1IIOA

Nmr-based structure of the conserved protein mth865 from the archea methanobacterium thermoautotrophicum
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
84
Chain Sequence
b'GSHMKMGVKEDIRGQIIGALAGADFPINSPEELMAALPNGPDTTCKSGDVELKASDAGQVLTADDFPFKSAEEVADTIVNKAGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein MTH865
publication title NMR-based structure of the conserved protein MTH865 from the archaeon Methanobacterium thermoautotrophicum.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Structural genomics, unknown function
total genus 17
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2001-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07747 MTH865 MTH865-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.80 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 MTH865-like 1iioA00
1IIOA
chains in the Genus database with same CATH superfamily
2LVIA 4N1GA 4A4BA 1B1GA 1JSAA 1TUZA 1QV0A 2KAXA 2M7NA 2NZ0A 2WCMA 3SG5A 1JC2A 2LNKA 4U8DA 3PSRA 2ISDA 5TNCA 4TNCA 3WHUB 5CSJA 1NCXA 1KQVA 4C0KA 1XFRA 3VGOA 2LUCA 4PT1A 2M0RA 1TRFA 2LV7A 1G33A 1TUJA 1IGVA 1KFUS 1MF8B 2GV5A 5AFPA 3VROA 3JTDC 3BYAA 3CYZA 2LHIA 3DVMA 1K95A 1F4QA 3D10A 1CM1A 2F3ZA 1A29A 1RFJA 2JPOA 2V53A 1OQPA 4GGFA 3D73A 5I2OA 3SJSA 1B8CA 1NYAA 1TTXA 2NXQA 1K90D 3D0YA 3PALA 1SRAA 2KNEA 3NSKA 4JKTA 2Y5IA 2QEBA 3BFBA 2ZRTA 2KLEA 2AUCA 3FE8A 3WHTB 3B86A 1MUXA 1TIZA 2E6WA 3LK1A 1P28A 1BJFA 2M29A 5I8NA 1LS8A 1BR1B 3BXKA 2KI6C 2JQ6A 2JT0A 1DEKA 3S0FA 3CZTX 3GOFA 1NX2A 1EJ3A 1LVCD 1OE9B 3EG5B 4DRWA 1XVJA 3KHEA 1YX7A 3IVTA 1RECA 1RK9A 2CTNA 1A2XA 1DC1A 4PHNA 3L4LA 1K94A 5D69A 2YGUA 1JBAA 4I5LB 1QX7A 4YI9A 1DJZA 3PJIA 2FOTA 2H2KA 1UWOA 1ZUZA 3AKBA 4PHMA 1DJXA 2JOJA 2KQ6A 1BODA 2LUXA 3I5GC 3O4YA 3FS7A 4JD9A 2PMYA 4BY5A 1LKJA 1IKUA 2F3YA 3CR2A 3D0YB 1J55A 4YGDB 2JRFA 1EH2A 3CZ2A 2LE9B 2Q91A 2ZN9A 2QEOA 4INXA 3I5FC 1QLSA 4GGFC 3SIBA 4CFRA 4ORBB 4F0ZB 1EG3A 1H8BA 3FWCA 3ICBA 1C3YA 3PLFB 4WQ2A 4WQ3A 2K7CA 1QX5B 2L2EA 1FW4A 2P6BB 3OB1B 3RZSA 1S6CA 1BT6A 2HETA 1CFCA 4ZCVA 2JT8A 2WCHA 1V1FA 1C3ZA 1GGWA 1XK4C 1E8AA 2LVJA 2PALA 1TWOA 1WRKA 4CPVA 2ZRSA 4DCKA 2OPOA 3OB2B 1G4YR 1SMGA 5F6TA 1YURA 1SYMA 3QRXA 5JOLA 4ETOA 1ZACA 2KI4C 4OVNF 1NSHA 3NHTA 4NDDA 1OZOA 1BMOA 3TZ1A 2K7DA 4PE7A 1BOCA 3OP0A 1ALVA 3D75A 2JT3A 4D1EA 5BPJA 1OSAA 3R1VA 3BFAA 3NSIA 1GGZA 2QEHA 2OS8C 4ZCUA 2WC5A 5GQQC 1YVHA 3NHIA 3R72A 4YRUA 2CBLA 4GGNA 1QX2A 3LL8B 2WORA 2ERBA 2MRDA 2M1UA 3CS1A 3TS5B 1M46A 3B87A 4N5XA 4I5KA 2L5XB 3JVTC 2AAOA 3I5IB 1DJGA 1KQMB 1XFYO 2JTTA 1OOJA 1QV1A 4HRHA 2COLB 2LANA 3HX4A 2L0PA 4MVFA 5I2LA 3CZ0A 1CKKA 3B6XA 1XFXO 2OTGC 3EVUA 1S36A 2LCPA 2K7BA 4HRGA 1YR5A 1AJ4A 1QIVA 1MXEA 3CZ1A 3Q8IA 4MEWA 2L4HA 2WC8A 2WCEA 2M97A 4KYNA 1ALWA 1S5GZ 2KAYA 4JQ0D 2A4JA 1YTZC 3BUWB 5D3OA 1OMDA 1KK8B 5CSFA 1CM4A 1CDMA 3VRRA 1IIOA 3L47A 5AXIA 1SR6C 1CLMA 5G08A 1T14A 1F70A 2LLSA 1M45A 2GTEA 3CR5X 1NUBA 1IWQA 1SKTA 4CIDA 2ZKMX 1OOHA 5KSZA 3IF7A 3SS4A 4BY4A 2Q4UA 2KBIA 2KFFA 3I5HB 4DIRA 4FQTA 1GJYA 3KO0A 2KFGA 4OV2A 1XO5A 2KFHA 3JTDB 4A4CA 2BAPA 1AK8A 4XJKB 1AP4A 5AERA 1KK7Y 3I5HC 4YGBB 4AQJA 2LM5A 1SPYA 1DGUA 4HSZA 1SCVA 4M2OA 1UHIA 3VRNA 1B7TY 1CFDA 2ZN8A 2I2RE 2P71A 1A75B 1OOGA 1SK6D 4ORCB 1F71A 4PHKA 2LP2A 2G9BA 1CDNA 3R1OA 1MHOA 4PE0A 4YI8A 4FQOA 5HL1A 1WY9A 1BLQA 1Q80A 2NCOA 2SASA 1BG1A 3EK7A 3SIAA 3S0AA 2M49B 2KDHA 1S6IA 1XFVO 4MLWA 3SG2A 1W7JB 1WLMA 2K61A 5CSIA 1XK4A 3D78A 4C0LA 4OZDA 1DF0A 1KFXS 1DGVA 2M8UA 4GPLB 4N1FA 2BE4A 1DJYA 1LINA 1NP8A 2LMUA 1WRLA 2KAVA 5D7FA 1XFWO 1WLZA 2BE6A 2KYFA 1A4PA 3AKAA 3DY9A 5AEQA 1QTXA 4HREE 1IQ3A 1K2HA 1QVIZ 4JWQA 1CDLA 3I5GB 1K96A 1IJ5A 2AMIA 1FI6A 3BFHA 3KEVA 3SG7A 2VRGA 5DKNA 2KBMA 2NCPA 4ORAB 2KPHA 3OGNA 2K8MB 3I5FB 2FJYA 4YBHB 1CMGA 1J7RA 1XFUO 1SCMB 2LLUA 1DJHA 1IQ5A 1CMFA 1HQVA 1UHJA 2JC2A 1SBJA 3DVKA 2ZNEA 4GAOA 4MRYA 5HYDA 2BCAA 2B1UA 1SCMC 3R1PA 1UUSA 3IQOA 1LXFC 3LCPC 2LC5A 3DF0A 1JF2A 1DF0B 2G2BA 1K9KA 3CWGA 2HQWA 5J3XA 1GQMA 2KQYA 4INWA 1NCYA 1Y6WA 1NIWA 4GFTA 3FE6A 1K93D 1KFUL 4Q04A 2JTZA 1TNWA 1OMVA 2HQ8A 1QATA 2MA2A 1L7ZA 2KI4B 2MHHA 3GK4X 1CLBA 2JZIA 4QJ5B 2O60A 1L2OC 1BU3A 2L4IA 1BF5A 1DJIA 1RROA 2JPTA 3BOWA 1TN4A 2MAZA 1NWDA 2F2PA 3PFVA 2DOQA 2KSPA 1TNQA 1KWOB 2OS8B 4YGCB 4GUKA 3EVVA 2M9GA 3M0WA 2LMVA 3E3RA 2JNFA 2MLFC 1FBVA 3O6BA 2JWWA 1IJ6A 1PVBA 4CFQA 3VRQA 5KU1A 2K60A 1Z2CB 2I7AA 1J1EA 1KWOC 1LA0A 1Y1AA 2KI6D 3JVTB 4YGAA 3O2PA 3TUYC 3OX6A 2FCDA 3DVEA 3UNWA 1KSMA 2LP3A 3DF0B 5CSNA 1K9UA 3RLZA 1FF1A 1QXPA 1SL7A 2OTGB 2KOTA 1YUUA 4NQGA 3VB1A 3O4XA 3ZNIA 2RGIA 4C0JA 2K2AA 4OCIA 3GK1A 1MQ1A 1FPWA 2ZFDA 1SNLA 3A4UB 2H61C 4P5OE 2PYQA 1YRTB 2H8VA 1S26D 2KHNA 1TNXA 1JWDA 3BOWB 1AJ5A 1SR6B 1FI5A 3BQ3A 4PCWA 1MXLC 1ORGA 5K89A 2MLEC 1W9ZA 3PATA 2M1KB 3TDIA 1F54A 2WOSA 3NGVA 3OHMB 1OMRA 2BL0C 2K7OA 2WC6A 3DD4A 3SG4A 1PRWA 1A03A 1DMOA 1UHHA 2PASA 1CNPA 3S0EA 2IS9A 1H4BA 3TDZA 1AHRA 2BECA 5ER5A 2O5GA 1J7OA 5EL2A 1NCZA 3FIAA 3D77A 5FI6A 1NX3A 1UHNA 3S0GA 3CTNA 5FI2A 1PALA 5HKYA 1DVIA 4AQIA 1GM0A 4IL1A 3SG3A 1PSRA 2K0JA 3OBVA 4WRIA 1B9AA 1LA3A 1M31A 1DTLA 1K8UA 2BKIB 2L51A 1OOIX 2BKHB 2KGBC 1CTRA 3PN7C 1S6JA 2EHBA 4MRXA 4MZKA 1NX1A 4YGEB 1EL4A 1B4CA 1CDPA 1DT7B 5DICA 2TN4A 2PSRA 1RJVA 1NPQA 2CXJA 3CDNA 2SCPA 5HLVA 3RM1A 1EXRA 5HKZA 5JJGA 1B8RA 2HF5A 3DZTA 4IJ7A 2WCBA 3K1EA 1SL9A 1N65A 4R1EA 2EGDA 4PE4A 4MBEA 3F45A 3PM8A 1NX0A 1MR8A 1UHKA 4M2PA 1UURA 1QVIY 1DELA 1YUSA 3N7HA 4PHJA 1J7QA 1PK0D 3BUMB 3LLEA 3DYEA 1U5IA 1AVSA 1C07A 3NSLA 3UO9A 1KK7Z 1VRKA 1WRZA 3SG6A 2CCMA 4ICBA 4UPGA 1B7TZ 1DQEA 2BBMA 2KGRA 1QS7A 4DUQA 2BCBA 2F8PA 4OKHA 2EC6B 3S0DA 2JU0A 1SSEB 1YVLA 4PDZA 3WXAA 3EVRA 3FE9A 3BJHA 3B7AA 1S3PA 1KSOA 2JXCA 2EC6C 1XFZO 3H4SE 2QEVA 2K2FA 1F8HA 1WDCB 3EK4A 2WCJA 1XA5A 1SW8A 1R2UA 3KF9A 1OOFA 1B8LA 1MWNA 3S0BA 5CPVA 5DKQA 1F4OA 1JUOA 1QASA 1WDCC 2I18A 1V1GA 1M39A 3BUOB 2M7LA 1IRJA 2H61A 1L2OB 1U5IB 2BNXA 4NDBA 1Z4HA 2L50A 5AANA 1XYDA 1CB1A 2F2OA 2LAPA 1CFFA 2JXLA 4P2YB 3C1VA 3DVJA 1AUIB 2MJWB 2NLNA 5KTYA 3NXAA 1PVAA 4AOMA 2KYCA 3B88A 1K9PA 2E30A 3TDUA 2CNPA 2LMTA 1HT9A 3BUXB 4NDCA 1TCFA 3EKHA 1CLLA 2QPTA 5FI7A 3TUYB 2Y4QA 2LVVA 5HLOA 2L98A 4GNKB 3MSEB 1Y0VH 1YRUB 1OW4A 1X02A 2P70A 2D8NA 3NSOA 1KFXL 4M2QA 4PE1A 3O78A 3CGAA 1CFPA 3A8RA 1UP5A 5ER4X 3BUNB 1ODBA 4USLA 2KLDA 4E68A 5B8IB 2JNXA 3V2LA 3LK0A 5I94A 1QWVA 2PVBA 1EG4A 2WCKA 1R6PA 4JPZB 5PALA 3SS5A 2PQLA 1G8IA 1SL8A 2QACA 3CR4X 4I5NB 3SS3A 2BCXA 3CABA 1KCYA 1S5GY 1RTP1 1J1DA 4MZLA 1N0YA 1YX8A 2PRUA 3EKJA 5I2QA 3HCMA 4MZJA 3D76A 1TCOB 1F55A 2WCFA 2FJUB 2GGZA 1IG5A 3PM2A 2JULA 2Y1MA 3VRPA 4QJ3B 2BL0B 3QMEA 1YUTA 1S1EA 4FTGA 1W7IB 1QJTA 1TNPA 4MN0A 5FYXA 1J7PA 3D74A 4QJ4B 1QLKA 2I94A 4L9MA 1C7VA 3EK8A 3AAJA 2HPSA 1RWYA 4GBAA 1BR4B 2ZNDA 2WNDA 3DXLA 2CT9A 3GK2A 2LLTA 3TS5C 2BBNA 2LHLA 4DS7A 1JFJA 1JF0A 4XJKA 1N2DA 5IBWA 1IH0A 3I5IC 1Y1XA 1KQMC 1Y1UA 3KPXA 5DKRA 4MSPA 3WNXB 2GGMA 2LVKA 1A75A 3K21A 3CLNA 1ZOTB 3L4AA 4F7FA 2WCLA 1B47A 2F33A 4PALA 2Y1NA 3FWBA 2L2CA 1DJWA 2MBXA 3PN7B 2L5YA 4XYNA 1SY9A 1D1OA 1C7WA 1ZMZA 5HKWA 3OX5A 4OR9B 4CLNA 3IQQA 1ZFSA 2R2IA 1QIWA 1KK8C 4I5JA 2M3WA 1M63B 1PSBA 2FCEA 1PULA 1TOPA 2QDIA 3AAKA 1OZSA 1JFKA 3ZWHA
chains in the Genus database with same CATH topology
1IIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IIO A; 
#chains in the Genus database with same CATH topology
 2LVI A;  4N1G A;  4A4B A;  1B1G A;  1JSA A;  1TUZ A;  1QV0 A;  2KAX A;  2M7N A;  2NZ0 A;  2WCM A;  3SG5 A;  1JC2 A;  2LNK A;  4U8D A;  3PSR A;  2ISD A;  5TNC A;  4TNC A;  3WHU B;  5CSJ A;  1NCX A;  1KQV A;  4C0K A;  1XFR A;  3VGO A;  2LUC A;  4PT1 A;  2M0R A;  1TRF A;  2LV7 A;  1G33 A;  1TUJ A;  1IGV A;  1KFU S;  1MF8 B;  2GV5 A;  5AFP A;  3VRO A;  3JTD C;  3BYA A;  3CYZ A;  2LHI A;  3DVM A;  1K95 A;  1F4Q A;  3D10 A;  1CM1 A;  2F3Z A;  1A29 A;  1RFJ A;  2JPO A;  2V53 A;  1OQP A;  4GGF A;  3D73 A;  5I2O A;  3SJS A;  1B8C A;  1NYA A;  1TTX A;  2NXQ A;  1K90 D;  3D0Y A;  3PAL A;  1SRA A;  2KNE A;  3NSK A;  4JKT A;  2Y5I A;  2QEB A;  3BFB A;  2ZRT A;  2KLE A;  2AUC A;  3FE8 A;  3WHT B;  3B86 A;  1MUX A;  1TIZ A;  2E6W A;  3LK1 A;  1P28 A;  1BJF A;  2M29 A;  5I8N A;  1LS8 A;  1BR1 B;  3BXK A;  2KI6 C;  2JQ6 A;  2JT0 A;  1DEK A;  3S0F A;  3CZT X;  3GOF A;  1NX2 A;  1EJ3 A;  1LVC D;  1OE9 B;  3EG5 B;  4DRW A;  1XVJ A;  3KHE A;  1YX7 A;  3IVT A;  1REC A;  1RK9 A;  2CTN A;  1A2X A;  1DC1 A;  4PHN A;  3L4L A;  1K94 A;  5D69 A;  2YGU A;  1JBA A;  4I5L B;  1QX7 A;  4YI9 A;  1DJZ A;  3PJI A;  2FOT A;  2H2K A;  1UWO A;  1ZUZ A;  3AKB A;  4PHM A;  1DJX A;  2JOJ A;  2KQ6 A;  1BOD A;  2LUX A;  3I5G C;  3O4Y A;  3FS7 A;  4JD9 A;  2PMY A;  4BY5 A;  1LKJ A;  1IKU A;  2F3Y A;  3CR2 A;  3D0Y B;  1J55 A;  4YGD B;  2JRF A;  1EH2 A;  3CZ2 A;  2LE9 B;  2Q91 A;  2ZN9 A;  2QEO A;  4INX A;  3I5F C;  1QLS A;  4GGF C;  3SIB A;  4CFR A;  4ORB B;  4F0Z B;  1EG3 A;  1H8B A;  3FWC A;  3ICB A;  1C3Y A;  3PLF B;  4WQ2 A;  4WQ3 A;  2K7C A;  1QX5 B;  2L2E A;  1FW4 A;  2P6B B;  3OB1 B;  3RZS A;  1S6C A;  1BT6 A;  2HET A;  1CFC A;  4ZCV A;  2JT8 A;  2WCH A;  1V1F A;  1C3Z A;  1GGW A;  1XK4 C;  1E8A A;  2LVJ A;  2PAL A;  1TWO A;  1WRK A;  4CPV A;  2ZRS A;  4DCK A;  2OPO A;  3OB2 B;  1G4Y R;  1SMG A;  5F6T A;  1YUR A;  1SYM A;  3QRX A;  5JOL A;  4ETO A;  1ZAC A;  2KI4 C;  4OVN F;  1NSH A;  3NHT A;  4NDD A;  1OZO A;  1BMO A;  3TZ1 A;  2K7D A;  4PE7 A;  1BOC A;  3OP0 A;  1ALV A;  3D75 A;  2JT3 A;  4D1E A;  5BPJ A;  1OSA A;  3R1V A;  3BFA A;  3NSI A;  1GGZ A;  2QEH A;  2OS8 C;  4ZCU A;  2WC5 A;  5GQQ C;  1YVH A;  3NHI A;  3R72 A;  4YRU A;  2CBL A;  4GGN A;  1QX2 A;  3LL8 B;  2WOR A;  2ERB A;  2MRD A;  2M1U A;  3CS1 A;  3TS5 B;  1M46 A;  3B87 A;  4N5X A;  4I5K A;  2L5X B;  3JVT C;  2AAO A;  3I5I B;  1DJG A;  1KQM B;  1XFY O;  2JTT A;  1OOJ A;  1QV1 A;  4HRH A;  2COL B;  2LAN A;  3HX4 A;  2L0P A;  4MVF A;  5I2L A;  3CZ0 A;  1CKK A;  3B6X A;  1XFX O;  2OTG C;  3EVU A;  1S36 A;  2LCP A;  2K7B A;  4HRG A;  1YR5 A;  1AJ4 A;  1QIV A;  1MXE A;  3CZ1 A;  3Q8I A;  4MEW A;  2L4H A;  2WC8 A;  2WCE A;  2M97 A;  4KYN A;  1ALW A;  1S5G Z;  2KAY A;  4JQ0 D;  2A4J A;  1YTZ C;  3BUW B;  5D3O A;  1OMD A;  1KK8 B;  5CSF A;  1CM4 A;  1CDM A;  3VRR A;  1IIO A;  3L47 A;  5AXI A;  1SR6 C;  1CLM A;  5G08 A;  1T14 A;  1F70 A;  2LLS A;  1M45 A;  2GTE A;  3CR5 X;  1NUB A;  1IWQ A;  1SKT A;  4CID A;  2ZKM X;  1OOH A;  5KSZ A;  3IF7 A;  3SS4 A;  4BY4 A;  2Q4U A;  2KBI A;  2KFF A;  3I5H B;  4DIR A;  4FQT A;  1GJY A;  3KO0 A;  2KFG A;  4OV2 A;  1XO5 A;  2KFH A;  3JTD B;  4A4C A;  2BAP A;  1AK8 A;  4XJK B;  1AP4 A;  5AER A;  1KK7 Y;  3I5H C;  4YGB B;  4AQJ A;  2LM5 A;  1SPY A;  1DGU A;  4HSZ A;  1SCV A;  4M2O A;  1UHI A;  3VRN A;  1B7T Y;  1CFD A;  2ZN8 A;  2I2R E;  2P71 A;  1A75 B;  1OOG A;  1SK6 D;  4ORC B;  1F71 A;  4PHK A;  2LP2 A;  2G9B A;  1CDN A;  3R1O A;  1MHO A;  4PE0 A;  4YI8 A;  4FQO A;  5HL1 A;  1WY9 A;  1BLQ A;  1Q80 A;  2NCO A;  2SAS A;  1BG1 A;  3EK7 A;  3SIA A;  3S0A A;  2M49 B;  2KDH A;  1S6I A;  1XFV O;  4MLW A;  3SG2 A;  1W7J B;  1WLM A;  2K61 A;  5CSI A;  1XK4 A;  3D78 A;  4C0L A;  4OZD A;  1DF0 A;  1KFX S;  1DGV A;  2M8U A;  4GPL B;  4N1F A;  2BE4 A;  1DJY A;  1LIN A;  1NP8 A;  2LMU A;  1WRL A;  2KAV A;  5D7F A;  1XFW O;  1WLZ A;  2BE6 A;  2KYF A;  1A4P A;  3AKA A;  3DY9 A;  5AEQ A;  1QTX A;  4HRE E;  1IQ3 A;  1K2H A;  1QVI Z;  4JWQ A;  1CDL A;  3I5G B;  1K96 A;  1IJ5 A;  2AMI A;  1FI6 A;  3BFH A;  3KEV A;  3SG7 A;  2VRG A;  5DKN A;  2KBM A;  2NCP A;  4ORA B;  2KPH A;  3OGN A;  2K8M B;  3I5F B;  2FJY A;  4YBH B;  1CMG A;  1J7R A;  1XFU O;  1SCM B;  2LLU A;  1DJH A;  1IQ5 A;  1CMF A;  1HQV A;  1UHJ A;  2JC2 A;  1SBJ A;  3DVK A;  2ZNE A;  4GAO A;  4MRY A;  5HYD A;  2BCA A;  2B1U A;  1SCM C;  3R1P A;  1UUS A;  3IQO A;  1LXF C;  3LCP C;  2LC5 A;  3DF0 A;  1JF2 A;  1DF0 B;  2G2B A;  1K9K A;  3CWG A;  2HQW A;  5J3X A;  1GQM A;  2KQY A;  4INW A;  1NCY A;  1Y6W A;  1NIW A;  4GFT A;  3FE6 A;  1K93 D;  1KFU L;  4Q04 A;  2JTZ A;  1TNW A;  1OMV A;  2HQ8 A;  1QAT A;  2MA2 A;  1L7Z A;  2KI4 B;  2MHH A;  3GK4 X;  1CLB A;  2JZI A;  4QJ5 B;  2O60 A;  1L2O C;  1BU3 A;  2L4I A;  1BF5 A;  1DJI A;  1RRO A;  2JPT A;  3BOW A;  1TN4 A;  2MAZ A;  1NWD A;  2F2P A;  3PFV A;  2DOQ A;  2KSP A;  1TNQ A;  1KWO B;  2OS8 B;  4YGC B;  4GUK A;  3EVV A;  2M9G A;  3M0W A;  2LMV A;  3E3R A;  2JNF A;  2MLF C;  1FBV A;  3O6B A;  2JWW A;  1IJ6 A;  1PVB A;  4CFQ A;  3VRQ A;  5KU1 A;  2K60 A;  1Z2C B;  2I7A A;  1J1E A;  1KWO C;  1LA0 A;  1Y1A A;  2KI6 D;  3JVT B;  4YGA A;  3O2P A;  3TUY C;  3OX6 A;  2FCD A;  3DVE A;  3UNW A;  1KSM A;  2LP3 A;  3DF0 B;  5CSN A;  1K9U A;  3RLZ A;  1FF1 A;  1QXP A;  1SL7 A;  2OTG B;  2KOT A;  1YUU A;  4NQG A;  3VB1 A;  3O4X A;  3ZNI A;  2RGI A;  4C0J A;  2K2A A;  4OCI A;  3GK1 A;  1MQ1 A;  1FPW A;  2ZFD A;  1SNL A;  3A4U B;  2H61 C;  4P5O E;  2PYQ A;  1YRT B;  2H8V A;  1S26 D;  2KHN A;  1TNX A;  1JWD A;  3BOW B;  1AJ5 A;  1SR6 B;  1FI5 A;  3BQ3 A;  4PCW A;  1MXL C;  1ORG A;  5K89 A;  2MLE C;  1W9Z A;  3PAT A;  2M1K B;  3TDI A;  1F54 A;  2WOS A;  3NGV A;  3OHM B;  1OMR A;  2BL0 C;  2K7O A;  2WC6 A;  3DD4 A;  3SG4 A;  1PRW A;  1A03 A;  1DMO A;  1UHH A;  2PAS A;  1CNP A;  3S0E A;  2IS9 A;  1H4B A;  3TDZ A;  1AHR A;  2BEC A;  5ER5 A;  2O5G A;  1J7O A;  5EL2 A;  1NCZ A;  3FIA A;  3D77 A;  5FI6 A;  1NX3 A;  1UHN A;  3S0G A;  3CTN A;  5FI2 A;  1PAL A;  5HKY A;  1DVI A;  4AQI A;  1GM0 A;  4IL1 A;  3SG3 A;  1PSR A;  2K0J A;  3OBV A;  4WRI A;  1B9A A;  1LA3 A;  1M31 A;  1DTL A;  1K8U A;  2BKI B;  2L51 A;  1OOI X;  2BKH B;  2KGB C;  1CTR A;  3PN7 C;  1S6J A;  2EHB A;  4MRX A;  4MZK A;  1NX1 A;  4YGE B;  1EL4 A;  1B4C A;  1CDP A;  1DT7 B;  5DIC A;  2TN4 A;  2PSR A;  1RJV A;  1NPQ A;  2CXJ A;  3CDN A;  2SCP A;  5HLV A;  3RM1 A;  1EXR A;  5HKZ A;  5JJG A;  1B8R A;  2HF5 A;  3DZT A;  4IJ7 A;  2WCB A;  3K1E A;  1SL9 A;  1N65 A;  4R1E A;  2EGD A;  4PE4 A;  4MBE A;  3F45 A;  3PM8 A;  1NX0 A;  1MR8 A;  1UHK A;  4M2P A;  1UUR A;  1QVI Y;  1DEL A;  1YUS A;  3N7H A;  4PHJ A;  1J7Q A;  1PK0 D;  3BUM B;  3LLE A;  3DYE A;  1U5I A;  1AVS A;  1C07 A;  3NSL A;  3UO9 A;  1KK7 Z;  1VRK A;  1WRZ A;  3SG6 A;  2CCM A;  4ICB A;  4UPG A;  1B7T Z;  1DQE A;  2BBM A;  2KGR A;  1QS7 A;  4DUQ A;  2BCB A;  2F8P A;  4OKH A;  2EC6 B;  3S0D A;  2JU0 A;  1SSE B;  1YVL A;  4PDZ A;  3WXA A;  3EVR A;  3FE9 A;  3BJH A;  3B7A A;  1S3P A;  1KSO A;  2JXC A;  2EC6 C;  1XFZ O;  3H4S E;  2QEV A;  2K2F A;  1F8H A;  1WDC B;  3EK4 A;  2WCJ A;  1XA5 A;  1SW8 A;  1R2U A;  3KF9 A;  1OOF A;  1B8L A;  1MWN A;  3S0B A;  5CPV A;  5DKQ A;  1F4O A;  1JUO A;  1QAS A;  1WDC C;  2I18 A;  1V1G A;  1M39 A;  3BUO B;  2M7L A;  1IRJ A;  2H61 A;  1L2O B;  1U5I B;  2BNX A;  4NDB A;  1Z4H A;  2L50 A;  5AAN A;  1XYD A;  1CB1 A;  2F2O A;  2LAP A;  1CFF A;  2JXL A;  4P2Y B;  3C1V A;  3DVJ A;  1AUI B;  2MJW B;  2NLN A;  5KTY A;  3NXA A;  1PVA A;  4AOM A;  2KYC A;  3B88 A;  1K9P A;  2E30 A;  3TDU A;  2CNP A;  2LMT A;  1HT9 A;  3BUX B;  4NDC A;  1TCF A;  3EKH A;  1CLL A;  2QPT A;  5FI7 A;  3TUY B;  2Y4Q A;  2LVV A;  5HLO A;  2L98 A;  4GNK B;  3MSE B;  1Y0V H;  1YRU B;  1OW4 A;  1X02 A;  2P70 A;  2D8N A;  3NSO A;  1KFX L;  4M2Q A;  4PE1 A;  3O78 A;  3CGA A;  1CFP A;  3A8R A;  1UP5 A;  5ER4 X;  3BUN B;  1ODB A;  4USL A;  2KLD A;  4E68 A;  5B8I B;  2JNX A;  3V2L A;  3LK0 A;  5I94 A;  1QWV A;  2PVB A;  1EG4 A;  2WCK A;  1R6P A;  4JPZ B;  5PAL A;  3SS5 A;  2PQL A;  1G8I A;  1SL8 A;  2QAC A;  3CR4 X;  4I5N B;  3SS3 A;  2BCX A;  3CAB A;  1KCY A;  1S5G Y;  1RTP 1;  1J1D A;  4MZL A;  1N0Y A;  1YX8 A;  2PRU A;  3EKJ A;  5I2Q A;  3HCM A;  4MZJ A;  3D76 A;  1TCO B;  1F55 A;  2WCF A;  2FJU B;  2GGZ A;  1IG5 A;  3PM2 A;  2JUL A;  2Y1M A;  3VRP A;  4QJ3 B;  2BL0 B;  3QME A;  1YUT A;  1S1E A;  4FTG A;  1W7I B;  1QJT A;  1TNP A;  4MN0 A;  5FYX A;  1J7P A;  3D74 A;  4QJ4 B;  1QLK A;  2I94 A;  4L9M A;  1C7V A;  3EK8 A;  3AAJ A;  2HPS A;  1RWY A;  4GBA A;  1BR4 B;  2ZND A;  2WND A;  3DXL A;  2CT9 A;  3GK2 A;  2LLT A;  3TS5 C;  2BBN A;  2LHL A;  4DS7 A;  1JFJ A;  1JF0 A;  4XJK A;  1N2D A;  5IBW A;  1IH0 A;  3I5I C;  1Y1X A;  1KQM C;  1Y1U A;  3KPX A;  5DKR A;  4MSP A;  3WNX B;  2GGM A;  2LVK A;  1A75 A;  3K21 A;  3CLN A;  1ZOT B;  3L4A A;  4F7F A;  2WCL A;  1B47 A;  2F33 A;  4PAL A;  2Y1N A;  3FWB A;  2L2C A;  1DJW A;  2MBX A;  3PN7 B;  2L5Y A;  4XYN A;  1SY9 A;  1D1O A;  1C7W A;  1ZMZ A;  5HKW A;  3OX5 A;  4OR9 B;  4CLN A;  3IQQ A;  1ZFS A;  2R2I A;  1QIW A;  1KK8 C;  4I5J A;  2M3W A;  1M63 B;  1PSB A;  2FCE A;  1PUL A;  1TOP A;  2QDI A;  3AAK A;  1OZS A;  1JFK A;  3ZWH A; 
#chains in the Genus database with same CATH homology
 1IIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...