1J7QA

Solution structure and backbone dynamics of the defunct ef-hand domain of calcium vector protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
86
structure length
86
Chain Sequence
b'AAPKARALGPEEKDECMKIFDIFDRNAENIAPVSDTMDMLTKLGQTYTKRETEAIMKEARGPKGDKKNIGPEEWLTLCSKWVRQDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium Vector Protein
publication title Solution structure and backbone dynamics of the defunct domain of calcium vector protein.
pubmed doi rcsb
source organism Branchiostoma lanceolatum
molecule tags Metal binding protein
total genus 21
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2001-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j7qA00
4I5KA 2MJWB 2K7CA 1J7OA 1K93D 2DOQA 2O60A 1BU3A 1TIZA 4PE0A 2JRFA 1JC2A 3SG4A 3EKJA 3BUMB 3O4YA 3OX6A 4WRIA 3BOWB 3H4SE 1SY9A 4QJ5B 2JNXA 2M0RA 4USLA 4FTGA 2HQWA 1CMFA 1IQ3A 5HYDA 1HQVA 1ZACA 5AXIA 3KO0A 2WC8A 2JTTA 2WORA 2ISDA 3CWGA 5CSIA 1W7JB 2HETA 3JVTC 3BUOB 1SL8A 2MRDA 3EKHA 1QS7A 5AANA 1BT6A 2PSRA 3CTNA 1NX1A 1JFKA 2KI4C 1OMDA 3PN7C 3O78A 5JJGA 1BOCA 2OTGC 2WCFA 2F3YA 1QXPA 1U5IA 4PALA 2JT0A 4CIDA 1XVJA 2LNKA 2KHNA 1J55A 4AOMA 2EC6B 2KI6D 2HQ8A 2BKIB 1IJ5A 2BBNA 1QV0A 3GK2A 1YVLA 1YUSA 1YURA 3D0YA 2ZNDA 5I2LA 2KFHA 4JWQA 1CDPA 1GGWA 2LP2A 1PULA 2HPSA 1AUIB 1DJYA 4ETOA 1DTLA 1XO5A 4MZJA 4N1GA 2AMIA 2KOTA 4PDZA 3CR5X 1YRUB 1KSMA 1MF8B 2F33A 2FOTA 2M8UA 4PHJA 2Y4QA 1IQ5A 3CR2A 1S36A 2E6WA 3AAJA 1KK7Z 4YGDB 1OMVA 3PSRA 2TN4A 1K95A 3VRNA 4JPZB 4DRWA 1CFFA 3PLFB 1M46A 1NX0A 1YTZC 1IKUA 3ICBA 3OB2B 4DUQA 1E8AA 2FCEA 3I5GC 1WLZA 1KK8C 3TDIA 1J7RA 4QJ3B 5F6TA 4ICBA 1K9PA 1S6JA 1K96A 5AERA 1UHKA 2LANA 1DJZA 3RM1A 3SIBA 3TS5C 3OHMB 3F45A 2NCOA 5CSNA 1R2UA 5KTYA 1NP8A 5FYXA 2EGDA 4CLNA 1YVHA 4FQOA 1XFVO 3E3RA 2R2IA 3I5IC 4GGNA 5DKRA 2I7AA 1RWYA 2CCMA 4MSPA 5PALA 3OP0A 1XA5A 4OVNF 2RGIA 4DCKA 2MLEC 2D8NA 1IWQA 1MUXA 1WLMA 3BUXB 1KFUS 1QIWA 1CKKA 3WXAA 4PE4A 4AQIA 1G33A 1B8LA 2K61A 2LM5A 1J1DA 1SNLA 1XYDA 1IRJA 2K7DA 4C0JA 2L0PA 1DJHA 1UHJA 1S1EA 3EVUA 2ZKMX 4MBEA 4A4CA 1FBVA 2M9GA 1TCFA 2K0JA 4E68A 1TN4A 3CS1A 4BY4A 2KQ6A 5CSJA 1AHRA 1IG5A 1KK7Y 1YX7A 2KAXA 2H2KA 1MR8A 2Q4UA 4OR9B 4ORAB 4CPVA 4GBAA 3JVTB 3DVJA 2G9BA 1S6CA 3BUWB 4QJ4B 4U8DA 1WRZA 1DJXA 4GGFA 1CNPA 1RK9A 2PALA 5D7FA 2JZIA 3GK4X 2KI4B 2WOSA 3EVVA 3PATA 3PN7B 4JQ0D 4MZKA 2OTGB 2L51A 4XYNA 1HT9A 4OKHA 3PFVA 2JPTA 2O5GA 5G08A 5I2OA 1LA3A 2L2EA 2LLTA 1BR1B 3KF9A 3TUYC 2WCBA 2GV5A 1N65A 1RROA 3FWCA 1QVIZ 2KAVA 1CDNA 2LLSA 2BL0C 2Y1NA 3SG6A 4YRUA 2WNDA 4MN0A 2GGZA 1G4YR 1LVCD 2ZN9A 4GFTA 2BCBA 4TNCA 1C07A 4YI9A 1DF0A 1B4CA 2IS9A 1DGVA 3QRXA 1NCXA 1YRTB 1CTRA 1NCYA 3DF0A 2EHBA 2F3ZA 1Y0VH 3AKBA 4YGCB 4OV2A 1PALA 4WQ3A 4MRYA 1QX5B 1C7VA 3BUNB 1SCVA 2ZNEA 3I5GB 1KK8B 2M3WA 4MEWA 1EH2A 3CZTX 3JTDC 1NPQA 1N0YA 4XJKB 1KFXL 4ZCVA 1SBJA 1SL9A 3TS5B 2KQYA 4N1FA 1KQMC 3I5FC 4IL1A 4ORBB 2F2OA 5KU1A 3CGAA 1A29A 2F2PA 2NLNA 1DT7B 2CTNA 2MLFC 3I5IB 4PCWA 2M29A 1W7IB 1GJYA 1NUBA 2LUCA 4HSZA 3CR4X 1ODBA 1JF0A 5CSFA 1BF5A 2ZRTA 1PRWA 1A75A 1XK4C 2H61A 1AK8A 4YGEB 1CM4A 5GQQC 4D1EA 1FI6A 4CFQA 3GOFA 2GGMA 1RFJA 3WHUB 1F70A 1OE9B 4NDDA 4YBHB 1QVIY 2MAZA 3NSOA 5HKZA 2LVJA 4I5NB 4PE1A 3O2PA 1YUTA 2COLB 4DS7A 1CFPA 2MHHA 1SMGA 4P2YB 5I8NA 2JWWA 1WDCC 1M31A 1SYMA 1EXRA 2JULA 3BQ3A 1SR6C 3EK8A 1KCYA 2KFGA 1Q80A 1SRAA 1F4QA 1GGZA 1Y1UA 5ER5A 3SJSA 2I94A 2LVKA 2KDHA 2BE6A 1K9KA 2LUXA 1AJ5A 3GK1A 5AEQA 5CPVA 4GPLB 4C0KA 3A4UB 1XFWO 1KWOB 4R1EA 4HRHA 2BKHB 2OS8C 1MWNA 1U5IB 1BLQA 1FF1A 5DKNA 1SCMC 1AP4A 1YUUA 2KNEA 4M2OA 1OOJA 5HKWA 4HREE 3VROA 1BJFA 1A4PA 1XFZO 5I2QA 2L4IA 1MQ1A 3D0YB 4N5XA 1QV1A 4YGAA 2JNFA 2LP3A 2K2FA 1B8CA 2LVVA 2Y5IA 4OCIA 3EVRA 2PVBA 1B8RA 4MLWA 3TUYB 1PVAA 3LL8B 3TZ1A 1H8BA 5HLVA 5HLOA 4PHKA 1BG1A 5IBWA 1KSOA 2FCDA 2BL0B 1QJTA 2LAPA 3BXKA 3CLNA 1B47A 1B7TZ 1AVSA 2LC5A 1GQMA 3IQQA 5JOLA 4F0ZB 3IF7A 1LINA 2KBIA 1DJWA 1OMRA 2K8MB 2M1UA 1OZOA 1XFXO 1CFCA 1IGVA 3HX4A 1M63B 1DMOA 1S3PA 1F54A 3BYAA 3KEVA 1CB1A 4AQJA 3LLEA 1PK0D 2M7NA 1KWOC 2M49B 1QLKA 5TNCA 3WNXB 3JTDB 1PSRA 1RTP1 1QTXA 1UP5A 2SASA 1JSAA 3IQOA 1AJ4A 2JTZA 5K89A 1D1OA 2K2AA 3TDZA 4CFRA 4NQGA 1V1GA 1TNPA 2KAYA 1KQMB 1K8UA 3BOWA 3I5FB 1N2DA 4DIRA 1BODA 2H61C 1QLSA 1KFXS 3SG5A 1DGUA 1IJ6A 1YR5A 3DVMA 3NSIA 4MRXA 4PHMA 1CMGA 2Y1MA 1K94A 2NXQA 1SPYA 2LMUA 1EJ3A 2BCAA 2HF5A 1UUSA 1QIVA 2KYFA 1DJGA 3SG3A 3LCPC 1KQVA 4GNKB 4NDBA 2QPTA 3RLZA 2LE9B 5J3XA 2PRUA 2KI6C 1LA0A 1B7TY 3I5HC 2I18A 3LK0A 1WDCB 1TOPA 1SR6B 1YX8A 3FIAA 2JT8A 1S26D 4Q04A 4ORCB 3KPXA 1RECA 2PASA 2K7OA 2KYCA 2WCEA 4M2PA 3VGOA 4L9MA 1EG3A 2QACA 2L4HA 2KGBC 2OS8B 1Y6WA 3NSKA 1SW8A 2LCPA 2B1UA 1SCMB 2LHIA 4WQ2A 1B1GA 1J7PA 3DVEA 4ZCUA 1SK6D 3ZWHA 2LVIA 2LV7A 4MVFA 1K90D 2BCXA 5KSZA 1XFYO 1G8IA 3PM8A 1VRKA 1ZFSA 1ZUZA 1NYAA 1ZMZA 2JT3A 2G2BA 1X02A 2NZ0A 3HCMA 1TCOB 1IH0A 3VRPA 1UHIA 2A4JA 3OB1B 1NWDA 1RJVA 2VRGA 2NCPA 4YI8A 4A4BA 1Y1AA 1DVIA 1ZOTB 1JBAA 1DF0B 1CDLA 2K7BA 3FS7A 1SKTA 3M0WA 2LLUA 1DJIA 2KSPA 2JOJA 2MBXA 3DF0B 3O6BA 1TNXA 1NIWA 1K2HA 2SCPA 1C7WA 4I5JA 1ALWA 2L98A 3DVKA 2AUCA 2CT9A 2M97A 2ZFDA 1CM1A 3VRQA 1L2OB 2BE4A 1JWDA 3DD4A 4GGFC 5ER4X 2KFFA 1JUOA 1CLLA 1SL7A 3A8RA 4UPGA 2F8PA 1FI5A 2CBLA 1LXFC 1TNQA 2I2RE 1UHNA 4I5LB 4P5OE 1TRFA 1UURA 4PHNA 1WRLA 3LK1A 3WHTB 2OPOA 2JXLA 2ZN8A 1UWOA 1M39A 1S5GZ 2L5XB 2JU0A 2P6BB 4YGBB 4GAOA 2CNPA 2MA2A 1A75B 1QATA 2ZRSA 1TNWA 2LMVA 3TDUA 3AKAA 2L50A 2JXCA 1F4OA 1A2XA 1NSHA 1BMOA 3KHEA 1TTXA 2BBMA 3ZNIA 1F71A 2Q91A 1ALVA 4M2QA 1NCZA 1M45A 1EL4A 1MXEA 1JF2A 4GUKA 3NXAA 4MZLA 1OZSA 1Y1XA 1CDMA 3FWBA 2EC6C 3D10A 3SIAA 3I5HB 1J1EA 1QX2A 1EG4A 2FJUB 1S6IA 1L2OC 3NSLA 4BY5A 3PALA 4NDCA 1A03A 2LHLA 1QASA 1F8HA 1JFJA 1J7QA 2V53A 5D69A 1QX7A 5AFPA 2E30A 1R6PA 1MHOA 1XK4A 2LMTA 2KBMA 1UHHA 3OX5A 1FW4A 5B8IB 1CFDA 1L7ZA 1PSBA 3EK7A 3VRRA 1NX2A 3K21A 1CLBA 1S5GY 1CLMA 3MSEB 1BR4B 3SG2A 1OQPA 3AAKA 3C1VA 2M1KB 4C0LA 4HRGA 1FPWA 2KGRA 1NX3A 1F55A 2PMYA 1PVBA 2JC2A 1WRKA 1XFUO 5HKYA 1H4BA 5BPJA 5DKQA 2CXJA 1V1FA 3EK4A 4XJKA 1B9AA 1KFUL 2M7LA 1K9UA 2BECA 1OSAA 1LKJA 1MXLC 2JQ6A 3SG7A 2AAOA 1WY9A 4PE7A
chains in the Genus database with same CATH superfamily
5FI7A 3BFHA 4I5KA 2MJWB 5D3OA 2K7CA 1J7OA 1K93D 2DOQA 3O4XA 2O60A 1BU3A 3L4AA 1TIZA 4PE0A 2JRFA 1JC2A 1XFRA 3SG4A 3EKJA 3BUMB 3O4YA 3OX6A 4WRIA 3BOWB 3H4SE 1SY9A 4QJ5B 2JNXA 2M0RA 4USLA 4FTGA 4KYNA 2HQWA 3VB1A 1CMFA 3UO9A 1IQ3A 3OBVA 5HYDA 1HQVA 1ZACA 5AXIA 3KO0A 2WC8A 2JTTA 2WORA 2ISDA 3CWGA 5CSIA 1W7JB 2HETA 3JVTC 1P28A 1SL8A 3BUOB 2MRDA 3EKHA 1QS7A 5AANA 1BT6A 2PSRA 3CTNA 1NX1A 1JFKA 3R72A 2KI4C 1OMDA 3PN7C 3O78A 5JJGA 1BOCA 2OTGC 2WCFA 4JKTA 2F3YA 1QXPA 1U5IA 4PALA 2JT0A 4CIDA 1XVJA 2LNKA 2KHNA 5FI6A 1J55A 4AOMA 2EC6B 2KI6D 2HQ8A 2BKIB 1IJ5A 2BBNA 1QV0A 3B7AA 1F71A 3GK2A 1YVLA 1YUSA 1YURA 3D0YA 2ZNDA 5I2LA 2KFHA 4JWQA 1CDPA 3B86A 1GGWA 2LP2A 1PULA 2HPSA 2WCKA 1AUIB 1DJYA 4ETOA 1DTLA 1XO5A 4MZJA 4N1GA 2AMIA 2KOTA 4PDZA 3CR5X 1YRUB 1KSMA 1MF8B 2F33A 2FOTA 2M8UA 4PHJA 2Y4QA 1IQ5A 3CR2A 1S36A 2E6WA 3AAJA 1KK7Z 4YGDB 1OMVA 3PSRA 2TN4A 1K95A 3VRNA 1LS8A 4JPZB 4DRWA 1CFFA 3PLFB 1M46A 1NX0A 1YTZC 1IKUA 3ICBA 3OB2B 4DUQA 1E8AA 2FCEA 3I5GC 1WLZA 1KK8C 3TDIA 1ORGA 2YGUA 1J7RA 4QJ3B 5F6TA 4ICBA 1K9PA 1S6JA 1K96A 5AERA 1UHKA 2LANA 1DJZA 2P71A 3RM1A 1QWVA 3SIBA 3TS5C 3OHMB 1GM0A 3F45A 2NCOA 3CZ2A 5CSNA 1R2UA 5KTYA 1NP8A 5FYXA 2EGDA 4CLNA 1YVHA 4FQOA 3NHTA 3B88A 1XFVO 2KPHA 3E3RA 2R2IA 3I5IC 4GGNA 2WC6A 2I7AA 1RWYA 2CCMA 4MSPA 5DKRA 5PALA 3OP0A 3R1VA 1XA5A 4OVNF 2RGIA 4DCKA 2MLEC 2D8NA 1IWQA 1WLMA 1MUXA 3BUXB 1KFUS 1QIWA 1CKKA 3WXAA 4PE4A 4AQIA 1G33A 1B8LA 2K61A 2LM5A 1J1DA 1SNLA 1XYDA 1IRJA 2K7DA 4C0JA 2L0PA 1DJHA 2WCJA 1UHJA 2WCHA 1S1EA 3EVUA 2ZKMX 4MBEA 4A4CA 1FBVA 2M9GA 2PYQA 1TCFA 2K0JA 4E68A 1TN4A 3CS1A 4BY4A 2KQ6A 5CSJA 1AHRA 1IG5A 1KK7Y 4PT1A 1YX7A 2KAXA 2H2KA 1DQEA 1MR8A 2Q4UA 4OR9B 4ORAB 4CPVA 3DYEA 4GBAA 3JVTB 3DVJA 2G9BA 1S6CA 3BUWB 4QJ4B 4U8DA 1WRZA 1DJXA 4GGFA 1CNPA 1RK9A 2PALA 5D7FA 2JZIA 3GK4X 2KI4B 2WOSA 3EVVA 3PATA 3PN7B 4JQ0D 4MZKA 2OTGB 2L51A 4XYNA 1HT9A 4OKHA 3PFVA 2JPTA 2O5GA 5G08A 5I2OA 1LA3A 2L2EA 2LLTA 1BR1B 3KF9A 3TUYC 3FE8A 2WCBA 1OOHA 2GV5A 1N65A 1RROA 3FWCA 1QVIZ 2KAVA 1CDNA 3OGNA 2LLSA 2BL0C 2Y1NA 3SG6A 4YRUA 2WNDA 4MN0A 2GGZA 1G4YR 1LVCD 1TWOA 2ZN9A 4GFTA 2BCBA 4TNCA 1C07A 4YI9A 1DF0A 1B4CA 2IS9A 1DGVA 3QRXA 1NCXA 1YRTB 1CTRA 1NCYA 3DF0A 2EHBA 2F3ZA 1Y0VH 3AKBA 2BAPA 4YGCB 4OV2A 1PALA 4WQ3A 4MRYA 1OOIX 1QX5B 1C7VA 3BUNB 1SCVA 2ZNEA 3I5GB 1KK8B 2M3WA 3D75A 4MEWA 1EH2A 3BFBA 3CZTX 3IVTA 3JTDC 1NPQA 1N0YA 4XJKB 1KFXL 4ZCVA 1SBJA 1SL9A 3TS5B 2BNXA 3DXLA 2KQYA 4N1FA 1KQMC 3DZTA 3I5FC 4IL1A 2WC5A 4ORBB 2F2OA 5KU1A 3CGAA 1A29A 2F2PA 1DEKA 2NLNA 1DT7B 2CTNA 2MLFC 3FE6A 3I5IB 3S0AA 4PCWA 2M29A 1W7IB 1GJYA 1NUBA 2LUCA 4HSZA 3CR4X 1ODBA 1JF0A 5CSFA 1BF5A 3S0DA 2ZRTA 1PRWA 1A75A 1XK4C 2H61A 1AK8A 4YGEB 1CM4A 5GQQC 5I94A 4D1EA 1FI6A 4CFQA 3GOFA 2GGMA 1RFJA 3WHUB 1F70A 1OE9B 4NDDA 4YBHB 1QVIY 2MAZA 3NSOA 5HKZA 5FI2A 2LVJA 4I5NB 4PE1A 3O2PA 3SS5A 1YUTA 2COLB 4DS7A 1CFPA 2MHHA 1SMGA 4P2YB 3D73A 1DELA 5I8NA 2JWWA 1WDCC 1M31A 1SYMA 1EXRA 2JULA 3BQ3A 1SR6C 3EK8A 1KCYA 2KFGA 1Q80A 1SRAA 1F4QA 1TUZA 1GGZA 1Y1UA 5ER5A 3SJSA 2I94A 2LVKA 2KDHA 2BE6A 1K9KA 2LUXA 1AJ5A 3GK1A 5AEQA 3CZ1A 5CPVA 4GPLB 4C0KA 1IIOA 3A4UB 1XFWO 1KWOB 4R1EA 4HRHA 2BKHB 2OS8C 3RZSA 1MWNA 1OOGA 1U5IB 1BLQA 1FF1A 5DKNA 1SCMC 1AP4A 1YUUA 2KNEA 4M2OA 1OOJA 5HKWA 4HREE 3VROA 2L5YA 1BJFA 1A4PA 1XFZO 5I2QA 2KLEA 2L4IA 1MQ1A 3D0YB 4N5XA 1QV1A 2WCLA 4YGAA 2JNFA 2QEHA 2LP3A 2K2FA 1B8CA 2LVVA 2P70A 2Y5IA 4OCIA 3EVRA 2PVBA 1B8RA 4MLWA 3TUYB 1PVAA 3FE9A 3LL8B 3TZ1A 1H8BA 5HLVA 5HLOA 4PHKA 1BG1A 5IBWA 1KSOA 2FCDA 2BL0B 1QJTA 2LAPA 3BXKA 3CLNA 3PM2A 1B47A 1B7TZ 1AVSA 2LC5A 1GQMA 3IQQA 5JOLA 4F0ZB 3IF7A 1LINA 2KBIA 1DJWA 1OMRA 2K8MB 2M1UA 1OZOA 1XFXO 2QDIA 1CFCA 1IGVA 2FJYA 3HX4A 1M63B 1DMOA 1S3PA 1F54A 3BYAA 3KEVA 1CB1A 4AQJA 3LLEA 1PK0D 2K60A 2M7NA 2ERBA 1KWOC 2M49B 1QLKA 5TNCA 2WCMA 3WNXB 3SS3A 3JTDB 1PSRA 1RTP1 1QTXA 1UP5A 2SASA 1JSAA 2QEVA 3IQOA 1AJ4A 2JTZA 5K89A 1D1OA 2K2AA 3TDZA 4CFRA 4NQGA 1V1GA 1TNPA 2KAYA 2JPOA 1KQMB 1K8UA 1Z4HA 3BOWA 1N2DA 3I5FB 4DIRA 1BODA 2H61C 1QLSA 1KFXS 3SG5A 1DGUA 1IJ6A 3EG5B 2PQLA 1YR5A 3B87A 4F7FA 3DVMA 3NSIA 4MRXA 4PHMA 1CMGA 2Y1MA 1K94A 2NXQA 3D78A 1SPYA 2QEBA 2LMUA 1EJ3A 2BCAA 2HF5A 1UUSA 1QIVA 1W9ZA 2KYFA 1DJGA 3SG3A 3LCPC 3CABA 3S0BA 1KQVA 4GNKB 4NDBA 2QPTA 3RLZA 1C3YA 2LE9B 5J3XA 2PRUA 2KI6C 1LA0A 1B7TY 3I5HC 2I18A 3LK0A 1WDCB 1TOPA 1SR6B 1YX8A 3FIAA 2JT8A 3PJIA 1S26D 4Q04A 4ORCB 3KPXA 1RECA 4JD9A 2PASA 2K7OA 2KYCA 2WCEA 4M2PA 3BFAA 3VGOA 4FQTA 4L9MA 1EG3A 2QACA 2L4HA 2KGBC 2OS8B 1OW4A 1Y6WA 1SW8A 3NSKA 2LCPA 2B1UA 1SCMB 2LHIA 4WQ2A 1B1GA 1J7PA 3DVEA 4ZCUA 5DICA 1SK6D 3ZWHA 1SSEB 2LVIA 2LV7A 4INXA 4MVFA 1K90D 5HL1A 2BCXA 5KSZA 1XFYO 3S0FA 1TUJA 1G8IA 3PM8A 1VRKA 1ZFSA 1ZUZA 1NYAA 1ZMZA 2JT3A 2G2BA 1X02A 2NZ0A 3HCMA 3CYZA 1TCOB 1IH0A 3VRPA 1UHIA 2A4JA 3OB1B 1DC1A 1NWDA 1RJVA 2VRGA 2NCPA 3N7HA 4YI8A 1Y1AA 4A4BA 1DVIA 1ZOTB 1JBAA 1DF0B 1CDLA 2K7BA 3FS7A 1SKTA 3M0WA 2LLUA 1DJIA 2KSPA 2JOJA 2MBXA 3DF0B 3O6BA 1TNXA 3L47A 1NIWA 1K2HA 2SCPA 4INWA 1C7WA 4I5JA 1ALWA 2L98A 3S0GA 3DVKA 2AUCA 2CT9A 2M97A 2ZFDA 1CM1A 3VRQA 1L2OB 2BE4A 1JWDA 3DD4A 4GGFC 5ER4X 2KFFA 1JUOA 1CLLA 1SL7A 3A8RA 4UPGA 2F8PA 1FI5A 2CBLA 1LXFC 1TNQA 2I2RE 4IJ7A 1UHNA 4I5LB 4P5OE 1TRFA 1UURA 4PHNA 1WRLA 3LK1A 3WHTB 2OPOA 3UNWA 3Q8IA 1C3ZA 2JXLA 2ZN8A 1OOFA 1UWOA 1M39A 1S5GZ 3S0EA 2L5XB 2JU0A 2P6BB 4YGBB 2L2CA 1T14A 4GAOA 2CNPA 2MA2A 3CZ0A 3QMEA 1A75B 1QATA 2ZRSA 1TNWA 2LMVA 3TDUA 3AKAA 2L50A 2JXCA 1F4OA 1A2XA 1NSHA 1BMOA 2QEOA 1TTXA 2BBMA 3KHEA 3ZNIA 2Q91A 1ALVA 4M2QA 4OZDA 1NCZA 1M45A 1EL4A 3DY9A 3K1EA 1MXEA 1JF2A 4GUKA 3NXAA 3V2LA 2H8VA 4MZLA 1OZSA 1Y1XA 3D77A 1CDMA 3FWBA 2EC6C 3D10A 3SIAA 2KLDA 3I5HB 1J1EA 1QX2A 1EG4A 2FJUB 3NGVA 1S6IA 1L2OC 3NSLA 1Z2CB 3PALA 4NDCA 4BY5A 1A03A 2LHLA 3D76A 1QASA 1F8HA 1JFJA 1J7QA 2V53A 5D69A 1QX7A 5AFPA 2E30A 1R6PA 1MHOA 1XK4A 2LMTA 2KBMA 1UHHA 3B6XA 3L4LA 3OX5A 1FW4A 5B8IB 1CFDA 5EL2A 1L7ZA 1PSBA 3EK7A 3VRRA 1NX2A 3K21A 1CLBA 1S5GY 1CLMA 3MSEB 1BR4B 3SG2A 1OQPA 3AAKA 3C1VA 2M1KB 3NHIA 4C0LA 4HRGA 1FPWA 2KGRA 1NX3A 1F55A 2PMYA 2GTEA 1PVBA 2JC2A 1WRKA 1XFUO 3R1OA 5HKYA 1H4BA 5BPJA 5DKQA 3BJHA 2CXJA 3R1PA 1V1FA 3D74A 3EK4A 4XJKA 3SS4A 1B9AA 1KFUL 2M7LA 1K9UA 2BECA 3CDNA 1OSAA 1LKJA 1MXLC 2JQ6A 3SG7A 2AAOA 1WY9A 4PE7A
chains in the Genus database with same CATH topology
4I5KA 2MJWB 2K7CA 1J7OA 1K93D 2DOQA 2O60A 1BU3A 1TIZA 4PE0A 2JRFA 1JC2A 3SG4A 3EKJA 3BUMB 3O4YA 3OX6A 4WRIA 3BOWB 3H4SE 1SY9A 4QJ5B 2JNXA 2M0RA 4USLA 4FTGA 2HQWA 1CMFA 1IQ3A 5HYDA 1HQVA 1ZACA 5AXIA 3KO0A 2WC8A 2JTTA 2WORA 2ISDA 3CWGA 5CSIA 1W7JB 2HETA 3JVTC 3BUOB 1SL8A 2MRDA 3EKHA 1QS7A 5AANA 1BT6A 2PSRA 3CTNA 1NX1A 1JFKA 2KI4C 1OMDA 3PN7C 3O78A 5JJGA 1BOCA 2OTGC 2WCFA 2F3YA 1QXPA 1U5IA 4PALA 2JT0A 4CIDA 1XVJA 2LNKA 2KHNA 1J55A 4AOMA 2EC6B 2KI6D 2HQ8A 2BKIB 1IJ5A 2BBNA 1QV0A 3GK2A 1YVLA 1YUSA 1YURA 3D0YA 2ZNDA 5I2LA 2KFHA 4JWQA 1CDPA 1GGWA 2LP2A 1PULA 2HPSA 1AUIB 1DJYA 4ETOA 1DTLA 1XO5A 4MZJA 4N1GA 2AMIA 2KOTA 4PDZA 3CR5X 1YRUB 1KSMA 1MF8B 2F33A 2FOTA 2M8UA 4PHJA 2Y4QA 1IQ5A 3CR2A 1S36A 2E6WA 3AAJA 1KK7Z 4YGDB 1OMVA 3PSRA 2TN4A 1K95A 3VRNA 4JPZB 4DRWA 1CFFA 3PLFB 1M46A 1NX0A 1YTZC 1IKUA 3ICBA 3OB2B 4DUQA 1E8AA 2FCEA 3I5GC 1WLZA 1KK8C 3TDIA 1J7RA 4QJ3B 5F6TA 4ICBA 1K9PA 1S6JA 1K96A 5AERA 1UHKA 2LANA 1DJZA 3RM1A 3SIBA 3TS5C 3OHMB 3F45A 2NCOA 5CSNA 1R2UA 5KTYA 1NP8A 5FYXA 2EGDA 4CLNA 1YVHA 4FQOA 1XFVO 3E3RA 2R2IA 3I5IC 4GGNA 5DKRA 2I7AA 1RWYA 2CCMA 4MSPA 5PALA 3OP0A 1XA5A 4OVNF 2RGIA 4DCKA 2MLEC 2D8NA 1IWQA 1MUXA 1WLMA 3BUXB 1KFUS 1QIWA 1CKKA 3WXAA 4PE4A 4AQIA 1G33A 1B8LA 2K61A 2LM5A 1J1DA 1SNLA 1XYDA 1IRJA 2K7DA 4C0JA 2L0PA 1DJHA 1UHJA 1S1EA 3EVUA 2ZKMX 4MBEA 4A4CA 1FBVA 2M9GA 1TCFA 2K0JA 4E68A 1TN4A 3CS1A 4BY4A 2KQ6A 5CSJA 1AHRA 1IG5A 1KK7Y 1YX7A 2KAXA 2H2KA 1MR8A 2Q4UA 4OR9B 4ORAB 4CPVA 4GBAA 3JVTB 3DVJA 2G9BA 1S6CA 3BUWB 4QJ4B 4U8DA 1WRZA 1DJXA 4GGFA 1CNPA 1RK9A 2PALA 5D7FA 2JZIA 3GK4X 2KI4B 2WOSA 3EVVA 3PATA 3PN7B 4JQ0D 4MZKA 2OTGB 2L51A 4XYNA 1HT9A 4OKHA 3PFVA 2JPTA 2O5GA 5G08A 5I2OA 1LA3A 2L2EA 2LLTA 1BR1B 3KF9A 3TUYC 2WCBA 2GV5A 1N65A 1RROA 3FWCA 1QVIZ 2KAVA 1CDNA 2LLSA 2BL0C 2Y1NA 3SG6A 4YRUA 2WNDA 4MN0A 2GGZA 1G4YR 1LVCD 2ZN9A 4GFTA 2BCBA 4TNCA 1C07A 4YI9A 1DF0A 1B4CA 2IS9A 1DGVA 3QRXA 1NCXA 1YRTB 1CTRA 1NCYA 3DF0A 2EHBA 2F3ZA 1Y0VH 3AKBA 4YGCB 4OV2A 1PALA 4WQ3A 4MRYA 1QX5B 1C7VA 3BUNB 1SCVA 2ZNEA 3I5GB 1KK8B 2M3WA 4MEWA 1EH2A 3CZTX 3JTDC 1NPQA 1N0YA 4XJKB 1KFXL 4ZCVA 1SBJA 1SL9A 3TS5B 2KQYA 4N1FA 1KQMC 3I5FC 4IL1A 4ORBB 2F2OA 5KU1A 3CGAA 1A29A 2F2PA 2NLNA 1DT7B 2CTNA 2MLFC 3I5IB 4PCWA 2M29A 1W7IB 1GJYA 1NUBA 2LUCA 4HSZA 3CR4X 1ODBA 1JF0A 5CSFA 1BF5A 2ZRTA 1PRWA 1A75A 1XK4C 2H61A 1AK8A 4YGEB 1CM4A 5GQQC 4D1EA 1FI6A 4CFQA 3GOFA 2GGMA 1RFJA 3WHUB 1F70A 1OE9B 4NDDA 4YBHB 1QVIY 2MAZA 3NSOA 5HKZA 2LVJA 4I5NB 4PE1A 3O2PA 1YUTA 2COLB 4DS7A 1CFPA 2MHHA 1SMGA 4P2YB 5I8NA 2JWWA 1WDCC 1M31A 1SYMA 1EXRA 2JULA 3BQ3A 1SR6C 3EK8A 1KCYA 2KFGA 1Q80A 1SRAA 1F4QA 1GGZA 1Y1UA 5ER5A 3SJSA 2I94A 2LVKA 2KDHA 2BE6A 1K9KA 2LUXA 1AJ5A 3GK1A 5AEQA 5CPVA 4GPLB 4C0KA 3A4UB 1XFWO 1KWOB 4R1EA 4HRHA 2BKHB 2OS8C 1MWNA 1U5IB 1BLQA 1FF1A 5DKNA 1SCMC 1AP4A 1YUUA 2KNEA 4M2OA 1OOJA 5HKWA 4HREE 3VROA 1BJFA 1A4PA 1XFZO 5I2QA 2L4IA 1MQ1A 3D0YB 4N5XA 1QV1A 4YGAA 2JNFA 2LP3A 2K2FA 1B8CA 2LVVA 2Y5IA 4OCIA 3EVRA 2PVBA 1B8RA 4MLWA 3TUYB 1PVAA 3LL8B 3TZ1A 1H8BA 5HLVA 5HLOA 4PHKA 1BG1A 5IBWA 1KSOA 2FCDA 2BL0B 1QJTA 2LAPA 3BXKA 3CLNA 1B47A 1B7TZ 1AVSA 2LC5A 1GQMA 3IQQA 5JOLA 4F0ZB 3IF7A 1LINA 2KBIA 1DJWA 1OMRA 2K8MB 2M1UA 1OZOA 1XFXO 1CFCA 1IGVA 3HX4A 1M63B 1DMOA 1S3PA 1F54A 3BYAA 3KEVA 1CB1A 4AQJA 3LLEA 1PK0D 2M7NA 1KWOC 2M49B 1QLKA 5TNCA 3WNXB 3JTDB 1PSRA 1RTP1 1QTXA 1UP5A 2SASA 1JSAA 3IQOA 1AJ4A 2JTZA 5K89A 1D1OA 2K2AA 3TDZA 4CFRA 4NQGA 1V1GA 1TNPA 2KAYA 1KQMB 1K8UA 3BOWA 3I5FB 1N2DA 4DIRA 1BODA 2H61C 1QLSA 1KFXS 3SG5A 1DGUA 1IJ6A 1YR5A 3DVMA 3NSIA 4MRXA 4PHMA 1CMGA 2Y1MA 1K94A 2NXQA 1SPYA 2LMUA 1EJ3A 2BCAA 2HF5A 1UUSA 1QIVA 2KYFA 1DJGA 3SG3A 3LCPC 1KQVA 4GNKB 4NDBA 2QPTA 3RLZA 2LE9B 5J3XA 2PRUA 2KI6C 1LA0A 1B7TY 3I5HC 2I18A 3LK0A 1WDCB 1TOPA 1SR6B 1YX8A 3FIAA 2JT8A 1S26D 4Q04A 4ORCB 3KPXA 1RECA 2PASA 2K7OA 2KYCA 2WCEA 4M2PA 3VGOA 4L9MA 1EG3A 2QACA 2L4HA 2KGBC 2OS8B 1Y6WA 3NSKA 1SW8A 2LCPA 2B1UA 1SCMB 2LHIA 4WQ2A 1B1GA 1J7PA 3DVEA 4ZCUA 1SK6D 3ZWHA 2LVIA 2LV7A 4MVFA 1K90D 2BCXA 5KSZA 1XFYO 1G8IA 3PM8A 1VRKA 1ZFSA 1ZUZA 1NYAA 1ZMZA 2JT3A 2G2BA 1X02A 2NZ0A 3HCMA 1TCOB 1IH0A 3VRPA 1UHIA 2A4JA 3OB1B 1NWDA 1RJVA 2VRGA 2NCPA 4YI8A 4A4BA 1Y1AA 1DVIA 1ZOTB 1JBAA 1DF0B 1CDLA 2K7BA 3FS7A 1SKTA 3M0WA 2LLUA 1DJIA 2KSPA 2JOJA 2MBXA 3DF0B 3O6BA 1TNXA 1NIWA 1K2HA 2SCPA 1C7WA 4I5JA 1ALWA 2L98A 3DVKA 2AUCA 2CT9A 2M97A 2ZFDA 1CM1A 3VRQA 1L2OB 2BE4A 1JWDA 3DD4A 4GGFC 5ER4X 2KFFA 1JUOA 1CLLA 1SL7A 3A8RA 4UPGA 2F8PA 1FI5A 2CBLA 1LXFC 1TNQA 2I2RE 1UHNA 4I5LB 4P5OE 1TRFA 1UURA 4PHNA 1WRLA 3LK1A 3WHTB 2OPOA 2JXLA 2ZN8A 1UWOA 1M39A 1S5GZ 2L5XB 2JU0A 2P6BB 4YGBB 4GAOA 2CNPA 2MA2A 1A75B 1QATA 2ZRSA 1TNWA 2LMVA 3TDUA 3AKAA 2L50A 2JXCA 1F4OA 1A2XA 1NSHA 1BMOA 3KHEA 1TTXA 2BBMA 3ZNIA 1F71A 2Q91A 1ALVA 4M2QA 1NCZA 1M45A 1EL4A 1MXEA 1JF2A 4GUKA 3NXAA 4MZLA 1OZSA 1Y1XA 1CDMA 3FWBA 2EC6C 3D10A 3SIAA 3I5HB 1J1EA 1QX2A 1EG4A 2FJUB 1S6IA 1L2OC 3NSLA 4BY5A 3PALA 4NDCA 1A03A 2LHLA 1QASA 1F8HA 1JFJA 1J7QA 2V53A 5D69A 1QX7A 5AFPA 2E30A 1R6PA 1MHOA 1XK4A 2LMTA 2KBMA 1UHHA 3OX5A 1FW4A 5B8IB 1CFDA 1L7ZA 1PSBA 3EK7A 3VRRA 1NX2A 3K21A 1CLBA 1S5GY 1CLMA 3MSEB 1BR4B 3SG2A 1OQPA 3AAKA 3C1VA 2M1KB 4C0LA 4HRGA 1FPWA 2KGRA 1NX3A 1F55A 2PMYA 1PVBA 2JC2A 1WRKA 1XFUO 5HKYA 1H4BA 5BPJA 5DKQA 2CXJA 1V1FA 3EK4A 4XJKA 1B9AA 1KFUL 2M7LA 1K9UA 2BECA 1OSAA 1LKJA 1MXLC 2JQ6A 3SG7A 2AAOA 1WY9A 4PE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5K A;  2MJW B;  2K7C A;  1J7O A;  1K93 D;  2DOQ A;  2O60 A;  1BU3 A;  1TIZ A;  4PE0 A;  2JRF A;  1JC2 A;  3SG4 A;  3EKJ A;  3BUM B;  3O4Y A;  3OX6 A;  4WRI A;  3BOW B;  3H4S E;  1SY9 A;  4QJ5 B;  2JNX A;  2M0R A;  4USL A;  4FTG A;  2HQW A;  1CMF A;  1IQ3 A;  5HYD A;  1HQV A;  1ZAC A;  5AXI A;  3KO0 A;  2WC8 A;  2JTT A;  2WOR A;  2ISD A;  3CWG A;  5CSI A;  1W7J B;  2HET A;  3JVT C;  3BUO B;  1SL8 A;  2MRD A;  3EKH A;  1QS7 A;  5AAN A;  1BT6 A;  2PSR A;  3CTN A;  1NX1 A;  1JFK A;  2KI4 C;  1OMD A;  3PN7 C;  3O78 A;  5JJG A;  1BOC A;  2OTG C;  2WCF A;  2F3Y A;  1QXP A;  1U5I A;  4PAL A;  2JT0 A;  4CID A;  1XVJ A;  2LNK A;  2KHN A;  1J55 A;  4AOM A;  2EC6 B;  2KI6 D;  2HQ8 A;  2BKI B;  1IJ5 A;  2BBN A;  1QV0 A;  3GK2 A;  1YVL A;  1YUS A;  1YUR A;  3D0Y A;  2ZND A;  5I2L A;  2KFH A;  4JWQ A;  1CDP A;  1GGW A;  2LP2 A;  1PUL A;  2HPS A;  1AUI B;  1DJY A;  4ETO A;  1DTL A;  1XO5 A;  4MZJ A;  4N1G A;  2AMI A;  2KOT A;  4PDZ A;  3CR5 X;  1YRU B;  1KSM A;  1MF8 B;  2F33 A;  2FOT A;  2M8U A;  4PHJ A;  2Y4Q A;  1IQ5 A;  3CR2 A;  1S36 A;  2E6W A;  3AAJ A;  1KK7 Z;  4YGD B;  1OMV A;  3PSR A;  2TN4 A;  1K95 A;  3VRN A;  4JPZ B;  4DRW A;  1CFF A;  3PLF B;  1M46 A;  1NX0 A;  1YTZ C;  1IKU A;  3ICB A;  3OB2 B;  4DUQ A;  1E8A A;  2FCE A;  3I5G C;  1WLZ A;  1KK8 C;  3TDI A;  1J7R A;  4QJ3 B;  5F6T A;  4ICB A;  1K9P A;  1S6J A;  1K96 A;  5AER A;  1UHK A;  2LAN A;  1DJZ A;  3RM1 A;  3SIB A;  3TS5 C;  3OHM B;  3F45 A;  2NCO A;  5CSN A;  1R2U A;  5KTY A;  1NP8 A;  5FYX A;  2EGD A;  4CLN A;  1YVH A;  4FQO A;  1XFV O;  3E3R A;  2R2I A;  3I5I C;  4GGN A;  5DKR A;  2I7A A;  1RWY A;  2CCM A;  4MSP A;  5PAL A;  3OP0 A;  1XA5 A;  4OVN F;  2RGI A;  4DCK A;  2MLE C;  2D8N A;  1IWQ A;  1MUX A;  1WLM A;  3BUX B;  1KFU S;  1QIW A;  1CKK A;  3WXA A;  4PE4 A;  4AQI A;  1G33 A;  1B8L A;  2K61 A;  2LM5 A;  1J1D A;  1SNL A;  1XYD A;  1IRJ A;  2K7D A;  4C0J A;  2L0P A;  1DJH A;  1UHJ A;  1S1E A;  3EVU A;  2ZKM X;  4MBE A;  4A4C A;  1FBV A;  2M9G A;  1TCF A;  2K0J A;  4E68 A;  1TN4 A;  3CS1 A;  4BY4 A;  2KQ6 A;  5CSJ A;  1AHR A;  1IG5 A;  1KK7 Y;  1YX7 A;  2KAX A;  2H2K A;  1MR8 A;  2Q4U A;  4OR9 B;  4ORA B;  4CPV A;  4GBA A;  3JVT B;  3DVJ A;  2G9B A;  1S6C A;  3BUW B;  4QJ4 B;  4U8D A;  1WRZ A;  1DJX A;  4GGF A;  1CNP A;  1RK9 A;  2PAL A;  5D7F A;  2JZI A;  3GK4 X;  2KI4 B;  2WOS A;  3EVV A;  3PAT A;  3PN7 B;  4JQ0 D;  4MZK A;  2OTG B;  2L51 A;  4XYN A;  1HT9 A;  4OKH A;  3PFV A;  2JPT A;  2O5G A;  5G08 A;  5I2O A;  1LA3 A;  2L2E A;  2LLT A;  1BR1 B;  3KF9 A;  3TUY C;  2WCB A;  2GV5 A;  1N65 A;  1RRO A;  3FWC A;  1QVI Z;  2KAV A;  1CDN A;  2LLS A;  2BL0 C;  2Y1N A;  3SG6 A;  4YRU A;  2WND A;  4MN0 A;  2GGZ A;  1G4Y R;  1LVC D;  2ZN9 A;  4GFT A;  2BCB A;  4TNC A;  1C07 A;  4YI9 A;  1DF0 A;  1B4C A;  2IS9 A;  1DGV A;  3QRX A;  1NCX A;  1YRT B;  1CTR A;  1NCY A;  3DF0 A;  2EHB A;  2F3Z A;  1Y0V H;  3AKB A;  4YGC B;  4OV2 A;  1PAL A;  4WQ3 A;  4MRY A;  1QX5 B;  1C7V A;  3BUN B;  1SCV A;  2ZNE A;  3I5G B;  1KK8 B;  2M3W A;  4MEW A;  1EH2 A;  3CZT X;  3JTD C;  1NPQ A;  1N0Y A;  4XJK B;  1KFX L;  4ZCV A;  1SBJ A;  1SL9 A;  3TS5 B;  2KQY A;  4N1F A;  1KQM C;  3I5F C;  4IL1 A;  4ORB B;  2F2O A;  5KU1 A;  3CGA A;  1A29 A;  2F2P A;  2NLN A;  1DT7 B;  2CTN A;  2MLF C;  3I5I B;  4PCW A;  2M29 A;  1W7I B;  1GJY A;  1NUB A;  2LUC A;  4HSZ A;  3CR4 X;  1ODB A;  1JF0 A;  5CSF A;  1BF5 A;  2ZRT A;  1PRW A;  1A75 A;  1XK4 C;  2H61 A;  1AK8 A;  4YGE B;  1CM4 A;  5GQQ C;  4D1E A;  1FI6 A;  4CFQ A;  3GOF A;  2GGM A;  1RFJ A;  3WHU B;  1F70 A;  1OE9 B;  4NDD A;  4YBH B;  1QVI Y;  2MAZ A;  3NSO A;  5HKZ A;  2LVJ A;  4I5N B;  4PE1 A;  3O2P A;  1YUT A;  2COL B;  4DS7 A;  1CFP A;  2MHH A;  1SMG A;  4P2Y B;  5I8N A;  2JWW A;  1WDC C;  1M31 A;  1SYM A;  1EXR A;  2JUL A;  3BQ3 A;  1SR6 C;  3EK8 A;  1KCY A;  2KFG A;  1Q80 A;  1SRA A;  1F4Q A;  1GGZ A;  1Y1U A;  5ER5 A;  3SJS A;  2I94 A;  2LVK A;  2KDH A;  2BE6 A;  1K9K A;  2LUX A;  1AJ5 A;  3GK1 A;  5AEQ A;  5CPV A;  4GPL B;  4C0K A;  3A4U B;  1XFW O;  1KWO B;  4R1E A;  4HRH A;  2BKH B;  2OS8 C;  1MWN A;  1U5I B;  1BLQ A;  1FF1 A;  5DKN A;  1SCM C;  1AP4 A;  1YUU A;  2KNE A;  4M2O A;  1OOJ A;  5HKW A;  4HRE E;  3VRO A;  1BJF A;  1A4P A;  1XFZ O;  5I2Q A;  2L4I A;  1MQ1 A;  3D0Y B;  4N5X A;  1QV1 A;  4YGA A;  2JNF A;  2LP3 A;  2K2F A;  1B8C A;  2LVV A;  2Y5I A;  4OCI A;  3EVR A;  2PVB A;  1B8R A;  4MLW A;  3TUY B;  1PVA A;  3LL8 B;  3TZ1 A;  1H8B A;  5HLV A;  5HLO A;  4PHK A;  1BG1 A;  5IBW A;  1KSO A;  2FCD A;  2BL0 B;  1QJT A;  2LAP A;  3BXK A;  3CLN A;  1B47 A;  1B7T Z;  1AVS A;  2LC5 A;  1GQM A;  3IQQ A;  5JOL A;  4F0Z B;  3IF7 A;  1LIN A;  2KBI A;  1DJW A;  1OMR A;  2K8M B;  2M1U A;  1OZO A;  1XFX O;  1CFC A;  1IGV A;  3HX4 A;  1M63 B;  1DMO A;  1S3P A;  1F54 A;  3BYA A;  3KEV A;  1CB1 A;  4AQJ A;  3LLE A;  1PK0 D;  2M7N A;  1KWO C;  2M49 B;  1QLK A;  5TNC A;  3WNX B;  3JTD B;  1PSR A;  1RTP 1;  1QTX A;  1UP5 A;  2SAS A;  1JSA A;  3IQO A;  1AJ4 A;  2JTZ A;  5K89 A;  1D1O A;  2K2A A;  3TDZ A;  4CFR A;  4NQG A;  1V1G A;  1TNP A;  2KAY A;  1KQM B;  1K8U A;  3BOW A;  3I5F B;  1N2D A;  4DIR A;  1BOD A;  2H61 C;  1QLS A;  1KFX S;  3SG5 A;  1DGU A;  1IJ6 A;  1YR5 A;  3DVM A;  3NSI A;  4MRX A;  4PHM A;  1CMG A;  2Y1M A;  1K94 A;  2NXQ A;  1SPY A;  2LMU A;  1EJ3 A;  2BCA A;  2HF5 A;  1UUS A;  1QIV A;  2KYF A;  1DJG A;  3SG3 A;  3LCP C;  1KQV A;  4GNK B;  4NDB A;  2QPT A;  3RLZ A;  2LE9 B;  5J3X A;  2PRU A;  2KI6 C;  1LA0 A;  1B7T Y;  3I5H C;  2I18 A;  3LK0 A;  1WDC B;  1TOP A;  1SR6 B;  1YX8 A;  3FIA A;  2JT8 A;  1S26 D;  4Q04 A;  4ORC B;  3KPX A;  1REC A;  2PAS A;  2K7O A;  2KYC A;  2WCE A;  4M2P A;  3VGO A;  4L9M A;  1EG3 A;  2QAC A;  2L4H A;  2KGB C;  2OS8 B;  1Y6W A;  3NSK A;  1SW8 A;  2LCP A;  2B1U A;  1SCM B;  2LHI A;  4WQ2 A;  1B1G A;  1J7P A;  3DVE A;  4ZCU A;  1SK6 D;  3ZWH A;  2LVI A;  2LV7 A;  4MVF A;  1K90 D;  2BCX A;  5KSZ A;  1XFY O;  1G8I A;  3PM8 A;  1VRK A;  1ZFS A;  1ZUZ A;  1NYA A;  1ZMZ A;  2JT3 A;  2G2B A;  1X02 A;  2NZ0 A;  3HCM A;  1TCO B;  1IH0 A;  3VRP A;  1UHI A;  2A4J A;  3OB1 B;  1NWD A;  1RJV A;  2VRG A;  2NCP A;  4YI8 A;  4A4B A;  1Y1A A;  1DVI A;  1ZOT B;  1JBA A;  1DF0 B;  1CDL A;  2K7B A;  3FS7 A;  1SKT A;  3M0W A;  2LLU A;  1DJI A;  2KSP A;  2JOJ A;  2MBX A;  3DF0 B;  3O6B A;  1TNX A;  1NIW A;  1K2H A;  2SCP A;  1C7W A;  4I5J A;  1ALW A;  2L98 A;  3DVK A;  2AUC A;  2CT9 A;  2M97 A;  2ZFD A;  1CM1 A;  3VRQ A;  1L2O B;  2BE4 A;  1JWD A;  3DD4 A;  4GGF C;  5ER4 X;  2KFF A;  1JUO A;  1CLL A;  1SL7 A;  3A8R A;  4UPG A;  2F8P A;  1FI5 A;  2CBL A;  1LXF C;  1TNQ A;  2I2R E;  1UHN A;  4I5L B;  4P5O E;  1TRF A;  1UUR A;  4PHN A;  1WRL A;  3LK1 A;  3WHT B;  2OPO A;  2JXL A;  2ZN8 A;  1UWO A;  1M39 A;  1S5G Z;  2L5X B;  2JU0 A;  2P6B B;  4YGB B;  4GAO A;  2CNP A;  2MA2 A;  1A75 B;  1QAT A;  2ZRS A;  1TNW A;  2LMV A;  3TDU A;  3AKA A;  2L50 A;  2JXC A;  1F4O A;  1A2X A;  1NSH A;  1BMO A;  3KHE A;  1TTX A;  2BBM A;  3ZNI A;  1F71 A;  2Q91 A;  1ALV A;  4M2Q A;  1NCZ A;  1M45 A;  1EL4 A;  1MXE A;  1JF2 A;  4GUK A;  3NXA A;  4MZL A;  1OZS A;  1Y1X A;  1CDM A;  3FWB A;  2EC6 C;  3D10 A;  3SIA A;  3I5H B;  1J1E A;  1QX2 A;  1EG4 A;  2FJU B;  1S6I A;  1L2O C;  3NSL A;  4BY5 A;  3PAL A;  4NDC A;  1A03 A;  2LHL A;  1QAS A;  1F8H A;  1JFJ A;  1J7Q A;  2V53 A;  5D69 A;  1QX7 A;  5AFP A;  2E30 A;  1R6P A;  1MHO A;  1XK4 A;  2LMT A;  2KBM A;  1UHH A;  3OX5 A;  1FW4 A;  5B8I B;  1CFD A;  1L7Z A;  1PSB A;  3EK7 A;  3VRR A;  1NX2 A;  3K21 A;  1CLB A;  1S5G Y;  1CLM A;  3MSE B;  1BR4 B;  3SG2 A;  1OQP A;  3AAK A;  3C1V A;  2M1K B;  4C0L A;  4HRG A;  1FPW A;  2KGR A;  1NX3 A;  1F55 A;  2PMY A;  1PVB A;  2JC2 A;  1WRK A;  1XFU O;  5HKY A;  1H4B A;  5BPJ A;  5DKQ A;  2CXJ A;  1V1F A;  3EK4 A;  4XJK A;  1B9A A;  1KFU L;  2M7L A;  1K9U A;  2BEC A;  1OSA A;  1LKJ A;  1MXL C;  2JQ6 A;  3SG7 A;  2AAO A;  1WY9 A;  4PE7 A; 
#chains in the Genus database with same CATH topology
 5FI7 A;  3BFH A;  4I5K A;  2MJW B;  5D3O A;  2K7C A;  1J7O A;  1K93 D;  2DOQ A;  3O4X A;  2O60 A;  1BU3 A;  3L4A A;  1TIZ A;  4PE0 A;  2JRF A;  1JC2 A;  1XFR A;  3SG4 A;  3EKJ A;  3BUM B;  3O4Y A;  3OX6 A;  4WRI A;  3BOW B;  3H4S E;  1SY9 A;  4QJ5 B;  2JNX A;  2M0R A;  4USL A;  4FTG A;  4KYN A;  2HQW A;  3VB1 A;  1CMF A;  3UO9 A;  1IQ3 A;  3OBV A;  5HYD A;  1HQV A;  1ZAC A;  5AXI A;  3KO0 A;  2WC8 A;  2JTT A;  2WOR A;  2ISD A;  3CWG A;  5CSI A;  1W7J B;  2HET A;  3JVT C;  1P28 A;  1SL8 A;  3BUO B;  2MRD A;  3EKH A;  1QS7 A;  5AAN A;  1BT6 A;  2PSR A;  3CTN A;  1NX1 A;  1JFK A;  3R72 A;  2KI4 C;  1OMD A;  3PN7 C;  3O78 A;  5JJG A;  1BOC A;  2OTG C;  2WCF A;  4JKT A;  2F3Y A;  1QXP A;  1U5I A;  4PAL A;  2JT0 A;  4CID A;  1XVJ A;  2LNK A;  2KHN A;  5FI6 A;  1J55 A;  4AOM A;  2EC6 B;  2KI6 D;  2HQ8 A;  2BKI B;  1IJ5 A;  2BBN A;  1QV0 A;  3B7A A;  1F71 A;  3GK2 A;  1YVL A;  1YUS A;  1YUR A;  3D0Y A;  2ZND A;  5I2L A;  2KFH A;  4JWQ A;  1CDP A;  3B86 A;  1GGW A;  2LP2 A;  1PUL A;  2HPS A;  2WCK A;  1AUI B;  1DJY A;  4ETO A;  1DTL A;  1XO5 A;  4MZJ A;  4N1G A;  2AMI A;  2KOT A;  4PDZ A;  3CR5 X;  1YRU B;  1KSM A;  1MF8 B;  2F33 A;  2FOT A;  2M8U A;  4PHJ A;  2Y4Q A;  1IQ5 A;  3CR2 A;  1S36 A;  2E6W A;  3AAJ A;  1KK7 Z;  4YGD B;  1OMV A;  3PSR A;  2TN4 A;  1K95 A;  3VRN A;  1LS8 A;  4JPZ B;  4DRW A;  1CFF A;  3PLF B;  1M46 A;  1NX0 A;  1YTZ C;  1IKU A;  3ICB A;  3OB2 B;  4DUQ A;  1E8A A;  2FCE A;  3I5G C;  1WLZ A;  1KK8 C;  3TDI A;  1ORG A;  2YGU A;  1J7R A;  4QJ3 B;  5F6T A;  4ICB A;  1K9P A;  1S6J A;  1K96 A;  5AER A;  1UHK A;  2LAN A;  1DJZ A;  2P71 A;  3RM1 A;  1QWV A;  3SIB A;  3TS5 C;  3OHM B;  1GM0 A;  3F45 A;  2NCO A;  3CZ2 A;  5CSN A;  1R2U A;  5KTY A;  1NP8 A;  5FYX A;  2EGD A;  4CLN A;  1YVH A;  4FQO A;  3NHT A;  3B88 A;  1XFV O;  2KPH A;  3E3R A;  2R2I A;  3I5I C;  4GGN A;  2WC6 A;  2I7A A;  1RWY A;  2CCM A;  4MSP A;  5DKR A;  5PAL A;  3OP0 A;  3R1V A;  1XA5 A;  4OVN F;  2RGI A;  4DCK A;  2MLE C;  2D8N A;  1IWQ A;  1WLM A;  1MUX A;  3BUX B;  1KFU S;  1QIW A;  1CKK A;  3WXA A;  4PE4 A;  4AQI A;  1G33 A;  1B8L A;  2K61 A;  2LM5 A;  1J1D A;  1SNL A;  1XYD A;  1IRJ A;  2K7D A;  4C0J A;  2L0P A;  1DJH A;  2WCJ A;  1UHJ A;  2WCH A;  1S1E A;  3EVU A;  2ZKM X;  4MBE A;  4A4C A;  1FBV A;  2M9G A;  2PYQ A;  1TCF A;  2K0J A;  4E68 A;  1TN4 A;  3CS1 A;  4BY4 A;  2KQ6 A;  5CSJ A;  1AHR A;  1IG5 A;  1KK7 Y;  4PT1 A;  1YX7 A;  2KAX A;  2H2K A;  1DQE A;  1MR8 A;  2Q4U A;  4OR9 B;  4ORA B;  4CPV A;  3DYE A;  4GBA A;  3JVT B;  3DVJ A;  2G9B A;  1S6C A;  3BUW B;  4QJ4 B;  4U8D A;  1WRZ A;  1DJX A;  4GGF A;  1CNP A;  1RK9 A;  2PAL A;  5D7F A;  2JZI A;  3GK4 X;  2KI4 B;  2WOS A;  3EVV A;  3PAT A;  3PN7 B;  4JQ0 D;  4MZK A;  2OTG B;  2L51 A;  4XYN A;  1HT9 A;  4OKH A;  3PFV A;  2JPT A;  2O5G A;  5G08 A;  5I2O A;  1LA3 A;  2L2E A;  2LLT A;  1BR1 B;  3KF9 A;  3TUY C;  3FE8 A;  2WCB A;  1OOH A;  2GV5 A;  1N65 A;  1RRO A;  3FWC A;  1QVI Z;  2KAV A;  1CDN A;  3OGN A;  2LLS A;  2BL0 C;  2Y1N A;  3SG6 A;  4YRU A;  2WND A;  4MN0 A;  2GGZ A;  1G4Y R;  1LVC D;  1TWO A;  2ZN9 A;  4GFT A;  2BCB A;  4TNC A;  1C07 A;  4YI9 A;  1DF0 A;  1B4C A;  2IS9 A;  1DGV A;  3QRX A;  1NCX A;  1YRT B;  1CTR A;  1NCY A;  3DF0 A;  2EHB A;  2F3Z A;  1Y0V H;  3AKB A;  2BAP A;  4YGC B;  4OV2 A;  1PAL A;  4WQ3 A;  4MRY A;  1OOI X;  1QX5 B;  1C7V A;  3BUN B;  1SCV A;  2ZNE A;  3I5G B;  1KK8 B;  2M3W A;  3D75 A;  4MEW A;  1EH2 A;  3BFB A;  3CZT X;  3IVT A;  3JTD C;  1NPQ A;  1N0Y A;  4XJK B;  1KFX L;  4ZCV A;  1SBJ A;  1SL9 A;  3TS5 B;  2BNX A;  3DXL A;  2KQY A;  4N1F A;  1KQM C;  3DZT A;  3I5F C;  4IL1 A;  2WC5 A;  4ORB B;  2F2O A;  5KU1 A;  3CGA A;  1A29 A;  2F2P A;  1DEK A;  2NLN A;  1DT7 B;  2CTN A;  2MLF C;  3FE6 A;  3I5I B;  3S0A A;  4PCW A;  2M29 A;  1W7I B;  1GJY A;  1NUB A;  2LUC A;  4HSZ A;  3CR4 X;  1ODB A;  1JF0 A;  5CSF A;  1BF5 A;  3S0D A;  2ZRT A;  1PRW A;  1A75 A;  1XK4 C;  2H61 A;  1AK8 A;  4YGE B;  1CM4 A;  5GQQ C;  5I94 A;  4D1E A;  1FI6 A;  4CFQ A;  3GOF A;  2GGM A;  1RFJ A;  3WHU B;  1F70 A;  1OE9 B;  4NDD A;  4YBH B;  1QVI Y;  2MAZ A;  3NSO A;  5HKZ A;  5FI2 A;  2LVJ A;  4I5N B;  4PE1 A;  3O2P A;  3SS5 A;  1YUT A;  2COL B;  4DS7 A;  1CFP A;  2MHH A;  1SMG A;  4P2Y B;  3D73 A;  1DEL A;  5I8N A;  2JWW A;  1WDC C;  1M31 A;  1SYM A;  1EXR A;  2JUL A;  3BQ3 A;  1SR6 C;  3EK8 A;  1KCY A;  2KFG A;  1Q80 A;  1SRA A;  1F4Q A;  1TUZ A;  1GGZ A;  1Y1U A;  5ER5 A;  3SJS A;  2I94 A;  2LVK A;  2KDH A;  2BE6 A;  1K9K A;  2LUX A;  1AJ5 A;  3GK1 A;  5AEQ A;  3CZ1 A;  5CPV A;  4GPL B;  4C0K A;  1IIO A;  3A4U B;  1XFW O;  1KWO B;  4R1E A;  4HRH A;  2BKH B;  2OS8 C;  3RZS A;  1MWN A;  1OOG A;  1U5I B;  1BLQ A;  1FF1 A;  5DKN A;  1SCM C;  1AP4 A;  1YUU A;  2KNE A;  4M2O A;  1OOJ A;  5HKW A;  4HRE E;  3VRO A;  2L5Y A;  1BJF A;  1A4P A;  1XFZ O;  5I2Q A;  2KLE A;  2L4I A;  1MQ1 A;  3D0Y B;  4N5X A;  1QV1 A;  2WCL A;  4YGA A;  2JNF A;  2QEH A;  2LP3 A;  2K2F A;  1B8C A;  2LVV A;  2P70 A;  2Y5I A;  4OCI A;  3EVR A;  2PVB A;  1B8R A;  4MLW A;  3TUY B;  1PVA A;  3FE9 A;  3LL8 B;  3TZ1 A;  1H8B A;  5HLV A;  5HLO A;  4PHK A;  1BG1 A;  5IBW A;  1KSO A;  2FCD A;  2BL0 B;  1QJT A;  2LAP A;  3BXK A;  3CLN A;  3PM2 A;  1B47 A;  1B7T Z;  1AVS A;  2LC5 A;  1GQM A;  3IQQ A;  5JOL A;  4F0Z B;  3IF7 A;  1LIN A;  2KBI A;  1DJW A;  1OMR A;  2K8M B;  2M1U A;  1OZO A;  1XFX O;  2QDI A;  1CFC A;  1IGV A;  2FJY A;  3HX4 A;  1M63 B;  1DMO A;  1S3P A;  1F54 A;  3BYA A;  3KEV A;  1CB1 A;  4AQJ A;  3LLE A;  1PK0 D;  2K60 A;  2M7N A;  2ERB A;  1KWO C;  2M49 B;  1QLK A;  5TNC A;  2WCM A;  3WNX B;  3SS3 A;  3JTD B;  1PSR A;  1RTP 1;  1QTX A;  1UP5 A;  2SAS A;  1JSA A;  2QEV A;  3IQO A;  1AJ4 A;  2JTZ A;  5K89 A;  1D1O A;  2K2A A;  3TDZ A;  4CFR A;  4NQG A;  1V1G A;  1TNP A;  2KAY A;  2JPO A;  1KQM B;  1K8U A;  1Z4H A;  3BOW A;  1N2D A;  3I5F B;  4DIR A;  1BOD A;  2H61 C;  1QLS A;  1KFX S;  3SG5 A;  1DGU A;  1IJ6 A;  3EG5 B;  2PQL A;  1YR5 A;  3B87 A;  4F7F A;  3DVM A;  3NSI A;  4MRX A;  4PHM A;  1CMG A;  2Y1M A;  1K94 A;  2NXQ A;  3D78 A;  1SPY A;  2QEB A;  2LMU A;  1EJ3 A;  2BCA A;  2HF5 A;  1UUS A;  1QIV A;  1W9Z A;  2KYF A;  1DJG A;  3SG3 A;  3LCP C;  3CAB A;  3S0B A;  1KQV A;  4GNK B;  4NDB A;  2QPT A;  3RLZ A;  1C3Y A;  2LE9 B;  5J3X A;  2PRU A;  2KI6 C;  1LA0 A;  1B7T Y;  3I5H C;  2I18 A;  3LK0 A;  1WDC B;  1TOP A;  1SR6 B;  1YX8 A;  3FIA A;  2JT8 A;  3PJI A;  1S26 D;  4Q04 A;  4ORC B;  3KPX A;  1REC A;  4JD9 A;  2PAS A;  2K7O A;  2KYC A;  2WCE A;  4M2P A;  3BFA A;  3VGO A;  4FQT A;  4L9M A;  1EG3 A;  2QAC A;  2L4H A;  2KGB C;  2OS8 B;  1OW4 A;  1Y6W A;  1SW8 A;  3NSK A;  2LCP A;  2B1U A;  1SCM B;  2LHI A;  4WQ2 A;  1B1G A;  1J7P A;  3DVE A;  4ZCU A;  5DIC A;  1SK6 D;  3ZWH A;  1SSE B;  2LVI A;  2LV7 A;  4INX A;  4MVF A;  1K90 D;  5HL1 A;  2BCX A;  5KSZ A;  1XFY O;  3S0F A;  1TUJ A;  1G8I A;  3PM8 A;  1VRK A;  1ZFS A;  1ZUZ A;  1NYA A;  1ZMZ A;  2JT3 A;  2G2B A;  1X02 A;  2NZ0 A;  3HCM A;  3CYZ A;  1TCO B;  1IH0 A;  3VRP A;  1UHI A;  2A4J A;  3OB1 B;  1DC1 A;  1NWD A;  1RJV A;  2VRG A;  2NCP A;  3N7H A;  4YI8 A;  1Y1A A;  4A4B A;  1DVI A;  1ZOT B;  1JBA A;  1DF0 B;  1CDL A;  2K7B A;  3FS7 A;  1SKT A;  3M0W A;  2LLU A;  1DJI A;  2KSP A;  2JOJ A;  2MBX A;  3DF0 B;  3O6B A;  1TNX A;  3L47 A;  1NIW A;  1K2H A;  2SCP A;  4INW A;  1C7W A;  4I5J A;  1ALW A;  2L98 A;  3S0G A;  3DVK A;  2AUC A;  2CT9 A;  2M97 A;  2ZFD A;  1CM1 A;  3VRQ A;  1L2O B;  2BE4 A;  1JWD A;  3DD4 A;  4GGF C;  5ER4 X;  2KFF A;  1JUO A;  1CLL A;  1SL7 A;  3A8R A;  4UPG A;  2F8P A;  1FI5 A;  2CBL A;  1LXF C;  1TNQ A;  2I2R E;  4IJ7 A;  1UHN A;  4I5L B;  4P5O E;  1TRF A;  1UUR A;  4PHN A;  1WRL A;  3LK1 A;  3WHT B;  2OPO A;  3UNW A;  3Q8I A;  1C3Z A;  2JXL A;  2ZN8 A;  1OOF A;  1UWO A;  1M39 A;  1S5G Z;  3S0E A;  2L5X B;  2JU0 A;  2P6B B;  4YGB B;  2L2C A;  1T14 A;  4GAO A;  2CNP A;  2MA2 A;  3CZ0 A;  3QME A;  1A75 B;  1QAT A;  2ZRS A;  1TNW A;  2LMV A;  3TDU A;  3AKA A;  2L50 A;  2JXC A;  1F4O A;  1A2X A;  1NSH A;  1BMO A;  2QEO A;  1TTX A;  2BBM A;  3KHE A;  3ZNI A;  2Q91 A;  1ALV A;  4M2Q A;  4OZD A;  1NCZ A;  1M45 A;  1EL4 A;  3DY9 A;  3K1E A;  1MXE A;  1JF2 A;  4GUK A;  3NXA A;  3V2L A;  2H8V A;  4MZL A;  1OZS A;  1Y1X A;  3D77 A;  1CDM A;  3FWB A;  2EC6 C;  3D10 A;  3SIA A;  2KLD A;  3I5H B;  1J1E A;  1QX2 A;  1EG4 A;  2FJU B;  3NGV A;  1S6I A;  1L2O C;  3NSL A;  1Z2C B;  3PAL A;  4NDC A;  4BY5 A;  1A03 A;  2LHL A;  3D76 A;  1QAS A;  1F8H A;  1JFJ A;  1J7Q A;  2V53 A;  5D69 A;  1QX7 A;  5AFP A;  2E30 A;  1R6P A;  1MHO A;  1XK4 A;  2LMT A;  2KBM A;  1UHH A;  3B6X A;  3L4L A;  3OX5 A;  1FW4 A;  5B8I B;  1CFD A;  5EL2 A;  1L7Z A;  1PSB A;  3EK7 A;  3VRR A;  1NX2 A;  3K21 A;  1CLB A;  1S5G Y;  1CLM A;  3MSE B;  1BR4 B;  3SG2 A;  1OQP A;  3AAK A;  3C1V A;  2M1K B;  3NHI A;  4C0L A;  4HRG A;  1FPW A;  2KGR A;  1NX3 A;  1F55 A;  2PMY A;  2GTE A;  1PVB A;  2JC2 A;  1WRK A;  1XFU O;  3R1O A;  5HKY A;  1H4B A;  5BPJ A;  5DKQ A;  3BJH A;  2CXJ A;  3R1P A;  1V1F A;  3D74 A;  3EK4 A;  4XJK A;  3SS4 A;  1B9A A;  1KFU L;  2M7L A;  1K9U A;  2BEC A;  3CDN A;  1OSA A;  1LKJ A;  1MXL C;  2JQ6 A;  3SG7 A;  2AAO A;  1WY9 A;  4PE7 A; 
#chains in the Genus database with same CATH homology
 4I5K A;  2MJW B;  2K7C A;  1J7O A;  1K93 D;  2DOQ A;  2O60 A;  1BU3 A;  1TIZ A;  4PE0 A;  2JRF A;  1JC2 A;  3SG4 A;  3EKJ A;  3BUM B;  3O4Y A;  3OX6 A;  4WRI A;  3BOW B;  3H4S E;  1SY9 A;  4QJ5 B;  2JNX A;  2M0R A;  4USL A;  4FTG A;  2HQW A;  1CMF A;  1IQ3 A;  5HYD A;  1HQV A;  1ZAC A;  5AXI A;  3KO0 A;  2WC8 A;  2JTT A;  2WOR A;  2ISD A;  3CWG A;  5CSI A;  1W7J B;  2HET A;  3JVT C;  3BUO B;  1SL8 A;  2MRD A;  3EKH A;  1QS7 A;  5AAN A;  1BT6 A;  2PSR A;  3CTN A;  1NX1 A;  1JFK A;  2KI4 C;  1OMD A;  3PN7 C;  3O78 A;  5JJG A;  1BOC A;  2OTG C;  2WCF A;  2F3Y A;  1QXP A;  1U5I A;  4PAL A;  2JT0 A;  4CID A;  1XVJ A;  2LNK A;  2KHN A;  1J55 A;  4AOM A;  2EC6 B;  2KI6 D;  2HQ8 A;  2BKI B;  1IJ5 A;  2BBN A;  1QV0 A;  3GK2 A;  1YVL A;  1YUS A;  1YUR A;  3D0Y A;  2ZND A;  5I2L A;  2KFH A;  4JWQ A;  1CDP A;  1GGW A;  2LP2 A;  1PUL A;  2HPS A;  1AUI B;  1DJY A;  4ETO A;  1DTL A;  1XO5 A;  4MZJ A;  4N1G A;  2AMI A;  2KOT A;  4PDZ A;  3CR5 X;  1YRU B;  1KSM A;  1MF8 B;  2F33 A;  2FOT A;  2M8U A;  4PHJ A;  2Y4Q A;  1IQ5 A;  3CR2 A;  1S36 A;  2E6W A;  3AAJ A;  1KK7 Z;  4YGD B;  1OMV A;  3PSR A;  2TN4 A;  1K95 A;  3VRN A;  4JPZ B;  4DRW A;  1CFF A;  3PLF B;  1M46 A;  1NX0 A;  1YTZ C;  1IKU A;  3ICB A;  3OB2 B;  4DUQ A;  1E8A A;  2FCE A;  3I5G C;  1WLZ A;  1KK8 C;  3TDI A;  1J7R A;  4QJ3 B;  5F6T A;  4ICB A;  1K9P A;  1S6J A;  1K96 A;  5AER A;  1UHK A;  2LAN A;  1DJZ A;  3RM1 A;  3SIB A;  3TS5 C;  3OHM B;  3F45 A;  2NCO A;  5CSN A;  1R2U A;  5KTY A;  1NP8 A;  5FYX A;  2EGD A;  4CLN A;  1YVH A;  4FQO A;  1XFV O;  3E3R A;  2R2I A;  3I5I C;  4GGN A;  5DKR A;  2I7A A;  1RWY A;  2CCM A;  4MSP A;  5PAL A;  3OP0 A;  1XA5 A;  4OVN F;  2RGI A;  4DCK A;  2MLE C;  2D8N A;  1IWQ A;  1MUX A;  1WLM A;  3BUX B;  1KFU S;  1QIW A;  1CKK A;  3WXA A;  4PE4 A;  4AQI A;  1G33 A;  1B8L A;  2K61 A;  2LM5 A;  1J1D A;  1SNL A;  1XYD A;  1IRJ A;  2K7D A;  4C0J A;  2L0P A;  1DJH A;  1UHJ A;  1S1E A;  3EVU A;  2ZKM X;  4MBE A;  4A4C A;  1FBV A;  2M9G A;  1TCF A;  2K0J A;  4E68 A;  1TN4 A;  3CS1 A;  4BY4 A;  2KQ6 A;  5CSJ A;  1AHR A;  1IG5 A;  1KK7 Y;  1YX7 A;  2KAX A;  2H2K A;  1MR8 A;  2Q4U A;  4OR9 B;  4ORA B;  4CPV A;  4GBA A;  3JVT B;  3DVJ A;  2G9B A;  1S6C A;  3BUW B;  4QJ4 B;  4U8D A;  1WRZ A;  1DJX A;  4GGF A;  1CNP A;  1RK9 A;  2PAL A;  5D7F A;  2JZI A;  3GK4 X;  2KI4 B;  2WOS A;  3EVV A;  3PAT A;  3PN7 B;  4JQ0 D;  4MZK A;  2OTG B;  2L51 A;  4XYN A;  1HT9 A;  4OKH A;  3PFV A;  2JPT A;  2O5G A;  5G08 A;  5I2O A;  1LA3 A;  2L2E A;  2LLT A;  1BR1 B;  3KF9 A;  3TUY C;  2WCB A;  2GV5 A;  1N65 A;  1RRO A;  3FWC A;  1QVI Z;  2KAV A;  1CDN A;  2LLS A;  2BL0 C;  2Y1N A;  3SG6 A;  4YRU A;  2WND A;  4MN0 A;  2GGZ A;  1G4Y R;  1LVC D;  2ZN9 A;  4GFT A;  2BCB A;  4TNC A;  1C07 A;  4YI9 A;  1DF0 A;  1B4C A;  2IS9 A;  1DGV A;  3QRX A;  1NCX A;  1YRT B;  1CTR A;  1NCY A;  3DF0 A;  2EHB A;  2F3Z A;  1Y0V H;  3AKB A;  4YGC B;  4OV2 A;  1PAL A;  4WQ3 A;  4MRY A;  1QX5 B;  1C7V A;  3BUN B;  1SCV A;  2ZNE A;  3I5G B;  1KK8 B;  2M3W A;  4MEW A;  1EH2 A;  3CZT X;  3JTD C;  1NPQ A;  1N0Y A;  4XJK B;  1KFX L;  4ZCV A;  1SBJ A;  1SL9 A;  3TS5 B;  2KQY A;  4N1F A;  1KQM C;  3I5F C;  4IL1 A;  4ORB B;  2F2O A;  5KU1 A;  3CGA A;  1A29 A;  2F2P A;  2NLN A;  1DT7 B;  2CTN A;  2MLF C;  3I5I B;  4PCW A;  2M29 A;  1W7I B;  1GJY A;  1NUB A;  2LUC A;  4HSZ A;  3CR4 X;  1ODB A;  1JF0 A;  5CSF A;  1BF5 A;  2ZRT A;  1PRW A;  1A75 A;  1XK4 C;  2H61 A;  1AK8 A;  4YGE B;  1CM4 A;  5GQQ C;  4D1E A;  1FI6 A;  4CFQ A;  3GOF A;  2GGM A;  1RFJ A;  3WHU B;  1F70 A;  1OE9 B;  4NDD A;  4YBH B;  1QVI Y;  2MAZ A;  3NSO A;  5HKZ A;  2LVJ A;  4I5N B;  4PE1 A;  3O2P A;  1YUT A;  2COL B;  4DS7 A;  1CFP A;  2MHH A;  1SMG A;  4P2Y B;  5I8N A;  2JWW A;  1WDC C;  1M31 A;  1SYM A;  1EXR A;  2JUL A;  3BQ3 A;  1SR6 C;  3EK8 A;  1KCY A;  2KFG A;  1Q80 A;  1SRA A;  1F4Q A;  1GGZ A;  1Y1U A;  5ER5 A;  3SJS A;  2I94 A;  2LVK A;  2KDH A;  2BE6 A;  1K9K A;  2LUX A;  1AJ5 A;  3GK1 A;  5AEQ A;  5CPV A;  4GPL B;  4C0K A;  3A4U B;  1XFW O;  1KWO B;  4R1E A;  4HRH A;  2BKH B;  2OS8 C;  1MWN A;  1U5I B;  1BLQ A;  1FF1 A;  5DKN A;  1SCM C;  1AP4 A;  1YUU A;  2KNE A;  4M2O A;  1OOJ A;  5HKW A;  4HRE E;  3VRO A;  1BJF A;  1A4P A;  1XFZ O;  5I2Q A;  2L4I A;  1MQ1 A;  3D0Y B;  4N5X A;  1QV1 A;  4YGA A;  2JNF A;  2LP3 A;  2K2F A;  1B8C A;  2LVV A;  2Y5I A;  4OCI A;  3EVR A;  2PVB A;  1B8R A;  4MLW A;  3TUY B;  1PVA A;  3LL8 B;  3TZ1 A;  1H8B A;  5HLV A;  5HLO A;  4PHK A;  1BG1 A;  5IBW A;  1KSO A;  2FCD A;  2BL0 B;  1QJT A;  2LAP A;  3BXK A;  3CLN A;  1B47 A;  1B7T Z;  1AVS A;  2LC5 A;  1GQM A;  3IQQ A;  5JOL A;  4F0Z B;  3IF7 A;  1LIN A;  2KBI A;  1DJW A;  1OMR A;  2K8M B;  2M1U A;  1OZO A;  1XFX O;  1CFC A;  1IGV A;  3HX4 A;  1M63 B;  1DMO A;  1S3P A;  1F54 A;  3BYA A;  3KEV A;  1CB1 A;  4AQJ A;  3LLE A;  1PK0 D;  2M7N A;  1KWO C;  2M49 B;  1QLK A;  5TNC A;  3WNX B;  3JTD B;  1PSR A;  1RTP 1;  1QTX A;  1UP5 A;  2SAS A;  1JSA A;  3IQO A;  1AJ4 A;  2JTZ A;  5K89 A;  1D1O A;  2K2A A;  3TDZ A;  4CFR A;  4NQG A;  1V1G A;  1TNP A;  2KAY A;  1KQM B;  1K8U A;  3BOW A;  3I5F B;  1N2D A;  4DIR A;  1BOD A;  2H61 C;  1QLS A;  1KFX S;  3SG5 A;  1DGU A;  1IJ6 A;  1YR5 A;  3DVM A;  3NSI A;  4MRX A;  4PHM A;  1CMG A;  2Y1M A;  1K94 A;  2NXQ A;  1SPY A;  2LMU A;  1EJ3 A;  2BCA A;  2HF5 A;  1UUS A;  1QIV A;  2KYF A;  1DJG A;  3SG3 A;  3LCP C;  1KQV A;  4GNK B;  4NDB A;  2QPT A;  3RLZ A;  2LE9 B;  5J3X A;  2PRU A;  2KI6 C;  1LA0 A;  1B7T Y;  3I5H C;  2I18 A;  3LK0 A;  1WDC B;  1TOP A;  1SR6 B;  1YX8 A;  3FIA A;  2JT8 A;  1S26 D;  4Q04 A;  4ORC B;  3KPX A;  1REC A;  2PAS A;  2K7O A;  2KYC A;  2WCE A;  4M2P A;  3VGO A;  4L9M A;  1EG3 A;  2QAC A;  2L4H A;  2KGB C;  2OS8 B;  1Y6W A;  3NSK A;  1SW8 A;  2LCP A;  2B1U A;  1SCM B;  2LHI A;  4WQ2 A;  1B1G A;  1J7P A;  3DVE A;  4ZCU A;  1SK6 D;  3ZWH A;  2LVI A;  2LV7 A;  4MVF A;  1K90 D;  2BCX A;  5KSZ A;  1XFY O;  1G8I A;  3PM8 A;  1VRK A;  1ZFS A;  1ZUZ A;  1NYA A;  1ZMZ A;  2JT3 A;  2G2B A;  1X02 A;  2NZ0 A;  3HCM A;  1TCO B;  1IH0 A;  3VRP A;  1UHI A;  2A4J A;  3OB1 B;  1NWD A;  1RJV A;  2VRG A;  2NCP A;  4YI8 A;  4A4B A;  1Y1A A;  1DVI A;  1ZOT B;  1JBA A;  1DF0 B;  1CDL A;  2K7B A;  3FS7 A;  1SKT A;  3M0W A;  2LLU A;  1DJI A;  2KSP A;  2JOJ A;  2MBX A;  3DF0 B;  3O6B A;  1TNX A;  1NIW A;  1K2H A;  2SCP A;  1C7W A;  4I5J A;  1ALW A;  2L98 A;  3DVK A;  2AUC A;  2CT9 A;  2M97 A;  2ZFD A;  1CM1 A;  3VRQ A;  1L2O B;  2BE4 A;  1JWD A;  3DD4 A;  4GGF C;  5ER4 X;  2KFF A;  1JUO A;  1CLL A;  1SL7 A;  3A8R A;  4UPG A;  2F8P A;  1FI5 A;  2CBL A;  1LXF C;  1TNQ A;  2I2R E;  1UHN A;  4I5L B;  4P5O E;  1TRF A;  1UUR A;  4PHN A;  1WRL A;  3LK1 A;  3WHT B;  2OPO A;  2JXL A;  2ZN8 A;  1UWO A;  1M39 A;  1S5G Z;  2L5X B;  2JU0 A;  2P6B B;  4YGB B;  4GAO A;  2CNP A;  2MA2 A;  1A75 B;  1QAT A;  2ZRS A;  1TNW A;  2LMV A;  3TDU A;  3AKA A;  2L50 A;  2JXC A;  1F4O A;  1A2X A;  1NSH A;  1BMO A;  3KHE A;  1TTX A;  2BBM A;  3ZNI A;  1F71 A;  2Q91 A;  1ALV A;  4M2Q A;  1NCZ A;  1M45 A;  1EL4 A;  1MXE A;  1JF2 A;  4GUK A;  3NXA A;  4MZL A;  1OZS A;  1Y1X A;  1CDM A;  3FWB A;  2EC6 C;  3D10 A;  3SIA A;  3I5H B;  1J1E A;  1QX2 A;  1EG4 A;  2FJU B;  1S6I A;  1L2O C;  3NSL A;  4BY5 A;  3PAL A;  4NDC A;  1A03 A;  2LHL A;  1QAS A;  1F8H A;  1JFJ A;  1J7Q A;  2V53 A;  5D69 A;  1QX7 A;  5AFP A;  2E30 A;  1R6P A;  1MHO A;  1XK4 A;  2LMT A;  2KBM A;  1UHH A;  3OX5 A;  1FW4 A;  5B8I B;  1CFD A;  1L7Z A;  1PSB A;  3EK7 A;  3VRR A;  1NX2 A;  3K21 A;  1CLB A;  1S5G Y;  1CLM A;  3MSE B;  1BR4 B;  3SG2 A;  1OQP A;  3AAK A;  3C1V A;  2M1K B;  4C0L A;  4HRG A;  1FPW A;  2KGR A;  1NX3 A;  1F55 A;  2PMY A;  1PVB A;  2JC2 A;  1WRK A;  1XFU O;  5HKY A;  1H4B A;  5BPJ A;  5DKQ A;  2CXJ A;  1V1F A;  3EK4 A;  4XJK A;  1B9A A;  1KFU L;  2M7L A;  1K9U A;  2BEC A;  1OSA A;  1LKJ A;  1MXL C;  2JQ6 A;  3SG7 A;  2AAO A;  1WY9 A;  4PE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...