1J7QA

Solution structure and backbone dynamics of the defunct ef-hand domain of calcium vector protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
86
structure length
86
Chain Sequence
AAPKARALGPEEKDECMKIFDIFDRNAENIAPVSDTMDMLTKLGQTYTKRETEAIMKEARGPKGDKKNIGPEEWLTLCSKWVRQDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium Vector Protein
publication title Solution structure and backbone dynamics of the defunct domain of calcium vector protein.
pubmed doi rcsb
source organism Branchiostoma lanceolatum
molecule tags Metal binding protein
total genus 21
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2001-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j7qA00
1NX2A 1JFKA 1Y1UA 1MQ1A 1TCOB 4YGDB 1JSAA 3O4YA 4DS7A 3WNXB 4XYNA 1YRUB 1EG4A 3NSIA 5IBWA 1R6PA 5TNCA 2KFHA 3RLZA 1CFPA 2L4HA 1B9AA 4Q04A 1YRTB 1A75B 4M2QA 2M49B 5KTYA 2MLEC 1TIZA 2KQ6A 1NX1A 1MF8B 4GUKA 2LLSA 4GAOA 2JXLA 2NCPA 1M31A 1RK9A 4ZCUA 1G33A 1NPQA 3JVTC 4A4CA 1JC2A 2LE9B 2JWWA 4JPZB 1BR4B 1K94A 2LLUA 3D10A 1F4QA 1OSAA 1LA3A 2SCPA 3DD4A 1DGUA 1XK4C 2F3ZA 2JQ6A 1JFJA 3I5IC 3O6BA 1TN4A 1QV1A 4MSPA 4XJKA 5AANA 1RTP1 3NSLA 2AMIA 1LINA 1UHNA 1SMGA 3SJSA 1OQPA 4D1EA 1M45A 2O60A 2KI4C 1DJIA 2LMTA 3SG6A 3EKJA 4ETOA 1KQMC 2KGRA 2M3WA 4NQGA 4PE0A 1Q80A 2AAOA 3DVMA 1N65A 4P5OE 1IJ6A 1A03A 1HT9A 3FWBA 2LP3A 1IG5A 3TDZA 2JRFA 3TZ1A 1XFYO 1QV0A 1QLKA 1SKTA 2Y1MA 3EK7A 2KI6D 2KGBC 3NXAA 4OV2A 4GNKB 1YX7A 1A29A 1OMRA 1NUBA 4M2OA 1EH2A 2ZRTA 3TUYC 2PSRA 2LMUA 2Y5IA 2LANA 1MXLC 4YBHB 1JF2A 3LK1A 1SK6D 1AJ4A 2CT9A 5I2QA 2B1UA 2F2PA 2M9GA 3OX6A 3PM8A 5PALA 1M63B 1MR8A 3PFVA 2MJWB 2WCBA 5FYXA 1S6CA 1F54A 3WXAA 1B47A 1EL4A 2CNPA 2L50A 2LAPA 4YGAA 4CLNA 2LVKA 1SL9A 4I5KA 3GK1A 3EVVA 1RFJA 3EK4A 1K9UA 1PVAA 1TNPA 3SG5A 1CKKA 4JWQA 2M29A 1AUIB 2EC6B 1KK8B 2HQ8A 2OTGC 1CTRA 1DTLA 2HETA 3EVUA 4R1EA 3I5GB 4GGFC 1J55A 4GBAA 3SIBA 3BYAA 2OS8C 3DVEA 5AFPA 1TRFA 1J7OA 3GK4X 3SG2A 1W7IB 1B4CA 4YGCB 2BBMA 1C7VA 2GGZA 1XFWO 4C0KA 1CDMA 2K7OA 1D1OA 2MHHA 1BU3A 1XFXO 4NDDA 2K7CA 1DJGA 4XJKB 2H61C 1K9KA 2KNEA 2K2AA 3A4UB 1SRAA 2BKHB 2LUXA 3E3RA 4CPVA 1IGVA 2LV7A 5F6TA 4QJ4B 1IKUA 2PVBA 2Q91A 2G2BA 1GJYA 1V1FA 1CMFA 1FW4A 2FJUB 2H2KA 1F8HA 1BG1A 1MXEA 1SCMC 2LNKA 1L2OC 2K61A 1DMOA 1MHOA 1EG3A 1QS7A 2BCXA 2AUCA 4MZJA 4QJ3B 4NDBA 1OZSA 2CXJA 3WHUB 5HLVA 4ORBB 1N2DA 2LUCA 3CR4X 1A4PA 1QASA 3JVTB 2KAYA 1AK8A 2O5GA 3I5FC 2F2OA 3LK0A 5I2LA 1EJ3A 2L0PA 3I5IB 3QRXA 2JTZA 4BY5A 1FPWA 2GV5A 2L2EA 5CSFA 4YGBB 5DKNA 5HKYA 3I5HB 4OR9B 1JUOA 4N1FA 1XFVO 4AOMA 2JNFA 1MUXA 4GPLB 4I5JA 5CSIA 1Y6WA 2FCEA 1UUSA 1UP5A 1YURA 3BUMB 1J1EA 2ZN8A 1ALVA 2LM5A 1J7RA 2CTNA 1C07A 4GGNA 1NIWA 2JXCA 2TN4A 3VRPA 2BL0C 1NP8A 1SL8A 1FF1A 2WC8A 1YUSA 2Q4UA 4MLWA 1YVHA 2NCOA 3ZNIA 3JTDB 1NCXA 1PALA 3KF9A 3VRRA 1PULA 1KQVA 1XVJA 2LC5A 2F8PA 3ICBA 5J3XA 1YVLA 1QATA 1BT6A 4MZLA 1LVCD 2SASA 1ODBA 3AKBA 4WRIA 1SR6B 3DVJA 1AVSA 1KWOC 5HLOA 2JPTA 2I7AA 2JTTA 1LXFC 3NSKA 1QJTA 1UHKA 4FTGA 4I5LB 3FIAA 5K89A 2OPOA 3PLFB 3PN7C 2JT0A 1YUTA 1XO5A 4CFRA 5B8IB 2OTGB 3AKAA 2HQWA 1U5IA 2LVJA 1SL7A 5I8NA 1KCYA 1S5GZ 2NLNA 1NCYA 1ZFSA 1Y1XA 2WCFA 1DVIA 1YTZC 2LHLA 4M2PA 2BECA 3PATA 3IQQA 2JOJA 4F0ZB 4HRHA 1GGWA 1Y1AA 1BF5A 1BJFA 1UHIA 2KDHA 1CDPA 3BOWA 2K8MB 2NXQA 2ZN9A 3VRNA 1DJXA 1XK4A 1NX3A 1YX8A 4TNCA 3GK2A 4DUQA 3LLEA 1TTXA 1F70A 1B8LA 2GGMA 2M0RA 3BXKA 1KFUS 3KHEA 2E30A 2JULA 1S6JA 2L98A 2CCMA 3SG7A 1OE9B 1QX7A 2KAXA 1L2OB 5CSJA 3OB2B 4NDCA 1BODA 1QIVA 3PSRA 1DJYA 2MAZA 1SY9A 2M8UA 1A2XA 3OHMB 1W7JB 5CPVA 4N5XA 3KPXA 1OMDA 5AERA 4HSZA 1WRKA 1SYMA 4DCKA 4PALA 2ZRSA 2R2IA 3DVKA 1RWYA 1WY9A 2WORA 1AHRA 2KSPA 3I5FB 4E68A 2LMVA 1HQVA 1CDLA 1XYDA 2M1UA 3C1VA 3DF0A 2PRUA 1NX0A 1KFUL 1IQ3A 3CR2A 1PSRA 3CLNA 1UWOA 3WHTB 1K9PA 1K95A 1ZACA 1DF0A 4OVNF 1SW8A 1C7WA 1ZMZA 2A4JA 1U5IB 1BOCA 3TDUA 1WLZA 1IH0A 2JC2A 2I2RE 1EXRA 1IWQA 1F55A 4PE4A 3TDIA 4GGFA 4HRGA 3A8RA 3BUWB 1YUUA 2BL0B 1KK7Z 2KHNA 4MRXA 1QLSA 2MA2A 1M46A 1OOJA 3VRQA 2JT8A 1RROA 3BOWB 3LL8B 2EC6C 1KK8C 1J7PA 4FQOA 3MSEB 3I5GC 4MRYA 4ORCB 4PE7A 2WNDA 1BR1B 1S5GY 1SNLA 4U8DA 1JBAA 2H61A 1B8CA 2NZ0A 3VROA 2E6WA 2F33A 4C0LA 1DJZA 1M39A 2KFGA 4OKHA 1L7ZA 5CSNA 2M1KB 1J1DA 1KWOB 3K21A 2HPSA 1LA0A 2KI4B 3BUOB 1S36A 1KQMB 1OZOA 3OB1B 4ORAB 2V53A 2KYCA 4PHKA 1G8IA 1BMOA 2M97A 1WDCC 1F4OA 2BE4A 3PN7B 1IJ5A 3TS5C 2L51A 4AQJA 5DKRA 2BBNA 2K2FA 3HCMA 3VGOA 2FOTA 3O78A 1CLMA 3KO0A 4ICBA 1NWDA 2COLB 3IF7A 3KEVA 1B7TZ 1N0YA 1GQMA 1E8AA 1CDNA 3TUYB 2LVIA 1K90D 1S3PA 3BUXB 4C0JA 3O2PA 1B8RA 1IQ5A 1K8UA 1DT7B 3DF0B 1NSHA 4MBEA 5I2OA 1S6IA 4YRUA 1CM4A 2FCDA 2P6BB 2ZFDA 1QVIZ 1JF0A 1SCVA 1CMGA 2VRGA 3OP0A 2K7DA 1DF0B 1WLMA 1ZUZA 1QX5B 3BQ3A 1UHJA 2LP2A 1SPYA 2PASA 4WQ2A 1IRJA 2MRDA 1KFXS 2WOSA 4JQ0D 4HREE 2OS8B 1JWDA 3I5HC 3CGAA 1PRWA 2RGIA 3AAJA 2F3YA 4DRWA 3F45A 5KU1A 4GFTA 1RECA 1Y0VH 3HX4A 4YI9A 1AP4A 1CFDA 1H8BA 3EK8A 1BLQA 5BPJA 3LCPC 4A4BA 2KOTA 3H4SE 1TCFA 1NYAA 5ER5A 1F71A 2JT3A 4PDZA 1VRKA 1TNWA 1H4BA 2KI6C 4USLA 4PHNA 1KK7Y 4I5NB 2I94A 2JZIA 2KYFA 1V1GA 3D0YA 3NSOA 3RM1A 1X02A 2PMYA 4PE1A 1TOPA 2KQYA 1CNPA 2HF5A 3JTDC 1QX2A 1DJHA 1RJVA 1SCMB 4L9MA 2ZNDA 1SBJA 2D8NA 1XA5A 3CWGA 2MBXA 2M7NA 1KFXL 1XFUO 2M7LA 2QPTA 1GGZA 1SR6C 4PHJA 3CTNA 3PALA 2QACA 2CBLA 5G08A 3CZTX 1KSMA 1TNXA 3EKHA 4MN0A 1CFFA 3FS7A 2KFFA 5DKQA 1PSBA 1AJ5A 1CLBA 3CS1A 2ISDA 1J7QA 1A75A 1CFCA 4YI8A 1QIWA 5HKZA 3FWCA 1WRZA 5ER4X 1YR5A 4QJ5B 4PHMA 2LHIA 1B7TY 1MWNA 5HYDA 4MEWA 1K93D 1UHHA 1QTXA 2ZNEA 4N1GA 2PALA 2LLTA 3CR5X 2L5XB 1LKJA 4MVFA 1S1EA 2ZKMX 4P2YB 1FBVA 2BE6A 2LCPA 3IQOA 2WCEA 4ZCVA 1WDCB 4IL1A 2BCBA 1QVIY 3TS5B 2JU0A 2KAVA 4OCIA 5GQQC 2I18A 2IS9A 3M0WA 5HKWA 4DIRA 1NCZA 1S26D 2K7BA 4WQ3A 5AEQA 1QXPA 1XFZO 1ALWA 1CM1A 3OX5A 1R2UA 5JJGA 3SIAA 1TNQA 1FI6A 1WRLA 2DOQA 1UURA 4YGEB 1FI5A 4AQIA 3AAKA 1K96A 2Y1NA 2MLFC 4PCWA 4CIDA 1ZOTB 1B1GA 3GOFA 2L4IA 4CFQA 4MZKA 3D0YB 1DJWA 4BY4A 2JNXA 2Y4QA 3ZWHA 5AXIA 5KSZA 3EVRA 2K0JA 2BKIB 2G9BA 5D69A 5JOLA 2BCAA 1DGVA 1G4YR 5D7FA 3SG3A 1CLLA 1PK0D 3BUNB 1K2HA 4UPGA 2EHBA 2EGDA 1OMVA 2LVVA 1CB1A 2KBMA 3SG4A 1PVBA 2KBIA 1KSOA
chains in the Genus database with same CATH superfamily
1DEKA 1NX2A 5D3OA 1JFKA 1Y1UA 1MQ1A 1TCOB 4YGDB 2WCKA 3O4YA 1JSAA 4DS7A 3WNXB 4XYNA 1YRUB 1EG4A 1ORGA 3NSIA 3V2LA 3B87A 5IBWA 1R6PA 5TNCA 1OW4A 2QEHA 2KFHA 3RLZA 1CFPA 2L4HA 1GM0A 1B9AA 4Q04A 1YRTB 1A75B 4M2QA 2M49B 5KTYA 2MLEC 1TIZA 2WCHA 2KQ6A 3SS5A 1NX1A 1MF8B 3CZ0A 4GUKA 2LLSA 4GAOA 2JXLA 2NCPA 1M31A 1RK9A 4ZCUA 1G33A 1NPQA 3JVTC 4A4CA 1JC2A 3CABA 3UNWA 2LE9B 2JWWA 4JPZB 1BR4B 1K94A 2LLUA 3D10A 1F4QA 1OSAA 1LA3A 3S0AA 3DYEA 2SCPA 3DD4A 1DGUA 1XK4C 2F3ZA 2JQ6A 1JFJA 3I5IC 3O6BA 1TN4A 1QV1A 4MSPA 4XJKA 4USLA 5AANA 2WC6A 1RTP1 3D75A 2AMIA 1LINA 1QWVA 1UHNA 3NSLA 1SMGA 2QEBA 3S0BA 3PM2A 1XFRA 1OQPA 3SJSA 4D1EA 1M45A 2O60A 2KI4C 1DJIA 2LMTA 1W9ZA 3SG6A 3BJHA 3EKJA 4ETOA 1KQMC 2KGRA 5DICA 2M3WA 4NQGA 4PE0A 1Q80A 2AAOA 3DVMA 1N65A 4P5OE 4PT1A 1IJ6A 1A03A 1HT9A 3FWBA 2LP3A 1IG5A 3TDZA 2JRFA 3TZ1A 1XFYO 1QV0A 1QLKA 1SKTA 2Y1MA 3EK7A 2KI6D 2KGBC 3NXAA 4OV2A 4GNKB 1YX7A 2KPHA 3B88A 1A29A 1OMRA 1NUBA 3CDNA 4M2OA 1EH2A 2ZRTA 3TUYC 2PSRA 2LMUA 2Y5IA 2LANA 1MXLC 4YBHB 1JF2A 3LK1A 1SK6D 1AJ4A 2CT9A 5I2QA 2B1UA 2F2PA 2M9GA 3OX6A 3PM8A 5PALA 1M63B 1MR8A 3IVTA 3PFVA 2MJWB 2WCBA 5FYXA 1S6CA 1F54A 3WXAA 1B47A 1EL4A 2CNPA 2L50A 2LAPA 3R72A 4YGAA 3OGNA 4CLNA 2LVKA 3NHIA 1SL9A 4I5KA 3GK1A 3EVVA 1RFJA 3EK4A 1K9UA 1PVAA 1TNPA 3SG5A 1CKKA 4JWQA 2M29A 1AUIB 2EC6B 1KK8B 2HQ8A 2OTGC 1CTRA 1DTLA 2HETA 3EVUA 4R1EA 3I5GB 4GGFC 1J55A 4GBAA 3SIBA 3BYAA 2OS8C 3DVEA 5AFPA 1TRFA 1J7OA 3GK4X 3SG2A 1W7IB 3BFAA 3K1EA 1B4CA 4OZDA 4YGCB 2BBMA 1C7VA 2QEVA 2GGZA 1XFWO 4C0KA 1CDMA 2K7OA 1D1OA 2MHHA 1BU3A 1XFXO 4NDDA 2K7CA 1DJGA 3BFHA 4IJ7A 4XJKB 2H61C 1K9KA 2KNEA 2K2AA 3A4UB 1SRAA 2BKHB 2LUXA 3E3RA 2PYQA 4CPVA 1IGVA 2LV7A 5F6TA 4QJ4B 1IKUA 2PVBA 2Q91A 2G2BA 1GJYA 1V1FA 1CMFA 1FW4A 2FJUB 2H2KA 1F8HA 1BG1A 1MXEA 1SCMC 4INWA 2LNKA 1L2OC 3EG5B 2K61A 1DMOA 4JD9A 1MHOA 1EG3A 1QS7A 2BCXA 2AUCA 4MZJA 1LS8A 4QJ3B 4NDBA 1OZSA 2CXJA 3WHUB 5HLVA 3B7AA 4ORBB 1N2DA 2LUCA 3CR4X 1A4PA 2YGUA 1QASA 3JVTB 2KAYA 1AK8A 2O5GA 3I5FC 2F2OA 3LK0A 2FJYA 5I2LA 1EJ3A 2L0PA 3I5IB 3QRXA 1Z4HA 2JTZA 4BY5A 1FPWA 2GV5A 2L2EA 5CSFA 4YGBB 5DKNA 5HKYA 3I5HB 4OR9B 1JUOA 4N1FA 1XFVO 4AOMA 2JNFA 1MUXA 4GPLB 4I5JA 5CSIA 1Y6WA 2FCEA 1UUSA 1P28A 1UP5A 1YURA 1J1EA 3BUMB 2ZN8A 1ALVA 2LM5A 1J7RA 2CTNA 1C07A 4GGNA 1NIWA 2JXCA 2TN4A 3VRPA 2BL0C 1NP8A 1SL8A 1FF1A 3BFBA 2WC8A 1YUSA 2Q4UA 1IIOA 4MLWA 1YVHA 2NCOA 3ZNIA 1TUZA 3JTDB 1NCXA 3B86A 1PALA 3KF9A 3VRRA 1PULA 1KQVA 1DQEA 1XVJA 2LC5A 2F8PA 3ICBA 5J3XA 1YVLA 1QATA 1BT6A 4MZLA 1LVCD 2SASA 1ODBA 3AKBA 4WRIA 1SR6B 3DVJA 1AVSA 1KWOC 5HLOA 2JPTA 2I7AA 2JTTA 1TUJA 1LXFC 3NSKA 1QJTA 1UHKA 3CZ2A 3R1PA 4FTGA 2WCJA 3FIAA 2OPOA 4I5LB 5K89A 3PLFB 3PN7C 1OOHA 2JT0A 1YUTA 1XO5A 5I94A 4CFRA 5B8IB 2OTGB 3AKAA 2HQWA 1U5IA 2LVJA 1SL7A 5I8NA 1KCYA 1S5GZ 2NLNA 1NCYA 1ZFSA 1Y1XA 2WCFA 1DVIA 1YTZC 2LHLA 4M2PA 2BECA 3VB1A 3PATA 3IQQA 2JOJA 4F0ZB 4HRHA 1GGWA 1Y1AA 1BF5A 1BJFA 1UHIA 2KDHA 1CDPA 3BOWA 2K8MB 2NXQA 2ZN9A 3NGVA 3VRNA 4F7FA 1DJXA 1XK4A 1NX3A 5HL1A 1YX8A 2K60A 4TNCA 3GK2A 4DUQA 3LLEA 3DXLA 4INXA 2ERBA 1TTXA 1F70A 1B8LA 2GGMA 2M0RA 3BXKA 1TWOA 1KFUS 3KHEA 2E30A 2JULA 1S6JA 2L98A 2CCMA 3SG7A 1OE9B 1QX7A 2KAXA 3QMEA 1L2OB 2PQLA 5CSJA 3OB2B 4NDCA 1BODA 1QIVA 3PSRA 1DJYA 2MAZA 1SY9A 2M8UA 1A2XA 3OHMB 1W7JB 5CPVA 4N5XA 3D76A 3KPXA 1OMDA 5AERA 4HSZA 1WRKA 1OOIX 1SYMA 4DCKA 4PALA 2ZRSA 2R2IA 3DVKA 3SS3A 1RWYA 1WY9A 3D77A 3FE8A 3S0DA 2WORA 3FE6A 1AHRA 2KSPA 3I5FB 4E68A 2LMVA 1CDLA 1HQVA 2BNXA 1XYDA 2M1UA 3C1VA 3DF0A 2PRUA 1NX0A 1KFUL 1IQ3A 3CR2A 1PSRA 3CLNA 1UWOA 2QEOA 1K9PA 3WHTB 1K95A 1ZACA 1DF0A 4OVNF 1SW8A 1C7WA 1ZMZA 2A4JA 1U5IB 1BOCA 3TDUA 1WLZA 1IH0A 2JC2A 2I2RE 1EXRA 1IWQA 3N7HA 1F55A 4PE4A 3TDIA 4GGFA 4HRGA 3A8RA 1C3ZA 3BUWB 1YUUA 2BL0B 1KK7Z 2KHNA 4MRXA 1QLSA 2MA2A 3B6XA 1M46A 1OOJA 3VRQA 2JT8A 3RM1A 1RROA 3BOWB 3LL8B 2EC6C 1KK8C 1J7PA 1OOFA 4FQOA 3MSEB 1OOGA 3I5GC 4MRYA 4ORCB 4PE7A 2WNDA 1BR1B 1S5GY 1SNLA 3L4LA 4U8DA 5FI6A 1JBAA 2H61A 1B8CA 2NZ0A 3VROA 2E6WA 2F33A 4C0LA 2WCMA 1DJZA 3S0GA 1M39A 2KFGA 4OKHA 1L7ZA 5CSNA 2M1KB 1J1DA 1KWOB 3K21A 2HPSA 1LA0A 2GTEA 2KI4B 3BUOB 1S36A 1KQMB 1OZOA 3OB1B 4ORAB 2V53A 2KYCA 4PHKA 1G8IA 1BMOA 2M97A 3R1VA 1WDCC 1F4OA 2BE4A 3PN7B 1IJ5A 3TS5C 2L51A 2BAPA 4AQJA 5DKRA 2BBNA 2K2FA 3HCMA 3VGOA 3D78A 2FOTA 3O78A 1CLMA 3KO0A 4ICBA 1NWDA 2COLB 3IF7A 3KEVA 1B7TZ 1N0YA 5FI7A 5FI2A 1GQMA 1E8AA 1CDNA 3TUYB 2LVIA 3D73A 1K90D 1S3PA 3BUXB 4C0JA 3O2PA 1B8RA 1IQ5A 1K8UA 1DT7B 3DF0B 1NSHA 4MBEA 5I2OA 1S6IA 4YRUA 1CM4A 2FCDA 2P6BB 2ZFDA 1QVIZ 1JF0A 1SCVA 2L5YA 1CMGA 2VRGA 3OP0A 3RZSA 2K7DA 1DF0B 1WLMA 1ZUZA 3L4AA 1QX5B 3BQ3A 1UHJA 3D74A 2LP2A 1SPYA 2PASA 4WQ2A 4KYNA 3S0FA 1IRJA 2MRDA 1KFXS 2WOSA 4JQ0D 4HREE 2OS8B 1JWDA 3I5HC 3CGAA 2WC5A 1PRWA 2RGIA 3AAJA 2F3YA 4DRWA 3F45A 5KU1A 3CZ1A 4GFTA 1RECA 1Y0VH 3HX4A 4YI9A 1AP4A 1CFDA 1H8BA 2WCLA 3EK8A 5BPJA 3LCPC 1BLQA 4A4BA 2KOTA 3H4SE 1TCFA 1NYAA 5ER5A 1T14A 1F71A 2JT3A 4PDZA 1VRKA 1TNWA 4FQTA 1H4BA 3SS4A 2KI6C 3DZTA 4PHNA 1KK7Y 4I5NB 2I94A 2JZIA 2KYFA 1V1GA 3D0YA 3DY9A 2H8VA 1X02A 2PMYA 3NSOA 4PE1A 1TOPA 2KQYA 1CNPA 2HF5A 1C3YA 3JTDC 1QX2A 1DJHA 1RJVA 1SCMB 3Q8IA 5EL2A 4L9MA 2ZNDA 1SBJA 2D8NA 1XA5A 3CWGA 3PJIA 2MBXA 2M7NA 3UO9A 1KFXL 3FE9A 1XFUO 2M7LA 2QPTA 1GGZA 1SR6C 4PHJA 3CTNA 2P71A 3PALA 2QACA 2CBLA 5G08A 2QDIA 3CZTX 1KSMA 1TNXA 3EKHA 4MN0A 1CFFA 3FS7A 2KFFA 4JKTA 1PSBA 1AJ5A 5DKQA 1DELA 1CLBA 3CS1A 1Z2CB 2ISDA 2JPOA 1J7QA 1A75A 1CFCA 4YI8A 1QIWA 5HKZA 3FWCA 1WRZA 5ER4X 1YR5A 4QJ5B 4PHMA 2LHIA 1B7TY 1MWNA 5HYDA 4MEWA 1K93D 1UHHA 1QTXA 2ZNEA 4N1GA 2PALA 2LLTA 3CR5X 2L5XB 1LKJA 4MVFA 1S1EA 2ZKMX 4P2YB 1FBVA 2BE6A 2LCPA 3L47A 2KLDA 2KLEA 1SSEB 3IQOA 2WCEA 4ZCVA 1WDCB 4IL1A 2BCBA 1QVIY 3R1OA 3TS5B 2JU0A 2KAVA 4OCIA 5GQQC 1DC1A 2I18A 2IS9A 3M0WA 5HKWA 4DIRA 1NCZA 1S26D 2K7BA 4WQ3A 5AEQA 1QXPA 1XFZO 1ALWA 1CM1A 3OX5A 1R2UA 5JJGA 3SIAA 1TNQA 1FI6A 1WRLA 2DOQA 1UURA 4YGEB 1FI5A 2L2CA 4AQIA 3AAKA 1K96A 2Y1NA 2MLFC 4PCWA 3S0EA 1ZOTB 4CIDA 3GOFA 2L4IA 3CYZA 4CFQA 1B1GA 4MZKA 3D0YB 1DJWA 4BY4A 2JNXA 2Y4QA 3ZWHA 5AXIA 5KSZA 3EVRA 2K0JA 2BKIB 2G9BA 5D69A 5JOLA 1DGVA 1G4YR 2BCAA 5D7FA 3SG3A 1CLLA 1PK0D 3BUNB 3O4XA 1K2HA 4UPGA 2EHBA 2EGDA 1OMVA 2LVVA 2P70A 3NHTA 1CB1A 2KBMA 3SG4A 1PVBA 3OBVA 2KBIA 1KSOA
chains in the Genus database with same CATH topology
1NX2A 1JFKA 1Y1UA 1MQ1A 1TCOB 4YGDB 1JSAA 3O4YA 4DS7A 3WNXB 4XYNA 1YRUB 1EG4A 3NSIA 5IBWA 1R6PA 5TNCA 2KFHA 3RLZA 1CFPA 2L4HA 1B9AA 4Q04A 1YRTB 1A75B 4M2QA 2M49B 5KTYA 2MLEC 1TIZA 2KQ6A 1NX1A 1MF8B 4GUKA 2LLSA 4GAOA 2JXLA 2NCPA 1M31A 1RK9A 4ZCUA 1G33A 1NPQA 3JVTC 4A4CA 1JC2A 2LE9B 2JWWA 4JPZB 1BR4B 1K94A 2LLUA 3D10A 1F4QA 1OSAA 1LA3A 2SCPA 3DD4A 1DGUA 1XK4C 2F3ZA 2JQ6A 1JFJA 3I5IC 3O6BA 1TN4A 1QV1A 4MSPA 4XJKA 5AANA 1RTP1 3NSLA 2AMIA 1LINA 1UHNA 1SMGA 3SJSA 1OQPA 4D1EA 1M45A 2O60A 2KI4C 1DJIA 2LMTA 3SG6A 3EKJA 4ETOA 1KQMC 2KGRA 2M3WA 4NQGA 4PE0A 1Q80A 2AAOA 3DVMA 1N65A 4P5OE 1IJ6A 1A03A 1HT9A 3FWBA 2LP3A 1IG5A 3TDZA 2JRFA 3TZ1A 1XFYO 1QV0A 1QLKA 1SKTA 2Y1MA 3EK7A 2KI6D 2KGBC 3NXAA 4OV2A 4GNKB 1YX7A 1A29A 1OMRA 1NUBA 4M2OA 1EH2A 2ZRTA 3TUYC 2PSRA 2LMUA 2Y5IA 2LANA 1MXLC 4YBHB 1JF2A 3LK1A 1SK6D 1AJ4A 2CT9A 5I2QA 2B1UA 2F2PA 2M9GA 3OX6A 3PM8A 5PALA 1M63B 1MR8A 3PFVA 2MJWB 2WCBA 5FYXA 1S6CA 1F54A 3WXAA 1B47A 1EL4A 2CNPA 2L50A 2LAPA 4YGAA 4CLNA 2LVKA 1SL9A 4I5KA 3GK1A 3EVVA 1RFJA 3EK4A 1K9UA 1PVAA 1TNPA 3SG5A 1CKKA 4JWQA 2M29A 1AUIB 2EC6B 1KK8B 2HQ8A 2OTGC 1CTRA 1DTLA 2HETA 3EVUA 4R1EA 3I5GB 4GGFC 1J55A 4GBAA 3SIBA 3BYAA 2OS8C 3DVEA 5AFPA 1TRFA 1J7OA 3GK4X 3SG2A 1W7IB 1B4CA 4YGCB 2BBMA 1C7VA 2GGZA 1XFWO 4C0KA 1CDMA 2K7OA 1D1OA 2MHHA 1BU3A 1XFXO 4NDDA 2K7CA 1DJGA 4XJKB 2H61C 1K9KA 2KNEA 2K2AA 3A4UB 1SRAA 2BKHB 2LUXA 3E3RA 4CPVA 1IGVA 2LV7A 5F6TA 4QJ4B 1IKUA 2PVBA 2Q91A 2G2BA 1GJYA 1V1FA 1CMFA 1FW4A 2FJUB 2H2KA 1F8HA 1BG1A 1MXEA 1SCMC 2LNKA 1L2OC 2K61A 1DMOA 1MHOA 1EG3A 1QS7A 2BCXA 2AUCA 4MZJA 4QJ3B 4NDBA 1OZSA 2CXJA 3WHUB 5HLVA 4ORBB 1N2DA 2LUCA 3CR4X 1A4PA 1QASA 3JVTB 2KAYA 1AK8A 2O5GA 3I5FC 2F2OA 3LK0A 5I2LA 1EJ3A 2L0PA 3I5IB 3QRXA 2JTZA 4BY5A 1FPWA 2GV5A 2L2EA 5CSFA 4YGBB 5DKNA 5HKYA 3I5HB 4OR9B 1JUOA 4N1FA 1XFVO 4AOMA 2JNFA 1MUXA 4GPLB 4I5JA 5CSIA 1Y6WA 2FCEA 1UUSA 1UP5A 1YURA 3BUMB 1J1EA 2ZN8A 1ALVA 2LM5A 1J7RA 2CTNA 1C07A 4GGNA 1NIWA 2JXCA 2TN4A 3VRPA 2BL0C 1NP8A 1SL8A 1FF1A 2WC8A 1YUSA 2Q4UA 4MLWA 1YVHA 2NCOA 3ZNIA 3JTDB 1NCXA 1PALA 3KF9A 3VRRA 1PULA 1KQVA 1XVJA 2LC5A 2F8PA 3ICBA 5J3XA 1YVLA 1QATA 1BT6A 4MZLA 1LVCD 2SASA 1ODBA 3AKBA 4WRIA 1SR6B 3DVJA 1AVSA 1KWOC 5HLOA 2JPTA 2I7AA 2JTTA 1LXFC 3NSKA 1QJTA 1UHKA 4FTGA 4I5LB 3FIAA 5K89A 2OPOA 3PLFB 3PN7C 2JT0A 1YUTA 1XO5A 4CFRA 5B8IB 2OTGB 3AKAA 2HQWA 1U5IA 2LVJA 1SL7A 5I8NA 1KCYA 1S5GZ 2NLNA 1NCYA 1ZFSA 1Y1XA 2WCFA 1DVIA 1YTZC 2LHLA 4M2PA 2BECA 3PATA 3IQQA 2JOJA 4F0ZB 4HRHA 1GGWA 1Y1AA 1BF5A 1BJFA 1UHIA 2KDHA 1CDPA 3BOWA 2K8MB 2NXQA 2ZN9A 3VRNA 1DJXA 1XK4A 1NX3A 1YX8A 4TNCA 3GK2A 4DUQA 3LLEA 1TTXA 1F70A 1B8LA 2GGMA 2M0RA 3BXKA 1KFUS 3KHEA 2E30A 2JULA 1S6JA 2L98A 2CCMA 3SG7A 1OE9B 1QX7A 2KAXA 1L2OB 5CSJA 3OB2B 4NDCA 1BODA 1QIVA 3PSRA 1DJYA 2MAZA 1SY9A 2M8UA 1A2XA 3OHMB 1W7JB 5CPVA 4N5XA 3KPXA 1OMDA 5AERA 4HSZA 1WRKA 1SYMA 4DCKA 4PALA 2ZRSA 2R2IA 3DVKA 1RWYA 1WY9A 2WORA 1AHRA 2KSPA 3I5FB 4E68A 2LMVA 1HQVA 1CDLA 1XYDA 2M1UA 3C1VA 3DF0A 2PRUA 1NX0A 1KFUL 1IQ3A 3CR2A 1PSRA 3CLNA 1UWOA 3WHTB 1K9PA 1K95A 1ZACA 1DF0A 4OVNF 1SW8A 1C7WA 1ZMZA 2A4JA 1U5IB 1BOCA 3TDUA 1WLZA 1IH0A 2JC2A 2I2RE 1EXRA 1IWQA 1F55A 4PE4A 3TDIA 4GGFA 4HRGA 3A8RA 3BUWB 1YUUA 2BL0B 1KK7Z 2KHNA 4MRXA 1QLSA 2MA2A 1M46A 1OOJA 3VRQA 2JT8A 1RROA 3BOWB 3LL8B 2EC6C 1KK8C 1J7PA 4FQOA 3MSEB 3I5GC 4MRYA 4ORCB 4PE7A 2WNDA 1BR1B 1S5GY 1SNLA 4U8DA 1JBAA 2H61A 1B8CA 2NZ0A 3VROA 2E6WA 2F33A 4C0LA 1DJZA 1M39A 2KFGA 4OKHA 1L7ZA 5CSNA 2M1KB 1J1DA 1KWOB 3K21A 2HPSA 1LA0A 2KI4B 3BUOB 1S36A 1KQMB 1OZOA 3OB1B 4ORAB 2V53A 2KYCA 4PHKA 1G8IA 1BMOA 2M97A 1WDCC 1F4OA 2BE4A 3PN7B 1IJ5A 3TS5C 2L51A 4AQJA 5DKRA 2BBNA 2K2FA 3HCMA 3VGOA 2FOTA 3O78A 1CLMA 3KO0A 4ICBA 1NWDA 2COLB 3IF7A 3KEVA 1B7TZ 1N0YA 1GQMA 1E8AA 1CDNA 3TUYB 2LVIA 1K90D 1S3PA 3BUXB 4C0JA 3O2PA 1B8RA 1IQ5A 1K8UA 1DT7B 3DF0B 1NSHA 4MBEA 5I2OA 1S6IA 4YRUA 1CM4A 2FCDA 2P6BB 2ZFDA 1QVIZ 1JF0A 1SCVA 1CMGA 2VRGA 3OP0A 2K7DA 1DF0B 1WLMA 1ZUZA 1QX5B 3BQ3A 1UHJA 2LP2A 1SPYA 2PASA 4WQ2A 1IRJA 2MRDA 1KFXS 2WOSA 4JQ0D 4HREE 2OS8B 1JWDA 3I5HC 3CGAA 1PRWA 2RGIA 3AAJA 2F3YA 4DRWA 3F45A 5KU1A 4GFTA 1RECA 1Y0VH 3HX4A 4YI9A 1AP4A 1CFDA 1H8BA 3EK8A 1BLQA 5BPJA 3LCPC 4A4BA 2KOTA 3H4SE 1TCFA 1NYAA 5ER5A 1F71A 2JT3A 4PDZA 1VRKA 1TNWA 1H4BA 2KI6C 4USLA 4PHNA 1KK7Y 4I5NB 2I94A 2JZIA 2KYFA 1V1GA 3D0YA 3NSOA 3RM1A 1X02A 2PMYA 4PE1A 1TOPA 2KQYA 1CNPA 2HF5A 3JTDC 1QX2A 1DJHA 1RJVA 1SCMB 4L9MA 2ZNDA 1SBJA 2D8NA 1XA5A 3CWGA 2MBXA 2M7NA 1KFXL 1XFUO 2M7LA 2QPTA 1GGZA 1SR6C 4PHJA 3CTNA 3PALA 2QACA 2CBLA 5G08A 3CZTX 1KSMA 1TNXA 3EKHA 4MN0A 1CFFA 3FS7A 2KFFA 5DKQA 1PSBA 1AJ5A 1CLBA 3CS1A 2ISDA 1J7QA 1A75A 1CFCA 4YI8A 1QIWA 5HKZA 3FWCA 1WRZA 5ER4X 1YR5A 4QJ5B 4PHMA 2LHIA 1B7TY 1MWNA 5HYDA 4MEWA 1K93D 1UHHA 1QTXA 2ZNEA 4N1GA 2PALA 2LLTA 3CR5X 2L5XB 1LKJA 4MVFA 1S1EA 2ZKMX 4P2YB 1FBVA 2BE6A 2LCPA 3IQOA 2WCEA 4ZCVA 1WDCB 4IL1A 2BCBA 1QVIY 3TS5B 2JU0A 2KAVA 4OCIA 5GQQC 2I18A 2IS9A 3M0WA 5HKWA 4DIRA 1NCZA 1S26D 2K7BA 4WQ3A 5AEQA 1QXPA 1XFZO 1ALWA 1CM1A 3OX5A 1R2UA 5JJGA 3SIAA 1TNQA 1FI6A 1WRLA 2DOQA 1UURA 4YGEB 1FI5A 4AQIA 3AAKA 1K96A 2Y1NA 2MLFC 4PCWA 4CIDA 1ZOTB 1B1GA 3GOFA 2L4IA 4CFQA 4MZKA 3D0YB 1DJWA 4BY4A 2JNXA 2Y4QA 3ZWHA 5AXIA 5KSZA 3EVRA 2K0JA 2BKIB 2G9BA 5D69A 5JOLA 2BCAA 1DGVA 1G4YR 5D7FA 3SG3A 1CLLA 1PK0D 3BUNB 1K2HA 4UPGA 2EHBA 2EGDA 1OMVA 2LVVA 1CB1A 2KBMA 3SG4A 1PVBA 2KBIA 1KSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NX2 A;  1JFK A;  1Y1U A;  1MQ1 A;  1TCO B;  4YGD B;  1JSA A;  3O4Y A;  4DS7 A;  3WNX B;  4XYN A;  1YRU B;  1EG4 A;  3NSI A;  5IBW A;  1R6P A;  5TNC A;  2KFH A;  3RLZ A;  1CFP A;  2L4H A;  1B9A A;  4Q04 A;  1YRT B;  1A75 B;  4M2Q A;  2M49 B;  5KTY A;  2MLE C;  1TIZ A;  2KQ6 A;  1NX1 A;  1MF8 B;  4GUK A;  2LLS A;  4GAO A;  2JXL A;  2NCP A;  1M31 A;  1RK9 A;  4ZCU A;  1G33 A;  1NPQ A;  3JVT C;  4A4C A;  1JC2 A;  2LE9 B;  2JWW A;  4JPZ B;  1BR4 B;  1K94 A;  2LLU A;  3D10 A;  1F4Q A;  1OSA A;  1LA3 A;  2SCP A;  3DD4 A;  1DGU A;  1XK4 C;  2F3Z A;  2JQ6 A;  1JFJ A;  3I5I C;  3O6B A;  1TN4 A;  1QV1 A;  4MSP A;  4XJK A;  5AAN A;  1RTP 1;  3NSL A;  2AMI A;  1LIN A;  1UHN A;  1SMG A;  3SJS A;  1OQP A;  4D1E A;  1M45 A;  2O60 A;  2KI4 C;  1DJI A;  2LMT A;  3SG6 A;  3EKJ A;  4ETO A;  1KQM C;  2KGR A;  2M3W A;  4NQG A;  4PE0 A;  1Q80 A;  2AAO A;  3DVM A;  1N65 A;  4P5O E;  1IJ6 A;  1A03 A;  1HT9 A;  3FWB A;  2LP3 A;  1IG5 A;  3TDZ A;  2JRF A;  3TZ1 A;  1XFY O;  1QV0 A;  1QLK A;  1SKT A;  2Y1M A;  3EK7 A;  2KI6 D;  2KGB C;  3NXA A;  4OV2 A;  4GNK B;  1YX7 A;  1A29 A;  1OMR A;  1NUB A;  4M2O A;  1EH2 A;  2ZRT A;  3TUY C;  2PSR A;  2LMU A;  2Y5I A;  2LAN A;  1MXL C;  4YBH B;  1JF2 A;  3LK1 A;  1SK6 D;  1AJ4 A;  2CT9 A;  5I2Q A;  2B1U A;  2F2P A;  2M9G A;  3OX6 A;  3PM8 A;  5PAL A;  1M63 B;  1MR8 A;  3PFV A;  2MJW B;  2WCB A;  5FYX A;  1S6C A;  1F54 A;  3WXA A;  1B47 A;  1EL4 A;  2CNP A;  2L50 A;  2LAP A;  4YGA A;  4CLN A;  2LVK A;  1SL9 A;  4I5K A;  3GK1 A;  3EVV A;  1RFJ A;  3EK4 A;  1K9U A;  1PVA A;  1TNP A;  3SG5 A;  1CKK A;  4JWQ A;  2M29 A;  1AUI B;  2EC6 B;  1KK8 B;  2HQ8 A;  2OTG C;  1CTR A;  1DTL A;  2HET A;  3EVU A;  4R1E A;  3I5G B;  4GGF C;  1J55 A;  4GBA A;  3SIB A;  3BYA A;  2OS8 C;  3DVE A;  5AFP A;  1TRF A;  1J7O A;  3GK4 X;  3SG2 A;  1W7I B;  1B4C A;  4YGC B;  2BBM A;  1C7V A;  2GGZ A;  1XFW O;  4C0K A;  1CDM A;  2K7O A;  1D1O A;  2MHH A;  1BU3 A;  1XFX O;  4NDD A;  2K7C A;  1DJG A;  4XJK B;  2H61 C;  1K9K A;  2KNE A;  2K2A A;  3A4U B;  1SRA A;  2BKH B;  2LUX A;  3E3R A;  4CPV A;  1IGV A;  2LV7 A;  5F6T A;  4QJ4 B;  1IKU A;  2PVB A;  2Q91 A;  2G2B A;  1GJY A;  1V1F A;  1CMF A;  1FW4 A;  2FJU B;  2H2K A;  1F8H A;  1BG1 A;  1MXE A;  1SCM C;  2LNK A;  1L2O C;  2K61 A;  1DMO A;  1MHO A;  1EG3 A;  1QS7 A;  2BCX A;  2AUC A;  4MZJ A;  4QJ3 B;  4NDB A;  1OZS A;  2CXJ A;  3WHU B;  5HLV A;  4ORB B;  1N2D A;  2LUC A;  3CR4 X;  1A4P A;  1QAS A;  3JVT B;  2KAY A;  1AK8 A;  2O5G A;  3I5F C;  2F2O A;  3LK0 A;  5I2L A;  1EJ3 A;  2L0P A;  3I5I B;  3QRX A;  2JTZ A;  4BY5 A;  1FPW A;  2GV5 A;  2L2E A;  5CSF A;  4YGB B;  5DKN A;  5HKY A;  3I5H B;  4OR9 B;  1JUO A;  4N1F A;  1XFV O;  4AOM A;  2JNF A;  1MUX A;  4GPL B;  4I5J A;  5CSI A;  1Y6W A;  2FCE A;  1UUS A;  1UP5 A;  1YUR A;  3BUM B;  1J1E A;  2ZN8 A;  1ALV A;  2LM5 A;  1J7R A;  2CTN A;  1C07 A;  4GGN A;  1NIW A;  2JXC A;  2TN4 A;  3VRP A;  2BL0 C;  1NP8 A;  1SL8 A;  1FF1 A;  2WC8 A;  1YUS A;  2Q4U A;  4MLW A;  1YVH A;  2NCO A;  3ZNI A;  3JTD B;  1NCX A;  1PAL A;  3KF9 A;  3VRR A;  1PUL A;  1KQV A;  1XVJ A;  2LC5 A;  2F8P A;  3ICB A;  5J3X A;  1YVL A;  1QAT A;  1BT6 A;  4MZL A;  1LVC D;  2SAS A;  1ODB A;  3AKB A;  4WRI A;  1SR6 B;  3DVJ A;  1AVS A;  1KWO C;  5HLO A;  2JPT A;  2I7A A;  2JTT A;  1LXF C;  3NSK A;  1QJT A;  1UHK A;  4FTG A;  4I5L B;  3FIA A;  5K89 A;  2OPO A;  3PLF B;  3PN7 C;  2JT0 A;  1YUT A;  1XO5 A;  4CFR A;  5B8I B;  2OTG B;  3AKA A;  2HQW A;  1U5I A;  2LVJ A;  1SL7 A;  5I8N A;  1KCY A;  1S5G Z;  2NLN A;  1NCY A;  1ZFS A;  1Y1X A;  2WCF A;  1DVI A;  1YTZ C;  2LHL A;  4M2P A;  2BEC A;  3PAT A;  3IQQ A;  2JOJ A;  4F0Z B;  4HRH A;  1GGW A;  1Y1A A;  1BF5 A;  1BJF A;  1UHI A;  2KDH A;  1CDP A;  3BOW A;  2K8M B;  2NXQ A;  2ZN9 A;  3VRN A;  1DJX A;  1XK4 A;  1NX3 A;  1YX8 A;  4TNC A;  3GK2 A;  4DUQ A;  3LLE A;  1TTX A;  1F70 A;  1B8L A;  2GGM A;  2M0R A;  3BXK A;  1KFU S;  3KHE A;  2E30 A;  2JUL A;  1S6J A;  2L98 A;  2CCM A;  3SG7 A;  1OE9 B;  1QX7 A;  2KAX A;  1L2O B;  5CSJ A;  3OB2 B;  4NDC A;  1BOD A;  1QIV A;  3PSR A;  1DJY A;  2MAZ A;  1SY9 A;  2M8U A;  1A2X A;  3OHM B;  1W7J B;  5CPV A;  4N5X A;  3KPX A;  1OMD A;  5AER A;  4HSZ A;  1WRK A;  1SYM A;  4DCK A;  4PAL A;  2ZRS A;  2R2I A;  3DVK A;  1RWY A;  1WY9 A;  2WOR A;  1AHR A;  2KSP A;  3I5F B;  4E68 A;  2LMV A;  1HQV A;  1CDL A;  1XYD A;  2M1U A;  3C1V A;  3DF0 A;  2PRU A;  1NX0 A;  1KFU L;  1IQ3 A;  3CR2 A;  1PSR A;  3CLN A;  1UWO A;  3WHT B;  1K9P A;  1K95 A;  1ZAC A;  1DF0 A;  4OVN F;  1SW8 A;  1C7W A;  1ZMZ A;  2A4J A;  1U5I B;  1BOC A;  3TDU A;  1WLZ A;  1IH0 A;  2JC2 A;  2I2R E;  1EXR A;  1IWQ A;  1F55 A;  4PE4 A;  3TDI A;  4GGF A;  4HRG A;  3A8R A;  3BUW B;  1YUU A;  2BL0 B;  1KK7 Z;  2KHN A;  4MRX A;  1QLS A;  2MA2 A;  1M46 A;  1OOJ A;  3VRQ A;  2JT8 A;  1RRO A;  3BOW B;  3LL8 B;  2EC6 C;  1KK8 C;  1J7P A;  4FQO A;  3MSE B;  3I5G C;  4MRY A;  4ORC B;  4PE7 A;  2WND A;  1BR1 B;  1S5G Y;  1SNL A;  4U8D A;  1JBA A;  2H61 A;  1B8C A;  2NZ0 A;  3VRO A;  2E6W A;  2F33 A;  4C0L A;  1DJZ A;  1M39 A;  2KFG A;  4OKH A;  1L7Z A;  5CSN A;  2M1K B;  1J1D A;  1KWO B;  3K21 A;  2HPS A;  1LA0 A;  2KI4 B;  3BUO B;  1S36 A;  1KQM B;  1OZO A;  3OB1 B;  4ORA B;  2V53 A;  2KYC A;  4PHK A;  1G8I A;  1BMO A;  2M97 A;  1WDC C;  1F4O A;  2BE4 A;  3PN7 B;  1IJ5 A;  3TS5 C;  2L51 A;  4AQJ A;  5DKR A;  2BBN A;  2K2F A;  3HCM A;  3VGO A;  2FOT A;  3O78 A;  1CLM A;  3KO0 A;  4ICB A;  1NWD A;  2COL B;  3IF7 A;  3KEV A;  1B7T Z;  1N0Y A;  1GQM A;  1E8A A;  1CDN A;  3TUY B;  2LVI A;  1K90 D;  1S3P A;  3BUX B;  4C0J A;  3O2P A;  1B8R A;  1IQ5 A;  1K8U A;  1DT7 B;  3DF0 B;  1NSH A;  4MBE A;  5I2O A;  1S6I A;  4YRU A;  1CM4 A;  2FCD A;  2P6B B;  2ZFD A;  1QVI Z;  1JF0 A;  1SCV A;  1CMG A;  2VRG A;  3OP0 A;  2K7D A;  1DF0 B;  1WLM A;  1ZUZ A;  1QX5 B;  3BQ3 A;  1UHJ A;  2LP2 A;  1SPY A;  2PAS A;  4WQ2 A;  1IRJ A;  2MRD A;  1KFX S;  2WOS A;  4JQ0 D;  4HRE E;  2OS8 B;  1JWD A;  3I5H C;  3CGA A;  1PRW A;  2RGI A;  3AAJ A;  2F3Y A;  4DRW A;  3F45 A;  5KU1 A;  4GFT A;  1REC A;  1Y0V H;  3HX4 A;  4YI9 A;  1AP4 A;  1CFD A;  1H8B A;  3EK8 A;  1BLQ A;  5BPJ A;  3LCP C;  4A4B A;  2KOT A;  3H4S E;  1TCF A;  1NYA A;  5ER5 A;  1F71 A;  2JT3 A;  4PDZ A;  1VRK A;  1TNW A;  1H4B A;  2KI6 C;  4USL A;  4PHN A;  1KK7 Y;  4I5N B;  2I94 A;  2JZI A;  2KYF A;  1V1G A;  3D0Y A;  3NSO A;  3RM1 A;  1X02 A;  2PMY A;  4PE1 A;  1TOP A;  2KQY A;  1CNP A;  2HF5 A;  3JTD C;  1QX2 A;  1DJH A;  1RJV A;  1SCM B;  4L9M A;  2ZND A;  1SBJ A;  2D8N A;  1XA5 A;  3CWG A;  2MBX A;  2M7N A;  1KFX L;  1XFU O;  2M7L A;  2QPT A;  1GGZ A;  1SR6 C;  4PHJ A;  3CTN A;  3PAL A;  2QAC A;  2CBL A;  5G08 A;  3CZT X;  1KSM A;  1TNX A;  3EKH A;  4MN0 A;  1CFF A;  3FS7 A;  2KFF A;  5DKQ A;  1PSB A;  1AJ5 A;  1CLB A;  3CS1 A;  2ISD A;  1J7Q A;  1A75 A;  1CFC A;  4YI8 A;  1QIW A;  5HKZ A;  3FWC A;  1WRZ A;  5ER4 X;  1YR5 A;  4QJ5 B;  4PHM A;  2LHI A;  1B7T Y;  1MWN A;  5HYD A;  4MEW A;  1K93 D;  1UHH A;  1QTX A;  2ZNE A;  4N1G A;  2PAL A;  2LLT A;  3CR5 X;  2L5X B;  1LKJ A;  4MVF A;  1S1E A;  2ZKM X;  4P2Y B;  1FBV A;  2BE6 A;  2LCP A;  3IQO A;  2WCE A;  4ZCV A;  1WDC B;  4IL1 A;  2BCB A;  1QVI Y;  3TS5 B;  2JU0 A;  2KAV A;  4OCI A;  5GQQ C;  2I18 A;  2IS9 A;  3M0W A;  5HKW A;  4DIR A;  1NCZ A;  1S26 D;  2K7B A;  4WQ3 A;  5AEQ A;  1QXP A;  1XFZ O;  1ALW A;  1CM1 A;  3OX5 A;  1R2U A;  5JJG A;  3SIA A;  1TNQ A;  1FI6 A;  1WRL A;  2DOQ A;  1UUR A;  4YGE B;  1FI5 A;  4AQI A;  3AAK A;  1K96 A;  2Y1N A;  2MLF C;  4PCW A;  4CID A;  1ZOT B;  1B1G A;  3GOF A;  2L4I A;  4CFQ A;  4MZK A;  3D0Y B;  1DJW A;  4BY4 A;  2JNX A;  2Y4Q A;  3ZWH A;  5AXI A;  5KSZ A;  3EVR A;  2K0J A;  2BKI B;  2G9B A;  5D69 A;  5JOL A;  2BCA A;  1DGV A;  1G4Y R;  5D7F A;  3SG3 A;  1CLL A;  1PK0 D;  3BUN B;  1K2H A;  4UPG A;  2EHB A;  2EGD A;  1OMV A;  2LVV A;  1CB1 A;  2KBM A;  3SG4 A;  1PVB A;  2KBI A;  1KSO A; 
#chains in the Genus database with same CATH topology
 1DEK A;  1NX2 A;  5D3O A;  1JFK A;  1Y1U A;  1MQ1 A;  1TCO B;  4YGD B;  2WCK A;  3O4Y A;  1JSA A;  4DS7 A;  3WNX B;  4XYN A;  1YRU B;  1EG4 A;  1ORG A;  3NSI A;  3V2L A;  3B87 A;  5IBW A;  1R6P A;  5TNC A;  1OW4 A;  2QEH A;  2KFH A;  3RLZ A;  1CFP A;  2L4H A;  1GM0 A;  1B9A A;  4Q04 A;  1YRT B;  1A75 B;  4M2Q A;  2M49 B;  5KTY A;  2MLE C;  1TIZ A;  2WCH A;  2KQ6 A;  3SS5 A;  1NX1 A;  1MF8 B;  3CZ0 A;  4GUK A;  2LLS A;  4GAO A;  2JXL A;  2NCP A;  1M31 A;  1RK9 A;  4ZCU A;  1G33 A;  1NPQ A;  3JVT C;  4A4C A;  1JC2 A;  3CAB A;  3UNW A;  2LE9 B;  2JWW A;  4JPZ B;  1BR4 B;  1K94 A;  2LLU A;  3D10 A;  1F4Q A;  1OSA A;  1LA3 A;  3S0A A;  3DYE A;  2SCP A;  3DD4 A;  1DGU A;  1XK4 C;  2F3Z A;  2JQ6 A;  1JFJ A;  3I5I C;  3O6B A;  1TN4 A;  1QV1 A;  4MSP A;  4XJK A;  4USL A;  5AAN A;  2WC6 A;  1RTP 1;  3D75 A;  2AMI A;  1LIN A;  1QWV A;  1UHN A;  3NSL A;  1SMG A;  2QEB A;  3S0B A;  3PM2 A;  1XFR A;  1OQP A;  3SJS A;  4D1E A;  1M45 A;  2O60 A;  2KI4 C;  1DJI A;  2LMT A;  1W9Z A;  3SG6 A;  3BJH A;  3EKJ A;  4ETO A;  1KQM C;  2KGR A;  5DIC A;  2M3W A;  4NQG A;  4PE0 A;  1Q80 A;  2AAO A;  3DVM A;  1N65 A;  4P5O E;  4PT1 A;  1IJ6 A;  1A03 A;  1HT9 A;  3FWB A;  2LP3 A;  1IG5 A;  3TDZ A;  2JRF A;  3TZ1 A;  1XFY O;  1QV0 A;  1QLK A;  1SKT A;  2Y1M A;  3EK7 A;  2KI6 D;  2KGB C;  3NXA A;  4OV2 A;  4GNK B;  1YX7 A;  2KPH A;  3B88 A;  1A29 A;  1OMR A;  1NUB A;  3CDN A;  4M2O A;  1EH2 A;  2ZRT A;  3TUY C;  2PSR A;  2LMU A;  2Y5I A;  2LAN A;  1MXL C;  4YBH B;  1JF2 A;  3LK1 A;  1SK6 D;  1AJ4 A;  2CT9 A;  5I2Q A;  2B1U A;  2F2P A;  2M9G A;  3OX6 A;  3PM8 A;  5PAL A;  1M63 B;  1MR8 A;  3IVT A;  3PFV A;  2MJW B;  2WCB A;  5FYX A;  1S6C A;  1F54 A;  3WXA A;  1B47 A;  1EL4 A;  2CNP A;  2L50 A;  2LAP A;  3R72 A;  4YGA A;  3OGN A;  4CLN A;  2LVK A;  3NHI A;  1SL9 A;  4I5K A;  3GK1 A;  3EVV A;  1RFJ A;  3EK4 A;  1K9U A;  1PVA A;  1TNP A;  3SG5 A;  1CKK A;  4JWQ A;  2M29 A;  1AUI B;  2EC6 B;  1KK8 B;  2HQ8 A;  2OTG C;  1CTR A;  1DTL A;  2HET A;  3EVU A;  4R1E A;  3I5G B;  4GGF C;  1J55 A;  4GBA A;  3SIB A;  3BYA A;  2OS8 C;  3DVE A;  5AFP A;  1TRF A;  1J7O A;  3GK4 X;  3SG2 A;  1W7I B;  3BFA A;  3K1E A;  1B4C A;  4OZD A;  4YGC B;  2BBM A;  1C7V A;  2QEV A;  2GGZ A;  1XFW O;  4C0K A;  1CDM A;  2K7O A;  1D1O A;  2MHH A;  1BU3 A;  1XFX O;  4NDD A;  2K7C A;  1DJG A;  3BFH A;  4IJ7 A;  4XJK B;  2H61 C;  1K9K A;  2KNE A;  2K2A A;  3A4U B;  1SRA A;  2BKH B;  2LUX A;  3E3R A;  2PYQ A;  4CPV A;  1IGV A;  2LV7 A;  5F6T A;  4QJ4 B;  1IKU A;  2PVB A;  2Q91 A;  2G2B A;  1GJY A;  1V1F A;  1CMF A;  1FW4 A;  2FJU B;  2H2K A;  1F8H A;  1BG1 A;  1MXE A;  1SCM C;  4INW A;  2LNK A;  1L2O C;  3EG5 B;  2K61 A;  1DMO A;  4JD9 A;  1MHO A;  1EG3 A;  1QS7 A;  2BCX A;  2AUC A;  4MZJ A;  1LS8 A;  4QJ3 B;  4NDB A;  1OZS A;  2CXJ A;  3WHU B;  5HLV A;  3B7A A;  4ORB B;  1N2D A;  2LUC A;  3CR4 X;  1A4P A;  2YGU A;  1QAS A;  3JVT B;  2KAY A;  1AK8 A;  2O5G A;  3I5F C;  2F2O A;  3LK0 A;  2FJY A;  5I2L A;  1EJ3 A;  2L0P A;  3I5I B;  3QRX A;  1Z4H A;  2JTZ A;  4BY5 A;  1FPW A;  2GV5 A;  2L2E A;  5CSF A;  4YGB B;  5DKN A;  5HKY A;  3I5H B;  4OR9 B;  1JUO A;  4N1F A;  1XFV O;  4AOM A;  2JNF A;  1MUX A;  4GPL B;  4I5J A;  5CSI A;  1Y6W A;  2FCE A;  1UUS A;  1P28 A;  1UP5 A;  1YUR A;  1J1E A;  3BUM B;  2ZN8 A;  1ALV A;  2LM5 A;  1J7R A;  2CTN A;  1C07 A;  4GGN A;  1NIW A;  2JXC A;  2TN4 A;  3VRP A;  2BL0 C;  1NP8 A;  1SL8 A;  1FF1 A;  3BFB A;  2WC8 A;  1YUS A;  2Q4U A;  1IIO A;  4MLW A;  1YVH A;  2NCO A;  3ZNI A;  1TUZ A;  3JTD B;  1NCX A;  3B86 A;  1PAL A;  3KF9 A;  3VRR A;  1PUL A;  1KQV A;  1DQE A;  1XVJ A;  2LC5 A;  2F8P A;  3ICB A;  5J3X A;  1YVL A;  1QAT A;  1BT6 A;  4MZL A;  1LVC D;  2SAS A;  1ODB A;  3AKB A;  4WRI A;  1SR6 B;  3DVJ A;  1AVS A;  1KWO C;  5HLO A;  2JPT A;  2I7A A;  2JTT A;  1TUJ A;  1LXF C;  3NSK A;  1QJT A;  1UHK A;  3CZ2 A;  3R1P A;  4FTG A;  2WCJ A;  3FIA A;  2OPO A;  4I5L B;  5K89 A;  3PLF B;  3PN7 C;  1OOH A;  2JT0 A;  1YUT A;  1XO5 A;  5I94 A;  4CFR A;  5B8I B;  2OTG B;  3AKA A;  2HQW A;  1U5I A;  2LVJ A;  1SL7 A;  5I8N A;  1KCY A;  1S5G Z;  2NLN A;  1NCY A;  1ZFS A;  1Y1X A;  2WCF A;  1DVI A;  1YTZ C;  2LHL A;  4M2P A;  2BEC A;  3VB1 A;  3PAT A;  3IQQ A;  2JOJ A;  4F0Z B;  4HRH A;  1GGW A;  1Y1A A;  1BF5 A;  1BJF A;  1UHI A;  2KDH A;  1CDP A;  3BOW A;  2K8M B;  2NXQ A;  2ZN9 A;  3NGV A;  3VRN A;  4F7F A;  1DJX A;  1XK4 A;  1NX3 A;  5HL1 A;  1YX8 A;  2K60 A;  4TNC A;  3GK2 A;  4DUQ A;  3LLE A;  3DXL A;  4INX A;  2ERB A;  1TTX A;  1F70 A;  1B8L A;  2GGM A;  2M0R A;  3BXK A;  1TWO A;  1KFU S;  3KHE A;  2E30 A;  2JUL A;  1S6J A;  2L98 A;  2CCM A;  3SG7 A;  1OE9 B;  1QX7 A;  2KAX A;  3QME A;  1L2O B;  2PQL A;  5CSJ A;  3OB2 B;  4NDC A;  1BOD A;  1QIV A;  3PSR A;  1DJY A;  2MAZ A;  1SY9 A;  2M8U A;  1A2X A;  3OHM B;  1W7J B;  5CPV A;  4N5X A;  3D76 A;  3KPX A;  1OMD A;  5AER A;  4HSZ A;  1WRK A;  1OOI X;  1SYM A;  4DCK A;  4PAL A;  2ZRS A;  2R2I A;  3DVK A;  3SS3 A;  1RWY A;  1WY9 A;  3D77 A;  3FE8 A;  3S0D A;  2WOR A;  3FE6 A;  1AHR A;  2KSP A;  3I5F B;  4E68 A;  2LMV A;  1CDL A;  1HQV A;  2BNX A;  1XYD A;  2M1U A;  3C1V A;  3DF0 A;  2PRU A;  1NX0 A;  1KFU L;  1IQ3 A;  3CR2 A;  1PSR A;  3CLN A;  1UWO A;  2QEO A;  1K9P A;  3WHT B;  1K95 A;  1ZAC A;  1DF0 A;  4OVN F;  1SW8 A;  1C7W A;  1ZMZ A;  2A4J A;  1U5I B;  1BOC A;  3TDU A;  1WLZ A;  1IH0 A;  2JC2 A;  2I2R E;  1EXR A;  1IWQ A;  3N7H A;  1F55 A;  4PE4 A;  3TDI A;  4GGF A;  4HRG A;  3A8R A;  1C3Z A;  3BUW B;  1YUU A;  2BL0 B;  1KK7 Z;  2KHN A;  4MRX A;  1QLS A;  2MA2 A;  3B6X A;  1M46 A;  1OOJ A;  3VRQ A;  2JT8 A;  3RM1 A;  1RRO A;  3BOW B;  3LL8 B;  2EC6 C;  1KK8 C;  1J7P A;  1OOF A;  4FQO A;  3MSE B;  1OOG A;  3I5G C;  4MRY A;  4ORC B;  4PE7 A;  2WND A;  1BR1 B;  1S5G Y;  1SNL A;  3L4L A;  4U8D A;  5FI6 A;  1JBA A;  2H61 A;  1B8C A;  2NZ0 A;  3VRO A;  2E6W A;  2F33 A;  4C0L A;  2WCM A;  1DJZ A;  3S0G A;  1M39 A;  2KFG A;  4OKH A;  1L7Z A;  5CSN A;  2M1K B;  1J1D A;  1KWO B;  3K21 A;  2HPS A;  1LA0 A;  2GTE A;  2KI4 B;  3BUO B;  1S36 A;  1KQM B;  1OZO A;  3OB1 B;  4ORA B;  2V53 A;  2KYC A;  4PHK A;  1G8I A;  1BMO A;  2M97 A;  3R1V A;  1WDC C;  1F4O A;  2BE4 A;  3PN7 B;  1IJ5 A;  3TS5 C;  2L51 A;  2BAP A;  4AQJ A;  5DKR A;  2BBN A;  2K2F A;  3HCM A;  3VGO A;  3D78 A;  2FOT A;  3O78 A;  1CLM A;  3KO0 A;  4ICB A;  1NWD A;  2COL B;  3IF7 A;  3KEV A;  1B7T Z;  1N0Y A;  5FI7 A;  5FI2 A;  1GQM A;  1E8A A;  1CDN A;  3TUY B;  2LVI A;  3D73 A;  1K90 D;  1S3P A;  3BUX B;  4C0J A;  3O2P A;  1B8R A;  1IQ5 A;  1K8U A;  1DT7 B;  3DF0 B;  1NSH A;  4MBE A;  5I2O A;  1S6I A;  4YRU A;  1CM4 A;  2FCD A;  2P6B B;  2ZFD A;  1QVI Z;  1JF0 A;  1SCV A;  2L5Y A;  1CMG A;  2VRG A;  3OP0 A;  3RZS A;  2K7D A;  1DF0 B;  1WLM A;  1ZUZ A;  3L4A A;  1QX5 B;  3BQ3 A;  1UHJ A;  3D74 A;  2LP2 A;  1SPY A;  2PAS A;  4WQ2 A;  4KYN A;  3S0F A;  1IRJ A;  2MRD A;  1KFX S;  2WOS A;  4JQ0 D;  4HRE E;  2OS8 B;  1JWD A;  3I5H C;  3CGA A;  2WC5 A;  1PRW A;  2RGI A;  3AAJ A;  2F3Y A;  4DRW A;  3F45 A;  5KU1 A;  3CZ1 A;  4GFT A;  1REC A;  1Y0V H;  3HX4 A;  4YI9 A;  1AP4 A;  1CFD A;  1H8B A;  2WCL A;  3EK8 A;  5BPJ A;  3LCP C;  1BLQ A;  4A4B A;  2KOT A;  3H4S E;  1TCF A;  1NYA A;  5ER5 A;  1T14 A;  1F71 A;  2JT3 A;  4PDZ A;  1VRK A;  1TNW A;  4FQT A;  1H4B A;  3SS4 A;  2KI6 C;  3DZT A;  4PHN A;  1KK7 Y;  4I5N B;  2I94 A;  2JZI A;  2KYF A;  1V1G A;  3D0Y A;  3DY9 A;  2H8V A;  1X02 A;  2PMY A;  3NSO A;  4PE1 A;  1TOP A;  2KQY A;  1CNP A;  2HF5 A;  1C3Y A;  3JTD C;  1QX2 A;  1DJH A;  1RJV A;  1SCM B;  3Q8I A;  5EL2 A;  4L9M A;  2ZND A;  1SBJ A;  2D8N A;  1XA5 A;  3CWG A;  3PJI A;  2MBX A;  2M7N A;  3UO9 A;  1KFX L;  3FE9 A;  1XFU O;  2M7L A;  2QPT A;  1GGZ A;  1SR6 C;  4PHJ A;  3CTN A;  2P71 A;  3PAL A;  2QAC A;  2CBL A;  5G08 A;  2QDI A;  3CZT X;  1KSM A;  1TNX A;  3EKH A;  4MN0 A;  1CFF A;  3FS7 A;  2KFF A;  4JKT A;  1PSB A;  1AJ5 A;  5DKQ A;  1DEL A;  1CLB A;  3CS1 A;  1Z2C B;  2ISD A;  2JPO A;  1J7Q A;  1A75 A;  1CFC A;  4YI8 A;  1QIW A;  5HKZ A;  3FWC A;  1WRZ A;  5ER4 X;  1YR5 A;  4QJ5 B;  4PHM A;  2LHI A;  1B7T Y;  1MWN A;  5HYD A;  4MEW A;  1K93 D;  1UHH A;  1QTX A;  2ZNE A;  4N1G A;  2PAL A;  2LLT A;  3CR5 X;  2L5X B;  1LKJ A;  4MVF A;  1S1E A;  2ZKM X;  4P2Y B;  1FBV A;  2BE6 A;  2LCP A;  3L47 A;  2KLD A;  2KLE A;  1SSE B;  3IQO A;  2WCE A;  4ZCV A;  1WDC B;  4IL1 A;  2BCB A;  1QVI Y;  3R1O A;  3TS5 B;  2JU0 A;  2KAV A;  4OCI A;  5GQQ C;  1DC1 A;  2I18 A;  2IS9 A;  3M0W A;  5HKW A;  4DIR A;  1NCZ A;  1S26 D;  2K7B A;  4WQ3 A;  5AEQ A;  1QXP A;  1XFZ O;  1ALW A;  1CM1 A;  3OX5 A;  1R2U A;  5JJG A;  3SIA A;  1TNQ A;  1FI6 A;  1WRL A;  2DOQ A;  1UUR A;  4YGE B;  1FI5 A;  2L2C A;  4AQI A;  3AAK A;  1K96 A;  2Y1N A;  2MLF C;  4PCW A;  3S0E A;  1ZOT B;  4CID A;  3GOF A;  2L4I A;  3CYZ A;  4CFQ A;  1B1G A;  4MZK A;  3D0Y B;  1DJW A;  4BY4 A;  2JNX A;  2Y4Q A;  3ZWH A;  5AXI A;  5KSZ A;  3EVR A;  2K0J A;  2BKI B;  2G9B A;  5D69 A;  5JOL A;  1DGV A;  1G4Y R;  2BCA A;  5D7F A;  3SG3 A;  1CLL A;  1PK0 D;  3BUN B;  3O4X A;  1K2H A;  4UPG A;  2EHB A;  2EGD A;  1OMV A;  2LVV A;  2P70 A;  3NHT A;  1CB1 A;  2KBM A;  3SG4 A;  1PVB A;  3OBV A;  2KBI A;  1KSO A; 
#chains in the Genus database with same CATH homology
 1NX2 A;  1JFK A;  1Y1U A;  1MQ1 A;  1TCO B;  4YGD B;  1JSA A;  3O4Y A;  4DS7 A;  3WNX B;  4XYN A;  1YRU B;  1EG4 A;  3NSI A;  5IBW A;  1R6P A;  5TNC A;  2KFH A;  3RLZ A;  1CFP A;  2L4H A;  1B9A A;  4Q04 A;  1YRT B;  1A75 B;  4M2Q A;  2M49 B;  5KTY A;  2MLE C;  1TIZ A;  2KQ6 A;  1NX1 A;  1MF8 B;  4GUK A;  2LLS A;  4GAO A;  2JXL A;  2NCP A;  1M31 A;  1RK9 A;  4ZCU A;  1G33 A;  1NPQ A;  3JVT C;  4A4C A;  1JC2 A;  2LE9 B;  2JWW A;  4JPZ B;  1BR4 B;  1K94 A;  2LLU A;  3D10 A;  1F4Q A;  1OSA A;  1LA3 A;  2SCP A;  3DD4 A;  1DGU A;  1XK4 C;  2F3Z A;  2JQ6 A;  1JFJ A;  3I5I C;  3O6B A;  1TN4 A;  1QV1 A;  4MSP A;  4XJK A;  5AAN A;  1RTP 1;  3NSL A;  2AMI A;  1LIN A;  1UHN A;  1SMG A;  3SJS A;  1OQP A;  4D1E A;  1M45 A;  2O60 A;  2KI4 C;  1DJI A;  2LMT A;  3SG6 A;  3EKJ A;  4ETO A;  1KQM C;  2KGR A;  2M3W A;  4NQG A;  4PE0 A;  1Q80 A;  2AAO A;  3DVM A;  1N65 A;  4P5O E;  1IJ6 A;  1A03 A;  1HT9 A;  3FWB A;  2LP3 A;  1IG5 A;  3TDZ A;  2JRF A;  3TZ1 A;  1XFY O;  1QV0 A;  1QLK A;  1SKT A;  2Y1M A;  3EK7 A;  2KI6 D;  2KGB C;  3NXA A;  4OV2 A;  4GNK B;  1YX7 A;  1A29 A;  1OMR A;  1NUB A;  4M2O A;  1EH2 A;  2ZRT A;  3TUY C;  2PSR A;  2LMU A;  2Y5I A;  2LAN A;  1MXL C;  4YBH B;  1JF2 A;  3LK1 A;  1SK6 D;  1AJ4 A;  2CT9 A;  5I2Q A;  2B1U A;  2F2P A;  2M9G A;  3OX6 A;  3PM8 A;  5PAL A;  1M63 B;  1MR8 A;  3PFV A;  2MJW B;  2WCB A;  5FYX A;  1S6C A;  1F54 A;  3WXA A;  1B47 A;  1EL4 A;  2CNP A;  2L50 A;  2LAP A;  4YGA A;  4CLN A;  2LVK A;  1SL9 A;  4I5K A;  3GK1 A;  3EVV A;  1RFJ A;  3EK4 A;  1K9U A;  1PVA A;  1TNP A;  3SG5 A;  1CKK A;  4JWQ A;  2M29 A;  1AUI B;  2EC6 B;  1KK8 B;  2HQ8 A;  2OTG C;  1CTR A;  1DTL A;  2HET A;  3EVU A;  4R1E A;  3I5G B;  4GGF C;  1J55 A;  4GBA A;  3SIB A;  3BYA A;  2OS8 C;  3DVE A;  5AFP A;  1TRF A;  1J7O A;  3GK4 X;  3SG2 A;  1W7I B;  1B4C A;  4YGC B;  2BBM A;  1C7V A;  2GGZ A;  1XFW O;  4C0K A;  1CDM A;  2K7O A;  1D1O A;  2MHH A;  1BU3 A;  1XFX O;  4NDD A;  2K7C A;  1DJG A;  4XJK B;  2H61 C;  1K9K A;  2KNE A;  2K2A A;  3A4U B;  1SRA A;  2BKH B;  2LUX A;  3E3R A;  4CPV A;  1IGV A;  2LV7 A;  5F6T A;  4QJ4 B;  1IKU A;  2PVB A;  2Q91 A;  2G2B A;  1GJY A;  1V1F A;  1CMF A;  1FW4 A;  2FJU B;  2H2K A;  1F8H A;  1BG1 A;  1MXE A;  1SCM C;  2LNK A;  1L2O C;  2K61 A;  1DMO A;  1MHO A;  1EG3 A;  1QS7 A;  2BCX A;  2AUC A;  4MZJ A;  4QJ3 B;  4NDB A;  1OZS A;  2CXJ A;  3WHU B;  5HLV A;  4ORB B;  1N2D A;  2LUC A;  3CR4 X;  1A4P A;  1QAS A;  3JVT B;  2KAY A;  1AK8 A;  2O5G A;  3I5F C;  2F2O A;  3LK0 A;  5I2L A;  1EJ3 A;  2L0P A;  3I5I B;  3QRX A;  2JTZ A;  4BY5 A;  1FPW A;  2GV5 A;  2L2E A;  5CSF A;  4YGB B;  5DKN A;  5HKY A;  3I5H B;  4OR9 B;  1JUO A;  4N1F A;  1XFV O;  4AOM A;  2JNF A;  1MUX A;  4GPL B;  4I5J A;  5CSI A;  1Y6W A;  2FCE A;  1UUS A;  1UP5 A;  1YUR A;  3BUM B;  1J1E A;  2ZN8 A;  1ALV A;  2LM5 A;  1J7R A;  2CTN A;  1C07 A;  4GGN A;  1NIW A;  2JXC A;  2TN4 A;  3VRP A;  2BL0 C;  1NP8 A;  1SL8 A;  1FF1 A;  2WC8 A;  1YUS A;  2Q4U A;  4MLW A;  1YVH A;  2NCO A;  3ZNI A;  3JTD B;  1NCX A;  1PAL A;  3KF9 A;  3VRR A;  1PUL A;  1KQV A;  1XVJ A;  2LC5 A;  2F8P A;  3ICB A;  5J3X A;  1YVL A;  1QAT A;  1BT6 A;  4MZL A;  1LVC D;  2SAS A;  1ODB A;  3AKB A;  4WRI A;  1SR6 B;  3DVJ A;  1AVS A;  1KWO C;  5HLO A;  2JPT A;  2I7A A;  2JTT A;  1LXF C;  3NSK A;  1QJT A;  1UHK A;  4FTG A;  4I5L B;  3FIA A;  5K89 A;  2OPO A;  3PLF B;  3PN7 C;  2JT0 A;  1YUT A;  1XO5 A;  4CFR A;  5B8I B;  2OTG B;  3AKA A;  2HQW A;  1U5I A;  2LVJ A;  1SL7 A;  5I8N A;  1KCY A;  1S5G Z;  2NLN A;  1NCY A;  1ZFS A;  1Y1X A;  2WCF A;  1DVI A;  1YTZ C;  2LHL A;  4M2P A;  2BEC A;  3PAT A;  3IQQ A;  2JOJ A;  4F0Z B;  4HRH A;  1GGW A;  1Y1A A;  1BF5 A;  1BJF A;  1UHI A;  2KDH A;  1CDP A;  3BOW A;  2K8M B;  2NXQ A;  2ZN9 A;  3VRN A;  1DJX A;  1XK4 A;  1NX3 A;  1YX8 A;  4TNC A;  3GK2 A;  4DUQ A;  3LLE A;  1TTX A;  1F70 A;  1B8L A;  2GGM A;  2M0R A;  3BXK A;  1KFU S;  3KHE A;  2E30 A;  2JUL A;  1S6J A;  2L98 A;  2CCM A;  3SG7 A;  1OE9 B;  1QX7 A;  2KAX A;  1L2O B;  5CSJ A;  3OB2 B;  4NDC A;  1BOD A;  1QIV A;  3PSR A;  1DJY A;  2MAZ A;  1SY9 A;  2M8U A;  1A2X A;  3OHM B;  1W7J B;  5CPV A;  4N5X A;  3KPX A;  1OMD A;  5AER A;  4HSZ A;  1WRK A;  1SYM A;  4DCK A;  4PAL A;  2ZRS A;  2R2I A;  3DVK A;  1RWY A;  1WY9 A;  2WOR A;  1AHR A;  2KSP A;  3I5F B;  4E68 A;  2LMV A;  1HQV A;  1CDL A;  1XYD A;  2M1U A;  3C1V A;  3DF0 A;  2PRU A;  1NX0 A;  1KFU L;  1IQ3 A;  3CR2 A;  1PSR A;  3CLN A;  1UWO A;  3WHT B;  1K9P A;  1K95 A;  1ZAC A;  1DF0 A;  4OVN F;  1SW8 A;  1C7W A;  1ZMZ A;  2A4J A;  1U5I B;  1BOC A;  3TDU A;  1WLZ A;  1IH0 A;  2JC2 A;  2I2R E;  1EXR A;  1IWQ A;  1F55 A;  4PE4 A;  3TDI A;  4GGF A;  4HRG A;  3A8R A;  3BUW B;  1YUU A;  2BL0 B;  1KK7 Z;  2KHN A;  4MRX A;  1QLS A;  2MA2 A;  1M46 A;  1OOJ A;  3VRQ A;  2JT8 A;  1RRO A;  3BOW B;  3LL8 B;  2EC6 C;  1KK8 C;  1J7P A;  4FQO A;  3MSE B;  3I5G C;  4MRY A;  4ORC B;  4PE7 A;  2WND A;  1BR1 B;  1S5G Y;  1SNL A;  4U8D A;  1JBA A;  2H61 A;  1B8C A;  2NZ0 A;  3VRO A;  2E6W A;  2F33 A;  4C0L A;  1DJZ A;  1M39 A;  2KFG A;  4OKH A;  1L7Z A;  5CSN A;  2M1K B;  1J1D A;  1KWO B;  3K21 A;  2HPS A;  1LA0 A;  2KI4 B;  3BUO B;  1S36 A;  1KQM B;  1OZO A;  3OB1 B;  4ORA B;  2V53 A;  2KYC A;  4PHK A;  1G8I A;  1BMO A;  2M97 A;  1WDC C;  1F4O A;  2BE4 A;  3PN7 B;  1IJ5 A;  3TS5 C;  2L51 A;  4AQJ A;  5DKR A;  2BBN A;  2K2F A;  3HCM A;  3VGO A;  2FOT A;  3O78 A;  1CLM A;  3KO0 A;  4ICB A;  1NWD A;  2COL B;  3IF7 A;  3KEV A;  1B7T Z;  1N0Y A;  1GQM A;  1E8A A;  1CDN A;  3TUY B;  2LVI A;  1K90 D;  1S3P A;  3BUX B;  4C0J A;  3O2P A;  1B8R A;  1IQ5 A;  1K8U A;  1DT7 B;  3DF0 B;  1NSH A;  4MBE A;  5I2O A;  1S6I A;  4YRU A;  1CM4 A;  2FCD A;  2P6B B;  2ZFD A;  1QVI Z;  1JF0 A;  1SCV A;  1CMG A;  2VRG A;  3OP0 A;  2K7D A;  1DF0 B;  1WLM A;  1ZUZ A;  1QX5 B;  3BQ3 A;  1UHJ A;  2LP2 A;  1SPY A;  2PAS A;  4WQ2 A;  1IRJ A;  2MRD A;  1KFX S;  2WOS A;  4JQ0 D;  4HRE E;  2OS8 B;  1JWD A;  3I5H C;  3CGA A;  1PRW A;  2RGI A;  3AAJ A;  2F3Y A;  4DRW A;  3F45 A;  5KU1 A;  4GFT A;  1REC A;  1Y0V H;  3HX4 A;  4YI9 A;  1AP4 A;  1CFD A;  1H8B A;  3EK8 A;  1BLQ A;  5BPJ A;  3LCP C;  4A4B A;  2KOT A;  3H4S E;  1TCF A;  1NYA A;  5ER5 A;  1F71 A;  2JT3 A;  4PDZ A;  1VRK A;  1TNW A;  1H4B A;  2KI6 C;  4USL A;  4PHN A;  1KK7 Y;  4I5N B;  2I94 A;  2JZI A;  2KYF A;  1V1G A;  3D0Y A;  3NSO A;  3RM1 A;  1X02 A;  2PMY A;  4PE1 A;  1TOP A;  2KQY A;  1CNP A;  2HF5 A;  3JTD C;  1QX2 A;  1DJH A;  1RJV A;  1SCM B;  4L9M A;  2ZND A;  1SBJ A;  2D8N A;  1XA5 A;  3CWG A;  2MBX A;  2M7N A;  1KFX L;  1XFU O;  2M7L A;  2QPT A;  1GGZ A;  1SR6 C;  4PHJ A;  3CTN A;  3PAL A;  2QAC A;  2CBL A;  5G08 A;  3CZT X;  1KSM A;  1TNX A;  3EKH A;  4MN0 A;  1CFF A;  3FS7 A;  2KFF A;  5DKQ A;  1PSB A;  1AJ5 A;  1CLB A;  3CS1 A;  2ISD A;  1J7Q A;  1A75 A;  1CFC A;  4YI8 A;  1QIW A;  5HKZ A;  3FWC A;  1WRZ A;  5ER4 X;  1YR5 A;  4QJ5 B;  4PHM A;  2LHI A;  1B7T Y;  1MWN A;  5HYD A;  4MEW A;  1K93 D;  1UHH A;  1QTX A;  2ZNE A;  4N1G A;  2PAL A;  2LLT A;  3CR5 X;  2L5X B;  1LKJ A;  4MVF A;  1S1E A;  2ZKM X;  4P2Y B;  1FBV A;  2BE6 A;  2LCP A;  3IQO A;  2WCE A;  4ZCV A;  1WDC B;  4IL1 A;  2BCB A;  1QVI Y;  3TS5 B;  2JU0 A;  2KAV A;  4OCI A;  5GQQ C;  2I18 A;  2IS9 A;  3M0W A;  5HKW A;  4DIR A;  1NCZ A;  1S26 D;  2K7B A;  4WQ3 A;  5AEQ A;  1QXP A;  1XFZ O;  1ALW A;  1CM1 A;  3OX5 A;  1R2U A;  5JJG A;  3SIA A;  1TNQ A;  1FI6 A;  1WRL A;  2DOQ A;  1UUR A;  4YGE B;  1FI5 A;  4AQI A;  3AAK A;  1K96 A;  2Y1N A;  2MLF C;  4PCW A;  4CID A;  1ZOT B;  1B1G A;  3GOF A;  2L4I A;  4CFQ A;  4MZK A;  3D0Y B;  1DJW A;  4BY4 A;  2JNX A;  2Y4Q A;  3ZWH A;  5AXI A;  5KSZ A;  3EVR A;  2K0J A;  2BKI B;  2G9B A;  5D69 A;  5JOL A;  2BCA A;  1DGV A;  1G4Y R;  5D7F A;  3SG3 A;  1CLL A;  1PK0 D;  3BUN B;  1K2H A;  4UPG A;  2EHB A;  2EGD A;  1OMV A;  2LVV A;  1CB1 A;  2KBM A;  3SG4 A;  1PVB A;  2KBI A;  1KSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...