4DUQA

The structure of ca2+-loaded s100a2 at 1.3a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
88
Chain Sequence
SSSLEQALAVLVTTFHKYSSQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMSNDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A2
publication title The structure of Ca2+-loaded S100A2 at 1.3- angstrom resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4duqA00
3OHMB 4CIDA 4ETOA 1G4YR 3BOWB 1Y1UA 1OMRA 3SIAA 2ZKMX 4L9MA 1NCXA 1AJ4A 2LHIA 3JTDC 2A4JA 4NDDA 3TDUA 1YVLA 3OB1B 2M0RA 2ZN8A 2M9GA 1UHJA 1L2OB 4MZJA 4GBAA 1RFJA 2KAXA 1KK7Y 3AKBA 1NP8A 2KGRA 1AUIB 2KFFA 1DJWA 1S26D 4MLWA 2MLEC 3NSOA 4PE4A 2LUCA 2M3WA 4PHKA 2BCXA 1TTXA 2CTNA 4HREE 4PALA 2NCOA 2M97A 3ZWHA 2OS8C 3I5GB 1KWOC 3C1VA 1F55A 2JRFA 1E8AA 5AERA 2Y1MA 1G33A 4ZCUA 2AAOA 3LK0A 4DS7A 4MZLA 2JQ6A 1MWNA 1SR6C 3CGAA 4PE0A 5I8NA 1QXPA 2PVBA 1BODA 1D1OA 1QASA 3PN7C 1J1EA 2LLSA 1BMOA 1TRFA 1FPWA 3BUNB 1DT7B 3FWCA 1QATA 2VRGA 4AQJA 4M2OA 5CPVA 1KK7Z 2JXLA 5ER4X 2LAPA 2K7OA 3SG4A 1ZFSA 1NX3A 1V1GA 1CDPA 2L5XB 2NLNA 1EL4A 1SL8A 1KSOA 3A8RA 3ICBA 2Y5IA 2KI4B 2MA2A 2KAVA 5DKRA 3TZ1A 4YGEB 1QX5B 1WRLA 1DJGA 4OCIA 1H4BA 1RECA 2IS9A 1QTXA 1A29A 1XK4A 2COLB 3CR5X 1BR4B 3DVKA 1JF0A 1F54A 3IQQA 1CDNA 5CSNA 1L2OC 2LE9B 1NX2A 3KF9A 1KFUS 3A4UB 4BY4A 2QACA 1PRWA 2LVKA 2E6WA 4P5OE 1YR5A 2BL0B 1WLZA 3IQOA 3LCPC 4YRUA 4XJKA 2KYFA 1ODBA 4MVFA 1IKUA 1BLQA 1JSAA 1CMGA 2WOSA 2FOTA 3IF7A 5D7FA 1RTP1 2KYCA 1LKJA 2L2EA 3M0WA 2MLFC 5IBWA 5CSJA 2LMUA 2BECA 2F2PA 3CWGA 1SL7A 3SJSA 2MAZA 3TUYB 5FYXA 3TDIA 2G2BA 2KHNA 3I5HB 4USLA 1M46A 3OX6A 3KO0A 2Q91A 2V53A 2OTGC 3EK4A 2M49B 3LLEA 3SG7A 3F45A 2L4HA 1Y1AA 5B8IB 1B7TY 1SBJA 3EVRA 2BKIB 1DJHA 1QX7A 4GUKA 1F70A 1A75A 2MHHA 1NWDA 3K21A 1OE9B 1IJ6A 3NSKA 4XYNA 1MF8B 2M29A 4DRWA 4JWQA 1UHHA 1QJTA 4N1GA 2WCFA 5TNCA 1MR8A 1EH2A 5AEQA 3OX5A 2KQYA 2OS8B 4WRIA 2PSRA 1XFXO 2KI4C 1SK6D 1S36A 1WRKA 2EHBA 1YX8A 5DKQA 2JULA 1CM1A 1DJYA 3BUMB 2KGBC 1KSMA 4A4CA 4U8DA 1UHKA 2M7LA 4DIRA 5KTYA 3NSIA 2PMYA 3BUOB 3AAKA 1BR1B 1SNLA 1DF0A 2GGZA 3DF0A 2K2FA 2LANA 4MRXA 1JBAA 5CSIA 2KDHA 1XK4C 3KEVA 3LL8B 4I5LB 1CM4A 1DF0B 1M63B 3DVJA 4N5XA 5DKNA 2JNXA 1FI6A 1B7TZ 2CBLA 1F71A 3BQ3A 3BYAA 4GGNA 1UHIA 1YX7A 3CLNA 4ZCVA 1K95A 3CR2A 4P2YB 2JOJA 1ZUZA 4MZKA 3H4SE 1JUOA 1FI5A 3EKHA 1PULA 3PATA 4BY5A 1C07A 1LA0A 1LVCD 1NPQA 1QV0A 4GNKB 3TUYC 2K7DA 2KSPA 1B1GA 4ORBB 2K61A 1TNXA 3I5HC 3WHUB 4C0LA 1DMOA 1BG1A 1CDLA 1K8UA 3EVUA 1ZACA 2ZFDA 2BKHB 1ALVA 1M39A 4GPLB 3TDZA 2KAYA 4HRGA 1CNPA 1Y6WA 2P6BB 2LLUA 2WCEA 2PRUA 3O4YA 4ORCB 3GK2A 1IWQA 1H8BA 3PFVA 2LMVA 1QIVA 3I5FB 2WORA 4QJ5B 3CR4X 4FTGA 1RWYA 3HX4A 1QX2A 1YUUA 2JT3A 5BPJA 4A4BA 1SCMB 3BUXB 1TOPA 1CFPA 1DGVA 1C7WA 3DD4A 2Y1NA 3TS5B 1JFJA 4GFTA 5I2QA 1UURA 1YUTA 3RM1A 1JC2A 3FWBA 2OTGB 1XFZO 4CFRA 5HYDA 4YGDB 3JVTC 3VROA 1XVJA 1KQVA 1KQMB 2KNEA 2O5GA 1EJ3A 4M2QA 1NX1A 2I18A 1YVHA 3DVEA 2F3ZA 2JTTA 3O6BA 1HT9A 1XYDA 4YGBB 1CB1A 1F8HA 2JWWA 3KHEA 2GGMA 2LMTA 5PALA 1WLMA 1KFUL 3RLZA 2LCPA 1A2XA 1DJIA 1IQ5A 2JT8A 2K0JA 2KFHA 3MSEB 4N1FA 1F4OA 3I5IB 1PALA 1B8RA 1B4CA 3OB2B 2GV5A 1FBVA 3NSLA 1IQ3A 1IRJA 1LA3A 1SRAA 1K90D 2LNKA 2HF5A 4YI9A 3SG3A 2CNPA 1TNWA 2JU0A 5K89A 1K96A 1DJZA 2ZRTA 1TCFA 4NDBA 2AUCA 5HLVA 3FIAA 3PSRA 4Q04A 3NXAA 2MBXA 1BT6A 4D1EA 5KU1A 1LXFC 1ZMZA 1B8LA 4DCKA 1R6PA 1SCVA 3I5FC 4XJKB 1OOJA 5ER5A 1QIWA 4I5JA 1NSHA 2NZ0A 1BJFA 1SCMC 1XFYO 2G9BA 2HQWA 2H61A 1AHRA 2FCEA 4PHNA 1CTRA 3TS5C 4JQ0D 2BBMA 1M31A 4NDCA 1OSAA 2M1UA 1K9PA 4PE1A 1A03A 1QLSA 3D0YA 4PHMA 2ISDA 1OZSA 2WNDA 1S6IA 2AMIA 2O60A 1PVAA 1KQMC 3OP0A 5D69A 1J7QA 5HKZA 1ALWA 3D0YB 5I2OA 1A75B 2LP2A 2OPOA 1K9KA 1MHOA 1YRTB 1OMDA 2CT9A 1G8IA 1SY9A 3D10A 4PHJA 5HKWA 1A4PA 4YGCB 2JC2A 5AFPA 1WY9A 4MN0A 3I5IC 2BCBA 2LV7A 1K94A 3JVTB 1WDCB 2MRDA 1X02A 2L50A 3O78A 4IL1A 4MEWA 1TNPA 2LUXA 2H2KA 2WC8A 3E3RA 3DF0B 2ZNEA 1SYMA 1TIZA 2JZIA 1S6JA 1AJ5A 1J1DA 4ICBA 4QJ3B 2F2OA 1BOCA 3SG2A 1CMFA 1MXEA 2LVJA 3GOFA 2JNFA 4PE7A 1U5IA 1R2UA 2PASA 1J55A 2BE6A 2SCPA 3GK1A 1MUXA 1KFXS 1SW8A 2M8UA 3HCMA 1DVIA 2LLTA 2QPTA 2F3YA 2ZRSA 4I5KA 1SPYA 1QLKA 1XFUO 1B47A 3VRRA 1DTLA 1TNQA 2H61C 3DVMA 5I2LA 1W7JB 5HLOA 1N65A 1AVSA 2K2AA 3EK8A 4YGAA 2KBMA 1DGUA 5HKYA 1ZOTB 2F33A 1CLMA 1K9UA 2B1UA 1BU3A 3PM8A 4R1EA 3AAJA 3EK7A 2LP3A 1QVIY 1PK0D 4NQGA 5GQQC 1J7PA 3PALA 2L98A 1IG5A 1RJVA 1UWOA 4OKHA 1NCYA 2LC5A 1B9AA 1CFCA 1FF1A 2DOQA 4I5NB 1OMVA 4HSZA 2KQ6A 2E30A 1OZOA 1AP4A 1DJXA 1UHNA 2JXCA 2LVVA 2SASA 5F6TA 1FW4A 1S6CA 1YTZC 4GGFA 1WDCC 3KPXA 2BE4A 1F4QA 1S5GY 2EGDA 3SG5A 5JOLA 1OQPA 2I94A 2Y4QA 1EG4A 1JFKA 1S3PA 3FS7A 4TNCA 3VRQA 1TN4A 1SL9A 1V1FA 1QS7A 2JPTA 1CKKA 2BCAA 3ZNIA 1YURA 1C7VA 2CCMA 1PVBA 1KK8B 1MQ1A 2EC6B 4YBHB 2RGIA 4WQ3A 1QVIZ 1Q80A 3AKAA 2L0PA 2JTZA 1Y0VH 3CZTX 4DUQA 4GAOA 1L7ZA 1SKTA 2I2RE 1J7RA 3BUWB 4MRYA 1K2HA 1EG3A 1QV1A 2K7CA 2R2IA 1GQMA 2WCBA 4C0JA 1N0YA 3BXKA 1JWDA 3QRXA 3VRPA 1S5GZ 2KOTA 2HETA 1XA5A 1KCYA 1NX0A 5J3XA 4JPZB 3WHTB 1PSBA 1B8CA 4CPVA 1NIWA 2ZN9A 2BBNA 2ZNDA 2K8MB 4FQOA 4QJ4B 5JJGA 5AXIA 4OV2A 2HQ8A 2TN4A 3SIBA 2L51A 1GGWA 1CLLA 5G08A 1W7IB 2KI6D 1NUBA 1J7OA 1IGVA 2KFGA 3CTNA 4GGFC 4PCWA 3WNXB 1XFWO 3VGOA 1CDMA 4MBEA 4UPGA 4MSPA 2LVIA 3I5GC 3JTDB 1UP5A 2I7AA 3EKJA 1Y1XA 1JF2A 2M7NA 4OVNF 4PDZA 1SMGA 4AOMA 1KK8C 2EC6C 1PSRA 1N2DA 3EVVA 2L4IA 4F0ZB 2MJWB 1XO5A 4C0KA 5KSZA 1UUSA 2FJUB 2JT0A 4E68A 1M45A 1MXLC 2D8NA 2HPSA 3O2PA 1TCOB 1WRZA 2F8PA 2Q4UA 1S1EA 5AANA 1AK8A 1KFXL 3SG6A 4CLNA 3GK4X 2FCDA 1GGZA 4ORAB 2LHLA 1XFVO 2M1KB 3VRNA 1GJYA 3LK1A 4M2PA 4OR9B 1NCZA 1YUSA 1BF5A 1KWOB 3PLFB 3CS1A 5CSFA 1SR6B 4CFQA 1IH0A 2NCPA 1NYAA 1RROA 1YRUB 1CFFA 2CXJA 4AQIA 1LINA 2PALA 2KI6C 3PN7B 4YI8A 2LM5A 1U5IB 1CFDA 4HRHA 2KBIA 1K93D 1CLBA 1EXRA 4WQ2A 1HQVA 3WXAA 1IJ5A 1RK9A 2NXQA 3BOWA 1VRKA 2BL0C 2K7BA
chains in the Genus database with same CATH superfamily
3OHMB 4CIDA 4ETOA 1G4YR 3BOWB 1T14A 1Y1UA 1OMRA 3SIAA 2ZKMX 4L9MA 1NCXA 1AJ4A 2LHIA 3JTDC 2A4JA 4NDDA 3TDUA 1YVLA 3OB1B 2M0RA 2ZN8A 2M9GA 1UHJA 1L2OB 4MZJA 4GBAA 1RFJA 2KAXA 3D77A 1KK7Y 3AKBA 1NP8A 1OOFA 2KGRA 1AUIB 2KFFA 1DJWA 1S26D 4MLWA 2MLEC 3NSOA 4PE4A 2LUCA 2M3WA 4PHKA 2BCXA 1TTXA 2CTNA 4HREE 4PALA 3L4AA 2NCOA 2QEBA 2M97A 3ZWHA 2OS8C 3I5GB 2P71A 1KWOC 3C1VA 3D73A 2JRFA 1F55A 1E8AA 5AERA 2Y1MA 1G33A 4ZCUA 2AAOA 3LK0A 4DS7A 4MZLA 2JQ6A 1MWNA 1SR6C 3CGAA 3L47A 4PE0A 5I8NA 1QXPA 2PVBA 3BFBA 1BODA 1D1OA 1QASA 1OOHA 3PN7C 1J1EA 2LLSA 1BMOA 1TRFA 1FPWA 3BUNB 1DT7B 3FWCA 1QATA 2VRGA 4AQJA 4M2OA 5CPVA 1KK7Z 2WCKA 2JXLA 5ER4X 2LAPA 2K7OA 1C3YA 3SG4A 1ZFSA 1V1GA 1NX3A 1CDPA 3Q8IA 2L5XB 2NLNA 1EL4A 1C3ZA 1SL8A 3OBVA 5EL2A 1KSOA 3A8RA 3ICBA 2Y5IA 2ERBA 2KI4B 3DXLA 2MA2A 2KAVA 5DKRA 1DEKA 3V2LA 3TZ1A 4YGEB 1QX5B 3S0BA 1WRLA 1DJGA 4OCIA 1H4BA 1RECA 2IS9A 1QTXA 1A29A 1XK4A 2COLB 3CR5X 1BR4B 3DVKA 4INWA 1JF0A 2L5YA 3IQQA 4IJ7A 1CDNA 1F54A 5CSNA 1L2OC 2LE9B 1NX2A 3KF9A 1KFUS 1OW4A 3A4UB 3VB1A 4BY4A 2QACA 1PRWA 2LVKA 2E6WA 4P5OE 1YR5A 2BL0B 1WLZA 3IQOA 3LCPC 4YRUA 4XJKA 2KYFA 1ODBA 4MVFA 1IKUA 1BLQA 1JSAA 3NHTA 1CMGA 2WOSA 2FOTA 3IF7A 5D7FA 1RTP1 2KYCA 1LKJA 2H8VA 2KLEA 2L2EA 3D76A 3B87A 3M0WA 2MLFC 5IBWA 5CSJA 2LMUA 2BECA 2F2PA 3CWGA 1SL7A 3SJSA 2MAZA 3TUYB 5FYXA 3TDIA 2G2BA 1XFRA 2KHNA 3I5HB 4USLA 2QEHA 1M46A 3OX6A 3KO0A 2Q91A 2V53A 2OTGC 3EK4A 2M49B 3LLEA 3SG7A 3F45A 2L4HA 1Y1AA 4JD9A 3QMEA 3BFAA 5B8IB 1B7TY 1SBJA 3EVRA 3FE8A 2BKIB 1DJHA 1QX7A 4GUKA 1F70A 1A75A 2MHHA 1NWDA 3K21A 1OE9B 1IJ6A 3NSKA 4XYNA 1MF8B 2M29A 3O4XA 4DRWA 4JWQA 1UHHA 1QJTA 4N1GA 2WCFA 5TNCA 1MR8A 1EH2A 5AEQA 3OX5A 2KQYA 2OS8B 4WRIA 2PSRA 1XFXO 2KI4C 1SK6D 1S36A 1WRKA 3S0EA 2EHBA 1YX8A 5DKQA 3S0AA 2JULA 1CM1A 1DJYA 1Z2CB 3BUMB 2KGBC 1KSMA 4A4CA 4U8DA 1UHKA 2M7LA 4DIRA 5KTYA 3SS5A 3NSIA 2PMYA 3BUOB 3CZ1A 3AAKA 3FE9A 1BR1B 1SNLA 1DF0A 2GGZA 3DF0A 2K2FA 2LANA 4MRXA 1JBAA 5CSIA 2KDHA 1XK4C 3KEVA 3LL8B 4I5LB 1CM4A 1IIOA 1DF0B 1M63B 2QDIA 3DVJA 3DYEA 2JNXA 4N5XA 5DKNA 1B7TZ 1FI6A 2CBLA 1TUJA 3R1VA 1F71A 3BQ3A 3BYAA 3DZTA 4GGNA 1UHIA 1YX7A 3CLNA 3CABA 4ZCVA 1K95A 3CR2A 4P2YB 2JOJA 1ZUZA 4MZKA 3H4SE 1JUOA 3SS3A 1FI5A 3EKHA 1PULA 3PATA 4BY5A 1C07A 1LA0A 1LVCD 1NPQA 1QV0A 4GNKB 3TUYC 2K7DA 2KSPA 1B1GA 4ORBB 2K61A 1TNXA 3I5HC 3WHUB 4C0LA 1DMOA 1BG1A 1CDLA 1K8UA 2FJYA 3BJHA 3EVUA 1ZACA 2ZFDA 2BKHB 2K60A 1ALVA 1M39A 2QEVA 4GPLB 3TDZA 4F7FA 1GM0A 2KAYA 4HRGA 1CNPA 2GTEA 1Y6WA 2P6BB 2LLUA 2WCEA 2PRUA 3O4YA 4ORCB 2KPHA 3GK2A 1IWQA 2WC5A 3PFVA 1H8BA 2LMVA 3OGNA 1QIVA 3I5FB 2WORA 4QJ5B 3CR4X 4FTGA 1RWYA 3HX4A 1QX2A 1YUUA 2JT3A 5BPJA 4A4BA 1SCMB 4OZDA 3BUXB 3NGVA 1TOPA 2BAPA 1DGVA 1C7WA 3DD4A 2Y1NA 3N7HA 3TS5B 1CFPA 4GFTA 5I2QA 1SSEB 1JFJA 1UURA 1YUTA 3RM1A 1JC2A 3FWBA 2OTGB 1XFZO 4CFRA 5HYDA 4YGDB 3JVTC 3VROA 1XVJA 1KQVA 1KQMB 2KNEA 2O5GA 1EJ3A 4M2QA 1NX1A 2I18A 1YVHA 3DVEA 2F3ZA 2JTTA 3O6BA 1HT9A 1XYDA 4YGBB 1CB1A 1F8HA 2JWWA 3KHEA 2GGMA 2LMTA 5PALA 1WLMA 1KFUL 3RLZA 2LCPA 1A2XA 1DJIA 3D75A 5I94A 1IQ5A 2JT8A 2K0JA 2KFHA 3MSEB 4N1FA 1F4OA 3I5IB 1PALA 1B8RA 1B4CA 3OB2B 2GV5A 1FBVA 3NSLA 1IQ3A 1IRJA 1LA3A 1SRAA 1K90D 2LNKA 2HF5A 3BFHA 3IVTA 3PJIA 2CNPA 4YI9A 3SG3A 1TNWA 5HL1A 3UNWA 2JU0A 5K89A 1K96A 1DJZA 2ZRTA 1TCFA 4NDBA 2AUCA 5HLVA 3FIAA 3PSRA 4Q04A 3NXAA 2MBXA 1BT6A 4D1EA 5KU1A 1LXFC 1ZMZA 1B8LA 4DCKA 1R6PA 1SCVA 3I5FC 1DC1A 3S0DA 4XJKB 1OOJA 3SS4A 5ER5A 1QIWA 4I5JA 1NSHA 3RZSA 2NZ0A 1BJFA 1SCMC 1XFYO 2G9BA 2HQWA 2H61A 2WCMA 1AHRA 2FCEA 4PHNA 1CTRA 3TS5C 4JQ0D 2BBMA 1M31A 4NDCA 1OSAA 2M1UA 1K9PA 4PE1A 1A03A 1QLSA 3CDNA 3D0YA 2PYQA 4PHMA 2ISDA 1OZSA 1TUZA 2WNDA 1S6IA 2AMIA 2O60A 1PVAA 1KQMC 3OP0A 5D69A 1J7QA 5HKZA 1ALWA 3D0YB 3R72A 2WCLA 3B86A 3K1EA 1ORGA 2PQLA 5I2OA 3CZ0A 1A75B 2LP2A 2OPOA 1K9KA 3EG5B 1MHOA 1YRTB 1OMDA 2CT9A 1G8IA 1SY9A 3D10A 4PHJA 5HKWA 1A4PA 4YGCB 2JC2A 5FI7A 5AFPA 1WY9A 4MN0A 3I5IC 2WCHA 2BCBA 2LV7A 1K94A 3B88A 1WDCB 3JVTB 2MRDA 1X02A 2L50A 2QEOA 3O78A 4IL1A 4MEWA 1TNPA 2LUXA 2H2KA 2WC8A 3E3RA 3DF0B 2ZNEA 1SYMA 1TIZA 2JZIA 1S6JA 1AJ5A 2P70A 1J1DA 1TWOA 4ICBA 3D74A 4QJ3B 2F2OA 1BOCA 3SG2A 1CMFA 1MXEA 2LVJA 3GOFA 2JNFA 4PE7A 1U5IA 1R2UA 2PASA 3S0GA 1J55A 2BE6A 1Z4HA 2SCPA 1MUXA 1KFXS 1SW8A 2M8UA 3B7AA 3GK1A 1DVIA 2LLTA 2QPTA 2F3YA 2ZRSA 3HCMA 4I5KA 1SPYA 1QLKA 3PM2A 1XFUO 4FQTA 1B47A 3VRRA 1DTLA 1TNQA 5D3OA 2H61C 3DVMA 5I2LA 1W7JB 5HLOA 1N65A 1AVSA 2K2AA 3EK8A 4YGAA 2KBMA 1DGUA 5HKYA 4KYNA 1ZOTB 2KLDA 2F33A 1CLMA 1K9UA 2B1UA 1BU3A 3PM8A 4R1EA 3AAJA 4JKTA 3EK7A 3R1PA 2LP3A 1QVIY 2WCJA 1PK0D 4NQGA 5GQQC 1J7PA 3CYZA 3PALA 2L98A 1IG5A 1RJVA 1UWOA 4OKHA 1NCYA 2LC5A 1B9AA 1CFCA 1FF1A 2DOQA 4I5NB 1OMVA 4HSZA 2KQ6A 2E30A 1OZOA 1AP4A 1DJXA 1UHNA 2JXCA 2LVVA 2SASA 5F6TA 1FW4A 1S6CA 1YTZC 4GGFA 1DELA 1WDCC 1LS8A 1F4QA 2BE4A 1S5GY 2EGDA 3KPXA 3SG5A 5JOLA 1OQPA 2I94A 2Y4QA 1EG4A 1JFKA 1S3PA 1W9ZA 3FS7A 4TNCA 2WC6A 3VRQA 1TN4A 1SL9A 1V1FA 1QS7A 2JPTA 1CKKA 2BCAA 2JPOA 3ZNIA 1YURA 3D78A 1C7VA 2CCMA 1PVBA 1KK8B 1MQ1A 2EC6B 4YBHB 2RGIA 4WQ3A 1QVIZ 1Q80A 4PT1A 3AKAA 2L0PA 2JTZA 1Y0VH 3CZTX 4DUQA 4GAOA 1L7ZA 1SKTA 2I2RE 1J7RA 3BUWB 4MRYA 1K2HA 1EG3A 1QV1A 2K7CA 2R2IA 1GQMA 2WCBA 4C0JA 1N0YA 3BXKA 1JWDA 3QRXA 1OOGA 1S5GZ 5FI6A 3B6XA 3DY9A 3VRPA 2KOTA 2HETA 1XA5A 1KCYA 5FI2A 1NX0A 5J3XA 4JPZB 3WHTB 1PSBA 2BNXA 1B8CA 4CPVA 1NIWA 2ZN9A 2BBNA 2ZNDA 2K8MB 4FQOA 4QJ4B 5JJGA 5AXIA 4OV2A 2HQ8A 2TN4A 3SIBA 2L51A 1GGWA 1CLLA 5G08A 1QWVA 1W7IB 2KI6D 1P28A 5DICA 1NUBA 1J7OA 1IGVA 2KFGA 3CTNA 4GGFC 4PCWA 3WNXB 1XFWO 3VGOA 2L2CA 1CDMA 4MBEA 4UPGA 4MSPA 2LVIA 3I5GC 3JTDB 1UP5A 3L4LA 2I7AA 3EKJA 1Y1XA 1JF2A 2M7NA 4OVNF 4PDZA 1SMGA 4AOMA 1KK8C 2EC6C 1PSRA 1N2DA 3EVVA 2L4IA 2YGUA 4F0ZB 2MJWB 3FE6A 1DQEA 1XO5A 4C0KA 5KSZA 1UUSA 2FJUB 1OOIX 2JT0A 4E68A 1M45A 1MXLC 2D8NA 2HPSA 3O2PA 1TCOB 1WRZA 2F8PA 2Q4UA 1S1EA 5AANA 1AK8A 1KFXL 3SG6A 4CLNA 3S0FA 3GK4X 2FCDA 1GGZA 4ORAB 2LHLA 1XFVO 2M1KB 3VRNA 1GJYA 3LK1A 4M2PA 4INXA 1NCZA 1YUSA 4OR9B 1KWOB 3PLFB 1BF5A 3CS1A 5CSFA 1SR6B 4CFQA 1IH0A 2NCPA 1NYAA 1RROA 1YRUB 1CFFA 2CXJA 3R1OA 4AQIA 1LINA 2PALA 3NHIA 2KI6C 3PN7B 3UO9A 4YI8A 2LM5A 1U5IB 1CFDA 4HRHA 2KBIA 1K93D 1CLBA 1EXRA 4WQ2A 1HQVA 3WXAA 1IJ5A 1RK9A 2NXQA 3BOWA 3CZ2A 1VRKA 2BL0C 2K7BA
chains in the Genus database with same CATH topology
3OHMB 4CIDA 4ETOA 1G4YR 3BOWB 1Y1UA 1OMRA 3SIAA 2ZKMX 4L9MA 1NCXA 1AJ4A 2LHIA 3JTDC 2A4JA 4NDDA 3TDUA 1YVLA 3OB1B 2M0RA 2ZN8A 2M9GA 1UHJA 1L2OB 4MZJA 4GBAA 1RFJA 2KAXA 1KK7Y 3AKBA 1NP8A 2KGRA 1AUIB 2KFFA 1DJWA 1S26D 4MLWA 2MLEC 3NSOA 4PE4A 2LUCA 2M3WA 4PHKA 2BCXA 1TTXA 2CTNA 4HREE 4PALA 2NCOA 2M97A 3ZWHA 2OS8C 3I5GB 1KWOC 3C1VA 1F55A 2JRFA 1E8AA 5AERA 2Y1MA 1G33A 4ZCUA 2AAOA 3LK0A 4DS7A 4MZLA 2JQ6A 1MWNA 1SR6C 3CGAA 4PE0A 5I8NA 1QXPA 2PVBA 1BODA 1D1OA 1QASA 3PN7C 1J1EA 2LLSA 1BMOA 1TRFA 1FPWA 3BUNB 1DT7B 3FWCA 1QATA 2VRGA 4AQJA 4M2OA 5CPVA 1KK7Z 2JXLA 5ER4X 2LAPA 2K7OA 3SG4A 1ZFSA 1NX3A 1V1GA 1CDPA 2L5XB 2NLNA 1EL4A 1SL8A 1KSOA 3A8RA 3ICBA 2Y5IA 2KI4B 2MA2A 2KAVA 5DKRA 3TZ1A 4YGEB 1QX5B 1WRLA 1DJGA 4OCIA 1H4BA 1RECA 2IS9A 1QTXA 1A29A 1XK4A 2COLB 3CR5X 1BR4B 3DVKA 1JF0A 1F54A 3IQQA 1CDNA 5CSNA 1L2OC 2LE9B 1NX2A 3KF9A 1KFUS 3A4UB 4BY4A 2QACA 1PRWA 2LVKA 2E6WA 4P5OE 1YR5A 2BL0B 1WLZA 3IQOA 3LCPC 4YRUA 4XJKA 2KYFA 1ODBA 4MVFA 1IKUA 1BLQA 1JSAA 1CMGA 2WOSA 2FOTA 3IF7A 5D7FA 1RTP1 2KYCA 1LKJA 2L2EA 3M0WA 2MLFC 5IBWA 5CSJA 2LMUA 2BECA 2F2PA 3CWGA 1SL7A 3SJSA 2MAZA 3TUYB 5FYXA 3TDIA 2G2BA 2KHNA 3I5HB 4USLA 1M46A 3OX6A 3KO0A 2Q91A 2V53A 2OTGC 3EK4A 2M49B 3LLEA 3SG7A 3F45A 2L4HA 1Y1AA 5B8IB 1B7TY 1SBJA 3EVRA 2BKIB 1DJHA 1QX7A 4GUKA 1F70A 1A75A 2MHHA 1NWDA 3K21A 1OE9B 1IJ6A 3NSKA 4XYNA 1MF8B 2M29A 4DRWA 4JWQA 1UHHA 1QJTA 4N1GA 2WCFA 5TNCA 1MR8A 1EH2A 5AEQA 3OX5A 2KQYA 2OS8B 4WRIA 2PSRA 1XFXO 2KI4C 1SK6D 1S36A 1WRKA 2EHBA 1YX8A 5DKQA 2JULA 1CM1A 1DJYA 3BUMB 2KGBC 1KSMA 4A4CA 4U8DA 1UHKA 2M7LA 4DIRA 5KTYA 3NSIA 2PMYA 3BUOB 3AAKA 1BR1B 1SNLA 1DF0A 2GGZA 3DF0A 2K2FA 2LANA 4MRXA 1JBAA 5CSIA 2KDHA 1XK4C 3KEVA 3LL8B 4I5LB 1CM4A 1DF0B 1M63B 3DVJA 4N5XA 5DKNA 2JNXA 1FI6A 1B7TZ 2CBLA 1F71A 3BQ3A 3BYAA 4GGNA 1UHIA 1YX7A 3CLNA 4ZCVA 1K95A 3CR2A 4P2YB 2JOJA 1ZUZA 4MZKA 3H4SE 1JUOA 1FI5A 3EKHA 1PULA 3PATA 4BY5A 1C07A 1LA0A 1LVCD 1NPQA 1QV0A 4GNKB 3TUYC 2K7DA 2KSPA 1B1GA 4ORBB 2K61A 1TNXA 3I5HC 3WHUB 4C0LA 1DMOA 1BG1A 1CDLA 1K8UA 3EVUA 1ZACA 2ZFDA 2BKHB 1ALVA 1M39A 4GPLB 3TDZA 2KAYA 4HRGA 1CNPA 1Y6WA 2P6BB 2LLUA 2WCEA 2PRUA 3O4YA 4ORCB 3GK2A 1IWQA 1H8BA 3PFVA 2LMVA 1QIVA 3I5FB 2WORA 4QJ5B 3CR4X 4FTGA 1RWYA 3HX4A 1QX2A 1YUUA 2JT3A 5BPJA 4A4BA 1SCMB 3BUXB 1TOPA 1CFPA 1DGVA 1C7WA 3DD4A 2Y1NA 3TS5B 1JFJA 4GFTA 5I2QA 1UURA 1YUTA 3RM1A 1JC2A 3FWBA 2OTGB 1XFZO 4CFRA 5HYDA 4YGDB 3JVTC 3VROA 1XVJA 1KQVA 1KQMB 2KNEA 2O5GA 1EJ3A 4M2QA 1NX1A 2I18A 1YVHA 3DVEA 2F3ZA 2JTTA 3O6BA 1HT9A 1XYDA 4YGBB 1CB1A 1F8HA 2JWWA 3KHEA 2GGMA 2LMTA 5PALA 1WLMA 1KFUL 3RLZA 2LCPA 1A2XA 1DJIA 1IQ5A 2JT8A 2K0JA 2KFHA 3MSEB 4N1FA 1F4OA 3I5IB 1PALA 1B8RA 1B4CA 3OB2B 2GV5A 1FBVA 3NSLA 1IQ3A 1IRJA 1LA3A 1SRAA 1K90D 2LNKA 2HF5A 4YI9A 3SG3A 2CNPA 1TNWA 2JU0A 5K89A 1K96A 1DJZA 2ZRTA 1TCFA 4NDBA 2AUCA 5HLVA 3FIAA 3PSRA 4Q04A 3NXAA 2MBXA 1BT6A 4D1EA 5KU1A 1LXFC 1ZMZA 1B8LA 4DCKA 1R6PA 1SCVA 3I5FC 4XJKB 1OOJA 5ER5A 1QIWA 4I5JA 1NSHA 2NZ0A 1BJFA 1SCMC 1XFYO 2G9BA 2HQWA 2H61A 1AHRA 2FCEA 4PHNA 1CTRA 3TS5C 4JQ0D 2BBMA 1M31A 4NDCA 1OSAA 2M1UA 1K9PA 4PE1A 1A03A 1QLSA 3D0YA 4PHMA 2ISDA 1OZSA 2WNDA 1S6IA 2AMIA 2O60A 1PVAA 1KQMC 3OP0A 5D69A 1J7QA 5HKZA 1ALWA 3D0YB 5I2OA 1A75B 2LP2A 2OPOA 1K9KA 1MHOA 1YRTB 1OMDA 2CT9A 1G8IA 1SY9A 3D10A 4PHJA 5HKWA 1A4PA 4YGCB 2JC2A 5AFPA 1WY9A 4MN0A 3I5IC 2BCBA 2LV7A 1K94A 3JVTB 1WDCB 2MRDA 1X02A 2L50A 3O78A 4IL1A 4MEWA 1TNPA 2LUXA 2H2KA 2WC8A 3E3RA 3DF0B 2ZNEA 1SYMA 1TIZA 2JZIA 1S6JA 1AJ5A 1J1DA 4ICBA 4QJ3B 2F2OA 1BOCA 3SG2A 1CMFA 1MXEA 2LVJA 3GOFA 2JNFA 4PE7A 1U5IA 1R2UA 2PASA 1J55A 2BE6A 2SCPA 3GK1A 1MUXA 1KFXS 1SW8A 2M8UA 3HCMA 1DVIA 2LLTA 2QPTA 2F3YA 2ZRSA 4I5KA 1SPYA 1QLKA 1XFUO 1B47A 3VRRA 1DTLA 1TNQA 2H61C 3DVMA 5I2LA 1W7JB 5HLOA 1N65A 1AVSA 2K2AA 3EK8A 4YGAA 2KBMA 1DGUA 5HKYA 1ZOTB 2F33A 1CLMA 1K9UA 2B1UA 1BU3A 3PM8A 4R1EA 3AAJA 3EK7A 2LP3A 1QVIY 1PK0D 4NQGA 5GQQC 1J7PA 3PALA 2L98A 1IG5A 1RJVA 1UWOA 4OKHA 1NCYA 2LC5A 1B9AA 1CFCA 1FF1A 2DOQA 4I5NB 1OMVA 4HSZA 2KQ6A 2E30A 1OZOA 1AP4A 1DJXA 1UHNA 2JXCA 2LVVA 2SASA 5F6TA 1FW4A 1S6CA 1YTZC 4GGFA 1WDCC 3KPXA 2BE4A 1F4QA 1S5GY 2EGDA 3SG5A 5JOLA 1OQPA 2I94A 2Y4QA 1EG4A 1JFKA 1S3PA 3FS7A 4TNCA 3VRQA 1TN4A 1SL9A 1V1FA 1QS7A 2JPTA 1CKKA 2BCAA 3ZNIA 1YURA 1C7VA 2CCMA 1PVBA 1KK8B 1MQ1A 2EC6B 4YBHB 2RGIA 4WQ3A 1QVIZ 1Q80A 3AKAA 2L0PA 2JTZA 1Y0VH 3CZTX 4DUQA 4GAOA 1L7ZA 1SKTA 2I2RE 1J7RA 3BUWB 4MRYA 1K2HA 1EG3A 1QV1A 2K7CA 2R2IA 1GQMA 2WCBA 4C0JA 1N0YA 3BXKA 1JWDA 3QRXA 3VRPA 1S5GZ 2KOTA 2HETA 1XA5A 1KCYA 1NX0A 5J3XA 4JPZB 3WHTB 1PSBA 1B8CA 4CPVA 1NIWA 2ZN9A 2BBNA 2ZNDA 2K8MB 4FQOA 4QJ4B 5JJGA 5AXIA 4OV2A 2HQ8A 2TN4A 3SIBA 2L51A 1GGWA 1CLLA 5G08A 1W7IB 2KI6D 1NUBA 1J7OA 1IGVA 2KFGA 3CTNA 4GGFC 4PCWA 3WNXB 1XFWO 3VGOA 1CDMA 4MBEA 4UPGA 4MSPA 2LVIA 3I5GC 3JTDB 1UP5A 2I7AA 3EKJA 1Y1XA 1JF2A 2M7NA 4OVNF 4PDZA 1SMGA 4AOMA 1KK8C 2EC6C 1PSRA 1N2DA 3EVVA 2L4IA 4F0ZB 2MJWB 1XO5A 4C0KA 5KSZA 1UUSA 2FJUB 2JT0A 4E68A 1M45A 1MXLC 2D8NA 2HPSA 3O2PA 1TCOB 1WRZA 2F8PA 2Q4UA 1S1EA 5AANA 1AK8A 1KFXL 3SG6A 4CLNA 3GK4X 2FCDA 1GGZA 4ORAB 2LHLA 1XFVO 2M1KB 3VRNA 1GJYA 3LK1A 4M2PA 4OR9B 1NCZA 1YUSA 1BF5A 1KWOB 3PLFB 3CS1A 5CSFA 1SR6B 4CFQA 1IH0A 2NCPA 1NYAA 1RROA 1YRUB 1CFFA 2CXJA 4AQIA 1LINA 2PALA 2KI6C 3PN7B 4YI8A 2LM5A 1U5IB 1CFDA 4HRHA 2KBIA 1K93D 1CLBA 1EXRA 4WQ2A 1HQVA 3WXAA 1IJ5A 1RK9A 2NXQA 3BOWA 1VRKA 2BL0C 2K7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OHM B;  4CID A;  4ETO A;  1G4Y R;  3BOW B;  1Y1U A;  1OMR A;  3SIA A;  2ZKM X;  4L9M A;  1NCX A;  1AJ4 A;  2LHI A;  3JTD C;  2A4J A;  4NDD A;  3TDU A;  1YVL A;  3OB1 B;  2M0R A;  2ZN8 A;  2M9G A;  1UHJ A;  1L2O B;  4MZJ A;  4GBA A;  1RFJ A;  2KAX A;  1KK7 Y;  3AKB A;  1NP8 A;  2KGR A;  1AUI B;  2KFF A;  1DJW A;  1S26 D;  4MLW A;  2MLE C;  3NSO A;  4PE4 A;  2LUC A;  2M3W A;  4PHK A;  2BCX A;  1TTX A;  2CTN A;  4HRE E;  4PAL A;  2NCO A;  2M97 A;  3ZWH A;  2OS8 C;  3I5G B;  1KWO C;  3C1V A;  1F55 A;  2JRF A;  1E8A A;  5AER A;  2Y1M A;  1G33 A;  4ZCU A;  2AAO A;  3LK0 A;  4DS7 A;  4MZL A;  2JQ6 A;  1MWN A;  1SR6 C;  3CGA A;  4PE0 A;  5I8N A;  1QXP A;  2PVB A;  1BOD A;  1D1O A;  1QAS A;  3PN7 C;  1J1E A;  2LLS A;  1BMO A;  1TRF A;  1FPW A;  3BUN B;  1DT7 B;  3FWC A;  1QAT A;  2VRG A;  4AQJ A;  4M2O A;  5CPV A;  1KK7 Z;  2JXL A;  5ER4 X;  2LAP A;  2K7O A;  3SG4 A;  1ZFS A;  1NX3 A;  1V1G A;  1CDP A;  2L5X B;  2NLN A;  1EL4 A;  1SL8 A;  1KSO A;  3A8R A;  3ICB A;  2Y5I A;  2KI4 B;  2MA2 A;  2KAV A;  5DKR A;  3TZ1 A;  4YGE B;  1QX5 B;  1WRL A;  1DJG A;  4OCI A;  1H4B A;  1REC A;  2IS9 A;  1QTX A;  1A29 A;  1XK4 A;  2COL B;  3CR5 X;  1BR4 B;  3DVK A;  1JF0 A;  1F54 A;  3IQQ A;  1CDN A;  5CSN A;  1L2O C;  2LE9 B;  1NX2 A;  3KF9 A;  1KFU S;  3A4U B;  4BY4 A;  2QAC A;  1PRW A;  2LVK A;  2E6W A;  4P5O E;  1YR5 A;  2BL0 B;  1WLZ A;  3IQO A;  3LCP C;  4YRU A;  4XJK A;  2KYF A;  1ODB A;  4MVF A;  1IKU A;  1BLQ A;  1JSA A;  1CMG A;  2WOS A;  2FOT A;  3IF7 A;  5D7F A;  1RTP 1;  2KYC A;  1LKJ A;  2L2E A;  3M0W A;  2MLF C;  5IBW A;  5CSJ A;  2LMU A;  2BEC A;  2F2P A;  3CWG A;  1SL7 A;  3SJS A;  2MAZ A;  3TUY B;  5FYX A;  3TDI A;  2G2B A;  2KHN A;  3I5H B;  4USL A;  1M46 A;  3OX6 A;  3KO0 A;  2Q91 A;  2V53 A;  2OTG C;  3EK4 A;  2M49 B;  3LLE A;  3SG7 A;  3F45 A;  2L4H A;  1Y1A A;  5B8I B;  1B7T Y;  1SBJ A;  3EVR A;  2BKI B;  1DJH A;  1QX7 A;  4GUK A;  1F70 A;  1A75 A;  2MHH A;  1NWD A;  3K21 A;  1OE9 B;  1IJ6 A;  3NSK A;  4XYN A;  1MF8 B;  2M29 A;  4DRW A;  4JWQ A;  1UHH A;  1QJT A;  4N1G A;  2WCF A;  5TNC A;  1MR8 A;  1EH2 A;  5AEQ A;  3OX5 A;  2KQY A;  2OS8 B;  4WRI A;  2PSR A;  1XFX O;  2KI4 C;  1SK6 D;  1S36 A;  1WRK A;  2EHB A;  1YX8 A;  5DKQ A;  2JUL A;  1CM1 A;  1DJY A;  3BUM B;  2KGB C;  1KSM A;  4A4C A;  4U8D A;  1UHK A;  2M7L A;  4DIR A;  5KTY A;  3NSI A;  2PMY A;  3BUO B;  3AAK A;  1BR1 B;  1SNL A;  1DF0 A;  2GGZ A;  3DF0 A;  2K2F A;  2LAN A;  4MRX A;  1JBA A;  5CSI A;  2KDH A;  1XK4 C;  3KEV A;  3LL8 B;  4I5L B;  1CM4 A;  1DF0 B;  1M63 B;  3DVJ A;  4N5X A;  5DKN A;  2JNX A;  1FI6 A;  1B7T Z;  2CBL A;  1F71 A;  3BQ3 A;  3BYA A;  4GGN A;  1UHI A;  1YX7 A;  3CLN A;  4ZCV A;  1K95 A;  3CR2 A;  4P2Y B;  2JOJ A;  1ZUZ A;  4MZK A;  3H4S E;  1JUO A;  1FI5 A;  3EKH A;  1PUL A;  3PAT A;  4BY5 A;  1C07 A;  1LA0 A;  1LVC D;  1NPQ A;  1QV0 A;  4GNK B;  3TUY C;  2K7D A;  2KSP A;  1B1G A;  4ORB B;  2K61 A;  1TNX A;  3I5H C;  3WHU B;  4C0L A;  1DMO A;  1BG1 A;  1CDL A;  1K8U A;  3EVU A;  1ZAC A;  2ZFD A;  2BKH B;  1ALV A;  1M39 A;  4GPL B;  3TDZ A;  2KAY A;  4HRG A;  1CNP A;  1Y6W A;  2P6B B;  2LLU A;  2WCE A;  2PRU A;  3O4Y A;  4ORC B;  3GK2 A;  1IWQ A;  1H8B A;  3PFV A;  2LMV A;  1QIV A;  3I5F B;  2WOR A;  4QJ5 B;  3CR4 X;  4FTG A;  1RWY A;  3HX4 A;  1QX2 A;  1YUU A;  2JT3 A;  5BPJ A;  4A4B A;  1SCM B;  3BUX B;  1TOP A;  1CFP A;  1DGV A;  1C7W A;  3DD4 A;  2Y1N A;  3TS5 B;  1JFJ A;  4GFT A;  5I2Q A;  1UUR A;  1YUT A;  3RM1 A;  1JC2 A;  3FWB A;  2OTG B;  1XFZ O;  4CFR A;  5HYD A;  4YGD B;  3JVT C;  3VRO A;  1XVJ A;  1KQV A;  1KQM B;  2KNE A;  2O5G A;  1EJ3 A;  4M2Q A;  1NX1 A;  2I18 A;  1YVH A;  3DVE A;  2F3Z A;  2JTT A;  3O6B A;  1HT9 A;  1XYD A;  4YGB B;  1CB1 A;  1F8H A;  2JWW A;  3KHE A;  2GGM A;  2LMT A;  5PAL A;  1WLM A;  1KFU L;  3RLZ A;  2LCP A;  1A2X A;  1DJI A;  1IQ5 A;  2JT8 A;  2K0J A;  2KFH A;  3MSE B;  4N1F A;  1F4O A;  3I5I B;  1PAL A;  1B8R A;  1B4C A;  3OB2 B;  2GV5 A;  1FBV A;  3NSL A;  1IQ3 A;  1IRJ A;  1LA3 A;  1SRA A;  1K90 D;  2LNK A;  2HF5 A;  4YI9 A;  3SG3 A;  2CNP A;  1TNW A;  2JU0 A;  5K89 A;  1K96 A;  1DJZ A;  2ZRT A;  1TCF A;  4NDB A;  2AUC A;  5HLV A;  3FIA A;  3PSR A;  4Q04 A;  3NXA A;  2MBX A;  1BT6 A;  4D1E A;  5KU1 A;  1LXF C;  1ZMZ A;  1B8L A;  4DCK A;  1R6P A;  1SCV A;  3I5F C;  4XJK B;  1OOJ A;  5ER5 A;  1QIW A;  4I5J A;  1NSH A;  2NZ0 A;  1BJF A;  1SCM C;  1XFY O;  2G9B A;  2HQW A;  2H61 A;  1AHR A;  2FCE A;  4PHN A;  1CTR A;  3TS5 C;  4JQ0 D;  2BBM A;  1M31 A;  4NDC A;  1OSA A;  2M1U A;  1K9P A;  4PE1 A;  1A03 A;  1QLS A;  3D0Y A;  4PHM A;  2ISD A;  1OZS A;  2WND A;  1S6I A;  2AMI A;  2O60 A;  1PVA A;  1KQM C;  3OP0 A;  5D69 A;  1J7Q A;  5HKZ A;  1ALW A;  3D0Y B;  5I2O A;  1A75 B;  2LP2 A;  2OPO A;  1K9K A;  1MHO A;  1YRT B;  1OMD A;  2CT9 A;  1G8I A;  1SY9 A;  3D10 A;  4PHJ A;  5HKW A;  1A4P A;  4YGC B;  2JC2 A;  5AFP A;  1WY9 A;  4MN0 A;  3I5I C;  2BCB A;  2LV7 A;  1K94 A;  3JVT B;  1WDC B;  2MRD A;  1X02 A;  2L50 A;  3O78 A;  4IL1 A;  4MEW A;  1TNP A;  2LUX A;  2H2K A;  2WC8 A;  3E3R A;  3DF0 B;  2ZNE A;  1SYM A;  1TIZ A;  2JZI A;  1S6J A;  1AJ5 A;  1J1D A;  4ICB A;  4QJ3 B;  2F2O A;  1BOC A;  3SG2 A;  1CMF A;  1MXE A;  2LVJ A;  3GOF A;  2JNF A;  4PE7 A;  1U5I A;  1R2U A;  2PAS A;  1J55 A;  2BE6 A;  2SCP A;  3GK1 A;  1MUX A;  1KFX S;  1SW8 A;  2M8U A;  3HCM A;  1DVI A;  2LLT A;  2QPT A;  2F3Y A;  2ZRS A;  4I5K A;  1SPY A;  1QLK A;  1XFU O;  1B47 A;  3VRR A;  1DTL A;  1TNQ A;  2H61 C;  3DVM A;  5I2L A;  1W7J B;  5HLO A;  1N65 A;  1AVS A;  2K2A A;  3EK8 A;  4YGA A;  2KBM A;  1DGU A;  5HKY A;  1ZOT B;  2F33 A;  1CLM A;  1K9U A;  2B1U A;  1BU3 A;  3PM8 A;  4R1E A;  3AAJ A;  3EK7 A;  2LP3 A;  1QVI Y;  1PK0 D;  4NQG A;  5GQQ C;  1J7P A;  3PAL A;  2L98 A;  1IG5 A;  1RJV A;  1UWO A;  4OKH A;  1NCY A;  2LC5 A;  1B9A A;  1CFC A;  1FF1 A;  2DOQ A;  4I5N B;  1OMV A;  4HSZ A;  2KQ6 A;  2E30 A;  1OZO A;  1AP4 A;  1DJX A;  1UHN A;  2JXC A;  2LVV A;  2SAS A;  5F6T A;  1FW4 A;  1S6C A;  1YTZ C;  4GGF A;  1WDC C;  3KPX A;  2BE4 A;  1F4Q A;  1S5G Y;  2EGD A;  3SG5 A;  5JOL A;  1OQP A;  2I94 A;  2Y4Q A;  1EG4 A;  1JFK A;  1S3P A;  3FS7 A;  4TNC A;  3VRQ A;  1TN4 A;  1SL9 A;  1V1F A;  1QS7 A;  2JPT A;  1CKK A;  2BCA A;  3ZNI A;  1YUR A;  1C7V A;  2CCM A;  1PVB A;  1KK8 B;  1MQ1 A;  2EC6 B;  4YBH B;  2RGI A;  4WQ3 A;  1QVI Z;  1Q80 A;  3AKA A;  2L0P A;  2JTZ A;  1Y0V H;  3CZT X;  4DUQ A;  4GAO A;  1L7Z A;  1SKT A;  2I2R E;  1J7R A;  3BUW B;  4MRY A;  1K2H A;  1EG3 A;  1QV1 A;  2K7C A;  2R2I A;  1GQM A;  2WCB A;  4C0J A;  1N0Y A;  3BXK A;  1JWD A;  3QRX A;  3VRP A;  1S5G Z;  2KOT A;  2HET A;  1XA5 A;  1KCY A;  1NX0 A;  5J3X A;  4JPZ B;  3WHT B;  1PSB A;  1B8C A;  4CPV A;  1NIW A;  2ZN9 A;  2BBN A;  2ZND A;  2K8M B;  4FQO A;  4QJ4 B;  5JJG A;  5AXI A;  4OV2 A;  2HQ8 A;  2TN4 A;  3SIB A;  2L51 A;  1GGW A;  1CLL A;  5G08 A;  1W7I B;  2KI6 D;  1NUB A;  1J7O A;  1IGV A;  2KFG A;  3CTN A;  4GGF C;  4PCW A;  3WNX B;  1XFW O;  3VGO A;  1CDM A;  4MBE A;  4UPG A;  4MSP A;  2LVI A;  3I5G C;  3JTD B;  1UP5 A;  2I7A A;  3EKJ A;  1Y1X A;  1JF2 A;  2M7N A;  4OVN F;  4PDZ A;  1SMG A;  4AOM A;  1KK8 C;  2EC6 C;  1PSR A;  1N2D A;  3EVV A;  2L4I A;  4F0Z B;  2MJW B;  1XO5 A;  4C0K A;  5KSZ A;  1UUS A;  2FJU B;  2JT0 A;  4E68 A;  1M45 A;  1MXL C;  2D8N A;  2HPS A;  3O2P A;  1TCO B;  1WRZ A;  2F8P A;  2Q4U A;  1S1E A;  5AAN A;  1AK8 A;  1KFX L;  3SG6 A;  4CLN A;  3GK4 X;  2FCD A;  1GGZ A;  4ORA B;  2LHL A;  1XFV O;  2M1K B;  3VRN A;  1GJY A;  3LK1 A;  4M2P A;  4OR9 B;  1NCZ A;  1YUS A;  1BF5 A;  1KWO B;  3PLF B;  3CS1 A;  5CSF A;  1SR6 B;  4CFQ A;  1IH0 A;  2NCP A;  1NYA A;  1RRO A;  1YRU B;  1CFF A;  2CXJ A;  4AQI A;  1LIN A;  2PAL A;  2KI6 C;  3PN7 B;  4YI8 A;  2LM5 A;  1U5I B;  1CFD A;  4HRH A;  2KBI A;  1K93 D;  1CLB A;  1EXR A;  4WQ2 A;  1HQV A;  3WXA A;  1IJ5 A;  1RK9 A;  2NXQ A;  3BOW A;  1VRK A;  2BL0 C;  2K7B A; 
#chains in the Genus database with same CATH topology
 3OHM B;  4CID A;  4ETO A;  1G4Y R;  3BOW B;  1T14 A;  1Y1U A;  1OMR A;  3SIA A;  2ZKM X;  4L9M A;  1NCX A;  1AJ4 A;  2LHI A;  3JTD C;  2A4J A;  4NDD A;  3TDU A;  1YVL A;  3OB1 B;  2M0R A;  2ZN8 A;  2M9G A;  1UHJ A;  1L2O B;  4MZJ A;  4GBA A;  1RFJ A;  2KAX A;  3D77 A;  1KK7 Y;  3AKB A;  1NP8 A;  1OOF A;  2KGR A;  1AUI B;  2KFF A;  1DJW A;  1S26 D;  4MLW A;  2MLE C;  3NSO A;  4PE4 A;  2LUC A;  2M3W A;  4PHK A;  2BCX A;  1TTX A;  2CTN A;  4HRE E;  4PAL A;  3L4A A;  2NCO A;  2QEB A;  2M97 A;  3ZWH A;  2OS8 C;  3I5G B;  2P71 A;  1KWO C;  3C1V A;  3D73 A;  2JRF A;  1F55 A;  1E8A A;  5AER A;  2Y1M A;  1G33 A;  4ZCU A;  2AAO A;  3LK0 A;  4DS7 A;  4MZL A;  2JQ6 A;  1MWN A;  1SR6 C;  3CGA A;  3L47 A;  4PE0 A;  5I8N A;  1QXP A;  2PVB A;  3BFB A;  1BOD A;  1D1O A;  1QAS A;  1OOH A;  3PN7 C;  1J1E A;  2LLS A;  1BMO A;  1TRF A;  1FPW A;  3BUN B;  1DT7 B;  3FWC A;  1QAT A;  2VRG A;  4AQJ A;  4M2O A;  5CPV A;  1KK7 Z;  2WCK A;  2JXL A;  5ER4 X;  2LAP A;  2K7O A;  1C3Y A;  3SG4 A;  1ZFS A;  1V1G A;  1NX3 A;  1CDP A;  3Q8I A;  2L5X B;  2NLN A;  1EL4 A;  1C3Z A;  1SL8 A;  3OBV A;  5EL2 A;  1KSO A;  3A8R A;  3ICB A;  2Y5I A;  2ERB A;  2KI4 B;  3DXL A;  2MA2 A;  2KAV A;  5DKR A;  1DEK A;  3V2L A;  3TZ1 A;  4YGE B;  1QX5 B;  3S0B A;  1WRL A;  1DJG A;  4OCI A;  1H4B A;  1REC A;  2IS9 A;  1QTX A;  1A29 A;  1XK4 A;  2COL B;  3CR5 X;  1BR4 B;  3DVK A;  4INW A;  1JF0 A;  2L5Y A;  3IQQ A;  4IJ7 A;  1CDN A;  1F54 A;  5CSN A;  1L2O C;  2LE9 B;  1NX2 A;  3KF9 A;  1KFU S;  1OW4 A;  3A4U B;  3VB1 A;  4BY4 A;  2QAC A;  1PRW A;  2LVK A;  2E6W A;  4P5O E;  1YR5 A;  2BL0 B;  1WLZ A;  3IQO A;  3LCP C;  4YRU A;  4XJK A;  2KYF A;  1ODB A;  4MVF A;  1IKU A;  1BLQ A;  1JSA A;  3NHT A;  1CMG A;  2WOS A;  2FOT A;  3IF7 A;  5D7F A;  1RTP 1;  2KYC A;  1LKJ A;  2H8V A;  2KLE A;  2L2E A;  3D76 A;  3B87 A;  3M0W A;  2MLF C;  5IBW A;  5CSJ A;  2LMU A;  2BEC A;  2F2P A;  3CWG A;  1SL7 A;  3SJS A;  2MAZ A;  3TUY B;  5FYX A;  3TDI A;  2G2B A;  1XFR A;  2KHN A;  3I5H B;  4USL A;  2QEH A;  1M46 A;  3OX6 A;  3KO0 A;  2Q91 A;  2V53 A;  2OTG C;  3EK4 A;  2M49 B;  3LLE A;  3SG7 A;  3F45 A;  2L4H A;  1Y1A A;  4JD9 A;  3QME A;  3BFA A;  5B8I B;  1B7T Y;  1SBJ A;  3EVR A;  3FE8 A;  2BKI B;  1DJH A;  1QX7 A;  4GUK A;  1F70 A;  1A75 A;  2MHH A;  1NWD A;  3K21 A;  1OE9 B;  1IJ6 A;  3NSK A;  4XYN A;  1MF8 B;  2M29 A;  3O4X A;  4DRW A;  4JWQ A;  1UHH A;  1QJT A;  4N1G A;  2WCF A;  5TNC A;  1MR8 A;  1EH2 A;  5AEQ A;  3OX5 A;  2KQY A;  2OS8 B;  4WRI A;  2PSR A;  1XFX O;  2KI4 C;  1SK6 D;  1S36 A;  1WRK A;  3S0E A;  2EHB A;  1YX8 A;  5DKQ A;  3S0A A;  2JUL A;  1CM1 A;  1DJY A;  1Z2C B;  3BUM B;  2KGB C;  1KSM A;  4A4C A;  4U8D A;  1UHK A;  2M7L A;  4DIR A;  5KTY A;  3SS5 A;  3NSI A;  2PMY A;  3BUO B;  3CZ1 A;  3AAK A;  3FE9 A;  1BR1 B;  1SNL A;  1DF0 A;  2GGZ A;  3DF0 A;  2K2F A;  2LAN A;  4MRX A;  1JBA A;  5CSI A;  2KDH A;  1XK4 C;  3KEV A;  3LL8 B;  4I5L B;  1CM4 A;  1IIO A;  1DF0 B;  1M63 B;  2QDI A;  3DVJ A;  3DYE A;  2JNX A;  4N5X A;  5DKN A;  1B7T Z;  1FI6 A;  2CBL A;  1TUJ A;  3R1V A;  1F71 A;  3BQ3 A;  3BYA A;  3DZT A;  4GGN A;  1UHI A;  1YX7 A;  3CLN A;  3CAB A;  4ZCV A;  1K95 A;  3CR2 A;  4P2Y B;  2JOJ A;  1ZUZ A;  4MZK A;  3H4S E;  1JUO A;  3SS3 A;  1FI5 A;  3EKH A;  1PUL A;  3PAT A;  4BY5 A;  1C07 A;  1LA0 A;  1LVC D;  1NPQ A;  1QV0 A;  4GNK B;  3TUY C;  2K7D A;  2KSP A;  1B1G A;  4ORB B;  2K61 A;  1TNX A;  3I5H C;  3WHU B;  4C0L A;  1DMO A;  1BG1 A;  1CDL A;  1K8U A;  2FJY A;  3BJH A;  3EVU A;  1ZAC A;  2ZFD A;  2BKH B;  2K60 A;  1ALV A;  1M39 A;  2QEV A;  4GPL B;  3TDZ A;  4F7F A;  1GM0 A;  2KAY A;  4HRG A;  1CNP A;  2GTE A;  1Y6W A;  2P6B B;  2LLU A;  2WCE A;  2PRU A;  3O4Y A;  4ORC B;  2KPH A;  3GK2 A;  1IWQ A;  2WC5 A;  3PFV A;  1H8B A;  2LMV A;  3OGN A;  1QIV A;  3I5F B;  2WOR A;  4QJ5 B;  3CR4 X;  4FTG A;  1RWY A;  3HX4 A;  1QX2 A;  1YUU A;  2JT3 A;  5BPJ A;  4A4B A;  1SCM B;  4OZD A;  3BUX B;  3NGV A;  1TOP A;  2BAP A;  1DGV A;  1C7W A;  3DD4 A;  2Y1N A;  3N7H A;  3TS5 B;  1CFP A;  4GFT A;  5I2Q A;  1SSE B;  1JFJ A;  1UUR A;  1YUT A;  3RM1 A;  1JC2 A;  3FWB A;  2OTG B;  1XFZ O;  4CFR A;  5HYD A;  4YGD B;  3JVT C;  3VRO A;  1XVJ A;  1KQV A;  1KQM B;  2KNE A;  2O5G A;  1EJ3 A;  4M2Q A;  1NX1 A;  2I18 A;  1YVH A;  3DVE A;  2F3Z A;  2JTT A;  3O6B A;  1HT9 A;  1XYD A;  4YGB B;  1CB1 A;  1F8H A;  2JWW A;  3KHE A;  2GGM A;  2LMT A;  5PAL A;  1WLM A;  1KFU L;  3RLZ A;  2LCP A;  1A2X A;  1DJI A;  3D75 A;  5I94 A;  1IQ5 A;  2JT8 A;  2K0J A;  2KFH A;  3MSE B;  4N1F A;  1F4O A;  3I5I B;  1PAL A;  1B8R A;  1B4C A;  3OB2 B;  2GV5 A;  1FBV A;  3NSL A;  1IQ3 A;  1IRJ A;  1LA3 A;  1SRA A;  1K90 D;  2LNK A;  2HF5 A;  3BFH A;  3IVT A;  3PJI A;  2CNP A;  4YI9 A;  3SG3 A;  1TNW A;  5HL1 A;  3UNW A;  2JU0 A;  5K89 A;  1K96 A;  1DJZ A;  2ZRT A;  1TCF A;  4NDB A;  2AUC A;  5HLV A;  3FIA A;  3PSR A;  4Q04 A;  3NXA A;  2MBX A;  1BT6 A;  4D1E A;  5KU1 A;  1LXF C;  1ZMZ A;  1B8L A;  4DCK A;  1R6P A;  1SCV A;  3I5F C;  1DC1 A;  3S0D A;  4XJK B;  1OOJ A;  3SS4 A;  5ER5 A;  1QIW A;  4I5J A;  1NSH A;  3RZS A;  2NZ0 A;  1BJF A;  1SCM C;  1XFY O;  2G9B A;  2HQW A;  2H61 A;  2WCM A;  1AHR A;  2FCE A;  4PHN A;  1CTR A;  3TS5 C;  4JQ0 D;  2BBM A;  1M31 A;  4NDC A;  1OSA A;  2M1U A;  1K9P A;  4PE1 A;  1A03 A;  1QLS A;  3CDN A;  3D0Y A;  2PYQ A;  4PHM A;  2ISD A;  1OZS A;  1TUZ A;  2WND A;  1S6I A;  2AMI A;  2O60 A;  1PVA A;  1KQM C;  3OP0 A;  5D69 A;  1J7Q A;  5HKZ A;  1ALW A;  3D0Y B;  3R72 A;  2WCL A;  3B86 A;  3K1E A;  1ORG A;  2PQL A;  5I2O A;  3CZ0 A;  1A75 B;  2LP2 A;  2OPO A;  1K9K A;  3EG5 B;  1MHO A;  1YRT B;  1OMD A;  2CT9 A;  1G8I A;  1SY9 A;  3D10 A;  4PHJ A;  5HKW A;  1A4P A;  4YGC B;  2JC2 A;  5FI7 A;  5AFP A;  1WY9 A;  4MN0 A;  3I5I C;  2WCH A;  2BCB A;  2LV7 A;  1K94 A;  3B88 A;  1WDC B;  3JVT B;  2MRD A;  1X02 A;  2L50 A;  2QEO A;  3O78 A;  4IL1 A;  4MEW A;  1TNP A;  2LUX A;  2H2K A;  2WC8 A;  3E3R A;  3DF0 B;  2ZNE A;  1SYM A;  1TIZ A;  2JZI A;  1S6J A;  1AJ5 A;  2P70 A;  1J1D A;  1TWO A;  4ICB A;  3D74 A;  4QJ3 B;  2F2O A;  1BOC A;  3SG2 A;  1CMF A;  1MXE A;  2LVJ A;  3GOF A;  2JNF A;  4PE7 A;  1U5I A;  1R2U A;  2PAS A;  3S0G A;  1J55 A;  2BE6 A;  1Z4H A;  2SCP A;  1MUX A;  1KFX S;  1SW8 A;  2M8U A;  3B7A A;  3GK1 A;  1DVI A;  2LLT A;  2QPT A;  2F3Y A;  2ZRS A;  3HCM A;  4I5K A;  1SPY A;  1QLK A;  3PM2 A;  1XFU O;  4FQT A;  1B47 A;  3VRR A;  1DTL A;  1TNQ A;  5D3O A;  2H61 C;  3DVM A;  5I2L A;  1W7J B;  5HLO A;  1N65 A;  1AVS A;  2K2A A;  3EK8 A;  4YGA A;  2KBM A;  1DGU A;  5HKY A;  4KYN A;  1ZOT B;  2KLD A;  2F33 A;  1CLM A;  1K9U A;  2B1U A;  1BU3 A;  3PM8 A;  4R1E A;  3AAJ A;  4JKT A;  3EK7 A;  3R1P A;  2LP3 A;  1QVI Y;  2WCJ A;  1PK0 D;  4NQG A;  5GQQ C;  1J7P A;  3CYZ A;  3PAL A;  2L98 A;  1IG5 A;  1RJV A;  1UWO A;  4OKH A;  1NCY A;  2LC5 A;  1B9A A;  1CFC A;  1FF1 A;  2DOQ A;  4I5N B;  1OMV A;  4HSZ A;  2KQ6 A;  2E30 A;  1OZO A;  1AP4 A;  1DJX A;  1UHN A;  2JXC A;  2LVV A;  2SAS A;  5F6T A;  1FW4 A;  1S6C A;  1YTZ C;  4GGF A;  1DEL A;  1WDC C;  1LS8 A;  1F4Q A;  2BE4 A;  1S5G Y;  2EGD A;  3KPX A;  3SG5 A;  5JOL A;  1OQP A;  2I94 A;  2Y4Q A;  1EG4 A;  1JFK A;  1S3P A;  1W9Z A;  3FS7 A;  4TNC A;  2WC6 A;  3VRQ A;  1TN4 A;  1SL9 A;  1V1F A;  1QS7 A;  2JPT A;  1CKK A;  2BCA A;  2JPO A;  3ZNI A;  1YUR A;  3D78 A;  1C7V A;  2CCM A;  1PVB A;  1KK8 B;  1MQ1 A;  2EC6 B;  4YBH B;  2RGI A;  4WQ3 A;  1QVI Z;  1Q80 A;  4PT1 A;  3AKA A;  2L0P A;  2JTZ A;  1Y0V H;  3CZT X;  4DUQ A;  4GAO A;  1L7Z A;  1SKT A;  2I2R E;  1J7R A;  3BUW B;  4MRY A;  1K2H A;  1EG3 A;  1QV1 A;  2K7C A;  2R2I A;  1GQM A;  2WCB A;  4C0J A;  1N0Y A;  3BXK A;  1JWD A;  3QRX A;  1OOG A;  1S5G Z;  5FI6 A;  3B6X A;  3DY9 A;  3VRP A;  2KOT A;  2HET A;  1XA5 A;  1KCY A;  5FI2 A;  1NX0 A;  5J3X A;  4JPZ B;  3WHT B;  1PSB A;  2BNX A;  1B8C A;  4CPV A;  1NIW A;  2ZN9 A;  2BBN A;  2ZND A;  2K8M B;  4FQO A;  4QJ4 B;  5JJG A;  5AXI A;  4OV2 A;  2HQ8 A;  2TN4 A;  3SIB A;  2L51 A;  1GGW A;  1CLL A;  5G08 A;  1QWV A;  1W7I B;  2KI6 D;  1P28 A;  5DIC A;  1NUB A;  1J7O A;  1IGV A;  2KFG A;  3CTN A;  4GGF C;  4PCW A;  3WNX B;  1XFW O;  3VGO A;  2L2C A;  1CDM A;  4MBE A;  4UPG A;  4MSP A;  2LVI A;  3I5G C;  3JTD B;  1UP5 A;  3L4L A;  2I7A A;  3EKJ A;  1Y1X A;  1JF2 A;  2M7N A;  4OVN F;  4PDZ A;  1SMG A;  4AOM A;  1KK8 C;  2EC6 C;  1PSR A;  1N2D A;  3EVV A;  2L4I A;  2YGU A;  4F0Z B;  2MJW B;  3FE6 A;  1DQE A;  1XO5 A;  4C0K A;  5KSZ A;  1UUS A;  2FJU B;  1OOI X;  2JT0 A;  4E68 A;  1M45 A;  1MXL C;  2D8N A;  2HPS A;  3O2P A;  1TCO B;  1WRZ A;  2F8P A;  2Q4U A;  1S1E A;  5AAN A;  1AK8 A;  1KFX L;  3SG6 A;  4CLN A;  3S0F A;  3GK4 X;  2FCD A;  1GGZ A;  4ORA B;  2LHL A;  1XFV O;  2M1K B;  3VRN A;  1GJY A;  3LK1 A;  4M2P A;  4INX A;  1NCZ A;  1YUS A;  4OR9 B;  1KWO B;  3PLF B;  1BF5 A;  3CS1 A;  5CSF A;  1SR6 B;  4CFQ A;  1IH0 A;  2NCP A;  1NYA A;  1RRO A;  1YRU B;  1CFF A;  2CXJ A;  3R1O A;  4AQI A;  1LIN A;  2PAL A;  3NHI A;  2KI6 C;  3PN7 B;  3UO9 A;  4YI8 A;  2LM5 A;  1U5I B;  1CFD A;  4HRH A;  2KBI A;  1K93 D;  1CLB A;  1EXR A;  4WQ2 A;  1HQV A;  3WXA A;  1IJ5 A;  1RK9 A;  2NXQ A;  3BOW A;  3CZ2 A;  1VRK A;  2BL0 C;  2K7B A; 
#chains in the Genus database with same CATH homology
 3OHM B;  4CID A;  4ETO A;  1G4Y R;  3BOW B;  1Y1U A;  1OMR A;  3SIA A;  2ZKM X;  4L9M A;  1NCX A;  1AJ4 A;  2LHI A;  3JTD C;  2A4J A;  4NDD A;  3TDU A;  1YVL A;  3OB1 B;  2M0R A;  2ZN8 A;  2M9G A;  1UHJ A;  1L2O B;  4MZJ A;  4GBA A;  1RFJ A;  2KAX A;  1KK7 Y;  3AKB A;  1NP8 A;  2KGR A;  1AUI B;  2KFF A;  1DJW A;  1S26 D;  4MLW A;  2MLE C;  3NSO A;  4PE4 A;  2LUC A;  2M3W A;  4PHK A;  2BCX A;  1TTX A;  2CTN A;  4HRE E;  4PAL A;  2NCO A;  2M97 A;  3ZWH A;  2OS8 C;  3I5G B;  1KWO C;  3C1V A;  1F55 A;  2JRF A;  1E8A A;  5AER A;  2Y1M A;  1G33 A;  4ZCU A;  2AAO A;  3LK0 A;  4DS7 A;  4MZL A;  2JQ6 A;  1MWN A;  1SR6 C;  3CGA A;  4PE0 A;  5I8N A;  1QXP A;  2PVB A;  1BOD A;  1D1O A;  1QAS A;  3PN7 C;  1J1E A;  2LLS A;  1BMO A;  1TRF A;  1FPW A;  3BUN B;  1DT7 B;  3FWC A;  1QAT A;  2VRG A;  4AQJ A;  4M2O A;  5CPV A;  1KK7 Z;  2JXL A;  5ER4 X;  2LAP A;  2K7O A;  3SG4 A;  1ZFS A;  1NX3 A;  1V1G A;  1CDP A;  2L5X B;  2NLN A;  1EL4 A;  1SL8 A;  1KSO A;  3A8R A;  3ICB A;  2Y5I A;  2KI4 B;  2MA2 A;  2KAV A;  5DKR A;  3TZ1 A;  4YGE B;  1QX5 B;  1WRL A;  1DJG A;  4OCI A;  1H4B A;  1REC A;  2IS9 A;  1QTX A;  1A29 A;  1XK4 A;  2COL B;  3CR5 X;  1BR4 B;  3DVK A;  1JF0 A;  1F54 A;  3IQQ A;  1CDN A;  5CSN A;  1L2O C;  2LE9 B;  1NX2 A;  3KF9 A;  1KFU S;  3A4U B;  4BY4 A;  2QAC A;  1PRW A;  2LVK A;  2E6W A;  4P5O E;  1YR5 A;  2BL0 B;  1WLZ A;  3IQO A;  3LCP C;  4YRU A;  4XJK A;  2KYF A;  1ODB A;  4MVF A;  1IKU A;  1BLQ A;  1JSA A;  1CMG A;  2WOS A;  2FOT A;  3IF7 A;  5D7F A;  1RTP 1;  2KYC A;  1LKJ A;  2L2E A;  3M0W A;  2MLF C;  5IBW A;  5CSJ A;  2LMU A;  2BEC A;  2F2P A;  3CWG A;  1SL7 A;  3SJS A;  2MAZ A;  3TUY B;  5FYX A;  3TDI A;  2G2B A;  2KHN A;  3I5H B;  4USL A;  1M46 A;  3OX6 A;  3KO0 A;  2Q91 A;  2V53 A;  2OTG C;  3EK4 A;  2M49 B;  3LLE A;  3SG7 A;  3F45 A;  2L4H A;  1Y1A A;  5B8I B;  1B7T Y;  1SBJ A;  3EVR A;  2BKI B;  1DJH A;  1QX7 A;  4GUK A;  1F70 A;  1A75 A;  2MHH A;  1NWD A;  3K21 A;  1OE9 B;  1IJ6 A;  3NSK A;  4XYN A;  1MF8 B;  2M29 A;  4DRW A;  4JWQ A;  1UHH A;  1QJT A;  4N1G A;  2WCF A;  5TNC A;  1MR8 A;  1EH2 A;  5AEQ A;  3OX5 A;  2KQY A;  2OS8 B;  4WRI A;  2PSR A;  1XFX O;  2KI4 C;  1SK6 D;  1S36 A;  1WRK A;  2EHB A;  1YX8 A;  5DKQ A;  2JUL A;  1CM1 A;  1DJY A;  3BUM B;  2KGB C;  1KSM A;  4A4C A;  4U8D A;  1UHK A;  2M7L A;  4DIR A;  5KTY A;  3NSI A;  2PMY A;  3BUO B;  3AAK A;  1BR1 B;  1SNL A;  1DF0 A;  2GGZ A;  3DF0 A;  2K2F A;  2LAN A;  4MRX A;  1JBA A;  5CSI A;  2KDH A;  1XK4 C;  3KEV A;  3LL8 B;  4I5L B;  1CM4 A;  1DF0 B;  1M63 B;  3DVJ A;  4N5X A;  5DKN A;  2JNX A;  1FI6 A;  1B7T Z;  2CBL A;  1F71 A;  3BQ3 A;  3BYA A;  4GGN A;  1UHI A;  1YX7 A;  3CLN A;  4ZCV A;  1K95 A;  3CR2 A;  4P2Y B;  2JOJ A;  1ZUZ A;  4MZK A;  3H4S E;  1JUO A;  1FI5 A;  3EKH A;  1PUL A;  3PAT A;  4BY5 A;  1C07 A;  1LA0 A;  1LVC D;  1NPQ A;  1QV0 A;  4GNK B;  3TUY C;  2K7D A;  2KSP A;  1B1G A;  4ORB B;  2K61 A;  1TNX A;  3I5H C;  3WHU B;  4C0L A;  1DMO A;  1BG1 A;  1CDL A;  1K8U A;  3EVU A;  1ZAC A;  2ZFD A;  2BKH B;  1ALV A;  1M39 A;  4GPL B;  3TDZ A;  2KAY A;  4HRG A;  1CNP A;  1Y6W A;  2P6B B;  2LLU A;  2WCE A;  2PRU A;  3O4Y A;  4ORC B;  3GK2 A;  1IWQ A;  1H8B A;  3PFV A;  2LMV A;  1QIV A;  3I5F B;  2WOR A;  4QJ5 B;  3CR4 X;  4FTG A;  1RWY A;  3HX4 A;  1QX2 A;  1YUU A;  2JT3 A;  5BPJ A;  4A4B A;  1SCM B;  3BUX B;  1TOP A;  1CFP A;  1DGV A;  1C7W A;  3DD4 A;  2Y1N A;  3TS5 B;  1JFJ A;  4GFT A;  5I2Q A;  1UUR A;  1YUT A;  3RM1 A;  1JC2 A;  3FWB A;  2OTG B;  1XFZ O;  4CFR A;  5HYD A;  4YGD B;  3JVT C;  3VRO A;  1XVJ A;  1KQV A;  1KQM B;  2KNE A;  2O5G A;  1EJ3 A;  4M2Q A;  1NX1 A;  2I18 A;  1YVH A;  3DVE A;  2F3Z A;  2JTT A;  3O6B A;  1HT9 A;  1XYD A;  4YGB B;  1CB1 A;  1F8H A;  2JWW A;  3KHE A;  2GGM A;  2LMT A;  5PAL A;  1WLM A;  1KFU L;  3RLZ A;  2LCP A;  1A2X A;  1DJI A;  1IQ5 A;  2JT8 A;  2K0J A;  2KFH A;  3MSE B;  4N1F A;  1F4O A;  3I5I B;  1PAL A;  1B8R A;  1B4C A;  3OB2 B;  2GV5 A;  1FBV A;  3NSL A;  1IQ3 A;  1IRJ A;  1LA3 A;  1SRA A;  1K90 D;  2LNK A;  2HF5 A;  4YI9 A;  3SG3 A;  2CNP A;  1TNW A;  2JU0 A;  5K89 A;  1K96 A;  1DJZ A;  2ZRT A;  1TCF A;  4NDB A;  2AUC A;  5HLV A;  3FIA A;  3PSR A;  4Q04 A;  3NXA A;  2MBX A;  1BT6 A;  4D1E A;  5KU1 A;  1LXF C;  1ZMZ A;  1B8L A;  4DCK A;  1R6P A;  1SCV A;  3I5F C;  4XJK B;  1OOJ A;  5ER5 A;  1QIW A;  4I5J A;  1NSH A;  2NZ0 A;  1BJF A;  1SCM C;  1XFY O;  2G9B A;  2HQW A;  2H61 A;  1AHR A;  2FCE A;  4PHN A;  1CTR A;  3TS5 C;  4JQ0 D;  2BBM A;  1M31 A;  4NDC A;  1OSA A;  2M1U A;  1K9P A;  4PE1 A;  1A03 A;  1QLS A;  3D0Y A;  4PHM A;  2ISD A;  1OZS A;  2WND A;  1S6I A;  2AMI A;  2O60 A;  1PVA A;  1KQM C;  3OP0 A;  5D69 A;  1J7Q A;  5HKZ A;  1ALW A;  3D0Y B;  5I2O A;  1A75 B;  2LP2 A;  2OPO A;  1K9K A;  1MHO A;  1YRT B;  1OMD A;  2CT9 A;  1G8I A;  1SY9 A;  3D10 A;  4PHJ A;  5HKW A;  1A4P A;  4YGC B;  2JC2 A;  5AFP A;  1WY9 A;  4MN0 A;  3I5I C;  2BCB A;  2LV7 A;  1K94 A;  3JVT B;  1WDC B;  2MRD A;  1X02 A;  2L50 A;  3O78 A;  4IL1 A;  4MEW A;  1TNP A;  2LUX A;  2H2K A;  2WC8 A;  3E3R A;  3DF0 B;  2ZNE A;  1SYM A;  1TIZ A;  2JZI A;  1S6J A;  1AJ5 A;  1J1D A;  4ICB A;  4QJ3 B;  2F2O A;  1BOC A;  3SG2 A;  1CMF A;  1MXE A;  2LVJ A;  3GOF A;  2JNF A;  4PE7 A;  1U5I A;  1R2U A;  2PAS A;  1J55 A;  2BE6 A;  2SCP A;  3GK1 A;  1MUX A;  1KFX S;  1SW8 A;  2M8U A;  3HCM A;  1DVI A;  2LLT A;  2QPT A;  2F3Y A;  2ZRS A;  4I5K A;  1SPY A;  1QLK A;  1XFU O;  1B47 A;  3VRR A;  1DTL A;  1TNQ A;  2H61 C;  3DVM A;  5I2L A;  1W7J B;  5HLO A;  1N65 A;  1AVS A;  2K2A A;  3EK8 A;  4YGA A;  2KBM A;  1DGU A;  5HKY A;  1ZOT B;  2F33 A;  1CLM A;  1K9U A;  2B1U A;  1BU3 A;  3PM8 A;  4R1E A;  3AAJ A;  3EK7 A;  2LP3 A;  1QVI Y;  1PK0 D;  4NQG A;  5GQQ C;  1J7P A;  3PAL A;  2L98 A;  1IG5 A;  1RJV A;  1UWO A;  4OKH A;  1NCY A;  2LC5 A;  1B9A A;  1CFC A;  1FF1 A;  2DOQ A;  4I5N B;  1OMV A;  4HSZ A;  2KQ6 A;  2E30 A;  1OZO A;  1AP4 A;  1DJX A;  1UHN A;  2JXC A;  2LVV A;  2SAS A;  5F6T A;  1FW4 A;  1S6C A;  1YTZ C;  4GGF A;  1WDC C;  3KPX A;  2BE4 A;  1F4Q A;  1S5G Y;  2EGD A;  3SG5 A;  5JOL A;  1OQP A;  2I94 A;  2Y4Q A;  1EG4 A;  1JFK A;  1S3P A;  3FS7 A;  4TNC A;  3VRQ A;  1TN4 A;  1SL9 A;  1V1F A;  1QS7 A;  2JPT A;  1CKK A;  2BCA A;  3ZNI A;  1YUR A;  1C7V A;  2CCM A;  1PVB A;  1KK8 B;  1MQ1 A;  2EC6 B;  4YBH B;  2RGI A;  4WQ3 A;  1QVI Z;  1Q80 A;  3AKA A;  2L0P A;  2JTZ A;  1Y0V H;  3CZT X;  4DUQ A;  4GAO A;  1L7Z A;  1SKT A;  2I2R E;  1J7R A;  3BUW B;  4MRY A;  1K2H A;  1EG3 A;  1QV1 A;  2K7C A;  2R2I A;  1GQM A;  2WCB A;  4C0J A;  1N0Y A;  3BXK A;  1JWD A;  3QRX A;  3VRP A;  1S5G Z;  2KOT A;  2HET A;  1XA5 A;  1KCY A;  1NX0 A;  5J3X A;  4JPZ B;  3WHT B;  1PSB A;  1B8C A;  4CPV A;  1NIW A;  2ZN9 A;  2BBN A;  2ZND A;  2K8M B;  4FQO A;  4QJ4 B;  5JJG A;  5AXI A;  4OV2 A;  2HQ8 A;  2TN4 A;  3SIB A;  2L51 A;  1GGW A;  1CLL A;  5G08 A;  1W7I B;  2KI6 D;  1NUB A;  1J7O A;  1IGV A;  2KFG A;  3CTN A;  4GGF C;  4PCW A;  3WNX B;  1XFW O;  3VGO A;  1CDM A;  4MBE A;  4UPG A;  4MSP A;  2LVI A;  3I5G C;  3JTD B;  1UP5 A;  2I7A A;  3EKJ A;  1Y1X A;  1JF2 A;  2M7N A;  4OVN F;  4PDZ A;  1SMG A;  4AOM A;  1KK8 C;  2EC6 C;  1PSR A;  1N2D A;  3EVV A;  2L4I A;  4F0Z B;  2MJW B;  1XO5 A;  4C0K A;  5KSZ A;  1UUS A;  2FJU B;  2JT0 A;  4E68 A;  1M45 A;  1MXL C;  2D8N A;  2HPS A;  3O2P A;  1TCO B;  1WRZ A;  2F8P A;  2Q4U A;  1S1E A;  5AAN A;  1AK8 A;  1KFX L;  3SG6 A;  4CLN A;  3GK4 X;  2FCD A;  1GGZ A;  4ORA B;  2LHL A;  1XFV O;  2M1K B;  3VRN A;  1GJY A;  3LK1 A;  4M2P A;  4OR9 B;  1NCZ A;  1YUS A;  1BF5 A;  1KWO B;  3PLF B;  3CS1 A;  5CSF A;  1SR6 B;  4CFQ A;  1IH0 A;  2NCP A;  1NYA A;  1RRO A;  1YRU B;  1CFF A;  2CXJ A;  4AQI A;  1LIN A;  2PAL A;  2KI6 C;  3PN7 B;  4YI8 A;  2LM5 A;  1U5I B;  1CFD A;  4HRH A;  2KBI A;  1K93 D;  1CLB A;  1EXR A;  4WQ2 A;  1HQV A;  3WXA A;  1IJ5 A;  1RK9 A;  2NXQ A;  3BOW A;  1VRK A;  2BL0 C;  2K7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...