1J7QA

Solution structure and backbone dynamics of the defunct ef-hand domain of calcium vector protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
86
structure length
86
Chain Sequence
AAPKARALGPEEKDECMKIFDIFDRNAENIAPVSDTMDMLTKLGQTYTKRETEAIMKEARGPKGDKKNIGPEEWLTLCSKWVRQDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calcium Vector Protein
publication title Solution structure and backbone dynamics of the defunct domain of calcium vector protein.
pubmed doi rcsb
source organism Branchiostoma lanceolatum
total genus 21
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2001-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j7qA00
2KGRA 4MZKA 1A2XA 1K94A 1QX2A 2NLNA 1SKTA 4C0LA 4FQOA 2LVVA 5JJGA 2JNFA 1XVJA 2Q91A 4XJKA 1TOPA 1U5IB 1BF5A 1BMOA 1FBVA 2LAPA 2BL0C 2MLFC 1ZMZA 2O60A 2E30A 4MLWA 4OVNF 4MVFA 4WRIA 3H4SE 2LM5A 1L7ZA 5DKRA 2L2EA 5ER4X 3AAJA 3VRRA 1OMVA 2I2RE 5CPVA 1XK4C 4QJ5B 2KOTA 4MBEA 2I7AA 1KFUL 3O6BA 2L50A 1AK8A 4DS7A 3VRNA 1EG4A 1DT7B 1OE9B 2VRGA 3WHTB 2P6BB 1DMOA 1FI6A 1WDCC 1KQMB 3PSRA 1V1GA 1IG5A 4PE7A 2CXJA 4PHKA 3LL8B 4ZCVA 4ORBB 3SIAA 2A4JA 2GV5A 1RK9A 2AAOA 1JUOA 3KHEA 1KK8B 1UUSA 2JXCA 1KFXL 2KNEA 1X02A 1SRAA 3D0YB 3PLFB 2M7LA 3CR5X 2EGDA 1CFDA 1A03A 1J7QA 2M7NA 1GGWA 4QJ3B 2LMVA 1B47A 4GFTA 2NCOA 1M63B 1MHOA 1NYAA 2LUXA 2K61A 2MA2A 3I5FB 4DRWA 1OSAA 2BE6A 1B8RA 1ZFSA 1G33A 3PN7B 3BOWA 3NSKA 2MRDA 2NZ0A 2HPSA 1JSAA 1JF2A 3I5IB 1ODBA 2LVIA 2KFFA 2L4IA 4GGNA 3I5GB 3LCPC 4CLNA 1OQPA 1QS7A 1EL4A 4GAOA 1S26D 1KCYA 1IWQA 1QASA 5HLOA 1H8BA 2FCEA 3GOFA 4FTGA 4BY4A 4CIDA 1YUTA 5I2LA 3TZ1A 3EK7A 2F33A 4YGAA 1LXFC 1QJTA 2KAYA 4ORCB 5AANA 2ISDA 1JC2A 1NSHA 2PASA 1YUSA 4N1GA 2JWWA 3MSEB 1L2OB 3KEVA 1A75A 4M2QA 4CFQA 1K90D 4M2OA 2ZFDA 4NQGA 2JPTA 2BECA 1ALWA 5FYXA 1B7TY 2KDHA 2KFHA 2KAXA 4ICBA 3AKAA 1IKUA 3CS1A 3AAKA 3WHUB 2Y5IA 2COLB 3C1VA 5I8NA 2JT8A 1RWYA 2LVKA 1YVHA 1G8IA 2WORA 3KF9A 1B8LA 5CSIA 1OMRA 2PRUA 2BBMA 2K7DA 1BJFA 1CM4A 1BR1B 5DKQA 2MAZA 1QTXA 4E68A 1N2DA 1CLLA 1S5GZ 2NCPA 1QVIZ 2KHNA 1H4BA 1DJXA 1NUBA 4HRGA 2AUCA 1K2HA 2HF5A 2WCEA 5HKZA 2LHLA 2LLTA 2LLUA 2KI4B 1SL7A 1XK4A 2JT0A 2K2FA 4M2PA 1TNPA 4ORAB 5F6TA 3WXAA 1BR4B 1QX7A 1NCZA 2H61C 1XA5A 4I5KA 1MWNA 3RM1A 4UPGA 1C7WA 1AVSA 1G4YR 3K21A 3NXAA 1DF0B 3GK2A 3EVVA 2KQYA 1PVAA 1KFUS 1N65A 1M45A 1AJ4A 3TUYC 1EG3A 3VRPA 1SPYA 1PVBA 4I5NB 4GBAA 1AJ5A 3I5HC 1QX5B 2L51A 1KQVA 3LLEA 1K96A 3OB1B 1C7VA 4MEWA 3EKJA 5TNCA 1UHNA 4OKHA 1DJIA 1S6CA 4OR9B 1XYDA 2MJWB 2R2IA 4PALA 1KFXS 3BQ3A 3BUOB 1KSMA 1B9AA 2O5GA 2WCBA 3JTDC 3VGOA 1DGUA 1PRWA 2HETA 1MF8B 1BLQA 1JFJA 1Y1XA 1DJWA 3CTNA 2F8PA 1J7PA 2OS8B 3EK8A 1OZOA 1LKJA 1YVLA 2KYFA 4YGDB 3TDIA 2L0PA 1QIWA 2GGZA 4TNCA 1IH0A 4YGCB 3PALA 1KK7Y 5KU1A 2K7CA 2JU0A 2CTNA 4JQ0D 4AQIA 5B8IB 1SMGA 5HLVA 1EH2A 2LV7A 2KBIA 1JFKA 4XJKB 5JOLA 1DJZA 1S1EA 2KSPA 2EHBA 1B1GA 1TNXA 3SG5A 1M31A 1YX8A 1PULA 1TTXA 3TS5B 2CCMA 2TN4A 3O2PA 1MR8A 2ZRTA 2KQ6A 1XFWO 3DF0A 2JZIA 4GPLB 5G08A 1CFPA 2WC8A 1NCXA 2SASA 5K89A 3SG3A 4A4BA 1B4CA 3O78A 2M3WA 2ZN9A 3O4YA 1QV0A 1YUUA 1LVCD 2F2PA 4MN0A 2MBXA 3SG6A 1EXRA 2ZKMX 2FOTA 1F71A 3CGAA 5CSJA 1V1FA 1SR6B 1B8CA 1SL9A 1E8AA 2AMIA 2K7OA 3JVTB 4MRYA 1WLMA 3PM8A 1RTP1 4PHMA 2EC6B 2ZN8A 2KGBC 1CB1A 1RECA 1TCOB 2CBLA 1YTZC 2H61A 1KWOC 2Y1NA 2JXLA 1SCVA 1MXLC 1SY9A 1F8HA 3OP0A 3BOWB 1KQMC 1PSRA 2E6WA 3BUWB 4PE1A 3BUNB 1B7TZ 1CMFA 1K9UA 1CNPA 5CSNA 3CR2A 1SCMB 2ZRSA 4NDCA 2ZNEA 2PSRA 1KK8C 1UHKA 2OPOA 1LA3A 1DVIA 1JF0A 2K0JA 1NWDA 2M29A 2M0RA 3SJSA 5J3XA 4U8DA 2LHIA 1UURA 1IJ6A 1UHJA 1R6PA 4F0ZB 1W7IB 2L5XB 3NSOA 4ETOA 3I5FC 1A75B 2L4HA 1CFCA 1UHHA 1PK0D 2Y1MA 3ICBA 1XFZO 1QLKA 3F45A 3PN7C 3ZNIA 3CLNA 1WRKA 1PALA 5KTYA 3I5IC 1BOCA 3DVMA 3OX6A 1K93D 1J1DA 1LA0A 1Y1AA 2LANA 4BY5A 1F4QA 3I5GC 2L98A 3DD4A 1F70A 1YURA 2PMYA 2JT3A 1SW8A 5DKNA 4CPVA 4CFRA 4GGFC 1ALVA 2M1UA 2KFGA 1CFFA 4YBHB 3BYAA 2BL0B 3OX5A 2LUCA 4WQ2A 1SK6D 3WNXB 1L2OC 2Y4QA 4JPZB 5HKYA 2BKIB 2K8MB 4USLA 2WOSA 1XO5A 3SG2A 4QJ4B 1QVIY 1CTRA 2HQ8A 4PE0A 1JWDA 1SYMA 1CDPA 2G2BA 3HX4A 4I5JA 3GK1A 2WCFA 1WDCB 3DVKA 2BCXA 1J7RA 1F4OA 1IRJA 1TNWA 2MHHA 4PHJA 1U5IA 3A4UB 1F55A 2KI6C 1CLBA 2JC2A 4MZLA 1TCFA 4DCKA 3LK0A 1TIZA 1VRKA 2K7BA 3QRXA 1XFUO 4OV2A 3E3RA 3EK4A 1CM1A 2FCDA 4Q04A 1CMGA 1FI5A 3NSLA 2KI4C 2H2KA 1BU3A 1CLMA 2SCPA 1QATA 3HCMA 2B1UA 4GNKB 4MZJA 5I2OA 1NCYA 2JTZA 1WRZA 1N0YA 4GUKA 2BBNA 3RLZA 2BCBA 4YI8A 2CNPA 1SNLA 3BUMB 2OTGC 1HT9A 1QXPA 4PCWA 1CDNA 3VROA 4D1EA 5PALA 4ZCUA 3SG4A 1OZSA 1XFYO 5AEQA 1K9KA 3CWGA 4L9MA 3CR4X 1AUIB 1AP4A 3LK1A 3M0WA 3IF7A 5I2QA 3D0YA 2JULA 2I94A 1IQ3A 4HREE 1WRLA 1KWOB 1IGVA 1J55A 2MLEC 1ZUZA 3NSIA 2KAVA 3FIAA 1OMDA 4AQJA 3GK4X 2JQ6A 2KBMA 2LMUA 4DUQA 4NDDA 2KYCA 2QPTA 3DVJA 2LCPA 1TN4A 2M8UA 1YRUB 1ZOTB 2OS8C 3A8RA 3FWCA 4JWQA 3DF0B 4R1EA 1UHIA 2JNXA 1RROA 3AKBA 3EVRA 1DJYA 4PHNA 2JRFA 4MSPA 2LVJA 2KI6D 2LP2A 1NIWA 1FPWA 4MRXA 2ZNDA 1SBJA 2BE4A 3PATA 4C0JA 1BG1A 3VRQA 4P5OE 1DJGA 1D1OA 4WQ3A 2FJUB 3FS7A 1Y0VH 2LNKA 3ZWHA 2QACA 1IQ5A 2BCAA 3BUXB 4N5XA 3EVUA 1EJ3A 1M46A 1KSOA 4GGFA 2I18A 1WY9A 4OCIA 4PE4A 5GQQC 3IQOA 1S36A 5D69A 2V53A 1MQ1A 1Q80A 2CT9A 2K2AA 1S6JA 5CSFA 3TS5C 1J7OA 1CDLA 3OHMB 5KSZA 1F54A 1A29A 4YGBB 1MUXA 1K95A 1M39A 4YI9A 1RFJA 4C0KA 1DTLA 1SL8A 2JOJA 1FF1A 1GQMA 2LC5A 3SIBA 2DOQA 3OB2B 2M1KB 1QLSA 3TUYB 1Y1UA 2GGMA 1OOJA 2BKHB 5IBWA 2WNDA 3FWBA 4PDZA 3I5HB 3EKHA 1NX2A 1YX7A 1SR6C 1CDMA 1IJ5A 1YRTB 1DJHA 4XYNA 1NX0A 2IS9A 4YGEB 3JVTC 1R2UA 2F3ZA 3DVEA 2LP3A 1Y6WA 1QIVA 1JBAA 1HQVA 2LE9B 3D10A 2EC6C 2F3YA 3TDZA 4N1FA 2LLSA 4A4CA 5AFPA 1C07A 2PALA 2RGIA 1GGZA 4HRHA 4HSZA 3JTDB 5AXIA 5AERA 2PVBA 3CZTX 1UWOA 3SG7A 1NP8A 1WLZA 2M9GA 2Q4UA 3KPXA 1CKKA 3TDUA 1DF0A 5HKWA 2LMTA 2M49B 2NXQA 1RJVA 1S6IA 2JTTA 1NPQA 4NDBA 2D8NA 1TRFA 3KO0A 3PFVA 1TNQA 2F2OA 1SCMC 3BXKA 1S5GY 1XFXO 1W7JB 1BODA 5HYDA 3IQQA 1LINA 1NX3A 1K9PA 4YRUA 5BPJA 1NX1A 1S3PA 1UP5A 2M97A 2OTGB 4IL1A 4DIRA 1XFVO 1YR5A 1ZACA 4I5LB 2G9BA 1AHRA 1KK7Z 1FW4A 1QV1A 4AOMA 1DGVA 1A4PA 1BT6A 5D7FA 1J1EA 1K8UA 4P2YB 1PSBA 2HQWA 5ER5A 1MXEA 1GJYA
chains in the Genus database with same CATH superfamily
3DY9A 2ERBA 2KGRA 4MZKA 4IJ7A 1A2XA 1K94A 1QX2A 2NLNA 1SKTA 4C0LA 4FQOA 2LVVA 5JJGA 2JNFA 1XVJA 2Q91A 4XJKA 1DEKA 1TOPA 1U5IB 2L5YA 1BMOA 1FBVA 2LAPA 1BF5A 2BL0C 3L4LA 2MLFC 1ZMZA 2O60A 2E30A 4MLWA 2H8VA 4OVNF 4MVFA 4WRIA 3H4SE 2LM5A 1L7ZA 5DKRA 2L2EA 5ER4X 3AAJA 2QEOA 3VRRA 1OMVA 2I2RE 5CPVA 1XK4C 4QJ5B 3S0EA 2KOTA 3CZ1A 2I7AA 1KFUL 4MBEA 3O6BA 2L50A 3Q8IA 1AK8A 4DS7A 2YGUA 1EG4A 3VRNA 1DT7B 1OE9B 2VRGA 1DELA 2P6BB 3WHTB 1DMOA 1WDCC 1FI6A 1KQMB 3PSRA 1V1GA 1IG5A 2WCKA 4PE7A 2CXJA 4PHKA 3LL8B 4ZCVA 4ORBB 3SIAA 2A4JA 2GV5A 1RK9A 2AAOA 1JUOA 3KHEA 1KK8B 1UUSA 2JXCA 1KFXL 2KNEA 1X02A 1SRAA 3D0YB 3R1PA 3PLFB 2M7LA 3UO9A 3CR5X 2EGDA 1CFDA 1A03A 1J7QA 2M7NA 1GGWA 1LS8A 3CZ0A 3EG5B 5EL2A 4QJ3B 2LMVA 1B47A 4GFTA 2NCOA 1M63B 1MHOA 1NYAA 2LUXA 2K61A 2MA2A 1T14A 3I5FB 1OSAA 3OBVA 4DRWA 2BE6A 1B8RA 1ZFSA 1G33A 1QWVA 3BOWA 3NSKA 3PN7B 4KYNA 2MRDA 2NZ0A 2HPSA 1JSAA 1JF2A 3I5IB 1ODBA 2LVIA 2KFFA 2L4IA 2P71A 4GGNA 3I5GB 3LCPC 4CLNA 1OQPA 1QS7A 1EL4A 4GAOA 1S26D 1KCYA 3BJHA 4F7FA 1IWQA 1QASA 5HLOA 1H8BA 2FCEA 3GOFA 4FTGA 4BY4A 3R1VA 4CIDA 1YUTA 5I2LA 3TZ1A 3EK7A 2F33A 4YGAA 1LXFC 1QJTA 2KAYA 4ORCB 5AANA 2ISDA 1JC2A 1NSHA 2PASA 1YUSA 4N1GA 2JWWA 3MSEB 1L2OB 3KEVA 1A75A 4M2QA 4CFQA 2WC5A 1K90D 2PQLA 4M2OA 2ZFDA 4NQGA 3SS3A 2JPTA 2BECA 1ALWA 5FYXA 1B7TY 2KDHA 2KFHA 2KAXA 4ICBA 3AKAA 1IKUA 3CS1A 3AAKA 3WHUB 2Y5IA 2COLB 3C1VA 5D3OA 5I8NA 2JT8A 1RWYA 2LVKA 1YVHA 1G8IA 2KPHA 2WORA 1B8LA 3KF9A 1OMRA 4OZDA 2PRUA 5CSIA 2BBMA 2K7DA 1BJFA 2QEBA 1CM4A 1BR1B 5DKQA 2MAZA 1OOFA 1QTXA 4E68A 1N2DA 1CLLA 1S5GZ 2NCPA 1QVIZ 2KHNA 1H4BA 1DJXA 1NUBA 4HRGA 2AUCA 1K2HA 2HF5A 2WCEA 5HKZA 2LHLA 2LLTA 2LLUA 2KI4B 5HL1A 1SL7A 1XK4A 2JT0A 2K2FA 4M2PA 1TNPA 2BNXA 4ORAB 5F6TA 3WXAA 1BR4B 1QX7A 1NCZA 2H61C 1XA5A 3CZ2A 1MWNA 4I5KA 3RM1A 4UPGA 1C7WA 1AVSA 1G4YR 3K21A 3NXAA 1DF0B 3GK2A 3EVVA 2KQYA 1PVAA 1KFUS 1N65A 1M45A 1AJ4A 3TUYC 1EG3A 3VRPA 1SPYA 1PVBA 4I5NB 3CDNA 4GBAA 1AJ5A 3I5HC 1QX5B 2L51A 3NHIA 1KQVA 3LLEA 1K96A 3OB1B 1C7VA 4MEWA 3EKJA 5TNCA 1UHNA 4OKHA 1DJIA 1S6CA 4OR9B 1XYDA 1Z2CB 2MJWB 2R2IA 1C3YA 4PALA 1KFXS 3BQ3A 3BUOB 1KSMA 1B9AA 2O5GA 2WCBA 3JTDC 3VGOA 1DGUA 1PRWA 3FE6A 2HETA 1MF8B 1BLQA 1TWOA 1JFJA 1Y1XA 1DJWA 3CTNA 2F8PA 1J7PA 2OS8B 3EK8A 1OZOA 1OOGA 1LKJA 1YVLA 2KYFA 3RZSA 3D73A 4YGDB 3TDIA 2L0PA 1QIWA 2GGZA 4TNCA 1IH0A 4YGCB 3PALA 2P70A 1KK7Y 5KU1A 2K7CA 2JU0A 2CTNA 3PM2A 1SSEB 4JQ0D 4AQIA 5B8IB 1SMGA 5HLVA 3S0AA 1EH2A 2LV7A 2KBIA 1JFKA 4XJKB 5JOLA 1DJZA 1S1EA 2KSPA 1IIOA 2EHBA 2QDIA 1B1GA 2WCHA 1TNXA 3SG5A 1M31A 1YX8A 1Z4HA 1PULA 1TTXA 3TS5B 2CCMA 2TN4A 3O2PA 1MR8A 2ZRTA 2KQ6A 1XFWO 3DF0A 2JZIA 4GPLB 5G08A 1CFPA 3N7HA 2WC8A 1NCXA 2SASA 3R72A 5K89A 3SG3A 4A4BA 2FJYA 1B4CA 3O78A 2M3WA 2ZN9A 1OOIX 1QV0A 1YUUA 1LVCD 2F2PA 3O4YA 4MN0A 2MBXA 3SG6A 1EXRA 2ZKMX 2FOTA 1F71A 3S0GA 3DZTA 3CGAA 5CSJA 1V1FA 3L4AA 3UNWA 1SR6B 1B8CA 1SL9A 1OW4A 1E8AA 2AMIA 2K7OA 3JVTB 4MRYA 1WLMA 3PM8A 1RTP1 4PHMA 2EC6B 2ZN8A 2KGBC 2KLEA 1CB1A 1RECA 1TCOB 1YTZC 2CBLA 2H61A 1KWOC 2Y1NA 2JXLA 1SCVA 3NGVA 1MXLC 1SY9A 1F8HA 3OP0A 2WCLA 3BOWB 1DQEA 1KQMC 1PSRA 2E6WA 3BUWB 4PE1A 3BUNB 1B7TZ 1CMFA 1K9UA 1CNPA 3DXLA 5CSNA 3CR2A 1SCMB 2ZRSA 2BAPA 4NDCA 2ZNEA 2PSRA 1KK8C 1UHKA 2OPOA 1LA3A 3FE9A 1DVIA 1JF0A 2K0JA 3B87A 1NWDA 2M29A 2M0RA 3SJSA 5J3XA 4U8DA 2LHIA 1UURA 1IJ6A 1UHJA 1R6PA 4F0ZB 1W7IB 2L5XB 3NSOA 4ETOA 3I5FC 1A75B 2L4HA 1CFCA 1UHHA 1PK0D 2Y1MA 3ICBA 1XFZO 1QLKA 3F45A 3PN7C 3ZNIA 3CLNA 3NHTA 1WRKA 1PALA 5KTYA 3I5IC 1BOCA 3DVMA 3OX6A 1K93D 1J1DA 1LA0A 1Y1AA 2LANA 4BY5A 1W9ZA 1F4QA 3I5GC 2L98A 3DD4A 1F70A 1YURA 2PMYA 2JT3A 1SW8A 5DKNA 2WCMA 4CPVA 4CFRA 4GGFC 1ALVA 2M1UA 2KFGA 1OOHA 1CFFA 4YBHB 3BYAA 2BL0B 3OX5A 2LUCA 4WQ2A 1SK6D 3WNXB 1L2OC 2Y4QA 4JPZB 1C3ZA 5HKYA 2BKIB 2K8MB 4USLA 4JD9A 2WOSA 1P28A 1XO5A 3SG2A 4QJ4B 1QVIY 1CTRA 2HQ8A 4PE0A 1JWDA 1SYMA 1CDPA 2G2BA 3HX4A 4I5JA 3GK1A 2WCFA 1WDCB 3SS4A 3DVKA 2BCXA 1J7RA 1F4OA 1IRJA 1ORGA 1TNWA 2MHHA 4PHJA 1U5IA 3A4UB 1F55A 2KI6C 1CLBA 2JC2A 3K1EA 4MZLA 1TCFA 3SS5A 4DCKA 3LK0A 1TIZA 1VRKA 2K7BA 2KLDA 3QRXA 1XFUO 5FI6A 4OV2A 3E3RA 3EK4A 1CM1A 2FCDA 4Q04A 1CMGA 1FI5A 3NSLA 2KI4C 2H2KA 1BU3A 1CLMA 3S0FA 2SCPA 1QATA 3HCMA 2B1UA 4GNKB 4MZJA 3QMEA 5DICA 5I2OA 1NCYA 2JTZA 1WRZA 1N0YA 4GUKA 3OGNA 2BBNA 3RLZA 2BCBA 4YI8A 2CNPA 1SNLA 3BUMB 2OTGC 1HT9A 2L2CA 1QXPA 4PCWA 1CDNA 3VROA 4D1EA 5PALA 4ZCUA 4PT1A 3SG4A 1OZSA 1XFYO 5AEQA 3BFBA 1K9KA 3CWGA 4L9MA 3CR4X 1AUIB 1AP4A 3LK1A 3M0WA 3IF7A 5I2QA 3D0YA 2JULA 3BFHA 2I94A 1IQ3A 4HREE 1WRLA 1KWOB 1IGVA 1J55A 2MLEC 1ZUZA 3PJIA 3NSIA 2KAVA 3FIAA 1OMDA 4AQJA 3GK4X 2JQ6A 2KBMA 3B6XA 2LMUA 2WC6A 4DUQA 4NDDA 3D76A 4INXA 2KYCA 2QPTA 3DVJA 2LCPA 1TN4A 2M8UA 1YRUB 1GM0A 1ZOTB 2OS8C 3A8RA 3FWCA 4JWQA 3DF0B 4R1EA 1UHIA 3CYZA 2JNXA 2GTEA 1RROA 3AKBA 3EVRA 4FQTA 1DJYA 4PHNA 2JRFA 3D75A 2LVJA 2KI6D 4MSPA 3S0DA 5I94A 2LP2A 1NIWA 1FPWA 4MRXA 2ZNDA 1SBJA 2BE4A 3PATA 4C0JA 1BG1A 3VRQA 4P5OE 1DJGA 1D1OA 4WQ3A 2FJUB 3FS7A 1Y0VH 2LNKA 3D74A 2QACA 3R1OA 3ZWHA 1IQ5A 2JPOA 2BCAA 3BUXB 3VB1A 4N5XA 3EVUA 1EJ3A 1M46A 1KSOA 3IVTA 4GGFA 2I18A 1WY9A 4OCIA 4PE4A 5GQQC 3IQOA 1S36A 5D69A 2V53A 1MQ1A 1Q80A 2CT9A 2K2AA 1S6JA 3FE8A 5CSFA 3TS5C 1J7OA 1CDLA 3OHMB 4INWA 5KSZA 3B86A 1F54A 2PYQA 3D78A 1A29A 4YGBB 1MUXA 1K95A 1M39A 4YI9A 1RFJA 4C0KA 1DTLA 1SL8A 2JOJA 1FF1A 1GQMA 2LC5A 3SIBA 2DOQA 3OB2B 2M1KB 1QLSA 3TUYB 1Y1UA 2GGMA 3O4XA 1OOJA 2BKHB 5IBWA 2WNDA 3FWBA 4PDZA 3I5HB 3EKHA 3B7AA 1NX2A 1YX7A 1SR6C 1CDMA 1IJ5A 1YRTB 3BFAA 1DJHA 4XYNA 1NX0A 2IS9A 4YGEB 3JVTC 1R2UA 2F3ZA 3DVEA 2LP3A 1Y6WA 1QIVA 1JBAA 1HQVA 2LE9B 3D10A 2WCJA 2EC6C 2F3YA 3TDZA 2QEHA 4N1FA 2LLSA 4A4CA 5FI7A 5AFPA 2PALA 1C07A 2RGIA 1GGZA 4HRHA 1TUJA 3JTDB 4HSZA 3D77A 5AXIA 5AERA 2PVBA 3CZTX 1UWOA 3SG7A 1NP8A 1WLZA 2M9GA 2Q4UA 3KPXA 1CKKA 2QEVA 3L47A 3TDUA 1DF0A 5HKWA 2LMTA 2M49B 2NXQA 1RJVA 1S6IA 2JTTA 1NPQA 3B88A 4NDBA 2D8NA 1TRFA 3KO0A 3PFVA 1TNQA 2F2OA 1SCMC 3BXKA 1S5GY 1XFXO 1W7JB 2K60A 3S0BA 3DYEA 1BODA 5HYDA 3IQQA 1LINA 1NX3A 5FI2A 1K9PA 4YRUA 5BPJA 1NX1A 1S3PA 1TUZA 1UP5A 2M97A 2OTGB 4IL1A 4DIRA 3CABA 1XFVO 1YR5A 1ZACA 4I5LB 2G9BA 1AHRA 4JKTA 1KK7Z 1FW4A 1QV1A 4AOMA 1DGVA 1A4PA 1BT6A 1XFRA 5D7FA 3V2LA 1DC1A 1J1EA 1K8UA 4P2YB 1PSBA 2HQWA 5ER5A 1MXEA 1GJYA
chains in the Genus database with same CATH topology
2KGRA 4MZKA 1A2XA 1K94A 1QX2A 2NLNA 1SKTA 4C0LA 4FQOA 2LVVA 5JJGA 2JNFA 1XVJA 2Q91A 4XJKA 1TOPA 1U5IB 1BF5A 1BMOA 1FBVA 2LAPA 2BL0C 2MLFC 1ZMZA 2O60A 2E30A 4MLWA 4OVNF 4MVFA 4WRIA 3H4SE 2LM5A 1L7ZA 5DKRA 2L2EA 5ER4X 3AAJA 3VRRA 1OMVA 2I2RE 5CPVA 1XK4C 4QJ5B 2KOTA 4MBEA 2I7AA 1KFUL 3O6BA 2L50A 1AK8A 4DS7A 3VRNA 1EG4A 1DT7B 1OE9B 2VRGA 3WHTB 2P6BB 1DMOA 1FI6A 1WDCC 1KQMB 3PSRA 1V1GA 1IG5A 4PE7A 2CXJA 4PHKA 3LL8B 4ZCVA 4ORBB 3SIAA 2A4JA 2GV5A 1RK9A 2AAOA 1JUOA 3KHEA 1KK8B 1UUSA 2JXCA 1KFXL 2KNEA 1X02A 1SRAA 3D0YB 3PLFB 2M7LA 3CR5X 2EGDA 1CFDA 1A03A 1J7QA 2M7NA 1GGWA 4QJ3B 2LMVA 1B47A 4GFTA 2NCOA 1M63B 1MHOA 1NYAA 2LUXA 2K61A 2MA2A 3I5FB 4DRWA 1OSAA 2BE6A 1B8RA 1ZFSA 1G33A 3PN7B 3BOWA 3NSKA 2MRDA 2NZ0A 2HPSA 1JSAA 1JF2A 3I5IB 1ODBA 2LVIA 2KFFA 2L4IA 4GGNA 3I5GB 3LCPC 4CLNA 1OQPA 1QS7A 1EL4A 4GAOA 1S26D 1KCYA 1IWQA 1QASA 5HLOA 1H8BA 2FCEA 3GOFA 4FTGA 4BY4A 4CIDA 1YUTA 5I2LA 3TZ1A 3EK7A 2F33A 4YGAA 1LXFC 1QJTA 2KAYA 4ORCB 5AANA 2ISDA 1JC2A 1NSHA 2PASA 1YUSA 4N1GA 2JWWA 3MSEB 1L2OB 3KEVA 1A75A 4M2QA 4CFQA 1K90D 4M2OA 2ZFDA 4NQGA 2JPTA 2BECA 1ALWA 5FYXA 1B7TY 2KDHA 2KFHA 2KAXA 4ICBA 3AKAA 1IKUA 3CS1A 3AAKA 3WHUB 2Y5IA 2COLB 3C1VA 5I8NA 2JT8A 1RWYA 2LVKA 1YVHA 1G8IA 2WORA 3KF9A 1B8LA 5CSIA 1OMRA 2PRUA 2BBMA 2K7DA 1BJFA 1CM4A 1BR1B 5DKQA 2MAZA 1QTXA 4E68A 1N2DA 1CLLA 1S5GZ 2NCPA 1QVIZ 2KHNA 1H4BA 1DJXA 1NUBA 4HRGA 2AUCA 1K2HA 2HF5A 2WCEA 5HKZA 2LHLA 2LLTA 2LLUA 2KI4B 1SL7A 1XK4A 2JT0A 2K2FA 4M2PA 1TNPA 4ORAB 5F6TA 3WXAA 1BR4B 1QX7A 1NCZA 2H61C 1XA5A 4I5KA 1MWNA 3RM1A 4UPGA 1C7WA 1AVSA 1G4YR 3K21A 3NXAA 1DF0B 3GK2A 3EVVA 2KQYA 1PVAA 1KFUS 1N65A 1M45A 1AJ4A 3TUYC 1EG3A 3VRPA 1SPYA 1PVBA 4I5NB 4GBAA 1AJ5A 3I5HC 1QX5B 2L51A 1KQVA 3LLEA 1K96A 3OB1B 1C7VA 4MEWA 3EKJA 5TNCA 1UHNA 4OKHA 1DJIA 1S6CA 4OR9B 1XYDA 2MJWB 2R2IA 4PALA 1KFXS 3BQ3A 3BUOB 1KSMA 1B9AA 2O5GA 2WCBA 3JTDC 3VGOA 1DGUA 1PRWA 2HETA 1MF8B 1BLQA 1JFJA 1Y1XA 1DJWA 3CTNA 2F8PA 1J7PA 2OS8B 3EK8A 1OZOA 1LKJA 1YVLA 2KYFA 4YGDB 3TDIA 2L0PA 1QIWA 2GGZA 4TNCA 1IH0A 4YGCB 3PALA 1KK7Y 5KU1A 2K7CA 2JU0A 2CTNA 4JQ0D 4AQIA 5B8IB 1SMGA 5HLVA 1EH2A 2LV7A 2KBIA 1JFKA 4XJKB 5JOLA 1DJZA 1S1EA 2KSPA 2EHBA 1B1GA 1TNXA 3SG5A 1M31A 1YX8A 1PULA 1TTXA 3TS5B 2CCMA 2TN4A 3O2PA 1MR8A 2ZRTA 2KQ6A 1XFWO 3DF0A 2JZIA 4GPLB 5G08A 1CFPA 2WC8A 1NCXA 2SASA 5K89A 3SG3A 4A4BA 1B4CA 3O78A 2M3WA 2ZN9A 3O4YA 1QV0A 1YUUA 1LVCD 2F2PA 4MN0A 2MBXA 3SG6A 1EXRA 2ZKMX 2FOTA 1F71A 3CGAA 5CSJA 1V1FA 1SR6B 1B8CA 1SL9A 1E8AA 2AMIA 2K7OA 3JVTB 4MRYA 1WLMA 3PM8A 1RTP1 4PHMA 2EC6B 2ZN8A 2KGBC 1CB1A 1RECA 1TCOB 2CBLA 1YTZC 2H61A 1KWOC 2Y1NA 2JXLA 1SCVA 1MXLC 1SY9A 1F8HA 3OP0A 3BOWB 1KQMC 1PSRA 2E6WA 3BUWB 4PE1A 3BUNB 1B7TZ 1CMFA 1K9UA 1CNPA 5CSNA 3CR2A 1SCMB 2ZRSA 4NDCA 2ZNEA 2PSRA 1KK8C 1UHKA 2OPOA 1LA3A 1DVIA 1JF0A 2K0JA 1NWDA 2M29A 2M0RA 3SJSA 5J3XA 4U8DA 2LHIA 1UURA 1IJ6A 1UHJA 1R6PA 4F0ZB 1W7IB 2L5XB 3NSOA 4ETOA 3I5FC 1A75B 2L4HA 1CFCA 1UHHA 1PK0D 2Y1MA 3ICBA 1XFZO 1QLKA 3F45A 3PN7C 3ZNIA 3CLNA 1WRKA 1PALA 5KTYA 3I5IC 1BOCA 3DVMA 3OX6A 1K93D 1J1DA 1LA0A 1Y1AA 2LANA 4BY5A 1F4QA 3I5GC 2L98A 3DD4A 1F70A 1YURA 2PMYA 2JT3A 1SW8A 5DKNA 4CPVA 4CFRA 4GGFC 1ALVA 2M1UA 2KFGA 1CFFA 4YBHB 3BYAA 2BL0B 3OX5A 2LUCA 4WQ2A 1SK6D 3WNXB 1L2OC 2Y4QA 4JPZB 5HKYA 2BKIB 2K8MB 4USLA 2WOSA 1XO5A 3SG2A 4QJ4B 1QVIY 1CTRA 2HQ8A 4PE0A 1JWDA 1SYMA 1CDPA 2G2BA 3HX4A 4I5JA 3GK1A 2WCFA 1WDCB 3DVKA 2BCXA 1J7RA 1F4OA 1IRJA 1TNWA 2MHHA 4PHJA 1U5IA 3A4UB 1F55A 2KI6C 1CLBA 2JC2A 4MZLA 1TCFA 4DCKA 3LK0A 1TIZA 1VRKA 2K7BA 3QRXA 1XFUO 4OV2A 3E3RA 3EK4A 1CM1A 2FCDA 4Q04A 1CMGA 1FI5A 3NSLA 2KI4C 2H2KA 1BU3A 1CLMA 2SCPA 1QATA 3HCMA 2B1UA 4GNKB 4MZJA 5I2OA 1NCYA 2JTZA 1WRZA 1N0YA 4GUKA 2BBNA 3RLZA 2BCBA 4YI8A 2CNPA 1SNLA 3BUMB 2OTGC 1HT9A 1QXPA 4PCWA 1CDNA 3VROA 4D1EA 5PALA 4ZCUA 3SG4A 1OZSA 1XFYO 5AEQA 1K9KA 3CWGA 4L9MA 3CR4X 1AUIB 1AP4A 3LK1A 3M0WA 3IF7A 5I2QA 3D0YA 2JULA 2I94A 1IQ3A 4HREE 1WRLA 1KWOB 1IGVA 1J55A 2MLEC 1ZUZA 3NSIA 2KAVA 3FIAA 1OMDA 4AQJA 3GK4X 2JQ6A 2KBMA 2LMUA 4DUQA 4NDDA 2KYCA 2QPTA 3DVJA 2LCPA 1TN4A 2M8UA 1YRUB 1ZOTB 2OS8C 3A8RA 3FWCA 4JWQA 3DF0B 4R1EA 1UHIA 2JNXA 1RROA 3AKBA 3EVRA 1DJYA 4PHNA 2JRFA 4MSPA 2LVJA 2KI6D 2LP2A 1NIWA 1FPWA 4MRXA 2ZNDA 1SBJA 2BE4A 3PATA 4C0JA 1BG1A 3VRQA 4P5OE 1DJGA 1D1OA 4WQ3A 2FJUB 3FS7A 1Y0VH 2LNKA 3ZWHA 2QACA 1IQ5A 2BCAA 3BUXB 4N5XA 3EVUA 1EJ3A 1M46A 1KSOA 4GGFA 2I18A 1WY9A 4OCIA 4PE4A 5GQQC 3IQOA 1S36A 5D69A 2V53A 1MQ1A 1Q80A 2CT9A 2K2AA 1S6JA 5CSFA 3TS5C 1J7OA 1CDLA 3OHMB 5KSZA 1F54A 1A29A 4YGBB 1MUXA 1K95A 1M39A 4YI9A 1RFJA 4C0KA 1DTLA 1SL8A 2JOJA 1FF1A 1GQMA 2LC5A 3SIBA 2DOQA 3OB2B 2M1KB 1QLSA 3TUYB 1Y1UA 2GGMA 1OOJA 2BKHB 5IBWA 2WNDA 3FWBA 4PDZA 3I5HB 3EKHA 1NX2A 1YX7A 1SR6C 1CDMA 1IJ5A 1YRTB 1DJHA 4XYNA 1NX0A 2IS9A 4YGEB 3JVTC 1R2UA 2F3ZA 3DVEA 2LP3A 1Y6WA 1QIVA 1JBAA 1HQVA 2LE9B 3D10A 2EC6C 2F3YA 3TDZA 4N1FA 2LLSA 4A4CA 5AFPA 1C07A 2PALA 2RGIA 1GGZA 4HRHA 4HSZA 3JTDB 5AXIA 5AERA 2PVBA 3CZTX 1UWOA 3SG7A 1NP8A 1WLZA 2M9GA 2Q4UA 3KPXA 1CKKA 3TDUA 1DF0A 5HKWA 2LMTA 2M49B 2NXQA 1RJVA 1S6IA 2JTTA 1NPQA 4NDBA 2D8NA 1TRFA 3KO0A 3PFVA 1TNQA 2F2OA 1SCMC 3BXKA 1S5GY 1XFXO 1W7JB 1BODA 5HYDA 3IQQA 1LINA 1NX3A 1K9PA 4YRUA 5BPJA 1NX1A 1S3PA 1UP5A 2M97A 2OTGB 4IL1A 4DIRA 1XFVO 1YR5A 1ZACA 4I5LB 2G9BA 1AHRA 1KK7Z 1FW4A 1QV1A 4AOMA 1DGVA 1A4PA 1BT6A 5D7FA 1J1EA 1K8UA 4P2YB 1PSBA 2HQWA 5ER5A 1MXEA 1GJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGR A;  4MZK A;  1A2X A;  1K94 A;  1QX2 A;  2NLN A;  1SKT A;  4C0L A;  4FQO A;  2LVV A;  5JJG A;  2JNF A;  1XVJ A;  2Q91 A;  4XJK A;  1TOP A;  1U5I B;  1BF5 A;  1BMO A;  1FBV A;  2LAP A;  2BL0 C;  2MLF C;  1ZMZ A;  2O60 A;  2E30 A;  4MLW A;  4OVN F;  4MVF A;  4WRI A;  3H4S E;  2LM5 A;  1L7Z A;  5DKR A;  2L2E A;  5ER4 X;  3AAJ A;  3VRR A;  1OMV A;  2I2R E;  5CPV A;  1XK4 C;  4QJ5 B;  2KOT A;  4MBE A;  2I7A A;  1KFU L;  3O6B A;  2L50 A;  1AK8 A;  4DS7 A;  3VRN A;  1EG4 A;  1DT7 B;  1OE9 B;  2VRG A;  3WHT B;  2P6B B;  1DMO A;  1FI6 A;  1WDC C;  1KQM B;  3PSR A;  1V1G A;  1IG5 A;  4PE7 A;  2CXJ A;  4PHK A;  3LL8 B;  4ZCV A;  4ORB B;  3SIA A;  2A4J A;  2GV5 A;  1RK9 A;  2AAO A;  1JUO A;  3KHE A;  1KK8 B;  1UUS A;  2JXC A;  1KFX L;  2KNE A;  1X02 A;  1SRA A;  3D0Y B;  3PLF B;  2M7L A;  3CR5 X;  2EGD A;  1CFD A;  1A03 A;  1J7Q A;  2M7N A;  1GGW A;  4QJ3 B;  2LMV A;  1B47 A;  4GFT A;  2NCO A;  1M63 B;  1MHO A;  1NYA A;  2LUX A;  2K61 A;  2MA2 A;  3I5F B;  4DRW A;  1OSA A;  2BE6 A;  1B8R A;  1ZFS A;  1G33 A;  3PN7 B;  3BOW A;  3NSK A;  2MRD A;  2NZ0 A;  2HPS A;  1JSA A;  1JF2 A;  3I5I B;  1ODB A;  2LVI A;  2KFF A;  2L4I A;  4GGN A;  3I5G B;  3LCP C;  4CLN A;  1OQP A;  1QS7 A;  1EL4 A;  4GAO A;  1S26 D;  1KCY A;  1IWQ A;  1QAS A;  5HLO A;  1H8B A;  2FCE A;  3GOF A;  4FTG A;  4BY4 A;  4CID A;  1YUT A;  5I2L A;  3TZ1 A;  3EK7 A;  2F33 A;  4YGA A;  1LXF C;  1QJT A;  2KAY A;  4ORC B;  5AAN A;  2ISD A;  1JC2 A;  1NSH A;  2PAS A;  1YUS A;  4N1G A;  2JWW A;  3MSE B;  1L2O B;  3KEV A;  1A75 A;  4M2Q A;  4CFQ A;  1K90 D;  4M2O A;  2ZFD A;  4NQG A;  2JPT A;  2BEC A;  1ALW A;  5FYX A;  1B7T Y;  2KDH A;  2KFH A;  2KAX A;  4ICB A;  3AKA A;  1IKU A;  3CS1 A;  3AAK A;  3WHU B;  2Y5I A;  2COL B;  3C1V A;  5I8N A;  2JT8 A;  1RWY A;  2LVK A;  1YVH A;  1G8I A;  2WOR A;  3KF9 A;  1B8L A;  5CSI A;  1OMR A;  2PRU A;  2BBM A;  2K7D A;  1BJF A;  1CM4 A;  1BR1 B;  5DKQ A;  2MAZ A;  1QTX A;  4E68 A;  1N2D A;  1CLL A;  1S5G Z;  2NCP A;  1QVI Z;  2KHN A;  1H4B A;  1DJX A;  1NUB A;  4HRG A;  2AUC A;  1K2H A;  2HF5 A;  2WCE A;  5HKZ A;  2LHL A;  2LLT A;  2LLU A;  2KI4 B;  1SL7 A;  1XK4 A;  2JT0 A;  2K2F A;  4M2P A;  1TNP A;  4ORA B;  5F6T A;  3WXA A;  1BR4 B;  1QX7 A;  1NCZ A;  2H61 C;  1XA5 A;  4I5K A;  1MWN A;  3RM1 A;  4UPG A;  1C7W A;  1AVS A;  1G4Y R;  3K21 A;  3NXA A;  1DF0 B;  3GK2 A;  3EVV A;  2KQY A;  1PVA A;  1KFU S;  1N65 A;  1M45 A;  1AJ4 A;  3TUY C;  1EG3 A;  3VRP A;  1SPY A;  1PVB A;  4I5N B;  4GBA A;  1AJ5 A;  3I5H C;  1QX5 B;  2L51 A;  1KQV A;  3LLE A;  1K96 A;  3OB1 B;  1C7V A;  4MEW A;  3EKJ A;  5TNC A;  1UHN A;  4OKH A;  1DJI A;  1S6C A;  4OR9 B;  1XYD A;  2MJW B;  2R2I A;  4PAL A;  1KFX S;  3BQ3 A;  3BUO B;  1KSM A;  1B9A A;  2O5G A;  2WCB A;  3JTD C;  3VGO A;  1DGU A;  1PRW A;  2HET A;  1MF8 B;  1BLQ A;  1JFJ A;  1Y1X A;  1DJW A;  3CTN A;  2F8P A;  1J7P A;  2OS8 B;  3EK8 A;  1OZO A;  1LKJ A;  1YVL A;  2KYF A;  4YGD B;  3TDI A;  2L0P A;  1QIW A;  2GGZ A;  4TNC A;  1IH0 A;  4YGC B;  3PAL A;  1KK7 Y;  5KU1 A;  2K7C A;  2JU0 A;  2CTN A;  4JQ0 D;  4AQI A;  5B8I B;  1SMG A;  5HLV A;  1EH2 A;  2LV7 A;  2KBI A;  1JFK A;  4XJK B;  5JOL A;  1DJZ A;  1S1E A;  2KSP A;  2EHB A;  1B1G A;  1TNX A;  3SG5 A;  1M31 A;  1YX8 A;  1PUL A;  1TTX A;  3TS5 B;  2CCM A;  2TN4 A;  3O2P A;  1MR8 A;  2ZRT A;  2KQ6 A;  1XFW O;  3DF0 A;  2JZI A;  4GPL B;  5G08 A;  1CFP A;  2WC8 A;  1NCX A;  2SAS A;  5K89 A;  3SG3 A;  4A4B A;  1B4C A;  3O78 A;  2M3W A;  2ZN9 A;  3O4Y A;  1QV0 A;  1YUU A;  1LVC D;  2F2P A;  4MN0 A;  2MBX A;  3SG6 A;  1EXR A;  2ZKM X;  2FOT A;  1F71 A;  3CGA A;  5CSJ A;  1V1F A;  1SR6 B;  1B8C A;  1SL9 A;  1E8A A;  2AMI A;  2K7O A;  3JVT B;  4MRY A;  1WLM A;  3PM8 A;  1RTP 1;  4PHM A;  2EC6 B;  2ZN8 A;  2KGB C;  1CB1 A;  1REC A;  1TCO B;  2CBL A;  1YTZ C;  2H61 A;  1KWO C;  2Y1N A;  2JXL A;  1SCV A;  1MXL C;  1SY9 A;  1F8H A;  3OP0 A;  3BOW B;  1KQM C;  1PSR A;  2E6W A;  3BUW B;  4PE1 A;  3BUN B;  1B7T Z;  1CMF A;  1K9U A;  1CNP A;  5CSN A;  3CR2 A;  1SCM B;  2ZRS A;  4NDC A;  2ZNE A;  2PSR A;  1KK8 C;  1UHK A;  2OPO A;  1LA3 A;  1DVI A;  1JF0 A;  2K0J A;  1NWD A;  2M29 A;  2M0R A;  3SJS A;  5J3X A;  4U8D A;  2LHI A;  1UUR A;  1IJ6 A;  1UHJ A;  1R6P A;  4F0Z B;  1W7I B;  2L5X B;  3NSO A;  4ETO A;  3I5F C;  1A75 B;  2L4H A;  1CFC A;  1UHH A;  1PK0 D;  2Y1M A;  3ICB A;  1XFZ O;  1QLK A;  3F45 A;  3PN7 C;  3ZNI A;  3CLN A;  1WRK A;  1PAL A;  5KTY A;  3I5I C;  1BOC A;  3DVM A;  3OX6 A;  1K93 D;  1J1D A;  1LA0 A;  1Y1A A;  2LAN A;  4BY5 A;  1F4Q A;  3I5G C;  2L98 A;  3DD4 A;  1F70 A;  1YUR A;  2PMY A;  2JT3 A;  1SW8 A;  5DKN A;  4CPV A;  4CFR A;  4GGF C;  1ALV A;  2M1U A;  2KFG A;  1CFF A;  4YBH B;  3BYA A;  2BL0 B;  3OX5 A;  2LUC A;  4WQ2 A;  1SK6 D;  3WNX B;  1L2O C;  2Y4Q A;  4JPZ B;  5HKY A;  2BKI B;  2K8M B;  4USL A;  2WOS A;  1XO5 A;  3SG2 A;  4QJ4 B;  1QVI Y;  1CTR A;  2HQ8 A;  4PE0 A;  1JWD A;  1SYM A;  1CDP A;  2G2B A;  3HX4 A;  4I5J A;  3GK1 A;  2WCF A;  1WDC B;  3DVK A;  2BCX A;  1J7R A;  1F4O A;  1IRJ A;  1TNW A;  2MHH A;  4PHJ A;  1U5I A;  3A4U B;  1F55 A;  2KI6 C;  1CLB A;  2JC2 A;  4MZL A;  1TCF A;  4DCK A;  3LK0 A;  1TIZ A;  1VRK A;  2K7B A;  3QRX A;  1XFU O;  4OV2 A;  3E3R A;  3EK4 A;  1CM1 A;  2FCD A;  4Q04 A;  1CMG A;  1FI5 A;  3NSL A;  2KI4 C;  2H2K A;  1BU3 A;  1CLM A;  2SCP A;  1QAT A;  3HCM A;  2B1U A;  4GNK B;  4MZJ A;  5I2O A;  1NCY A;  2JTZ A;  1WRZ A;  1N0Y A;  4GUK A;  2BBN A;  3RLZ A;  2BCB A;  4YI8 A;  2CNP A;  1SNL A;  3BUM B;  2OTG C;  1HT9 A;  1QXP A;  4PCW A;  1CDN A;  3VRO A;  4D1E A;  5PAL A;  4ZCU A;  3SG4 A;  1OZS A;  1XFY O;  5AEQ A;  1K9K A;  3CWG A;  4L9M A;  3CR4 X;  1AUI B;  1AP4 A;  3LK1 A;  3M0W A;  3IF7 A;  5I2Q A;  3D0Y A;  2JUL A;  2I94 A;  1IQ3 A;  4HRE E;  1WRL A;  1KWO B;  1IGV A;  1J55 A;  2MLE C;  1ZUZ A;  3NSI A;  2KAV A;  3FIA A;  1OMD A;  4AQJ A;  3GK4 X;  2JQ6 A;  2KBM A;  2LMU A;  4DUQ A;  4NDD A;  2KYC A;  2QPT A;  3DVJ A;  2LCP A;  1TN4 A;  2M8U A;  1YRU B;  1ZOT B;  2OS8 C;  3A8R A;  3FWC A;  4JWQ A;  3DF0 B;  4R1E A;  1UHI A;  2JNX A;  1RRO A;  3AKB A;  3EVR A;  1DJY A;  4PHN A;  2JRF A;  4MSP A;  2LVJ A;  2KI6 D;  2LP2 A;  1NIW A;  1FPW A;  4MRX A;  2ZND A;  1SBJ A;  2BE4 A;  3PAT A;  4C0J A;  1BG1 A;  3VRQ A;  4P5O E;  1DJG A;  1D1O A;  4WQ3 A;  2FJU B;  3FS7 A;  1Y0V H;  2LNK A;  3ZWH A;  2QAC A;  1IQ5 A;  2BCA A;  3BUX B;  4N5X A;  3EVU A;  1EJ3 A;  1M46 A;  1KSO A;  4GGF A;  2I18 A;  1WY9 A;  4OCI A;  4PE4 A;  5GQQ C;  3IQO A;  1S36 A;  5D69 A;  2V53 A;  1MQ1 A;  1Q80 A;  2CT9 A;  2K2A A;  1S6J A;  5CSF A;  3TS5 C;  1J7O A;  1CDL A;  3OHM B;  5KSZ A;  1F54 A;  1A29 A;  4YGB B;  1MUX A;  1K95 A;  1M39 A;  4YI9 A;  1RFJ A;  4C0K A;  1DTL A;  1SL8 A;  2JOJ A;  1FF1 A;  1GQM A;  2LC5 A;  3SIB A;  2DOQ A;  3OB2 B;  2M1K B;  1QLS A;  3TUY B;  1Y1U A;  2GGM A;  1OOJ A;  2BKH B;  5IBW A;  2WND A;  3FWB A;  4PDZ A;  3I5H B;  3EKH A;  1NX2 A;  1YX7 A;  1SR6 C;  1CDM A;  1IJ5 A;  1YRT B;  1DJH A;  4XYN A;  1NX0 A;  2IS9 A;  4YGE B;  3JVT C;  1R2U A;  2F3Z A;  3DVE A;  2LP3 A;  1Y6W A;  1QIV A;  1JBA A;  1HQV A;  2LE9 B;  3D10 A;  2EC6 C;  2F3Y A;  3TDZ A;  4N1F A;  2LLS A;  4A4C A;  5AFP A;  1C07 A;  2PAL A;  2RGI A;  1GGZ A;  4HRH A;  4HSZ A;  3JTD B;  5AXI A;  5AER A;  2PVB A;  3CZT X;  1UWO A;  3SG7 A;  1NP8 A;  1WLZ A;  2M9G A;  2Q4U A;  3KPX A;  1CKK A;  3TDU A;  1DF0 A;  5HKW A;  2LMT A;  2M49 B;  2NXQ A;  1RJV A;  1S6I A;  2JTT A;  1NPQ A;  4NDB A;  2D8N A;  1TRF A;  3KO0 A;  3PFV A;  1TNQ A;  2F2O A;  1SCM C;  3BXK A;  1S5G Y;  1XFX O;  1W7J B;  1BOD A;  5HYD A;  3IQQ A;  1LIN A;  1NX3 A;  1K9P A;  4YRU A;  5BPJ A;  1NX1 A;  1S3P A;  1UP5 A;  2M97 A;  2OTG B;  4IL1 A;  4DIR A;  1XFV O;  1YR5 A;  1ZAC A;  4I5L B;  2G9B A;  1AHR A;  1KK7 Z;  1FW4 A;  1QV1 A;  4AOM A;  1DGV A;  1A4P A;  1BT6 A;  5D7F A;  1J1E A;  1K8U A;  4P2Y B;  1PSB A;  2HQW A;  5ER5 A;  1MXE A;  1GJY A; 
#chains in the Genus database with same CATH topology
 3DY9 A;  2ERB A;  2KGR A;  4MZK A;  4IJ7 A;  1A2X A;  1K94 A;  1QX2 A;  2NLN A;  1SKT A;  4C0L A;  4FQO A;  2LVV A;  5JJG A;  2JNF A;  1XVJ A;  2Q91 A;  4XJK A;  1DEK A;  1TOP A;  1U5I B;  2L5Y A;  1BMO A;  1FBV A;  2LAP A;  1BF5 A;  2BL0 C;  3L4L A;  2MLF C;  1ZMZ A;  2O60 A;  2E30 A;  4MLW A;  2H8V A;  4OVN F;  4MVF A;  4WRI A;  3H4S E;  2LM5 A;  1L7Z A;  5DKR A;  2L2E A;  5ER4 X;  3AAJ A;  2QEO A;  3VRR A;  1OMV A;  2I2R E;  5CPV A;  1XK4 C;  4QJ5 B;  3S0E A;  2KOT A;  3CZ1 A;  2I7A A;  1KFU L;  4MBE A;  3O6B A;  2L50 A;  3Q8I A;  1AK8 A;  4DS7 A;  2YGU A;  1EG4 A;  3VRN A;  1DT7 B;  1OE9 B;  2VRG A;  1DEL A;  2P6B B;  3WHT B;  1DMO A;  1WDC C;  1FI6 A;  1KQM B;  3PSR A;  1V1G A;  1IG5 A;  2WCK A;  4PE7 A;  2CXJ A;  4PHK A;  3LL8 B;  4ZCV A;  4ORB B;  3SIA A;  2A4J A;  2GV5 A;  1RK9 A;  2AAO A;  1JUO A;  3KHE A;  1KK8 B;  1UUS A;  2JXC A;  1KFX L;  2KNE A;  1X02 A;  1SRA A;  3D0Y B;  3R1P A;  3PLF B;  2M7L A;  3UO9 A;  3CR5 X;  2EGD A;  1CFD A;  1A03 A;  1J7Q A;  2M7N A;  1GGW A;  1LS8 A;  3CZ0 A;  3EG5 B;  5EL2 A;  4QJ3 B;  2LMV A;  1B47 A;  4GFT A;  2NCO A;  1M63 B;  1MHO A;  1NYA A;  2LUX A;  2K61 A;  2MA2 A;  1T14 A;  3I5F B;  1OSA A;  3OBV A;  4DRW A;  2BE6 A;  1B8R A;  1ZFS A;  1G33 A;  1QWV A;  3BOW A;  3NSK A;  3PN7 B;  4KYN A;  2MRD A;  2NZ0 A;  2HPS A;  1JSA A;  1JF2 A;  3I5I B;  1ODB A;  2LVI A;  2KFF A;  2L4I A;  2P71 A;  4GGN A;  3I5G B;  3LCP C;  4CLN A;  1OQP A;  1QS7 A;  1EL4 A;  4GAO A;  1S26 D;  1KCY A;  3BJH A;  4F7F A;  1IWQ A;  1QAS A;  5HLO A;  1H8B A;  2FCE A;  3GOF A;  4FTG A;  4BY4 A;  3R1V A;  4CID A;  1YUT A;  5I2L A;  3TZ1 A;  3EK7 A;  2F33 A;  4YGA A;  1LXF C;  1QJT A;  2KAY A;  4ORC B;  5AAN A;  2ISD A;  1JC2 A;  1NSH A;  2PAS A;  1YUS A;  4N1G A;  2JWW A;  3MSE B;  1L2O B;  3KEV A;  1A75 A;  4M2Q A;  4CFQ A;  2WC5 A;  1K90 D;  2PQL A;  4M2O A;  2ZFD A;  4NQG A;  3SS3 A;  2JPT A;  2BEC A;  1ALW A;  5FYX A;  1B7T Y;  2KDH A;  2KFH A;  2KAX A;  4ICB A;  3AKA A;  1IKU A;  3CS1 A;  3AAK A;  3WHU B;  2Y5I A;  2COL B;  3C1V A;  5D3O A;  5I8N A;  2JT8 A;  1RWY A;  2LVK A;  1YVH A;  1G8I A;  2KPH A;  2WOR A;  1B8L A;  3KF9 A;  1OMR A;  4OZD A;  2PRU A;  5CSI A;  2BBM A;  2K7D A;  1BJF A;  2QEB A;  1CM4 A;  1BR1 B;  5DKQ A;  2MAZ A;  1OOF A;  1QTX A;  4E68 A;  1N2D A;  1CLL A;  1S5G Z;  2NCP A;  1QVI Z;  2KHN A;  1H4B A;  1DJX A;  1NUB A;  4HRG A;  2AUC A;  1K2H A;  2HF5 A;  2WCE A;  5HKZ A;  2LHL A;  2LLT A;  2LLU A;  2KI4 B;  5HL1 A;  1SL7 A;  1XK4 A;  2JT0 A;  2K2F A;  4M2P A;  1TNP A;  2BNX A;  4ORA B;  5F6T A;  3WXA A;  1BR4 B;  1QX7 A;  1NCZ A;  2H61 C;  1XA5 A;  3CZ2 A;  1MWN A;  4I5K A;  3RM1 A;  4UPG A;  1C7W A;  1AVS A;  1G4Y R;  3K21 A;  3NXA A;  1DF0 B;  3GK2 A;  3EVV A;  2KQY A;  1PVA A;  1KFU S;  1N65 A;  1M45 A;  1AJ4 A;  3TUY C;  1EG3 A;  3VRP A;  1SPY A;  1PVB A;  4I5N B;  3CDN A;  4GBA A;  1AJ5 A;  3I5H C;  1QX5 B;  2L51 A;  3NHI A;  1KQV A;  3LLE A;  1K96 A;  3OB1 B;  1C7V A;  4MEW A;  3EKJ A;  5TNC A;  1UHN A;  4OKH A;  1DJI A;  1S6C A;  4OR9 B;  1XYD A;  1Z2C B;  2MJW B;  2R2I A;  1C3Y A;  4PAL A;  1KFX S;  3BQ3 A;  3BUO B;  1KSM A;  1B9A A;  2O5G A;  2WCB A;  3JTD C;  3VGO A;  1DGU A;  1PRW A;  3FE6 A;  2HET A;  1MF8 B;  1BLQ A;  1TWO A;  1JFJ A;  1Y1X A;  1DJW A;  3CTN A;  2F8P A;  1J7P A;  2OS8 B;  3EK8 A;  1OZO A;  1OOG A;  1LKJ A;  1YVL A;  2KYF A;  3RZS A;  3D73 A;  4YGD B;  3TDI A;  2L0P A;  1QIW A;  2GGZ A;  4TNC A;  1IH0 A;  4YGC B;  3PAL A;  2P70 A;  1KK7 Y;  5KU1 A;  2K7C A;  2JU0 A;  2CTN A;  3PM2 A;  1SSE B;  4JQ0 D;  4AQI A;  5B8I B;  1SMG A;  5HLV A;  3S0A A;  1EH2 A;  2LV7 A;  2KBI A;  1JFK A;  4XJK B;  5JOL A;  1DJZ A;  1S1E A;  2KSP A;  1IIO A;  2EHB A;  2QDI A;  1B1G A;  2WCH A;  1TNX A;  3SG5 A;  1M31 A;  1YX8 A;  1Z4H A;  1PUL A;  1TTX A;  3TS5 B;  2CCM A;  2TN4 A;  3O2P A;  1MR8 A;  2ZRT A;  2KQ6 A;  1XFW O;  3DF0 A;  2JZI A;  4GPL B;  5G08 A;  1CFP A;  3N7H A;  2WC8 A;  1NCX A;  2SAS A;  3R72 A;  5K89 A;  3SG3 A;  4A4B A;  2FJY A;  1B4C A;  3O78 A;  2M3W A;  2ZN9 A;  1OOI X;  1QV0 A;  1YUU A;  1LVC D;  2F2P A;  3O4Y A;  4MN0 A;  2MBX A;  3SG6 A;  1EXR A;  2ZKM X;  2FOT A;  1F71 A;  3S0G A;  3DZT A;  3CGA A;  5CSJ A;  1V1F A;  3L4A A;  3UNW A;  1SR6 B;  1B8C A;  1SL9 A;  1OW4 A;  1E8A A;  2AMI A;  2K7O A;  3JVT B;  4MRY A;  1WLM A;  3PM8 A;  1RTP 1;  4PHM A;  2EC6 B;  2ZN8 A;  2KGB C;  2KLE A;  1CB1 A;  1REC A;  1TCO B;  1YTZ C;  2CBL A;  2H61 A;  1KWO C;  2Y1N A;  2JXL A;  1SCV A;  3NGV A;  1MXL C;  1SY9 A;  1F8H A;  3OP0 A;  2WCL A;  3BOW B;  1DQE A;  1KQM C;  1PSR A;  2E6W A;  3BUW B;  4PE1 A;  3BUN B;  1B7T Z;  1CMF A;  1K9U A;  1CNP A;  3DXL A;  5CSN A;  3CR2 A;  1SCM B;  2ZRS A;  2BAP A;  4NDC A;  2ZNE A;  2PSR A;  1KK8 C;  1UHK A;  2OPO A;  1LA3 A;  3FE9 A;  1DVI A;  1JF0 A;  2K0J A;  3B87 A;  1NWD A;  2M29 A;  2M0R A;  3SJS A;  5J3X A;  4U8D A;  2LHI A;  1UUR A;  1IJ6 A;  1UHJ A;  1R6P A;  4F0Z B;  1W7I B;  2L5X B;  3NSO A;  4ETO A;  3I5F C;  1A75 B;  2L4H A;  1CFC A;  1UHH A;  1PK0 D;  2Y1M A;  3ICB A;  1XFZ O;  1QLK A;  3F45 A;  3PN7 C;  3ZNI A;  3CLN A;  3NHT A;  1WRK A;  1PAL A;  5KTY A;  3I5I C;  1BOC A;  3DVM A;  3OX6 A;  1K93 D;  1J1D A;  1LA0 A;  1Y1A A;  2LAN A;  4BY5 A;  1W9Z A;  1F4Q A;  3I5G C;  2L98 A;  3DD4 A;  1F70 A;  1YUR A;  2PMY A;  2JT3 A;  1SW8 A;  5DKN A;  2WCM A;  4CPV A;  4CFR A;  4GGF C;  1ALV A;  2M1U A;  2KFG A;  1OOH A;  1CFF A;  4YBH B;  3BYA A;  2BL0 B;  3OX5 A;  2LUC A;  4WQ2 A;  1SK6 D;  3WNX B;  1L2O C;  2Y4Q A;  4JPZ B;  1C3Z A;  5HKY A;  2BKI B;  2K8M B;  4USL A;  4JD9 A;  2WOS A;  1P28 A;  1XO5 A;  3SG2 A;  4QJ4 B;  1QVI Y;  1CTR A;  2HQ8 A;  4PE0 A;  1JWD A;  1SYM A;  1CDP A;  2G2B A;  3HX4 A;  4I5J A;  3GK1 A;  2WCF A;  1WDC B;  3SS4 A;  3DVK A;  2BCX A;  1J7R A;  1F4O A;  1IRJ A;  1ORG A;  1TNW A;  2MHH A;  4PHJ A;  1U5I A;  3A4U B;  1F55 A;  2KI6 C;  1CLB A;  2JC2 A;  3K1E A;  4MZL A;  1TCF A;  3SS5 A;  4DCK A;  3LK0 A;  1TIZ A;  1VRK A;  2K7B A;  2KLD A;  3QRX A;  1XFU O;  5FI6 A;  4OV2 A;  3E3R A;  3EK4 A;  1CM1 A;  2FCD A;  4Q04 A;  1CMG A;  1FI5 A;  3NSL A;  2KI4 C;  2H2K A;  1BU3 A;  1CLM A;  3S0F A;  2SCP A;  1QAT A;  3HCM A;  2B1U A;  4GNK B;  4MZJ A;  3QME A;  5DIC A;  5I2O A;  1NCY A;  2JTZ A;  1WRZ A;  1N0Y A;  4GUK A;  3OGN A;  2BBN A;  3RLZ A;  2BCB A;  4YI8 A;  2CNP A;  1SNL A;  3BUM B;  2OTG C;  1HT9 A;  2L2C A;  1QXP A;  4PCW A;  1CDN A;  3VRO A;  4D1E A;  5PAL A;  4ZCU A;  4PT1 A;  3SG4 A;  1OZS A;  1XFY O;  5AEQ A;  3BFB A;  1K9K A;  3CWG A;  4L9M A;  3CR4 X;  1AUI B;  1AP4 A;  3LK1 A;  3M0W A;  3IF7 A;  5I2Q A;  3D0Y A;  2JUL A;  3BFH A;  2I94 A;  1IQ3 A;  4HRE E;  1WRL A;  1KWO B;  1IGV A;  1J55 A;  2MLE C;  1ZUZ A;  3PJI A;  3NSI A;  2KAV A;  3FIA A;  1OMD A;  4AQJ A;  3GK4 X;  2JQ6 A;  2KBM A;  3B6X A;  2LMU A;  2WC6 A;  4DUQ A;  4NDD A;  3D76 A;  4INX A;  2KYC A;  2QPT A;  3DVJ A;  2LCP A;  1TN4 A;  2M8U A;  1YRU B;  1GM0 A;  1ZOT B;  2OS8 C;  3A8R A;  3FWC A;  4JWQ A;  3DF0 B;  4R1E A;  1UHI A;  3CYZ A;  2JNX A;  2GTE A;  1RRO A;  3AKB A;  3EVR A;  4FQT A;  1DJY A;  4PHN A;  2JRF A;  3D75 A;  2LVJ A;  2KI6 D;  4MSP A;  3S0D A;  5I94 A;  2LP2 A;  1NIW A;  1FPW A;  4MRX A;  2ZND A;  1SBJ A;  2BE4 A;  3PAT A;  4C0J A;  1BG1 A;  3VRQ A;  4P5O E;  1DJG A;  1D1O A;  4WQ3 A;  2FJU B;  3FS7 A;  1Y0V H;  2LNK A;  3D74 A;  2QAC A;  3R1O A;  3ZWH A;  1IQ5 A;  2JPO A;  2BCA A;  3BUX B;  3VB1 A;  4N5X A;  3EVU A;  1EJ3 A;  1M46 A;  1KSO A;  3IVT A;  4GGF A;  2I18 A;  1WY9 A;  4OCI A;  4PE4 A;  5GQQ C;  3IQO A;  1S36 A;  5D69 A;  2V53 A;  1MQ1 A;  1Q80 A;  2CT9 A;  2K2A A;  1S6J A;  3FE8 A;  5CSF A;  3TS5 C;  1J7O A;  1CDL A;  3OHM B;  4INW A;  5KSZ A;  3B86 A;  1F54 A;  2PYQ A;  3D78 A;  1A29 A;  4YGB B;  1MUX A;  1K95 A;  1M39 A;  4YI9 A;  1RFJ A;  4C0K A;  1DTL A;  1SL8 A;  2JOJ A;  1FF1 A;  1GQM A;  2LC5 A;  3SIB A;  2DOQ A;  3OB2 B;  2M1K B;  1QLS A;  3TUY B;  1Y1U A;  2GGM A;  3O4X A;  1OOJ A;  2BKH B;  5IBW A;  2WND A;  3FWB A;  4PDZ A;  3I5H B;  3EKH A;  3B7A A;  1NX2 A;  1YX7 A;  1SR6 C;  1CDM A;  1IJ5 A;  1YRT B;  3BFA A;  1DJH A;  4XYN A;  1NX0 A;  2IS9 A;  4YGE B;  3JVT C;  1R2U A;  2F3Z A;  3DVE A;  2LP3 A;  1Y6W A;  1QIV A;  1JBA A;  1HQV A;  2LE9 B;  3D10 A;  2WCJ A;  2EC6 C;  2F3Y A;  3TDZ A;  2QEH A;  4N1F A;  2LLS A;  4A4C A;  5FI7 A;  5AFP A;  2PAL A;  1C07 A;  2RGI A;  1GGZ A;  4HRH A;  1TUJ A;  3JTD B;  4HSZ A;  3D77 A;  5AXI A;  5AER A;  2PVB A;  3CZT X;  1UWO A;  3SG7 A;  1NP8 A;  1WLZ A;  2M9G A;  2Q4U A;  3KPX A;  1CKK A;  2QEV A;  3L47 A;  3TDU A;  1DF0 A;  5HKW A;  2LMT A;  2M49 B;  2NXQ A;  1RJV A;  1S6I A;  2JTT A;  1NPQ A;  3B88 A;  4NDB A;  2D8N A;  1TRF A;  3KO0 A;  3PFV A;  1TNQ A;  2F2O A;  1SCM C;  3BXK A;  1S5G Y;  1XFX O;  1W7J B;  2K60 A;  3S0B A;  3DYE A;  1BOD A;  5HYD A;  3IQQ A;  1LIN A;  1NX3 A;  5FI2 A;  1K9P A;  4YRU A;  5BPJ A;  1NX1 A;  1S3P A;  1TUZ A;  1UP5 A;  2M97 A;  2OTG B;  4IL1 A;  4DIR A;  3CAB A;  1XFV O;  1YR5 A;  1ZAC A;  4I5L B;  2G9B A;  1AHR A;  4JKT A;  1KK7 Z;  1FW4 A;  1QV1 A;  4AOM A;  1DGV A;  1A4P A;  1BT6 A;  1XFR A;  5D7F A;  3V2L A;  1DC1 A;  1J1E A;  1K8U A;  4P2Y B;  1PSB A;  2HQW A;  5ER5 A;  1MXE A;  1GJY A; 
#chains in the Genus database with same CATH homology
 2KGR A;  4MZK A;  1A2X A;  1K94 A;  1QX2 A;  2NLN A;  1SKT A;  4C0L A;  4FQO A;  2LVV A;  5JJG A;  2JNF A;  1XVJ A;  2Q91 A;  4XJK A;  1TOP A;  1U5I B;  1BF5 A;  1BMO A;  1FBV A;  2LAP A;  2BL0 C;  2MLF C;  1ZMZ A;  2O60 A;  2E30 A;  4MLW A;  4OVN F;  4MVF A;  4WRI A;  3H4S E;  2LM5 A;  1L7Z A;  5DKR A;  2L2E A;  5ER4 X;  3AAJ A;  3VRR A;  1OMV A;  2I2R E;  5CPV A;  1XK4 C;  4QJ5 B;  2KOT A;  4MBE A;  2I7A A;  1KFU L;  3O6B A;  2L50 A;  1AK8 A;  4DS7 A;  3VRN A;  1EG4 A;  1DT7 B;  1OE9 B;  2VRG A;  3WHT B;  2P6B B;  1DMO A;  1FI6 A;  1WDC C;  1KQM B;  3PSR A;  1V1G A;  1IG5 A;  4PE7 A;  2CXJ A;  4PHK A;  3LL8 B;  4ZCV A;  4ORB B;  3SIA A;  2A4J A;  2GV5 A;  1RK9 A;  2AAO A;  1JUO A;  3KHE A;  1KK8 B;  1UUS A;  2JXC A;  1KFX L;  2KNE A;  1X02 A;  1SRA A;  3D0Y B;  3PLF B;  2M7L A;  3CR5 X;  2EGD A;  1CFD A;  1A03 A;  1J7Q A;  2M7N A;  1GGW A;  4QJ3 B;  2LMV A;  1B47 A;  4GFT A;  2NCO A;  1M63 B;  1MHO A;  1NYA A;  2LUX A;  2K61 A;  2MA2 A;  3I5F B;  4DRW A;  1OSA A;  2BE6 A;  1B8R A;  1ZFS A;  1G33 A;  3PN7 B;  3BOW A;  3NSK A;  2MRD A;  2NZ0 A;  2HPS A;  1JSA A;  1JF2 A;  3I5I B;  1ODB A;  2LVI A;  2KFF A;  2L4I A;  4GGN A;  3I5G B;  3LCP C;  4CLN A;  1OQP A;  1QS7 A;  1EL4 A;  4GAO A;  1S26 D;  1KCY A;  1IWQ A;  1QAS A;  5HLO A;  1H8B A;  2FCE A;  3GOF A;  4FTG A;  4BY4 A;  4CID A;  1YUT A;  5I2L A;  3TZ1 A;  3EK7 A;  2F33 A;  4YGA A;  1LXF C;  1QJT A;  2KAY A;  4ORC B;  5AAN A;  2ISD A;  1JC2 A;  1NSH A;  2PAS A;  1YUS A;  4N1G A;  2JWW A;  3MSE B;  1L2O B;  3KEV A;  1A75 A;  4M2Q A;  4CFQ A;  1K90 D;  4M2O A;  2ZFD A;  4NQG A;  2JPT A;  2BEC A;  1ALW A;  5FYX A;  1B7T Y;  2KDH A;  2KFH A;  2KAX A;  4ICB A;  3AKA A;  1IKU A;  3CS1 A;  3AAK A;  3WHU B;  2Y5I A;  2COL B;  3C1V A;  5I8N A;  2JT8 A;  1RWY A;  2LVK A;  1YVH A;  1G8I A;  2WOR A;  3KF9 A;  1B8L A;  5CSI A;  1OMR A;  2PRU A;  2BBM A;  2K7D A;  1BJF A;  1CM4 A;  1BR1 B;  5DKQ A;  2MAZ A;  1QTX A;  4E68 A;  1N2D A;  1CLL A;  1S5G Z;  2NCP A;  1QVI Z;  2KHN A;  1H4B A;  1DJX A;  1NUB A;  4HRG A;  2AUC A;  1K2H A;  2HF5 A;  2WCE A;  5HKZ A;  2LHL A;  2LLT A;  2LLU A;  2KI4 B;  1SL7 A;  1XK4 A;  2JT0 A;  2K2F A;  4M2P A;  1TNP A;  4ORA B;  5F6T A;  3WXA A;  1BR4 B;  1QX7 A;  1NCZ A;  2H61 C;  1XA5 A;  4I5K A;  1MWN A;  3RM1 A;  4UPG A;  1C7W A;  1AVS A;  1G4Y R;  3K21 A;  3NXA A;  1DF0 B;  3GK2 A;  3EVV A;  2KQY A;  1PVA A;  1KFU S;  1N65 A;  1M45 A;  1AJ4 A;  3TUY C;  1EG3 A;  3VRP A;  1SPY A;  1PVB A;  4I5N B;  4GBA A;  1AJ5 A;  3I5H C;  1QX5 B;  2L51 A;  1KQV A;  3LLE A;  1K96 A;  3OB1 B;  1C7V A;  4MEW A;  3EKJ A;  5TNC A;  1UHN A;  4OKH A;  1DJI A;  1S6C A;  4OR9 B;  1XYD A;  2MJW B;  2R2I A;  4PAL A;  1KFX S;  3BQ3 A;  3BUO B;  1KSM A;  1B9A A;  2O5G A;  2WCB A;  3JTD C;  3VGO A;  1DGU A;  1PRW A;  2HET A;  1MF8 B;  1BLQ A;  1JFJ A;  1Y1X A;  1DJW A;  3CTN A;  2F8P A;  1J7P A;  2OS8 B;  3EK8 A;  1OZO A;  1LKJ A;  1YVL A;  2KYF A;  4YGD B;  3TDI A;  2L0P A;  1QIW A;  2GGZ A;  4TNC A;  1IH0 A;  4YGC B;  3PAL A;  1KK7 Y;  5KU1 A;  2K7C A;  2JU0 A;  2CTN A;  4JQ0 D;  4AQI A;  5B8I B;  1SMG A;  5HLV A;  1EH2 A;  2LV7 A;  2KBI A;  1JFK A;  4XJK B;  5JOL A;  1DJZ A;  1S1E A;  2KSP A;  2EHB A;  1B1G A;  1TNX A;  3SG5 A;  1M31 A;  1YX8 A;  1PUL A;  1TTX A;  3TS5 B;  2CCM A;  2TN4 A;  3O2P A;  1MR8 A;  2ZRT A;  2KQ6 A;  1XFW O;  3DF0 A;  2JZI A;  4GPL B;  5G08 A;  1CFP A;  2WC8 A;  1NCX A;  2SAS A;  5K89 A;  3SG3 A;  4A4B A;  1B4C A;  3O78 A;  2M3W A;  2ZN9 A;  3O4Y A;  1QV0 A;  1YUU A;  1LVC D;  2F2P A;  4MN0 A;  2MBX A;  3SG6 A;  1EXR A;  2ZKM X;  2FOT A;  1F71 A;  3CGA A;  5CSJ A;  1V1F A;  1SR6 B;  1B8C A;  1SL9 A;  1E8A A;  2AMI A;  2K7O A;  3JVT B;  4MRY A;  1WLM A;  3PM8 A;  1RTP 1;  4PHM A;  2EC6 B;  2ZN8 A;  2KGB C;  1CB1 A;  1REC A;  1TCO B;  2CBL A;  1YTZ C;  2H61 A;  1KWO C;  2Y1N A;  2JXL A;  1SCV A;  1MXL C;  1SY9 A;  1F8H A;  3OP0 A;  3BOW B;  1KQM C;  1PSR A;  2E6W A;  3BUW B;  4PE1 A;  3BUN B;  1B7T Z;  1CMF A;  1K9U A;  1CNP A;  5CSN A;  3CR2 A;  1SCM B;  2ZRS A;  4NDC A;  2ZNE A;  2PSR A;  1KK8 C;  1UHK A;  2OPO A;  1LA3 A;  1DVI A;  1JF0 A;  2K0J A;  1NWD A;  2M29 A;  2M0R A;  3SJS A;  5J3X A;  4U8D A;  2LHI A;  1UUR A;  1IJ6 A;  1UHJ A;  1R6P A;  4F0Z B;  1W7I B;  2L5X B;  3NSO A;  4ETO A;  3I5F C;  1A75 B;  2L4H A;  1CFC A;  1UHH A;  1PK0 D;  2Y1M A;  3ICB A;  1XFZ O;  1QLK A;  3F45 A;  3PN7 C;  3ZNI A;  3CLN A;  1WRK A;  1PAL A;  5KTY A;  3I5I C;  1BOC A;  3DVM A;  3OX6 A;  1K93 D;  1J1D A;  1LA0 A;  1Y1A A;  2LAN A;  4BY5 A;  1F4Q A;  3I5G C;  2L98 A;  3DD4 A;  1F70 A;  1YUR A;  2PMY A;  2JT3 A;  1SW8 A;  5DKN A;  4CPV A;  4CFR A;  4GGF C;  1ALV A;  2M1U A;  2KFG A;  1CFF A;  4YBH B;  3BYA A;  2BL0 B;  3OX5 A;  2LUC A;  4WQ2 A;  1SK6 D;  3WNX B;  1L2O C;  2Y4Q A;  4JPZ B;  5HKY A;  2BKI B;  2K8M B;  4USL A;  2WOS A;  1XO5 A;  3SG2 A;  4QJ4 B;  1QVI Y;  1CTR A;  2HQ8 A;  4PE0 A;  1JWD A;  1SYM A;  1CDP A;  2G2B A;  3HX4 A;  4I5J A;  3GK1 A;  2WCF A;  1WDC B;  3DVK A;  2BCX A;  1J7R A;  1F4O A;  1IRJ A;  1TNW A;  2MHH A;  4PHJ A;  1U5I A;  3A4U B;  1F55 A;  2KI6 C;  1CLB A;  2JC2 A;  4MZL A;  1TCF A;  4DCK A;  3LK0 A;  1TIZ A;  1VRK A;  2K7B A;  3QRX A;  1XFU O;  4OV2 A;  3E3R A;  3EK4 A;  1CM1 A;  2FCD A;  4Q04 A;  1CMG A;  1FI5 A;  3NSL A;  2KI4 C;  2H2K A;  1BU3 A;  1CLM A;  2SCP A;  1QAT A;  3HCM A;  2B1U A;  4GNK B;  4MZJ A;  5I2O A;  1NCY A;  2JTZ A;  1WRZ A;  1N0Y A;  4GUK A;  2BBN A;  3RLZ A;  2BCB A;  4YI8 A;  2CNP A;  1SNL A;  3BUM B;  2OTG C;  1HT9 A;  1QXP A;  4PCW A;  1CDN A;  3VRO A;  4D1E A;  5PAL A;  4ZCU A;  3SG4 A;  1OZS A;  1XFY O;  5AEQ A;  1K9K A;  3CWG A;  4L9M A;  3CR4 X;  1AUI B;  1AP4 A;  3LK1 A;  3M0W A;  3IF7 A;  5I2Q A;  3D0Y A;  2JUL A;  2I94 A;  1IQ3 A;  4HRE E;  1WRL A;  1KWO B;  1IGV A;  1J55 A;  2MLE C;  1ZUZ A;  3NSI A;  2KAV A;  3FIA A;  1OMD A;  4AQJ A;  3GK4 X;  2JQ6 A;  2KBM A;  2LMU A;  4DUQ A;  4NDD A;  2KYC A;  2QPT A;  3DVJ A;  2LCP A;  1TN4 A;  2M8U A;  1YRU B;  1ZOT B;  2OS8 C;  3A8R A;  3FWC A;  4JWQ A;  3DF0 B;  4R1E A;  1UHI A;  2JNX A;  1RRO A;  3AKB A;  3EVR A;  1DJY A;  4PHN A;  2JRF A;  4MSP A;  2LVJ A;  2KI6 D;  2LP2 A;  1NIW A;  1FPW A;  4MRX A;  2ZND A;  1SBJ A;  2BE4 A;  3PAT A;  4C0J A;  1BG1 A;  3VRQ A;  4P5O E;  1DJG A;  1D1O A;  4WQ3 A;  2FJU B;  3FS7 A;  1Y0V H;  2LNK A;  3ZWH A;  2QAC A;  1IQ5 A;  2BCA A;  3BUX B;  4N5X A;  3EVU A;  1EJ3 A;  1M46 A;  1KSO A;  4GGF A;  2I18 A;  1WY9 A;  4OCI A;  4PE4 A;  5GQQ C;  3IQO A;  1S36 A;  5D69 A;  2V53 A;  1MQ1 A;  1Q80 A;  2CT9 A;  2K2A A;  1S6J A;  5CSF A;  3TS5 C;  1J7O A;  1CDL A;  3OHM B;  5KSZ A;  1F54 A;  1A29 A;  4YGB B;  1MUX A;  1K95 A;  1M39 A;  4YI9 A;  1RFJ A;  4C0K A;  1DTL A;  1SL8 A;  2JOJ A;  1FF1 A;  1GQM A;  2LC5 A;  3SIB A;  2DOQ A;  3OB2 B;  2M1K B;  1QLS A;  3TUY B;  1Y1U A;  2GGM A;  1OOJ A;  2BKH B;  5IBW A;  2WND A;  3FWB A;  4PDZ A;  3I5H B;  3EKH A;  1NX2 A;  1YX7 A;  1SR6 C;  1CDM A;  1IJ5 A;  1YRT B;  1DJH A;  4XYN A;  1NX0 A;  2IS9 A;  4YGE B;  3JVT C;  1R2U A;  2F3Z A;  3DVE A;  2LP3 A;  1Y6W A;  1QIV A;  1JBA A;  1HQV A;  2LE9 B;  3D10 A;  2EC6 C;  2F3Y A;  3TDZ A;  4N1F A;  2LLS A;  4A4C A;  5AFP A;  1C07 A;  2PAL A;  2RGI A;  1GGZ A;  4HRH A;  4HSZ A;  3JTD B;  5AXI A;  5AER A;  2PVB A;  3CZT X;  1UWO A;  3SG7 A;  1NP8 A;  1WLZ A;  2M9G A;  2Q4U A;  3KPX A;  1CKK A;  3TDU A;  1DF0 A;  5HKW A;  2LMT A;  2M49 B;  2NXQ A;  1RJV A;  1S6I A;  2JTT A;  1NPQ A;  4NDB A;  2D8N A;  1TRF A;  3KO0 A;  3PFV A;  1TNQ A;  2F2O A;  1SCM C;  3BXK A;  1S5G Y;  1XFX O;  1W7J B;  1BOD A;  5HYD A;  3IQQ A;  1LIN A;  1NX3 A;  1K9P A;  4YRU A;  5BPJ A;  1NX1 A;  1S3P A;  1UP5 A;  2M97 A;  2OTG B;  4IL1 A;  4DIR A;  1XFV O;  1YR5 A;  1ZAC A;  4I5L B;  2G9B A;  1AHR A;  1KK7 Z;  1FW4 A;  1QV1 A;  4AOM A;  1DGV A;  1A4P A;  1BT6 A;  5D7F A;  1J1E A;  1K8U A;  4P2Y B;  1PSB A;  2HQW A;  5ER5 A;  1MXE A;  1GJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...