ7 A;  1DQE A;  1OMR A;  1Y1A A;  4F7F A;  2QEH A;  4I5K A;  1CDL A;  1J7Q A;  2PQL A;  1QIW A;  2ZN8 A;  1ZMZ A;  3EG5 B;  1WY9 A;  4C0K A;  2HF5 A;  2CCM A;  1L2O C;  3EK7 A;  3WNX B;  5HYD A;  2LUX A;  2GGM A;  5G08 A;  3LLE A;  3RZS A;  1JFJ A;  1H4B A;  1NX2 A;  2GV5 A;  3E3R A;  3I5F B;  5AEQ A;  1G4Y R;  2LAP A;  2Y5I A;  5TNC A;  2LVV A;  1F55 A;  2LE9 B;  1Y6W A;  3VRP A;  2WCM A;  3NSK A;  2KAV A;  4MZL A;  1K8U A;  1NYA A;  1P28 A;  1A75 B;  4FTG A;  4CPV A;  1Y1U A;  4MBE A;  4GPL B;  2KAY A;  1UHN A;  2K7B A;  2G2B A;  1QTX A;  3DVJ A;  3RLZ A;  4YI9 A;  3ZNI A;  5I2Q A;  4PT1 A;  3OB2 B;  1B7T Z;  1N0Y A;  1LS8 A;  1FPW A;  2RGI A;  2LHL A;  3PN7 B;  1W7I B;  1KK8 C;  1RJV A;  1C07 A;  1R2U A;  1DGU A;  4JWQ A;  3KF9 A;  3C1V A;  5D69 A;  1LIN A;  2FCE A;  2H8V A;  3B87 A;  3OBV A;  1J1E A;  4ETO A;  2JT0 A;  3AAJ A;  4YGD B;  4CLN A;  2QDI A;  5FI7 A;  1J7P A;  4JD9 A;  4BY4 A;  1CLB A;  4P5O E;  2H61 A;  3SG7 A;  4HRG A;  2K2F A;  4GUK A;  2KLE A;  3SIB A;  1CFD A;  3ZWH A;  3ICB A;  4WRI A;  1K2H A;  4P2Y B;  1BMO A;  3CR2 A;  1DJY A;  2L98 A;  4TNC A;  1PSR A;  1S26 D;  2KI6 C;  2QAC A;  3O6B A;  1IWQ A;  1A29 A;  1DEK A;  1R6P A;  2GGZ A;  2JTZ A;  2ZKM X;  4INX A;  2LM5 A;  2ZND A;  4GGN A;  4PHK A;  1DMO A;  3I5H C;  2OTG C;  4HRH A;  1KQM C;  4GBA A;  1QV0 A;  4MN0 A;  1BJF A;  4MSP A;  1M45 A;  1N65 A;  3NHT A;  3BUX B;  3EKH A;  4AOM A;  1IGV A;  2P6B B;  3WHU B;  2JUL A;  2WOR A;  1PSB A;  1KQV A;  1UP5 A;  1OZO A;  2IS9 A;  2JT8 A;  2L4H A;  4MLW A;  1DGV A;  4OV2 A;  1ZFS A;  4OZD A;  1SMG A;  2KI4 C;  5CSN A;  1CFF A;  3IVT A;  1YVL A;  2DOQ A;  1CMG A;  1OQP A;  1TTX A;  1L2O B;  1ORG A;  4N5X A;  2L51 A;  1AK8 A;  5D3O A;  1KK7 Z;  3JTD C;  2O5G A;  5PAL A;  4PE0 A;  2D8N A;  2KGB C;  1TNP A;  3VGO A;  1RTP 1;  1SL7 A;  3OP0 A;  1T14 A;  5CPV A;  3I5F C;  4OR9 B;  2PRU A;  3NSO A;  2BKI B;  1F54 A;  2JXL A;  2GTE A;  3DY9 A;  5AFP A;  3MSE B;  2EHB A;  1ZUZ A;  3OHM B;  3SIA A;  1YVH A;  1WDC C;  3D0Y A;  3SS4 A;  2ZRT A;  1BG1 A;  5J3X A;  2L0P A;  2L2E A;  1XFZ O;  1PVA A;  4PE4 A;  5HKZ A;  2BEC A;  1F4O A;  4DIR A;  1QS7 A;  1YUT A;  4DCK A;  4DS7 A;  2LVI A;  4N1F A;  5K89 A;  1Y1X A;  3SS5 A;  1A2X A;  3PN7 C;  1MXE A;  3PAT A;  3RM1 A;  1DF0 B;  1PRW A;  1SL9 A;  3TDZ A;  1KCY A;  1J1D A;  3KHE A;  3WHT B;  5HKY A;  3TDU A;  1LA0 A;  4GGF C;  5D7F A;  1A4P A;  1QAT A;  1BOC A;  1NUB A;  4OVN F;  4BY5 A;  1B7T Y;  3BQ3 A;  1TUZ A;  4HRE E;  4WQ2 A;  5HLV A;  5AAN A;  1SW8 A;  2KAX A;  2LUC A;  1AJ4 A;  3I5H B;  3I5I C;  1J55 A;  1G33 A;  1IJ5 A;  1F4Q A;  4NDC A;  1W9Z A;  3KO0 A;  1C3Y A;  2M3W A;  1KQM B;  2KFG A;  2KI6 D; 
#chains in the Genus database with same CATH homology
 2BE6 A;  3TZ1 A;  2KOT A;  4MZJ A;  3QRX A;  2Q4U A;  2LMU A;  4M2O A;  1FF1 A;  1J7R A;  3HX4 A;  3GK4 X;  1SR6 B;  5AER A;  2BBN A;  2M29 A;  1GGW A;  1EL4 A;  1JWD A;  2BKH B;  5FYX A;  1G8I A;  5CSF A;  3F45 A;  1DJG A;  2KHN A;  2EC6 B;  1K93 D;  2CT9 A;  3EVR A;  2I18 A;  2JPT A;  3A4U B;  1QX5 B;  4NDD A;  2AMI A;  3GOF A;  4ORB B;  4YGE B;  2KNE A;  1K90 D;  3JTD B;  1XFW O;  2JU0 A;  2O60 A;  2AUC A;  1EJ3 A;  1GGZ A;  2LAN A;  3KPX A;  1A75 A;  3CLN A;  2K8M B;  3TS5 B;  2L4I A;  1LXF C;  4MEW A;  1BLQ A;  1M63 B;  1NX1 A;  1SRA A;  4IL1 A;  3SJS A;  2KBI A;  4QJ3 B;  2KGR A;  1WDC B;  4YGB B;  5I2L A;  1ALW A;  1A03 A;  4C0J A;  4MVF A;  1IG5 A;  1KFU S;  1CM1 A;  1ALV A;  2FOT A;  2MAZ A;  1X02 A;  3IQO A;  1MQ1 A;  1KK7 Y;  3AKA A;  4GGF A;  1JBA A;  2LC5 A;  1BR1 B;  3EKJ A;  3BYA A;  1QAS A;  1QX7 A;  2PSR A;  2NCO A;  1CTR A;  2Y1N A;  1NIW A;  4YI8 A;  1TNW A;  3LK0 A;  1CDM A;  2KBM A;  3CR4 X;  1IH0 A;  1DJH A;  5ER4 X;  1AHR A;  1KFX L;  4D1E A;  3DVM A;  4YRU A;  2KSP A;  2ISD A;  3I5I B;  1CFC A;  1BR4 B;  1NCZ A;  2LV7 A;  3EK4 A;  1B8C A;  4PE1 A;  3O2P A;  1WLZ A;  2K7C A;  1B1G A;  1K9U A;  2ZNE A;  2ZRS A;  1S5G Z;  1F71 A;  2CBL A;  1YUU A;  1J7O A;  1B9A A;  1GJY A;  1EXR A;  1FI5 A;  4HSZ A;  3CWG A;  3FWB A;  4JQ0 D;  1CFP A;  3EVU A;  1WRK A;  1SR6 C;  1IJ6 A;  3VRQ A;  1NP8 A;  4ZCV A;  2K7D A;  1XK4 C;  1TOP A;  2Y1M A;  2I7A A;  1KSO A;  2EC6 C;  1UUS A;  3D10 A;  1UHJ A;  3KEV A;  1K96 A;  2QPT A;  1XFV O;  2M7N A;  1JC2 A;  2NCP A;  4N1G A;  2OS8 C;  4CFQ A;  1QJT A;  1VRK A;  1FBV A;  4GAO A;  1K9P A;  1TN4 A;  4GFT A;  4A4C A;  1B47 A;  1XYD A;  1QLK A;  1MXL C;  1SY9 A;  5DKR A;  4MRX A;  3LL8 B;  1Y0V H;  2BL0 C;  1XFX O;  3HCM A;  2WCF A;  3TS5 C;  1HT9 A;  2M9G A;  1JFK A;  3OB1 B;  3PFV A;  2K0J A;  2Q91 A;  2M1K B;  4L9M A;  4PHJ A;  1DF0 A;  1GQM A;  2F3Y A;  1AP4 A;  2MBX A;  2WCB A;  4ICB A;  5JOL A;  1NCX A;  2LMV A;  2KFH A;  1YX8 A;  4CFR A;  3JVT B;  2K61 A;  5ER5 A;  1XFU O;  1LA3 A;  4AQJ A;  1AVS A;  1B4C A;  3OX6 A;  1MHO A;  5CSI A;  1RRO A;  3EK8 A;  3IQQ A;  3TUY B;  2LP3 A;  3SG4 A;  4QJ5 B;  4NDB A;  2K7O A;  2MRD A;  1S1E A;  2JWW A;  4PHM A;  3EVV A;  1TCF A;  1JUO A;  2F8P A;  2M7L A;  1MR8 A;  2PAL A;  1S3P A;  1XK4 A;  2EGD A;  5HLO A;  2MJW B;  2G9B A;  1CM4 A;  4E68 A;  1SBJ A;  3FWC A;  2LLS A;  2JC2 A;  1DJW A;  4XJK B;  1SCV A;  4GNK B;  4CID A;  4AQI A;  1SK6 D;  5BPJ A;  5KSZ A;  2MHH A;  4DRW A;  2BCA A;  3SG5 A;  1TCO B;  1KWO B;  3GK1 A;  4JPZ B;  4PDZ A;  4PE7 A;  1U5I B;  1CDP A;  3LCP C;  3DF0 B;  1ODB A;  1EH2 A;  4A4B A;  3BOW B;  2OS8 B;  3AAK A;  1KSM A;  4U8D A;  1XFY O;  5I2O A;  3CGA A;  1S5G Y;  1JF2 A;  1PUL A;  3OX5 A;  1IRJ A;  2FJU B;  2LHI A;  2PMY A;  2H61 C;  1N2D A;  1QVI Z;  3PAL A;  2HET A;  2TN4 A;  2NLN A;  3BUO B;  2BL0 B;  4QJ4 B;  1B8R A;  2I94 A;  1QLS A;  1JF0 A;  3I5G C;  2F2P A;  1AJ5 A;  2WOS A;  4OCI A;  1V1F A;  1YUR A;  1MUX A;  2M49 B;  4I5J A;  2KQY A;  1OMV A;  3VRN A;  1B8L A;  1YRU B;  2H2K A;  3VRR A;  2CTN A;  5CSJ A;  1C7V A;  2L50 A;  2R2I A;  1DT7 B;  1PK0 D;  3DVK A;  4NQG A;  1S6J A;  2HQW A;  3CTN A;  1CLM A;  2KFF A;  3M0W A;  3FIA A;  4YBH B;  2MLE C;  1F8H A;  1WLM A;  1YUS A;  2LLT A;  2Y4Q A;  2JZI A;  1QIV A;  1M31 A;  4WQ3 A;  1QX2 A;  3SG3 A;  1K95 A;  1UUR A;  1SL8 A;  1CB1 A;  3JVT C;  2B1U A;  3NXA A;  4ORC B;  3WXA A;  1WRZ A;  2ZFD A;  1FW4 A;  1BU3 A;  5GQQ C;  4PAL A;  2M8U A;  1XA5 A;  1TIZ A;  2BCB A;  5AXI A;  3TUY C;  1C7W A;  2JQ6 A;  2PVB A;  1OMD A;  1UHI A;  3PM8 A;  1PAL A;  2NZ0 A;  3IF7 A;  1HQV A;  2LLU A;  1IQ5 A;  2HPS A;  3O78 A;  2JNF A;  1XVJ A;  5IBW A;  2HQ8 A;  1H8B A;  3NSI A;  5HKW A;  1E8A A;  1YRT B;  2M97 A;  2MA2 A;  2WC8 A;  2BCX A;  5DKQ A;  4C0L A;  2LP2 A;  4PCW A;  4YGA A;  1BF5 A;  3BUN B;  3PLF B;  4Q04 A;  2SAS A;  1KWO C;  1QXP A;  1UWO A;  2JT3 A;  2MLF C;  1CDN A;  3TDI A;  3VRO A;  5I8N A;  1FI6 A;  1UHK A;  3BUW B;  3PSR A;  1NCY A;  3K21 A;  1TRF A;  4OKH A;  4USL A;  2I2R E;  2K2A A;  3I5G B;  4FQO A;  4YGD B;  1QV1 A;  1V1G A;  1MWN A;  3DD4 A;  1REC A;  4ZCU A;  1SCM B;  2E30 A;  3AKB A;  2LCP A;  1Q80 A;  4M2Q A;  4XYN A;  1NX0 A;  2BE4 A;  4ORA B;  5F6T A;  1EG3 A;  2F3Z A;  4M2P A;  3O4Y A;  2JTT A;  2KDH A;  1NSH A;  4DUQ A;  1ZOT B;  2JNX A;  2WND A;  1SYM A;  1M46 A;  1QVI Y;  1RFJ A;  1WRL A;  4MZK A;  1RWY A;  1YR5 A;  2FCD A;  3H4S E;  1MF8 B;  1W7J B;  1JSA A;  5JJG A;  2F2O A;  2VRG A;  2CNP A;  3CZT X;  1YTZ C;  2M0R A;  3CR5 X;  1KFX S;  2V53 A;  2WCE A;  2BBM A;  1NWD A;  1OOJ A;  1IQ3 A;  1F70 A;  5KTY A;  2COL B;  1DJX A;  4I5N B;  2LNK A;  1D1O A;  1L7Z A;  1LKJ A;  4XJK A;  3BUM B;  3CS1 A;  2AAO A;  1KK8 B;  1UHH A;  1NPQ A;  1OZS A;  2F33 A;  3A8R A;  3SG6 A;  1KFU L;  1NX3 A;  2A4J A;  2SCP A;  1LVC D;  3BXK A;  1CMF A;  3D0Y B;  1S6I A;  1CNP A;  2PAS A;  4F0Z B;  3FS7 A;  1K94 A;  1RK9 A;  1U5I A;  2KYF A;  3DF0 A;  3SG2 A;  2JOJ A;  2L5X B;  1SKT A;  2LMT A;  3BOW A;  3NSL A;  2JRF A;  1IKU A;  1OSA A;  1YX7 A;  1ZAC A;  4YGC B;  4PHN A;  1SPY A;  2M1U A;  2E6W A;  1CLL A;  1PVB A;  1TNX A;  1S6C A;  1DJZ A;  1EG4 A;  2NXQ A;  4R1E A;  2LVK A;  1DJI A;  1BOD A;  2OTG B;  3LK1 A;  2LVJ A;  4I5L B;  1M39 A;  1DVI A;  2CXJ A;  5KU1 A;  4UPG A;  3GK2 A;  5B8I B;  1BT6 A;  1XO5 A;  1K9K A;  2JXC A;  1OE9 B;  2OPO A;  1CKK A;  1SCM C;  1AUI B;  5DKN A;  1SNL A;  4MRY A;  1TNQ A;  3DVE A;  2KI4 B;  2KYC A;  2ZN9 A;  1S36 A;  2KQ6 A;  1DTL A;  1OMR A;  1Y1A A;  4I5K A;  1J7Q A;  1CDL A;  1QIW A;  2ZN8 A;  1ZMZ A;  4C0K A;  1WY9 A;  2HF5 A;  2CCM A;  1L2O C;  3EK7 A;  3WNX B;  5HYD A;  2LUX A;  2GGM A;  5G08 A;  3LLE A;  1JFJ A;  1H4B A;  1NX2 A;  2GV5 A;  3E3R A;  3I5F B;  5AEQ A;  1G4Y R;  2LAP A;  2Y5I A;  5TNC A;  2LVV A;  1F55 A;  2LE9 B;  1Y6W A;  3VRP A;  3NSK A;  2KAV A;  4MZL A;  1K8U A;  1NYA A;  4CPV A;  1A75 B;  4FTG A;  1Y1U A;  4MBE A;  4GPL B;  2KAY A;  1UHN A;  2K7B A;  2G2B A;  1QTX A;  3DVJ A;  3RLZ A;  4YI9 A;  3ZNI A;  5I2Q A;  3OB2 B;  1B7T Z;  1N0Y A;  1FPW A;  2RGI A;  2LHL A;  3PN7 B;  1W7I B;  1KK8 C;  1RJV A;  1C07 A;  1R2U A;  1DGU A;  4JWQ A;  3KF9 A;  3C1V A;  5D69 A;  1LIN A;  2FCE A;  4ETO A;  1J1E A;  2JT0 A;  3AAJ A;  4CLN A;  1J7P A;  4BY4 A;  1CLB A;  4P5O E;  2H61 A;  3SG7 A;  4HRG A;  2K2F A;  4GUK A;  3SIB A;  1CFD A;  3ZWH A;  3ICB A;  4WRI A;  1K2H A;  4P2Y B;  1BMO A;  3CR2 A;  1DJY A;  2L98 A;  4TNC A;  1PSR A;  1S26 D;  2KI6 C;  2QAC A;  3O6B A;  1IWQ A;  1A29 A;  1R6P A;  2GGZ A;  2JTZ A;  2ZKM X;  2LM5 A;  2ZND A;  4GGN A;  4PHK A;  1DMO A;  3I5H C;  2OTG C;  4HRH A;  1KQM C;  4GBA A;  1QV0 A;  4MN0 A;  1BJF A;  4MSP A;  1M45 A;  1N65 A;  3BUX B;  3EKH A;  4AOM A;  1IGV A;  2P6B B;  3WHU B;  2JUL A;  2WOR A;  1PSB A;  1KQV A;  1UP5 A;  1OZO A;  2IS9 A;  2JT8 A;  2L4H A;  4MLW A;  1DGV A;  4OV2 A;  1ZFS A;  5CSN A;  1SMG A;  2KI4 C;  1CFF A;  1YVL A;  2DOQ A;  1CMG A;  1OQP A;  1TTX A;  1L2O B;  4N5X A;  2L51 A;  1AK8 A;  1KK7 Z;  3JTD C;  2O5G A;  5PAL A;  4PE0 A;  2D8N A;  2KGB C;  1TNP A;  3VGO A;  1RTP 1;  1SL7 A;  3OP0 A;  5CPV A;  3I5F C;  4OR9 B;  2PRU A;  3NSO A;  2BKI B;  1F54 A;  2JXL A;  5AFP A;  3MSE B;  2EHB A;  1ZUZ A;  3OHM B;  3SIA A;  1YVH A;  1WDC C;  3D0Y A;  1BG1 A;  2ZRT A;  5J3X A;  2L0P A;  2L2E A;  1XFZ O;  1PVA A;  4PE4 A;  5HKZ A;  2BEC A;  1F4O A;  4DIR A;  1QS7 A;  1YUT A;  4DCK A;  4DS7 A;  2LVI A;  4N1F A;  5K89 A;  1Y1X A;  1A2X A;  3PN7 C;  1MXE A;  3PAT A;  3RM1 A;  1DF0 B;  1PRW A;  1SL9 A;  3TDZ A;  1KCY A;  1J1D A;  3KHE A;  3WHT B;  5HKY A;  3TDU A;  1LA0 A;  4GGF C;  5D7F A;  1A4P A;  1QAT A;  1BOC A;  1NUB A;  4OVN F;  4BY5 A;  1B7T Y;  3BQ3 A;  4HRE E;  4WQ2 A;  5HLV A;  5AAN A;  1SW8 A;  2KAX A;  2LUC A;  1AJ4 A;  3I5H B;  3I5I C;  1J55 A;  1G33 A;  1IJ5 A;  1F4Q A;  4NDC A;  3KO0 A;  2M3W A;  1KQM B;  2KFG A;  2KI6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...