1J7QA

Solution structure and backbone dynamics of the defunct ef-hand domain of calcium vector protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
86
structure length
86
Chain Sequence
AAPKARALGPEEKDECMKIFDIFDRNAENIAPVSDTMDMLTKLGQTYTKRETEAIMKEARGPKGDKKNIGPEEWLTLCSKWVRQDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and backbone dynamics of the defunct domain of calcium vector protein.
pubmed doi rcsb
source organism Branchiostoma lanceolatum
molecule tags Metal binding protein
molecule keywords Calcium Vector Protein
total genus 21
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2001-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j7qA00
2BKHB 4YI8A 1PALA 2JC2A 5AANA 1BJFA 1DJYA 5AFPA 1EH2A 2JTZA 2HPSA 2QPTA 2M7LA 1XFVO 2G2BA 2L4IA 2EC6B 4PHKA 3BUWB 5AERA 3H4SE 1CLMA 1UP5A 1IJ5A 2KI4C 2JZIA 2OTGC 3GK2A 3IQQA 4WRIA 1KFXL 1S6JA 1YRTB 4Q04A 2KI6D 3JTDB 3VGOA 1SL7A 3I5HB 5TNCA 3OHMB 2KFHA 4ZCVA 1SY9A 1NX2A 2H61A 1OSAA 1AJ5A 3KEVA 3I5IB 3PSRA 5ER5A 4N5XA 2L50A 4OVNF 3PATA 1V1GA 1QIWA 2BECA 1EL4A 1IQ5A 2CTNA 2KBIA 2NZ0A 4N1GA 3BQ3A 4PHMA 2F2PA 3TUYC 1N65A 2H2KA 1PRWA 1BMOA 3FWCA 2JNFA 2PALA 1PSBA 1FI5A 1TNPA 1J7RA 1L2OB 3EVRA 1XK4A 2KSPA 2ZFDA 3M0WA 4PCWA 1L7ZA 2AUCA 1SR6C 1YVLA 1AJ4A 1WY9A 2Q4UA 5D7FA 3GK1A 1A4PA 1DF0B 1M45A 2LLUA 5I2OA 1KK8C 3E3RA 2ZRSA 3FWBA 5CSFA 4YGDB 1QV1A 2KHNA 2ZKMX 2MA2A 2JU0A 3LCPC 5PALA 4C0KA 1S6IA 1PSRA 1SK6D 4I5JA 1B4CA 1S5GZ 1CDNA 2ISDA 2M1KB 3RM1A 1GJYA 2M49B 2WNDA 3CR4X 5AXIA 1KQVA 1S3PA 3LL8B 4QJ5B 2JT8A 1PULA 5ER4X 5KTYA 3KF9A 2MLFC 1WRZA 5DKRA 1Y6WA 3TS5B 2Q91A 1OOJA 1B7TY 3VRRA 2JWWA 4FQOA 1RWYA 1YURA 2K7OA 1MR8A 3O78A 2L98A 1CFPA 1BT6A 2KNEA 5GQQC 1BLQA 1IKUA 3SIBA 1J1EA 4MRYA 2JT0A 4CFQA 4GAOA 1CDLA 2JXLA 2H61C 1LA3A 4PALA 4AQJA 1TIZA 2K61A 1NP8A 1S5GY 3OX6A 1KQMC 1SBJA 3LK0A 1K94A 2LMTA 2GV5A 1CTRA 1U5IA 2KAYA 1DJHA 1WLMA 2BE6A 1H4BA 1IG5A 3KPXA 1CLBA 1YRUB 2M9GA 1UUSA 1CDPA 1KFUL 3ICBA 1DGUA 2LUXA 3WNXB 1A75B 3PALA 2FCEA 1K2HA 2IS9A 3JVTB 2L2EA 3CWGA 3FS7A 1TOPA 4CLNA 4MBEA 3NSIA 1EG3A 3VRPA 1JSAA 1YVHA 3TDZA 2LE9B 1BG1A 2PSRA 4ORBB 3OP0A 1K9KA 1KFUS 1DT7B 2CT9A 4C0JA 1F8HA 1V1FA 4PE1A 2KFGA 4PE0A 1MWNA 2FOTA 1YTZC 5CSJA 1JFJA 1ZACA 1K9PA 2HQWA 3HX4A 3I5IC 2K7BA 1IQ3A 3DVJA 2LLSA 1J1DA 4I5NB 1TNWA 1R2UA 1J7PA 2I18A 2OS8C 2KI6C 4MSPA 4XJKB 4YGAA 1JF0A 1X02A 4YGEB 1WDCC 1CNPA 3DF0A 1F4QA 3F45A 4QJ4B 2G9BA 2CXJA 2JTTA 1FPWA 3O4YA 4GGFA 1SYMA 2KAVA 2ZN8A 2LANA 3ZWHA 3TDUA 1BOCA 1HQVA 1S6CA 1QIVA 1SCMC 1KWOC 2I7AA 3D0YA 1TNXA 4NQGA 4WQ3A 1FI6A 3JVTC 1IJ6A 1ALVA 2BBMA 2FCDA 2JQ6A 2QACA 4YGBB 1KFXS 3BUMB 1XFWO 3CR5X 1A75A 2ZNEA 3EK7A 3TUYB 1XO5A 1NSHA 1GGZA 4ICBA 1ODBA 2CBLA 2WCEA 4MEWA 1WRLA 3PLFB 1YX8A 2E6WA 2WCBA 2I2RE 1DJXA 4HRHA 1B47A 4NDBA 1ZFSA 1DVIA 1N2DA 1KK7Z 4A4CA 4DCKA 1FF1A 1QTXA 3AAKA 5HKZA 5HLVA 1NX0A 2NLNA 3AKBA 1F70A 2LVJA 5IBWA 1BODA 2WCFA 4MRXA 3EVUA 1SR6B 1DJWA 1NCYA 4UPGA 1KCYA 1J7QA 2O60A 1ZMZA 1CDMA 3I5FC 2P6BB 5HKYA 2LM5A 1CM1A 1PK0D 3AAJA 1SW8A 2CNPA 1XK4C 1WLZA 2M0RA 2JT3A 1CLLA 1RJVA 1NX1A 2MAZA 4QJ3B 1BU3A 2K2AA 5CPVA 2LVKA 2K7CA 2MLEC 3AKAA 5J3XA 4I5LB 4F0ZB 1KWOB 1Y1UA 1ZOTB 3NSLA 2OTGB 1S36A 2LV7A 1S1EA 1SCVA 3I5FB 1RTP1 4N1FA 4YRUA 2KYFA 2M3WA 4MZJA 2KOTA 1NPQA 2F2OA 2LMUA 1CMFA 1JWDA 4MZLA 2JXCA 3SG7A 5AEQA 1FBVA 1RFJA 4XYNA 1XYDA 1CB1A 2LP2A 1K95A 2BCBA 1SL8A 1SKTA 4PE4A 1R6PA 2WC8A 2NCOA 2MBXA 5HLOA 1DTLA 1QJTA 5DKNA 1MQ1A 1EXRA 1AP4A 1UHKA 1YUUA 4MVFA 2PVBA 1LKJA 3OX5A 3IQOA 5JJGA 1B1GA 1QLKA 5K89A 1VRKA 1F55A 1NYAA 3RLZA 3BOWB 3NSKA 1Q80A 3BOWA 1SCMB 3LLEA 2SASA 1PVBA 1QATA 1SRAA 1YX7A 1Y1XA 2GGMA 4A4BA 2VRGA 2D8NA 1B8RA 3EVVA 4MLWA 3CGAA 4JQ0D 1YUTA 2B1UA 3CZTX 4ORCB 4PE7A 1N0YA 1MHOA 2KQ6A 3PN7C 1HT9A 2HF5A 3BUOB 5BPJA 4DS7A 2KFFA 1UHNA 4BY4A 3SIAA 1IWQA 2BCAA 1WRKA 1B9AA 2DOQA 1CFCA 3OB1B 1OQPA 1F71A 4HREE 2SCPA 2F33A 2Y5IA 1J7OA 2OS8B 1TN4A 2M7NA 1LINA 2AAOA 1UHJA 3CLNA 2JRFA 1OMDA 2KI4B 1C07A 4I5KA 2EC6C 1FW4A 3PFVA 1K90D 1UHIA 4TNCA 2LCPA 3VROA 4PHJA 4HSZA 2K8MB 4M2OA 3D10A 1W7JB 1XFXO 4OCIA 2BL0C 1KSOA 2BKIB 1J55A 2I94A 2WOSA 3SG5A 4OV2A 2KGBC 5HKWA 1JUOA 1B7TZ 2K0JA 1TTXA 5CSIA 3DVEA 1SNLA 3A4UB 1M39A 1KK8B 4XJKA 2HQ8A 1BF5A 1K93D 2MRDA 1CFFA 2F8PA 1M46A 1JBAA 3DVKA 3I5GC 1JF2A 2KAXA 5FYXA 1QX2A 5I8NA 1AUIB 1YUSA 2Y4QA 1E8AA 4GUKA 2WORA 1EJ3A 1SPYA 4GGFC 1A03A 2EGDA 5D69A 1RROA 3PN7B 2ZRTA 1LVCD 1BR4B 3A8RA 5CSNA 1KQMB 2L0PA 3CS1A 1CM4A 2LC5A 2RGIA 2K7DA 4E68A 1B8CA 4YBHB 1NWDA 4M2PA 1MXEA 1NCZA 1SMGA 1ZUZA 1JFKA 2PRUA 1IH0A 1TRFA 1ALWA 1OZOA 1QASA 2L51A 2NCPA 1IRJA 2L4HA 1QX7A 2R2IA 4GNKB 3VRNA 2CCMA 2K2FA 2LUCA 4PDZA 2M97A 1G33A 1U5IB 1XFUO 3SJSA 3WHUB 2LMVA 1KSMA 3MSEB 4CPVA 2FJUB 2KQYA 4CIDA 2KYCA 1XFYO 1GGWA 1M31A 1A29A 1DJGA 1QX5B 3BYAA 1CKKA 1OZSA 2OPOA 4ZCUA 2MJWB 4P5OE 5I2LA 4JWQA 5I2QA 4MN0A 1CMGA 1DJIA 2E30A 1JC2A 4YGCB 1A2XA 1OMVA 4D1EA 2V53A 3C1VA 3GK4X 4AQIA 1OMRA 2TN4A 5G08A 3SG4A 2LLTA 3EK4A 1Y0VH 1LXFC 3HCMA 1UWOA 2LNKA 1TCOB 3DD4A 3EK8A 5DKQA 3EKJA 3DVMA 3TDIA 4GGNA 1D1OA 1TCFA 2MHHA 4GFTA 1QS7A 2NXQA 3CTNA 3O2PA 1F54A 1UHHA 1MF8B 1H8BA 4AOMA 3IF7A 3QRXA 2KDHA 1QLSA 1MUXA 1WDCB 1LA0A 1XVJA 2L5XB 2LVVA 3BXKA 4NDDA 2F3YA 3DF0B 1RK9A 3EKHA 1EG4A 3LK1A 4DIRA 2ZNDA 2HETA 1G4YR 1BR1B 2KBMA 3I5GB 5F6TA 3SG3A 3I5HC 3WHTB 2ZN9A 1F4OA 3JTDC 1XA5A 3NSOA 1AHRA 1YR5A 1TNQA 1B8LA 4DUQA 4P2YB 2JNXA 2LP3A 3FIAA 2M8UA 1NCXA 1NUBA 4NDCA 3TZ1A 1S26D 1C7VA 1NIWA 1RECA 4U8DA 2BL0B 2LHLA 1K8UA 1K96A 4JPZB 1XFZO 2LAPA 3WXAA 4CFRA 1CFDA 3O6BA 1QXPA 1Y1AA 2BE4A 1GQMA 4PHNA 1W7IB 4DRWA 4MZKA 2Y1MA 4R1EA 3KHEA 3KO0A 3BUNB 4M2QA 2A4JA 4YI9A 2F3ZA 3TS5C 4ETOA 4GBAA 2AMIA 4BY5A 2EHBA 3D0YB 1M63B 1SL9A 2JPTA 2PASA 3BUXB 5KSZA 2GGZA 2COLB 4GPLB 1AVSA 4OR9B 4WQ2A 4OKHA 2BBNA 3SG6A 3VRQA 1DMOA 5B8IB 1KK7Y 3SG2A 3K21A 2JULA 3PM8A 1DJZA 3CR2A 1OE9B 4FTGA 5HYDA 2LVIA 4C0LA 5JOLA 3OB2B 1K9UA 1C7WA 3GOFA 1IGVA 2PMYA 1MXLC 1QVIZ 1L2OC 4HRGA 2Y1NA 1PVAA 5KU1A 1QVIY 2M1UA 2KGRA 1NX3A 1UURA 2LHIA 1AK8A 2M29A 2O5GA 1QV0A 3NXAA 4USLA 1DF0A 4L9MA 4IL1A 1G8IA 2BCXA 3ZNIA 2JOJA 4ORAB 1DGVA
chains in the Genus database with same CATH superfamily
2BKHB 4YI8A 1PALA 2JC2A 5AANA 1BJFA 1DJYA 5AFPA 1EH2A 2JTZA 2HPSA 2QPTA 3B7AA 1XFVO 1OOFA 2G2BA 2M7LA 2L4IA 2EC6B 4PHKA 3BUWB 5AERA 3H4SE 1CLMA 1UP5A 1IJ5A 1DQEA 2JZIA 2KI4C 2OTGC 3GK2A 3IQQA 1KFXL 4WRIA 1S6JA 1YRTB 4Q04A 2KI6D 3JTDB 3VGOA 1SL7A 3DY9A 3I5HB 5TNCA 3OHMB 2KFHA 2WC6A 4ZCVA 1SY9A 1NX2A 2H61A 1OSAA 1AJ5A 3KEVA 3I5IB 3PSRA 5ER5A 4N5XA 2L50A 4OVNF 3PATA 1V1GA 1QIWA 2BECA 1EL4A 1IQ5A 2CTNA 3PJIA 2FJYA 3BJHA 2KBIA 3V2LA 2NZ0A 4N1GA 3BQ3A 4PHMA 2F2PA 3TUYC 1N65A 2H2KA 1PRWA 1BMOA 3BFBA 3FWCA 2JNFA 2PALA 1PSBA 1FI5A 1TNPA 1J7RA 1L2OB 2YGUA 1XK4A 2KSPA 1XFRA 2WCHA 2ZFDA 3EVRA 3M0WA 4PCWA 1DC1A 1L7ZA 2AUCA 1SR6C 1YVLA 1AJ4A 1WY9A 2Q4UA 5D7FA 3GK1A 1A4PA 1DF0B 1M45A 2LLUA 3PM2A 5I2OA 1KK8C 3E3RA 2ZRSA 3FWBA 5CSFA 4YGDB 1QV1A 2KHNA 2ZKMX 2MA2A 3OBVA 2JU0A 2GTEA 3LCPC 3FE8A 5PALA 4C0KA 1S6IA 1PSRA 1SK6D 3CZ2A 4I5JA 5D3OA 1S5GZ 1B4CA 1CDNA 2ISDA 2M1KB 3RM1A 1GJYA 2M49B 2WNDA 3CR4X 5AXIA 1KQVA 1S3PA 3LL8B 4QJ5B 2JT8A 1PULA 5ER4X 5KTYA 3KF9A 2MLFC 1WRZA 5DKRA 1Y6WA 3TS5B 2Q91A 1OOJA 1B7TY 3CZ1A 3VRRA 2JWWA 3BFAA 4FQOA 3S0GA 1RWYA 1YURA 2K7OA 1MR8A 3O78A 2L98A 1CFPA 1BT6A 2KNEA 3O4XA 5GQQC 1BLQA 1IKUA 3SIBA 3N7HA 1J1EA 4MRYA 2JT0A 4CFQA 3D74A 1CDLA 4GAOA 2JXLA 2H61C 1LA3A 4PALA 4AQJA 1TIZA 2K61A 1NP8A 1S5GY 3D75A 3OX6A 1KQMC 1SBJA 3LK0A 1K94A 2LMTA 2GV5A 1CTRA 3S0FA 1U5IA 4F7FA 2KAYA 1DJHA 1WLMA 2BE6A 1H4BA 1IG5A 3KPXA 1CLBA 1YRUB 2M9GA 1UUSA 1CDPA 1KFUL 2KLEA 1DGUA 2LUXA 3ICBA 3WNXB 1A75B 3D78A 3PALA 2FCEA 1K2HA 2IS9A 3JVTB 2L2EA 3CWGA 2P70A 3FS7A 1OOGA 1TOPA 4CLNA 4INXA 3UNWA 3L4LA 4MBEA 3NSIA 1EG3A 3VRPA 3CABA 1JSAA 1YVHA 3TDZA 2LE9B 1BG1A 2PSRA 4ORBB 2QDIA 3OP0A 1K9KA 1KFUS 1DT7B 2CT9A 3L4AA 4C0JA 1F8HA 1V1FA 4PE1A 2KFGA 3NHIA 4PE0A 1MWNA 2FOTA 1YTZC 5CSJA 1JFJA 1ZACA 1K9PA 2HQWA 3HX4A 3QMEA 3I5IC 2K7BA 3SS5A 1IQ3A 3D77A 3DVJA 2LLSA 1J1DA 4I5NB 3DYEA 1TNWA 1R2UA 5FI2A 1J7PA 2I18A 2OS8C 2KI6C 4MSPA 4XJKB 4YGAA 1JF0A 1X02A 4YGEB 1WDCC 1CNPA 3DF0A 1F4QA 3F45A 4QJ4B 2G9BA 2CXJA 2JTTA 1FPWA 3O4YA 4GGFA 1SYMA 2KAVA 2ZN8A 2LANA 3WHTB 1T14A 3ZWHA 3TDUA 1BOCA 2ERBA 1HQVA 1S6CA 1QIVA 1SCMC 1KWOC 2I7AA 3D0YA 1DEKA 1TNXA 4NQGA 4WQ3A 1FI6A 3JVTC 1IJ6A 3R1OA 1ALVA 2BBMA 2FCDA 2JQ6A 2QACA 4YGBB 1KFXS 3BUMB 1XFWO 2QEVA 1A75A 2ZNEA 3CR5X 3EK7A 3TUYB 1XO5A 1NSHA 1GGZA 4ICBA 1GM0A 1ODBA 2CBLA 2WCEA 4MEWA 1WRLA 3PLFB 1YX8A 2E6WA 2WCBA 2I2RE 3R72A 1DJXA 4HRHA 1B47A 4NDBA 1ZFSA 1DVIA 1N2DA 1KK7Z 5FI7A 4A4CA 4DCKA 1FF1A 1QTXA 3AAKA 5HKZA 5HLVA 1NX0A 2WCMA 2JPOA 2NLNA 3AKBA 1F70A 2LVJA 5IBWA 1BODA 2WCFA 4MRXA 3EVUA 1SR6B 1DJWA 1NCYA 4UPGA 1KCYA 1Z4HA 1J7QA 2O60A 1ZMZA 1CDMA 3I5FC 2P6BB 3B87A 5HKYA 2LM5A 1CM1A 1PK0D 3AAJA 1LS8A 1SW8A 2CNPA 1XK4C 1WLZA 2M0RA 1OOHA 2JT3A 1CLLA 3R1VA 1RJVA 1NX1A 2MAZA 4QJ3B 1BU3A 2K2AA 5CPVA 2LVKA 2K7CA 2MLEC 3AKAA 5J3XA 4I5LB 4F0ZB 1KWOB 2K60A 1Y1UA 1ZOTB 3K1EA 3NSLA 2OTGB 1S36A 2BAPA 1S1EA 1SCVA 2LV7A 3I5FB 1RTP1 4N1FA 4YRUA 2KYFA 2M3WA 4MZJA 2KOTA 1NPQA 2F2OA 2LMUA 1CMFA 1JWDA 4MZLA 2JXCA 3SG7A 5AEQA 1FBVA 1RFJA 4XYNA 1XYDA 1CB1A 2LP2A 1K95A 2BCBA 1SL8A 1SKTA 4PE4A 1R6PA 2WC8A 2NCOA 2MBXA 3D73A 5HLOA 1DTLA 3S0BA 1QJTA 5DKNA 1MQ1A 1EXRA 1AP4A 1UHKA 1W9ZA 1YUUA 4MVFA 2PVBA 1LKJA 3OX5A 3EG5B 3IQOA 5JJGA 1B1GA 1QLKA 5K89A 1VRKA 1F55A 1NYAA 1ORGA 3RLZA 3BOWB 3NSKA 1Q80A 3BOWA 1SCMB 3LLEA 2SASA 1PVBA 1QATA 4JKTA 1SRAA 1YX7A 5I94A 1Y1XA 2GGMA 4A4BA 2VRGA 2D8NA 1B8RA 3EVVA 4MLWA 3CGAA 4JQ0D 2QEBA 1YUTA 2B1UA 3CZTX 4ORCB 4PE7A 1N0YA 1MHOA 2KQ6A 3FE9A 3PN7C 1HT9A 2HF5A 3BUOB 3S0DA 5BPJA 4DS7A 2KFFA 1UHNA 4BY4A 3SIAA 1IWQA 1Z2CB 3CDNA 2BCAA 1WRKA 1B9AA 2DOQA 1CFCA 3OB1B 1OQPA 1F71A 4HREE 2SCPA 2F33A 2Y5IA 1J7OA 2OS8B 1TN4A 2M7NA 1LINA 2AAOA 3L47A 1UHJA 3CLNA 2JRFA 1OMDA 2KI4B 1C07A 2PYQA 4I5KA 2EC6C 1FW4A 3PFVA 3DZTA 1K90D 1UHIA 4TNCA 2LCPA 3VROA 2BNXA 4PHJA 4HSZA 2K8MB 4M2OA 3D10A 1W7JB 1XFXO 4OCIA 2BL0C 1KSOA 2BKIB 1J55A 2I94A 2WOSA 3SG5A 4OV2A 2KGBC 5HKWA 1JUOA 1B7TZ 2K0JA 1TTXA 5CSIA 3DVEA 1SNLA 3A4UB 1M39A 1KK8B 3OGNA 4XJKA 2HQ8A 1BF5A 1K93D 2MRDA 1CFFA 2F8PA 2WCLA 2WCJA 1M46A 4INWA 1JBAA 3DVKA 3I5GC 3FE6A 1JF2A 2KAXA 5FYXA 1QX2A 4FQTA 5I8NA 1AUIB 1TWOA 4KYNA 2PQLA 1YUSA 2Y4QA 2QEHA 1E8AA 4GUKA 2WORA 1EJ3A 1SPYA 4OZDA 4GGFC 1A03A 2WCKA 2EGDA 5D69A 1RROA 3PN7B 2ZRTA 1LVCD 1BR4B 3A8RA 5CSNA 1KQMB 3UO9A 2L0PA 3CS1A 1CM4A 3SS4A 2LC5A 2RGIA 2K7DA 4E68A 3S0EA 1B8CA 4YBHB 1NWDA 4M2PA 1MXEA 1NCZA 1SMGA 1ZUZA 1JFKA 2PRUA 1IH0A 1TRFA 1ALWA 1OZOA 1QASA 2L51A 2NCPA 1IRJA 2L4HA 1QX7A 2R2IA 4GNKB 3VRNA 2CCMA 2K2FA 2LUCA 4PDZA 2M97A 1G33A 1U5IB 1XFUO 3SJSA 3WHUB 2LMVA 1KSMA 3R1PA 3MSEB 4CPVA 2FJUB 2KQYA 4CIDA 5DICA 1DELA 2KYCA 1XFYO 3NHTA 1GGWA 1M31A 1A29A 1DJGA 1QX5B 3BYAA 1CKKA 1OZSA 2OPOA 4ZCUA 2MJWB 4P5OE 5I2LA 3B86A 4JWQA 5I2QA 4MN0A 1CMGA 1DJIA 2E30A 3VB1A 4YGCB 1JC2A 1A2XA 1OMVA 3NGVA 4D1EA 2V53A 3C1VA 3GK4X 4AQIA 1OMRA 2TN4A 5G08A 3SG4A 2LLTA 3EK4A 1Y0VH 1LXFC 2KPHA 3HCMA 1UWOA 4JD9A 3SS3A 2LNKA 1TCOB 3DD4A 3EK8A 5DKQA 5HL1A 3EKJA 3DVMA 3TDIA 4GGNA 1D1OA 1TCFA 2MHHA 4GFTA 1QS7A 2NXQA 3CTNA 3O2PA 1F54A 1UHHA 1MF8B 1H8BA 4AOMA 3S0AA 3IF7A 3QRXA 1TUZA 2KDHA 1QLSA 1MUXA 1WDCB 1LA0A 1XVJA 2L5XB 2LVVA 3BXKA 4NDDA 2F3YA 3DF0B 1RK9A 3EKHA 1EG4A 3LK1A 1OOIX 4DIRA 2ZNDA 2HETA 1G4YR 1BR1B 2KBMA 3I5GB 3Q8IA 5F6TA 3I5HC 3SG3A 2ZN9A 1F4OA 3JTDC 1XA5A 3NSOA 1AHRA 5EL2A 1YR5A 1SSEB 3RZSA 1TNQA 1B8LA 4IJ7A 4P2YB 4DUQA 2JNXA 2LP3A 3FIAA 2M8UA 1NCXA 1NUBA 4NDCA 1TUJA 3TZ1A 1S26D 1C7VA 4PT1A 3IVTA 1NIWA 1RECA 5FI6A 4U8DA 1P28A 2BL0B 2LHLA 1K8UA 1K96A 4JPZB 1XFZO 2LAPA 3WXAA 4CFRA 1C3YA 1CFDA 3O6BA 1QXPA 1Y1AA 2BE4A 1GQMA 4PHNA 1W7IB 4DRWA 4MZKA 2Y1MA 3CZ0A 4R1EA 3KHEA 3KO0A 3BUNB 4M2QA 2A4JA 4YI9A 2F3ZA 3TS5C 2P71A 4ETOA 4GBAA 2AMIA 4BY5A 2EHBA 3BFHA 3D0YB 1M63B 1SL9A 3DXLA 1OW4A 2JPTA 2PASA 3BUXB 5KSZA 3B88A 2GGZA 2COLB 3CYZA 2L2CA 4GPLB 1AVSA 4OR9B 4WQ2A 1IIOA 4OKHA 2BBNA 3SG6A 3VRQA 1DMOA 5B8IB 1KK7Y 3SG2A 3K21A 2JULA 3PM8A 1DJZA 2KLDA 3CR2A 1OE9B 4FTGA 5HYDA 2LVIA 4C0LA 5JOLA 3OB2B 1K9UA 1C7WA 1QWVA 3GOFA 2QEOA 1IGVA 2L5YA 2PMYA 1MXLC 1QVIZ 1L2OC 4HRGA 2Y1NA 1PVAA 5KU1A 1QVIY 2M1UA 2KGRA 1NX3A 1UURA 2LHIA 1AK8A 2M29A 2O5GA 3D76A 1QV0A 3NXAA 4USLA 1DF0A 4L9MA 4IL1A 1G8IA 2BCXA 3ZNIA 2WC5A 2JOJA 1C3ZA 3B6XA 2H8VA 4ORAB 1DGVA
chains in the Genus database with same CATH topology
2BKHB 4YI8A 1PALA 2JC2A 5AANA 1BJFA 1DJYA 5AFPA 1EH2A 2JTZA 2HPSA 2QPTA 2M7LA 1XFVO 2G2BA 2L4IA 2EC6B 4PHKA 3BUWB 5AERA 3H4SE 1CLMA 1UP5A 1IJ5A 2KI4C 2JZIA 2OTGC 3GK2A 3IQQA 4WRIA 1KFXL 1S6JA 1YRTB 4Q04A 2KI6D 3JTDB 3VGOA 1SL7A 3I5HB 5TNCA 3OHMB 2KFHA 4ZCVA 1SY9A 1NX2A 2H61A 1OSAA 1AJ5A 3KEVA 3I5IB 3PSRA 5ER5A 4N5XA 2L50A 4OVNF 3PATA 1V1GA 1QIWA 2BECA 1EL4A 1IQ5A 2CTNA 2KBIA 2NZ0A 4N1GA 3BQ3A 4PHMA 2F2PA 3TUYC 1N65A 2H2KA 1PRWA 1BMOA 3FWCA 2JNFA 2PALA 1PSBA 1FI5A 1TNPA 1J7RA 1L2OB 3EVRA 1XK4A 2KSPA 2ZFDA 3M0WA 4PCWA 1L7ZA 2AUCA 1SR6C 1YVLA 1AJ4A 1WY9A 2Q4UA 5D7FA 3GK1A 1A4PA 1DF0B 1M45A 2LLUA 5I2OA 1KK8C 3E3RA 2ZRSA 3FWBA 5CSFA 4YGDB 1QV1A 2KHNA 2ZKMX 2MA2A 2JU0A 3LCPC 5PALA 4C0KA 1S6IA 1PSRA 1SK6D 4I5JA 1B4CA 1S5GZ 1CDNA 2ISDA 2M1KB 3RM1A 1GJYA 2M49B 2WNDA 3CR4X 5AXIA 1KQVA 1S3PA 3LL8B 4QJ5B 2JT8A 1PULA 5ER4X 5KTYA 3KF9A 2MLFC 1WRZA 5DKRA 1Y6WA 3TS5B 2Q91A 1OOJA 1B7TY 3VRRA 2JWWA 4FQOA 1RWYA 1YURA 2K7OA 1MR8A 3O78A 2L98A 1CFPA 1BT6A 2KNEA 5GQQC 1BLQA 1IKUA 3SIBA 1J1EA 4MRYA 2JT0A 4CFQA 4GAOA 1CDLA 2JXLA 2H61C 1LA3A 4PALA 4AQJA 1TIZA 2K61A 1NP8A 1S5GY 3OX6A 1KQMC 1SBJA 3LK0A 1K94A 2LMTA 2GV5A 1CTRA 1U5IA 2KAYA 1DJHA 1WLMA 2BE6A 1H4BA 1IG5A 3KPXA 1CLBA 1YRUB 2M9GA 1UUSA 1CDPA 1KFUL 3ICBA 1DGUA 2LUXA 3WNXB 1A75B 3PALA 2FCEA 1K2HA 2IS9A 3JVTB 2L2EA 3CWGA 3FS7A 1TOPA 4CLNA 4MBEA 3NSIA 1EG3A 3VRPA 1JSAA 1YVHA 3TDZA 2LE9B 1BG1A 2PSRA 4ORBB 3OP0A 1K9KA 1KFUS 1DT7B 2CT9A 4C0JA 1F8HA 1V1FA 4PE1A 2KFGA 4PE0A 1MWNA 2FOTA 1YTZC 5CSJA 1JFJA 1ZACA 1K9PA 2HQWA 3HX4A 3I5IC 2K7BA 1IQ3A 3DVJA 2LLSA 1J1DA 4I5NB 1TNWA 1R2UA 1J7PA 2I18A 2OS8C 2KI6C 4MSPA 4XJKB 4YGAA 1JF0A 1X02A 4YGEB 1WDCC 1CNPA 3DF0A 1F4QA 3F45A 4QJ4B 2G9BA 2CXJA 2JTTA 1FPWA 3O4YA 4GGFA 1SYMA 2KAVA 2ZN8A 2LANA 3ZWHA 3TDUA 1BOCA 1HQVA 1S6CA 1QIVA 1SCMC 1KWOC 2I7AA 3D0YA 1TNXA 4NQGA 4WQ3A 1FI6A 3JVTC 1IJ6A 1ALVA 2BBMA 2FCDA 2JQ6A 2QACA 4YGBB 1KFXS 3BUMB 1XFWO 3CR5X 1A75A 2ZNEA 3EK7A 3TUYB 1XO5A 1NSHA 1GGZA 4ICBA 1ODBA 2CBLA 2WCEA 4MEWA 1WRLA 3PLFB 1YX8A 2E6WA 2WCBA 2I2RE 1DJXA 4HRHA 1B47A 4NDBA 1ZFSA 1DVIA 1N2DA 1KK7Z 4A4CA 4DCKA 1FF1A 1QTXA 3AAKA 5HKZA 5HLVA 1NX0A 2NLNA 3AKBA 1F70A 2LVJA 5IBWA 1BODA 2WCFA 4MRXA 3EVUA 1SR6B 1DJWA 1NCYA 4UPGA 1KCYA 1J7QA 2O60A 1ZMZA 1CDMA 3I5FC 2P6BB 5HKYA 2LM5A 1CM1A 1PK0D 3AAJA 1SW8A 2CNPA 1XK4C 1WLZA 2M0RA 2JT3A 1CLLA 1RJVA 1NX1A 2MAZA 4QJ3B 1BU3A 2K2AA 5CPVA 2LVKA 2K7CA 2MLEC 3AKAA 5J3XA 4I5LB 4F0ZB 1KWOB 1Y1UA 1ZOTB 3NSLA 2OTGB 1S36A 2LV7A 1S1EA 1SCVA 3I5FB 1RTP1 4N1FA 4YRUA 2KYFA 2M3WA 4MZJA 2KOTA 1NPQA 2F2OA 2LMUA 1CMFA 1JWDA 4MZLA 2JXCA 3SG7A 5AEQA 1FBVA 1RFJA 4XYNA 1XYDA 1CB1A 2LP2A 1K95A 2BCBA 1SL8A 1SKTA 4PE4A 1R6PA 2WC8A 2NCOA 2MBXA 5HLOA 1DTLA 1QJTA 5DKNA 1MQ1A 1EXRA 1AP4A 1UHKA 1YUUA 4MVFA 2PVBA 1LKJA 3OX5A 3IQOA 5JJGA 1B1GA 1QLKA 5K89A 1VRKA 1F55A 1NYAA 3RLZA 3BOWB 3NSKA 1Q80A 3BOWA 1SCMB 3LLEA 2SASA 1PVBA 1QATA 1SRAA 1YX7A 1Y1XA 2GGMA 4A4BA 2VRGA 2D8NA 1B8RA 3EVVA 4MLWA 3CGAA 4JQ0D 1YUTA 2B1UA 3CZTX 4ORCB 4PE7A 1N0YA 1MHOA 2KQ6A 3PN7C 1HT9A 2HF5A 3BUOB 5BPJA 4DS7A 2KFFA 1UHNA 4BY4A 3SIAA 1IWQA 2BCAA 1WRKA 1B9AA 2DOQA 1CFCA 3OB1B 1OQPA 1F71A 4HREE 2SCPA 2F33A 2Y5IA 1J7OA 2OS8B 1TN4A 2M7NA 1LINA 2AAOA 1UHJA 3CLNA 2JRFA 1OMDA 2KI4B 1C07A 4I5KA 2EC6C 1FW4A 3PFVA 1K90D 1UHIA 4TNCA 2LCPA 3VROA 4PHJA 4HSZA 2K8MB 4M2OA 3D10A 1W7JB 1XFXO 4OCIA 2BL0C 1KSOA 2BKIB 1J55A 2I94A 2WOSA 3SG5A 4OV2A 2KGBC 5HKWA 1JUOA 1B7TZ 2K0JA 1TTXA 5CSIA 3DVEA 1SNLA 3A4UB 1M39A 1KK8B 4XJKA 2HQ8A 1BF5A 1K93D 2MRDA 1CFFA 2F8PA 1M46A 1JBAA 3DVKA 3I5GC 1JF2A 2KAXA 5FYXA 1QX2A 5I8NA 1AUIB 1YUSA 2Y4QA 1E8AA 4GUKA 2WORA 1EJ3A 1SPYA 4GGFC 1A03A 2EGDA 5D69A 1RROA 3PN7B 2ZRTA 1LVCD 1BR4B 3A8RA 5CSNA 1KQMB 2L0PA 3CS1A 1CM4A 2LC5A 2RGIA 2K7DA 4E68A 1B8CA 4YBHB 1NWDA 4M2PA 1MXEA 1NCZA 1SMGA 1ZUZA 1JFKA 2PRUA 1IH0A 1TRFA 1ALWA 1OZOA 1QASA 2L51A 2NCPA 1IRJA 2L4HA 1QX7A 2R2IA 4GNKB 3VRNA 2CCMA 2K2FA 2LUCA 4PDZA 2M97A 1G33A 1U5IB 1XFUO 3SJSA 3WHUB 2LMVA 1KSMA 3MSEB 4CPVA 2FJUB 2KQYA 4CIDA 2KYCA 1XFYO 1GGWA 1M31A 1A29A 1DJGA 1QX5B 3BYAA 1CKKA 1OZSA 2OPOA 4ZCUA 2MJWB 4P5OE 5I2LA 4JWQA 5I2QA 4MN0A 1CMGA 1DJIA 2E30A 1JC2A 4YGCB 1A2XA 1OMVA 4D1EA 2V53A 3C1VA 3GK4X 4AQIA 1OMRA 2TN4A 5G08A 3SG4A 2LLTA 3EK4A 1Y0VH 1LXFC 3HCMA 1UWOA 2LNKA 1TCOB 3DD4A 3EK8A 5DKQA 3EKJA 3DVMA 3TDIA 4GGNA 1D1OA 1TCFA 2MHHA 4GFTA 1QS7A 2NXQA 3CTNA 3O2PA 1F54A 1UHHA 1MF8B 1H8BA 4AOMA 3IF7A 3QRXA 2KDHA 1QLSA 1MUXA 1WDCB 1LA0A 1XVJA 2L5XB 2LVVA 3BXKA 4NDDA 2F3YA 3DF0B 1RK9A 3EKHA 1EG4A 3LK1A 4DIRA 2ZNDA 2HETA 1G4YR 1BR1B 2KBMA 3I5GB 5F6TA 3SG3A 3I5HC 3WHTB 2ZN9A 1F4OA 3JTDC 1XA5A 3NSOA 1AHRA 1YR5A 1TNQA 1B8LA 4DUQA 4P2YB 2JNXA 2LP3A 3FIAA 2M8UA 1NCXA 1NUBA 4NDCA 3TZ1A 1S26D 1C7VA 1NIWA 1RECA 4U8DA 2BL0B 2LHLA 1K8UA 1K96A 4JPZB 1XFZO 2LAPA 3WXAA 4CFRA 1CFDA 3O6BA 1QXPA 1Y1AA 2BE4A 1GQMA 4PHNA 1W7IB 4DRWA 4MZKA 2Y1MA 4R1EA 3KHEA 3KO0A 3BUNB 4M2QA 2A4JA 4YI9A 2F3ZA 3TS5C 4ETOA 4GBAA 2AMIA 4BY5A 2EHBA 3D0YB 1M63B 1SL9A 2JPTA 2PASA 3BUXB 5KSZA 2GGZA 2COLB 4GPLB 1AVSA 4OR9B 4WQ2A 4OKHA 2BBNA 3SG6A 3VRQA 1DMOA 5B8IB 1KK7Y 3SG2A 3K21A 2JULA 3PM8A 1DJZA 3CR2A 1OE9B 4FTGA 5HYDA 2LVIA 4C0LA 5JOLA 3OB2B 1K9UA 1C7WA 3GOFA 1IGVA 2PMYA 1MXLC 1QVIZ 1L2OC 4HRGA 2Y1NA 1PVAA 5KU1A 1QVIY 2M1UA 2KGRA 1NX3A 1UURA 2LHIA 1AK8A 2M29A 2O5GA 1QV0A 3NXAA 4USLA 1DF0A 4L9MA 4IL1A 1G8IA 2BCXA 3ZNIA 2JOJA 4ORAB 1DGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BKH B;  4YI8 A;  1PAL A;  2JC2 A;  5AAN A;  1BJF A;  1DJY A;  5AFP A;  1EH2 A;  2JTZ A;  2HPS A;  2QPT A;  2M7L A;  1XFV O;  2G2B A;  2L4I A;  2EC6 B;  4PHK A;  3BUW B;  5AER A;  3H4S E;  1CLM A;  1UP5 A;  1IJ5 A;  2KI4 C;  2JZI A;  2OTG C;  3GK2 A;  3IQQ A;  4WRI A;  1KFX L;  1S6J A;  1YRT B;  4Q04 A;  2KI6 D;  3JTD B;  3VGO A;  1SL7 A;  3I5H B;  5TNC A;  3OHM B;  2KFH A;  4ZCV A;  1SY9 A;  1NX2 A;  2H61 A;  1OSA A;  1AJ5 A;  3KEV A;  3I5I B;  3PSR A;  5ER5 A;  4N5X A;  2L50 A;  4OVN F;  3PAT A;  1V1G A;  1QIW A;  2BEC A;  1EL4 A;  1IQ5 A;  2CTN A;  2KBI A;  2NZ0 A;  4N1G A;  3BQ3 A;  4PHM A;  2F2P A;  3TUY C;  1N65 A;  2H2K A;  1PRW A;  1BMO A;  3FWC A;  2JNF A;  2PAL A;  1PSB A;  1FI5 A;  1TNP A;  1J7R A;  1L2O B;  3EVR A;  1XK4 A;  2KSP A;  2ZFD A;  3M0W A;  4PCW A;  1L7Z A;  2AUC A;  1SR6 C;  1YVL A;  1AJ4 A;  1WY9 A;  2Q4U A;  5D7F A;  3GK1 A;  1A4P A;  1DF0 B;  1M45 A;  2LLU A;  5I2O A;  1KK8 C;  3E3R A;  2ZRS A;  3FWB A;  5CSF A;  4YGD B;  1QV1 A;  2KHN A;  2ZKM X;  2MA2 A;  2JU0 A;  3LCP C;  5PAL A;  4C0K A;  1S6I A;  1PSR A;  1SK6 D;  4I5J A;  1B4C A;  1S5G Z;  1CDN A;  2ISD A;  2M1K B;  3RM1 A;  1GJY A;  2M49 B;  2WND A;  3CR4 X;  5AXI A;  1KQV A;  1S3P A;  3LL8 B;  4QJ5 B;  2JT8 A;  1PUL A;  5ER4 X;  5KTY A;  3KF9 A;  2MLF C;  1WRZ A;  5DKR A;  1Y6W A;  3TS5 B;  2Q91 A;  1OOJ A;  1B7T Y;  3VRR A;  2JWW A;  4FQO A;  1RWY A;  1YUR A;  2K7O A;  1MR8 A;  3O78 A;  2L98 A;  1CFP A;  1BT6 A;  2KNE A;  5GQQ C;  1BLQ A;  1IKU A;  3SIB A;  1J1E A;  4MRY A;  2JT0 A;  4CFQ A;  4GAO A;  1CDL A;  2JXL A;  2H61 C;  1LA3 A;  4PAL A;  4AQJ A;  1TIZ A;  2K61 A;  1NP8 A;  1S5G Y;  3OX6 A;  1KQM C;  1SBJ A;  3LK0 A;  1K94 A;  2LMT A;  2GV5 A;  1CTR A;  1U5I A;  2KAY A;  1DJH A;  1WLM A;  2BE6 A;  1H4B A;  1IG5 A;  3KPX A;  1CLB A;  1YRU B;  2M9G A;  1UUS A;  1CDP A;  1KFU L;  3ICB A;  1DGU A;  2LUX A;  3WNX B;  1A75 B;  3PAL A;  2FCE A;  1K2H A;  2IS9 A;  3JVT B;  2L2E A;  3CWG A;  3FS7 A;  1TOP A;  4CLN A;  4MBE A;  3NSI A;  1EG3 A;  3VRP A;  1JSA A;  1YVH A;  3TDZ A;  2LE9 B;  1BG1 A;  2PSR A;  4ORB B;  3OP0 A;  1K9K A;  1KFU S;  1DT7 B;  2CT9 A;  4C0J A;  1F8H A;  1V1F A;  4PE1 A;  2KFG A;  4PE0 A;  1MWN A;  2FOT A;  1YTZ C;  5CSJ A;  1JFJ A;  1ZAC A;  1K9P A;  2HQW A;  3HX4 A;  3I5I C;  2K7B A;  1IQ3 A;  3DVJ A;  2LLS A;  1J1D A;  4I5N B;  1TNW A;  1R2U A;  1J7P A;  2I18 A;  2OS8 C;  2KI6 C;  4MSP A;  4XJK B;  4YGA A;  1JF0 A;  1X02 A;  4YGE B;  1WDC C;  1CNP A;  3DF0 A;  1F4Q A;  3F45 A;  4QJ4 B;  2G9B A;  2CXJ A;  2JTT A;  1FPW A;  3O4Y A;  4GGF A;  1SYM A;  2KAV A;  2ZN8 A;  2LAN A;  3ZWH A;  3TDU A;  1BOC A;  1HQV A;  1S6C A;  1QIV A;  1SCM C;  1KWO C;  2I7A A;  3D0Y A;  1TNX A;  4NQG A;  4WQ3 A;  1FI6 A;  3JVT C;  1IJ6 A;  1ALV A;  2BBM A;  2FCD A;  2JQ6 A;  2QAC A;  4YGB B;  1KFX S;  3BUM B;  1XFW O;  3CR5 X;  1A75 A;  2ZNE A;  3EK7 A;  3TUY B;  1XO5 A;  1NSH A;  1GGZ A;  4ICB A;  1ODB A;  2CBL A;  2WCE A;  4MEW A;  1WRL A;  3PLF B;  1YX8 A;  2E6W A;  2WCB A;  2I2R E;  1DJX A;  4HRH A;  1B47 A;  4NDB A;  1ZFS A;  1DVI A;  1N2D A;  1KK7 Z;  4A4C A;  4DCK A;  1FF1 A;  1QTX A;  3AAK A;  5HKZ A;  5HLV A;  1NX0 A;  2NLN A;  3AKB A;  1F70 A;  2LVJ A;  5IBW A;  1BOD A;  2WCF A;  4MRX A;  3EVU A;  1SR6 B;  1DJW A;  1NCY A;  4UPG A;  1KCY A;  1J7Q A;  2O60 A;  1ZMZ A;  1CDM A;  3I5F C;  2P6B B;  5HKY A;  2LM5 A;  1CM1 A;  1PK0 D;  3AAJ A;  1SW8 A;  2CNP A;  1XK4 C;  1WLZ A;  2M0R A;  2JT3 A;  1CLL A;  1RJV A;  1NX1 A;  2MAZ A;  4QJ3 B;  1BU3 A;  2K2A A;  5CPV A;  2LVK A;  2K7C A;  2MLE C;  3AKA A;  5J3X A;  4I5L B;  4F0Z B;  1KWO B;  1Y1U A;  1ZOT B;  3NSL A;  2OTG B;  1S36 A;  2LV7 A;  1S1E A;  1SCV A;  3I5F B;  1RTP 1;  4N1F A;  4YRU A;  2KYF A;  2M3W A;  4MZJ A;  2KOT A;  1NPQ A;  2F2O A;  2LMU A;  1CMF A;  1JWD A;  4MZL A;  2JXC A;  3SG7 A;  5AEQ A;  1FBV A;  1RFJ A;  4XYN A;  1XYD A;  1CB1 A;  2LP2 A;  1K95 A;  2BCB A;  1SL8 A;  1SKT A;  4PE4 A;  1R6P A;  2WC8 A;  2NCO A;  2MBX A;  5HLO A;  1DTL A;  1QJT A;  5DKN A;  1MQ1 A;  1EXR A;  1AP4 A;  1UHK A;  1YUU A;  4MVF A;  2PVB A;  1LKJ A;  3OX5 A;  3IQO A;  5JJG A;  1B1G A;  1QLK A;  5K89 A;  1VRK A;  1F55 A;  1NYA A;  3RLZ A;  3BOW B;  3NSK A;  1Q80 A;  3BOW A;  1SCM B;  3LLE A;  2SAS A;  1PVB A;  1QAT A;  1SRA A;  1YX7 A;  1Y1X A;  2GGM A;  4A4B A;  2VRG A;  2D8N A;  1B8R A;  3EVV A;  4MLW A;  3CGA A;  4JQ0 D;  1YUT A;  2B1U A;  3CZT X;  4ORC B;  4PE7 A;  1N0Y A;  1MHO A;  2KQ6 A;  3PN7 C;  1HT9 A;  2HF5 A;  3BUO B;  5BPJ A;  4DS7 A;  2KFF A;  1UHN A;  4BY4 A;  3SIA A;  1IWQ A;  2BCA A;  1WRK A;  1B9A A;  2DOQ A;  1CFC A;  3OB1 B;  1OQP A;  1F71 A;  4HRE E;  2SCP A;  2F33 A;  2Y5I A;  1J7O A;  2OS8 B;  1TN4 A;  2M7N A;  1LIN A;  2AAO A;  1UHJ A;  3CLN A;  2JRF A;  1OMD A;  2KI4 B;  1C07 A;  4I5K A;  2EC6 C;  1FW4 A;  3PFV A;  1K90 D;  1UHI A;  4TNC A;  2LCP A;  3VRO A;  4PHJ A;  4HSZ A;  2K8M B;  4M2O A;  3D10 A;  1W7J B;  1XFX O;  4OCI A;  2BL0 C;  1KSO A;  2BKI B;  1J55 A;  2I94 A;  2WOS A;  3SG5 A;  4OV2 A;  2KGB C;  5HKW A;  1JUO A;  1B7T Z;  2K0J A;  1TTX A;  5CSI A;  3DVE A;  1SNL A;  3A4U B;  1M39 A;  1KK8 B;  4XJK A;  2HQ8 A;  1BF5 A;  1K93 D;  2MRD A;  1CFF A;  2F8P A;  1M46 A;  1JBA A;  3DVK A;  3I5G C;  1JF2 A;  2KAX A;  5FYX A;  1QX2 A;  5I8N A;  1AUI B;  1YUS A;  2Y4Q A;  1E8A A;  4GUK A;  2WOR A;  1EJ3 A;  1SPY A;  4GGF C;  1A03 A;  2EGD A;  5D69 A;  1RRO A;  3PN7 B;  2ZRT A;  1LVC D;  1BR4 B;  3A8R A;  5CSN A;  1KQM B;  2L0P A;  3CS1 A;  1CM4 A;  2LC5 A;  2RGI A;  2K7D A;  4E68 A;  1B8C A;  4YBH B;  1NWD A;  4M2P A;  1MXE A;  1NCZ A;  1SMG A;  1ZUZ A;  1JFK A;  2PRU A;  1IH0 A;  1TRF A;  1ALW A;  1OZO A;  1QAS A;  2L51 A;  2NCP A;  1IRJ A;  2L4H A;  1QX7 A;  2R2I A;  4GNK B;  3VRN A;  2CCM A;  2K2F A;  2LUC A;  4PDZ A;  2M97 A;  1G33 A;  1U5I B;  1XFU O;  3SJS A;  3WHU B;  2LMV A;  1KSM A;  3MSE B;  4CPV A;  2FJU B;  2KQY A;  4CID A;  2KYC A;  1XFY O;  1GGW A;  1M31 A;  1A29 A;  1DJG A;  1QX5 B;  3BYA A;  1CKK A;  1OZS A;  2OPO A;  4ZCU A;  2MJW B;  4P5O E;  5I2L A;  4JWQ A;  5I2Q A;  4MN0 A;  1CMG A;  1DJI A;  2E30 A;  1JC2 A;  4YGC B;  1A2X A;  1OMV A;  4D1E A;  2V53 A;  3C1V A;  3GK4 X;  4AQI A;  1OMR A;  2TN4 A;  5G08 A;  3SG4 A;  2LLT A;  3EK4 A;  1Y0V H;  1LXF C;  3HCM A;  1UWO A;  2LNK A;  1TCO B;  3DD4 A;  3EK8 A;  5DKQ A;  3EKJ A;  3DVM A;  3TDI A;  4GGN A;  1D1O A;  1TCF A;  2MHH A;  4GFT A;  1QS7 A;  2NXQ A;  3CTN A;  3O2P A;  1F54 A;  1UHH A;  1MF8 B;  1H8B A;  4AOM A;  3IF7 A;  3QRX A;  2KDH A;  1QLS A;  1MUX A;  1WDC B;  1LA0 A;  1XVJ A;  2L5X B;  2LVV A;  3BXK A;  4NDD A;  2F3Y A;  3DF0 B;  1RK9 A;  3EKH A;  1EG4 A;  3LK1 A;  4DIR A;  2ZND A;  2HET A;  1G4Y R;  1BR1 B;  2KBM A;  3I5G B;  5F6T A;  3SG3 A;  3I5H C;  3WHT B;  2ZN9 A;  1F4O A;  3JTD C;  1XA5 A;  3NSO A;  1AHR A;  1YR5 A;  1TNQ A;  1B8L A;  4DUQ A;  4P2Y B;  2JNX A;  2LP3 A;  3FIA A;  2M8U A;  1NCX A;  1NUB A;  4NDC A;  3TZ1 A;  1S26 D;  1C7V A;  1NIW A;  1REC A;  4U8D A;  2BL0 B;  2LHL A;  1K8U A;  1K96 A;  4JPZ B;  1XFZ O;  2LAP A;  3WXA A;  4CFR A;  1CFD A;  3O6B A;  1QXP A;  1Y1A A;  2BE4 A;  1GQM A;  4PHN A;  1W7I B;  4DRW A;  4MZK A;  2Y1M A;  4R1E A;  3KHE A;  3KO0 A;  3BUN B;  4M2Q A;  2A4J A;  4YI9 A;  2F3Z A;  3TS5 C;  4ETO A;  4GBA A;  2AMI A;  4BY5 A;  2EHB A;  3D0Y B;  1M63 B;  1SL9 A;  2JPT A;  2PAS A;  3BUX B;  5KSZ A;  2GGZ A;  2COL B;  4GPL B;  1AVS A;  4OR9 B;  4WQ2 A;  4OKH A;  2BBN A;  3SG6 A;  3VRQ A;  1DMO A;  5B8I B;  1KK7 Y;  3SG2 A;  3K21 A;  2JUL A;  3PM8 A;  1DJZ A;  3CR2 A;  1OE9 B;  4FTG A;  5HYD A;  2LVI A;  4C0L A;  5JOL A;  3OB2 B;  1K9U A;  1C7W A;  3GOF A;  1IGV A;  2PMY A;  1MXL C;  1QVI Z;  1L2O C;  4HRG A;  2Y1N A;  1PVA A;  5KU1 A;  1QVI Y;  2M1U A;  2KGR A;  1NX3 A;  1UUR A;  2LHI A;  1AK8 A;  2M29 A;  2O5G A;  1QV0 A;  3NXA A;  4USL A;  1DF0 A;  4L9M A;  4IL1 A;  1G8I A;  2BCX A;  3ZNI A;  2JOJ A;  4ORA B;  1DGV A; 
#chains in the Genus database with same CATH topology
 2BKH B;  4YI8 A;  1PAL A;  2JC2 A;  5AAN A;  1BJF A;  1DJY A;  5AFP A;  1EH2 A;  2JTZ A;  2HPS A;  2QPT A;  3B7A A;  1XFV O;  1OOF A;  2G2B A;  2M7L A;  2L4I A;  2EC6 B;  4PHK A;  3BUW B;  5AER A;  3H4S E;  1CLM A;  1UP5 A;  1IJ5 A;  1DQE A;  2JZI A;  2KI4 C;  2OTG C;  3GK2 A;  3IQQ A;  1KFX L;  4WRI A;  1S6J A;  1YRT B;  4Q04 A;  2KI6 D;  3JTD B;  3VGO A;  1SL7 A;  3DY9 A;  3I5H B;  5TNC A;  3OHM B;  2KFH A;  2WC6 A;  4ZCV A;  1SY9 A;  1NX2 A;  2H61 A;  1OSA A;  1AJ5 A;  3KEV A;  3I5I B;  3PSR A;  5ER5 A;  4N5X A;  2L50 A;  4OVN F;  3PAT A;  1V1G A;  1QIW A;  2BEC A;  1EL4 A;  1IQ5 A;  2CTN A;  3PJI A;  2FJY A;  3BJH A;  2KBI A;  3V2L A;  2NZ0 A;  4N1G A;  3BQ3 A;  4PHM A;  2F2P A;  3TUY C;  1N65 A;  2H2K A;  1PRW A;  1BMO A;  3BFB A;  3FWC A;  2JNF A;  2PAL A;  1PSB A;  1FI5 A;  1TNP A;  1J7R A;  1L2O B;  2YGU A;  1XK4 A;  2KSP A;  1XFR A;  2WCH A;  2ZFD A;  3EVR A;  3M0W A;  4PCW A;  1DC1 A;  1L7Z A;  2AUC A;  1SR6 C;  1YVL A;  1AJ4 A;  1WY9 A;  2Q4U A;  5D7F A;  3GK1 A;  1A4P A;  1DF0 B;  1M45 A;  2LLU A;  3PM2 A;  5I2O A;  1KK8 C;  3E3R A;  2ZRS A;  3FWB A;  5CSF A;  4YGD B;  1QV1 A;  2KHN A;  2ZKM X;  2MA2 A;  3OBV A;  2JU0 A;  2GTE A;  3LCP C;  3FE8 A;  5PAL A;  4C0K A;  1S6I A;  1PSR A;  1SK6 D;  3CZ2 A;  4I5J A;  5D3O A;  1S5G Z;  1B4C A;  1CDN A;  2ISD A;  2M1K B;  3RM1 A;  1GJY A;  2M49 B;  2WND A;  3CR4 X;  5AXI A;  1KQV A;  1S3P A;  3LL8 B;  4QJ5 B;  2JT8 A;  1PUL A;  5ER4 X;  5KTY A;  3KF9 A;  2MLF C;  1WRZ A;  5DKR A;  1Y6W A;  3TS5 B;  2Q91 A;  1OOJ A;  1B7T Y;  3CZ1 A;  3VRR A;  2JWW A;  3BFA A;  4FQO A;  3S0G A;  1RWY A;  1YUR A;  2K7O A;  1MR8 A;  3O78 A;  2L98 A;  1CFP A;  1BT6 A;  2KNE A;  3O4X A;  5GQQ C;  1BLQ A;  1IKU A;  3SIB A;  3N7H A;  1J1E A;  4MRY A;  2JT0 A;  4CFQ A;  3D74 A;  1CDL A;  4GAO A;  2JXL A;  2H61 C;  1LA3 A;  4PAL A;  4AQJ A;  1TIZ A;  2K61 A;  1NP8 A;  1S5G Y;  3D75 A;  3OX6 A;  1KQM C;  1SBJ A;  3LK0 A;  1K94 A;  2LMT A;  2GV5 A;  1CTR A;  3S0F A;  1U5I A;  4F7F A;  2KAY A;  1DJH A;  1WLM A;  2BE6 A;  1H4B A;  1IG5 A;  3KPX A;  1CLB A;  1YRU B;  2M9G A;  1UUS A;  1CDP A;  1KFU L;  2KLE A;  1DGU A;  2LUX A;  3ICB A;  3WNX B;  1A75 B;  3D78 A;  3PAL A;  2FCE A;  1K2H A;  2IS9 A;  3JVT B;  2L2E A;  3CWG A;  2P70 A;  3FS7 A;  1OOG A;  1TOP A;  4CLN A;  4INX A;  3UNW A;  3L4L A;  4MBE A;  3NSI A;  1EG3 A;  3VRP A;  3CAB A;  1JSA A;  1YVH A;  3TDZ A;  2LE9 B;  1BG1 A;  2PSR A;  4ORB B;  2QDI A;  3OP0 A;  1K9K A;  1KFU S;  1DT7 B;  2CT9 A;  3L4A A;  4C0J A;  1F8H A;  1V1F A;  4PE1 A;  2KFG A;  3NHI A;  4PE0 A;  1MWN A;  2FOT A;  1YTZ C;  5CSJ A;  1JFJ A;  1ZAC A;  1K9P A;  2HQW A;  3HX4 A;  3QME A;  3I5I C;  2K7B A;  3SS5 A;  1IQ3 A;  3D77 A;  3DVJ A;  2LLS A;  1J1D A;  4I5N B;  3DYE A;  1TNW A;  1R2U A;  5FI2 A;  1J7P A;  2I18 A;  2OS8 C;  2KI6 C;  4MSP A;  4XJK B;  4YGA A;  1JF0 A;  1X02 A;  4YGE B;  1WDC C;  1CNP A;  3DF0 A;  1F4Q A;  3F45 A;  4QJ4 B;  2G9B A;  2CXJ A;  2JTT A;  1FPW A;  3O4Y A;  4GGF A;  1SYM A;  2KAV A;  2ZN8 A;  2LAN A;  3WHT B;  1T14 A;  3ZWH A;  3TDU A;  1BOC A;  2ERB A;  1HQV A;  1S6C A;  1QIV A;  1SCM C;  1KWO C;  2I7A A;  3D0Y A;  1DEK A;  1TNX A;  4NQG A;  4WQ3 A;  1FI6 A;  3JVT C;  1IJ6 A;  3R1O A;  1ALV A;  2BBM A;  2FCD A;  2JQ6 A;  2QAC A;  4YGB B;  1KFX S;  3BUM B;  1XFW O;  2QEV A;  1A75 A;  2ZNE A;  3CR5 X;  3EK7 A;  3TUY B;  1XO5 A;  1NSH A;  1GGZ A;  4ICB A;  1GM0 A;  1ODB A;  2CBL A;  2WCE A;  4MEW A;  1WRL A;  3PLF B;  1YX8 A;  2E6W A;  2WCB A;  2I2R E;  3R72 A;  1DJX A;  4HRH A;  1B47 A;  4NDB A;  1ZFS A;  1DVI A;  1N2D A;  1KK7 Z;  5FI7 A;  4A4C A;  4DCK A;  1FF1 A;  1QTX A;  3AAK A;  5HKZ A;  5HLV A;  1NX0 A;  2WCM A;  2JPO A;  2NLN A;  3AKB A;  1F70 A;  2LVJ A;  5IBW A;  1BOD A;  2WCF A;  4MRX A;  3EVU A;  1SR6 B;  1DJW A;  1NCY A;  4UPG A;  1KCY A;  1Z4H A;  1J7Q A;  2O60 A;  1ZMZ A;  1CDM A;  3I5F C;  2P6B B;  3B87 A;  5HKY A;  2LM5 A;  1CM1 A;  1PK0 D;  3AAJ A;  1LS8 A;  1SW8 A;  2CNP A;  1XK4 C;  1WLZ A;  2M0R A;  1OOH A;  2JT3 A;  1CLL A;  3R1V A;  1RJV A;  1NX1 A;  2MAZ A;  4QJ3 B;  1BU3 A;  2K2A A;  5CPV A;  2LVK A;  2K7C A;  2MLE C;  3AKA A;  5J3X A;  4I5L B;  4F0Z B;  1KWO B;  2K60 A;  1Y1U A;  1ZOT B;  3K1E A;  3NSL A;  2OTG B;  1S36 A;  2BAP A;  1S1E A;  1SCV A;  2LV7 A;  3I5F B;  1RTP 1;  4N1F A;  4YRU A;  2KYF A;  2M3W A;  4MZJ A;  2KOT A;  1NPQ A;  2F2O A;  2LMU A;  1CMF A;  1JWD A;  4MZL A;  2JXC A;  3SG7 A;  5AEQ A;  1FBV A;  1RFJ A;  4XYN A;  1XYD A;  1CB1 A;  2LP2 A;  1K95 A;  2BCB A;  1SL8 A;  1SKT A;  4PE4 A;  1R6P A;  2WC8 A;  2NCO A;  2MBX A;  3D73 A;  5HLO A;  1DTL A;  3S0B A;  1QJT A;  5DKN A;  1MQ1 A;  1EXR A;  1AP4 A;  1UHK A;  1W9Z A;  1YUU A;  4MVF A;  2PVB A;  1LKJ A;  3OX5 A;  3EG5 B;  3IQO A;  5JJG A;  1B1G A;  1QLK A;  5K89 A;  1VRK A;  1F55 A;  1NYA A;  1ORG A;  3RLZ A;  3BOW B;  3NSK A;  1Q80 A;  3BOW A;  1SCM B;  3LLE A;  2SAS A;  1PVB A;  1QAT A;  4JKT A;  1SRA A;  1YX7 A;  5I94 A;  1Y1X A;  2GGM A;  4A4B A;  2VRG A;  2D8N A;  1B8R A;  3EVV A;  4MLW A;  3CGA A;  4JQ0 D;  2QEB A;  1YUT A;  2B1U A;  3CZT X;  4ORC B;  4PE7 A;  1N0Y A;  1MHO A;  2KQ6 A;  3FE9 A;  3PN7 C;  1HT9 A;  2HF5 A;  3BUO B;  3S0D A;  5BPJ A;  4DS7 A;  2KFF A;  1UHN A;  4BY4 A;  3SIA A;  1IWQ A;  1Z2C B;  3CDN A;  2BCA A;  1WRK A;  1B9A A;  2DOQ A;  1CFC A;  3OB1 B;  1OQP A;  1F71 A;  4HRE E;  2SCP A;  2F33 A;  2Y5I A;  1J7O A;  2OS8 B;  1TN4 A;  2M7N A;  1LIN A;  2AAO A;  3L47 A;  1UHJ A;  3CLN A;  2JRF A;  1OMD A;  2KI4 B;  1C07 A;  2PYQ A;  4I5K A;  2EC6 C;  1FW4 A;  3PFV A;  3DZT A;  1K90 D;  1UHI A;  4TNC A;  2LCP A;  3VRO A;  2BNX A;  4PHJ A;  4HSZ A;  2K8M B;  4M2O A;  3D10 A;  1W7J B;  1XFX O;  4OCI A;  2BL0 C;  1KSO A;  2BKI B;  1J55 A;  2I94 A;  2WOS A;  3SG5 A;  4OV2 A;  2KGB C;  5HKW A;  1JUO A;  1B7T Z;  2K0J A;  1TTX A;  5CSI A;  3DVE A;  1SNL A;  3A4U B;  1M39 A;  1KK8 B;  3OGN A;  4XJK A;  2HQ8 A;  1BF5 A;  1K93 D;  2MRD A;  1CFF A;  2F8P A;  2WCL A;  2WCJ A;  1M46 A;  4INW A;  1JBA A;  3DVK A;  3I5G C;  3FE6 A;  1JF2 A;  2KAX A;  5FYX A;  1QX2 A;  4FQT A;  5I8N A;  1AUI B;  1TWO A;  4KYN A;  2PQL A;  1YUS A;  2Y4Q A;  2QEH A;  1E8A A;  4GUK A;  2WOR A;  1EJ3 A;  1SPY A;  4OZD A;  4GGF C;  1A03 A;  2WCK A;  2EGD A;  5D69 A;  1RRO A;  3PN7 B;  2ZRT A;  1LVC D;  1BR4 B;  3A8R A;  5CSN A;  1KQM B;  3UO9 A;  2L0P A;  3CS1 A;  1CM4 A;  3SS4 A;  2LC5 A;  2RGI A;  2K7D A;  4E68 A;  3S0E A;  1B8C A;  4YBH B;  1NWD A;  4M2P A;  1MXE A;  1NCZ A;  1SMG A;  1ZUZ A;  1JFK A;  2PRU A;  1IH0 A;  1TRF A;  1ALW A;  1OZO A;  1QAS A;  2L51 A;  2NCP A;  1IRJ A;  2L4H A;  1QX7 A;  2R2I A;  4GNK B;  3VRN A;  2CCM A;  2K2F A;  2LUC A;  4PDZ A;  2M97 A;  1G33 A;  1U5I B;  1XFU O;  3SJS A;  3WHU B;  2LMV A;  1KSM A;  3R1P A;  3MSE B;  4CPV A;  2FJU B;  2KQY A;  4CID A;  5DIC A;  1DEL A;  2KYC A;  1XFY O;  3NHT A;  1GGW A;  1M31 A;  1A29 A;  1DJG A;  1QX5 B;  3BYA A;  1CKK A;  1OZS A;  2OPO A;  4ZCU A;  2MJW B;  4P5O E;  5I2L A;  3B86 A;  4JWQ A;  5I2Q A;  4MN0 A;  1CMG A;  1DJI A;  2E30 A;  3VB1 A;  4YGC B;  1JC2 A;  1A2X A;  1OMV A;  3NGV A;  4D1E A;  2V53 A;  3C1V A;  3GK4 X;  4AQI A;  1OMR A;  2TN4 A;  5G08 A;  3SG4 A;  2LLT A;  3EK4 A;  1Y0V H;  1LXF C;  2KPH A;  3HCM A;  1UWO A;  4JD9 A;  3SS3 A;  2LNK A;  1TCO B;  3DD4 A;  3EK8 A;  5DKQ A;  5HL1 A;  3EKJ A;  3DVM A;  3TDI A;  4GGN A;  1D1O A;  1TCF A;  2MHH A;  4GFT A;  1QS7 A;  2NXQ A;  3CTN A;  3O2P A;  1F54 A;  1UHH A;  1MF8 B;  1H8B A;  4AOM A;  3S0A A;  3IF7 A;  3QRX A;  1TUZ A;  2KDH A;  1QLS A;  1MUX A;  1WDC B;  1LA0 A;  1XVJ A;  2L5X B;  2LVV A;  3BXK A;  4NDD A;  2F3Y A;  3DF0 B;  1RK9 A;  3EKH A;  1EG4 A;  3LK1 A;  1OOI X;  4DIR A;  2ZND A;  2HET A;  1G4Y R;  1BR1 B;  2KBM A;  3I5G B;  3Q8I A;  5F6T A;  3I5H C;  3SG3 A;  2ZN9 A;  1F4O A;  3JTD C;  1XA5 A;  3NSO A;  1AHR A;  5EL2 A;  1YR5 A;  1SSE B;  3RZS A;  1TNQ A;  1B8L A;  4IJ7 A;  4P2Y B;  4DUQ A;  2JNX A;  2LP3 A;  3FIA A;  2M8U A;  1NCX A;  1NUB A;  4NDC A;  1TUJ A;  3TZ1 A;  1S26 D;  1C7V A;  4PT1 A;  3IVT A;  1NIW A;  1REC A;  5FI6 A;  4U8D A;  1P28 A;  2BL0 B;  2LHL A;  1K8U A;  1K96 A;  4JPZ B;  1XFZ O;  2LAP A;  3WXA A;  4CFR A;  1C3Y A;  1CFD A;  3O6B A;  1QXP A;  1Y1A A;  2BE4 A;  1GQM A;  4PHN A;  1W7I B;  4DRW A;  4MZK A;  2Y1M A;  3CZ0 A;  4R1E A;  3KHE A;  3KO0 A;  3BUN B;  4M2Q A;  2A4J A;  4YI9 A;  2F3Z A;  3TS5 C;  2P71 A;  4ETO A;  4GBA A;  2AMI A;  4BY5 A;  2EHB A;  3BFH A;  3D0Y B;  1M63 B;  1SL9 A;  3DXL A;  1OW4 A;  2JPT A;  2PAS A;  3BUX B;  5KSZ A;  3B88 A;  2GGZ A;  2COL B;  3CYZ A;  2L2C A;  4GPL B;  1AVS A;  4OR9 B;  4WQ2 A;  1IIO A;  4OKH A;  2BBN A;  3SG6 A;  3VRQ A;  1DMO A;  5B8I B;  1KK7 Y;  3SG2 A;  3K21 A;  2JUL A;  3PM8 A;  1DJZ A;  2KLD A;  3CR2 A;  1OE9 B;  4FTG A;  5HYD A;  2LVI A;  4C0L A;  5JOL A;  3OB2 B;  1K9U A;  1C7W A;  1QWV A;  3GOF A;  2QEO A;  1IGV A;  2L5Y A;  2PMY A;  1MXL C;  1QVI Z;  1L2O C;  4HRG A;  2Y1N A;  1PVA A;  5KU1 A;  1QVI Y;  2M1U A;  2KGR A;  1NX3 A;  1UUR A;  2LHI A;  1AK8 A;  2M29 A;  2O5G A;  3D76 A;  1QV0 A;  3NXA A;  4USL A;  1DF0 A;  4L9M A;  4IL1 A;  1G8I A;  2BCX A;  3ZNI A;  2WC5 A;  2JOJ A;  1C3Z A;  3B6X A;  2H8V A;  4ORA B;  1DGV A; 
#chains in the Genus database with same CATH homology
 2BKH B;  4YI8 A;  1PAL A;  2JC2 A;  5AAN A;  1BJF A;  1DJY A;  5AFP A;  1EH2 A;  2JTZ A;  2HPS A;  2QPT A;  2M7L A;  1XFV O;  2G2B A;  2L4I A;  2EC6 B;  4PHK A;  3BUW B;  5AER A;  3H4S E;  1CLM A;  1UP5 A;  1IJ5 A;  2KI4 C;  2JZI A;  2OTG C;  3GK2 A;  3IQQ A;  4WRI A;  1KFX L;  1S6J A;  1YRT B;  4Q04 A;  2KI6 D;  3JTD B;  3VGO A;  1SL7 A;  3I5H B;  5TNC A;  3OHM B;  2KFH A;  4ZCV A;  1SY9 A;  1NX2 A;  2H61 A;  1OSA A;  1AJ5 A;  3KEV A;  3I5I B;  3PSR A;  5ER5 A;  4N5X A;  2L50 A;  4OVN F;  3PAT A;  1V1G A;  1QIW A;  2BEC A;  1EL4 A;  1IQ5 A;  2CTN A;  2KBI A;  2NZ0 A;  4N1G A;  3BQ3 A;  4PHM A;  2F2P A;  3TUY C;  1N65 A;  2H2K A;  1PRW A;  1BMO A;  3FWC A;  2JNF A;  2PAL A;  1PSB A;  1FI5 A;  1TNP A;  1J7R A;  1L2O B;  3EVR A;  1XK4 A;  2KSP A;  2ZFD A;  3M0W A;  4PCW A;  1L7Z A;  2AUC A;  1SR6 C;  1YVL A;  1AJ4 A;  1WY9 A;  2Q4U A;  5D7F A;  3GK1 A;  1A4P A;  1DF0 B;  1M45 A;  2LLU A;  5I2O A;  1KK8 C;  3E3R A;  2ZRS A;  3FWB A;  5CSF A;  4YGD B;  1QV1 A;  2KHN A;  2ZKM X;  2MA2 A;  2JU0 A;  3LCP C;  5PAL A;  4C0K A;  1S6I A;  1PSR A;  1SK6 D;  4I5J A;  1B4C A;  1S5G Z;  1CDN A;  2ISD A;  2M1K B;  3RM1 A;  1GJY A;  2M49 B;  2WND A;  3CR4 X;  5AXI A;  1KQV A;  1S3P A;  3LL8 B;  4QJ5 B;  2JT8 A;  1PUL A;  5ER4 X;  5KTY A;  3KF9 A;  2MLF C;  1WRZ A;  5DKR A;  1Y6W A;  3TS5 B;  2Q91 A;  1OOJ A;  1B7T Y;  3VRR A;  2JWW A;  4FQO A;  1RWY A;  1YUR A;  2K7O A;  1MR8 A;  3O78 A;  2L98 A;  1CFP A;  1BT6 A;  2KNE A;  5GQQ C;  1BLQ A;  1IKU A;  3SIB A;  1J1E A;  4MRY A;  2JT0 A;  4CFQ A;  4GAO A;  1CDL A;  2JXL A;  2H61 C;  1LA3 A;  4PAL A;  4AQJ A;  1TIZ A;  2K61 A;  1NP8 A;  1S5G Y;  3OX6 A;  1KQM C;  1SBJ A;  3LK0 A;  1K94 A;  2LMT A;  2GV5 A;  1CTR A;  1U5I A;  2KAY A;  1DJH A;  1WLM A;  2BE6 A;  1H4B A;  1IG5 A;  3KPX A;  1CLB A;  1YRU B;  2M9G A;  1UUS A;  1CDP A;  1KFU L;  3ICB A;  1DGU A;  2LUX A;  3WNX B;  1A75 B;  3PAL A;  2FCE A;  1K2H A;  2IS9 A;  3JVT B;  2L2E A;  3CWG A;  3FS7 A;  1TOP A;  4CLN A;  4MBE A;  3NSI A;  1EG3 A;  3VRP A;  1JSA A;  1YVH A;  3TDZ A;  2LE9 B;  1BG1 A;  2PSR A;  4ORB B;  3OP0 A;  1K9K A;  1KFU S;  1DT7 B;  2CT9 A;  4C0J A;  1F8H A;  1V1F A;  4PE1 A;  2KFG A;  4PE0 A;  1MWN A;  2FOT A;  1YTZ C;  5CSJ A;  1JFJ A;  1ZAC A;  1K9P A;  2HQW A;  3HX4 A;  3I5I C;  2K7B A;  1IQ3 A;  3DVJ A;  2LLS A;  1J1D A;  4I5N B;  1TNW A;  1R2U A;  1J7P A;  2I18 A;  2OS8 C;  2KI6 C;  4MSP A;  4XJK B;  4YGA A;  1JF0 A;  1X02 A;  4YGE B;  1WDC C;  1CNP A;  3DF0 A;  1F4Q A;  3F45 A;  4QJ4 B;  2G9B A;  2CXJ A;  2JTT A;  1FPW A;  3O4Y A;  4GGF A;  1SYM A;  2KAV A;  2ZN8 A;  2LAN A;  3ZWH A;  3TDU A;  1BOC A;  1HQV A;  1S6C A;  1QIV A;  1SCM C;  1KWO C;  2I7A A;  3D0Y A;  1TNX A;  4NQG A;  4WQ3 A;  1FI6 A;  3JVT C;  1IJ6 A;  1ALV A;  2BBM A;  2FCD A;  2JQ6 A;  2QAC A;  4YGB B;  1KFX S;  3BUM B;  1XFW O;  3CR5 X;  1A75 A;  2ZNE A;  3EK7 A;  3TUY B;  1XO5 A;  1NSH A;  1GGZ A;  4ICB A;  1ODB A;  2CBL A;  2WCE A;  4MEW A;  1WRL A;  3PLF B;  1YX8 A;  2E6W A;  2WCB A;  2I2R E;  1DJX A;  4HRH A;  1B47 A;  4NDB A;  1ZFS A;  1DVI A;  1N2D A;  1KK7 Z;  4A4C A;  4DCK A;  1FF1 A;  1QTX A;  3AAK A;  5HKZ A;  5HLV A;  1NX0 A;  2NLN A;  3AKB A;  1F70 A;  2LVJ A;  5IBW A;  1BOD A;  2WCF A;  4MRX A;  3EVU A;  1SR6 B;  1DJW A;  1NCY A;  4UPG A;  1KCY A;  1J7Q A;  2O60 A;  1ZMZ A;  1CDM A;  3I5F C;  2P6B B;  5HKY A;  2LM5 A;  1CM1 A;  1PK0 D;  3AAJ A;  1SW8 A;  2CNP A;  1XK4 C;  1WLZ A;  2M0R A;  2JT3 A;  1CLL A;  1RJV A;  1NX1 A;  2MAZ A;  4QJ3 B;  1BU3 A;  2K2A A;  5CPV A;  2LVK A;  2K7C A;  2MLE C;  3AKA A;  5J3X A;  4I5L B;  4F0Z B;  1KWO B;  1Y1U A;  1ZOT B;  3NSL A;  2OTG B;  1S36 A;  2LV7 A;  1S1E A;  1SCV A;  3I5F B;  1RTP 1;  4N1F A;  4YRU A;  2KYF A;  2M3W A;  4MZJ A;  2KOT A;  1NPQ A;  2F2O A;  2LMU A;  1CMF A;  1JWD A;  4MZL A;  2JXC A;  3SG7 A;  5AEQ A;  1FBV A;  1RFJ A;  4XYN A;  1XYD A;  1CB1 A;  2LP2 A;  1K95 A;  2BCB A;  1SL8 A;  1SKT A;  4PE4 A;  1R6P A;  2WC8 A;  2NCO A;  2MBX A;  5HLO A;  1DTL A;  1QJT A;  5DKN A;  1MQ1 A;  1EXR A;  1AP4 A;  1UHK A;  1YUU A;  4MVF A;  2PVB A;  1LKJ A;  3OX5 A;  3IQO A;  5JJG A;  1B1G A;  1QLK A;  5K89 A;  1VRK A;  1F55 A;  1NYA A;  3RLZ A;  3BOW B;  3NSK A;  1Q80 A;  3BOW A;  1SCM B;  3LLE A;  2SAS A;  1PVB A;  1QAT A;  1SRA A;  1YX7 A;  1Y1X A;  2GGM A;  4A4B A;  2VRG A;  2D8N A;  1B8R A;  3EVV A;  4MLW A;  3CGA A;  4JQ0 D;  1YUT A;  2B1U A;  3CZT X;  4ORC B;  4PE7 A;  1N0Y A;  1MHO A;  2KQ6 A;  3PN7 C;  1HT9 A;  2HF5 A;  3BUO B;  5BPJ A;  4DS7 A;  2KFF A;  1UHN A;  4BY4 A;  3SIA A;  1IWQ A;  2BCA A;  1WRK A;  1B9A A;  2DOQ A;  1CFC A;  3OB1 B;  1OQP A;  1F71 A;  4HRE E;  2SCP A;  2F33 A;  2Y5I A;  1J7O A;  2OS8 B;  1TN4 A;  2M7N A;  1LIN A;  2AAO A;  1UHJ A;  3CLN A;  2JRF A;  1OMD A;  2KI4 B;  1C07 A;  4I5K A;  2EC6 C;  1FW4 A;  3PFV A;  1K90 D;  1UHI A;  4TNC A;  2LCP A;  3VRO A;  4PHJ A;  4HSZ A;  2K8M B;  4M2O A;  3D10 A;  1W7J B;  1XFX O;  4OCI A;  2BL0 C;  1KSO A;  2BKI B;  1J55 A;  2I94 A;  2WOS A;  3SG5 A;  4OV2 A;  2KGB C;  5HKW A;  1JUO A;  1B7T Z;  2K0J A;  1TTX A;  5CSI A;  3DVE A;  1SNL A;  3A4U B;  1M39 A;  1KK8 B;  4XJK A;  2HQ8 A;  1BF5 A;  1K93 D;  2MRD A;  1CFF A;  2F8P A;  1M46 A;  1JBA A;  3DVK A;  3I5G C;  1JF2 A;  2KAX A;  5FYX A;  1QX2 A;  5I8N A;  1AUI B;  1YUS A;  2Y4Q A;  1E8A A;  4GUK A;  2WOR A;  1EJ3 A;  1SPY A;  4GGF C;  1A03 A;  2EGD A;  5D69 A;  1RRO A;  3PN7 B;  2ZRT A;  1LVC D;  1BR4 B;  3A8R A;  5CSN A;  1KQM B;  2L0P A;  3CS1 A;  1CM4 A;  2LC5 A;  2RGI A;  2K7D A;  4E68 A;  1B8C A;  4YBH B;  1NWD A;  4M2P A;  1MXE A;  1NCZ A;  1SMG A;  1ZUZ A;  1JFK A;  2PRU A;  1IH0 A;  1TRF A;  1ALW A;  1OZO A;  1QAS A;  2L51 A;  2NCP A;  1IRJ A;  2L4H A;  1QX7 A;  2R2I A;  4GNK B;  3VRN A;  2CCM A;  2K2F A;  2LUC A;  4PDZ A;  2M97 A;  1G33 A;  1U5I B;  1XFU O;  3SJS A;  3WHU B;  2LMV A;  1KSM A;  3MSE B;  4CPV A;  2FJU B;  2KQY A;  4CID A;  2KYC A;  1XFY O;  1GGW A;  1M31 A;  1A29 A;  1DJG A;  1QX5 B;  3BYA A;  1CKK A;  1OZS A;  2OPO A;  4ZCU A;  2MJW B;  4P5O E;  5I2L A;  4JWQ A;  5I2Q A;  4MN0 A;  1CMG A;  1DJI A;  2E30 A;  1JC2 A;  4YGC B;  1A2X A;  1OMV A;  4D1E A;  2V53 A;  3C1V A;  3GK4 X;  4AQI A;  1OMR A;  2TN4 A;  5G08 A;  3SG4 A;  2LLT A;  3EK4 A;  1Y0V H;  1LXF C;  3HCM A;  1UWO A;  2LNK A;  1TCO B;  3DD4 A;  3EK8 A;  5DKQ A;  3EKJ A;  3DVM A;  3TDI A;  4GGN A;  1D1O A;  1TCF A;  2MHH A;  4GFT A;  1QS7 A;  2NXQ A;  3CTN A;  3O2P A;  1F54 A;  1UHH A;  1MF8 B;  1H8B A;  4AOM A;  3IF7 A;  3QRX A;  2KDH A;  1QLS A;  1MUX A;  1WDC B;  1LA0 A;  1XVJ A;  2L5X B;  2LVV A;  3BXK A;  4NDD A;  2F3Y A;  3DF0 B;  1RK9 A;  3EKH A;  1EG4 A;  3LK1 A;  4DIR A;  2ZND A;  2HET A;  1G4Y R;  1BR1 B;  2KBM A;  3I5G B;  5F6T A;  3SG3 A;  3I5H C;  3WHT B;  2ZN9 A;  1F4O A;  3JTD C;  1XA5 A;  3NSO A;  1AHR A;  1YR5 A;  1TNQ A;  1B8L A;  4DUQ A;  4P2Y B;  2JNX A;  2LP3 A;  3FIA A;  2M8U A;  1NCX A;  1NUB A;  4NDC A;  3TZ1 A;  1S26 D;  1C7V A;  1NIW A;  1REC A;  4U8D A;  2BL0 B;  2LHL A;  1K8U A;  1K96 A;  4JPZ B;  1XFZ O;  2LAP A;  3WXA A;  4CFR A;  1CFD A;  3O6B A;  1QXP A;  1Y1A A;  2BE4 A;  1GQM A;  4PHN A;  1W7I B;  4DRW A;  4MZK A;  2Y1M A;  4R1E A;  3KHE A;  3KO0 A;  3BUN B;  4M2Q A;  2A4J A;  4YI9 A;  2F3Z A;  3TS5 C;  4ETO A;  4GBA A;  2AMI A;  4BY5 A;  2EHB A;  3D0Y B;  1M63 B;  1SL9 A;  2JPT A;  2PAS A;  3BUX B;  5KSZ A;  2GGZ A;  2COL B;  4GPL B;  1AVS A;  4OR9 B;  4WQ2 A;  4OKH A;  2BBN A;  3SG6 A;  3VRQ A;  1DMO A;  5B8I B;  1KK7 Y;  3SG2 A;  3K21 A;  2JUL A;  3PM8 A;  1DJZ A;  3CR2 A;  1OE9 B;  4FTG A;  5HYD A;  2LVI A;  4C0L A;  5JOL A;  3OB2 B;  1K9U A;  1C7W A;  3GOF A;  1IGV A;  2PMY A;  1MXL C;  1QVI Z;  1L2O C;  4HRG A;  2Y1N A;  1PVA A;  5KU1 A;  1QVI Y;  2M1U A;  2KGR A;  1NX3 A;  1UUR A;  2LHI A;  1AK8 A;  2M29 A;  2O5G A;  1QV0 A;  3NXA A;  4USL A;  1DF0 A;  4L9M A;  4IL1 A;  1G8I A;  2BCX A;  3ZNI A;  2JOJ A;  4ORA B;  1DGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...