1J7QA

Solution structure and backbone dynamics of the defunct ef-hand domain of calcium vector protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
86
structure length
86
Chain Sequence
AAPKARALGPEEKDECMKIFDIFDRNAENIAPVSDTMDMLTKLGQTYTKRETEAIMKEARGPKGDKKNIGPEEWLTLCSKWVRQDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium Vector Protein
publication title Solution structure and backbone dynamics of the defunct domain of calcium vector protein.
pubmed doi rcsb
source organism Branchiostoma lanceolatum
molecule tags Metal binding protein
total genus 21
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2001-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j7qA00
1B47A 1PVBA 1TNWA 2FOTA 1C7WA 2IS9A 1TRFA 1B7TY 1CKKA 1PALA 1E8AA 2FJUB 2KI6D 1YURA 3OX6A 4MN0A 1CM4A 2M0RA 1R2UA 1TIZA 4C0KA 3D0YA 3AKBA 1OMRA 4MEWA 1ZMZA 5KU1A 4HSZA 1G33A 3FWBA 1KK8B 1UUSA 1DJIA 2B1UA 2GGZA 3TS5B 1FBVA 3OB2B 1CDMA 1S5GY 5KSZA 3KO0A 3OB1B 3BYAA 4JQ0D 2K7CA 1R6PA 4A4BA 4MZLA 2O60A 3KHEA 2BKHB 1N2DA 1Y6WA 5DKQA 4CPVA 1SW8A 1DJWA 3I5IB 2Y5IA 1CFFA 1BT6A 1VRKA 1B4CA 2CBLA 1QS7A 2EHBA 3F45A 4OCIA 1QVIZ 2LHLA 4MRYA 5HKZA 1MUXA 1YTZC 3D0YB 1BU3A 4DUQA 2E6WA 1J1EA 3EVVA 2O5GA 2BKIB 1IQ5A 5G08A 1EG3A 2H61C 2OS8C 1YRTB 1Q80A 1CTRA 1LKJA 2LM5A 4YGBB 4TNCA 2MHHA 2MRDA 4PE7A 2CT9A 1QASA 4PHNA 1BJFA 1UHNA 1K90D 4OVNF 2LLUA 2BCBA 1QV1A 5HLVA 3NSIA 2JWWA 4GGFC 5CSFA 3O6BA 2OTGB 4CLNA 1IWQA 1Y1XA 2KBMA 2L5XB 1M46A 1S6CA 1ODBA 4A4CA 4Q04A 3DF0B 1CDNA 1SCMB 1EXRA 1SL7A 3TDZA 1AK8A 1DTLA 3TUYB 3FS7A 3SG3A 2MLEC 2WCEA 3CR5X 4L9MA 2M1KB 2K61A 2EC6B 4NDDA 2L98A 2KOTA 3PN7C 3NSKA 1L2OC 4PE1A 1SL8A 2F3ZA 1KFXL 1M31A 3AAJA 3QRXA 2Y1MA 5J3XA 2CXJA 1DGUA 1J55A 1QVIY 4E68A 2M1UA 1MXEA 3JTDB 1NX0A 2LE9B 4QJ3B 1SR6C 1MWNA 2LP3A 1YUUA 3BOWA 3JVTC 2KFFA 2A4JA 1IQ3A 1S3PA 1RFJA 2ZN9A 2COLB 3IF7A 4YI9A 2KDHA 1F4OA 2WOSA 3CWGA 3DVMA 2NCOA 3ZWHA 2HETA 2ZN8A 3FWCA 4N1FA 1DJXA 2M8UA 4I5KA 4BY4A 1B8CA 5FYXA 3SG6A 4HRGA 2JTTA 3SG5A 2G2BA 2Q4UA 1UWOA 2KHNA 4HREE 3DVJA 3I5GC 3SIAA 2MLFC 2ZKMX 3VRPA 1J1DA 3TZ1A 2F33A 5TNCA 3O78A 4D1EA 1LXFC 1QX2A 3O4YA 1BR4B 1ALWA 2KI4C 1K96A 1W7IB 1NP8A 1QTXA 3WXAA 1WRZA 2M97A 3VRNA 5HYDA 1YX7A 1BMOA 2WORA 4DCKA 1CFDA 1XK4A 1BODA 1C7VA 2AAOA 2G9BA 2SCPA 1J7RA 2K8MB 5KTYA 2BL0C 3EKJA 1WLMA 3LK0A 1KK7Z 1PVAA 2L4IA 1H4BA 2JZIA 2L4HA 3EK4A 3SG2A 3E3RA 2LUXA 3NSOA 1J7PA 2LHIA 3C1VA 2GV5A 1HQVA 1WLZA 2M29A 2OPOA 1NWDA 2JNXA 3DVEA 4DS7A 3LK1A 2KNEA 2JT3A 2JULA 4PE0A 1CNPA 1JFJA 1NIWA 3VGOA 1CDPA 4N5XA 2JT8A 3ZNIA 2LUCA 1IKUA 1QIVA 3EVRA 3EVUA 1CLLA 3VRRA 2RGIA 3K21A 1KWOC 1M45A 1JSAA 2LAPA 2JU0A 1CFCA 2KAYA 1DJGA 1G8IA 3LCPC 1KFUL 1MF8B 2JPTA 2HPSA 1NX1A 1NYAA 5HLOA 3EK7A 2K2AA 2WCFA 1UHHA 2JQ6A 4M2PA 1XVJA 4ZCUA 2JXCA 4MLWA 4ORCB 1GGZA 2JXLA 1SCVA 2M9GA 1OMDA 3IQOA 1EG4A 5AANA 3RLZA 3D10A 3VROA 5D7FA 1UHIA 4CFQA 2LVIA 1JC2A 4YGAA 1WDCC 1FW4A 1XFVO 1CMGA 2BBNA 1KSOA 5CPVA 2JC2A 5JOLA 2NXQA 3DF0A 1SKTA 4N1GA 4C0LA 4WRIA 4GUKA 2KFGA 5B8IB 4CFRA 1KQMC 1XFZO 1ZOTB 1NCYA 1CM1A 2ZNEA 4ICBA 2JRFA 2KQ6A 2F3YA 2KYFA 3WHTB 2M49B 1M63B 4MZKA 2LLTA 3VRQA 3GK2A 2BCXA 3PSRA 1QLSA 2I2RE 2I7AA 3BUXB 2H61A 4MVFA 2L0PA 3RM1A 1IG5A 2NLNA 2JNFA 1KFUS 3CZTX 1V1GA 2BBMA 2QACA 3FIAA 1UP5A 2KGRA 1PRWA 4XJKA 1Y0VH 2PSRA 4GNKB 2F2OA 4M2QA 1H8BA 2SASA 5IBWA 1F54A 1OZSA 1SRAA 1NX2A 3LL8B 2KFHA 1RECA 2KAVA 3A8RA 1S6IA 5I8NA 1S26D 4GFTA 1QX7A 4GAOA 4M2OA 1OSAA 3I5FC 5I2OA 1QATA 1K95A 1AHRA 1TOPA 2L50A 2HQ8A 4MZJA 5D69A 1WRLA 1ZUZA 2Q91A 1TNPA 2OS8B 4YGDB 2GGMA 1TCFA 2BE6A 2KGBC 3SG4A 2LC5A 2FCDA 3DD4A 1A29A 4XJKB 1N0YA 2VRGA 2MBXA 1NPQA 1WY9A 4C0JA 5ER4X 3M0WA 4MRXA 1N65A 1TN4A 2TN4A 1YX8A 2R2IA 1EL4A 1UURA 1MQ1A 1EJ3A 1W7JB 2I18A 2K0JA 3I5HC 1J7QA 2PASA 3TDIA 2JOJA 1JUOA 5AXIA 1AJ4A 1NSHA 1CFPA 2PMYA 3BUOB 3EKHA 3AKAA 4AQIA 4XYNA 4PDZA 3IQQA 2F8PA 1NUBA 1PSRA 2LVKA 3NSLA 3GK4X 1IGVA 2PRUA 3PN7B 1L2OB 2LVJA 1BR1B 1UHKA 2BECA 2PALA 3HCMA 1KFXS 1M39A 1XFUO 1CLBA 3CS1A 2CNPA 2V53A 1U5IB 4WQ3A 1ZFSA 2KYCA 2JTZA 5PALA 1A75B 1OE9B 1RROA 1SR6B 1DJHA 5CSJA 3TDUA 1QXPA 2LANA 4JPZB 3JVTB 1BLQA 1F4QA 1PULA 5CSIA 1TNQA 1B8LA 1KK8C 2D8NA 1Y1UA 3SIBA 3TS5C 1XYDA 1XO5A 1JF2A 4HRHA 2Y4QA 1SMGA 1IH0A 5AFPA 2L2EA 3OX5A 5BPJA 2K7BA 4OKHA 1QX5B 1S6JA 4MBEA 1KCYA 4AQJA 1MHOA 3CGAA 3I5IC 2H2KA 3BXKA 2KQYA 3KF9A 1DF0A 1IJ6A 1F70A 3AAKA 3SG7A 3I5GB 5DKRA 2QPTA 2BE4A 1CLMA 1X02A 3PFVA 1NX3A 1F71A 2AMIA 1EH2A 3A4UB 3WHUB 1OMVA 1RJVA 1V1FA 4NDBA 1QJTA 1FI6A 2KI4B 2NCPA 2KSPA 4AOMA 1J7OA 2L51A 1GGWA 5HKWA 4R1EA 4FQOA 1Y1AA 1TNXA 1LA0A 2BL0B 3CLNA 2Y1NA 2CTNA 4PALA 4WQ2A 4DIRA 1HT9A 1TCOB 2LMTA 1YUTA 1DVIA 2HQWA 2WC8A 4CIDA 1WRKA 1D1OA 1DF0B 1QIWA 2P6BB 3PM8A 5I2QA 2ZRTA 1C07A 2HF5A 2DOQA 2NZ0A 2LV7A 1AVSA 2OTGC 1FF1A 1MXLC 2LNKA 2LCPA 1YUSA 1S36A 2CCMA 2WCBA 2ZNDA 1L7ZA 1BF5A 1KK7Y 1YVHA 1XFXO 1KWOB 1XA5A 3HX4A 1SCMC 1KQVA 3GOFA 3TUYC 1KSMA 4NDCA 4GBAA 4OR9B 2K2FA 4GPLB 2EC6C 2ZRSA 3OP0A 2EGDA 2JT0A 1K9PA 1DGVA 4ORAB 4YI8A 2KAXA 3GK1A 4DRWA 4QJ4B 4GGNA 1NCXA 1K9UA 1SY9A 1SNLA 4YBHB 1LVCD 5F6TA 4GGFA 3JTDC 3BQ3A 1SK6D 1WDCB 2M7NA 3CR2A 1DJZA 2E30A 3CTNA 4I5LB 4ORBB 1K9KA 4P2YB 4USLA 5I2LA 1ZACA 2I94A 2M7LA 1SL9A 1B1GA 3ICBA 1B9AA 1LINA 3BUNB 1QLKA 1PK0D 2LMUA 2M3WA 3O2PA 3OHMB 1JWDA 1KQMB 4PCWA 1DMOA 1BOCA 1AP4A 2MAZA 4JWQA 4ETOA 1A4PA 1F8HA 5CSNA 1XFYO 3H4SE 2WNDA 2AUCA 3NXAA 1GJYA 1A03A 1NCZA 3PLFB 1B8RA 1U5IA 1FI5A 3SJSA 1QV0A 3EK8A 1A75A 2KI6C 1CMFA 1PSBA 5GQQC 5K89A 1SBJA 4YGCB 5DKNA 1B7TZ 3PATA 1YVLA 4YGEB 1IJ5A 2LP2A 1K2HA 1MR8A 1FPWA 1OOJA 1RTP1 4BY5A 4F0ZB 1K8UA 4UPGA 4P5OE 1UHJA 1K94A 3I5FB 1GQMA 2MJWB 3KEVA 4U8DA 4YRUA 5HKYA 4QJ5B 4OV2A 1S5GZ 1F55A 1AJ5A 5AEQA 2BCAA 2ISDA 4MSPA 1TTXA 1YRUB 3LLEA 4PE4A 4NQGA 4PHJA 1XFWO 2F2PA 5AERA 1IRJA 1K93D 1DT7B 1JBAA 1RWYA 4I5NB 5JJGA 2LMVA 1G4YR 2K7DA 3KPXA 1OZOA 2PVBA 3BUWB 3MSEB 3CR4X 1S1EA 1CDLA 4ZCVA 4PHKA 2KBIA 5ER5A 1JFKA 2K7OA 2MA2A 4I5JA 3BOWB 1XK4C 4FTGA 1JF0A 2LLSA 1AUIB 1CB1A 1LA3A 3I5HB 1ALVA 1OQPA 1SPYA 4IL1A 1BG1A 4PHMA 1YR5A 1SYMA 2ZFDA 3WNXB 1A2XA 3PALA 3DVKA 3BUMB 2LVVA 1RK9A 1DJYA 2FCEA
chains in the Genus database with same CATH superfamily
1B47A 1PVBA 1TNWA 2FOTA 1C7WA 1DEKA 2IS9A 1TRFA 1B7TY 1CKKA 1PALA 1E8AA 2FJUB 2KI6D 3CYZA 1YURA 3OX6A 4MN0A 1CM4A 2M0RA 1R2UA 1TIZA 4C0KA 3D0YA 3AKBA 1OMRA 1LS8A 4MEWA 1ZMZA 5KU1A 4HSZA 1G33A 3FWBA 2JPOA 1KK8B 1UUSA 1DJIA 5FI2A 2B1UA 2GGZA 3TS5B 1FBVA 3OB2B 1CDMA 1S5GY 5KSZA 3KO0A 3OB1B 3BYAA 4JQ0D 2K7CA 1R6PA 4A4BA 4MZLA 2O60A 3KHEA 3L4LA 2BKHB 1N2DA 1Y6WA 5DKQA 4CPVA 1TUZA 1SW8A 1DJWA 3I5IB 2Y5IA 1CFFA 1BT6A 1VRKA 1B4CA 2CBLA 5FI6A 1QS7A 2EHBA 3F45A 4OCIA 1QVIZ 2LHLA 4MRYA 5HKZA 1MUXA 1YTZC 3D0YB 1BU3A 4DUQA 2E6WA 4FQTA 1J1EA 4KYNA 3EVVA 2O5GA 2BKIB 4INWA 1IQ5A 5G08A 1EG3A 2H61C 2OS8C 1YRTB 1Q80A 1CTRA 1LKJA 2LM5A 4YGBB 4TNCA 2MHHA 3B6XA 4JD9A 2MRDA 4PE7A 2K60A 2CT9A 3CZ0A 1QASA 4PHNA 1BJFA 3D76A 1UHNA 1K90D 4OVNF 2LLUA 2BCBA 1QV1A 5HLVA 3NSIA 2JWWA 4GGFC 5CSFA 3O6BA 2OTGB 4CLNA 1IWQA 1Y1XA 2KBMA 2L5XB 1M46A 1S6CA 1ODBA 4A4CA 4Q04A 3DF0B 1CDNA 1SCMB 1EXRA 1SL7A 3TDZA 1AK8A 1DTLA 3OBVA 3TUYB 3FS7A 2L2CA 3SG3A 2MLEC 2WCEA 3CR5X 3L47A 4L9MA 2M1KB 2K61A 2EC6B 4NDDA 2L98A 3B87A 2KOTA 3S0FA 3PN7C 3NSKA 1L2OC 4PE1A 1T14A 1SL8A 2F3ZA 1KFXL 1M31A 3AAJA 3QRXA 2Y1MA 5J3XA 2CXJA 3FE8A 1DGUA 1J55A 1QVIY 4E68A 2M1UA 1MXEA 3JTDB 1NX0A 2LE9B 4QJ3B 1SR6C 1MWNA 2LP3A 1YUUA 3BOWA 3JVTC 2KFFA 2A4JA 1IQ3A 3CABA 1S3PA 1RFJA 2ZN9A 2COLB 3IF7A 4YI9A 2KDHA 1F4OA 2WOSA 3CWGA 3DVMA 2NCOA 3VB1A 3ZWHA 2HETA 2ZN8A 3FWCA 4N1FA 1DJXA 3R1VA 2M8UA 4I5KA 4BY4A 1B8CA 5FYXA 3SG6A 4HRGA 2JTTA 3SG5A 2G2BA 2Q4UA 1UWOA 2KHNA 2WC6A 3O4XA 4HREE 2WC5A 3DVJA 3I5GC 4OZDA 3SIAA 2MLFC 2ZKMX 3VRPA 1J1DA 2WCLA 3TZ1A 2F33A 5TNCA 3O78A 4D1EA 1LXFC 1QX2A 3O4YA 1BR4B 1ALWA 2KI4C 1K96A 1W7IB 1NP8A 1QTXA 3WXAA 1WRZA 2M97A 3VRNA 5HYDA 1YX7A 1BMOA 2WORA 4DCKA 1CFDA 1XK4A 1BODA 1C7VA 2AAOA 2G9BA 2SCPA 1J7RA 2K8MB 3R1PA 2BL0C 5KTYA 1P28A 3D75A 3EKJA 1WLMA 3LK0A 3UO9A 1KK7Z 1PVAA 2L4IA 1H4BA 2JZIA 2L4HA 3EK4A 3S0GA 3E3RA 2LUXA 3NSOA 3SG2A 2LHIA 3C1VA 1J7PA 2GV5A 1HQVA 1WLZA 2M29A 2OPOA 1NWDA 2JNXA 3B88A 3DVEA 5D3OA 4DS7A 3LK1A 2KNEA 2JT3A 2JULA 4PE0A 1CNPA 1JFJA 1NIWA 3SS5A 3VGOA 1CDPA 4N5XA 2JT8A 3ZNIA 2LUCA 1IKUA 1QIVA 3EVRA 3EVUA 1W9ZA 1CLLA 1ORGA 2RGIA 3K21A 1KWOC 1M45A 3VRRA 1JSAA 2LAPA 3B86A 2JU0A 1DC1A 1CFCA 2KAYA 1DJGA 1G8IA 3LCPC 1KFUL 1MF8B 2JPTA 2KLEA 2HPSA 1NX1A 1NYAA 5HLOA 3EK7A 2K2AA 2WCFA 3DXLA 1UHHA 2JQ6A 2QDIA 3RZSA 4M2PA 1XVJA 4ZCUA 2JXCA 4MLWA 4ORCB 1GGZA 2JXLA 1SCVA 2M9GA 1OMDA 3IQOA 1EG4A 5AANA 3RLZA 2L5YA 3D10A 3VROA 5D7FA 1UHIA 4CFQA 2LVIA 1JC2A 4YGAA 1WDCC 1QWVA 1FW4A 1XFVO 3SS4A 1CMGA 2BBNA 3L4AA 1KSOA 2P71A 5CPVA 2JC2A 5JOLA 2NXQA 3DF0A 1SKTA 4IJ7A 4N1GA 3SS3A 4C0LA 4WRIA 4GUKA 1C3ZA 2KFGA 5B8IB 4CFRA 5DICA 1KQMC 1XFZO 1ZOTB 3BJHA 1NCYA 1CM1A 2ZNEA 4ICBA 1TWOA 2JRFA 2KQ6A 2F3YA 1XFRA 2KYFA 3WHTB 2M49B 1M63B 4MZKA 2LLTA 3VRQA 3GK2A 2BCXA 3PSRA 1QLSA 2I2RE 2I7AA 3BUXB 2H61A 3D77A 2L0PA 4MVFA 3RM1A 1IG5A 2NLNA 2JNFA 1KFUS 3CZTX 1V1GA 2BBMA 2QACA 3FIAA 1UP5A 2KGRA 1PRWA 4XJKA 1Y0VH 2PSRA 4GNKB 2F2OA 4M2QA 1H8BA 2SASA 2WCHA 5IBWA 1F54A 1OZSA 3CZ1A 1SRAA 1NX2A 3EG5B 3LL8B 1OOFA 1RECA 2KFHA 2KAVA 3A8RA 1S6IA 5I8NA 1S26D 4GFTA 1QX7A 4GAOA 4M2OA 2GTEA 1OSAA 3BFAA 3I5FC 5I2OA 1QATA 1K95A 1Z2CB 2PYQA 3PM2A 1AHRA 1TOPA 2L50A 2HQ8A 4MZJA 5D69A 1WRLA 1ZUZA 2Q91A 1TNPA 2OS8B 4YGDB 3D74A 2GGMA 1TCFA 2BE6A 2KGBC 2WCJA 5EL2A 3SG4A 2LC5A 4PT1A 2FCDA 3DD4A 1A29A 4XJKB 1N0YA 2VRGA 2MBXA 1NPQA 1WY9A 4C0JA 5ER4X 1OOGA 3M0WA 4MRXA 1N65A 1TN4A 2TN4A 1YX8A 2R2IA 3NHIA 1EL4A 1UURA 1MQ1A 3FE6A 1EJ3A 1W7JB 2I18A 2K0JA 3I5HC 1J7QA 3R72A 2PASA 3TDIA 3NHTA 2JOJA 1JUOA 5AXIA 1AJ4A 1NSHA 1CFPA 2PMYA 1TUJA 3BUOB 3AKAA 3EKHA 4XYNA 4AQIA 3S0AA 4PDZA 3IQQA 2F8PA 1NUBA 1PSRA 2LVKA 1GM0A 2QEOA 3NSLA 3GK4X 1IGVA 2PRUA 3PN7B 1L2OB 2LVJA 1BR1B 1UHKA 2BECA 2PALA 3HCMA 1KFXS 1M39A 1XFUO 1CLBA 3CS1A 2CNPA 2V53A 1U5IB 4WQ3A 1ZFSA 2KYCA 2JTZA 3NGVA 5PALA 1A75B 1OE9B 1RROA 1SR6B 2QEVA 1DJHA 5CSJA 3TDUA 1QXPA 2LANA 4JPZB 3JVTB 2QEBA 1BLQA 3QMEA 3S0DA 1F4QA 1PULA 5CSIA 1TNQA 2P70A 4F7FA 1B8LA 1KK8C 2D8NA 1Y1UA 3SIBA 3TS5C 2YGUA 1XYDA 1XO5A 1JF2A 4HRHA 2Y4QA 1SMGA 1IH0A 5AFPA 2L2EA 3OX5A 5BPJA 3Q8IA 2K7BA 4OKHA 1QX5B 1S6JA 4MBEA 2KLDA 3D78A 1KCYA 4AQJA 1MHOA 3CGAA 3I5IC 2H2KA 3BXKA 2KQYA 3KF9A 1DF0A 1IJ6A 1F70A 3AAKA 3SG7A 3I5GB 5DKRA 2QPTA 2BE4A 3BFHA 1CLMA 1X02A 3PFVA 1NX3A 1F71A 2AMIA 1EH2A 3A4UB 3WHUB 3IVTA 1OMVA 1RJVA 1V1FA 4NDBA 1QJTA 1FI6A 2KI4B 2NCPA 2KSPA 4AOMA 1J7OA 1OOIX 1IIOA 2L51A 1GGWA 5HKWA 4R1EA 4FQOA 1Y1AA 1TNXA 1LA0A 2BL0B 2QEHA 3CLNA 2Y1NA 2CTNA 4PALA 4WQ2A 4DIRA 1SSEB 1HT9A 1TCOB 2FJYA 2LMTA 1YUTA 1DVIA 2HQWA 2WC8A 4CIDA 1WRKA 1D1OA 1DF0B 1QIWA 2P6BB 3PM8A 5I2QA 2ZRTA 1C07A 2HF5A 2DOQA 2NZ0A 2LV7A 1AVSA 2OTGC 1FF1A 1MXLC 2LNKA 2LCPA 1YUSA 1S36A 2CCMA 3D73A 2WCBA 2ZNDA 1L7ZA 1BF5A 1KK7Y 1YVHA 1XFXO 1KWOB 1XA5A 3HX4A 1SCMC 3V2LA 3GOFA 1KQVA 3CDNA 2KPHA 3TUYC 4JKTA 1KSMA 4NDCA 4GBAA 4OR9B 2K2FA 5HL1A 4GPLB 2EC6C 2ZRSA 3OP0A 2EGDA 2JT0A 3B7AA 1K9PA 1DGVA 4ORAB 4YI8A 2KAXA 3GK1A 4DRWA 3FE9A 4QJ4B 4GGNA 1NCXA 2BNXA 1K9UA 2H8VA 1OOHA 1SY9A 1SNLA 4YBHB 1LVCD 5F6TA 3UNWA 4GGFA 3JTDC 3BQ3A 1SK6D 1WDCB 2M7NA 3CR2A 1DJZA 2E30A 3CTNA 4I5LB 4ORBB 1K9KA 4P2YB 4USLA 5I2LA 1ZACA 2ERBA 2I94A 1OW4A 1SL9A 2M7LA 1B1GA 3ICBA 1B9AA 1LINA 3S0EA 2PQLA 1QLKA 3BUNB 1PK0D 2LMUA 2M3WA 3DY9A 3N7HA 3O2PA 3OHMB 1JWDA 1KQMB 4PCWA 4INXA 1DMOA 1BOCA 1AP4A 2MAZA 4JWQA 4ETOA 1A4PA 1F8HA 5CSNA 1XFYO 3H4SE 2WNDA 2AUCA 3NXAA 1GJYA 1A03A 1NCZA 3PLFB 1B8RA 1U5IA 1FI5A 3SJSA 1QV0A 3EK8A 1A75A 2KI6C 1CMFA 1PSBA 3DYEA 5GQQC 5K89A 1SBJA 4YGCB 5DKNA 1B7TZ 3PATA 1YVLA 2BAPA 4YGEB 1IJ5A 2LP2A 3CZ2A 1K2HA 1DELA 1MR8A 1FPWA 1OOJA 1RTP1 4BY5A 4F0ZB 1K8UA 3PJIA 4UPGA 1Z4HA 4P5OE 1UHJA 1K94A 3I5FB 1GQMA 2MJWB 3S0BA 3KEVA 4U8DA 4YRUA 5HKYA 4QJ5B 3OGNA 4OV2A 1S5GZ 1F55A 1AJ5A 5AEQA 2BCAA 2ISDA 4MSPA 1TTXA 1YRUB 3LLEA 4PE4A 4NQGA 4PHJA 1XFWO 2F2PA 5FI7A 5AERA 1IRJA 1K93D 1DT7B 1JBAA 1RWYA 4I5NB 5JJGA 2LMVA 1G4YR 2K7DA 3KPXA 1OZOA 2PVBA 3BUWB 3MSEB 3CR4X 1S1EA 1CDLA 4ZCVA 1C3YA 4PHKA 2KBIA 5ER5A 1JFKA 2K7OA 2MA2A 4I5JA 3BOWB 5I94A 1XK4C 3DZTA 4FTGA 2WCMA 1JF0A 2LLSA 1AUIB 3K1EA 1CB1A 1LA3A 3I5HB 1ALVA 1OQPA 1SPYA 4IL1A 1BG1A 4PHMA 1YR5A 1SYMA 2ZFDA 3R1OA 3WNXB 1A2XA 3PALA 1DQEA 3BFBA 3DVKA 3BUMB 2LVVA 2WCKA 1RK9A 1DJYA 2FCEA
chains in the Genus database with same CATH topology
1B47A 1PVBA 1TNWA 2FOTA 1C7WA 2IS9A 1TRFA 1B7TY 1CKKA 1PALA 1E8AA 2FJUB 2KI6D 1YURA 3OX6A 4MN0A 1CM4A 2M0RA 1R2UA 1TIZA 4C0KA 3D0YA 3AKBA 1OMRA 4MEWA 1ZMZA 5KU1A 4HSZA 1G33A 3FWBA 1KK8B 1UUSA 1DJIA 2B1UA 2GGZA 3TS5B 1FBVA 3OB2B 1CDMA 1S5GY 5KSZA 3KO0A 3OB1B 3BYAA 4JQ0D 2K7CA 1R6PA 4A4BA 4MZLA 2O60A 3KHEA 2BKHB 1N2DA 1Y6WA 5DKQA 4CPVA 1SW8A 1DJWA 3I5IB 2Y5IA 1CFFA 1BT6A 1VRKA 1B4CA 2CBLA 1QS7A 2EHBA 3F45A 4OCIA 1QVIZ 2LHLA 4MRYA 5HKZA 1MUXA 1YTZC 3D0YB 1BU3A 4DUQA 2E6WA 1J1EA 3EVVA 2O5GA 2BKIB 1IQ5A 5G08A 1EG3A 2H61C 2OS8C 1YRTB 1Q80A 1CTRA 1LKJA 2LM5A 4YGBB 4TNCA 2MHHA 2MRDA 4PE7A 2CT9A 1QASA 4PHNA 1BJFA 1UHNA 1K90D 4OVNF 2LLUA 2BCBA 1QV1A 5HLVA 3NSIA 2JWWA 4GGFC 5CSFA 3O6BA 2OTGB 4CLNA 1IWQA 1Y1XA 2KBMA 2L5XB 1M46A 1S6CA 1ODBA 4A4CA 4Q04A 3DF0B 1CDNA 1SCMB 1EXRA 1SL7A 3TDZA 1AK8A 1DTLA 3TUYB 3FS7A 3SG3A 2MLEC 2WCEA 3CR5X 4L9MA 2M1KB 2K61A 2EC6B 4NDDA 2L98A 2KOTA 3PN7C 3NSKA 1L2OC 4PE1A 1SL8A 2F3ZA 1KFXL 1M31A 3AAJA 3QRXA 2Y1MA 5J3XA 2CXJA 1DGUA 1J55A 1QVIY 4E68A 2M1UA 1MXEA 3JTDB 1NX0A 2LE9B 4QJ3B 1SR6C 1MWNA 2LP3A 1YUUA 3BOWA 3JVTC 2KFFA 2A4JA 1IQ3A 1S3PA 1RFJA 2ZN9A 2COLB 3IF7A 4YI9A 2KDHA 1F4OA 2WOSA 3CWGA 3DVMA 2NCOA 3ZWHA 2HETA 2ZN8A 3FWCA 4N1FA 1DJXA 2M8UA 4I5KA 4BY4A 1B8CA 5FYXA 3SG6A 4HRGA 2JTTA 3SG5A 2G2BA 2Q4UA 1UWOA 2KHNA 4HREE 3DVJA 3I5GC 3SIAA 2MLFC 2ZKMX 3VRPA 1J1DA 3TZ1A 2F33A 5TNCA 3O78A 4D1EA 1LXFC 1QX2A 3O4YA 1BR4B 1ALWA 2KI4C 1K96A 1W7IB 1NP8A 1QTXA 3WXAA 1WRZA 2M97A 3VRNA 5HYDA 1YX7A 1BMOA 2WORA 4DCKA 1CFDA 1XK4A 1BODA 1C7VA 2AAOA 2G9BA 2SCPA 1J7RA 2K8MB 5KTYA 2BL0C 3EKJA 1WLMA 3LK0A 1KK7Z 1PVAA 2L4IA 1H4BA 2JZIA 2L4HA 3EK4A 3SG2A 3E3RA 2LUXA 3NSOA 1J7PA 2LHIA 3C1VA 2GV5A 1HQVA 1WLZA 2M29A 2OPOA 1NWDA 2JNXA 3DVEA 4DS7A 3LK1A 2KNEA 2JT3A 2JULA 4PE0A 1CNPA 1JFJA 1NIWA 3VGOA 1CDPA 4N5XA 2JT8A 3ZNIA 2LUCA 1IKUA 1QIVA 3EVRA 3EVUA 1CLLA 3VRRA 2RGIA 3K21A 1KWOC 1M45A 1JSAA 2LAPA 2JU0A 1CFCA 2KAYA 1DJGA 1G8IA 3LCPC 1KFUL 1MF8B 2JPTA 2HPSA 1NX1A 1NYAA 5HLOA 3EK7A 2K2AA 2WCFA 1UHHA 2JQ6A 4M2PA 1XVJA 4ZCUA 2JXCA 4MLWA 4ORCB 1GGZA 2JXLA 1SCVA 2M9GA 1OMDA 3IQOA 1EG4A 5AANA 3RLZA 3D10A 3VROA 5D7FA 1UHIA 4CFQA 2LVIA 1JC2A 4YGAA 1WDCC 1FW4A 1XFVO 1CMGA 2BBNA 1KSOA 5CPVA 2JC2A 5JOLA 2NXQA 3DF0A 1SKTA 4N1GA 4C0LA 4WRIA 4GUKA 2KFGA 5B8IB 4CFRA 1KQMC 1XFZO 1ZOTB 1NCYA 1CM1A 2ZNEA 4ICBA 2JRFA 2KQ6A 2F3YA 2KYFA 3WHTB 2M49B 1M63B 4MZKA 2LLTA 3VRQA 3GK2A 2BCXA 3PSRA 1QLSA 2I2RE 2I7AA 3BUXB 2H61A 4MVFA 2L0PA 3RM1A 1IG5A 2NLNA 2JNFA 1KFUS 3CZTX 1V1GA 2BBMA 2QACA 3FIAA 1UP5A 2KGRA 1PRWA 4XJKA 1Y0VH 2PSRA 4GNKB 2F2OA 4M2QA 1H8BA 2SASA 5IBWA 1F54A 1OZSA 1SRAA 1NX2A 3LL8B 2KFHA 1RECA 2KAVA 3A8RA 1S6IA 5I8NA 1S26D 4GFTA 1QX7A 4GAOA 4M2OA 1OSAA 3I5FC 5I2OA 1QATA 1K95A 1AHRA 1TOPA 2L50A 2HQ8A 4MZJA 5D69A 1WRLA 1ZUZA 2Q91A 1TNPA 2OS8B 4YGDB 2GGMA 1TCFA 2BE6A 2KGBC 3SG4A 2LC5A 2FCDA 3DD4A 1A29A 4XJKB 1N0YA 2VRGA 2MBXA 1NPQA 1WY9A 4C0JA 5ER4X 3M0WA 4MRXA 1N65A 1TN4A 2TN4A 1YX8A 2R2IA 1EL4A 1UURA 1MQ1A 1EJ3A 1W7JB 2I18A 2K0JA 3I5HC 1J7QA 2PASA 3TDIA 2JOJA 1JUOA 5AXIA 1AJ4A 1NSHA 1CFPA 2PMYA 3BUOB 3EKHA 3AKAA 4AQIA 4XYNA 4PDZA 3IQQA 2F8PA 1NUBA 1PSRA 2LVKA 3NSLA 3GK4X 1IGVA 2PRUA 3PN7B 1L2OB 2LVJA 1BR1B 1UHKA 2BECA 2PALA 3HCMA 1KFXS 1M39A 1XFUO 1CLBA 3CS1A 2CNPA 2V53A 1U5IB 4WQ3A 1ZFSA 2KYCA 2JTZA 5PALA 1A75B 1OE9B 1RROA 1SR6B 1DJHA 5CSJA 3TDUA 1QXPA 2LANA 4JPZB 3JVTB 1BLQA 1F4QA 1PULA 5CSIA 1TNQA 1B8LA 1KK8C 2D8NA 1Y1UA 3SIBA 3TS5C 1XYDA 1XO5A 1JF2A 4HRHA 2Y4QA 1SMGA 1IH0A 5AFPA 2L2EA 3OX5A 5BPJA 2K7BA 4OKHA 1QX5B 1S6JA 4MBEA 1KCYA 4AQJA 1MHOA 3CGAA 3I5IC 2H2KA 3BXKA 2KQYA 3KF9A 1DF0A 1IJ6A 1F70A 3AAKA 3SG7A 3I5GB 5DKRA 2QPTA 2BE4A 1CLMA 1X02A 3PFVA 1NX3A 1F71A 2AMIA 1EH2A 3A4UB 3WHUB 1OMVA 1RJVA 1V1FA 4NDBA 1QJTA 1FI6A 2KI4B 2NCPA 2KSPA 4AOMA 1J7OA 2L51A 1GGWA 5HKWA 4R1EA 4FQOA 1Y1AA 1TNXA 1LA0A 2BL0B 3CLNA 2Y1NA 2CTNA 4PALA 4WQ2A 4DIRA 1HT9A 1TCOB 2LMTA 1YUTA 1DVIA 2HQWA 2WC8A 4CIDA 1WRKA 1D1OA 1DF0B 1QIWA 2P6BB 3PM8A 5I2QA 2ZRTA 1C07A 2HF5A 2DOQA 2NZ0A 2LV7A 1AVSA 2OTGC 1FF1A 1MXLC 2LNKA 2LCPA 1YUSA 1S36A 2CCMA 2WCBA 2ZNDA 1L7ZA 1BF5A 1KK7Y 1YVHA 1XFXO 1KWOB 1XA5A 3HX4A 1SCMC 1KQVA 3GOFA 3TUYC 1KSMA 4NDCA 4GBAA 4OR9B 2K2FA 4GPLB 2EC6C 2ZRSA 3OP0A 2EGDA 2JT0A 1K9PA 1DGVA 4ORAB 4YI8A 2KAXA 3GK1A 4DRWA 4QJ4B 4GGNA 1NCXA 1K9UA 1SY9A 1SNLA 4YBHB 1LVCD 5F6TA 4GGFA 3JTDC 3BQ3A 1SK6D 1WDCB 2M7NA 3CR2A 1DJZA 2E30A 3CTNA 4I5LB 4ORBB 1K9KA 4P2YB 4USLA 5I2LA 1ZACA 2I94A 2M7LA 1SL9A 1B1GA 3ICBA 1B9AA 1LINA 3BUNB 1QLKA 1PK0D 2LMUA 2M3WA 3O2PA 3OHMB 1JWDA 1KQMB 4PCWA 1DMOA 1BOCA 1AP4A 2MAZA 4JWQA 4ETOA 1A4PA 1F8HA 5CSNA 1XFYO 3H4SE 2WNDA 2AUCA 3NXAA 1GJYA 1A03A 1NCZA 3PLFB 1B8RA 1U5IA 1FI5A 3SJSA 1QV0A 3EK8A 1A75A 2KI6C 1CMFA 1PSBA 5GQQC 5K89A 1SBJA 4YGCB 5DKNA 1B7TZ 3PATA 1YVLA 4YGEB 1IJ5A 2LP2A 1K2HA 1MR8A 1FPWA 1OOJA 1RTP1 4BY5A 4F0ZB 1K8UA 4UPGA 4P5OE 1UHJA 1K94A 3I5FB 1GQMA 2MJWB 3KEVA 4U8DA 4YRUA 5HKYA 4QJ5B 4OV2A 1S5GZ 1F55A 1AJ5A 5AEQA 2BCAA 2ISDA 4MSPA 1TTXA 1YRUB 3LLEA 4PE4A 4NQGA 4PHJA 1XFWO 2F2PA 5AERA 1IRJA 1K93D 1DT7B 1JBAA 1RWYA 4I5NB 5JJGA 2LMVA 1G4YR 2K7DA 3KPXA 1OZOA 2PVBA 3BUWB 3MSEB 3CR4X 1S1EA 1CDLA 4ZCVA 4PHKA 2KBIA 5ER5A 1JFKA 2K7OA 2MA2A 4I5JA 3BOWB 1XK4C 4FTGA 1JF0A 2LLSA 1AUIB 1CB1A 1LA3A 3I5HB 1ALVA 1OQPA 1SPYA 4IL1A 1BG1A 4PHMA 1YR5A 1SYMA 2ZFDA 3WNXB 1A2XA 3PALA 3DVKA 3BUMB 2LVVA 1RK9A 1DJYA 2FCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B47 A;  1PVB A;  1TNW A;  2FOT A;  1C7W A;  2IS9 A;  1TRF A;  1B7T Y;  1CKK A;  1PAL A;  1E8A A;  2FJU B;  2KI6 D;  1YUR A;  3OX6 A;  4MN0 A;  1CM4 A;  2M0R A;  1R2U A;  1TIZ A;  4C0K A;  3D0Y A;  3AKB A;  1OMR A;  4MEW A;  1ZMZ A;  5KU1 A;  4HSZ A;  1G33 A;  3FWB A;  1KK8 B;  1UUS A;  1DJI A;  2B1U A;  2GGZ A;  3TS5 B;  1FBV A;  3OB2 B;  1CDM A;  1S5G Y;  5KSZ A;  3KO0 A;  3OB1 B;  3BYA A;  4JQ0 D;  2K7C A;  1R6P A;  4A4B A;  4MZL A;  2O60 A;  3KHE A;  2BKH B;  1N2D A;  1Y6W A;  5DKQ A;  4CPV A;  1SW8 A;  1DJW A;  3I5I B;  2Y5I A;  1CFF A;  1BT6 A;  1VRK A;  1B4C A;  2CBL A;  1QS7 A;  2EHB A;  3F45 A;  4OCI A;  1QVI Z;  2LHL A;  4MRY A;  5HKZ A;  1MUX A;  1YTZ C;  3D0Y B;  1BU3 A;  4DUQ A;  2E6W A;  1J1E A;  3EVV A;  2O5G A;  2BKI B;  1IQ5 A;  5G08 A;  1EG3 A;  2H61 C;  2OS8 C;  1YRT B;  1Q80 A;  1CTR A;  1LKJ A;  2LM5 A;  4YGB B;  4TNC A;  2MHH A;  2MRD A;  4PE7 A;  2CT9 A;  1QAS A;  4PHN A;  1BJF A;  1UHN A;  1K90 D;  4OVN F;  2LLU A;  2BCB A;  1QV1 A;  5HLV A;  3NSI A;  2JWW A;  4GGF C;  5CSF A;  3O6B A;  2OTG B;  4CLN A;  1IWQ A;  1Y1X A;  2KBM A;  2L5X B;  1M46 A;  1S6C A;  1ODB A;  4A4C A;  4Q04 A;  3DF0 B;  1CDN A;  1SCM B;  1EXR A;  1SL7 A;  3TDZ A;  1AK8 A;  1DTL A;  3TUY B;  3FS7 A;  3SG3 A;  2MLE C;  2WCE A;  3CR5 X;  4L9M A;  2M1K B;  2K61 A;  2EC6 B;  4NDD A;  2L98 A;  2KOT A;  3PN7 C;  3NSK A;  1L2O C;  4PE1 A;  1SL8 A;  2F3Z A;  1KFX L;  1M31 A;  3AAJ A;  3QRX A;  2Y1M A;  5J3X A;  2CXJ A;  1DGU A;  1J55 A;  1QVI Y;  4E68 A;  2M1U A;  1MXE A;  3JTD B;  1NX0 A;  2LE9 B;  4QJ3 B;  1SR6 C;  1MWN A;  2LP3 A;  1YUU A;  3BOW A;  3JVT C;  2KFF A;  2A4J A;  1IQ3 A;  1S3P A;  1RFJ A;  2ZN9 A;  2COL B;  3IF7 A;  4YI9 A;  2KDH A;  1F4O A;  2WOS A;  3CWG A;  3DVM A;  2NCO A;  3ZWH A;  2HET A;  2ZN8 A;  3FWC A;  4N1F A;  1DJX A;  2M8U A;  4I5K A;  4BY4 A;  1B8C A;  5FYX A;  3SG6 A;  4HRG A;  2JTT A;  3SG5 A;  2G2B A;  2Q4U A;  1UWO A;  2KHN A;  4HRE E;  3DVJ A;  3I5G C;  3SIA A;  2MLF C;  2ZKM X;  3VRP A;  1J1D A;  3TZ1 A;  2F33 A;  5TNC A;  3O78 A;  4D1E A;  1LXF C;  1QX2 A;  3O4Y A;  1BR4 B;  1ALW A;  2KI4 C;  1K96 A;  1W7I B;  1NP8 A;  1QTX A;  3WXA A;  1WRZ A;  2M97 A;  3VRN A;  5HYD A;  1YX7 A;  1BMO A;  2WOR A;  4DCK A;  1CFD A;  1XK4 A;  1BOD A;  1C7V A;  2AAO A;  2G9B A;  2SCP A;  1J7R A;  2K8M B;  5KTY A;  2BL0 C;  3EKJ A;  1WLM A;  3LK0 A;  1KK7 Z;  1PVA A;  2L4I A;  1H4B A;  2JZI A;  2L4H A;  3EK4 A;  3SG2 A;  3E3R A;  2LUX A;  3NSO A;  1J7P A;  2LHI A;  3C1V A;  2GV5 A;  1HQV A;  1WLZ A;  2M29 A;  2OPO A;  1NWD A;  2JNX A;  3DVE A;  4DS7 A;  3LK1 A;  2KNE A;  2JT3 A;  2JUL A;  4PE0 A;  1CNP A;  1JFJ A;  1NIW A;  3VGO A;  1CDP A;  4N5X A;  2JT8 A;  3ZNI A;  2LUC A;  1IKU A;  1QIV A;  3EVR A;  3EVU A;  1CLL A;  3VRR A;  2RGI A;  3K21 A;  1KWO C;  1M45 A;  1JSA A;  2LAP A;  2JU0 A;  1CFC A;  2KAY A;  1DJG A;  1G8I A;  3LCP C;  1KFU L;  1MF8 B;  2JPT A;  2HPS A;  1NX1 A;  1NYA A;  5HLO A;  3EK7 A;  2K2A A;  2WCF A;  1UHH A;  2JQ6 A;  4M2P A;  1XVJ A;  4ZCU A;  2JXC A;  4MLW A;  4ORC B;  1GGZ A;  2JXL A;  1SCV A;  2M9G A;  1OMD A;  3IQO A;  1EG4 A;  5AAN A;  3RLZ A;  3D10 A;  3VRO A;  5D7F A;  1UHI A;  4CFQ A;  2LVI A;  1JC2 A;  4YGA A;  1WDC C;  1FW4 A;  1XFV O;  1CMG A;  2BBN A;  1KSO A;  5CPV A;  2JC2 A;  5JOL A;  2NXQ A;  3DF0 A;  1SKT A;  4N1G A;  4C0L A;  4WRI A;  4GUK A;  2KFG A;  5B8I B;  4CFR A;  1KQM C;  1XFZ O;  1ZOT B;  1NCY A;  1CM1 A;  2ZNE A;  4ICB A;  2JRF A;  2KQ6 A;  2F3Y A;  2KYF A;  3WHT B;  2M49 B;  1M63 B;  4MZK A;  2LLT A;  3VRQ A;  3GK2 A;  2BCX A;  3PSR A;  1QLS A;  2I2R E;  2I7A A;  3BUX B;  2H61 A;  4MVF A;  2L0P A;  3RM1 A;  1IG5 A;  2NLN A;  2JNF A;  1KFU S;  3CZT X;  1V1G A;  2BBM A;  2QAC A;  3FIA A;  1UP5 A;  2KGR A;  1PRW A;  4XJK A;  1Y0V H;  2PSR A;  4GNK B;  2F2O A;  4M2Q A;  1H8B A;  2SAS A;  5IBW A;  1F54 A;  1OZS A;  1SRA A;  1NX2 A;  3LL8 B;  2KFH A;  1REC A;  2KAV A;  3A8R A;  1S6I A;  5I8N A;  1S26 D;  4GFT A;  1QX7 A;  4GAO A;  4M2O A;  1OSA A;  3I5F C;  5I2O A;  1QAT A;  1K95 A;  1AHR A;  1TOP A;  2L50 A;  2HQ8 A;  4MZJ A;  5D69 A;  1WRL A;  1ZUZ A;  2Q91 A;  1TNP A;  2OS8 B;  4YGD B;  2GGM A;  1TCF A;  2BE6 A;  2KGB C;  3SG4 A;  2LC5 A;  2FCD A;  3DD4 A;  1A29 A;  4XJK B;  1N0Y A;  2VRG A;  2MBX A;  1NPQ A;  1WY9 A;  4C0J A;  5ER4 X;  3M0W A;  4MRX A;  1N65 A;  1TN4 A;  2TN4 A;  1YX8 A;  2R2I A;  1EL4 A;  1UUR A;  1MQ1 A;  1EJ3 A;  1W7J B;  2I18 A;  2K0J A;  3I5H C;  1J7Q A;  2PAS A;  3TDI A;  2JOJ A;  1JUO A;  5AXI A;  1AJ4 A;  1NSH A;  1CFP A;  2PMY A;  3BUO B;  3EKH A;  3AKA A;  4AQI A;  4XYN A;  4PDZ A;  3IQQ A;  2F8P A;  1NUB A;  1PSR A;  2LVK A;  3NSL A;  3GK4 X;  1IGV A;  2PRU A;  3PN7 B;  1L2O B;  2LVJ A;  1BR1 B;  1UHK A;  2BEC A;  2PAL A;  3HCM A;  1KFX S;  1M39 A;  1XFU O;  1CLB A;  3CS1 A;  2CNP A;  2V53 A;  1U5I B;  4WQ3 A;  1ZFS A;  2KYC A;  2JTZ A;  5PAL A;  1A75 B;  1OE9 B;  1RRO A;  1SR6 B;  1DJH A;  5CSJ A;  3TDU A;  1QXP A;  2LAN A;  4JPZ B;  3JVT B;  1BLQ A;  1F4Q A;  1PUL A;  5CSI A;  1TNQ A;  1B8L A;  1KK8 C;  2D8N A;  1Y1U A;  3SIB A;  3TS5 C;  1XYD A;  1XO5 A;  1JF2 A;  4HRH A;  2Y4Q A;  1SMG A;  1IH0 A;  5AFP A;  2L2E A;  3OX5 A;  5BPJ A;  2K7B A;  4OKH A;  1QX5 B;  1S6J A;  4MBE A;  1KCY A;  4AQJ A;  1MHO A;  3CGA A;  3I5I C;  2H2K A;  3BXK A;  2KQY A;  3KF9 A;  1DF0 A;  1IJ6 A;  1F70 A;  3AAK A;  3SG7 A;  3I5G B;  5DKR A;  2QPT A;  2BE4 A;  1CLM A;  1X02 A;  3PFV A;  1NX3 A;  1F71 A;  2AMI A;  1EH2 A;  3A4U B;  3WHU B;  1OMV A;  1RJV A;  1V1F A;  4NDB A;  1QJT A;  1FI6 A;  2KI4 B;  2NCP A;  2KSP A;  4AOM A;  1J7O A;  2L51 A;  1GGW A;  5HKW A;  4R1E A;  4FQO A;  1Y1A A;  1TNX A;  1LA0 A;  2BL0 B;  3CLN A;  2Y1N A;  2CTN A;  4PAL A;  4WQ2 A;  4DIR A;  1HT9 A;  1TCO B;  2LMT A;  1YUT A;  1DVI A;  2HQW A;  2WC8 A;  4CID A;  1WRK A;  1D1O A;  1DF0 B;  1QIW A;  2P6B B;  3PM8 A;  5I2Q A;  2ZRT A;  1C07 A;  2HF5 A;  2DOQ A;  2NZ0 A;  2LV7 A;  1AVS A;  2OTG C;  1FF1 A;  1MXL C;  2LNK A;  2LCP A;  1YUS A;  1S36 A;  2CCM A;  2WCB A;  2ZND A;  1L7Z A;  1BF5 A;  1KK7 Y;  1YVH A;  1XFX O;  1KWO B;  1XA5 A;  3HX4 A;  1SCM C;  1KQV A;  3GOF A;  3TUY C;  1KSM A;  4NDC A;  4GBA A;  4OR9 B;  2K2F A;  4GPL B;  2EC6 C;  2ZRS A;  3OP0 A;  2EGD A;  2JT0 A;  1K9P A;  1DGV A;  4ORA B;  4YI8 A;  2KAX A;  3GK1 A;  4DRW A;  4QJ4 B;  4GGN A;  1NCX A;  1K9U A;  1SY9 A;  1SNL A;  4YBH B;  1LVC D;  5F6T A;  4GGF A;  3JTD C;  3BQ3 A;  1SK6 D;  1WDC B;  2M7N A;  3CR2 A;  1DJZ A;  2E30 A;  3CTN A;  4I5L B;  4ORB B;  1K9K A;  4P2Y B;  4USL A;  5I2L A;  1ZAC A;  2I94 A;  2M7L A;  1SL9 A;  1B1G A;  3ICB A;  1B9A A;  1LIN A;  3BUN B;  1QLK A;  1PK0 D;  2LMU A;  2M3W A;  3O2P A;  3OHM B;  1JWD A;  1KQM B;  4PCW A;  1DMO A;  1BOC A;  1AP4 A;  2MAZ A;  4JWQ A;  4ETO A;  1A4P A;  1F8H A;  5CSN A;  1XFY O;  3H4S E;  2WND A;  2AUC A;  3NXA A;  1GJY A;  1A03 A;  1NCZ A;  3PLF B;  1B8R A;  1U5I A;  1FI5 A;  3SJS A;  1QV0 A;  3EK8 A;  1A75 A;  2KI6 C;  1CMF A;  1PSB A;  5GQQ C;  5K89 A;  1SBJ A;  4YGC B;  5DKN A;  1B7T Z;  3PAT A;  1YVL A;  4YGE B;  1IJ5 A;  2LP2 A;  1K2H A;  1MR8 A;  1FPW A;  1OOJ A;  1RTP 1;  4BY5 A;  4F0Z B;  1K8U A;  4UPG A;  4P5O E;  1UHJ A;  1K94 A;  3I5F B;  1GQM A;  2MJW B;  3KEV A;  4U8D A;  4YRU A;  5HKY A;  4QJ5 B;  4OV2 A;  1S5G Z;  1F55 A;  1AJ5 A;  5AEQ A;  2BCA A;  2ISD A;  4MSP A;  1TTX A;  1YRU B;  3LLE A;  4PE4 A;  4NQG A;  4PHJ A;  1XFW O;  2F2P A;  5AER A;  1IRJ A;  1K93 D;  1DT7 B;  1JBA A;  1RWY A;  4I5N B;  5JJG A;  2LMV A;  1G4Y R;  2K7D A;  3KPX A;  1OZO A;  2PVB A;  3BUW B;  3MSE B;  3CR4 X;  1S1E A;  1CDL A;  4ZCV A;  4PHK A;  2KBI A;  5ER5 A;  1JFK A;  2K7O A;  2MA2 A;  4I5J A;  3BOW B;  1XK4 C;  4FTG A;  1JF0 A;  2LLS A;  1AUI B;  1CB1 A;  1LA3 A;  3I5H B;  1ALV A;  1OQP A;  1SPY A;  4IL1 A;  1BG1 A;  4PHM A;  1YR5 A;  1SYM A;  2ZFD A;  3WNX B;  1A2X A;  3PAL A;  3DVK A;  3BUM B;  2LVV A;  1RK9 A;  1DJY A;  2FCE A; 
#chains in the Genus database with same CATH topology
 1B47 A;  1PVB A;  1TNW A;  2FOT A;  1C7W A;  1DEK A;  2IS9 A;  1TRF A;  1B7T Y;  1CKK A;  1PAL A;  1E8A A;  2FJU B;  2KI6 D;  3CYZ A;  1YUR A;  3OX6 A;  4MN0 A;  1CM4 A;  2M0R A;  1R2U A;  1TIZ A;  4C0K A;  3D0Y A;  3AKB A;  1OMR A;  1LS8 A;  4MEW A;  1ZMZ A;  5KU1 A;  4HSZ A;  1G33 A;  3FWB A;  2JPO A;  1KK8 B;  1UUS A;  1DJI A;  5FI2 A;  2B1U A;  2GGZ A;  3TS5 B;  1FBV A;  3OB2 B;  1CDM A;  1S5G Y;  5KSZ A;  3KO0 A;  3OB1 B;  3BYA A;  4JQ0 D;  2K7C A;  1R6P A;  4A4B A;  4MZL A;  2O60 A;  3KHE A;  3L4L A;  2BKH B;  1N2D A;  1Y6W A;  5DKQ A;  4CPV A;  1TUZ A;  1SW8 A;  1DJW A;  3I5I B;  2Y5I A;  1CFF A;  1BT6 A;  1VRK A;  1B4C A;  2CBL A;  5FI6 A;  1QS7 A;  2EHB A;  3F45 A;  4OCI A;  1QVI Z;  2LHL A;  4MRY A;  5HKZ A;  1MUX A;  1YTZ C;  3D0Y B;  1BU3 A;  4DUQ A;  2E6W A;  4FQT A;  1J1E A;  4KYN A;  3EVV A;  2O5G A;  2BKI B;  4INW A;  1IQ5 A;  5G08 A;  1EG3 A;  2H61 C;  2OS8 C;  1YRT B;  1Q80 A;  1CTR A;  1LKJ A;  2LM5 A;  4YGB B;  4TNC A;  2MHH A;  3B6X A;  4JD9 A;  2MRD A;  4PE7 A;  2K60 A;  2CT9 A;  3CZ0 A;  1QAS A;  4PHN A;  1BJF A;  3D76 A;  1UHN A;  1K90 D;  4OVN F;  2LLU A;  2BCB A;  1QV1 A;  5HLV A;  3NSI A;  2JWW A;  4GGF C;  5CSF A;  3O6B A;  2OTG B;  4CLN A;  1IWQ A;  1Y1X A;  2KBM A;  2L5X B;  1M46 A;  1S6C A;  1ODB A;  4A4C A;  4Q04 A;  3DF0 B;  1CDN A;  1SCM B;  1EXR A;  1SL7 A;  3TDZ A;  1AK8 A;  1DTL A;  3OBV A;  3TUY B;  3FS7 A;  2L2C A;  3SG3 A;  2MLE C;  2WCE A;  3CR5 X;  3L47 A;  4L9M A;  2M1K B;  2K61 A;  2EC6 B;  4NDD A;  2L98 A;  3B87 A;  2KOT A;  3S0F A;  3PN7 C;  3NSK A;  1L2O C;  4PE1 A;  1T14 A;  1SL8 A;  2F3Z A;  1KFX L;  1M31 A;  3AAJ A;  3QRX A;  2Y1M A;  5J3X A;  2CXJ A;  3FE8 A;  1DGU A;  1J55 A;  1QVI Y;  4E68 A;  2M1U A;  1MXE A;  3JTD B;  1NX0 A;  2LE9 B;  4QJ3 B;  1SR6 C;  1MWN A;  2LP3 A;  1YUU A;  3BOW A;  3JVT C;  2KFF A;  2A4J A;  1IQ3 A;  3CAB A;  1S3P A;  1RFJ A;  2ZN9 A;  2COL B;  3IF7 A;  4YI9 A;  2KDH A;  1F4O A;  2WOS A;  3CWG A;  3DVM A;  2NCO A;  3VB1 A;  3ZWH A;  2HET A;  2ZN8 A;  3FWC A;  4N1F A;  1DJX A;  3R1V A;  2M8U A;  4I5K A;  4BY4 A;  1B8C A;  5FYX A;  3SG6 A;  4HRG A;  2JTT A;  3SG5 A;  2G2B A;  2Q4U A;  1UWO A;  2KHN A;  2WC6 A;  3O4X A;  4HRE E;  2WC5 A;  3DVJ A;  3I5G C;  4OZD A;  3SIA A;  2MLF C;  2ZKM X;  3VRP A;  1J1D A;  2WCL A;  3TZ1 A;  2F33 A;  5TNC A;  3O78 A;  4D1E A;  1LXF C;  1QX2 A;  3O4Y A;  1BR4 B;  1ALW A;  2KI4 C;  1K96 A;  1W7I B;  1NP8 A;  1QTX A;  3WXA A;  1WRZ A;  2M97 A;  3VRN A;  5HYD A;  1YX7 A;  1BMO A;  2WOR A;  4DCK A;  1CFD A;  1XK4 A;  1BOD A;  1C7V A;  2AAO A;  2G9B A;  2SCP A;  1J7R A;  2K8M B;  3R1P A;  2BL0 C;  5KTY A;  1P28 A;  3D75 A;  3EKJ A;  1WLM A;  3LK0 A;  3UO9 A;  1KK7 Z;  1PVA A;  2L4I A;  1H4B A;  2JZI A;  2L4H A;  3EK4 A;  3S0G A;  3E3R A;  2LUX A;  3NSO A;  3SG2 A;  2LHI A;  3C1V A;  1J7P A;  2GV5 A;  1HQV A;  1WLZ A;  2M29 A;  2OPO A;  1NWD A;  2JNX A;  3B88 A;  3DVE A;  5D3O A;  4DS7 A;  3LK1 A;  2KNE A;  2JT3 A;  2JUL A;  4PE0 A;  1CNP A;  1JFJ A;  1NIW A;  3SS5 A;  3VGO A;  1CDP A;  4N5X A;  2JT8 A;  3ZNI A;  2LUC A;  1IKU A;  1QIV A;  3EVR A;  3EVU A;  1W9Z A;  1CLL A;  1ORG A;  2RGI A;  3K21 A;  1KWO C;  1M45 A;  3VRR A;  1JSA A;  2LAP A;  3B86 A;  2JU0 A;  1DC1 A;  1CFC A;  2KAY A;  1DJG A;  1G8I A;  3LCP C;  1KFU L;  1MF8 B;  2JPT A;  2KLE A;  2HPS A;  1NX1 A;  1NYA A;  5HLO A;  3EK7 A;  2K2A A;  2WCF A;  3DXL A;  1UHH A;  2JQ6 A;  2QDI A;  3RZS A;  4M2P A;  1XVJ A;  4ZCU A;  2JXC A;  4MLW A;  4ORC B;  1GGZ A;  2JXL A;  1SCV A;  2M9G A;  1OMD A;  3IQO A;  1EG4 A;  5AAN A;  3RLZ A;  2L5Y A;  3D10 A;  3VRO A;  5D7F A;  1UHI A;  4CFQ A;  2LVI A;  1JC2 A;  4YGA A;  1WDC C;  1QWV A;  1FW4 A;  1XFV O;  3SS4 A;  1CMG A;  2BBN A;  3L4A A;  1KSO A;  2P71 A;  5CPV A;  2JC2 A;  5JOL A;  2NXQ A;  3DF0 A;  1SKT A;  4IJ7 A;  4N1G A;  3SS3 A;  4C0L A;  4WRI A;  4GUK A;  1C3Z A;  2KFG A;  5B8I B;  4CFR A;  5DIC A;  1KQM C;  1XFZ O;  1ZOT B;  3BJH A;  1NCY A;  1CM1 A;  2ZNE A;  4ICB A;  1TWO A;  2JRF A;  2KQ6 A;  2F3Y A;  1XFR A;  2KYF A;  3WHT B;  2M49 B;  1M63 B;  4MZK A;  2LLT A;  3VRQ A;  3GK2 A;  2BCX A;  3PSR A;  1QLS A;  2I2R E;  2I7A A;  3BUX B;  2H61 A;  3D77 A;  2L0P A;  4MVF A;  3RM1 A;  1IG5 A;  2NLN A;  2JNF A;  1KFU S;  3CZT X;  1V1G A;  2BBM A;  2QAC A;  3FIA A;  1UP5 A;  2KGR A;  1PRW A;  4XJK A;  1Y0V H;  2PSR A;  4GNK B;  2F2O A;  4M2Q A;  1H8B A;  2SAS A;  2WCH A;  5IBW A;  1F54 A;  1OZS A;  3CZ1 A;  1SRA A;  1NX2 A;  3EG5 B;  3LL8 B;  1OOF A;  1REC A;  2KFH A;  2KAV A;  3A8R A;  1S6I A;  5I8N A;  1S26 D;  4GFT A;  1QX7 A;  4GAO A;  4M2O A;  2GTE A;  1OSA A;  3BFA A;  3I5F C;  5I2O A;  1QAT A;  1K95 A;  1Z2C B;  2PYQ A;  3PM2 A;  1AHR A;  1TOP A;  2L50 A;  2HQ8 A;  4MZJ A;  5D69 A;  1WRL A;  1ZUZ A;  2Q91 A;  1TNP A;  2OS8 B;  4YGD B;  3D74 A;  2GGM A;  1TCF A;  2BE6 A;  2KGB C;  2WCJ A;  5EL2 A;  3SG4 A;  2LC5 A;  4PT1 A;  2FCD A;  3DD4 A;  1A29 A;  4XJK B;  1N0Y A;  2VRG A;  2MBX A;  1NPQ A;  1WY9 A;  4C0J A;  5ER4 X;  1OOG A;  3M0W A;  4MRX A;  1N65 A;  1TN4 A;  2TN4 A;  1YX8 A;  2R2I A;  3NHI A;  1EL4 A;  1UUR A;  1MQ1 A;  3FE6 A;  1EJ3 A;  1W7J B;  2I18 A;  2K0J A;  3I5H C;  1J7Q A;  3R72 A;  2PAS A;  3TDI A;  3NHT A;  2JOJ A;  1JUO A;  5AXI A;  1AJ4 A;  1NSH A;  1CFP A;  2PMY A;  1TUJ A;  3BUO B;  3AKA A;  3EKH A;  4XYN A;  4AQI A;  3S0A A;  4PDZ A;  3IQQ A;  2F8P A;  1NUB A;  1PSR A;  2LVK A;  1GM0 A;  2QEO A;  3NSL A;  3GK4 X;  1IGV A;  2PRU A;  3PN7 B;  1L2O B;  2LVJ A;  1BR1 B;  1UHK A;  2BEC A;  2PAL A;  3HCM A;  1KFX S;  1M39 A;  1XFU O;  1CLB A;  3CS1 A;  2CNP A;  2V53 A;  1U5I B;  4WQ3 A;  1ZFS A;  2KYC A;  2JTZ A;  3NGV A;  5PAL A;  1A75 B;  1OE9 B;  1RRO A;  1SR6 B;  2QEV A;  1DJH A;  5CSJ A;  3TDU A;  1QXP A;  2LAN A;  4JPZ B;  3JVT B;  2QEB A;  1BLQ A;  3QME A;  3S0D A;  1F4Q A;  1PUL A;  5CSI A;  1TNQ A;  2P70 A;  4F7F A;  1B8L A;  1KK8 C;  2D8N A;  1Y1U A;  3SIB A;  3TS5 C;  2YGU A;  1XYD A;  1XO5 A;  1JF2 A;  4HRH A;  2Y4Q A;  1SMG A;  1IH0 A;  5AFP A;  2L2E A;  3OX5 A;  5BPJ A;  3Q8I A;  2K7B A;  4OKH A;  1QX5 B;  1S6J A;  4MBE A;  2KLD A;  3D78 A;  1KCY A;  4AQJ A;  1MHO A;  3CGA A;  3I5I C;  2H2K A;  3BXK A;  2KQY A;  3KF9 A;  1DF0 A;  1IJ6 A;  1F70 A;  3AAK A;  3SG7 A;  3I5G B;  5DKR A;  2QPT A;  2BE4 A;  3BFH A;  1CLM A;  1X02 A;  3PFV A;  1NX3 A;  1F71 A;  2AMI A;  1EH2 A;  3A4U B;  3WHU B;  3IVT A;  1OMV A;  1RJV A;  1V1F A;  4NDB A;  1QJT A;  1FI6 A;  2KI4 B;  2NCP A;  2KSP A;  4AOM A;  1J7O A;  1OOI X;  1IIO A;  2L51 A;  1GGW A;  5HKW A;  4R1E A;  4FQO A;  1Y1A A;  1TNX A;  1LA0 A;  2BL0 B;  2QEH A;  3CLN A;  2Y1N A;  2CTN A;  4PAL A;  4WQ2 A;  4DIR A;  1SSE B;  1HT9 A;  1TCO B;  2FJY A;  2LMT A;  1YUT A;  1DVI A;  2HQW A;  2WC8 A;  4CID A;  1WRK A;  1D1O A;  1DF0 B;  1QIW A;  2P6B B;  3PM8 A;  5I2Q A;  2ZRT A;  1C07 A;  2HF5 A;  2DOQ A;  2NZ0 A;  2LV7 A;  1AVS A;  2OTG C;  1FF1 A;  1MXL C;  2LNK A;  2LCP A;  1YUS A;  1S36 A;  2CCM A;  3D73 A;  2WCB A;  2ZND A;  1L7Z A;  1BF5 A;  1KK7 Y;  1YVH A;  1XFX O;  1KWO B;  1XA5 A;  3HX4 A;  1SCM C;  3V2L A;  3GOF A;  1KQV A;  3CDN A;  2KPH A;  3TUY C;  4JKT A;  1KSM A;  4NDC A;  4GBA A;  4OR9 B;  2K2F A;  5HL1 A;  4GPL B;  2EC6 C;  2ZRS A;  3OP0 A;  2EGD A;  2JT0 A;  3B7A A;  1K9P A;  1DGV A;  4ORA B;  4YI8 A;  2KAX A;  3GK1 A;  4DRW A;  3FE9 A;  4QJ4 B;  4GGN A;  1NCX A;  2BNX A;  1K9U A;  2H8V A;  1OOH A;  1SY9 A;  1SNL A;  4YBH B;  1LVC D;  5F6T A;  3UNW A;  4GGF A;  3JTD C;  3BQ3 A;  1SK6 D;  1WDC B;  2M7N A;  3CR2 A;  1DJZ A;  2E30 A;  3CTN A;  4I5L B;  4ORB B;  1K9K A;  4P2Y B;  4USL A;  5I2L A;  1ZAC A;  2ERB A;  2I94 A;  1OW4 A;  1SL9 A;  2M7L A;  1B1G A;  3ICB A;  1B9A A;  1LIN A;  3S0E A;  2PQL A;  1QLK A;  3BUN B;  1PK0 D;  2LMU A;  2M3W A;  3DY9 A;  3N7H A;  3O2P A;  3OHM B;  1JWD A;  1KQM B;  4PCW A;  4INX A;  1DMO A;  1BOC A;  1AP4 A;  2MAZ A;  4JWQ A;  4ETO A;  1A4P A;  1F8H A;  5CSN A;  1XFY O;  3H4S E;  2WND A;  2AUC A;  3NXA A;  1GJY A;  1A03 A;  1NCZ A;  3PLF B;  1B8R A;  1U5I A;  1FI5 A;  3SJS A;  1QV0 A;  3EK8 A;  1A75 A;  2KI6 C;  1CMF A;  1PSB A;  3DYE A;  5GQQ C;  5K89 A;  1SBJ A;  4YGC B;  5DKN A;  1B7T Z;  3PAT A;  1YVL A;  2BAP A;  4YGE B;  1IJ5 A;  2LP2 A;  3CZ2 A;  1K2H A;  1DEL A;  1MR8 A;  1FPW A;  1OOJ A;  1RTP 1;  4BY5 A;  4F0Z B;  1K8U A;  3PJI A;  4UPG A;  1Z4H A;  4P5O E;  1UHJ A;  1K94 A;  3I5F B;  1GQM A;  2MJW B;  3S0B A;  3KEV A;  4U8D A;  4YRU A;  5HKY A;  4QJ5 B;  3OGN A;  4OV2 A;  1S5G Z;  1F55 A;  1AJ5 A;  5AEQ A;  2BCA A;  2ISD A;  4MSP A;  1TTX A;  1YRU B;  3LLE A;  4PE4 A;  4NQG A;  4PHJ A;  1XFW O;  2F2P A;  5FI7 A;  5AER A;  1IRJ A;  1K93 D;  1DT7 B;  1JBA A;  1RWY A;  4I5N B;  5JJG A;  2LMV A;  1G4Y R;  2K7D A;  3KPX A;  1OZO A;  2PVB A;  3BUW B;  3MSE B;  3CR4 X;  1S1E A;  1CDL A;  4ZCV A;  1C3Y A;  4PHK A;  2KBI A;  5ER5 A;  1JFK A;  2K7O A;  2MA2 A;  4I5J A;  3BOW B;  5I94 A;  1XK4 C;  3DZT A;  4FTG A;  2WCM A;  1JF0 A;  2LLS A;  1AUI B;  3K1E A;  1CB1 A;  1LA3 A;  3I5H B;  1ALV A;  1OQP A;  1SPY A;  4IL1 A;  1BG1 A;  4PHM A;  1YR5 A;  1SYM A;  2ZFD A;  3R1O A;  3WNX B;  1A2X A;  3PAL A;  1DQE A;  3BFB A;  3DVK A;  3BUM B;  2LVV A;  2WCK A;  1RK9 A;  1DJY A;  2FCE A; 
#chains in the Genus database with same CATH homology
 1B47 A;  1PVB A;  1TNW A;  2FOT A;  1C7W A;  2IS9 A;  1TRF A;  1B7T Y;  1CKK A;  1PAL A;  1E8A A;  2FJU B;  2KI6 D;  1YUR A;  3OX6 A;  4MN0 A;  1CM4 A;  2M0R A;  1R2U A;  1TIZ A;  4C0K A;  3D0Y A;  3AKB A;  1OMR A;  4MEW A;  1ZMZ A;  5KU1 A;  4HSZ A;  1G33 A;  3FWB A;  1KK8 B;  1UUS A;  1DJI A;  2B1U A;  2GGZ A;  3TS5 B;  1FBV A;  3OB2 B;  1CDM A;  1S5G Y;  5KSZ A;  3KO0 A;  3OB1 B;  3BYA A;  4JQ0 D;  2K7C A;  1R6P A;  4A4B A;  4MZL A;  2O60 A;  3KHE A;  2BKH B;  1N2D A;  1Y6W A;  5DKQ A;  4CPV A;  1SW8 A;  1DJW A;  3I5I B;  2Y5I A;  1CFF A;  1BT6 A;  1VRK A;  1B4C A;  2CBL A;  1QS7 A;  2EHB A;  3F45 A;  4OCI A;  1QVI Z;  2LHL A;  4MRY A;  5HKZ A;  1MUX A;  1YTZ C;  3D0Y B;  1BU3 A;  4DUQ A;  2E6W A;  1J1E A;  3EVV A;  2O5G A;  2BKI B;  1IQ5 A;  5G08 A;  1EG3 A;  2H61 C;  2OS8 C;  1YRT B;  1Q80 A;  1CTR A;  1LKJ A;  2LM5 A;  4YGB B;  4TNC A;  2MHH A;  2MRD A;  4PE7 A;  2CT9 A;  1QAS A;  4PHN A;  1BJF A;  1UHN A;  1K90 D;  4OVN F;  2LLU A;  2BCB A;  1QV1 A;  5HLV A;  3NSI A;  2JWW A;  4GGF C;  5CSF A;  3O6B A;  2OTG B;  4CLN A;  1IWQ A;  1Y1X A;  2KBM A;  2L5X B;  1M46 A;  1S6C A;  1ODB A;  4A4C A;  4Q04 A;  3DF0 B;  1CDN A;  1SCM B;  1EXR A;  1SL7 A;  3TDZ A;  1AK8 A;  1DTL A;  3TUY B;  3FS7 A;  3SG3 A;  2MLE C;  2WCE A;  3CR5 X;  4L9M A;  2M1K B;  2K61 A;  2EC6 B;  4NDD A;  2L98 A;  2KOT A;  3PN7 C;  3NSK A;  1L2O C;  4PE1 A;  1SL8 A;  2F3Z A;  1KFX L;  1M31 A;  3AAJ A;  3QRX A;  2Y1M A;  5J3X A;  2CXJ A;  1DGU A;  1J55 A;  1QVI Y;  4E68 A;  2M1U A;  1MXE A;  3JTD B;  1NX0 A;  2LE9 B;  4QJ3 B;  1SR6 C;  1MWN A;  2LP3 A;  1YUU A;  3BOW A;  3JVT C;  2KFF A;  2A4J A;  1IQ3 A;  1S3P A;  1RFJ A;  2ZN9 A;  2COL B;  3IF7 A;  4YI9 A;  2KDH A;  1F4O A;  2WOS A;  3CWG A;  3DVM A;  2NCO A;  3ZWH A;  2HET A;  2ZN8 A;  3FWC A;  4N1F A;  1DJX A;  2M8U A;  4I5K A;  4BY4 A;  1B8C A;  5FYX A;  3SG6 A;  4HRG A;  2JTT A;  3SG5 A;  2G2B A;  2Q4U A;  1UWO A;  2KHN A;  4HRE E;  3DVJ A;  3I5G C;  3SIA A;  2MLF C;  2ZKM X;  3VRP A;  1J1D A;  3TZ1 A;  2F33 A;  5TNC A;  3O78 A;  4D1E A;  1LXF C;  1QX2 A;  3O4Y A;  1BR4 B;  1ALW A;  2KI4 C;  1K96 A;  1W7I B;  1NP8 A;  1QTX A;  3WXA A;  1WRZ A;  2M97 A;  3VRN A;  5HYD A;  1YX7 A;  1BMO A;  2WOR A;  4DCK A;  1CFD A;  1XK4 A;  1BOD A;  1C7V A;  2AAO A;  2G9B A;  2SCP A;  1J7R A;  2K8M B;  5KTY A;  2BL0 C;  3EKJ A;  1WLM A;  3LK0 A;  1KK7 Z;  1PVA A;  2L4I A;  1H4B A;  2JZI A;  2L4H A;  3EK4 A;  3SG2 A;  3E3R A;  2LUX A;  3NSO A;  1J7P A;  2LHI A;  3C1V A;  2GV5 A;  1HQV A;  1WLZ A;  2M29 A;  2OPO A;  1NWD A;  2JNX A;  3DVE A;  4DS7 A;  3LK1 A;  2KNE A;  2JT3 A;  2JUL A;  4PE0 A;  1CNP A;  1JFJ A;  1NIW A;  3VGO A;  1CDP A;  4N5X A;  2JT8 A;  3ZNI A;  2LUC A;  1IKU A;  1QIV A;  3EVR A;  3EVU A;  1CLL A;  3VRR A;  2RGI A;  3K21 A;  1KWO C;  1M45 A;  1JSA A;  2LAP A;  2JU0 A;  1CFC A;  2KAY A;  1DJG A;  1G8I A;  3LCP C;  1KFU L;  1MF8 B;  2JPT A;  2HPS A;  1NX1 A;  1NYA A;  5HLO A;  3EK7 A;  2K2A A;  2WCF A;  1UHH A;  2JQ6 A;  4M2P A;  1XVJ A;  4ZCU A;  2JXC A;  4MLW A;  4ORC B;  1GGZ A;  2JXL A;  1SCV A;  2M9G A;  1OMD A;  3IQO A;  1EG4 A;  5AAN A;  3RLZ A;  3D10 A;  3VRO A;  5D7F A;  1UHI A;  4CFQ A;  2LVI A;  1JC2 A;  4YGA A;  1WDC C;  1FW4 A;  1XFV O;  1CMG A;  2BBN A;  1KSO A;  5CPV A;  2JC2 A;  5JOL A;  2NXQ A;  3DF0 A;  1SKT A;  4N1G A;  4C0L A;  4WRI A;  4GUK A;  2KFG A;  5B8I B;  4CFR A;  1KQM C;  1XFZ O;  1ZOT B;  1NCY A;  1CM1 A;  2ZNE A;  4ICB A;  2JRF A;  2KQ6 A;  2F3Y A;  2KYF A;  3WHT B;  2M49 B;  1M63 B;  4MZK A;  2LLT A;  3VRQ A;  3GK2 A;  2BCX A;  3PSR A;  1QLS A;  2I2R E;  2I7A A;  3BUX B;  2H61 A;  4MVF A;  2L0P A;  3RM1 A;  1IG5 A;  2NLN A;  2JNF A;  1KFU S;  3CZT X;  1V1G A;  2BBM A;  2QAC A;  3FIA A;  1UP5 A;  2KGR A;  1PRW A;  4XJK A;  1Y0V H;  2PSR A;  4GNK B;  2F2O A;  4M2Q A;  1H8B A;  2SAS A;  5IBW A;  1F54 A;  1OZS A;  1SRA A;  1NX2 A;  3LL8 B;  2KFH A;  1REC A;  2KAV A;  3A8R A;  1S6I A;  5I8N A;  1S26 D;  4GFT A;  1QX7 A;  4GAO A;  4M2O A;  1OSA A;  3I5F C;  5I2O A;  1QAT A;  1K95 A;  1AHR A;  1TOP A;  2L50 A;  2HQ8 A;  4MZJ A;  5D69 A;  1WRL A;  1ZUZ A;  2Q91 A;  1TNP A;  2OS8 B;  4YGD B;  2GGM A;  1TCF A;  2BE6 A;  2KGB C;  3SG4 A;  2LC5 A;  2FCD A;  3DD4 A;  1A29 A;  4XJK B;  1N0Y A;  2VRG A;  2MBX A;  1NPQ A;  1WY9 A;  4C0J A;  5ER4 X;  3M0W A;  4MRX A;  1N65 A;  1TN4 A;  2TN4 A;  1YX8 A;  2R2I A;  1EL4 A;  1UUR A;  1MQ1 A;  1EJ3 A;  1W7J B;  2I18 A;  2K0J A;  3I5H C;  1J7Q A;  2PAS A;  3TDI A;  2JOJ A;  1JUO A;  5AXI A;  1AJ4 A;  1NSH A;  1CFP A;  2PMY A;  3BUO B;  3EKH A;  3AKA A;  4AQI A;  4XYN A;  4PDZ A;  3IQQ A;  2F8P A;  1NUB A;  1PSR A;  2LVK A;  3NSL A;  3GK4 X;  1IGV A;  2PRU A;  3PN7 B;  1L2O B;  2LVJ A;  1BR1 B;  1UHK A;  2BEC A;  2PAL A;  3HCM A;  1KFX S;  1M39 A;  1XFU O;  1CLB A;  3CS1 A;  2CNP A;  2V53 A;  1U5I B;  4WQ3 A;  1ZFS A;  2KYC A;  2JTZ A;  5PAL A;  1A75 B;  1OE9 B;  1RRO A;  1SR6 B;  1DJH A;  5CSJ A;  3TDU A;  1QXP A;  2LAN A;  4JPZ B;  3JVT B;  1BLQ A;  1F4Q A;  1PUL A;  5CSI A;  1TNQ A;  1B8L A;  1KK8 C;  2D8N A;  1Y1U A;  3SIB A;  3TS5 C;  1XYD A;  1XO5 A;  1JF2 A;  4HRH A;  2Y4Q A;  1SMG A;  1IH0 A;  5AFP A;  2L2E A;  3OX5 A;  5BPJ A;  2K7B A;  4OKH A;  1QX5 B;  1S6J A;  4MBE A;  1KCY A;  4AQJ A;  1MHO A;  3CGA A;  3I5I C;  2H2K A;  3BXK A;  2KQY A;  3KF9 A;  1DF0 A;  1IJ6 A;  1F70 A;  3AAK A;  3SG7 A;  3I5G B;  5DKR A;  2QPT A;  2BE4 A;  1CLM A;  1X02 A;  3PFV A;  1NX3 A;  1F71 A;  2AMI A;  1EH2 A;  3A4U B;  3WHU B;  1OMV A;  1RJV A;  1V1F A;  4NDB A;  1QJT A;  1FI6 A;  2KI4 B;  2NCP A;  2KSP A;  4AOM A;  1J7O A;  2L51 A;  1GGW A;  5HKW A;  4R1E A;  4FQO A;  1Y1A A;  1TNX A;  1LA0 A;  2BL0 B;  3CLN A;  2Y1N A;  2CTN A;  4PAL A;  4WQ2 A;  4DIR A;  1HT9 A;  1TCO B;  2LMT A;  1YUT A;  1DVI A;  2HQW A;  2WC8 A;  4CID A;  1WRK A;  1D1O A;  1DF0 B;  1QIW A;  2P6B B;  3PM8 A;  5I2Q A;  2ZRT A;  1C07 A;  2HF5 A;  2DOQ A;  2NZ0 A;  2LV7 A;  1AVS A;  2OTG C;  1FF1 A;  1MXL C;  2LNK A;  2LCP A;  1YUS A;  1S36 A;  2CCM A;  2WCB A;  2ZND A;  1L7Z A;  1BF5 A;  1KK7 Y;  1YVH A;  1XFX O;  1KWO B;  1XA5 A;  3HX4 A;  1SCM C;  1KQV A;  3GOF A;  3TUY C;  1KSM A;  4NDC A;  4GBA A;  4OR9 B;  2K2F A;  4GPL B;  2EC6 C;  2ZRS A;  3OP0 A;  2EGD A;  2JT0 A;  1K9P A;  1DGV A;  4ORA B;  4YI8 A;  2KAX A;  3GK1 A;  4DRW A;  4QJ4 B;  4GGN A;  1NCX A;  1K9U A;  1SY9 A;  1SNL A;  4YBH B;  1LVC D;  5F6T A;  4GGF A;  3JTD C;  3BQ3 A;  1SK6 D;  1WDC B;  2M7N A;  3CR2 A;  1DJZ A;  2E30 A;  3CTN A;  4I5L B;  4ORB B;  1K9K A;  4P2Y B;  4USL A;  5I2L A;  1ZAC A;  2I94 A;  2M7L A;  1SL9 A;  1B1G A;  3ICB A;  1B9A A;  1LIN A;  3BUN B;  1QLK A;  1PK0 D;  2LMU A;  2M3W A;  3O2P A;  3OHM B;  1JWD A;  1KQM B;  4PCW A;  1DMO A;  1BOC A;  1AP4 A;  2MAZ A;  4JWQ A;  4ETO A;  1A4P A;  1F8H A;  5CSN A;  1XFY O;  3H4S E;  2WND A;  2AUC A;  3NXA A;  1GJY A;  1A03 A;  1NCZ A;  3PLF B;  1B8R A;  1U5I A;  1FI5 A;  3SJS A;  1QV0 A;  3EK8 A;  1A75 A;  2KI6 C;  1CMF A;  1PSB A;  5GQQ C;  5K89 A;  1SBJ A;  4YGC B;  5DKN A;  1B7T Z;  3PAT A;  1YVL A;  4YGE B;  1IJ5 A;  2LP2 A;  1K2H A;  1MR8 A;  1FPW A;  1OOJ A;  1RTP 1;  4BY5 A;  4F0Z B;  1K8U A;  4UPG A;  4P5O E;  1UHJ A;  1K94 A;  3I5F B;  1GQM A;  2MJW B;  3KEV A;  4U8D A;  4YRU A;  5HKY A;  4QJ5 B;  4OV2 A;  1S5G Z;  1F55 A;  1AJ5 A;  5AEQ A;  2BCA A;  2ISD A;  4MSP A;  1TTX A;  1YRU B;  3LLE A;  4PE4 A;  4NQG A;  4PHJ A;  1XFW O;  2F2P A;  5AER A;  1IRJ A;  1K93 D;  1DT7 B;  1JBA A;  1RWY A;  4I5N B;  5JJG A;  2LMV A;  1G4Y R;  2K7D A;  3KPX A;  1OZO A;  2PVB A;  3BUW B;  3MSE B;  3CR4 X;  1S1E A;  1CDL A;  4ZCV A;  4PHK A;  2KBI A;  5ER5 A;  1JFK A;  2K7O A;  2MA2 A;  4I5J A;  3BOW B;  1XK4 C;  4FTG A;  1JF0 A;  2LLS A;  1AUI B;  1CB1 A;  1LA3 A;  3I5H B;  1ALV A;  1OQP A;  1SPY A;  4IL1 A;  1BG1 A;  4PHM A;  1YR5 A;  1SYM A;  2ZFD A;  3WNX B;  1A2X A;  3PAL A;  3DVK A;  3BUM B;  2LVV A;  1RK9 A;  1DJY A;  2FCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...