1IIOA

Nmr-based structure of the conserved protein mth865 from the archea methanobacterium thermoautotrophicum
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
84
Chain Sequence
GSHMKMGVKEDIRGQIIGALAGADFPINSPEELMAALPNGPDTTCKSGDVELKASDAGQVLTADDFPFKSAEEVADTIVNKAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein MTH865
publication title NMR-based structure of the conserved protein MTH865 from the archaeon Methanobacterium thermoautotrophicum.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Structural genomics, unknown function
total genus 17
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2001-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07747 MTH865 MTH865-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.80 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 MTH865-like 1iioA00
1IIOA
chains in the Genus database with same CATH superfamily
2K8MB 1CFCA 5KSZA 1AUIB 3CZ1A 2QACA 4AQJA 1J7QA 3S0AA 2KHNA 1SY9A 1U5IA 4INWA 1NUBA 3NSKA 5I8NA 1XFUO 3DF0A 3BUXB 3SS5A 3SIAA 4GGFA 1AP4A 1TCOB 5CSIA 1YRUB 2I2RE 2K2AA 1B9AA 5DICA 3UO9A 3OP0A 2LMVA 3LLEA 3QRXA 2CBLA 4N5XA 2PALA 1L7ZA 2ZRSA 3KF9A 3NHTA 3VRQA 1NWDA 4FQTA 2HF5A 5ER4X 2HETA 1T14A 2JOJA 1PULA 2M7LA 1N0YA 1ODBA 1W7IB 1XO5A 1LKJA 2RGIA 1UP5A 2CXJA 2LLSA 3VB1A 3I5IB 4OZDA 4C0LA 2KLEA 1OQPA 2ZNDA 2JTZA 1RTP1 4USLA 1Y1UA 1DJZA 1BLQA 1UHIA 4OKHA 1LXFC 5TNCA 2KI4C 3CR2A 2AUCA 3KEVA 3EKHA 1BG1A 2H2KA 5JOLA 4P2YB 1IQ5A 1IH0A 2CNPA 1MQ1A 2Y1MA 2MRDA 3BJHA 1ALVA 2ZRTA 2FJYA 1CFFA 2NXQA 4WQ2A 1CM1A 2BBNA 1UHNA 4IL1A 4Q04A 2LHLA 1B8LA 1K95A 3HX4A 3OBVA 4MVFA 1J7PA 1ZACA 1DJHA 2WCBA 3S0GA 2I94A 3ZNIA 1YRTB 3F45A 1LS8A 1QASA 4MLWA 4GFTA 2QDIA 3PLFB 1YVHA 1SL9A 5HKYA 2CTNA 3O2PA 4JKTA 4PCWA 4FQOA 1P28A 3DVJA 3SS3A 4QJ4B 3DY9A 5I2LA 5GQQC 4CFRA 3DXLA 2K2FA 4YGCB 2LLUA 1SNLA 1VRKA 2WCLA 3D78A 2LMUA 1QIVA 1WRKA 1CLLA 1QIWA 3GOFA 1IQ3A 2IS9A 2FOTA 4MBEA 3PM2A 4CIDA 1KK7Z 3D10A 1G33A 1KFXL 1IWQA 4MZKA 2SASA 1CDNA 4N1GA 2CT9A 4E68A 1CB1A 2GTEA 3E3RA 5AFPA 4PHJA 1F71A 2COLB 1FF1A 4CFQA 3D76A 3OB1B 1W9ZA 3O4YA 2BAPA 1J7RA 4MRXA 3DZTA 2V53A 1DF0B 5D69A 2ZFDA 1EG3A 1K94A 1QV1A 1PVAA 3CABA 2GGMA 3SG3A 3TUYB 5B8IB 1TNWA 3GK4X 4M2PA 3FE6A 5G08A 1C07A 2KBMA 2OTGB 1YURA 3EVVA 2LAPA 5HLOA 1JBAA 1QATA 1UHHA 2H8VA 4PHNA 1PK0D 2KGRA 1GJYA 2KI6D 5I2QA 4MEWA 2KAYA 1M39A 2K7OA 1B7TZ 2R2IA 1KQVA 5HKZA 3ICBA 2Q91A 5DKQA 1A2XA 1DQEA 1CMFA 1MHOA 4GBAA 1OMDA 1K9UA 5CSFA 2L4HA 2KAXA 1WRZA 2PASA 4BY5A 4P5OE 1QX7A 1L2OC 1MXLC 3UNWA 1JWDA 2LCPA 1JUOA 2QPTA 5K89A 1CFPA 3WNXB 3R1PA 4XJKB 1FW4A 4I5KA 3BFHA 3S0BA 1QLSA 3H4SE 1BF5A 3I5GC 2KBIA 1CDLA 1ZUZA 1TIZA 1FI6A 1KWOB 1LINA 4INXA 5D3OA 5CSJA 2DOQA 2KYFA 1AVSA 2ISDA 3CDNA 2KQYA 1NX0A 2L50A 1SCVA 4OCIA 1WDCC 2MHHA 1E8AA 3CTNA 1DVIA 1B4CA 1SPYA 1SCMC 1OOJA 3D0YB 5FI7A 3DYEA 2L4IA 4U8DA 1JF0A 2JNFA 3V2LA 1UUSA 3M0WA 1GQMA 1MXEA 3TUYC 2WCMA 2WORA 2JXLA 4HSZA 1J1DA 1DMOA 3FS7A 2OTGC 1B1GA 2KAVA 4KYNA 1Y1XA 1AHRA 2MA2A 1W7JB 2MJWB 1WLZA 4YI8A 1OZSA 3A4UB 1PSRA 2M0RA 2EGDA 4JD9A 1M45A 1DC1A 3RLZA 4L9MA 3CYZA 3O4XA 1TTXA 3WXAA 4MZLA 2JPOA 4JWQA 5KTYA 1S5GZ 3PM8A 3LK1A 4PALA 3NSIA 3CLNA 5J3XA 2JWWA 3HCMA 1BMOA 1PSBA 3FWCA 3N7HA 3CGAA 1RFJA 2LP2A 1MF8B 3D75A 3BXKA 2PMYA 4GNKB 1QWVA 4PE7A 1OE9B 2PRUA 3L4LA 3BOWB 2ZN9A 4YGBB 1KFUL 1QS7A 3EKJA 2JC2A 4D1EA 2KI6C 1KWOC 1F70A 2EC6B 1X02A 3BQ3A 3PJIA 1WY9A 1CLBA 1SR6B 2E6WA 5IBWA 2QEHA 3LL8B 1SKTA 4JPZB 4PHKA 4ORCB 1N65A 5JJGA 1S6IA 1MWNA 3EK4A 4I5LB 2LVKA 1SK6D 3CZ0A 1ZFSA 1M46A 1YX7A 1B47A 2MLEC 3PSRA 1NP8A 4YI9A 2P6BB 1L2OB 1CM4A 1K2HA 1C3ZA 1H4BA 1BJFA 2L0PA 1BODA 2BNXA 3FWBA 1G4YR 1YR5A 2M1KB 2H61C 3BFAA 3WHUB 1QVIY 1XFXO 1DJIA 2L2EA 2TN4A 3K21A 1C3YA 3LK0A 1TUZA 1UHKA 1OZOA 2LNKA 3WHTB 1DJXA 3I5GB 1V1FA 1R2UA 3TZ1A 1IJ5A 1OW4A 4CLNA 1GGWA 1LVCD 1S6CA 5I94A 1FI5A 1TNQA 1SMGA 1S6JA 3VRNA 3CR4X 1XFYO 2AAOA 2BCBA 1RK9A 2JRFA 1NIWA 3R72A 4ICBA 2SCPA 3EVUA 5DKNA 1WDCB 1RROA 1KCYA 3VRPA 2I18A 1SCMB 1OSAA 2L51A 1NPQA 4YGDB 1DF0A 1EJ3A 2ERBA 3B6XA 4PE0A 4ETOA 5HL1A 2BCXA 2M3WA 3FE9A 1QTXA 5PALA 2E30A 3OB2B 3CZ2A 4YBHB 2KNEA 3D77A 3SG6A 2M8UA 2A4JA 1YUUA 2AMIA 2BECA 2WCJA 1UURA 1TWOA 1JF2A 1YVLA 2EC6C 1SRAA 2KGBC 2LUXA 1JFKA 2KFFA 2MLFC 4PE1A 4DCKA 2QEBA 3VRRA 3IQOA 2HPSA 1KK8B 5CPVA 1SR6C 1IJ6A 1QX2A 4YRUA 1N2DA 1DEKA 1RWYA 1S1EA 2M49B 1M31A 3I5FB 1PVBA 1K9KA 1XFVO 1RJVA 2WCHA 1OOFA 1F55A 1GM0A 2F2PA 1TNPA 2BE6A 4OR9B 3TDIA 3SG7A 1Y1AA 1NX2A 1XFRA 4GAOA 2FCEA 1KFXS 3B7AA 1SL7A 1XFWO 2O60A 2WCFA 2KOTA 2ZN8A 2LC5A 2JULA 4XJKA 2BL0B 4F0ZB 1J7OA 1CTRA 4MZJA 3B87A 3I5HB 1A75B 1GGZA 2KYCA 3BUOB 1WLMA 1Q80A 1QJTA 4MN0A 4R1EA 1XK4C 4PT1A 4GPLB 1Y6WA 2K60A 1OMVA 2HQWA 2Y5IA 4GGNA 4GUKA 1MR8A 1R6PA 2JPTA 2BBMA 2OPOA 2KSPA 1IRJA 2EHBA 1Z2CB 3AAJA 3JVTB 3MSEB 3OHMB 2KQ6A 3TDUA 4PHMA 2M1UA 1A03A 1ALWA 2GGZA 2KFHA 5FYXA 1YUTA 1S26D 1JFJA 1PRWA 4UPGA 1J1EA 1DJWA 5D7FA 2B1UA 1A29A 1WRLA 2Y1NA 1S36A 4DIRA 1DT7B 1SW8A 1ZOTB 3D0YA 2NZ0A 1DJGA 2LM5A 3K1EA 5EL2A 4DS7A 1SSEB 3GK1A 1QX5B 1ORGA 4TNCA 2I7AA 5HKWA 4ORBB 1K96A 1DJYA 2K61A 3PN7B 3QMEA 2F8PA 1KQMB 3OX5A 2D8NA 1HT9A 1TN4A 3EG5B 1CDMA 1K9PA 1KK8C 2MAZA 3FIAA 1CDPA 2WOSA 4HRGA 3BUWB 1IG5A 2PSRA 2JT0A 3ZWHA 1DTLA 2LANA 4ZCUA 3I5FC 4DRWA 3D73A 2WC6A 1FPWA 1NSHA 3EK8A 1J55A 5BPJA 1U5IB 1K8UA 3CZTX 1M63B 3JTDB 4I5NB 1ZMZA 4QJ3B 1OOIX 3DF0B 3SG5A 2O5GA 2CCMA 2NLNA 4MRYA 2JNXA 2L5XB 2QEOA 2QEVA 3R1OA 2LUCA 2KFGA 2P70A 2JQ6A 2BL0C 2F2OA 1Z4HA 2OS8B 3AKBA 1SL8A 3KPXA 2Q4UA 3BOWA 2WC5A 1IIOA 3I5HC 3OGNA 1K93D 2JT8A 4OV2A 1JSAA 1K90D 2LE9B 1V1GA 2F33A 3PFVA 3S0EA 5I2OA 2LVIA 4M2QA 3SS4A 2K7BA 2LVJA 2M97A 3VROA 2NCOA 3NSOA 1AJ4A 1NX3A 1H8BA 3JVTC 1JC2A 1TOPA 1LA0A 1C7VA 4C0KA 4NQGA 4YGEB 3KO0A 4IJ7A 4PE4A 4QJ5B 2KDHA 1B8CA 1YTZC 2LMTA 2PQLA 3O78A 4WQ3A 4WRIA 5HLVA 4AOMA 1CKKA 3R1VA 1XYDA 2G9BA 1PALA 3VGOA 3EVRA 4ORAB 1F54A 2JTTA 1KSMA 4C0JA 4N1FA 4NDCA 3IQQA 4F7FA 3PN7C 2L2CA 2G2BA 3SIBA 1KQMC 1KK7Y 3C1VA 4MSPA 1EG4A 2PYQA 1QV0A 1IGVA 1XK4A 4AQIA 3TDZA 2K0JA 2LHIA 2KLDA 3L47A 1AK8A 1D1OA 1YX8A 1BT6A 5CSNA 3SG4A 1SBJA 1HQVA 1XVJA 3JTDC 1CFDA 1KFUS 3LCPC 4BY4A 1BU3A 2JT3A 2L98A 2WC8A 3EK7A 3B86A 3BYAA 2MBXA 2M7NA 3FE8A 4GGFC 1QVIZ 2LV7A 3D74A 1BR1B 3PATA 3Q8IA 3IVTA 1XFZO 2YGUA 4OVNF 3AAKA 5AXIA 2NCPA 3RZSA 3BUMB 1MUXA 1G8IA 2OS8C 3CR5X 1TRFA 3DVKA 1F4QA 3SG2A 3AKAA 1TNXA 2KPHA 2M29A 2PVBA 4ZCVA 1DGVA 1B7TY 5FI2A 3RM1A 3NGVA 1NYAA 1OOGA 1F4OA 1SYMA 4HREE 1TUJA 4CPVA 2BKHB 1DELA 3I5IC 1NCYA 3TS5B 1TCFA 1FBVA 1UWOA 3DD4A 1F8HA 1YUSA 1B8RA 1EXRA 1NCZA 2FCDA 5ER5A 1S3PA 2M9GA 3NXAA 4JQ0D 1IKUA 2WNDA 3BUNB 1LA3A 1EL4A 1QXPA 3S0FA 1CMGA 2WCKA 2JZIA 1RECA 2L5YA 5KU1A 2F3ZA 3BFBA 1OOHA 1NX1A 3SJSA 1A75A 3B88A 1BOCA 3NSLA 1QLKA 3OX6A 4HRHA 1KSOA 3NHIA 2FJUB 2ZNEA 2HQ8A 4YGAA 4M2OA 1A4PA 3GK2A 3L4AA 3O6BA 4NDBA 4PDZA 4XYNA 3DVMA 5F6TA 5DKRA 3CS1A 5AERA 3S0DA 2KI4B 1XA5A 3PALA 3A8RA 4DUQA 2LLTA 2LVVA 1CLMA 2BKIB 2JXCA 3CWGA 1EH2A 1AJ5A 2K7DA 2H61A 1BR4B 1OMRA 3KHEA 2GV5A 1NCXA 2BCAA 2P71A 4I5JA 2LP3A 4A4CA 1UHJA 2ZKMX 2VRGA 4FTGA 3IF7A 2BE4A 2F3YA 5FI6A 4A4BA 1C7WA 4NDDA 2K7CA 3DVEA 2JU0A 2Y4QA 1CNPA 1DGUA 1S5GY 2WCEA 5AANA 5HYDA 3TS5C 5AEQA 1Y0VH
chains in the Genus database with same CATH topology
1IIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IIO A; 
#chains in the Genus database with same CATH topology
 2K8M B;  1CFC A;  5KSZ A;  1AUI B;  3CZ1 A;  2QAC A;  4AQJ A;  1J7Q A;  3S0A A;  2KHN A;  1SY9 A;  1U5I A;  4INW A;  1NUB A;  3NSK A;  5I8N A;  1XFU O;  3DF0 A;  3BUX B;  3SS5 A;  3SIA A;  4GGF A;  1AP4 A;  1TCO B;  5CSI A;  1YRU B;  2I2R E;  2K2A A;  1B9A A;  5DIC A;  3UO9 A;  3OP0 A;  2LMV A;  3LLE A;  3QRX A;  2CBL A;  4N5X A;  2PAL A;  1L7Z A;  2ZRS A;  3KF9 A;  3NHT A;  3VRQ A;  1NWD A;  4FQT A;  2HF5 A;  5ER4 X;  2HET A;  1T14 A;  2JOJ A;  1PUL A;  2M7L A;  1N0Y A;  1ODB A;  1W7I B;  1XO5 A;  1LKJ A;  2RGI A;  1UP5 A;  2CXJ A;  2LLS A;  3VB1 A;  3I5I B;  4OZD A;  4C0L A;  2KLE A;  1OQP A;  2ZND A;  2JTZ A;  1RTP 1;  4USL A;  1Y1U A;  1DJZ A;  1BLQ A;  1UHI A;  4OKH A;  1LXF C;  5TNC A;  2KI4 C;  3CR2 A;  2AUC A;  3KEV A;  3EKH A;  1BG1 A;  2H2K A;  5JOL A;  4P2Y B;  1IQ5 A;  1IH0 A;  2CNP A;  1MQ1 A;  2Y1M A;  2MRD A;  3BJH A;  1ALV A;  2ZRT A;  2FJY A;  1CFF A;  2NXQ A;  4WQ2 A;  1CM1 A;  2BBN A;  1UHN A;  4IL1 A;  4Q04 A;  2LHL A;  1B8L A;  1K95 A;  3HX4 A;  3OBV A;  4MVF A;  1J7P A;  1ZAC A;  1DJH A;  2WCB A;  3S0G A;  2I94 A;  3ZNI A;  1YRT B;  3F45 A;  1LS8 A;  1QAS A;  4MLW A;  4GFT A;  2QDI A;  3PLF B;  1YVH A;  1SL9 A;  5HKY A;  2CTN A;  3O2P A;  4JKT A;  4PCW A;  4FQO A;  1P28 A;  3DVJ A;  3SS3 A;  4QJ4 B;  3DY9 A;  5I2L A;  5GQQ C;  4CFR A;  3DXL A;  2K2F A;  4YGC B;  2LLU A;  1SNL A;  1VRK A;  2WCL A;  3D78 A;  2LMU A;  1QIV A;  1WRK A;  1CLL A;  1QIW A;  3GOF A;  1IQ3 A;  2IS9 A;  2FOT A;  4MBE A;  3PM2 A;  4CID A;  1KK7 Z;  3D10 A;  1G33 A;  1KFX L;  1IWQ A;  4MZK A;  2SAS A;  1CDN A;  4N1G A;  2CT9 A;  4E68 A;  1CB1 A;  2GTE A;  3E3R A;  5AFP A;  4PHJ A;  1F71 A;  2COL B;  1FF1 A;  4CFQ A;  3D76 A;  3OB1 B;  1W9Z A;  3O4Y A;  2BAP A;  1J7R A;  4MRX A;  3DZT A;  2V53 A;  1DF0 B;  5D69 A;  2ZFD A;  1EG3 A;  1K94 A;  1QV1 A;  1PVA A;  3CAB A;  2GGM A;  3SG3 A;  3TUY B;  5B8I B;  1TNW A;  3GK4 X;  4M2P A;  3FE6 A;  5G08 A;  1C07 A;  2KBM A;  2OTG B;  1YUR A;  3EVV A;  2LAP A;  5HLO A;  1JBA A;  1QAT A;  1UHH A;  2H8V A;  4PHN A;  1PK0 D;  2KGR A;  1GJY A;  2KI6 D;  5I2Q A;  4MEW A;  2KAY A;  1M39 A;  2K7O A;  1B7T Z;  2R2I A;  1KQV A;  5HKZ A;  3ICB A;  2Q91 A;  5DKQ A;  1A2X A;  1DQE A;  1CMF A;  1MHO A;  4GBA A;  1OMD A;  1K9U A;  5CSF A;  2L4H A;  2KAX A;  1WRZ A;  2PAS A;  4BY5 A;  4P5O E;  1QX7 A;  1L2O C;  1MXL C;  3UNW A;  1JWD A;  2LCP A;  1JUO A;  2QPT A;  5K89 A;  1CFP A;  3WNX B;  3R1P A;  4XJK B;  1FW4 A;  4I5K A;  3BFH A;  3S0B A;  1QLS A;  3H4S E;  1BF5 A;  3I5G C;  2KBI A;  1CDL A;  1ZUZ A;  1TIZ A;  1FI6 A;  1KWO B;  1LIN A;  4INX A;  5D3O A;  5CSJ A;  2DOQ A;  2KYF A;  1AVS A;  2ISD A;  3CDN A;  2KQY A;  1NX0 A;  2L50 A;  1SCV A;  4OCI A;  1WDC C;  2MHH A;  1E8A A;  3CTN A;  1DVI A;  1B4C A;  1SPY A;  1SCM C;  1OOJ A;  3D0Y B;  5FI7 A;  3DYE A;  2L4I A;  4U8D A;  1JF0 A;  2JNF A;  3V2L A;  1UUS A;  3M0W A;  1GQM A;  1MXE A;  3TUY C;  2WCM A;  2WOR A;  2JXL A;  4HSZ A;  1J1D A;  1DMO A;  3FS7 A;  2OTG C;  1B1G A;  2KAV A;  4KYN A;  1Y1X A;  1AHR A;  2MA2 A;  1W7J B;  2MJW B;  1WLZ A;  4YI8 A;  1OZS A;  3A4U B;  1PSR A;  2M0R A;  2EGD A;  4JD9 A;  1M45 A;  1DC1 A;  3RLZ A;  4L9M A;  3CYZ A;  3O4X A;  1TTX A;  3WXA A;  4MZL A;  2JPO A;  4JWQ A;  5KTY A;  1S5G Z;  3PM8 A;  3LK1 A;  4PAL A;  3NSI A;  3CLN A;  5J3X A;  2JWW A;  3HCM A;  1BMO A;  1PSB A;  3FWC A;  3N7H A;  3CGA A;  1RFJ A;  2LP2 A;  1MF8 B;  3D75 A;  3BXK A;  2PMY A;  4GNK B;  1QWV A;  4PE7 A;  1OE9 B;  2PRU A;  3L4L A;  3BOW B;  2ZN9 A;  4YGB B;  1KFU L;  1QS7 A;  3EKJ A;  2JC2 A;  4D1E A;  2KI6 C;  1KWO C;  1F70 A;  2EC6 B;  1X02 A;  3BQ3 A;  3PJI A;  1WY9 A;  1CLB A;  1SR6 B;  2E6W A;  5IBW A;  2QEH A;  3LL8 B;  1SKT A;  4JPZ B;  4PHK A;  4ORC B;  1N65 A;  5JJG A;  1S6I A;  1MWN A;  3EK4 A;  4I5L B;  2LVK A;  1SK6 D;  3CZ0 A;  1ZFS A;  1M46 A;  1YX7 A;  1B47 A;  2MLE C;  3PSR A;  1NP8 A;  4YI9 A;  2P6B B;  1L2O B;  1CM4 A;  1K2H A;  1C3Z A;  1H4B A;  1BJF A;  2L0P A;  1BOD A;  2BNX A;  3FWB A;  1G4Y R;  1YR5 A;  2M1K B;  2H61 C;  3BFA A;  3WHU B;  1QVI Y;  1XFX O;  1DJI A;  2L2E A;  2TN4 A;  3K21 A;  1C3Y A;  3LK0 A;  1TUZ A;  1UHK A;  1OZO A;  2LNK A;  3WHT B;  1DJX A;  3I5G B;  1V1F A;  1R2U A;  3TZ1 A;  1IJ5 A;  1OW4 A;  4CLN A;  1GGW A;  1LVC D;  1S6C A;  5I94 A;  1FI5 A;  1TNQ A;  1SMG A;  1S6J A;  3VRN A;  3CR4 X;  1XFY O;  2AAO A;  2BCB A;  1RK9 A;  2JRF A;  1NIW A;  3R72 A;  4ICB A;  2SCP A;  3EVU A;  5DKN A;  1WDC B;  1RRO A;  1KCY A;  3VRP A;  2I18 A;  1SCM B;  1OSA A;  2L51 A;  1NPQ A;  4YGD B;  1DF0 A;  1EJ3 A;  2ERB A;  3B6X A;  4PE0 A;  4ETO A;  5HL1 A;  2BCX A;  2M3W A;  3FE9 A;  1QTX A;  5PAL A;  2E30 A;  3OB2 B;  3CZ2 A;  4YBH B;  2KNE A;  3D77 A;  3SG6 A;  2M8U A;  2A4J A;  1YUU A;  2AMI A;  2BEC A;  2WCJ A;  1UUR A;  1TWO A;  1JF2 A;  1YVL A;  2EC6 C;  1SRA A;  2KGB C;  2LUX A;  1JFK A;  2KFF A;  2MLF C;  4PE1 A;  4DCK A;  2QEB A;  3VRR A;  3IQO A;  2HPS A;  1KK8 B;  5CPV A;  1SR6 C;  1IJ6 A;  1QX2 A;  4YRU A;  1N2D A;  1DEK A;  1RWY A;  1S1E A;  2M49 B;  1M31 A;  3I5F B;  1PVB A;  1K9K A;  1XFV O;  1RJV A;  2WCH A;  1OOF A;  1F55 A;  1GM0 A;  2F2P A;  1TNP A;  2BE6 A;  4OR9 B;  3TDI A;  3SG7 A;  1Y1A A;  1NX2 A;  1XFR A;  4GAO A;  2FCE A;  1KFX S;  3B7A A;  1SL7 A;  1XFW O;  2O60 A;  2WCF A;  2KOT A;  2ZN8 A;  2LC5 A;  2JUL A;  4XJK A;  2BL0 B;  4F0Z B;  1J7O A;  1CTR A;  4MZJ A;  3B87 A;  3I5H B;  1A75 B;  1GGZ A;  2KYC A;  3BUO B;  1WLM A;  1Q80 A;  1QJT A;  4MN0 A;  4R1E A;  1XK4 C;  4PT1 A;  4GPL B;  1Y6W A;  2K60 A;  1OMV A;  2HQW A;  2Y5I A;  4GGN A;  4GUK A;  1MR8 A;  1R6P A;  2JPT A;  2BBM A;  2OPO A;  2KSP A;  1IRJ A;  2EHB A;  1Z2C B;  3AAJ A;  3JVT B;  3MSE B;  3OHM B;  2KQ6 A;  3TDU A;  4PHM A;  2M1U A;  1A03 A;  1ALW A;  2GGZ A;  2KFH A;  5FYX A;  1YUT A;  1S26 D;  1JFJ A;  1PRW A;  4UPG A;  1J1E A;  1DJW A;  5D7F A;  2B1U A;  1A29 A;  1WRL A;  2Y1N A;  1S36 A;  4DIR A;  1DT7 B;  1SW8 A;  1ZOT B;  3D0Y A;  2NZ0 A;  1DJG A;  2LM5 A;  3K1E A;  5EL2 A;  4DS7 A;  1SSE B;  3GK1 A;  1QX5 B;  1ORG A;  4TNC A;  2I7A A;  5HKW A;  4ORB B;  1K96 A;  1DJY A;  2K61 A;  3PN7 B;  3QME A;  2F8P A;  1KQM B;  3OX5 A;  2D8N A;  1HT9 A;  1TN4 A;  3EG5 B;  1CDM A;  1K9P A;  1KK8 C;  2MAZ A;  3FIA A;  1CDP A;  2WOS A;  4HRG A;  3BUW B;  1IG5 A;  2PSR A;  2JT0 A;  3ZWH A;  1DTL A;  2LAN A;  4ZCU A;  3I5F C;  4DRW A;  3D73 A;  2WC6 A;  1FPW A;  1NSH A;  3EK8 A;  1J55 A;  5BPJ A;  1U5I B;  1K8U A;  3CZT X;  1M63 B;  3JTD B;  4I5N B;  1ZMZ A;  4QJ3 B;  1OOI X;  3DF0 B;  3SG5 A;  2O5G A;  2CCM A;  2NLN A;  4MRY A;  2JNX A;  2L5X B;  2QEO A;  2QEV A;  3R1O A;  2LUC A;  2KFG A;  2P70 A;  2JQ6 A;  2BL0 C;  2F2O A;  1Z4H A;  2OS8 B;  3AKB A;  1SL8 A;  3KPX A;  2Q4U A;  3BOW A;  2WC5 A;  1IIO A;  3I5H C;  3OGN A;  1K93 D;  2JT8 A;  4OV2 A;  1JSA A;  1K90 D;  2LE9 B;  1V1G A;  2F33 A;  3PFV A;  3S0E A;  5I2O A;  2LVI A;  4M2Q A;  3SS4 A;  2K7B A;  2LVJ A;  2M97 A;  3VRO A;  2NCO A;  3NSO A;  1AJ4 A;  1NX3 A;  1H8B A;  3JVT C;  1JC2 A;  1TOP A;  1LA0 A;  1C7V A;  4C0K A;  4NQG A;  4YGE B;  3KO0 A;  4IJ7 A;  4PE4 A;  4QJ5 B;  2KDH A;  1B8C A;  1YTZ C;  2LMT A;  2PQL A;  3O78 A;  4WQ3 A;  4WRI A;  5HLV A;  4AOM A;  1CKK A;  3R1V A;  1XYD A;  2G9B A;  1PAL A;  3VGO A;  3EVR A;  4ORA B;  1F54 A;  2JTT A;  1KSM A;  4C0J A;  4N1F A;  4NDC A;  3IQQ A;  4F7F A;  3PN7 C;  2L2C A;  2G2B A;  3SIB A;  1KQM C;  1KK7 Y;  3C1V A;  4MSP A;  1EG4 A;  2PYQ A;  1QV0 A;  1IGV A;  1XK4 A;  4AQI A;  3TDZ A;  2K0J A;  2LHI A;  2KLD A;  3L47 A;  1AK8 A;  1D1O A;  1YX8 A;  1BT6 A;  5CSN A;  3SG4 A;  1SBJ A;  1HQV A;  1XVJ A;  3JTD C;  1CFD A;  1KFU S;  3LCP C;  4BY4 A;  1BU3 A;  2JT3 A;  2L98 A;  2WC8 A;  3EK7 A;  3B86 A;  3BYA A;  2MBX A;  2M7N A;  3FE8 A;  4GGF C;  1QVI Z;  2LV7 A;  3D74 A;  1BR1 B;  3PAT A;  3Q8I A;  3IVT A;  1XFZ O;  2YGU A;  4OVN F;  3AAK A;  5AXI A;  2NCP A;  3RZS A;  3BUM B;  1MUX A;  1G8I A;  2OS8 C;  3CR5 X;  1TRF A;  3DVK A;  1F4Q A;  3SG2 A;  3AKA A;  1TNX A;  2KPH A;  2M29 A;  2PVB A;  4ZCV A;  1DGV A;  1B7T Y;  5FI2 A;  3RM1 A;  3NGV A;  1NYA A;  1OOG A;  1F4O A;  1SYM A;  4HRE E;  1TUJ A;  4CPV A;  2BKH B;  1DEL A;  3I5I C;  1NCY A;  3TS5 B;  1TCF A;  1FBV A;  1UWO A;  3DD4 A;  1F8H A;  1YUS A;  1B8R A;  1EXR A;  1NCZ A;  2FCD A;  5ER5 A;  1S3P A;  2M9G A;  3NXA A;  4JQ0 D;  1IKU A;  2WND A;  3BUN B;  1LA3 A;  1EL4 A;  1QXP A;  3S0F A;  1CMG A;  2WCK A;  2JZI A;  1REC A;  2L5Y A;  5KU1 A;  2F3Z A;  3BFB A;  1OOH A;  1NX1 A;  3SJS A;  1A75 A;  3B88 A;  1BOC A;  3NSL A;  1QLK A;  3OX6 A;  4HRH A;  1KSO A;  3NHI A;  2FJU B;  2ZNE A;  2HQ8 A;  4YGA A;  4M2O A;  1A4P A;  3GK2 A;  3L4A A;  3O6B A;  4NDB A;  4PDZ A;  4XYN A;  3DVM A;  5F6T A;  5DKR A;  3CS1 A;  5AER A;  3S0D A;  2KI4 B;  1XA5 A;  3PAL A;  3A8R A;  4DUQ A;  2LLT A;  2LVV A;  1CLM A;  2BKI B;  2JXC A;  3CWG A;  1EH2 A;  1AJ5 A;  2K7D A;  2H61 A;  1BR4 B;  1OMR A;  3KHE A;  2GV5 A;  1NCX A;  2BCA A;  2P71 A;  4I5J A;  2LP3 A;  4A4C A;  1UHJ A;  2ZKM X;  2VRG A;  4FTG A;  3IF7 A;  2BE4 A;  2F3Y A;  5FI6 A;  4A4B A;  1C7W A;  4NDD A;  2K7C A;  3DVE A;  2JU0 A;  2Y4Q A;  1CNP A;  1DGU A;  1S5G Y;  2WCE A;  5AAN A;  5HYD A;  3TS5 C;  5AEQ A;  1Y0V H; 
#chains in the Genus database with same CATH homology
 1IIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...