1IIOA

Nmr-based structure of the conserved protein mth865 from the archea methanobacterium thermoautotrophicum
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
84
Chain Sequence
GSHMKMGVKEDIRGQIIGALAGADFPINSPEELMAALPNGPDTTCKSGDVELKASDAGQVLTADDFPFKSAEEVADTIVNKAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein MTH865
publication title NMR-based structure of the conserved protein MTH865 from the archaeon Methanobacterium thermoautotrophicum.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Structural genomics, unknown function
total genus 17
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2001-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07747 MTH865 MTH865-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.80 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 MTH865-like 1iioA00
1IIOA
chains in the Genus database with same CATH superfamily
2F2OA 1J7OA 1Y6WA 3TS5B 1HQVA 1EL4A 5I8NA 1B9AA 5BPJA 1S6CA 1LINA 2COLB 2NXQA 2YGUA 1SMGA 2I94A 5GQQC 3FE8A 2MAZA 4INXA 1CFCA 1SCMB 1TIZA 5CSIA 3TS5C 3FE6A 4GGFA 4GBAA 3JTDB 4YI8A 1SNLA 2JZIA 2MHHA 3PSRA 1KSMA 1R6PA 1JFKA 1XYDA 4I5NB 4PT1A 1KQVA 3S0BA 5AERA 2L50A 2M97A 3L47A 2H2KA 2LLUA 1SCMC 4N1FA 2SASA 2WC8A 3DVMA 3LL8B 5HLVA 3S0FA 1NX3A 2LHLA 1QATA 3OBVA 1W9ZA 1RECA 3IQOA 2WCKA 1NCYA 4YGBB 2KHNA 3PM8A 5F6TA 4AQJA 1MXEA 3D78A 1BJFA 3ZNIA 3FWCA 1JBAA 2F8PA 2M1KB 3AAKA 1ALWA 4USLA 2LMVA 3TDZA 5I2QA 1EG4A 1N0YA 2LMUA 3KO0A 4A4CA 2K0JA 2CNPA 1KK8C 2QPTA 5TNCA 1AJ4A 2FJYA 5CSNA 1UHKA 2ERBA 4WQ3A 2LLSA 3TDUA 1CLLA 3GK2A 3NSIA 1Y0VH 1DQEA 5DKQA 1YTZC 3M0WA 3B87A 3DYEA 1NSHA 1J7RA 2M49B 4MLWA 1B1GA 2AAOA 1UP5A 2JT0A 2QEOA 3BJHA 2P71A 1WDCB 3SS3A 2JOJA 1JFJA 1IQ5A 3WHTB 4DCKA 3SG5A 4UPGA 3LK1A 3B88A 1BT6A 1TCFA 3B6XA 4Q04A 1F55A 2M8UA 1XK4C 2AMIA 5I2LA 3PJIA 1XFWO 5FI6A 4MRYA 2KQ6A 1WDCC 1KFUS 3EKHA 3EVRA 4I5LB 4YGDB 4DRWA 4M2PA 1G8IA 2B1UA 2KPHA 1XFXO 1YUTA 1NWDA 4PHJA 2JPOA 2M3WA 5AXIA 2FCEA 2H61C 1BLQA 1QVIZ 3C1VA 1OE9B 3EKJA 2NCOA 4MN0A 4PE0A 3SIAA 3BOWB 3CZTX 3KF9A 1KCYA 1IIOA 3ICBA 1A03A 1RWYA 3GOFA 1S5GY 1MQ1A 1DELA 1YURA 1XO5A 1A2XA 2WCHA 2LV7A 2QEBA 1L2OB 4BY4A 1YX7A 2KBMA 1TWOA 2KOTA 3WXAA 3DF0A 1MHOA 3FIAA 3NHTA 1CM4A 1OOIX 1KWOC 4L9MA 5AANA 1L2OC 1BU3A 1K95A 5FYXA 5KU1A 2DOQA 3SG6A 3D0YB 2JU0A 1BG1A 1A75B 2PASA 4PHMA 3D77A 2WNDA 1ZOTB 2KSPA 2PRUA 1DMOA 4JKTA 2E6WA 1Y1XA 1SKTA 1CDPA 1CDLA 1K9PA 1J1DA 4XJKB 2ISDA 2CBLA 2ZKMX 2KFHA 4C0LA 1AHRA 2CTNA 1QXPA 3QMEA 4XYNA 1B4CA 3BXKA 1RROA 3FS7A 2K8MB 4MEWA 1AUIB 2KNEA 1C3ZA 2R2IA 2SCPA 4MZJA 1F4QA 1KQMB 1Q80A 2BL0B 2ZRSA 1KSOA 2JC2A 2L0PA 1Z4HA 1CM1A 2MRDA 4A4BA 3K1EA 2K7DA 3E3RA 1IQ3A 2GGMA 1JF0A 3D73A 1SR6B 2I18A 2BL0C 1J7PA 5HL1A 1XFZO 2LVJA 2JT3A 4F0ZB 3TDIA 4JQ0D 3CS1A 1OMRA 1WRZA 2OTGC 1DJZA 2K7BA 1LKJA 3K21A 2LP3A 1QX7A 1QASA 1ZFSA 2PYQA 1DGUA 2EC6B 2LUXA 2WCBA 2WORA 3DD4A 3JVTB 2JXLA 4YGAA 3CGAA 4OVNF 1ODBA 4PE7A 3S0AA 3I5IB 2F33A 2WCMA 4PALA 1K2HA 3H4SE 2ZRTA 1Z2CB 2L4IA 3GK4X 1T14A 2EHBA 1OOJA 2KI6C 1B47A 1PK0D 2PALA 2F2PA 4C0KA 4U8DA 4YI9A 3ZWHA 4PCWA 1MXLC 1XFUO 4DUQA 4QJ5B 2G9BA 2P6BB 1KK7Y 2L98A 1LS8A 2KYCA 3IF7A 4ZCUA 4CFQA 1BODA 1PVBA 3PLFB 1G4YR 1UHJA 4ICBA 4AOMA 5D69A 2KDHA 1S36A 2JWWA 3BUWB 1NCZA 2NCPA 2L5XB 5D7FA 2RGIA 2CT9A 5HKWA 2MA2A 5DKRA 1OZSA 2EGDA 2BNXA 2KI4C 3PFVA 3PATA 1LXFC 4DS7A 3DZTA 2I7AA 3SG4A 1WLZA 4MBEA 5DKNA 3S0GA 2P70A 1MUXA 4MZLA 1QWVA 2Y4QA 5K89A 1CFDA 1QV0A 2WCEA 1YRTB 1CDNA 3OX5A 3IVTA 1TRFA 1YUUA 2MLFC 3CZ1A 1WRLA 1KK8B 1XA5A 2F3YA 1TNQA 2M7NA 2GGZA 4OR9B 1K9UA 4TNCA 4GAOA 4IJ7A 2K60A 1XFVO 2ZNDA 3AAJA 4M2OA 1C7WA 4FQTA 3EK4A 3D74A 3NSLA 4HRGA 1OMDA 1SL8A 3BUMB 4ETOA 1JF2A 1S5GZ 1U5IB 2NLNA 1NCXA 1RJVA 1DGVA 4GGFC 2Y5IA 3UO9A 1F54A 1HT9A 3VRRA 1WY9A 3DVEA 2LHIA 1CB1A 1SPYA 1V1FA 2FCDA 1CDMA 3EK8A 1ALVA 4MSPA 2OPOA 5ER4X 2JTTA 1CTRA 1VRKA 1IJ6A 2E30A 2JRFA 2JPTA 2KLDA 2LC5A 2Y1NA 3D76A 1S26D 1S1EA 3OGNA 3UNWA 2G2BA 2HQ8A 1NPQA 1MWNA 1SYMA 1TNWA 1DC1A 3BOWA 4ZCVA 5CPVA 2BCXA 3R1PA 2LAPA 3O4XA 1NX1A 4NQGA 4GNKB 1JUOA 1M31A 3VROA 4OZDA 4I5JA 4F7FA 2PMYA 3CLNA 2WC6A 1DF0B 3CZ0A 4GUKA 5AEQA 1EH2A 1OW4A 2GV5A 2V53A 1WRKA 4WRIA 3DXLA 1YR5A 3CR2A 2FOTA 3B7AA 1KWOB 3KEVA 4GFTA 5HLOA 1BOCA 1UHNA 2M1UA 2BECA 4MVFA 2L2CA 5I94A 1J55A 3D0YA 1A75A 5AFPA 2JXCA 2L2EA 2L51A 2CXJA 4ORAB 3KHEA 1C7VA 3GK1A 1EJ3A 2M0RA 1LVCD 4XJKA 1K94A 3SG3A 3WHUB 2JQ6A 4WQ2A 1NP8A 4FTGA 1FPWA 4GGNA 1YVHA 5ER5A 1QX2A 1IJ5A 1SL9A 4JWQA 1IH0A 1GM0A 2JNFA 1S3PA 3CR4X 1PULA 1CMGA 2LE9B 2NZ0A 4KYNA 1PSRA 2JULA 4PHKA 3MSEB 3R1OA 1SK6D 3A4UB 2K61A 1TCOB 1D1OA 2M29A 1NX0A 1OOFA 2ZFDA 4CLNA 4ORCB 5FI2A 3FWBA 1G33A 2MJWB 2LUCA 2LVVA 2OTGB 3EK7A 1AVSA 2MBXA 1SL7A 1AJ5A 1KK7Z 1SCVA 5KTYA 1J7QA 4PE4A 2FJUB 3DVJA 2MLEC 1K90D 4R1EA 3SG7A 1A4PA 3TUYC 2HPSA 3DVKA 1TUJA 3NSOA 1MF8B 1NYAA 1QLKA 2KGBC 5D3OA 3RZSA 1GGZA 3OB1B 4NDDA 1P28A 4M2QA 1K9KA 2KLEA 1KFXL 3D75A 2I2RE 5EL2A 1QS7A 1GJYA 3LLEA 1QIWA 3PALA 1XFYO 4CPVA 1UHHA 4I5KA 1PRWA 1A29A 2BCAA 1UUSA 1IWQA 1V1GA 1NIWA 3LK0A 4PDZA 1OOHA 3BFAA 1SY9A 3SJSA 2WCFA 5CSJA 5DICA 2BKHB 3BFBA 1DJXA 4INWA 4CIDA 2KI4B 2TN4A 1B7TZ 1GQMA 1AP4A 1WLMA 3CDNA 3I5GB 4MZKA 3O4YA 3D10A 1BR4B 1CMFA 1QTXA 3L4AA 1LA0A 1ZACA 3BFHA 4HREE 2LVIA 1JC2A 2KFFA 3I5GC 1CFFA 1OZOA 1B8LA 2BBNA 3BYAA 5I2OA 3TZ1A 2LNKA 1FI5A 2QDIA 1FW4A 1TTXA 3BQ3A 3OX6A 2ZN8A 1IGVA 4C0JA 3O6BA 3VB1A 1QIVA 2F3ZA 4PE1A 4NDCA 1B8RA 1Y1AA 1RFJA 1YUSA 2KI6D 3RM1A 4D1EA 1B7TY 4IL1A 4OV2A 1C07A 2WCJA 1BMOA 1U5IA 1XK4A 5HKZA 1YX8A 3JTDC 2K2FA 3CABA 3HX4A 1JWDA 2A4JA 3V2LA 1EXRA 3BUOB 1H4BA 1XVJA 4N5XA 3EVVA 1PSBA 1IG5A 1L7ZA 2Q4UA 4P5OE 5IBWA 2JTZA 2LANA 2OS8B 2BE6A 2LMTA 1F71A 1ZMZA 2H61A 2HF5A 1H8BA 1TN4A 3VRNA 3B86A 1DJGA 1K8UA 4E68A 2ZNEA 1F4OA 2M9GA 3NHIA 2QEVA 1TNPA 2OS8C 1Y1UA 3OHMB 2K7CA 2VRGA 1SBJA 2H8VA 1M45A 4AQIA 1OSAA 4YGCB 1UWOA 1DF0A 2IS9A 1GGWA 2BCBA 2HQWA 5JOLA 5FI7A 2CCMA 2KQYA 4JPZB 3EG5B 2JT8A 2LM5A 1DJIA 1DJHA 2QACA 1S6JA 3SIBA 4CFRA 1QJTA 1CLMA 3OB2B 3LCPC 3SS4A 1OOGA 5J3XA 4GPLB 5KSZA 3HCMA 4YGEB 1PALA 1DJWA 2KGRA 3I5HB 4BY5A 2BAPA 4OKHA 2PVBA 4YBHB 3PM2A 4OCIA 1E8AA 3BUXB 3DY9A 2LP2A 3CTNA 3EVUA 1N2DA 3I5HC 1KFUL 5PALA 1CLBA 2WC5A 3S0EA 2KAYA 1AK8A 1DTLA 1EG3A 1TUZA 3R1VA 2L4HA 2AUCA 2Q91A 3NGVA 2KYFA 4NDBA 1QX5B 3NXAA 1PVAA 2BE4A 1W7JB 4YRUA 2O5GA 2GTEA 3VGOA 2QEHA 2D8NA 3I5FB 1TNXA 1BR1B 2ZN9A 1NX2A 1F8HA 1SW8A 3OP0A 1R2UA 3TUYB 1ORGA 3DF0B 3Q8IA 4QJ4B 2KAXA 1FF1A 1X02A 3NSKA 3IQQA 3I5FC 3L4LA 3AKAA 3CZ2A 1K93D 1XFRA 2K2AA 5HKYA 1N65A 1QVIY 2LCPA 1OQPA 4P2YB 2PSRA 3BUNB 1KFXS 1SRAA 3A8RA 1CKKA 2PQLA 4MRXA 3VRPA 1M63B 1DT7B 1QV1A 2O60A 5JJGA 1NUBA 2WCLA 1YVLA 3FE9A 3SS5A 1F70A 1IRJA 1K96A 1MR8A 2JNXA 4DIRA 1C3YA 1S6IA 3O2PA 2HETA 3R72A 4HRHA 1M39A 1DEKA 3N7HA 1CNPA 3PN7B 3RLZA 2LVKA 1KQMC 2Y1MA 1M46A 1BF5A 4JD9A 1LA3A 4FQOA 4ORBB 1JSAA 1TOPA 4HSZA 3CR5X 3KPXA 2KAVA 2LLTA 1OMVA 1UHIA 3PN7C 3CWGA 1SR6C 1UURA 2BKIB 2KFGA 3O78A 1YRUB 2M7LA 5HYDA 4PHNA 3SG2A 1FI6A 1ZUZA 2BBMA 1SSEB 3QRXA 3VRQA 1RTP1 1CFPA 2KBIA 4N1GA 3S0DA 1FBVA 5B8IB 1DJYA 1RK9A 3F45A 1B8CA 1IKUA 2EC6C 3JVTC 3AKBA 1W7IB 5CSFA 3WNXB 2L5YA 1J1EA 2K7OA 1QLSA 5G08A 1DVIA 4QJ3B 2WOSA 3CYZA 3I5IC
chains in the Genus database with same CATH topology
1IIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IIO A; 
#chains in the Genus database with same CATH topology
 2F2O A;  1J7O A;  1Y6W A;  3TS5 B;  1HQV A;  1EL4 A;  5I8N A;  1B9A A;  5BPJ A;  1S6C A;  1LIN A;  2COL B;  2NXQ A;  2YGU A;  1SMG A;  2I94 A;  5GQQ C;  3FE8 A;  2MAZ A;  4INX A;  1CFC A;  1SCM B;  1TIZ A;  5CSI A;  3TS5 C;  3FE6 A;  4GGF A;  4GBA A;  3JTD B;  4YI8 A;  1SNL A;  2JZI A;  2MHH A;  3PSR A;  1KSM A;  1R6P A;  1JFK A;  1XYD A;  4I5N B;  4PT1 A;  1KQV A;  3S0B A;  5AER A;  2L50 A;  2M97 A;  3L47 A;  2H2K A;  2LLU A;  1SCM C;  4N1F A;  2SAS A;  2WC8 A;  3DVM A;  3LL8 B;  5HLV A;  3S0F A;  1NX3 A;  2LHL A;  1QAT A;  3OBV A;  1W9Z A;  1REC A;  3IQO A;  2WCK A;  1NCY A;  4YGB B;  2KHN A;  3PM8 A;  5F6T A;  4AQJ A;  1MXE A;  3D78 A;  1BJF A;  3ZNI A;  3FWC A;  1JBA A;  2F8P A;  2M1K B;  3AAK A;  1ALW A;  4USL A;  2LMV A;  3TDZ A;  5I2Q A;  1EG4 A;  1N0Y A;  2LMU A;  3KO0 A;  4A4C A;  2K0J A;  2CNP A;  1KK8 C;  2QPT A;  5TNC A;  1AJ4 A;  2FJY A;  5CSN A;  1UHK A;  2ERB A;  4WQ3 A;  2LLS A;  3TDU A;  1CLL A;  3GK2 A;  3NSI A;  1Y0V H;  1DQE A;  5DKQ A;  1YTZ C;  3M0W A;  3B87 A;  3DYE A;  1NSH A;  1J7R A;  2M49 B;  4MLW A;  1B1G A;  2AAO A;  1UP5 A;  2JT0 A;  2QEO A;  3BJH A;  2P71 A;  1WDC B;  3SS3 A;  2JOJ A;  1JFJ A;  1IQ5 A;  3WHT B;  4DCK A;  3SG5 A;  4UPG A;  3LK1 A;  3B88 A;  1BT6 A;  1TCF A;  3B6X A;  4Q04 A;  1F55 A;  2M8U A;  1XK4 C;  2AMI A;  5I2L A;  3PJI A;  1XFW O;  5FI6 A;  4MRY A;  2KQ6 A;  1WDC C;  1KFU S;  3EKH A;  3EVR A;  4I5L B;  4YGD B;  4DRW A;  4M2P A;  1G8I A;  2B1U A;  2KPH A;  1XFX O;  1YUT A;  1NWD A;  4PHJ A;  2JPO A;  2M3W A;  5AXI A;  2FCE A;  2H61 C;  1BLQ A;  1QVI Z;  3C1V A;  1OE9 B;  3EKJ A;  2NCO A;  4MN0 A;  4PE0 A;  3SIA A;  3BOW B;  3CZT X;  3KF9 A;  1KCY A;  1IIO A;  3ICB A;  1A03 A;  1RWY A;  3GOF A;  1S5G Y;  1MQ1 A;  1DEL A;  1YUR A;  1XO5 A;  1A2X A;  2WCH A;  2LV7 A;  2QEB A;  1L2O B;  4BY4 A;  1YX7 A;  2KBM A;  1TWO A;  2KOT A;  3WXA A;  3DF0 A;  1MHO A;  3FIA A;  3NHT A;  1CM4 A;  1OOI X;  1KWO C;  4L9M A;  5AAN A;  1L2O C;  1BU3 A;  1K95 A;  5FYX A;  5KU1 A;  2DOQ A;  3SG6 A;  3D0Y B;  2JU0 A;  1BG1 A;  1A75 B;  2PAS A;  4PHM A;  3D77 A;  2WND A;  1ZOT B;  2KSP A;  2PRU A;  1DMO A;  4JKT A;  2E6W A;  1Y1X A;  1SKT A;  1CDP A;  1CDL A;  1K9P A;  1J1D A;  4XJK B;  2ISD A;  2CBL A;  2ZKM X;  2KFH A;  4C0L A;  1AHR A;  2CTN A;  1QXP A;  3QME A;  4XYN A;  1B4C A;  3BXK A;  1RRO A;  3FS7 A;  2K8M B;  4MEW A;  1AUI B;  2KNE A;  1C3Z A;  2R2I A;  2SCP A;  4MZJ A;  1F4Q A;  1KQM B;  1Q80 A;  2BL0 B;  2ZRS A;  1KSO A;  2JC2 A;  2L0P A;  1Z4H A;  1CM1 A;  2MRD A;  4A4B A;  3K1E A;  2K7D A;  3E3R A;  1IQ3 A;  2GGM A;  1JF0 A;  3D73 A;  1SR6 B;  2I18 A;  2BL0 C;  1J7P A;  5HL1 A;  1XFZ O;  2LVJ A;  2JT3 A;  4F0Z B;  3TDI A;  4JQ0 D;  3CS1 A;  1OMR A;  1WRZ A;  2OTG C;  1DJZ A;  2K7B A;  1LKJ A;  3K21 A;  2LP3 A;  1QX7 A;  1QAS A;  1ZFS A;  2PYQ A;  1DGU A;  2EC6 B;  2LUX A;  2WCB A;  2WOR A;  3DD4 A;  3JVT B;  2JXL A;  4YGA A;  3CGA A;  4OVN F;  1ODB A;  4PE7 A;  3S0A A;  3I5I B;  2F33 A;  2WCM A;  4PAL A;  1K2H A;  3H4S E;  2ZRT A;  1Z2C B;  2L4I A;  3GK4 X;  1T14 A;  2EHB A;  1OOJ A;  2KI6 C;  1B47 A;  1PK0 D;  2PAL A;  2F2P A;  4C0K A;  4U8D A;  4YI9 A;  3ZWH A;  4PCW A;  1MXL C;  1XFU O;  4DUQ A;  4QJ5 B;  2G9B A;  2P6B B;  1KK7 Y;  2L98 A;  1LS8 A;  2KYC A;  3IF7 A;  4ZCU A;  4CFQ A;  1BOD A;  1PVB A;  3PLF B;  1G4Y R;  1UHJ A;  4ICB A;  4AOM A;  5D69 A;  2KDH A;  1S36 A;  2JWW A;  3BUW B;  1NCZ A;  2NCP A;  2L5X B;  5D7F A;  2RGI A;  2CT9 A;  5HKW A;  2MA2 A;  5DKR A;  1OZS A;  2EGD A;  2BNX A;  2KI4 C;  3PFV A;  3PAT A;  1LXF C;  4DS7 A;  3DZT A;  2I7A A;  3SG4 A;  1WLZ A;  4MBE A;  5DKN A;  3S0G A;  2P70 A;  1MUX A;  4MZL A;  1QWV A;  2Y4Q A;  5K89 A;  1CFD A;  1QV0 A;  2WCE A;  1YRT B;  1CDN A;  3OX5 A;  3IVT A;  1TRF A;  1YUU A;  2MLF C;  3CZ1 A;  1WRL A;  1KK8 B;  1XA5 A;  2F3Y A;  1TNQ A;  2M7N A;  2GGZ A;  4OR9 B;  1K9U A;  4TNC A;  4GAO A;  4IJ7 A;  2K60 A;  1XFV O;  2ZND A;  3AAJ A;  4M2O A;  1C7W A;  4FQT A;  3EK4 A;  3D74 A;  3NSL A;  4HRG A;  1OMD A;  1SL8 A;  3BUM B;  4ETO A;  1JF2 A;  1S5G Z;  1U5I B;  2NLN A;  1NCX A;  1RJV A;  1DGV A;  4GGF C;  2Y5I A;  3UO9 A;  1F54 A;  1HT9 A;  3VRR A;  1WY9 A;  3DVE A;  2LHI A;  1CB1 A;  1SPY A;  1V1F A;  2FCD A;  1CDM A;  3EK8 A;  1ALV A;  4MSP A;  2OPO A;  5ER4 X;  2JTT A;  1CTR A;  1VRK A;  1IJ6 A;  2E30 A;  2JRF A;  2JPT A;  2KLD A;  2LC5 A;  2Y1N A;  3D76 A;  1S26 D;  1S1E A;  3OGN A;  3UNW A;  2G2B A;  2HQ8 A;  1NPQ A;  1MWN A;  1SYM A;  1TNW A;  1DC1 A;  3BOW A;  4ZCV A;  5CPV A;  2BCX A;  3R1P A;  2LAP A;  3O4X A;  1NX1 A;  4NQG A;  4GNK B;  1JUO A;  1M31 A;  3VRO A;  4OZD A;  4I5J A;  4F7F A;  2PMY A;  3CLN A;  2WC6 A;  1DF0 B;  3CZ0 A;  4GUK A;  5AEQ A;  1EH2 A;  1OW4 A;  2GV5 A;  2V53 A;  1WRK A;  4WRI A;  3DXL A;  1YR5 A;  3CR2 A;  2FOT A;  3B7A A;  1KWO B;  3KEV A;  4GFT A;  5HLO A;  1BOC A;  1UHN A;  2M1U A;  2BEC A;  4MVF A;  2L2C A;  5I94 A;  1J55 A;  3D0Y A;  1A75 A;  5AFP A;  2JXC A;  2L2E A;  2L51 A;  2CXJ A;  4ORA B;  3KHE A;  1C7V A;  3GK1 A;  1EJ3 A;  2M0R A;  1LVC D;  4XJK A;  1K94 A;  3SG3 A;  3WHU B;  2JQ6 A;  4WQ2 A;  1NP8 A;  4FTG A;  1FPW A;  4GGN A;  1YVH A;  5ER5 A;  1QX2 A;  1IJ5 A;  1SL9 A;  4JWQ A;  1IH0 A;  1GM0 A;  2JNF A;  1S3P A;  3CR4 X;  1PUL A;  1CMG A;  2LE9 B;  2NZ0 A;  4KYN A;  1PSR A;  2JUL A;  4PHK A;  3MSE B;  3R1O A;  1SK6 D;  3A4U B;  2K61 A;  1TCO B;  1D1O A;  2M29 A;  1NX0 A;  1OOF A;  2ZFD A;  4CLN A;  4ORC B;  5FI2 A;  3FWB A;  1G33 A;  2MJW B;  2LUC A;  2LVV A;  2OTG B;  3EK7 A;  1AVS A;  2MBX A;  1SL7 A;  1AJ5 A;  1KK7 Z;  1SCV A;  5KTY A;  1J7Q A;  4PE4 A;  2FJU B;  3DVJ A;  2MLE C;  1K90 D;  4R1E A;  3SG7 A;  1A4P A;  3TUY C;  2HPS A;  3DVK A;  1TUJ A;  3NSO A;  1MF8 B;  1NYA A;  1QLK A;  2KGB C;  5D3O A;  3RZS A;  1GGZ A;  3OB1 B;  4NDD A;  1P28 A;  4M2Q A;  1K9K A;  2KLE A;  1KFX L;  3D75 A;  2I2R E;  5EL2 A;  1QS7 A;  1GJY A;  3LLE A;  1QIW A;  3PAL A;  1XFY O;  4CPV A;  1UHH A;  4I5K A;  1PRW A;  1A29 A;  2BCA A;  1UUS A;  1IWQ A;  1V1G A;  1NIW A;  3LK0 A;  4PDZ A;  1OOH A;  3BFA A;  1SY9 A;  3SJS A;  2WCF A;  5CSJ A;  5DIC A;  2BKH B;  3BFB A;  1DJX A;  4INW A;  4CID A;  2KI4 B;  2TN4 A;  1B7T Z;  1GQM A;  1AP4 A;  1WLM A;  3CDN A;  3I5G B;  4MZK A;  3O4Y A;  3D10 A;  1BR4 B;  1CMF A;  1QTX A;  3L4A A;  1LA0 A;  1ZAC A;  3BFH A;  4HRE E;  2LVI A;  1JC2 A;  2KFF A;  3I5G C;  1CFF A;  1OZO A;  1B8L A;  2BBN A;  3BYA A;  5I2O A;  3TZ1 A;  2LNK A;  1FI5 A;  2QDI A;  1FW4 A;  1TTX A;  3BQ3 A;  3OX6 A;  2ZN8 A;  1IGV A;  4C0J A;  3O6B A;  3VB1 A;  1QIV A;  2F3Z A;  4PE1 A;  4NDC A;  1B8R A;  1Y1A A;  1RFJ A;  1YUS A;  2KI6 D;  3RM1 A;  4D1E A;  1B7T Y;  4IL1 A;  4OV2 A;  1C07 A;  2WCJ A;  1BMO A;  1U5I A;  1XK4 A;  5HKZ A;  1YX8 A;  3JTD C;  2K2F A;  3CAB A;  3HX4 A;  1JWD A;  2A4J A;  3V2L A;  1EXR A;  3BUO B;  1H4B A;  1XVJ A;  4N5X A;  3EVV A;  1PSB A;  1IG5 A;  1L7Z A;  2Q4U A;  4P5O E;  5IBW A;  2JTZ A;  2LAN A;  2OS8 B;  2BE6 A;  2LMT A;  1F71 A;  1ZMZ A;  2H61 A;  2HF5 A;  1H8B A;  1TN4 A;  3VRN A;  3B86 A;  1DJG A;  1K8U A;  4E68 A;  2ZNE A;  1F4O A;  2M9G A;  3NHI A;  2QEV A;  1TNP A;  2OS8 C;  1Y1U A;  3OHM B;  2K7C A;  2VRG A;  1SBJ A;  2H8V A;  1M45 A;  4AQI A;  1OSA A;  4YGC B;  1UWO A;  1DF0 A;  2IS9 A;  1GGW A;  2BCB A;  2HQW A;  5JOL A;  5FI7 A;  2CCM A;  2KQY A;  4JPZ B;  3EG5 B;  2JT8 A;  2LM5 A;  1DJI A;  1DJH A;  2QAC A;  1S6J A;  3SIB A;  4CFR A;  1QJT A;  1CLM A;  3OB2 B;  3LCP C;  3SS4 A;  1OOG A;  5J3X A;  4GPL B;  5KSZ A;  3HCM A;  4YGE B;  1PAL A;  1DJW A;  2KGR A;  3I5H B;  4BY5 A;  2BAP A;  4OKH A;  2PVB A;  4YBH B;  3PM2 A;  4OCI A;  1E8A A;  3BUX B;  3DY9 A;  2LP2 A;  3CTN A;  3EVU A;  1N2D A;  3I5H C;  1KFU L;  5PAL A;  1CLB A;  2WC5 A;  3S0E A;  2KAY A;  1AK8 A;  1DTL A;  1EG3 A;  1TUZ A;  3R1V A;  2L4H A;  2AUC A;  2Q91 A;  3NGV A;  2KYF A;  4NDB A;  1QX5 B;  3NXA A;  1PVA A;  2BE4 A;  1W7J B;  4YRU A;  2O5G A;  2GTE A;  3VGO A;  2QEH A;  2D8N A;  3I5F B;  1TNX A;  1BR1 B;  2ZN9 A;  1NX2 A;  1F8H A;  1SW8 A;  3OP0 A;  1R2U A;  3TUY B;  1ORG A;  3DF0 B;  3Q8I A;  4QJ4 B;  2KAX A;  1FF1 A;  1X02 A;  3NSK A;  3IQQ A;  3I5F C;  3L4L A;  3AKA A;  3CZ2 A;  1K93 D;  1XFR A;  2K2A A;  5HKY A;  1N65 A;  1QVI Y;  2LCP A;  1OQP A;  4P2Y B;  2PSR A;  3BUN B;  1KFX S;  1SRA A;  3A8R A;  1CKK A;  2PQL A;  4MRX A;  3VRP A;  1M63 B;  1DT7 B;  1QV1 A;  2O60 A;  5JJG A;  1NUB A;  2WCL A;  1YVL A;  3FE9 A;  3SS5 A;  1F70 A;  1IRJ A;  1K96 A;  1MR8 A;  2JNX A;  4DIR A;  1C3Y A;  1S6I A;  3O2P A;  2HET A;  3R72 A;  4HRH A;  1M39 A;  1DEK A;  3N7H A;  1CNP A;  3PN7 B;  3RLZ A;  2LVK A;  1KQM C;  2Y1M A;  1M46 A;  1BF5 A;  4JD9 A;  1LA3 A;  4FQO A;  4ORB B;  1JSA A;  1TOP A;  4HSZ A;  3CR5 X;  3KPX A;  2KAV A;  2LLT A;  1OMV A;  1UHI A;  3PN7 C;  3CWG A;  1SR6 C;  1UUR A;  2BKI B;  2KFG A;  3O78 A;  1YRU B;  2M7L A;  5HYD A;  4PHN A;  3SG2 A;  1FI6 A;  1ZUZ A;  2BBM A;  1SSE B;  3QRX A;  3VRQ A;  1RTP 1;  1CFP A;  2KBI A;  4N1G A;  3S0D A;  1FBV A;  5B8I B;  1DJY A;  1RK9 A;  3F45 A;  1B8C A;  1IKU A;  2EC6 C;  3JVT C;  3AKB A;  1W7I B;  5CSF A;  3WNX B;  2L5Y A;  1J1E A;  2K7O A;  1QLS A;  5G08 A;  1DVI A;  4QJ3 B;  2WOS A;  3CYZ A;  3I5I C; 
#chains in the Genus database with same CATH homology
 1IIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...