1J7QA

Solution structure and backbone dynamics of the defunct ef-hand domain of calcium vector protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
86
structure length
86
Chain Sequence
AAPKARALGPEEKDECMKIFDIFDRNAENIAPVSDTMDMLTKLGQTYTKRETEAIMKEARGPKGDKKNIGPEEWLTLCSKWVRQDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and backbone dynamics of the defunct domain of calcium vector protein.
pubmed doi rcsb
source organism Branchiostoma lanceolatum
molecule tags Metal binding protein
molecule keywords Calcium Vector Protein
total genus 21
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2001-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j7qA00
3DVKA 5K89A 1K90D 1RWYA 3A8RA 2ZRSA 1OQPA 3FWCA 3ICBA 1JC2A 1GGWA 3M0WA 2OTGC 2VRGA 1XK4A 2F3YA 2WNDA 4IL1A 3I5GC 4L9MA 3AKBA 4MRXA 3RM1A 2L98A 1AUIB 1SR6C 1LKJA 1UHKA 2GGZA 2KYFA 2LP3A 2F8PA 4ETOA 4N1FA 4OR9B 1SCVA 1DTLA 2K2FA 1IWQA 4GAOA 1XK4C 1YUUA 1IG5A 1AHRA 1FI6A 2M8UA 1JSAA 1K94A 2KGBC 1A75B 3TZ1A 4NDDA 3OB2B 4YGBB 2M9GA 3BUXB 1SNLA 1UHIA 4HREE 1CB1A 2O60A 2Y5IA 3DF0B 2P6BB 4OKHA 4YI9A 1HT9A 1KSOA 1MXLC 3LK0A 4YI8A 4M2OA 2I18A 3LL8B 3TDIA 5JJGA 2L4HA 3VRQA 2HF5A 5I2OA 1J7QA 1EG4A 4YGEB 1G33A 3DVEA 1YRTB 1LA3A 1KFUL 1KFXS 1DJZA 1NCXA 3VRRA 4AQJA 2JPTA 3KEVA 3JTDC 1CFFA 1KK8C 3EVRA 2K7CA 2KAYA 1RECA 4MLWA 1H8BA 5HKYA 4F0ZB 4ZCVA 4PE1A 4FQOA 2MLEC 3CR4X 3CZTX 1CM4A 3DVMA 2R2IA 1QLSA 4MZKA 4GPLB 3VGOA 2E6WA 5BPJA 1IGVA 1SBJA 2KI6C 4PE4A 1MR8A 1J1DA 4GGNA 3SIAA 1OMVA 1QS7A 1BF5A 1KFXL 2L2EA 3GOFA 1PSBA 2E30A 5FYXA 1QVIZ 4PHMA 1CFDA 2BKIB 3O6BA 1KWOB 1L2OC 3I5FB 3VRNA 3DF0A 1MQ1A 2CTNA 1XFYO 2M97A 3KF9A 2D8NA 2MLFC 2MAZA 2MJWB 2OPOA 1KCYA 1AJ4A 3QRXA 1ALVA 1W7JB 2KI6D 3I5IC 4GUKA 4N1GA 4USLA 2EC6B 2KHNA 1SCMC 3NSLA 4BY4A 1DT7B 1F54A 1JF2A 1FI5A 3EKHA 2WCFA 4OVNF 4I5LB 1SYMA 3BYAA 1ODBA 2FCEA 2HETA 5HLOA 4I5JA 4CLNA 3JVTC 1YR5A 1BMOA 2K7DA 2LMUA 3PN7C 4TNCA 5HKWA 4ORCB 4FTGA 4CPVA 2M1KB 1ALWA 4BY5A 2JWWA 2KAVA 1SRAA 1ZUZA 4GGFA 4HRHA 2JXCA 1KK7Z 4P2YB 1F70A 2H61A 4MVFA 2LLSA 1BU3A 2BCBA 2ZRTA 3I5HB 2WCBA 3I5HC 2M7LA 1J7PA 2ZN9A 3BOWA 1UHJA 4M2PA 1CNPA 4NDBA 3AKAA 3E3RA 3OX5A 2KBMA 1KQVA 1PSRA 4CFRA 1WDCC 3OHMB 3PN7B 1S6IA 2LUXA 3DD4A 3JVTB 5KU1A 4AQIA 1AP4A 3NXAA 2M7NA 2MA2A 1N2DA 1MF8B 2TN4A 1YX7A 2AMIA 1UHHA 3EVVA 1OMDA 2ZN8A 3EK4A 3FWBA 1CLBA 1EXRA 5D7FA 4ICBA 2LLUA 1IH0A 1WRZA 3TS5C 1SL9A 1RK9A 1MUXA 3NSKA 2JU0A 1A29A 1JUOA 2F2OA 3BOWB 5DKQA 2DOQA 5ER5A 1A2XA 1KQMC 4I5NB 2LM5A 1TNPA 3CR5X 3VROA 1B8LA 1Y1XA 4XYNA 4C0KA 1UP5A 1FF1A 1JFKA 2OS8B 4ORAB 2OS8C 2H2KA 1UWOA 1QLKA 2M29A 4WQ2A 5CSNA 1SKTA 4GGFC 1M46A 1QJTA 1K8UA 2KSPA 3IQQA 5CSFA 2KBIA 1S26D 1SK6D 5G08A 3BQ3A 2BCXA 5CSJA 1SPYA 5DKNA 3OX6A 3D0YB 1CMGA 3SJSA 2GGMA 1H4BA 3LCPC 1LVCD 1WLZA 1J7OA 4Q04A 2F33A 3TS5B 1Y1AA 1Y1UA 2WCEA 3CR2A 1B4CA 2LVKA 1ZFSA 1M63B 1UURA 2KFFA 2PALA 3WHTB 1KK8B 2KNEA 2FJUB 1S36A 1OOJA 3TDUA 1HQVA 1DVIA 1YVHA 1ZMZA 3GK4X 1RFJA 2KDHA 2V53A 4QJ5B 1WDCB 3NSIA 2I94A 4MBEA 2LLTA 1EL4A 4DCKA 3BUNB 2KGRA 2PRUA 1OSAA 3K21A 3FIAA 1YVLA 2KFHA 4PCWA 1LXFC 2FCDA 1BODA 1YUTA 1RTP1 2BKHB 5J3XA 1BR1B 1WRLA 3C1VA 1XA5A 4HSZA 4PALA 4OCIA 3OB1B 2HQWA 3CS1A 4WQ3A 1CKKA 1TCFA 1YX8A 3TDZA 1F4QA 1DJHA 3KO0A 2KQ6A 1A75A 1B8CA 2JOJA 1OZSA 2ZNDA 1F8HA 1ZACA 5KSZA 1XFXO 1FPWA 1W7IB 1N65A 1AJ5A 3I5FC 2LVIA 3EKJA 1R6PA 1UUSA 1WLMA 4QJ3B 1IQ3A 3F45A 1BT6A 3I5IB 3KHEA 1TNWA 1SL8A 1K95A 1KQMB 1DF0B 2LNKA 1DJYA 1NSHA 3ZWHA 1QVIY 2JC2A 5CSIA 1DJXA 1XFZO 1PVBA 2A4JA 1CDLA 1N0YA 2Y1NA 4DRWA 3GK2A 1YTZC 2CBLA 2JT3A 2L50A 3WHUB 4GBAA 1K2HA 2EHBA 4PE7A 3JTDB 1NPQA 1NWDA 3CTNA 4MZJA 3KPXA 1BLQA 1J55A 1GQMA 1OMRA 2LVJA 2O5GA 1CDMA 2I2RE 1ZOTB 2LV7A 2ZFDA 2K8MB 1V1FA 1CDNA 2LUCA 2WOSA 1EG3A 1X02A 3CLNA 1SMGA 1NX2A 2B1UA 2MHHA 1F71A 5AERA 4M2QA 1PALA 1FBVA 1JWDA 2LP2A 2K7BA 2RGIA 2JNFA 5I8NA 2BE4A 1NCZA 1JF0A 2KYCA 5IBWA 1V1GA 3SG7A 4C0LA 3WNXB 4A4BA 2H61C 2LC5A 1GJYA 1A03A 1QX5B 1DMOA 2CCMA 3D10A 1C7VA 2KAXA 4JPZB 1IQ5A 1DJGA 1XFVO 1Y6WA 4DIRA 1R2UA 1U5IA 1CLLA 1B7TY 3O4YA 1K96A 1SL7A 2L5XB 1DJWA 2NCOA 4N5XA 5ER4X 5HKZA 2K2AA 1S1EA 4CFQA 1K93D 3PATA 1BG1A 1C07A 1VRKA 2BL0C 4MEWA 4AOMA 4U8DA 1NX3A 3LLEA 5HYDA 4YRUA 1BJFA 1CLMA 1QATA 4DUQA 1IKUA 2NZ0A 2BCAA 2LCPA 3SG4A 2F2PA 1EJ3A 1SCMB 4XJKB 3PLFB 1AVSA 2EC6C 2G2BA 3HCMA 3H4SE 2JRFA 2QPTA 4D1EA 3O2PA 2M49B 2PMYA 3I5GB 1PVAA 2HQ8A 2JNXA 1QTXA 1SY9A 4PE0A 1MXEA 1J1EA 1FW4A 1KWOC 1L2OB 1G4YR 1CMFA 1S3PA 4GFTA 2LAPA 1TIZA 3SIBA 2L51A 3A4UB 3HX4A 1K9KA 2Y4QA 3VRPA 1UHNA 1QV0A 1KSMA 1DF0A 2KFGA 4YGAA 5F6TA 2IS9A 2KI4C 2NLNA 1XFWO 4MN0A 4YGCB 1S5GZ 1J7RA 3BXKA 2JZIA 1NYAA 1TNXA 1PULA 1QX7A 5TNCA 2NCPA 2ISDA 5AXIA 1S6JA 1QX2A 4WRIA 3ZNIA 2Q4UA 1S6CA 1Y0VH 1F55A 2LMVA 1JBAA 1IJ6A 1CM1A 1QIVA 5CPVA 1AK8A 4PDZA 1DGVA 1L7ZA 1IRJA 1LA0A 2FOTA 1TCOB 3SG5A 2G9BA 2GV5A 4ZCUA 1NX0A 1BOCA 3EVUA 1B1GA 1TN4A 4JQ0D 1MHOA 1TNQA 1S5GY 2JTZA 2AAOA 3WXAA 4OV2A 1GGZA 2LE9B 2NXQA 2JQ6A 1Q80A 1MWNA 2CNPA 3PALA 1E8AA 3D0YA 5AEQA 4I5KA 2F3ZA 1B8RA 4NDCA 3EK7A 1IJ5A 1NIWA 1SR6B 1KK7Y 3TUYB 2KQYA 1K9PA 1TTXA 3BUWB 2JT0A 2COLB 1A4PA 1QASA 2I7AA 1DGUA 4A4CA 3MSEB 1YURA 1NX1A 2M1UA 5PALA 3PSRA 2PSRA 1XVJA 2BBMA 2OTGB 2JXLA 2BE6A 1DJIA 4PHKA 1OE9B 5HLVA 2L4IA 2BECA 3SG6A 2MBXA 3GK1A 5I2LA 4PHJA 4P5OE 4GNKB 1BR4B 1PK0D 1CFPA 1B47A 1WRKA 3SG3A 3BUMB 3OP0A 2SCPA 4NQGA 1B9AA 1K9UA 2L0PA 2K0JA 5AFPA 1QIWA 1QXPA 5I2QA 1G8IA 2BL0B 3TUYC 5AANA 5DKRA 3SG2A 3LK1A 5B8IB 1NUBA 1TOPA 3CWGA 5D69A 1OZOA 1XO5A 1CDPA 1XYDA 3AAKA 2LHLA 1B7TZ 2ZNEA 1YRUB 2WORA 3BUOB 3IQOA 1JFJA 2PVBA 2Q91A 4HRGA 4YBHB 2EGDA 1M31A 4JWQA 2JULA 3IF7A 4MSPA 1QV1A 2LHIA 2MRDA 3CGAA 2HPSA 1F4OA 4C0JA 4UPGA 4QJ4B 1TRFA 2ZKMX 3NSOA 2K7OA 4MZLA 5GQQC 4DS7A 1RROA 1EH2A 1NCYA 1PRWA 4R1EA 1XFUO 1CTRA 3PFVA 3RLZA 3EK8A 4CIDA 2LMTA 3DVJA 2JT8A 2AUCA 1LINA 5JOLA 2Y1MA 1NP8A 1U5IB 4PHNA 1SW8A 2M3WA 3AAJA 4E68A 4YGDB 1CFCA 2JTTA 1KFUS 1YUSA 4ORBB 2LANA 4MRYA 2M0RA 3PM8A 2BBNA 2KOTA 2KI4B 2K61A 3FS7A 2CXJA 1WY9A 2WC8A 3O78A 5KTYA 1C7WA 4XJKA 1RJVA 2LVVA 1D1OA 2CT9A 2QACA 1M39A 1M45A 2PASA 2SASA
chains in the Genus database with same CATH superfamily
3DVKA 5K89A 1K90D 1RWYA 3A8RA 2ZRSA 1OQPA 3FWCA 3ICBA 2WCHA 1JC2A 1GGWA 3M0WA 2OTGC 2VRGA 1XK4A 2F3YA 2WNDA 4IL1A 3I5GC 3S0FA 1C3ZA 4L9MA 3AKBA 4MRXA 3RM1A 2L98A 1AUIB 1SR6C 1LKJA 1UHKA 1C3YA 2GGZA 2KYFA 2LP3A 2F8PA 4ETOA 4N1FA 4OR9B 1SCVA 1DTLA 2K2FA 1IWQA 4GAOA 3FE8A 1XK4C 1YUUA 1IG5A 1AHRA 1FI6A 2M8UA 1JSAA 3VB1A 1K94A 2KGBC 1A75B 3TZ1A 4NDDA 3OB2B 4YGBB 2M9GA 3BUXB 1SNLA 1UHIA 4HREE 1CB1A 2O60A 2Y5IA 1DEKA 3DF0B 2P6BB 4OKHA 4YI9A 1HT9A 1KSOA 1MXLC 3LK0A 4YI8A 3L4LA 2I18A 3LL8B 3NHTA 4M2OA 3TDIA 5JJGA 2L4HA 3VRQA 2HF5A 5I2OA 1J7QA 1EG4A 4YGEB 1G33A 3DVEA 1YRTB 1LA3A 1KFUL 5D3OA 1KFXS 3O4XA 1DJZA 1NCXA 3V2LA 3VRRA 3DXLA 4AQJA 2JPTA 3KEVA 3JTDC 1CFFA 1KK8C 3EVRA 2K7CA 2KAYA 1RECA 4MLWA 3S0DA 1H8BA 5HKYA 4F0ZB 4ZCVA 4PE1A 4FQOA 2MLEC 3CR4X 3CZTX 1CM4A 3DVMA 2R2IA 1QLSA 3D76A 4MZKA 4GPLB 3VGOA 1OOHA 2E6WA 5BPJA 1IGVA 1SBJA 5FI7A 2KI6C 4PE4A 1MR8A 1J1DA 4GGNA 2WCKA 3SIAA 1OMVA 1QS7A 1BF5A 1KFXL 2L2EA 3GOFA 1PSBA 2E30A 5FYXA 1QVIZ 4PHMA 1CFDA 2BKIB 3O6BA 1KWOB 1L2OC 3I5FB 3VRNA 3DF0A 1MQ1A 1ORGA 2CTNA 1XFYO 2M97A 3KF9A 2D8NA 2MLFC 2MAZA 2MJWB 2OPOA 1KCYA 1AJ4A 3QRXA 1ALVA 1W7JB 2KI6D 3I5IC 4GUKA 3R1VA 4N1GA 3D75A 4USLA 1P28A 3B86A 4FQTA 2EC6B 2KHNA 1SCMC 3NSLA 4BY4A 1DT7B 1F54A 1JF2A 1FI5A 2WCMA 3EKHA 2WCFA 4OVNF 2WC5A 4I5LB 1SYMA 3BYAA 1ODBA 2FCEA 3D77A 2HETA 5HLOA 4I5JA 2WC6A 3S0BA 4CLNA 3JVTC 1YR5A 1BMOA 2K7DA 2LMUA 3PN7C 4TNCA 5HKWA 4ORCB 4FTGA 4CPVA 2M1KB 1ALWA 3R1OA 4BY5A 2JWWA 2KAVA 1SRAA 1ZUZA 3BFAA 4GGFA 4HRHA 2JXCA 1KK7Z 5DICA 4P2YB 1F70A 2H61A 4MVFA 2LLSA 1BU3A 2BCBA 2ZRTA 3I5HB 2WCBA 3I5HC 2JPOA 2M7LA 1J7PA 2ZN9A 3BOWA 1UHJA 4M2PA 3SS4A 1CNPA 4NDBA 3AKAA 3E3RA 3OX5A 2KBMA 1KQVA 1PSRA 4CFRA 1WDCC 3OHMB 3PN7B 1S6IA 2LUXA 3DD4A 3JVTB 3DY9A 4F7FA 5KU1A 4AQIA 1AP4A 3NXAA 2M7NA 2MA2A 1N2DA 1MF8B 2TN4A 1YX7A 2AMIA 2QEOA 1UHHA 3EVVA 1OMDA 2ZN8A 3EK4A 3FWBA 2BNXA 1CLBA 1EXRA 3B88A 4ICBA 2LLUA 5D7FA 1IH0A 1WRZA 3TS5C 1SL9A 1RK9A 1MUXA 3NSKA 5FI6A 1QWVA 2JU0A 1A29A 1JUOA 2F2OA 3BOWB 5DKQA 2DOQA 5ER5A 1A2XA 1KQMC 4I5NB 2LM5A 3BJHA 1TNPA 3CR5X 3VROA 2QDIA 1B8LA 1Y1XA 4XYNA 4C0KA 1UP5A 1FF1A 1JFKA 2OS8B 4ORAB 2OS8C 2H2KA 1UWOA 1QLKA 2M29A 4WQ2A 5CSNA 1SKTA 1LS8A 4GGFC 1M46A 1QJTA 1K8UA 2KSPA 3IQQA 5CSFA 3SS5A 2KBIA 1S26D 3K1EA 1SK6D 5G08A 3BQ3A 2BCXA 5CSJA 1SPYA 5DKNA 3OX6A 3D0YB 1CMGA 3SJSA 1Z2CB 2GGMA 1H4BA 3LCPC 1LVCD 1WLZA 1J7OA 4Q04A 1W9ZA 2F33A 4JD9A 1Y1AA 1Y1UA 2WCEA 3CR2A 3TS5B 3PM2A 1B4CA 2LVKA 1ZFSA 1M63B 1UURA 2KFFA 2PALA 3WHTB 1KK8B 2KNEA 2FJUB 1S36A 1OOJA 3TDUA 1HQVA 1DVIA 1YVHA 1ZMZA 2K60A 3DZTA 1RFJA 3B87A 3GK4X 2KDHA 2V53A 4IJ7A 3UNWA 4QJ5B 1WDCB 3NSIA 2I94A 4MBEA 2LLTA 1EL4A 3B6XA 3BUNB 4DCKA 2KGRA 2PRUA 1OSAA 3K21A 3EG5B 3CZ1A 3FIAA 1YVLA 3D73A 2KFHA 4PCWA 2H8VA 1LXFC 3OGNA 2FCDA 2ERBA 3UO9A 1BODA 1YUTA 1RTP1 2BKHB 5J3XA 1BR1B 1WRLA 3C1VA 1XA5A 4HSZA 4PALA 1Z4HA 3OB1B 2HQWA 2P70A 3CS1A 4OCIA 1TCFA 4WQ3A 1YX8A 3TDZA 2KLDA 1DQEA 1F4QA 1DJHA 3KO0A 2KQ6A 3S0EA 1A75A 1B8CA 2JOJA 1OZSA 2ZNDA 1F8HA 1ZACA 1XFRA 5KSZA 1XFXO 1FPWA 1W7IB 1N65A 2KPHA 1AJ5A 3NGVA 3I5FC 2LVIA 3EKJA 3QMEA 1R6PA 1UUSA 1WLMA 4QJ3B 1IQ3A 3F45A 1BT6A 3I5IB 3KHEA 1TNWA 1SL8A 1K95A 1KQMB 1DF0B 2LNKA 1DJYA 1NSHA 3ZWHA 1QVIY 2JC2A 5CSIA 1DJXA 1XFZO 1PVBA 2A4JA 1CDLA 1N0YA 2Y1NA 4DRWA 3GK2A 1GM0A 1YTZC 2CBLA 2JT3A 2L50A 3WHUB 1DC1A 4GBAA 1K2HA 2EHBA 4PE7A 3JTDB 1NPQA 1NWDA 3BFHA 3CTNA 3OBVA 4MZJA 3KPXA 1BLQA 1J55A 1GQMA 1OMRA 2LVJA 2O5GA 1CDMA 2I2RE 3CZ2A 1ZOTB 2LV7A 2ZFDA 2K8MB 1V1FA 1CDNA 2LUCA 2WOSA 1EG3A 1X02A 3CLNA 1SMGA 1NX2A 2B1UA 2MHHA 3S0AA 1F71A 5AERA 4M2QA 1PALA 1FBVA 1JWDA 2LP2A 2K7BA 2RGIA 2JNFA 4JKTA 5I8NA 2BE4A 1NCZA 1JF0A 2KYCA 3Q8IA 5IBWA 1V1GA 3SG7A 4C0LA 3WNXB 4A4BA 2H61C 2LC5A 5I94A 1GJYA 1A03A 1QX5B 2FJYA 2CCMA 3L47A 3D10A 1DMOA 3IVTA 1OOIX 1C7VA 2KAXA 4JPZB 1IQ5A 1DJGA 1XFVO 4OZDA 1Y6WA 4DIRA 1R2UA 1U5IA 1CLLA 1B7TY 3O4YA 1K96A 1SL7A 2L5XB 1DJWA 2GTEA 2NCOA 4N5XA 5ER4X 2K2AA 1S1EA 5HKZA 1K93D 3PATA 4CFQA 1BG1A 3FE9A 1C07A 1VRKA 2BL0C 4MEWA 4AOMA 4U8DA 1NX3A 3B7AA 3LLEA 5HYDA 2L5YA 4YRUA 5EL2A 1BJFA 3S0GA 1CLMA 1QATA 4DUQA 1IKUA 2NZ0A 2BCAA 2LCPA 3SG4A 2F2PA 1EJ3A 1SCMB 4XJKB 3PLFB 1AVSA 2EC6C 2G2BA 3HCMA 3CYZA 3H4SE 3RZSA 2JRFA 2QPTA 4D1EA 3O2PA 2M49B 2PMYA 3I5GB 1PVAA 2HQ8A 2JNXA 1QTXA 1SY9A 4PE0A 1MXEA 4PT1A 1J1EA 1FW4A 1KWOC 1L2OB 1G4YR 1CMFA 2PYQA 1S3PA 1TWOA 3CDNA 4GFTA 2LAPA 1TIZA 3SIBA 1CKKA 2L51A 3A4UB 3HX4A 1K9KA 3DYEA 2Y4QA 3VRPA 1TUZA 1UHNA 2YGUA 3CZ0A 1QV0A 1KSMA 1DF0A 2KFGA 4YGAA 5F6TA 2IS9A 2KI4C 3R1PA 2NLNA 1XFWO 4MN0A 4YGCB 1S5GZ 1J7RA 3BXKA 3NHIA 2JZIA 1NYAA 5HL1A 1TNXA 2QEBA 2L2CA 1PULA 1QX7A 5TNCA 2NCPA 2ISDA 1OOFA 3PJIA 3CABA 1S6JA 5AXIA 3R72A 1QX2A 4WRIA 3ZNIA 2Q4UA 1DELA 1S6CA 1Y0VH 1F55A 2WCJA 2LMVA 1JBAA 1TUJA 1IJ6A 1CM1A 1QIVA 5CPVA 1AK8A 2QEHA 4PDZA 1DGVA 1L7ZA 1IRJA 3SS3A 1LA0A 2FOTA 1TCOB 3SG5A 2G9BA 2GV5A 4ZCUA 2P71A 1NX0A 1BOCA 3EVUA 1B1GA 1TN4A 4JQ0D 1MHOA 1TNQA 1S5GY 2JTZA 2AAOA 3D74A 3WXAA 4OV2A 1GGZA 2LE9B 2KLEA 2NXQA 2JQ6A 1Q80A 1MWNA 2CNPA 3PALA 1E8AA 3D0YA 5AEQA 2WCLA 2F3ZA 1B8RA 4I5KA 4NDCA 5FI2A 3EK7A 1IJ5A 1NIWA 1SR6B 1KK7Y 3TUYB 2KQYA 1K9PA 1TTXA 3BUWB 2JT0A 2COLB 1A4PA 1QASA 2I7AA 1DGUA 4A4CA 3MSEB 1YURA 1NX1A 2M1UA 5PALA 3PSRA 2PSRA 1XVJA 2BBMA 2OTGB 2JXLA 2BE6A 1DJIA 4PHKA 1OE9B 5HLVA 2L4IA 2BECA 3SG6A 2MBXA 3GK1A 5I2LA 3D78A 4PHJA 4P5OE 4INXA 4GNKB 1BR4B 1PK0D 1CFPA 1B47A 1WRKA 3SG3A 1T14A 3BUMB 3OP0A 2SCPA 4NQGA 1B9AA 1K9UA 2L0PA 2K0JA 5AFPA 1QIWA 1QXPA 5I2QA 1G8IA 3L4AA 2BL0B 3TUYC 5AANA 5DKRA 3SG2A 3LK1A 5B8IB 1NUBA 1TOPA 3CWGA 5D69A 1OZOA 1XO5A 1CDPA 1XYDA 3AAKA 2LHLA 1B7TZ 2ZNEA 1YRUB 2WORA 3BUOB 3IQOA 1JFJA 2PVBA 2Q91A 4HRGA 4YBHB 2EGDA 1M31A 4JWQA 2JULA 3IF7A 4MSPA 1QV1A 2LHIA 2MRDA 3BFBA 4KYNA 4INWA 3CGAA 2HPSA 1F4OA 4C0JA 4UPGA 3N7HA 4QJ4B 1TRFA 2ZKMX 3NSOA 2K7OA 4MZLA 5GQQC 4DS7A 1RROA 1OOGA 2BAPA 1EH2A 1NCYA 1PRWA 4R1EA 1XFUO 1CTRA 3FE6A 3PFVA 3RLZA 3EK8A 4CIDA 2LMTA 2QEVA 3DVJA 2JT8A 2AUCA 1LINA 5JOLA 2Y1MA 1NP8A 1OW4A 1SSEB 1U5IB 4PHNA 1SW8A 2M3WA 3AAJA 4E68A 4YGDB 2PQLA 1CFCA 2JTTA 1KFUS 1YUSA 4ORBB 2LANA 4MRYA 2M0RA 3PM8A 2BBNA 2KOTA 2KI4B 2K61A 3FS7A 2CXJA 1WY9A 2WC8A 3O78A 5KTYA 1IIOA 1C7WA 4XJKA 1RJVA 2LVVA 1D1OA 2CT9A 2QACA 1M39A 1M45A 2PASA 2SASA
chains in the Genus database with same CATH topology
3DVKA 5K89A 1K90D 1RWYA 3A8RA 2ZRSA 1OQPA 3FWCA 3ICBA 1JC2A 1GGWA 3M0WA 2OTGC 2VRGA 1XK4A 2F3YA 2WNDA 4IL1A 3I5GC 4L9MA 3AKBA 4MRXA 3RM1A 2L98A 1AUIB 1SR6C 1LKJA 1UHKA 2GGZA 2KYFA 2LP3A 2F8PA 4ETOA 4N1FA 4OR9B 1SCVA 1DTLA 2K2FA 1IWQA 4GAOA 1XK4C 1YUUA 1IG5A 1AHRA 1FI6A 2M8UA 1JSAA 1K94A 2KGBC 1A75B 3TZ1A 4NDDA 3OB2B 4YGBB 2M9GA 3BUXB 1SNLA 1UHIA 4HREE 1CB1A 2O60A 2Y5IA 3DF0B 2P6BB 4OKHA 4YI9A 1HT9A 1KSOA 1MXLC 3LK0A 4YI8A 4M2OA 2I18A 3LL8B 3TDIA 5JJGA 2L4HA 3VRQA 2HF5A 5I2OA 1J7QA 1EG4A 4YGEB 1G33A 3DVEA 1YRTB 1LA3A 1KFUL 1KFXS 1DJZA 1NCXA 3VRRA 4AQJA 2JPTA 3KEVA 3JTDC 1CFFA 1KK8C 3EVRA 2K7CA 2KAYA 1RECA 4MLWA 1H8BA 5HKYA 4F0ZB 4ZCVA 4PE1A 4FQOA 2MLEC 3CR4X 3CZTX 1CM4A 3DVMA 2R2IA 1QLSA 4MZKA 4GPLB 3VGOA 2E6WA 5BPJA 1IGVA 1SBJA 2KI6C 4PE4A 1MR8A 1J1DA 4GGNA 3SIAA 1OMVA 1QS7A 1BF5A 1KFXL 2L2EA 3GOFA 1PSBA 2E30A 5FYXA 1QVIZ 4PHMA 1CFDA 2BKIB 3O6BA 1KWOB 1L2OC 3I5FB 3VRNA 3DF0A 1MQ1A 2CTNA 1XFYO 2M97A 3KF9A 2D8NA 2MLFC 2MAZA 2MJWB 2OPOA 1KCYA 1AJ4A 3QRXA 1ALVA 1W7JB 2KI6D 3I5IC 4GUKA 4N1GA 4USLA 2EC6B 2KHNA 1SCMC 3NSLA 4BY4A 1DT7B 1F54A 1JF2A 1FI5A 3EKHA 2WCFA 4OVNF 4I5LB 1SYMA 3BYAA 1ODBA 2FCEA 2HETA 5HLOA 4I5JA 4CLNA 3JVTC 1YR5A 1BMOA 2K7DA 2LMUA 3PN7C 4TNCA 5HKWA 4ORCB 4FTGA 4CPVA 2M1KB 1ALWA 4BY5A 2JWWA 2KAVA 1SRAA 1ZUZA 4GGFA 4HRHA 2JXCA 1KK7Z 4P2YB 1F70A 2H61A 4MVFA 2LLSA 1BU3A 2BCBA 2ZRTA 3I5HB 2WCBA 3I5HC 2M7LA 1J7PA 2ZN9A 3BOWA 1UHJA 4M2PA 1CNPA 4NDBA 3AKAA 3E3RA 3OX5A 2KBMA 1KQVA 1PSRA 4CFRA 1WDCC 3OHMB 3PN7B 1S6IA 2LUXA 3DD4A 3JVTB 5KU1A 4AQIA 1AP4A 3NXAA 2M7NA 2MA2A 1N2DA 1MF8B 2TN4A 1YX7A 2AMIA 1UHHA 3EVVA 1OMDA 2ZN8A 3EK4A 3FWBA 1CLBA 1EXRA 5D7FA 4ICBA 2LLUA 1IH0A 1WRZA 3TS5C 1SL9A 1RK9A 1MUXA 3NSKA 2JU0A 1A29A 1JUOA 2F2OA 3BOWB 5DKQA 2DOQA 5ER5A 1A2XA 1KQMC 4I5NB 2LM5A 1TNPA 3CR5X 3VROA 1B8LA 1Y1XA 4XYNA 4C0KA 1UP5A 1FF1A 1JFKA 2OS8B 4ORAB 2OS8C 2H2KA 1UWOA 1QLKA 2M29A 4WQ2A 5CSNA 1SKTA 4GGFC 1M46A 1QJTA 1K8UA 2KSPA 3IQQA 5CSFA 2KBIA 1S26D 1SK6D 5G08A 3BQ3A 2BCXA 5CSJA 1SPYA 5DKNA 3OX6A 3D0YB 1CMGA 3SJSA 2GGMA 1H4BA 3LCPC 1LVCD 1WLZA 1J7OA 4Q04A 2F33A 3TS5B 1Y1AA 1Y1UA 2WCEA 3CR2A 1B4CA 2LVKA 1ZFSA 1M63B 1UURA 2KFFA 2PALA 3WHTB 1KK8B 2KNEA 2FJUB 1S36A 1OOJA 3TDUA 1HQVA 1DVIA 1YVHA 1ZMZA 3GK4X 1RFJA 2KDHA 2V53A 4QJ5B 1WDCB 3NSIA 2I94A 4MBEA 2LLTA 1EL4A 4DCKA 3BUNB 2KGRA 2PRUA 1OSAA 3K21A 3FIAA 1YVLA 2KFHA 4PCWA 1LXFC 2FCDA 1BODA 1YUTA 1RTP1 2BKHB 5J3XA 1BR1B 1WRLA 3C1VA 1XA5A 4HSZA 4PALA 4OCIA 3OB1B 2HQWA 3CS1A 4WQ3A 1CKKA 1TCFA 1YX8A 3TDZA 1F4QA 1DJHA 3KO0A 2KQ6A 1A75A 1B8CA 2JOJA 1OZSA 2ZNDA 1F8HA 1ZACA 5KSZA 1XFXO 1FPWA 1W7IB 1N65A 1AJ5A 3I5FC 2LVIA 3EKJA 1R6PA 1UUSA 1WLMA 4QJ3B 1IQ3A 3F45A 1BT6A 3I5IB 3KHEA 1TNWA 1SL8A 1K95A 1KQMB 1DF0B 2LNKA 1DJYA 1NSHA 3ZWHA 1QVIY 2JC2A 5CSIA 1DJXA 1XFZO 1PVBA 2A4JA 1CDLA 1N0YA 2Y1NA 4DRWA 3GK2A 1YTZC 2CBLA 2JT3A 2L50A 3WHUB 4GBAA 1K2HA 2EHBA 4PE7A 3JTDB 1NPQA 1NWDA 3CTNA 4MZJA 3KPXA 1BLQA 1J55A 1GQMA 1OMRA 2LVJA 2O5GA 1CDMA 2I2RE 1ZOTB 2LV7A 2ZFDA 2K8MB 1V1FA 1CDNA 2LUCA 2WOSA 1EG3A 1X02A 3CLNA 1SMGA 1NX2A 2B1UA 2MHHA 1F71A 5AERA 4M2QA 1PALA 1FBVA 1JWDA 2LP2A 2K7BA 2RGIA 2JNFA 5I8NA 2BE4A 1NCZA 1JF0A 2KYCA 5IBWA 1V1GA 3SG7A 4C0LA 3WNXB 4A4BA 2H61C 2LC5A 1GJYA 1A03A 1QX5B 1DMOA 2CCMA 3D10A 1C7VA 2KAXA 4JPZB 1IQ5A 1DJGA 1XFVO 1Y6WA 4DIRA 1R2UA 1U5IA 1CLLA 1B7TY 3O4YA 1K96A 1SL7A 2L5XB 1DJWA 2NCOA 4N5XA 5ER4X 5HKZA 2K2AA 1S1EA 4CFQA 1K93D 3PATA 1BG1A 1C07A 1VRKA 2BL0C 4MEWA 4AOMA 4U8DA 1NX3A 3LLEA 5HYDA 4YRUA 1BJFA 1CLMA 1QATA 4DUQA 1IKUA 2NZ0A 2BCAA 2LCPA 3SG4A 2F2PA 1EJ3A 1SCMB 4XJKB 3PLFB 1AVSA 2EC6C 2G2BA 3HCMA 3H4SE 2JRFA 2QPTA 4D1EA 3O2PA 2M49B 2PMYA 3I5GB 1PVAA 2HQ8A 2JNXA 1QTXA 1SY9A 4PE0A 1MXEA 1J1EA 1FW4A 1KWOC 1L2OB 1G4YR 1CMFA 1S3PA 4GFTA 2LAPA 1TIZA 3SIBA 2L51A 3A4UB 3HX4A 1K9KA 2Y4QA 3VRPA 1UHNA 1QV0A 1KSMA 1DF0A 2KFGA 4YGAA 5F6TA 2IS9A 2KI4C 2NLNA 1XFWO 4MN0A 4YGCB 1S5GZ 1J7RA 3BXKA 2JZIA 1NYAA 1TNXA 1PULA 1QX7A 5TNCA 2NCPA 2ISDA 5AXIA 1S6JA 1QX2A 4WRIA 3ZNIA 2Q4UA 1S6CA 1Y0VH 1F55A 2LMVA 1JBAA 1IJ6A 1CM1A 1QIVA 5CPVA 1AK8A 4PDZA 1DGVA 1L7ZA 1IRJA 1LA0A 2FOTA 1TCOB 3SG5A 2G9BA 2GV5A 4ZCUA 1NX0A 1BOCA 3EVUA 1B1GA 1TN4A 4JQ0D 1MHOA 1TNQA 1S5GY 2JTZA 2AAOA 3WXAA 4OV2A 1GGZA 2LE9B 2NXQA 2JQ6A 1Q80A 1MWNA 2CNPA 3PALA 1E8AA 3D0YA 5AEQA 4I5KA 2F3ZA 1B8RA 4NDCA 3EK7A 1IJ5A 1NIWA 1SR6B 1KK7Y 3TUYB 2KQYA 1K9PA 1TTXA 3BUWB 2JT0A 2COLB 1A4PA 1QASA 2I7AA 1DGUA 4A4CA 3MSEB 1YURA 1NX1A 2M1UA 5PALA 3PSRA 2PSRA 1XVJA 2BBMA 2OTGB 2JXLA 2BE6A 1DJIA 4PHKA 1OE9B 5HLVA 2L4IA 2BECA 3SG6A 2MBXA 3GK1A 5I2LA 4PHJA 4P5OE 4GNKB 1BR4B 1PK0D 1CFPA 1B47A 1WRKA 3SG3A 3BUMB 3OP0A 2SCPA 4NQGA 1B9AA 1K9UA 2L0PA 2K0JA 5AFPA 1QIWA 1QXPA 5I2QA 1G8IA 2BL0B 3TUYC 5AANA 5DKRA 3SG2A 3LK1A 5B8IB 1NUBA 1TOPA 3CWGA 5D69A 1OZOA 1XO5A 1CDPA 1XYDA 3AAKA 2LHLA 1B7TZ 2ZNEA 1YRUB 2WORA 3BUOB 3IQOA 1JFJA 2PVBA 2Q91A 4HRGA 4YBHB 2EGDA 1M31A 4JWQA 2JULA 3IF7A 4MSPA 1QV1A 2LHIA 2MRDA 3CGAA 2HPSA 1F4OA 4C0JA 4UPGA 4QJ4B 1TRFA 2ZKMX 3NSOA 2K7OA 4MZLA 5GQQC 4DS7A 1RROA 1EH2A 1NCYA 1PRWA 4R1EA 1XFUO 1CTRA 3PFVA 3RLZA 3EK8A 4CIDA 2LMTA 3DVJA 2JT8A 2AUCA 1LINA 5JOLA 2Y1MA 1NP8A 1U5IB 4PHNA 1SW8A 2M3WA 3AAJA 4E68A 4YGDB 1CFCA 2JTTA 1KFUS 1YUSA 4ORBB 2LANA 4MRYA 2M0RA 3PM8A 2BBNA 2KOTA 2KI4B 2K61A 3FS7A 2CXJA 1WY9A 2WC8A 3O78A 5KTYA 1C7WA 4XJKA 1RJVA 2LVVA 1D1OA 2CT9A 2QACA 1M39A 1M45A 2PASA 2SASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVK A;  5K89 A;  1K90 D;  1RWY A;  3A8R A;  2ZRS A;  1OQP A;  3FWC A;  3ICB A;  1JC2 A;  1GGW A;  3M0W A;  2OTG C;  2VRG A;  1XK4 A;  2F3Y A;  2WND A;  4IL1 A;  3I5G C;  4L9M A;  3AKB A;  4MRX A;  3RM1 A;  2L98 A;  1AUI B;  1SR6 C;  1LKJ A;  1UHK A;  2GGZ A;  2KYF A;  2LP3 A;  2F8P A;  4ETO A;  4N1F A;  4OR9 B;  1SCV A;  1DTL A;  2K2F A;  1IWQ A;  4GAO A;  1XK4 C;  1YUU A;  1IG5 A;  1AHR A;  1FI6 A;  2M8U A;  1JSA A;  1K94 A;  2KGB C;  1A75 B;  3TZ1 A;  4NDD A;  3OB2 B;  4YGB B;  2M9G A;  3BUX B;  1SNL A;  1UHI A;  4HRE E;  1CB1 A;  2O60 A;  2Y5I A;  3DF0 B;  2P6B B;  4OKH A;  4YI9 A;  1HT9 A;  1KSO A;  1MXL C;  3LK0 A;  4YI8 A;  4M2O A;  2I18 A;  3LL8 B;  3TDI A;  5JJG A;  2L4H A;  3VRQ A;  2HF5 A;  5I2O A;  1J7Q A;  1EG4 A;  4YGE B;  1G33 A;  3DVE A;  1YRT B;  1LA3 A;  1KFU L;  1KFX S;  1DJZ A;  1NCX A;  3VRR A;  4AQJ A;  2JPT A;  3KEV A;  3JTD C;  1CFF A;  1KK8 C;  3EVR A;  2K7C A;  2KAY A;  1REC A;  4MLW A;  1H8B A;  5HKY A;  4F0Z B;  4ZCV A;  4PE1 A;  4FQO A;  2MLE C;  3CR4 X;  3CZT X;  1CM4 A;  3DVM A;  2R2I A;  1QLS A;  4MZK A;  4GPL B;  3VGO A;  2E6W A;  5BPJ A;  1IGV A;  1SBJ A;  2KI6 C;  4PE4 A;  1MR8 A;  1J1D A;  4GGN A;  3SIA A;  1OMV A;  1QS7 A;  1BF5 A;  1KFX L;  2L2E A;  3GOF A;  1PSB A;  2E30 A;  5FYX A;  1QVI Z;  4PHM A;  1CFD A;  2BKI B;  3O6B A;  1KWO B;  1L2O C;  3I5F B;  3VRN A;  3DF0 A;  1MQ1 A;  2CTN A;  1XFY O;  2M97 A;  3KF9 A;  2D8N A;  2MLF C;  2MAZ A;  2MJW B;  2OPO A;  1KCY A;  1AJ4 A;  3QRX A;  1ALV A;  1W7J B;  2KI6 D;  3I5I C;  4GUK A;  4N1G A;  4USL A;  2EC6 B;  2KHN A;  1SCM C;  3NSL A;  4BY4 A;  1DT7 B;  1F54 A;  1JF2 A;  1FI5 A;  3EKH A;  2WCF A;  4OVN F;  4I5L B;  1SYM A;  3BYA A;  1ODB A;  2FCE A;  2HET A;  5HLO A;  4I5J A;  4CLN A;  3JVT C;  1YR5 A;  1BMO A;  2K7D A;  2LMU A;  3PN7 C;  4TNC A;  5HKW A;  4ORC B;  4FTG A;  4CPV A;  2M1K B;  1ALW A;  4BY5 A;  2JWW A;  2KAV A;  1SRA A;  1ZUZ A;  4GGF A;  4HRH A;  2JXC A;  1KK7 Z;  4P2Y B;  1F70 A;  2H61 A;  4MVF A;  2LLS A;  1BU3 A;  2BCB A;  2ZRT A;  3I5H B;  2WCB A;  3I5H C;  2M7L A;  1J7P A;  2ZN9 A;  3BOW A;  1UHJ A;  4M2P A;  1CNP A;  4NDB A;  3AKA A;  3E3R A;  3OX5 A;  2KBM A;  1KQV A;  1PSR A;  4CFR A;  1WDC C;  3OHM B;  3PN7 B;  1S6I A;  2LUX A;  3DD4 A;  3JVT B;  5KU1 A;  4AQI A;  1AP4 A;  3NXA A;  2M7N A;  2MA2 A;  1N2D A;  1MF8 B;  2TN4 A;  1YX7 A;  2AMI A;  1UHH A;  3EVV A;  1OMD A;  2ZN8 A;  3EK4 A;  3FWB A;  1CLB A;  1EXR A;  5D7F A;  4ICB A;  2LLU A;  1IH0 A;  1WRZ A;  3TS5 C;  1SL9 A;  1RK9 A;  1MUX A;  3NSK A;  2JU0 A;  1A29 A;  1JUO A;  2F2O A;  3BOW B;  5DKQ A;  2DOQ A;  5ER5 A;  1A2X A;  1KQM C;  4I5N B;  2LM5 A;  1TNP A;  3CR5 X;  3VRO A;  1B8L A;  1Y1X A;  4XYN A;  4C0K A;  1UP5 A;  1FF1 A;  1JFK A;  2OS8 B;  4ORA B;  2OS8 C;  2H2K A;  1UWO A;  1QLK A;  2M29 A;  4WQ2 A;  5CSN A;  1SKT A;  4GGF C;  1M46 A;  1QJT A;  1K8U A;  2KSP A;  3IQQ A;  5CSF A;  2KBI A;  1S26 D;  1SK6 D;  5G08 A;  3BQ3 A;  2BCX A;  5CSJ A;  1SPY A;  5DKN A;  3OX6 A;  3D0Y B;  1CMG A;  3SJS A;  2GGM A;  1H4B A;  3LCP C;  1LVC D;  1WLZ A;  1J7O A;  4Q04 A;  2F33 A;  3TS5 B;  1Y1A A;  1Y1U A;  2WCE A;  3CR2 A;  1B4C A;  2LVK A;  1ZFS A;  1M63 B;  1UUR A;  2KFF A;  2PAL A;  3WHT B;  1KK8 B;  2KNE A;  2FJU B;  1S36 A;  1OOJ A;  3TDU A;  1HQV A;  1DVI A;  1YVH A;  1ZMZ A;  3GK4 X;  1RFJ A;  2KDH A;  2V53 A;  4QJ5 B;  1WDC B;  3NSI A;  2I94 A;  4MBE A;  2LLT A;  1EL4 A;  4DCK A;  3BUN B;  2KGR A;  2PRU A;  1OSA A;  3K21 A;  3FIA A;  1YVL A;  2KFH A;  4PCW A;  1LXF C;  2FCD A;  1BOD A;  1YUT A;  1RTP 1;  2BKH B;  5J3X A;  1BR1 B;  1WRL A;  3C1V A;  1XA5 A;  4HSZ A;  4PAL A;  4OCI A;  3OB1 B;  2HQW A;  3CS1 A;  4WQ3 A;  1CKK A;  1TCF A;  1YX8 A;  3TDZ A;  1F4Q A;  1DJH A;  3KO0 A;  2KQ6 A;  1A75 A;  1B8C A;  2JOJ A;  1OZS A;  2ZND A;  1F8H A;  1ZAC A;  5KSZ A;  1XFX O;  1FPW A;  1W7I B;  1N65 A;  1AJ5 A;  3I5F C;  2LVI A;  3EKJ A;  1R6P A;  1UUS A;  1WLM A;  4QJ3 B;  1IQ3 A;  3F45 A;  1BT6 A;  3I5I B;  3KHE A;  1TNW A;  1SL8 A;  1K95 A;  1KQM B;  1DF0 B;  2LNK A;  1DJY A;  1NSH A;  3ZWH A;  1QVI Y;  2JC2 A;  5CSI A;  1DJX A;  1XFZ O;  1PVB A;  2A4J A;  1CDL A;  1N0Y A;  2Y1N A;  4DRW A;  3GK2 A;  1YTZ C;  2CBL A;  2JT3 A;  2L50 A;  3WHU B;  4GBA A;  1K2H A;  2EHB A;  4PE7 A;  3JTD B;  1NPQ A;  1NWD A;  3CTN A;  4MZJ A;  3KPX A;  1BLQ A;  1J55 A;  1GQM A;  1OMR A;  2LVJ A;  2O5G A;  1CDM A;  2I2R E;  1ZOT B;  2LV7 A;  2ZFD A;  2K8M B;  1V1F A;  1CDN A;  2LUC A;  2WOS A;  1EG3 A;  1X02 A;  3CLN A;  1SMG A;  1NX2 A;  2B1U A;  2MHH A;  1F71 A;  5AER A;  4M2Q A;  1PAL A;  1FBV A;  1JWD A;  2LP2 A;  2K7B A;  2RGI A;  2JNF A;  5I8N A;  2BE4 A;  1NCZ A;  1JF0 A;  2KYC A;  5IBW A;  1V1G A;  3SG7 A;  4C0L A;  3WNX B;  4A4B A;  2H61 C;  2LC5 A;  1GJY A;  1A03 A;  1QX5 B;  1DMO A;  2CCM A;  3D10 A;  1C7V A;  2KAX A;  4JPZ B;  1IQ5 A;  1DJG A;  1XFV O;  1Y6W A;  4DIR A;  1R2U A;  1U5I A;  1CLL A;  1B7T Y;  3O4Y A;  1K96 A;  1SL7 A;  2L5X B;  1DJW A;  2NCO A;  4N5X A;  5ER4 X;  5HKZ A;  2K2A A;  1S1E A;  4CFQ A;  1K93 D;  3PAT A;  1BG1 A;  1C07 A;  1VRK A;  2BL0 C;  4MEW A;  4AOM A;  4U8D A;  1NX3 A;  3LLE A;  5HYD A;  4YRU A;  1BJF A;  1CLM A;  1QAT A;  4DUQ A;  1IKU A;  2NZ0 A;  2BCA A;  2LCP A;  3SG4 A;  2F2P A;  1EJ3 A;  1SCM B;  4XJK B;  3PLF B;  1AVS A;  2EC6 C;  2G2B A;  3HCM A;  3H4S E;  2JRF A;  2QPT A;  4D1E A;  3O2P A;  2M49 B;  2PMY A;  3I5G B;  1PVA A;  2HQ8 A;  2JNX A;  1QTX A;  1SY9 A;  4PE0 A;  1MXE A;  1J1E A;  1FW4 A;  1KWO C;  1L2O B;  1G4Y R;  1CMF A;  1S3P A;  4GFT A;  2LAP A;  1TIZ A;  3SIB A;  2L51 A;  3A4U B;  3HX4 A;  1K9K A;  2Y4Q A;  3VRP A;  1UHN A;  1QV0 A;  1KSM A;  1DF0 A;  2KFG A;  4YGA A;  5F6T A;  2IS9 A;  2KI4 C;  2NLN A;  1XFW O;  4MN0 A;  4YGC B;  1S5G Z;  1J7R A;  3BXK A;  2JZI A;  1NYA A;  1TNX A;  1PUL A;  1QX7 A;  5TNC A;  2NCP A;  2ISD A;  5AXI A;  1S6J A;  1QX2 A;  4WRI A;  3ZNI A;  2Q4U A;  1S6C A;  1Y0V H;  1F55 A;  2LMV A;  1JBA A;  1IJ6 A;  1CM1 A;  1QIV A;  5CPV A;  1AK8 A;  4PDZ A;  1DGV A;  1L7Z A;  1IRJ A;  1LA0 A;  2FOT A;  1TCO B;  3SG5 A;  2G9B A;  2GV5 A;  4ZCU A;  1NX0 A;  1BOC A;  3EVU A;  1B1G A;  1TN4 A;  4JQ0 D;  1MHO A;  1TNQ A;  1S5G Y;  2JTZ A;  2AAO A;  3WXA A;  4OV2 A;  1GGZ A;  2LE9 B;  2NXQ A;  2JQ6 A;  1Q80 A;  1MWN A;  2CNP A;  3PAL A;  1E8A A;  3D0Y A;  5AEQ A;  4I5K A;  2F3Z A;  1B8R A;  4NDC A;  3EK7 A;  1IJ5 A;  1NIW A;  1SR6 B;  1KK7 Y;  3TUY B;  2KQY A;  1K9P A;  1TTX A;  3BUW B;  2JT0 A;  2COL B;  1A4P A;  1QAS A;  2I7A A;  1DGU A;  4A4C A;  3MSE B;  1YUR A;  1NX1 A;  2M1U A;  5PAL A;  3PSR A;  2PSR A;  1XVJ A;  2BBM A;  2OTG B;  2JXL A;  2BE6 A;  1DJI A;  4PHK A;  1OE9 B;  5HLV A;  2L4I A;  2BEC A;  3SG6 A;  2MBX A;  3GK1 A;  5I2L A;  4PHJ A;  4P5O E;  4GNK B;  1BR4 B;  1PK0 D;  1CFP A;  1B47 A;  1WRK A;  3SG3 A;  3BUM B;  3OP0 A;  2SCP A;  4NQG A;  1B9A A;  1K9U A;  2L0P A;  2K0J A;  5AFP A;  1QIW A;  1QXP A;  5I2Q A;  1G8I A;  2BL0 B;  3TUY C;  5AAN A;  5DKR A;  3SG2 A;  3LK1 A;  5B8I B;  1NUB A;  1TOP A;  3CWG A;  5D69 A;  1OZO A;  1XO5 A;  1CDP A;  1XYD A;  3AAK A;  2LHL A;  1B7T Z;  2ZNE A;  1YRU B;  2WOR A;  3BUO B;  3IQO A;  1JFJ A;  2PVB A;  2Q91 A;  4HRG A;  4YBH B;  2EGD A;  1M31 A;  4JWQ A;  2JUL A;  3IF7 A;  4MSP A;  1QV1 A;  2LHI A;  2MRD A;  3CGA A;  2HPS A;  1F4O A;  4C0J A;  4UPG A;  4QJ4 B;  1TRF A;  2ZKM X;  3NSO A;  2K7O A;  4MZL A;  5GQQ C;  4DS7 A;  1RRO A;  1EH2 A;  1NCY A;  1PRW A;  4R1E A;  1XFU O;  1CTR A;  3PFV A;  3RLZ A;  3EK8 A;  4CID A;  2LMT A;  3DVJ A;  2JT8 A;  2AUC A;  1LIN A;  5JOL A;  2Y1M A;  1NP8 A;  1U5I B;  4PHN A;  1SW8 A;  2M3W A;  3AAJ A;  4E68 A;  4YGD B;  1CFC A;  2JTT A;  1KFU S;  1YUS A;  4ORB B;  2LAN A;  4MRY A;  2M0R A;  3PM8 A;  2BBN A;  2KOT A;  2KI4 B;  2K61 A;  3FS7 A;  2CXJ A;  1WY9 A;  2WC8 A;  3O78 A;  5KTY A;  1C7W A;  4XJK A;  1RJV A;  2LVV A;  1D1O A;  2CT9 A;  2QAC A;  1M39 A;  1M45 A;  2PAS A;  2SAS A; 
#chains in the Genus database with same CATH topology
 3DVK A;  5K89 A;  1K90 D;  1RWY A;  3A8R A;  2ZRS A;  1OQP A;  3FWC A;  3ICB A;  2WCH A;  1JC2 A;  1GGW A;  3M0W A;  2OTG C;  2VRG A;  1XK4 A;  2F3Y A;  2WND A;  4IL1 A;  3I5G C;  3S0F A;  1C3Z A;  4L9M A;  3AKB A;  4MRX A;  3RM1 A;  2L98 A;  1AUI B;  1SR6 C;  1LKJ A;  1UHK A;  1C3Y A;  2GGZ A;  2KYF A;  2LP3 A;  2F8P A;  4ETO A;  4N1F A;  4OR9 B;  1SCV A;  1DTL A;  2K2F A;  1IWQ A;  4GAO A;  3FE8 A;  1XK4 C;  1YUU A;  1IG5 A;  1AHR A;  1FI6 A;  2M8U A;  1JSA A;  3VB1 A;  1K94 A;  2KGB C;  1A75 B;  3TZ1 A;  4NDD A;  3OB2 B;  4YGB B;  2M9G A;  3BUX B;  1SNL A;  1UHI A;  4HRE E;  1CB1 A;  2O60 A;  2Y5I A;  1DEK A;  3DF0 B;  2P6B B;  4OKH A;  4YI9 A;  1HT9 A;  1KSO A;  1MXL C;  3LK0 A;  4YI8 A;  3L4L A;  2I18 A;  3LL8 B;  3NHT A;  4M2O A;  3TDI A;  5JJG A;  2L4H A;  3VRQ A;  2HF5 A;  5I2O A;  1J7Q A;  1EG4 A;  4YGE B;  1G33 A;  3DVE A;  1YRT B;  1LA3 A;  1KFU L;  5D3O A;  1KFX S;  3O4X A;  1DJZ A;  1NCX A;  3V2L A;  3VRR A;  3DXL A;  4AQJ A;  2JPT A;  3KEV A;  3JTD C;  1CFF A;  1KK8 C;  3EVR A;  2K7C A;  2KAY A;  1REC A;  4MLW A;  3S0D A;  1H8B A;  5HKY A;  4F0Z B;  4ZCV A;  4PE1 A;  4FQO A;  2MLE C;  3CR4 X;  3CZT X;  1CM4 A;  3DVM A;  2R2I A;  1QLS A;  3D76 A;  4MZK A;  4GPL B;  3VGO A;  1OOH A;  2E6W A;  5BPJ A;  1IGV A;  1SBJ A;  5FI7 A;  2KI6 C;  4PE4 A;  1MR8 A;  1J1D A;  4GGN A;  2WCK A;  3SIA A;  1OMV A;  1QS7 A;  1BF5 A;  1KFX L;  2L2E A;  3GOF A;  1PSB A;  2E30 A;  5FYX A;  1QVI Z;  4PHM A;  1CFD A;  2BKI B;  3O6B A;  1KWO B;  1L2O C;  3I5F B;  3VRN A;  3DF0 A;  1MQ1 A;  1ORG A;  2CTN A;  1XFY O;  2M97 A;  3KF9 A;  2D8N A;  2MLF C;  2MAZ A;  2MJW B;  2OPO A;  1KCY A;  1AJ4 A;  3QRX A;  1ALV A;  1W7J B;  2KI6 D;  3I5I C;  4GUK A;  3R1V A;  4N1G A;  3D75 A;  4USL A;  1P28 A;  3B86 A;  4FQT A;  2EC6 B;  2KHN A;  1SCM C;  3NSL A;  4BY4 A;  1DT7 B;  1F54 A;  1JF2 A;  1FI5 A;  2WCM A;  3EKH A;  2WCF A;  4OVN F;  2WC5 A;  4I5L B;  1SYM A;  3BYA A;  1ODB A;  2FCE A;  3D77 A;  2HET A;  5HLO A;  4I5J A;  2WC6 A;  3S0B A;  4CLN A;  3JVT C;  1YR5 A;  1BMO A;  2K7D A;  2LMU A;  3PN7 C;  4TNC A;  5HKW A;  4ORC B;  4FTG A;  4CPV A;  2M1K B;  1ALW A;  3R1O A;  4BY5 A;  2JWW A;  2KAV A;  1SRA A;  1ZUZ A;  3BFA A;  4GGF A;  4HRH A;  2JXC A;  1KK7 Z;  5DIC A;  4P2Y B;  1F70 A;  2H61 A;  4MVF A;  2LLS A;  1BU3 A;  2BCB A;  2ZRT A;  3I5H B;  2WCB A;  3I5H C;  2JPO A;  2M7L A;  1J7P A;  2ZN9 A;  3BOW A;  1UHJ A;  4M2P A;  3SS4 A;  1CNP A;  4NDB A;  3AKA A;  3E3R A;  3OX5 A;  2KBM A;  1KQV A;  1PSR A;  4CFR A;  1WDC C;  3OHM B;  3PN7 B;  1S6I A;  2LUX A;  3DD4 A;  3JVT B;  3DY9 A;  4F7F A;  5KU1 A;  4AQI A;  1AP4 A;  3NXA A;  2M7N A;  2MA2 A;  1N2D A;  1MF8 B;  2TN4 A;  1YX7 A;  2AMI A;  2QEO A;  1UHH A;  3EVV A;  1OMD A;  2ZN8 A;  3EK4 A;  3FWB A;  2BNX A;  1CLB A;  1EXR A;  3B88 A;  4ICB A;  2LLU A;  5D7F A;  1IH0 A;  1WRZ A;  3TS5 C;  1SL9 A;  1RK9 A;  1MUX A;  3NSK A;  5FI6 A;  1QWV A;  2JU0 A;  1A29 A;  1JUO A;  2F2O A;  3BOW B;  5DKQ A;  2DOQ A;  5ER5 A;  1A2X A;  1KQM C;  4I5N B;  2LM5 A;  3BJH A;  1TNP A;  3CR5 X;  3VRO A;  2QDI A;  1B8L A;  1Y1X A;  4XYN A;  4C0K A;  1UP5 A;  1FF1 A;  1JFK A;  2OS8 B;  4ORA B;  2OS8 C;  2H2K A;  1UWO A;  1QLK A;  2M29 A;  4WQ2 A;  5CSN A;  1SKT A;  1LS8 A;  4GGF C;  1M46 A;  1QJT A;  1K8U A;  2KSP A;  3IQQ A;  5CSF A;  3SS5 A;  2KBI A;  1S26 D;  3K1E A;  1SK6 D;  5G08 A;  3BQ3 A;  2BCX A;  5CSJ A;  1SPY A;  5DKN A;  3OX6 A;  3D0Y B;  1CMG A;  3SJS A;  1Z2C B;  2GGM A;  1H4B A;  3LCP C;  1LVC D;  1WLZ A;  1J7O A;  4Q04 A;  1W9Z A;  2F33 A;  4JD9 A;  1Y1A A;  1Y1U A;  2WCE A;  3CR2 A;  3TS5 B;  3PM2 A;  1B4C A;  2LVK A;  1ZFS A;  1M63 B;  1UUR A;  2KFF A;  2PAL A;  3WHT B;  1KK8 B;  2KNE A;  2FJU B;  1S36 A;  1OOJ A;  3TDU A;  1HQV A;  1DVI A;  1YVH A;  1ZMZ A;  2K60 A;  3DZT A;  1RFJ A;  3B87 A;  3GK4 X;  2KDH A;  2V53 A;  4IJ7 A;  3UNW A;  4QJ5 B;  1WDC B;  3NSI A;  2I94 A;  4MBE A;  2LLT A;  1EL4 A;  3B6X A;  3BUN B;  4DCK A;  2KGR A;  2PRU A;  1OSA A;  3K21 A;  3EG5 B;  3CZ1 A;  3FIA A;  1YVL A;  3D73 A;  2KFH A;  4PCW A;  2H8V A;  1LXF C;  3OGN A;  2FCD A;  2ERB A;  3UO9 A;  1BOD A;  1YUT A;  1RTP 1;  2BKH B;  5J3X A;  1BR1 B;  1WRL A;  3C1V A;  1XA5 A;  4HSZ A;  4PAL A;  1Z4H A;  3OB1 B;  2HQW A;  2P70 A;  3CS1 A;  4OCI A;  1TCF A;  4WQ3 A;  1YX8 A;  3TDZ A;  2KLD A;  1DQE A;  1F4Q A;  1DJH A;  3KO0 A;  2KQ6 A;  3S0E A;  1A75 A;  1B8C A;  2JOJ A;  1OZS A;  2ZND A;  1F8H A;  1ZAC A;  1XFR A;  5KSZ A;  1XFX O;  1FPW A;  1W7I B;  1N65 A;  2KPH A;  1AJ5 A;  3NGV A;  3I5F C;  2LVI A;  3EKJ A;  3QME A;  1R6P A;  1UUS A;  1WLM A;  4QJ3 B;  1IQ3 A;  3F45 A;  1BT6 A;  3I5I B;  3KHE A;  1TNW A;  1SL8 A;  1K95 A;  1KQM B;  1DF0 B;  2LNK A;  1DJY A;  1NSH A;  3ZWH A;  1QVI Y;  2JC2 A;  5CSI A;  1DJX A;  1XFZ O;  1PVB A;  2A4J A;  1CDL A;  1N0Y A;  2Y1N A;  4DRW A;  3GK2 A;  1GM0 A;  1YTZ C;  2CBL A;  2JT3 A;  2L50 A;  3WHU B;  1DC1 A;  4GBA A;  1K2H A;  2EHB A;  4PE7 A;  3JTD B;  1NPQ A;  1NWD A;  3BFH A;  3CTN A;  3OBV A;  4MZJ A;  3KPX A;  1BLQ A;  1J55 A;  1GQM A;  1OMR A;  2LVJ A;  2O5G A;  1CDM A;  2I2R E;  3CZ2 A;  1ZOT B;  2LV7 A;  2ZFD A;  2K8M B;  1V1F A;  1CDN A;  2LUC A;  2WOS A;  1EG3 A;  1X02 A;  3CLN A;  1SMG A;  1NX2 A;  2B1U A;  2MHH A;  3S0A A;  1F71 A;  5AER A;  4M2Q A;  1PAL A;  1FBV A;  1JWD A;  2LP2 A;  2K7B A;  2RGI A;  2JNF A;  4JKT A;  5I8N A;  2BE4 A;  1NCZ A;  1JF0 A;  2KYC A;  3Q8I A;  5IBW A;  1V1G A;  3SG7 A;  4C0L A;  3WNX B;  4A4B A;  2H61 C;  2LC5 A;  5I94 A;  1GJY A;  1A03 A;  1QX5 B;  2FJY A;  2CCM A;  3L47 A;  3D10 A;  1DMO A;  3IVT A;  1OOI X;  1C7V A;  2KAX A;  4JPZ B;  1IQ5 A;  1DJG A;  1XFV O;  4OZD A;  1Y6W A;  4DIR A;  1R2U A;  1U5I A;  1CLL A;  1B7T Y;  3O4Y A;  1K96 A;  1SL7 A;  2L5X B;  1DJW A;  2GTE A;  2NCO A;  4N5X A;  5ER4 X;  2K2A A;  1S1E A;  5HKZ A;  1K93 D;  3PAT A;  4CFQ A;  1BG1 A;  3FE9 A;  1C07 A;  1VRK A;  2BL0 C;  4MEW A;  4AOM A;  4U8D A;  1NX3 A;  3B7A A;  3LLE A;  5HYD A;  2L5Y A;  4YRU A;  5EL2 A;  1BJF A;  3S0G A;  1CLM A;  1QAT A;  4DUQ A;  1IKU A;  2NZ0 A;  2BCA A;  2LCP A;  3SG4 A;  2F2P A;  1EJ3 A;  1SCM B;  4XJK B;  3PLF B;  1AVS A;  2EC6 C;  2G2B A;  3HCM A;  3CYZ A;  3H4S E;  3RZS A;  2JRF A;  2QPT A;  4D1E A;  3O2P A;  2M49 B;  2PMY A;  3I5G B;  1PVA A;  2HQ8 A;  2JNX A;  1QTX A;  1SY9 A;  4PE0 A;  1MXE A;  4PT1 A;  1J1E A;  1FW4 A;  1KWO C;  1L2O B;  1G4Y R;  1CMF A;  2PYQ A;  1S3P A;  1TWO A;  3CDN A;  4GFT A;  2LAP A;  1TIZ A;  3SIB A;  1CKK A;  2L51 A;  3A4U B;  3HX4 A;  1K9K A;  3DYE A;  2Y4Q A;  3VRP A;  1TUZ A;  1UHN A;  2YGU A;  3CZ0 A;  1QV0 A;  1KSM A;  1DF0 A;  2KFG A;  4YGA A;  5F6T A;  2IS9 A;  2KI4 C;  3R1P A;  2NLN A;  1XFW O;  4MN0 A;  4YGC B;  1S5G Z;  1J7R A;  3BXK A;  3NHI A;  2JZI A;  1NYA A;  5HL1 A;  1TNX A;  2QEB A;  2L2C A;  1PUL A;  1QX7 A;  5TNC A;  2NCP A;  2ISD A;  1OOF A;  3PJI A;  3CAB A;  1S6J A;  5AXI A;  3R72 A;  1QX2 A;  4WRI A;  3ZNI A;  2Q4U A;  1DEL A;  1S6C A;  1Y0V H;  1F55 A;  2WCJ A;  2LMV A;  1JBA A;  1TUJ A;  1IJ6 A;  1CM1 A;  1QIV A;  5CPV A;  1AK8 A;  2QEH A;  4PDZ A;  1DGV A;  1L7Z A;  1IRJ A;  3SS3 A;  1LA0 A;  2FOT A;  1TCO B;  3SG5 A;  2G9B A;  2GV5 A;  4ZCU A;  2P71 A;  1NX0 A;  1BOC A;  3EVU A;  1B1G A;  1TN4 A;  4JQ0 D;  1MHO A;  1TNQ A;  1S5G Y;  2JTZ A;  2AAO A;  3D74 A;  3WXA A;  4OV2 A;  1GGZ A;  2LE9 B;  2KLE A;  2NXQ A;  2JQ6 A;  1Q80 A;  1MWN A;  2CNP A;  3PAL A;  1E8A A;  3D0Y A;  5AEQ A;  2WCL A;  2F3Z A;  1B8R A;  4I5K A;  4NDC A;  5FI2 A;  3EK7 A;  1IJ5 A;  1NIW A;  1SR6 B;  1KK7 Y;  3TUY B;  2KQY A;  1K9P A;  1TTX A;  3BUW B;  2JT0 A;  2COL B;  1A4P A;  1QAS A;  2I7A A;  1DGU A;  4A4C A;  3MSE B;  1YUR A;  1NX1 A;  2M1U A;  5PAL A;  3PSR A;  2PSR A;  1XVJ A;  2BBM A;  2OTG B;  2JXL A;  2BE6 A;  1DJI A;  4PHK A;  1OE9 B;  5HLV A;  2L4I A;  2BEC A;  3SG6 A;  2MBX A;  3GK1 A;  5I2L A;  3D78 A;  4PHJ A;  4P5O E;  4INX A;  4GNK B;  1BR4 B;  1PK0 D;  1CFP A;  1B47 A;  1WRK A;  3SG3 A;  1T14 A;  3BUM B;  3OP0 A;  2SCP A;  4NQG A;  1B9A A;  1K9U A;  2L0P A;  2K0J A;  5AFP A;  1QIW A;  1QXP A;  5I2Q A;  1G8I A;  3L4A A;  2BL0 B;  3TUY C;  5AAN A;  5DKR A;  3SG2 A;  3LK1 A;  5B8I B;  1NUB A;  1TOP A;  3CWG A;  5D69 A;  1OZO A;  1XO5 A;  1CDP A;  1XYD A;  3AAK A;  2LHL A;  1B7T Z;  2ZNE A;  1YRU B;  2WOR A;  3BUO B;  3IQO A;  1JFJ A;  2PVB A;  2Q91 A;  4HRG A;  4YBH B;  2EGD A;  1M31 A;  4JWQ A;  2JUL A;  3IF7 A;  4MSP A;  1QV1 A;  2LHI A;  2MRD A;  3BFB A;  4KYN A;  4INW A;  3CGA A;  2HPS A;  1F4O A;  4C0J A;  4UPG A;  3N7H A;  4QJ4 B;  1TRF A;  2ZKM X;  3NSO A;  2K7O A;  4MZL A;  5GQQ C;  4DS7 A;  1RRO A;  1OOG A;  2BAP A;  1EH2 A;  1NCY A;  1PRW A;  4R1E A;  1XFU O;  1CTR A;  3FE6 A;  3PFV A;  3RLZ A;  3EK8 A;  4CID A;  2LMT A;  2QEV A;  3DVJ A;  2JT8 A;  2AUC A;  1LIN A;  5JOL A;  2Y1M A;  1NP8 A;  1OW4 A;  1SSE B;  1U5I B;  4PHN A;  1SW8 A;  2M3W A;  3AAJ A;  4E68 A;  4YGD B;  2PQL A;  1CFC A;  2JTT A;  1KFU S;  1YUS A;  4ORB B;  2LAN A;  4MRY A;  2M0R A;  3PM8 A;  2BBN A;  2KOT A;  2KI4 B;  2K61 A;  3FS7 A;  2CXJ A;  1WY9 A;  2WC8 A;  3O78 A;  5KTY A;  1IIO A;  1C7W A;  4XJK A;  1RJV A;  2LVV A;  1D1O A;  2CT9 A;  2QAC A;  1M39 A;  1M45 A;  2PAS A;  2SAS A; 
#chains in the Genus database with same CATH homology
 3DVK A;  5K89 A;  1K90 D;  1RWY A;  3A8R A;  2ZRS A;  1OQP A;  3FWC A;  3ICB A;  1JC2 A;  1GGW A;  3M0W A;  2OTG C;  2VRG A;  1XK4 A;  2F3Y A;  2WND A;  4IL1 A;  3I5G C;  4L9M A;  3AKB A;  4MRX A;  3RM1 A;  2L98 A;  1AUI B;  1SR6 C;  1LKJ A;  1UHK A;  2GGZ A;  2KYF A;  2LP3 A;  2F8P A;  4ETO A;  4N1F A;  4OR9 B;  1SCV A;  1DTL A;  2K2F A;  1IWQ A;  4GAO A;  1XK4 C;  1YUU A;  1IG5 A;  1AHR A;  1FI6 A;  2M8U A;  1JSA A;  1K94 A;  2KGB C;  1A75 B;  3TZ1 A;  4NDD A;  3OB2 B;  4YGB B;  2M9G A;  3BUX B;  1SNL A;  1UHI A;  4HRE E;  1CB1 A;  2O60 A;  2Y5I A;  3DF0 B;  2P6B B;  4OKH A;  4YI9 A;  1HT9 A;  1KSO A;  1MXL C;  3LK0 A;  4YI8 A;  4M2O A;  2I18 A;  3LL8 B;  3TDI A;  5JJG A;  2L4H A;  3VRQ A;  2HF5 A;  5I2O A;  1J7Q A;  1EG4 A;  4YGE B;  1G33 A;  3DVE A;  1YRT B;  1LA3 A;  1KFU L;  1KFX S;  1DJZ A;  1NCX A;  3VRR A;  4AQJ A;  2JPT A;  3KEV A;  3JTD C;  1CFF A;  1KK8 C;  3EVR A;  2K7C A;  2KAY A;  1REC A;  4MLW A;  1H8B A;  5HKY A;  4F0Z B;  4ZCV A;  4PE1 A;  4FQO A;  2MLE C;  3CR4 X;  3CZT X;  1CM4 A;  3DVM A;  2R2I A;  1QLS A;  4MZK A;  4GPL B;  3VGO A;  2E6W A;  5BPJ A;  1IGV A;  1SBJ A;  2KI6 C;  4PE4 A;  1MR8 A;  1J1D A;  4GGN A;  3SIA A;  1OMV A;  1QS7 A;  1BF5 A;  1KFX L;  2L2E A;  3GOF A;  1PSB A;  2E30 A;  5FYX A;  1QVI Z;  4PHM A;  1CFD A;  2BKI B;  3O6B A;  1KWO B;  1L2O C;  3I5F B;  3VRN A;  3DF0 A;  1MQ1 A;  2CTN A;  1XFY O;  2M97 A;  3KF9 A;  2D8N A;  2MLF C;  2MAZ A;  2MJW B;  2OPO A;  1KCY A;  1AJ4 A;  3QRX A;  1ALV A;  1W7J B;  2KI6 D;  3I5I C;  4GUK A;  4N1G A;  4USL A;  2EC6 B;  2KHN A;  1SCM C;  3NSL A;  4BY4 A;  1DT7 B;  1F54 A;  1JF2 A;  1FI5 A;  3EKH A;  2WCF A;  4OVN F;  4I5L B;  1SYM A;  3BYA A;  1ODB A;  2FCE A;  2HET A;  5HLO A;  4I5J A;  4CLN A;  3JVT C;  1YR5 A;  1BMO A;  2K7D A;  2LMU A;  3PN7 C;  4TNC A;  5HKW A;  4ORC B;  4FTG A;  4CPV A;  2M1K B;  1ALW A;  4BY5 A;  2JWW A;  2KAV A;  1SRA A;  1ZUZ A;  4GGF A;  4HRH A;  2JXC A;  1KK7 Z;  4P2Y B;  1F70 A;  2H61 A;  4MVF A;  2LLS A;  1BU3 A;  2BCB A;  2ZRT A;  3I5H B;  2WCB A;  3I5H C;  2M7L A;  1J7P A;  2ZN9 A;  3BOW A;  1UHJ A;  4M2P A;  1CNP A;  4NDB A;  3AKA A;  3E3R A;  3OX5 A;  2KBM A;  1KQV A;  1PSR A;  4CFR A;  1WDC C;  3OHM B;  3PN7 B;  1S6I A;  2LUX A;  3DD4 A;  3JVT B;  5KU1 A;  4AQI A;  1AP4 A;  3NXA A;  2M7N A;  2MA2 A;  1N2D A;  1MF8 B;  2TN4 A;  1YX7 A;  2AMI A;  1UHH A;  3EVV A;  1OMD A;  2ZN8 A;  3EK4 A;  3FWB A;  1CLB A;  1EXR A;  5D7F A;  4ICB A;  2LLU A;  1IH0 A;  1WRZ A;  3TS5 C;  1SL9 A;  1RK9 A;  1MUX A;  3NSK A;  2JU0 A;  1A29 A;  1JUO A;  2F2O A;  3BOW B;  5DKQ A;  2DOQ A;  5ER5 A;  1A2X A;  1KQM C;  4I5N B;  2LM5 A;  1TNP A;  3CR5 X;  3VRO A;  1B8L A;  1Y1X A;  4XYN A;  4C0K A;  1UP5 A;  1FF1 A;  1JFK A;  2OS8 B;  4ORA B;  2OS8 C;  2H2K A;  1UWO A;  1QLK A;  2M29 A;  4WQ2 A;  5CSN A;  1SKT A;  4GGF C;  1M46 A;  1QJT A;  1K8U A;  2KSP A;  3IQQ A;  5CSF A;  2KBI A;  1S26 D;  1SK6 D;  5G08 A;  3BQ3 A;  2BCX A;  5CSJ A;  1SPY A;  5DKN A;  3OX6 A;  3D0Y B;  1CMG A;  3SJS A;  2GGM A;  1H4B A;  3LCP C;  1LVC D;  1WLZ A;  1J7O A;  4Q04 A;  2F33 A;  3TS5 B;  1Y1A A;  1Y1U A;  2WCE A;  3CR2 A;  1B4C A;  2LVK A;  1ZFS A;  1M63 B;  1UUR A;  2KFF A;  2PAL A;  3WHT B;  1KK8 B;  2KNE A;  2FJU B;  1S36 A;  1OOJ A;  3TDU A;  1HQV A;  1DVI A;  1YVH A;  1ZMZ A;  3GK4 X;  1RFJ A;  2KDH A;  2V53 A;  4QJ5 B;  1WDC B;  3NSI A;  2I94 A;  4MBE A;  2LLT A;  1EL4 A;  4DCK A;  3BUN B;  2KGR A;  2PRU A;  1OSA A;  3K21 A;  3FIA A;  1YVL A;  2KFH A;  4PCW A;  1LXF C;  2FCD A;  1BOD A;  1YUT A;  1RTP 1;  2BKH B;  5J3X A;  1BR1 B;  1WRL A;  3C1V A;  1XA5 A;  4HSZ A;  4PAL A;  4OCI A;  3OB1 B;  2HQW A;  3CS1 A;  4WQ3 A;  1CKK A;  1TCF A;  1YX8 A;  3TDZ A;  1F4Q A;  1DJH A;  3KO0 A;  2KQ6 A;  1A75 A;  1B8C A;  2JOJ A;  1OZS A;  2ZND A;  1F8H A;  1ZAC A;  5KSZ A;  1XFX O;  1FPW A;  1W7I B;  1N65 A;  1AJ5 A;  3I5F C;  2LVI A;  3EKJ A;  1R6P A;  1UUS A;  1WLM A;  4QJ3 B;  1IQ3 A;  3F45 A;  1BT6 A;  3I5I B;  3KHE A;  1TNW A;  1SL8 A;  1K95 A;  1KQM B;  1DF0 B;  2LNK A;  1DJY A;  1NSH A;  3ZWH A;  1QVI Y;  2JC2 A;  5CSI A;  1DJX A;  1XFZ O;  1PVB A;  2A4J A;  1CDL A;  1N0Y A;  2Y1N A;  4DRW A;  3GK2 A;  1YTZ C;  2CBL A;  2JT3 A;  2L50 A;  3WHU B;  4GBA A;  1K2H A;  2EHB A;  4PE7 A;  3JTD B;  1NPQ A;  1NWD A;  3CTN A;  4MZJ A;  3KPX A;  1BLQ A;  1J55 A;  1GQM A;  1OMR A;  2LVJ A;  2O5G A;  1CDM A;  2I2R E;  1ZOT B;  2LV7 A;  2ZFD A;  2K8M B;  1V1F A;  1CDN A;  2LUC A;  2WOS A;  1EG3 A;  1X02 A;  3CLN A;  1SMG A;  1NX2 A;  2B1U A;  2MHH A;  1F71 A;  5AER A;  4M2Q A;  1PAL A;  1FBV A;  1JWD A;  2LP2 A;  2K7B A;  2RGI A;  2JNF A;  5I8N A;  2BE4 A;  1NCZ A;  1JF0 A;  2KYC A;  5IBW A;  1V1G A;  3SG7 A;  4C0L A;  3WNX B;  4A4B A;  2H61 C;  2LC5 A;  1GJY A;  1A03 A;  1QX5 B;  1DMO A;  2CCM A;  3D10 A;  1C7V A;  2KAX A;  4JPZ B;  1IQ5 A;  1DJG A;  1XFV O;  1Y6W A;  4DIR A;  1R2U A;  1U5I A;  1CLL A;  1B7T Y;  3O4Y A;  1K96 A;  1SL7 A;  2L5X B;  1DJW A;  2NCO A;  4N5X A;  5ER4 X;  5HKZ A;  2K2A A;  1S1E A;  4CFQ A;  1K93 D;  3PAT A;  1BG1 A;  1C07 A;  1VRK A;  2BL0 C;  4MEW A;  4AOM A;  4U8D A;  1NX3 A;  3LLE A;  5HYD A;  4YRU A;  1BJF A;  1CLM A;  1QAT A;  4DUQ A;  1IKU A;  2NZ0 A;  2BCA A;  2LCP A;  3SG4 A;  2F2P A;  1EJ3 A;  1SCM B;  4XJK B;  3PLF B;  1AVS A;  2EC6 C;  2G2B A;  3HCM A;  3H4S E;  2JRF A;  2QPT A;  4D1E A;  3O2P A;  2M49 B;  2PMY A;  3I5G B;  1PVA A;  2HQ8 A;  2JNX A;  1QTX A;  1SY9 A;  4PE0 A;  1MXE A;  1J1E A;  1FW4 A;  1KWO C;  1L2O B;  1G4Y R;  1CMF A;  1S3P A;  4GFT A;  2LAP A;  1TIZ A;  3SIB A;  2L51 A;  3A4U B;  3HX4 A;  1K9K A;  2Y4Q A;  3VRP A;  1UHN A;  1QV0 A;  1KSM A;  1DF0 A;  2KFG A;  4YGA A;  5F6T A;  2IS9 A;  2KI4 C;  2NLN A;  1XFW O;  4MN0 A;  4YGC B;  1S5G Z;  1J7R A;  3BXK A;  2JZI A;  1NYA A;  1TNX A;  1PUL A;  1QX7 A;  5TNC A;  2NCP A;  2ISD A;  5AXI A;  1S6J A;  1QX2 A;  4WRI A;  3ZNI A;  2Q4U A;  1S6C A;  1Y0V H;  1F55 A;  2LMV A;  1JBA A;  1IJ6 A;  1CM1 A;  1QIV A;  5CPV A;  1AK8 A;  4PDZ A;  1DGV A;  1L7Z A;  1IRJ A;  1LA0 A;  2FOT A;  1TCO B;  3SG5 A;  2G9B A;  2GV5 A;  4ZCU A;  1NX0 A;  1BOC A;  3EVU A;  1B1G A;  1TN4 A;  4JQ0 D;  1MHO A;  1TNQ A;  1S5G Y;  2JTZ A;  2AAO A;  3WXA A;  4OV2 A;  1GGZ A;  2LE9 B;  2NXQ A;  2JQ6 A;  1Q80 A;  1MWN A;  2CNP A;  3PAL A;  1E8A A;  3D0Y A;  5AEQ A;  4I5K A;  2F3Z A;  1B8R A;  4NDC A;  3EK7 A;  1IJ5 A;  1NIW A;  1SR6 B;  1KK7 Y;  3TUY B;  2KQY A;  1K9P A;  1TTX A;  3BUW B;  2JT0 A;  2COL B;  1A4P A;  1QAS A;  2I7A A;  1DGU A;  4A4C A;  3MSE B;  1YUR A;  1NX1 A;  2M1U A;  5PAL A;  3PSR A;  2PSR A;  1XVJ A;  2BBM A;  2OTG B;  2JXL A;  2BE6 A;  1DJI A;  4PHK A;  1OE9 B;  5HLV A;  2L4I A;  2BEC A;  3SG6 A;  2MBX A;  3GK1 A;  5I2L A;  4PHJ A;  4P5O E;  4GNK B;  1BR4 B;  1PK0 D;  1CFP A;  1B47 A;  1WRK A;  3SG3 A;  3BUM B;  3OP0 A;  2SCP A;  4NQG A;  1B9A A;  1K9U A;  2L0P A;  2K0J A;  5AFP A;  1QIW A;  1QXP A;  5I2Q A;  1G8I A;  2BL0 B;  3TUY C;  5AAN A;  5DKR A;  3SG2 A;  3LK1 A;  5B8I B;  1NUB A;  1TOP A;  3CWG A;  5D69 A;  1OZO A;  1XO5 A;  1CDP A;  1XYD A;  3AAK A;  2LHL A;  1B7T Z;  2ZNE A;  1YRU B;  2WOR A;  3BUO B;  3IQO A;  1JFJ A;  2PVB A;  2Q91 A;  4HRG A;  4YBH B;  2EGD A;  1M31 A;  4JWQ A;  2JUL A;  3IF7 A;  4MSP A;  1QV1 A;  2LHI A;  2MRD A;  3CGA A;  2HPS A;  1F4O A;  4C0J A;  4UPG A;  4QJ4 B;  1TRF A;  2ZKM X;  3NSO A;  2K7O A;  4MZL A;  5GQQ C;  4DS7 A;  1RRO A;  1EH2 A;  1NCY A;  1PRW A;  4R1E A;  1XFU O;  1CTR A;  3PFV A;  3RLZ A;  3EK8 A;  4CID A;  2LMT A;  3DVJ A;  2JT8 A;  2AUC A;  1LIN A;  5JOL A;  2Y1M A;  1NP8 A;  1U5I B;  4PHN A;  1SW8 A;  2M3W A;  3AAJ A;  4E68 A;  4YGD B;  1CFC A;  2JTT A;  1KFU S;  1YUS A;  4ORB B;  2LAN A;  4MRY A;  2M0R A;  3PM8 A;  2BBN A;  2KOT A;  2KI4 B;  2K61 A;  3FS7 A;  2CXJ A;  1WY9 A;  2WC8 A;  3O78 A;  5KTY A;  1C7W A;  4XJK A;  1RJV A;  2LVV A;  1D1O A;  2CT9 A;  2QAC A;  1M39 A;  1M45 A;  2PAS A;  2SAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...