1IIOA

Nmr-based structure of the conserved protein mth865 from the archea methanobacterium thermoautotrophicum
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
84
Chain Sequence
GSHMKMGVKEDIRGQIIGALAGADFPINSPEELMAALPNGPDTTCKSGDVELKASDAGQVLTADDFPFKSAEEVADTIVNKAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein MTH865
publication title NMR-based structure of the conserved protein MTH865 from the archaeon Methanobacterium thermoautotrophicum.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 17
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2001-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07747 MTH865 MTH865-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.80 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 MTH865-like 1iioA00
1IIOA
chains in the Genus database with same CATH superfamily
4Q04A 1M31A 1B47A 1PVAA 3PLFB 2ZNEA 3CYZA 3JTDB 1PSBA 1QV1A 4XJKB 1F55A 2QEHA 3JVTB 3CR5X 1PULA 2JZIA 4MLWA 2ISDA 1YRTB 1FI5A 1OMRA 3AKBA 3D75A 1NIWA 2MBXA 3TUYB 4AOMA 4PE0A 1C07A 5K89A 2BNXA 3VRQA 1YUSA 3BUWB 5F6TA 1NYAA 2KFHA 2KLDA 2RGIA 2LVIA 3NSKA 3RZSA 3CZ2A 1MWNA 1SR6B 1D1OA 1K96A 1SKTA 3BOWA 1N65A 3ZNIA 4F0ZB 3I5FB 2ERBA 4JWQA 2ZN8A 1CFDA 2OS8B 2PQLA 3D0YA 4ZCVA 3VROA 3CDNA 2H61C 2ZRSA 3PATA 1QWVA 4FQOA 5I2QA 1MXEA 2I18A 2G2BA 1PK0D 1XFRA 1DT7B 1DJIA 4JQ0D 1YUUA 1WDCC 1B8RA 1MQ1A 5HL1A 2KQ6A 1KFXS 1SCMB 2GGMA 2OTGB 2WCBA 1E8AA 3MSEB 1K8UA 3I5IC 4GUKA 1GM0A 2WCHA 1MXLC 1B9AA 2KFFA 1RWYA 1SPYA 1Y0VH 2Q91A 2L4HA 4CIDA 3CABA 2A4JA 4GGFA 2KI6C 4MBEA 4P2YB 2CBLA 5IBWA 1QVIZ 2FJYA 2KYCA 5FI6A 2M1KB 2HQWA 4ZCUA 3NSIA 4PALA 1G8IA 3HCMA 1ZOTB 3KEVA 4GNKB 5CSNA 1K9UA 3ICBA 2WNDA 2JNXA 3DVEA 3FS7A 4IJ7A 2L50A 1CFFA 1QIVA 4L9MA 1MF8B 2KQYA 3CGAA 3AKAA 2E6WA 1A75A 1IRJA 2QEOA 2OPOA 1N0YA 2ZRTA 4OVNF 3OX6A 3OX5A 2KYFA 4I5JA 1EG4A 4MSPA 3O2PA 4E68A 2LUXA 2JRFA 5G08A 5DKQA 3SG3A 1KWOC 2LMVA 2LVKA 2PALA 3IF7A 3DZTA 3D78A 1WLMA 2AMIA 1IQ3A 2JT0A 1PVBA 4C0JA 1YX7A 1XYDA 4PHJA 4N5XA 3K1EA 4UPGA 1KQMC 2L2CA 1M46A 2JPOA 4U8DA 1TUJA 2LE9B 3CLNA 5ER5A 4DS7A 1WRKA 1F8HA 1BJFA 3EK7A 1TIZA 1A29A 3VGOA 2LUCA 2MAZA 3LCPC 4AQIA 4YBHB 3EVVA 2FCDA 1CDLA 1SRAA 3EVRA 3NSOA 1CDPA 2K7CA 4JKTA 1TCFA 1LS8A 1ORGA 4D1EA 2KFGA 1BR1B 1OOHA 2MA2A 1CKKA 2BCBA 1K2HA 1JC2A 2KBMA 1TOPA 2LLSA 3EKHA 3BOWB 1F4QA 1IQ5A 1PALA 2JNFA 1TTXA 2LC5A 1IIOA 4N1GA 3B87A 1UP5A 4A4BA 1DGVA 2EHBA 1AP4A 2F2OA 1J55A 1DJWA 2P6BB 2FOTA 1HQVA 1VRKA 2MLEC 1C3YA 4PT1A 3TS5C 1ALVA 5DKRA 1NCXA 1G33A 1YRUB 2QDIA 2WCKA 2WCLA 3I5GB 1RECA 3EVUA 3TDIA 2H2KA 3BYAA 1DJGA 1B1GA 1S36A 3CWGA 1MUXA 3S0DA 1BU3A 3B86A 2PASA 1YVLA 2K2FA 2LMUA 1DMOA 3L4LA 1JF2A 3DYEA 5EL2A 2BBMA 2LANA 1S6CA 1UUSA 3K21A 2F33A 2KAYA 4PHMA 3B7AA 2COLB 1W7JB 1AJ4A 2Y1MA 3DXLA 3CZ0A 4PDZA 3SS4A 1DF0A 1CDMA 3C1VA 1SY9A 1OSAA 1V1GA 3A4UB 2M0RA 4AQJA 1SK6D 1WLZA 1QTXA 4MEWA 3L47A 2LVVA 3LK1A 1JFKA 3QMEA 1QIWA 2P71A 2ZKMX 2CT9A 3KHEA 2NLNA 2LP3A 1TWOA 1XA5A 4GFTA 1DTLA 2HQ8A 1IJ5A 2F8PA 1KFUL 1F70A 3SG5A 3M0WA 2HF5A 3BUOB 1K9KA 3WNXB 1F4OA 1WDCB 1NCZA 3L4AA 3EK8A 4USLA 2K7DA 1U5IA 3SG4A 1S26D 4MZKA 5TNCA 1XFWO 4ORAB 2PMYA 3JVTC 4INWA 2NXQA 1IWQA 5KTYA 3FE6A 2EC6B 1J1DA 3FWBA 3OHMB 3TUYC 1CFCA 1AVSA 1OOFA 4MN0A 4PE4A 1UURA 3DD4A 3SG6A 1QX5B 1BLQA 5GQQC 1OMVA 2KPHA 2PSRA 1DQEA 2QEVA 1KK7Z 1S5GZ 1SR6C 1BT6A 2AUCA 2BE6A 1K90D 4QJ4B 1TNXA 1QJTA 2B1UA 4PE1A 2L98A 1F71A 5I8NA 2OS8C 4HRHA 1F54A 1LA0A 1BMOA 4CFRA 2LM5A 3BUMB 2M1UA 2LP2A 3IQQA 2AAOA 3NHIA 1LXFC 3EK4A 3GOFA 3OGNA 5HKWA 2KNEA 4C0KA 1GQMA 1CLLA 4C0LA 1Y6WA 5HKYA 1S6IA 1QLSA 1XO5A 3UNWA 2BCAA 4INXA 5I2OA 1PSRA 2L4IA 1EJ3A 2OTGC 2SCPA 2BECA 1DGUA 2JXLA 2MHHA 4DCKA 1J7RA 3AAKA 1FW4A 3DF0A 1TNWA 1FI6A 1K95A 2K2AA 4MRYA 1DVIA 3WHTB 1DJZA 1GGZA 3SS5A 3CR2A 1ZMZA 5CSJA 1OOIX 1KQMB 2NCOA 4PCWA 3R1PA 1DJHA 5CSFA 3H4SE 3PFVA 1TN4A 1YTZC 4XJKA 1CLMA 1B7TZ 3FE8A 3IVTA 4ORBB 2M29A 2O60A 5KSZA 2NCPA 4NDCA 3PM8A 1JWDA 1OQPA 1XFXO 2YGUA 1KSOA 2HETA 3S0FA 3TDUA 4YGCB 2LVJA 2QPTA 1S3PA 2JTZA 1YVHA 5D7FA 4ORCB 4OKHA 5FI7A 4BY4A 1J7QA 1SL7A 2JPTA 3GK1A 5JJGA 1OZOA 2JQ6A 4YGEB 5ER4X 1JUOA 4JPZB 1EL4A 3DY9A 4WRIA 2LHLA 3PSRA 4TNCA 2M8UA 1QVIY 1NX1A 3D77A 1H4BA 2PYQA 1KK7Y 2R2IA 2D8NA 2LNKA 4GPLB 5JOLA 2L51A 2KI4C 1SMGA 3B88A 2WCJA 3D0YB 4IL1A 3V2LA 1J7PA 3TS5B 3IQOA 1QS7A 3S0BA 1B8CA 1EH2A 3LL8B 2ZN9A 3PN7C 2KI6D 2GTEA 2WC5A 3D76A 4MVFA 1BF5A 1NPQA 1QLKA 1Z4HA 3LK0A 3GK2A 1A4PA 2VRGA 3KF9A 1XVJA 3BFBA 1UWOA 4NDDA 5FI2A 1XFVO 1M63B 1EG3A 5D69A 2FJUB 1KK8B 1BG1A 1QX2A 3OB1B 1NP8A 1JF0A 3DVKA 4XYNA 5DKNA 2JTTA 2KLEA 2QEBA 1KCYA 1L2OC 4GAOA 4MZLA 1W9ZA 1UHIA 3D73A 4CFQA 3ZWHA 1S6JA 1WRLA 2EGDA 2JC2A 2O5GA 1OE9B 1NX2A 1SCVA 4YGDB 1LKJA 1AHRA 3SIBA 2K8MB 1SNLA 1BOCA 5CSIA 2BKIB 3PJIA 1CM4A 2KDHA 2QACA 2M3WA 1FPWA 4YI9A 3SG7A 2LLTA 1J1EA 4YI8A 3WXAA 1TRFA 1A75B 3Q8IA 4HRGA 1FBVA 3I5HC 1HT9A 1W7IB 3OB2B 2JU0A 1LINA 5D3OA 2Y5IA 1NCYA 2KGBC 2MJWB 2CTNA 1KFUS 3DF0B 3CZTX 3PM2A 2WCFA 4M2OA 3KO0A 3EG5B 2BL0C 2K60A 2WOSA 3OBVA 1JFJA 1Y1UA 3O4XA 1C3ZA 4I5LB 1MR8A 3PALA 1ODBA 1CDNA 4FTGA 2FCEA 2HPSA 3BJHA 5PALA 2M9GA 2LAPA 3A8RA 1IJ6A 2LV7A 2KGRA 2H8VA 3JTDC 3S0AA 1CLBA 1XK4C 1K93D 1LVCD 3I5IB 1YX8A 1P28A 3OP0A 4FQTA 3HX4A 2K7BA 2I2RE 1UHNA 3NHTA 1A03A 4MZJA 3R1OA 3R1VA 1XFYO 1TNQA 2PRUA 1DELA 3BQ3A 1SW8A 2WCMA 1AJ5A 1PRWA 1RTP1 1M45A 1QATA 3FIAA 1G4YR 4KYNA 4OZDA 5HKZA 3O6BA 1GJYA 1GGWA 3GK4X 3DVMA 4I5KA 5HLVA 4I5NB 2MRDA 1XFUO 2ZNDA 4ETOA 3B6XA 1LA3A 1TNPA 5FYXA 1SL9A 2ZFDA 2M7LA 5KU1A 3I5FC 2LMTA 2JWWA 1B4CA 5BPJA 1R2UA 2WORA 1EXRA 2KBIA 2P70A 5AFPA 2K61A 2Y1NA 3SJSA 1DJYA 3CTNA 2KAXA 3VB1A 1BR4B 2K0JA 1Z2CB 2BAPA 5B8IB 1QX7A 1S1EA 1NSHA 1DEKA 4ICBA 1JBAA 4GGNA 3BXKA 3S0EA 1KWOB 2KHNA 1UHJA 3VRRA 1KQVA 1SCMC 2Q4UA 4YGAA 2EC6C 1KFXL 1SBJA 1IH0A 1YUTA 1QXPA 2IS9A 5I2LA 4A4CA 2L0PA 1IGVA 2DOQA 3KPXA 3QRXA 1CFPA 5I94A 4NDBA 2F2PA 3BFHA 3O4YA 1FF1A 5DICA 3CS1A 4M2PA 3D10A 1T14A 2L2EA 1QASA 3SIAA 1XK4A 1IG5A 3DVJA 2LHIA 1OZSA 1K9PA 3E3RA 2TN4A 2G9BA 2F3YA 3CZ1A 3FE9A 2LCPA 3UO9A 1DF0B 2JT8A 4WQ2A 1TUZA 3FWCA 1DC1A 2E30A 4YGBB 4DRWA 5HLOA 4JD9A 1OOJA 1SYMA 2L5YA 1DJXA 1NUBA 2V53A 1L7ZA 1JSAA 1Y1XA 2BKHB 1NX3A 2H61A 2KI4B 1OOGA 2I7AA 4HSZA 5AXIA 2F3ZA 1S5GY 1ZFSA 4BY5A 3LLEA 4CPVA 1CTRA 2GV5A 4YRUA 1NX0A 3WHUB 3PN7B 1CMFA 1OMDA 3VRNA 4PHNA 1K94A 2PVBA 5CPVA 2KSPA 3NSLA 1B8LA 2BE4A 3D74A 4GBAA 1X02A 4OCIA 3TDZA 2SASA 1RFJA 3AAJA 2CNPA 3N7HA 4NQGA 1OW4A 2LLUA 4PHKA 1U5IB 1CM1A 3SG2A 3EKJA 1C7WA 1BODA 2JULA 1A2XA 1L2OB 2WC6A 2MLFC 2GGZA 1RK9A 1YR5A 1XFZO 1R6PA 2WCEA 2WC8A 4HREE 4QJ5B 1AK8A 1MHOA 4MRXA 1J7OA 4CLNA 2JOJA 2KAVA 2BBNA 3O78A 2I94A 5AERA 2L5XB 4WQ3A 5AANA 3RM1A 2BCXA 2KOTA 3NXAA 4PE7A 3VRPA 1ALWA 1UHKA 4R1EA 4F7FA 1ZACA 1Y1AA 2K7OA 1KSMA 4DUQA 1B7TY 3BUNB 2CXJA 3BUXB 1IKUA 4N1FA 2JXCA 5J3XA 3F45A 1CMGA 3I5HB 2M7NA 3R72A 1M39A 1C7VA 2M97A 3NGVA 1CB1A 5HYDA 4M2QA 3BFAA 1WRZA 2CCMA 3S0GA 1CNPA 1NWDA 4OV2A 3CR4X 2M49B 3I5GC 1V1FA 3RLZA 4P5OE 1TCOB 4OR9B 1N2DA 4QJ3B 2BL0B 4DIRA 1WY9A 1SL8A 1AUIB 1RJVA 1SSEB 2JT3A 1KK8C 2Y4QA 3SS3A 3TZ1A 1H8BA 1YURA 1UHHA 1RROA 1Q80A 1QV0A 1ZUZA 4GGFC 2NZ0A 5AEQA
chains in the Genus database with same CATH topology
1IIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IIO A; 
#chains in the Genus database with same CATH topology
 4Q04 A;  1M31 A;  1B47 A;  1PVA A;  3PLF B;  2ZNE A;  3CYZ A;  3JTD B;  1PSB A;  1QV1 A;  4XJK B;  1F55 A;  2QEH A;  3JVT B;  3CR5 X;  1PUL A;  2JZI A;  4MLW A;  2ISD A;  1YRT B;  1FI5 A;  1OMR A;  3AKB A;  3D75 A;  1NIW A;  2MBX A;  3TUY B;  4AOM A;  4PE0 A;  1C07 A;  5K89 A;  2BNX A;  3VRQ A;  1YUS A;  3BUW B;  5F6T A;  1NYA A;  2KFH A;  2KLD A;  2RGI A;  2LVI A;  3NSK A;  3RZS A;  3CZ2 A;  1MWN A;  1SR6 B;  1D1O A;  1K96 A;  1SKT A;  3BOW A;  1N65 A;  3ZNI A;  4F0Z B;  3I5F B;  2ERB A;  4JWQ A;  2ZN8 A;  1CFD A;  2OS8 B;  2PQL A;  3D0Y A;  4ZCV A;  3VRO A;  3CDN A;  2H61 C;  2ZRS A;  3PAT A;  1QWV A;  4FQO A;  5I2Q A;  1MXE A;  2I18 A;  2G2B A;  1PK0 D;  1XFR A;  1DT7 B;  1DJI A;  4JQ0 D;  1YUU A;  1WDC C;  1B8R A;  1MQ1 A;  5HL1 A;  2KQ6 A;  1KFX S;  1SCM B;  2GGM A;  2OTG B;  2WCB A;  1E8A A;  3MSE B;  1K8U A;  3I5I C;  4GUK A;  1GM0 A;  2WCH A;  1MXL C;  1B9A A;  2KFF A;  1RWY A;  1SPY A;  1Y0V H;  2Q91 A;  2L4H A;  4CID A;  3CAB A;  2A4J A;  4GGF A;  2KI6 C;  4MBE A;  4P2Y B;  2CBL A;  5IBW A;  1QVI Z;  2FJY A;  2KYC A;  5FI6 A;  2M1K B;  2HQW A;  4ZCU A;  3NSI A;  4PAL A;  1G8I A;  3HCM A;  1ZOT B;  3KEV A;  4GNK B;  5CSN A;  1K9U A;  3ICB A;  2WND A;  2JNX A;  3DVE A;  3FS7 A;  4IJ7 A;  2L50 A;  1CFF A;  1QIV A;  4L9M A;  1MF8 B;  2KQY A;  3CGA A;  3AKA A;  2E6W A;  1A75 A;  1IRJ A;  2QEO A;  2OPO A;  1N0Y A;  2ZRT A;  4OVN F;  3OX6 A;  3OX5 A;  2KYF A;  4I5J A;  1EG4 A;  4MSP A;  3O2P A;  4E68 A;  2LUX A;  2JRF A;  5G08 A;  5DKQ A;  3SG3 A;  1KWO C;  2LMV A;  2LVK A;  2PAL A;  3IF7 A;  3DZT A;  3D78 A;  1WLM A;  2AMI A;  1IQ3 A;  2JT0 A;  1PVB A;  4C0J A;  1YX7 A;  1XYD A;  4PHJ A;  4N5X A;  3K1E A;  4UPG A;  1KQM C;  2L2C A;  1M46 A;  2JPO A;  4U8D A;  1TUJ A;  2LE9 B;  3CLN A;  5ER5 A;  4DS7 A;  1WRK A;  1F8H A;  1BJF A;  3EK7 A;  1TIZ A;  1A29 A;  3VGO A;  2LUC A;  2MAZ A;  3LCP C;  4AQI A;  4YBH B;  3EVV A;  2FCD A;  1CDL A;  1SRA A;  3EVR A;  3NSO A;  1CDP A;  2K7C A;  4JKT A;  1TCF A;  1LS8 A;  1ORG A;  4D1E A;  2KFG A;  1BR1 B;  1OOH A;  2MA2 A;  1CKK A;  2BCB A;  1K2H A;  1JC2 A;  2KBM A;  1TOP A;  2LLS A;  3EKH A;  3BOW B;  1F4Q A;  1IQ5 A;  1PAL A;  2JNF A;  1TTX A;  2LC5 A;  1IIO A;  4N1G A;  3B87 A;  1UP5 A;  4A4B A;  1DGV A;  2EHB A;  1AP4 A;  2F2O A;  1J55 A;  1DJW A;  2P6B B;  2FOT A;  1HQV A;  1VRK A;  2MLE C;  1C3Y A;  4PT1 A;  3TS5 C;  1ALV A;  5DKR A;  1NCX A;  1G33 A;  1YRU B;  2QDI A;  2WCK A;  2WCL A;  3I5G B;  1REC A;  3EVU A;  3TDI A;  2H2K A;  3BYA A;  1DJG A;  1B1G A;  1S36 A;  3CWG A;  1MUX A;  3S0D A;  1BU3 A;  3B86 A;  2PAS A;  1YVL A;  2K2F A;  2LMU A;  1DMO A;  3L4L A;  1JF2 A;  3DYE A;  5EL2 A;  2BBM A;  2LAN A;  1S6C A;  1UUS A;  3K21 A;  2F33 A;  2KAY A;  4PHM A;  3B7A A;  2COL B;  1W7J B;  1AJ4 A;  2Y1M A;  3DXL A;  3CZ0 A;  4PDZ A;  3SS4 A;  1DF0 A;  1CDM A;  3C1V A;  1SY9 A;  1OSA A;  1V1G A;  3A4U B;  2M0R A;  4AQJ A;  1SK6 D;  1WLZ A;  1QTX A;  4MEW A;  3L47 A;  2LVV A;  3LK1 A;  1JFK A;  3QME A;  1QIW A;  2P71 A;  2ZKM X;  2CT9 A;  3KHE A;  2NLN A;  2LP3 A;  1TWO A;  1XA5 A;  4GFT A;  1DTL A;  2HQ8 A;  1IJ5 A;  2F8P A;  1KFU L;  1F70 A;  3SG5 A;  3M0W A;  2HF5 A;  3BUO B;  1K9K A;  3WNX B;  1F4O A;  1WDC B;  1NCZ A;  3L4A A;  3EK8 A;  4USL A;  2K7D A;  1U5I A;  3SG4 A;  1S26 D;  4MZK A;  5TNC A;  1XFW O;  4ORA B;  2PMY A;  3JVT C;  4INW A;  2NXQ A;  1IWQ A;  5KTY A;  3FE6 A;  2EC6 B;  1J1D A;  3FWB A;  3OHM B;  3TUY C;  1CFC A;  1AVS A;  1OOF A;  4MN0 A;  4PE4 A;  1UUR A;  3DD4 A;  3SG6 A;  1QX5 B;  1BLQ A;  5GQQ C;  1OMV A;  2KPH A;  2PSR A;  1DQE A;  2QEV A;  1KK7 Z;  1S5G Z;  1SR6 C;  1BT6 A;  2AUC A;  2BE6 A;  1K90 D;  4QJ4 B;  1TNX A;  1QJT A;  2B1U A;  4PE1 A;  2L98 A;  1F71 A;  5I8N A;  2OS8 C;  4HRH A;  1F54 A;  1LA0 A;  1BMO A;  4CFR A;  2LM5 A;  3BUM B;  2M1U A;  2LP2 A;  3IQQ A;  2AAO A;  3NHI A;  1LXF C;  3EK4 A;  3GOF A;  3OGN A;  5HKW A;  2KNE A;  4C0K A;  1GQM A;  1CLL A;  4C0L A;  1Y6W A;  5HKY A;  1S6I A;  1QLS A;  1XO5 A;  3UNW A;  2BCA A;  4INX A;  5I2O A;  1PSR A;  2L4I A;  1EJ3 A;  2OTG C;  2SCP A;  2BEC A;  1DGU A;  2JXL A;  2MHH A;  4DCK A;  1J7R A;  3AAK A;  1FW4 A;  3DF0 A;  1TNW A;  1FI6 A;  1K95 A;  2K2A A;  4MRY A;  1DVI A;  3WHT B;  1DJZ A;  1GGZ A;  3SS5 A;  3CR2 A;  1ZMZ A;  5CSJ A;  1OOI X;  1KQM B;  2NCO A;  4PCW A;  3R1P A;  1DJH A;  5CSF A;  3H4S E;  3PFV A;  1TN4 A;  1YTZ C;  4XJK A;  1CLM A;  1B7T Z;  3FE8 A;  3IVT A;  4ORB B;  2M29 A;  2O60 A;  5KSZ A;  2NCP A;  4NDC A;  3PM8 A;  1JWD A;  1OQP A;  1XFX O;  2YGU A;  1KSO A;  2HET A;  3S0F A;  3TDU A;  4YGC B;  2LVJ A;  2QPT A;  1S3P A;  2JTZ A;  1YVH A;  5D7F A;  4ORC B;  4OKH A;  5FI7 A;  4BY4 A;  1J7Q A;  1SL7 A;  2JPT A;  3GK1 A;  5JJG A;  1OZO A;  2JQ6 A;  4YGE B;  5ER4 X;  1JUO A;  4JPZ B;  1EL4 A;  3DY9 A;  4WRI A;  2LHL A;  3PSR A;  4TNC A;  2M8U A;  1QVI Y;  1NX1 A;  3D77 A;  1H4B A;  2PYQ A;  1KK7 Y;  2R2I A;  2D8N A;  2LNK A;  4GPL B;  5JOL A;  2L51 A;  2KI4 C;  1SMG A;  3B88 A;  2WCJ A;  3D0Y B;  4IL1 A;  3V2L A;  1J7P A;  3TS5 B;  3IQO A;  1QS7 A;  3S0B A;  1B8C A;  1EH2 A;  3LL8 B;  2ZN9 A;  3PN7 C;  2KI6 D;  2GTE A;  2WC5 A;  3D76 A;  4MVF A;  1BF5 A;  1NPQ A;  1QLK A;  1Z4H A;  3LK0 A;  3GK2 A;  1A4P A;  2VRG A;  3KF9 A;  1XVJ A;  3BFB A;  1UWO A;  4NDD A;  5FI2 A;  1XFV O;  1M63 B;  1EG3 A;  5D69 A;  2FJU B;  1KK8 B;  1BG1 A;  1QX2 A;  3OB1 B;  1NP8 A;  1JF0 A;  3DVK A;  4XYN A;  5DKN A;  2JTT A;  2KLE A;  2QEB A;  1KCY A;  1L2O C;  4GAO A;  4MZL A;  1W9Z A;  1UHI A;  3D73 A;  4CFQ A;  3ZWH A;  1S6J A;  1WRL A;  2EGD A;  2JC2 A;  2O5G A;  1OE9 B;  1NX2 A;  1SCV A;  4YGD B;  1LKJ A;  1AHR A;  3SIB A;  2K8M B;  1SNL A;  1BOC A;  5CSI A;  2BKI B;  3PJI A;  1CM4 A;  2KDH A;  2QAC A;  2M3W A;  1FPW A;  4YI9 A;  3SG7 A;  2LLT A;  1J1E A;  4YI8 A;  3WXA A;  1TRF A;  1A75 B;  3Q8I A;  4HRG A;  1FBV A;  3I5H C;  1HT9 A;  1W7I B;  3OB2 B;  2JU0 A;  1LIN A;  5D3O A;  2Y5I A;  1NCY A;  2KGB C;  2MJW B;  2CTN A;  1KFU S;  3DF0 B;  3CZT X;  3PM2 A;  2WCF A;  4M2O A;  3KO0 A;  3EG5 B;  2BL0 C;  2K60 A;  2WOS A;  3OBV A;  1JFJ A;  1Y1U A;  3O4X A;  1C3Z A;  4I5L B;  1MR8 A;  3PAL A;  1ODB A;  1CDN A;  4FTG A;  2FCE A;  2HPS A;  3BJH A;  5PAL A;  2M9G A;  2LAP A;  3A8R A;  1IJ6 A;  2LV7 A;  2KGR A;  2H8V A;  3JTD C;  3S0A A;  1CLB A;  1XK4 C;  1K93 D;  1LVC D;  3I5I B;  1YX8 A;  1P28 A;  3OP0 A;  4FQT A;  3HX4 A;  2K7B A;  2I2R E;  1UHN A;  3NHT A;  1A03 A;  4MZJ A;  3R1O A;  3R1V A;  1XFY O;  1TNQ A;  2PRU A;  1DEL A;  3BQ3 A;  1SW8 A;  2WCM A;  1AJ5 A;  1PRW A;  1RTP 1;  1M45 A;  1QAT A;  3FIA A;  1G4Y R;  4KYN A;  4OZD A;  5HKZ A;  3O6B A;  1GJY A;  1GGW A;  3GK4 X;  3DVM A;  4I5K A;  5HLV A;  4I5N B;  2MRD A;  1XFU O;  2ZND A;  4ETO A;  3B6X A;  1LA3 A;  1TNP A;  5FYX A;  1SL9 A;  2ZFD A;  2M7L A;  5KU1 A;  3I5F C;  2LMT A;  2JWW A;  1B4C A;  5BPJ A;  1R2U A;  2WOR A;  1EXR A;  2KBI A;  2P70 A;  5AFP A;  2K61 A;  2Y1N A;  3SJS A;  1DJY A;  3CTN A;  2KAX A;  3VB1 A;  1BR4 B;  2K0J A;  1Z2C B;  2BAP A;  5B8I B;  1QX7 A;  1S1E A;  1NSH A;  1DEK A;  4ICB A;  1JBA A;  4GGN A;  3BXK A;  3S0E A;  1KWO B;  2KHN A;  1UHJ A;  3VRR A;  1KQV A;  1SCM C;  2Q4U A;  4YGA A;  2EC6 C;  1KFX L;  1SBJ A;  1IH0 A;  1YUT A;  1QXP A;  2IS9 A;  5I2L A;  4A4C A;  2L0P A;  1IGV A;  2DOQ A;  3KPX A;  3QRX A;  1CFP A;  5I94 A;  4NDB A;  2F2P A;  3BFH A;  3O4Y A;  1FF1 A;  5DIC A;  3CS1 A;  4M2P A;  3D10 A;  1T14 A;  2L2E A;  1QAS A;  3SIA A;  1XK4 A;  1IG5 A;  3DVJ A;  2LHI A;  1OZS A;  1K9P A;  3E3R A;  2TN4 A;  2G9B A;  2F3Y A;  3CZ1 A;  3FE9 A;  2LCP A;  3UO9 A;  1DF0 B;  2JT8 A;  4WQ2 A;  1TUZ A;  3FWC A;  1DC1 A;  2E30 A;  4YGB B;  4DRW A;  5HLO A;  4JD9 A;  1OOJ A;  1SYM A;  2L5Y A;  1DJX A;  1NUB A;  2V53 A;  1L7Z A;  1JSA A;  1Y1X A;  2BKH B;  1NX3 A;  2H61 A;  2KI4 B;  1OOG A;  2I7A A;  4HSZ A;  5AXI A;  2F3Z A;  1S5G Y;  1ZFS A;  4BY5 A;  3LLE A;  4CPV A;  1CTR A;  2GV5 A;  4YRU A;  1NX0 A;  3WHU B;  3PN7 B;  1CMF A;  1OMD A;  3VRN A;  4PHN A;  1K94 A;  2PVB A;  5CPV A;  2KSP A;  3NSL A;  1B8L A;  2BE4 A;  3D74 A;  4GBA A;  1X02 A;  4OCI A;  3TDZ A;  2SAS A;  1RFJ A;  3AAJ A;  2CNP A;  3N7H A;  4NQG A;  1OW4 A;  2LLU A;  4PHK A;  1U5I B;  1CM1 A;  3SG2 A;  3EKJ A;  1C7W A;  1BOD A;  2JUL A;  1A2X A;  1L2O B;  2WC6 A;  2MLF C;  2GGZ A;  1RK9 A;  1YR5 A;  1XFZ O;  1R6P A;  2WCE A;  2WC8 A;  4HRE E;  4QJ5 B;  1AK8 A;  1MHO A;  4MRX A;  1J7O A;  4CLN A;  2JOJ A;  2KAV A;  2BBN A;  3O78 A;  2I94 A;  5AER A;  2L5X B;  4WQ3 A;  5AAN A;  3RM1 A;  2BCX A;  2KOT A;  3NXA A;  4PE7 A;  3VRP A;  1ALW A;  1UHK A;  4R1E A;  4F7F A;  1ZAC A;  1Y1A A;  2K7O A;  1KSM A;  4DUQ A;  1B7T Y;  3BUN B;  2CXJ A;  3BUX B;  1IKU A;  4N1F A;  2JXC A;  5J3X A;  3F45 A;  1CMG A;  3I5H B;  2M7N A;  3R72 A;  1M39 A;  1C7V A;  2M97 A;  3NGV A;  1CB1 A;  5HYD A;  4M2Q A;  3BFA A;  1WRZ A;  2CCM A;  3S0G A;  1CNP A;  1NWD A;  4OV2 A;  3CR4 X;  2M49 B;  3I5G C;  1V1F A;  3RLZ A;  4P5O E;  1TCO B;  4OR9 B;  1N2D A;  4QJ3 B;  2BL0 B;  4DIR A;  1WY9 A;  1SL8 A;  1AUI B;  1RJV A;  1SSE B;  2JT3 A;  1KK8 C;  2Y4Q A;  3SS3 A;  3TZ1 A;  1H8B A;  1YUR A;  1UHH A;  1RRO A;  1Q80 A;  1QV0 A;  1ZUZ A;  4GGF C;  2NZ0 A;  5AEQ A; 
#chains in the Genus database with same CATH homology
 1IIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...