1W7IB

Crystal structure of myosin v motor without nucleotide soaked in 10 mm mgadp
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
148
structure length
145
Chain Sequence
EFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN VA
publication title Three Myosin V Structures Delineate Essential Features of Chemo-Mechanical Transduction
pubmed doi rcsb
source organism Gallus gallus
molecule tags Motor protein
total genus 35
structure length 145
sequence length 148
ec nomenclature
pdb deposition date 2004-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1w7iB02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1w7iB01
2WCFA 1BG1A 1JFKA 3KHEA 2KGBC 4DRWA 1B8RA 4AQJA 3RM1A 3VRQA 3AKAA 4A4CA 3ZNIA 5HKWA 5PALA 1SCMC 1XO5A 1RJVA 2LLTA 2F33A 2LMTA 2LLUA 2F8PA 1XK4C 4DIRA 1K95A 1NWDA 1WRLA 1CDNA 1F71A 1TIZA 1H4BA 5HKZA 2LUXA 1NYAA 3FWCA 5HLOA 1R2UA 1A03A 2LMVA 1Y0VH 2SCPA 3D0YA 1RTP1 3WNXB 3PLFB 1KFXS 1IG5A 1H8BA 3LK0A 2ISDA 5GQQC 4QJ4B 1YRTB 2I94A 1LA3A 2G2BA 1KFUS 3WHTB 1DF0A 2G9BA 3BUNB 4NDDA 5AFPA 2FOTA 2LAPA 5DKNA 2KI6D 1MQ1A 1NX0A 2JRFA 3I5HC 2OS8B 1OE9B 3WXAA 2LVKA 1B8LA 2LVVA 3EKJA 1PK0D 1LKJA 3O4YA 4C0KA 1B9AA 1JF2A 1Y1AA 1QS7A 2M3WA 4MLWA 1A75B 3SIBA 1KSOA 1YUTA 2LHIA 1TNWA 2NZ0A 3PN7B 3SJSA 1NP8A 3BUOB 1M39A 2HETA 2EC6C 2Y4QA 2ZN9A 2QPTA 3WHUB 3PM8A 4AQIA 1BODA 1ZFSA 5TNCA 4MBEA 1IKUA 1B47A 2TN4A 2PASA 2M29A 4FQOA 1NX1A 1QXPA 2R2IA 3LCPC 5AANA 1YX8A 1JUOA 1GQMA 2Y1MA 2JT8A 1TRFA 2LNKA 1YX7A 1A29A 1KK8B 1KQVA 5DKRA 3I5FB 2PVBA 2K2FA 1OMRA 1CFFA 3LK1A 4L9MA 1F70A 2WNDA 2MLEC 1A75A 5CSFA 1AP4A 1QJTA 3KF9A 4HRGA 1KQMB 1QIWA 4NDBA 2BBNA 1F4OA 5F6TA 1BOCA 1MXEA 5ER4X 1RECA 5I2LA 1A4PA 1CDPA 2M97A 1F54A 1S6IA 2KGRA 1PVAA 3EK4A 2ZRTA 1AUIB 1NCYA 2LHLA 1WY9A 1Q80A 4MN0A 1QVIZ 1S36A 4CPVA 4GGNA 3DF0B 1GGWA 1IJ6A 2JZIA 4I5JA 1FBVA 5DKQA 1PRWA 5ER5A 2KFFA 3BUWB 1QTXA 1M46A 2K7CA 1CM1A 1DGVA 1K96A 1M63B 4YGCB 4GPLB 3SG2A 1D1OA 4IL1A 3SG7A 1BR1B 4M2PA 2WCBA 1DGUA 1TN4A 4P5OE 1EG3A 4MZKA 3O6BA 3GK2A 4ZCVA 1PALA 1K8UA 1W7JB 1SL7A 4PE7A 2HQWA 4OV2A 3K21A 1IH0A 5AERA 1CM4A 1SRAA 3DF0A 1XFWO 2LVIA 4D1EA 1F4QA 4CFQA 3JTDB 3ICBA 1EH2A 1MR8A 4AOMA 4YBHB 2O5GA 4YI9A 2OTGC 1UP5A 1N65A 1QX7A 5KSZA 1EJ3A 4ZCUA 2WORA 1KFUL 1UWOA 3EVVA 3BXKA 3HX4A 5BPJA 2KI4C 2LP2A 1KWOB 1S5GY 2LC5A 1SK6D 1JBAA 4DUQA 3PFVA 4XJKB 2PALA 3LL8B 4WQ3A 2MLFC 1MWNA 3FIAA 2BECA 4HREE 3H4SE 1XFYO 4TNCA 5FYXA 3AKBA 2HPSA 3NXAA 3A8RA 4ORAB 4UPGA 4GUKA 2FCEA 4PDZA 2KSPA 3TUYB 3VRNA 2JU0A 1QLSA 2CNPA 1B7TY 1UHIA 2LCPA 1N2DA 4GAOA 1MUXA 2BE4A 2O60A 5HYDA 2KYCA 2M0RA 1WLZA 3CS1A 5D69A 1CLMA 3EKHA 1OOJA 2A4JA 2EGDA 1G8IA 3I5GB 1ALWA 2AMIA 2I18A 4PHMA 5CSJA 1F8HA 1DJWA 1UHNA 2WOSA 1JSAA 1A2XA 1AJ4A 5HLVA 2K7BA 3TS5B 1SL8A 2K7DA 1QLKA 1DMOA 1UHHA 4XJKA 4OVNF 1BLQA 1SR6B 1X02A 3MSEB 2BL0B 3I5IC 1MHOA 2GGZA 2DOQA 1WLMA 2M1KB 3JVTC 3CR2A 1UURA 3KPXA 1SCVA 4YRUA 1EL4A 2M7LA 4BY4A 2ZKMX 3PALA 2LM5A 1HT9A 2HQ8A 1QX2A 1XYDA 1DJHA 1S5GZ 4GGFA 3GK4X 1DT7B 1BMOA 4HRHA 4XYNA 5JOLA 5JJGA 2LUCA 1J7OA 1QIVA 1WDCC 3EVRA 1W7IB 4NDCA 2BCBA 5B8IB 1GGZA 2BCXA 1E8AA 2JWWA 4BY5A 5CSNA 1NX2A 1BJFA 1SCMB 2Q91A 1F55A 1FW4A 1NSHA 2L2EA 4I5NB 3VROA 3VRRA 1FI5A 5KU1A 2JULA 4YGBB 2MBXA 3SG3A 4C0JA 4MVFA 1VRKA 1YVLA 4GBAA 1U5IB 1L2OC 2JQ6A 2NLNA 4MRXA 2MAZA 1OQPA 1IQ5A 4PHJA 4E68A 2L4IA 4A4BA 1YR5A 4PE1A 1TNQA 2WCEA 1S6JA 2HF5A 1RWYA 1WRZA 1IGVA 1YURA 3GOFA 1K2HA 1TCFA 1IQ3A 3O78A 1RROA 2L51A 3DVKA 1CFPA 1UHJA 1B8CA 2JNXA 2KDHA 3SG5A 3JTDC 4N5XA 1QASA 2KQ6A 2M8UA 4MSPA 1BT6A 2KOTA 2RGIA 3I5HB 1N0YA 4PHKA 4R1EA 4ICBA 1S3PA 2M49B 4QJ3B 4OKHA 1J7RA 4YGDB 3SIAA 1Y6WA 5I2OA 2IS9A 1UUSA 3F45A 3AAKA 1SY9A 1XK4A 1JFJA 2GV5A 2LP3A 2LV7A 2JTTA 2KHNA 1KSMA 1U5IA 1DJXA 2EHBA 5IBWA 2EC6B 1DTLA 3TDIA 1ZUZA 1YVHA 1KK7Y 2JT3A 3E3RA 1ZMZA 1K93D 1TCOB 1NPQA 3M0WA 1DJGA 2ZFDA 1ALVA 1YUUA 2CBLA 1NIWA 4YGEB 1XFXO 2CXJA 4GGFC 1CMFA 5CSIA 3DVJA 4YGAA 2ZN8A 3DVMA 2M1UA 2JXLA 2WC8A 4FTGA 5D7FA 2Y1NA 3OB1B 5HKYA 1JC2A 2L98A 1K9UA 3PSRA 1KFXL 1SKTA 4P2YB 2OS8C 3SG6A 2SASA 1CFDA 1CFCA 1ODBA 2E30A 3IF7A 2MRDA 3C1VA 2E6WA 1IWQA 1OMVA 2JC2A 2JT0A 2K8MB 2L5XB 3BUXB 4MZJA 3TDUA 2BL0C 2MA2A 3NSLA 1CLLA 4ORCB 4CLNA 3DVEA 3OP0A 1DVIA 3PN7C 4PE0A 1B4CA 1TNXA 2V53A 3TZ1A 1SYMA 2JXCA 4OCIA 1AHRA 1CB1A 1AJ5A 1FI6A 1NX3A 4WQ2A 4CFRA 2BBMA 2QACA 2JPTA 2F3ZA 1LXFC 3DD4A 2L4HA 2FCDA 2AUCA 5I2QA 3PATA 3ZWHA 2KNEA 3TDZA 2JOJA 1IJ5A 2Q4UA 2OPOA 3RLZA 1NCXA 1OZSA 1KK7Z 1QV1A 2F2OA 4WRIA 2KAYA 2L50A 1KK8C 4NQGA 4DS7A 3QRXA 3A4UB 1BF5A 3I5FC 1FPWA 1NCZA 1K90D 2K2AA 4OR9B 3AAJA 1DJIA 2I2RE 2KAVA 4QJ5B 1SMGA 1TTXA 2BCAA 3OX5A 2JNFA 3BQ3A 1GJYA 4JWQA 4HSZA 1G4YR 1KQMC 1OZOA 2ZRSA 3IQQA 3NSIA 4N1GA 2GGMA 3KO0A 1JF0A 2F3YA 2I7AA 1J7PA 4PE4A 5G08A 1XFZO 2KI6C 2ZNEA 2FJUB 3OHMB 3CWGA 1K94A 4GFTA 4YI8A 4JPZB 1OSAA 1R6PA 4F0ZB 2BKHB 4MRYA 1QV0A 3HCMA 1PSBA 1S6CA 2CTNA 3EK8A 2OTGB 1B1GA 4I5LB 2CT9A 2PRUA 5AEQA 1QVIY 1XFUO 4M2QA 1M45A 1QX5B 1QATA 2KI4B 1DJZA 2PMYA 3BOWB 1CDLA 1SL9A 4N1FA 4USLA 2CCMA 2H61A 1MF8B 4JQ0D 1BU3A 3NSOA 2NXQA 1OMDA 1PSRA 3CZTX 2LMUA 2BE6A 2MHHA 1V1GA 1B7TZ 5AXIA 4PHNA 1FF1A 1V1FA 2COLB 4CIDA 1J55A 5K89A 1CKKA 1CNPA 3CLNA 5CPVA 1NUBA 1J1EA 3CR4X 2NCPA 4PALA 3CTNA 4M2OA 1SBJA 1PULA 1JWDA 2K61A 1UHKA 1C7VA 1TNPA 3D10A 2KFGA 3EK7A 1EG4A 2L0PA 2BKIB 3O2PA 3EVUA 2JTZA 2B1UA 2F2PA 1J1DA 1M31A 1S26D 4MZLA 1CLBA 1LVCD 2VRGA 2KYFA 3BOWA 2KQYA 1K9PA 2LE9B 4Q04A 1KWOC 2D8NA 3FWBA 3I5IB 3JVTB 5I8NA 2PSRA 3NSKA 4ORBB 1SNLA 3FS7A 4MEWA 3CR5X 1YRUB 1Y1UA 2KAXA 2H2KA 1XA5A 3OB2B 1XFVO 2LVJA 1WRKA 2KFHA 1CTRA 1IRJA 1AK8A 3TUYC 5J3XA 1MXLC 3LLEA 2P6BB 3OX6A 4I5KA 1J7QA 1KCYA 1WDCB 4PCWA 1SPYA 2LLSA 3BYAA 4DCKA 1DJYA 1RFJA 4C0LA 2K0JA 1AVSA 4ETOA 3I5GC 4U8DA 1EXRA 1YTZC 2ZNDA 2M9GA 2AAOA 2LANA 1CDMA 1L7ZA 1PVBA 2MJWB 5KTYA 2H61C 1L2OB 3KEVA 2K7OA 3TS5C 3CGAA 1C7WA 1SR6C 1ZOTB 2Y5IA 1LA0A 3IQOA 3BUMB 2KBIA 4GNKB 1HQVA 3SG4A 1TOPA 3D0YB 1LINA 1XVJA 2KBMA 1C07A 1BR4B 3GK1A 2M7NA 1CMGA 1DF0B 1G33A 3VRPA 1ZACA 1K9KA 1YUSA 2NCOA 1SW8A 1RK9A 1S1EA 1Y1XA 3VGOA
chains in the Genus database with same CATH superfamily
2WCFA 1BG1A 1JFKA 3KHEA 4OZDA 2KGBC 4DRWA 1B8RA 4AQJA 3RM1A 4JKTA 3AKAA 3VRQA 3ZNIA 4A4CA 5HKWA 5PALA 1SCMC 1XO5A 1RJVA 2LLTA 2F33A 1DC1A 2LMTA 2LLUA 2F8PA 1XK4C 4DIRA 1K95A 1NWDA 1WRLA 1CDNA 1F71A 1TIZA 3DZTA 1H4BA 5HKZA 2LUXA 1NYAA 1GM0A 3FWCA 5HLOA 1R2UA 3QMEA 1A03A 2LMVA 1Y0VH 2SCPA 3D0YA 3S0AA 1RTP1 3WNXB 3PLFB 1KFXS 2H8VA 1IG5A 1H8BA 3LK0A 2ISDA 5GQQC 4QJ4B 1YRTB 2I94A 1LA3A 2G2BA 1KFUS 3WHTB 1DF0A 2G9BA 3BUNB 4NDDA 5AFPA 2FOTA 3B87A 2LAPA 3OGNA 5DKNA 2KI6D 1MQ1A 1NX0A 2JRFA 3I5HC 2OS8B 1OE9B 3WXAA 2LVKA 1B8LA 2LVVA 3EKJA 1PK0D 1LKJA 3O4YA 3UO9A 4C0KA 1B9AA 1JF2A 1Y1AA 1QS7A 2M3WA 1OOIX 4MLWA 1A75B 1P28A 3SIBA 1KSOA 2L2CA 1YUTA 2LHIA 2BAPA 1TNWA 2NZ0A 3PN7B 3SJSA 1NP8A 3BUOB 1M39A 2HETA 2EC6C 2Y4QA 2ZN9A 2QPTA 3WHUB 3PM8A 4AQIA 1BODA 1ZFSA 5TNCA 4MBEA 3Q8IA 1IKUA 1B47A 2TN4A 2PASA 2M29A 4FQOA 1NX1A 1QXPA 2R2IA 2WC6A 3LCPC 5AANA 1YX8A 4INXA 1JUOA 1GQMA 2Y1MA 2JT8A 1TRFA 2LNKA 1YX7A 1A29A 1KK8B 3D73A 1KQVA 5DKRA 3I5FB 2PVBA 2K2FA 1OMRA 1CFFA 3LK1A 4L9MA 1F70A 2WNDA 2MLEC 1A75A 1OOGA 1OOHA 5CSFA 1QJTA 1AP4A 3KF9A 4HRGA 1KQMB 1QIWA 4NDBA 1F4OA 2BBNA 5F6TA 1BOCA 1MXEA 5ER4X 1RECA 5I2LA 1A4PA 1CDPA 2M97A 1F54A 1S6IA 2KGRA 1PVAA 3EK4A 2ZRTA 1AUIB 3R72A 1NCYA 2LHLA 1WY9A 1Q80A 3CDNA 4MN0A 1QVIZ 1S36A 5FI2A 4CPVA 4GGNA 3DF0B 1GGWA 1IJ6A 2JZIA 4I5JA 4JD9A 1FBVA 5DKQA 1PRWA 5ER5A 2KFFA 3BUWB 1QTXA 1M46A 2K7CA 2YGUA 1CM1A 1DGVA 1K96A 1M63B 4YGCB 4GPLB 3SG2A 1D1OA 4IL1A 3SG7A 1BR1B 4M2PA 2WCBA 1DGUA 1TN4A 4P5OE 1EG3A 4MZKA 3O6BA 3GK2A 4ZCVA 1PALA 2L5YA 1K8UA 1W7JB 4KYNA 1SL7A 4PE7A 2HQWA 4OV2A 3K21A 1IH0A 5AERA 1CM4A 1SRAA 3DF0A 3S0FA 1SSEB 1XFWO 2LVIA 4D1EA 1F4QA 4CFQA 3JTDB 3ICBA 3UNWA 1EH2A 1MR8A 4AOMA 4YBHB 3BFHA 2O5GA 4PT1A 4YI9A 2OTGC 1UP5A 1N65A 1QX7A 5KSZA 1EJ3A 4ZCUA 2WORA 5FI7A 1KFUL 3DYEA 1UWOA 3CZ0A 3EVVA 3BXKA 3HX4A 5BPJA 3BFBA 2KI4C 2KPHA 2LP2A 1KWOB 1S5GY 2LC5A 1SK6D 1JBAA 4DUQA 3PFVA 4XJKB 2PALA 3LL8B 4WQ3A 2MLFC 1MWNA 3FIAA 1OW4A 2BECA 4HREE 3H4SE 1XFYO 4TNCA 5FYXA 3AKBA 2HPSA 2FJYA 3NXAA 3V2LA 3A8RA 4ORAB 4UPGA 4GUKA 2FCEA 4PDZA 2KSPA 3TUYB 3VRNA 5HL1A 2JPOA 2JU0A 1QLSA 3PM2A 2CNPA 1B7TY 1UHIA 2LCPA 1N2DA 4GAOA 1MUXA 2BE4A 2O60A 5HYDA 2KYCA 2M0RA 1WLZA 2BNXA 3CS1A 5D69A 1CLMA 3VB1A 3EKHA 1OOJA 2A4JA 2EGDA 1G8IA 3I5GB 1ALWA 2AMIA 2I18A 4PHMA 5CSJA 1F8HA 1DJWA 3NGVA 1UHNA 2WOSA 3D74A 3FE8A 1TUZA 1JSAA 1A2XA 1AJ4A 5HLVA 2K7BA 3TS5B 1SL8A 2GTEA 5DICA 2K7DA 1QLKA 1DMOA 1UHHA 4XJKA 4OVNF 1BLQA 1SR6B 1X02A 3MSEB 2BL0B 3I5IC 1MHOA 2GGZA 2DOQA 1WLMA 2M1KB 3JVTC 3CR2A 1UURA 3KPXA 1SCVA 4YRUA 1EL4A 2M7LA 4BY4A 2ZKMX 3PALA 2LM5A 1HT9A 2HQ8A 2PQLA 1QX2A 1XYDA 1DJHA 1S5GZ 4GGFA 3GK4X 1DT7B 1BMOA 4HRHA 4XYNA 5JOLA 5JJGA 2LUCA 1J7OA 3CZ1A 1QIVA 1T14A 1WDCC 3EVRA 1W7IB 4NDCA 2BCBA 5B8IB 1GGZA 2BCXA 3CYZA 1E8AA 1OOFA 2JWWA 5CSNA 4BY5A 1NX2A 1BJFA 1SCMB 2Q91A 1F55A 1C3ZA 1FW4A 1NSHA 2L2EA 4I5NB 2WC5A 3VROA 3VRRA 1FI5A 5KU1A 2JULA 3B7AA 4YGBB 2MBXA 3SG3A 4C0JA 1XFRA 4MVFA 1VRKA 1YVLA 4GBAA 1U5IB 1L2OC 2JQ6A 2NLNA 4MRXA 2MAZA 1OQPA 1IQ5A 4PHJA 4E68A 2L4IA 3FE9A 3S0EA 4A4BA 1YR5A 4PE1A 1TNQA 2WCEA 1S6JA 2HF5A 1RWYA 1WRZA 1IGVA 1YURA 3GOFA 1K2HA 1TCFA 1IQ3A 3O78A 1DQEA 2WCJA 1RROA 2L51A 3DVKA 1CFPA 3D76A 1UHJA 1B8CA 2JNXA 2KDHA 3K1EA 3SG5A 3JTDC 3L47A 4N5XA 1QASA 3S0DA 2KQ6A 2M8UA 2QEHA 1BT6A 2QDIA 4MSPA 2KOTA 2RGIA 3I5HB 1N0YA 3R1VA 4PHKA 4R1EA 4ICBA 1S3PA 2M49B 4QJ3B 4OKHA 1J7RA 4YGDB 3SIAA 1Y6WA 5I2OA 2IS9A 2PYQA 1UUSA 3F45A 3AAKA 1SY9A 3CABA 1XK4A 1JFJA 1ORGA 2GV5A 2LP3A 2LV7A 2JTTA 2KHNA 1KSMA 1U5IA 1DJXA 1W9ZA 2EHBA 4INWA 5IBWA 2EC6B 2P70A 1DTLA 3TDIA 1ZUZA 1YVHA 1KK7Y 2JT3A 1IIOA 3E3RA 1ZMZA 1K93D 1TCOB 1LS8A 1NPQA 1DJGA 2P71A 3M0WA 2ZFDA 1ALVA 1YUUA 2CBLA 1NIWA 4YGEB 1XFXO 2CXJA 4GGFC 1CMFA 3B6XA 5CSIA 3DVJA 4YGAA 3SS5A 2ZN8A 3DVMA 2M1UA 2JXLA 3L4LA 2WC8A 3D75A 4FTGA 5D7FA 2Y1NA 3OB1B 5HKYA 1JC2A 2L98A 1K9UA 3PSRA 3SS3A 1KFXL 1SKTA 4P2YB 2OS8C 2QEOA 3SG6A 2SASA 1CFDA 1CFCA 1ODBA 2WCMA 2E30A 3IF7A 2MRDA 3N7HA 3C1VA 2E6WA 1IWQA 1OMVA 2JC2A 2JT0A 2K8MB 2L5XB 3BUXB 4MZJA 3TDUA 2BL0C 2MA2A 3NSLA 1CLLA 4ORCB 4CLNA 3DVEA 3OP0A 1DVIA 3NHIA 3PN7C 4PE0A 1B4CA 1TNXA 1Z2CB 2V53A 1SYMA 2JXCA 4OCIA 3TZ1A 1AHRA 3DY9A 1AJ5A 1CB1A 1FI6A 1NX3A 4WQ2A 4CFRA 2BBMA 2QACA 2JPTA 2F3ZA 1LXFC 3DD4A 2L4HA 2FCDA 2AUCA 5I2QA 3PATA 3ZWHA 2KNEA 1TUJA 5D3OA 3TDZA 2JOJA 1IJ5A 3B88A 2Q4UA 2OPOA 3RLZA 1NCXA 1OZSA 1KK7Z 1QV1A 2F2OA 4WRIA 2KAYA 2L50A 1KK8C 4NQGA 4FQTA 3QRXA 4DS7A 3A4UB 1BF5A 3I5FC 1FPWA 1NCZA 1K90D 2K2AA 4OR9B 3AAJA 1DJIA 2I2RE 2KAVA 4QJ5B 1SMGA 1TTXA 2BCAA 3OX5A 2JNFA 3BQ3A 1GJYA 4JWQA 2KLEA 4HSZA 1G4YR 1KQMC 1OZOA 2QEVA 2ZRSA 3IQQA 3NSIA 2GGMA 4N1GA 3PJIA 3KO0A 1JF0A 2F3YA 2I7AA 1J7PA 4PE4A 5G08A 1XFZO 2KI6C 3CZ2A 2ZNEA 2FJUB 3OHMB 3CWGA 1K94A 4GFTA 4YI8A 3NHTA 4JPZB 1OSAA 1R6PA 4F0ZB 2BKHB 4MRYA 1QV0A 3HCMA 1PSBA 1S6CA 2CTNA 3EK8A 2OTGB 1B1GA 4I5LB 3BJHA 2CT9A 2PRUA 5AEQA 1QVIY 3O4XA 1XFUO 4M2QA 1M45A 1QX5B 1QATA 2KI4B 3DXLA 1DJZA 3S0BA 2PMYA 3B86A 1CDLA 3BOWB 2WCLA 1SL9A 4N1FA 4USLA 2CCMA 2H61A 1MF8B 5EL2A 4JQ0D 1BU3A 3NSOA 2NXQA 1OMDA 1PSRA 3CZTX 2LMUA 2BE6A 2MHHA 1V1GA 1B7TZ 5AXIA 4PHNA 1FF1A 1V1FA 2COLB 4CIDA 1J55A 5K89A 1CKKA 5FI6A 1TWOA 1Z4HA 1CNPA 3CLNA 5CPVA 1NUBA 1J1EA 3CR4X 2NCPA 4PALA 3CTNA 4M2OA 1SBJA 1PULA 1JWDA 2K61A 1UHKA 1C7VA 1TNPA 3D10A 2KFGA 3EG5B 3EK7A 1EG4A 2L0PA 2BKIB 3O2PA 3EVUA 3SS4A 2JTZA 2B1UA 2F2PA 4IJ7A 1J1DA 1M31A 1S26D 3RZSA 4MZLA 3S0GA 1CLBA 1LVCD 2VRGA 4F7FA 2KYFA 3BOWA 2KQYA 1K9PA 2LE9B 4Q04A 3L4AA 1DELA 1QWVA 1C3YA 1KWOC 2D8NA 3FWBA 3I5IB 3R1OA 3JVTB 5I8NA 2PSRA 3D77A 3NSKA 4ORBB 2WCKA 1SNLA 2QEBA 3FS7A 4MEWA 1DEKA 3CR5X 1YRUB 3FE6A 1Y1UA 2KAXA 2H2KA 1XA5A 3OB2B 1XFVO 2LVJA 3OBVA 3IVTA 1WRKA 2KFHA 1CTRA 1IRJA 1AK8A 3TUYC 5J3XA 1MXLC 3LLEA 2P6BB 3OX6A 4I5KA 1J7QA 1KCYA 1WDCB 4PCWA 1SPYA 2LLSA 3BYAA 4DCKA 1DJYA 1RFJA 4C0LA 2K0JA 1AVSA 4ETOA 3I5GC 4U8DA 1EXRA 1YTZC 2ZNDA 2M9GA 2AAOA 2LANA 1CDMA 1L7ZA 1PVBA 2K60A 2MJWB 2WCHA 5KTYA 2H61C 1L2OB 3KEVA 2K7OA 3BFAA 3TS5C 3CGAA 3D78A 1C7WA 3R1PA 1SR6C 1ZOTB 2Y5IA 1LA0A 3IQOA 3BUMB 2KBIA 4GNKB 1HQVA 3SG4A 1TOPA 3D0YB 1LINA 1XVJA 2KBMA 1C07A 1BR4B 3GK1A 2M7NA 2ERBA 1CMGA 1DF0B 1G33A 2KLDA 1ZACA 1K9KA 1YUSA 2NCOA 3VRPA 5I94A 1SW8A 1RK9A 1S1EA 1Y1XA 3VGOA
chains in the Genus database with same CATH topology
2WCFA 1BG1A 1JFKA 3KHEA 2KGBC 4DRWA 1B8RA 4AQJA 3RM1A 3VRQA 3AKAA 4A4CA 3ZNIA 5HKWA 5PALA 1SCMC 1XO5A 1RJVA 2LLTA 2F33A 2LMTA 2LLUA 2F8PA 1XK4C 4DIRA 1K95A 1NWDA 1WRLA 1CDNA 1F71A 1TIZA 1H4BA 5HKZA 2LUXA 1NYAA 3FWCA 5HLOA 1R2UA 1A03A 2LMVA 1Y0VH 2SCPA 3D0YA 1RTP1 3WNXB 3PLFB 1KFXS 1IG5A 1H8BA 3LK0A 2ISDA 5GQQC 4QJ4B 1YRTB 2I94A 1LA3A 2G2BA 1KFUS 3WHTB 1DF0A 2G9BA 3BUNB 4NDDA 5AFPA 2FOTA 2LAPA 5DKNA 2KI6D 1MQ1A 1NX0A 2JRFA 3I5HC 2OS8B 1OE9B 3WXAA 2LVKA 1B8LA 2LVVA 3EKJA 1PK0D 1LKJA 3O4YA 4C0KA 1B9AA 1JF2A 1Y1AA 1QS7A 2M3WA 4MLWA 1A75B 3SIBA 1KSOA 1YUTA 2LHIA 1TNWA 2NZ0A 3PN7B 3SJSA 1NP8A 3BUOB 1M39A 2HETA 2EC6C 2Y4QA 2ZN9A 2QPTA 3WHUB 3PM8A 4AQIA 1BODA 1ZFSA 5TNCA 4MBEA 1IKUA 1B47A 2TN4A 2PASA 2M29A 4FQOA 1NX1A 1QXPA 2R2IA 3LCPC 5AANA 1YX8A 1JUOA 1GQMA 2Y1MA 2JT8A 1TRFA 2LNKA 1YX7A 1A29A 1KK8B 1KQVA 5DKRA 3I5FB 2PVBA 2K2FA 1OMRA 1CFFA 3LK1A 4L9MA 1F70A 2WNDA 2MLEC 1A75A 5CSFA 1AP4A 1QJTA 3KF9A 4HRGA 1KQMB 1QIWA 4NDBA 2BBNA 1F4OA 5F6TA 1BOCA 1MXEA 5ER4X 1RECA 5I2LA 1A4PA 1CDPA 2M97A 1F54A 1S6IA 2KGRA 1PVAA 3EK4A 2ZRTA 1AUIB 1NCYA 2LHLA 1WY9A 1Q80A 4MN0A 1QVIZ 1S36A 4CPVA 4GGNA 3DF0B 1GGWA 1IJ6A 2JZIA 4I5JA 1FBVA 5DKQA 1PRWA 5ER5A 2KFFA 3BUWB 1QTXA 1M46A 2K7CA 1CM1A 1DGVA 1K96A 1M63B 4YGCB 4GPLB 3SG2A 1D1OA 4IL1A 3SG7A 1BR1B 4M2PA 2WCBA 1DGUA 1TN4A 4P5OE 1EG3A 4MZKA 3O6BA 3GK2A 4ZCVA 1PALA 1K8UA 1W7JB 1SL7A 4PE7A 2HQWA 4OV2A 3K21A 1IH0A 5AERA 1CM4A 1SRAA 3DF0A 1XFWO 2LVIA 4D1EA 1F4QA 4CFQA 3JTDB 3ICBA 1EH2A 1MR8A 4AOMA 4YBHB 2O5GA 4YI9A 2OTGC 1UP5A 1N65A 1QX7A 5KSZA 1EJ3A 4ZCUA 2WORA 1KFUL 1UWOA 3EVVA 3BXKA 3HX4A 5BPJA 2KI4C 2LP2A 1KWOB 1S5GY 2LC5A 1SK6D 1JBAA 4DUQA 3PFVA 4XJKB 2PALA 3LL8B 4WQ3A 2MLFC 1MWNA 3FIAA 2BECA 4HREE 3H4SE 1XFYO 4TNCA 5FYXA 3AKBA 2HPSA 3NXAA 3A8RA 4ORAB 4UPGA 4GUKA 2FCEA 4PDZA 2KSPA 3TUYB 3VRNA 2JU0A 1QLSA 2CNPA 1B7TY 1UHIA 2LCPA 1N2DA 4GAOA 1MUXA 2BE4A 2O60A 5HYDA 2KYCA 2M0RA 1WLZA 3CS1A 5D69A 1CLMA 3EKHA 1OOJA 2A4JA 2EGDA 1G8IA 3I5GB 1ALWA 2AMIA 2I18A 4PHMA 5CSJA 1F8HA 1DJWA 1UHNA 2WOSA 1JSAA 1A2XA 1AJ4A 5HLVA 2K7BA 3TS5B 1SL8A 2K7DA 1QLKA 1DMOA 1UHHA 4XJKA 4OVNF 1BLQA 1SR6B 1X02A 3MSEB 2BL0B 3I5IC 1MHOA 2GGZA 2DOQA 1WLMA 2M1KB 3JVTC 3CR2A 1UURA 3KPXA 1SCVA 4YRUA 1EL4A 2M7LA 4BY4A 2ZKMX 3PALA 2LM5A 1HT9A 2HQ8A 1QX2A 1XYDA 1DJHA 1S5GZ 4GGFA 3GK4X 1DT7B 1BMOA 4HRHA 4XYNA 5JOLA 5JJGA 2LUCA 1J7OA 1QIVA 1WDCC 3EVRA 1W7IB 4NDCA 2BCBA 5B8IB 1GGZA 2BCXA 1E8AA 2JWWA 4BY5A 5CSNA 1NX2A 1BJFA 1SCMB 2Q91A 1F55A 1FW4A 1NSHA 2L2EA 4I5NB 3VROA 3VRRA 1FI5A 5KU1A 2JULA 4YGBB 2MBXA 3SG3A 4C0JA 4MVFA 1VRKA 1YVLA 4GBAA 1U5IB 1L2OC 2JQ6A 2NLNA 4MRXA 2MAZA 1OQPA 1IQ5A 4PHJA 4E68A 2L4IA 4A4BA 1YR5A 4PE1A 1TNQA 2WCEA 1S6JA 2HF5A 1RWYA 1WRZA 1IGVA 1YURA 3GOFA 1K2HA 1TCFA 1IQ3A 3O78A 1RROA 2L51A 3DVKA 1CFPA 1UHJA 1B8CA 2JNXA 2KDHA 3SG5A 3JTDC 4N5XA 1QASA 2KQ6A 2M8UA 4MSPA 1BT6A 2KOTA 2RGIA 3I5HB 1N0YA 4PHKA 4R1EA 4ICBA 1S3PA 2M49B 4QJ3B 4OKHA 1J7RA 4YGDB 3SIAA 1Y6WA 5I2OA 2IS9A 1UUSA 3F45A 3AAKA 1SY9A 1XK4A 1JFJA 2GV5A 2LP3A 2LV7A 2JTTA 2KHNA 1KSMA 1U5IA 1DJXA 2EHBA 5IBWA 2EC6B 1DTLA 3TDIA 1ZUZA 1YVHA 1KK7Y 2JT3A 3E3RA 1ZMZA 1K93D 1TCOB 1NPQA 3M0WA 1DJGA 2ZFDA 1ALVA 1YUUA 2CBLA 1NIWA 4YGEB 1XFXO 2CXJA 4GGFC 1CMFA 5CSIA 3DVJA 4YGAA 2ZN8A 3DVMA 2M1UA 2JXLA 2WC8A 4FTGA 5D7FA 2Y1NA 3OB1B 5HKYA 1JC2A 2L98A 1K9UA 3PSRA 1KFXL 1SKTA 4P2YB 2OS8C 3SG6A 2SASA 1CFDA 1CFCA 1ODBA 2E30A 3IF7A 2MRDA 3C1VA 2E6WA 1IWQA 1OMVA 2JC2A 2JT0A 2K8MB 2L5XB 3BUXB 4MZJA 3TDUA 2BL0C 2MA2A 3NSLA 1CLLA 4ORCB 4CLNA 3DVEA 3OP0A 1DVIA 3PN7C 4PE0A 1B4CA 1TNXA 2V53A 3TZ1A 1SYMA 2JXCA 4OCIA 1AHRA 1CB1A 1AJ5A 1FI6A 1NX3A 4WQ2A 4CFRA 2BBMA 2QACA 2JPTA 2F3ZA 1LXFC 3DD4A 2L4HA 2FCDA 2AUCA 5I2QA 3PATA 3ZWHA 2KNEA 3TDZA 2JOJA 1IJ5A 2Q4UA 2OPOA 3RLZA 1NCXA 1OZSA 1KK7Z 1QV1A 2F2OA 4WRIA 2KAYA 2L50A 1KK8C 4NQGA 4DS7A 3QRXA 3A4UB 1BF5A 3I5FC 1FPWA 1NCZA 1K90D 2K2AA 4OR9B 3AAJA 1DJIA 2I2RE 2KAVA 4QJ5B 1SMGA 1TTXA 2BCAA 3OX5A 2JNFA 3BQ3A 1GJYA 4JWQA 4HSZA 1G4YR 1KQMC 1OZOA 2ZRSA 3IQQA 3NSIA 4N1GA 2GGMA 3KO0A 1JF0A 2F3YA 2I7AA 1J7PA 4PE4A 5G08A 1XFZO 2KI6C 2ZNEA 2FJUB 3OHMB 3CWGA 1K94A 4GFTA 4YI8A 4JPZB 1OSAA 1R6PA 4F0ZB 2BKHB 4MRYA 1QV0A 3HCMA 1PSBA 1S6CA 2CTNA 3EK8A 2OTGB 1B1GA 4I5LB 2CT9A 2PRUA 5AEQA 1QVIY 1XFUO 4M2QA 1M45A 1QX5B 1QATA 2KI4B 1DJZA 2PMYA 3BOWB 1CDLA 1SL9A 4N1FA 4USLA 2CCMA 2H61A 1MF8B 4JQ0D 1BU3A 3NSOA 2NXQA 1OMDA 1PSRA 3CZTX 2LMUA 2BE6A 2MHHA 1V1GA 1B7TZ 5AXIA 4PHNA 1FF1A 1V1FA 2COLB 4CIDA 1J55A 5K89A 1CKKA 1CNPA 3CLNA 5CPVA 1NUBA 1J1EA 3CR4X 2NCPA 4PALA 3CTNA 4M2OA 1SBJA 1PULA 1JWDA 2K61A 1UHKA 1C7VA 1TNPA 3D10A 2KFGA 3EK7A 1EG4A 2L0PA 2BKIB 3O2PA 3EVUA 2JTZA 2B1UA 2F2PA 1J1DA 1M31A 1S26D 4MZLA 1CLBA 1LVCD 2VRGA 2KYFA 3BOWA 2KQYA 1K9PA 2LE9B 4Q04A 1KWOC 2D8NA 3FWBA 3I5IB 3JVTB 5I8NA 2PSRA 3NSKA 4ORBB 1SNLA 3FS7A 4MEWA 3CR5X 1YRUB 1Y1UA 2KAXA 2H2KA 1XA5A 3OB2B 1XFVO 2LVJA 1WRKA 2KFHA 1CTRA 1IRJA 1AK8A 3TUYC 5J3XA 1MXLC 3LLEA 2P6BB 3OX6A 4I5KA 1J7QA 1KCYA 1WDCB 4PCWA 1SPYA 2LLSA 3BYAA 4DCKA 1DJYA 1RFJA 4C0LA 2K0JA 1AVSA 4ETOA 3I5GC 4U8DA 1EXRA 1YTZC 2ZNDA 2M9GA 2AAOA 2LANA 1CDMA 1L7ZA 1PVBA 2MJWB 5KTYA 2H61C 1L2OB 3KEVA 2K7OA 3TS5C 3CGAA 1C7WA 1SR6C 1ZOTB 2Y5IA 1LA0A 3IQOA 3BUMB 2KBIA 4GNKB 1HQVA 3SG4A 1TOPA 3D0YB 1LINA 1XVJA 2KBMA 1C07A 1BR4B 3GK1A 2M7NA 1CMGA 1DF0B 1G33A 3VRPA 1ZACA 1K9KA 1YUSA 2NCOA 1SW8A 1RK9A 1S1EA 1Y1XA 3VGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCF A;  1BG1 A;  1JFK A;  3KHE A;  2KGB C;  4DRW A;  1B8R A;  4AQJ A;  3RM1 A;  3VRQ A;  3AKA A;  4A4C A;  3ZNI A;  5HKW A;  5PAL A;  1SCM C;  1XO5 A;  1RJV A;  2LLT A;  2F33 A;  2LMT A;  2LLU A;  2F8P A;  1XK4 C;  4DIR A;  1K95 A;  1NWD A;  1WRL A;  1CDN A;  1F71 A;  1TIZ A;  1H4B A;  5HKZ A;  2LUX A;  1NYA A;  3FWC A;  5HLO A;  1R2U A;  1A03 A;  2LMV A;  1Y0V H;  2SCP A;  3D0Y A;  1RTP 1;  3WNX B;  3PLF B;  1KFX S;  1IG5 A;  1H8B A;  3LK0 A;  2ISD A;  5GQQ C;  4QJ4 B;  1YRT B;  2I94 A;  1LA3 A;  2G2B A;  1KFU S;  3WHT B;  1DF0 A;  2G9B A;  3BUN B;  4NDD A;  5AFP A;  2FOT A;  2LAP A;  5DKN A;  2KI6 D;  1MQ1 A;  1NX0 A;  2JRF A;  3I5H C;  2OS8 B;  1OE9 B;  3WXA A;  2LVK A;  1B8L A;  2LVV A;  3EKJ A;  1PK0 D;  1LKJ A;  3O4Y A;  4C0K A;  1B9A A;  1JF2 A;  1Y1A A;  1QS7 A;  2M3W A;  4MLW A;  1A75 B;  3SIB A;  1KSO A;  1YUT A;  2LHI A;  1TNW A;  2NZ0 A;  3PN7 B;  3SJS A;  1NP8 A;  3BUO B;  1M39 A;  2HET A;  2EC6 C;  2Y4Q A;  2ZN9 A;  2QPT A;  3WHU B;  3PM8 A;  4AQI A;  1BOD A;  1ZFS A;  5TNC A;  4MBE A;  1IKU A;  1B47 A;  2TN4 A;  2PAS A;  2M29 A;  4FQO A;  1NX1 A;  1QXP A;  2R2I A;  3LCP C;  5AAN A;  1YX8 A;  1JUO A;  1GQM A;  2Y1M A;  2JT8 A;  1TRF A;  2LNK A;  1YX7 A;  1A29 A;  1KK8 B;  1KQV A;  5DKR A;  3I5F B;  2PVB A;  2K2F A;  1OMR A;  1CFF A;  3LK1 A;  4L9M A;  1F70 A;  2WND A;  2MLE C;  1A75 A;  5CSF A;  1AP4 A;  1QJT A;  3KF9 A;  4HRG A;  1KQM B;  1QIW A;  4NDB A;  2BBN A;  1F4O A;  5F6T A;  1BOC A;  1MXE A;  5ER4 X;  1REC A;  5I2L A;  1A4P A;  1CDP A;  2M97 A;  1F54 A;  1S6I A;  2KGR A;  1PVA A;  3EK4 A;  2ZRT A;  1AUI B;  1NCY A;  2LHL A;  1WY9 A;  1Q80 A;  4MN0 A;  1QVI Z;  1S36 A;  4CPV A;  4GGN A;  3DF0 B;  1GGW A;  1IJ6 A;  2JZI A;  4I5J A;  1FBV A;  5DKQ A;  1PRW A;  5ER5 A;  2KFF A;  3BUW B;  1QTX A;  1M46 A;  2K7C A;  1CM1 A;  1DGV A;  1K96 A;  1M63 B;  4YGC B;  4GPL B;  3SG2 A;  1D1O A;  4IL1 A;  3SG7 A;  1BR1 B;  4M2P A;  2WCB A;  1DGU A;  1TN4 A;  4P5O E;  1EG3 A;  4MZK A;  3O6B A;  3GK2 A;  4ZCV A;  1PAL A;  1K8U A;  1W7J B;  1SL7 A;  4PE7 A;  2HQW A;  4OV2 A;  3K21 A;  1IH0 A;  5AER A;  1CM4 A;  1SRA A;  3DF0 A;  1XFW O;  2LVI A;  4D1E A;  1F4Q A;  4CFQ A;  3JTD B;  3ICB A;  1EH2 A;  1MR8 A;  4AOM A;  4YBH B;  2O5G A;  4YI9 A;  2OTG C;  1UP5 A;  1N65 A;  1QX7 A;  5KSZ A;  1EJ3 A;  4ZCU A;  2WOR A;  1KFU L;  1UWO A;  3EVV A;  3BXK A;  3HX4 A;  5BPJ A;  2KI4 C;  2LP2 A;  1KWO B;  1S5G Y;  2LC5 A;  1SK6 D;  1JBA A;  4DUQ A;  3PFV A;  4XJK B;  2PAL A;  3LL8 B;  4WQ3 A;  2MLF C;  1MWN A;  3FIA A;  2BEC A;  4HRE E;  3H4S E;  1XFY O;  4TNC A;  5FYX A;  3AKB A;  2HPS A;  3NXA A;  3A8R A;  4ORA B;  4UPG A;  4GUK A;  2FCE A;  4PDZ A;  2KSP A;  3TUY B;  3VRN A;  2JU0 A;  1QLS A;  2CNP A;  1B7T Y;  1UHI A;  2LCP A;  1N2D A;  4GAO A;  1MUX A;  2BE4 A;  2O60 A;  5HYD A;  2KYC A;  2M0R A;  1WLZ A;  3CS1 A;  5D69 A;  1CLM A;  3EKH A;  1OOJ A;  2A4J A;  2EGD A;  1G8I A;  3I5G B;  1ALW A;  2AMI A;  2I18 A;  4PHM A;  5CSJ A;  1F8H A;  1DJW A;  1UHN A;  2WOS A;  1JSA A;  1A2X A;  1AJ4 A;  5HLV A;  2K7B A;  3TS5 B;  1SL8 A;  2K7D A;  1QLK A;  1DMO A;  1UHH A;  4XJK A;  4OVN F;  1BLQ A;  1SR6 B;  1X02 A;  3MSE B;  2BL0 B;  3I5I C;  1MHO A;  2GGZ A;  2DOQ A;  1WLM A;  2M1K B;  3JVT C;  3CR2 A;  1UUR A;  3KPX A;  1SCV A;  4YRU A;  1EL4 A;  2M7L A;  4BY4 A;  2ZKM X;  3PAL A;  2LM5 A;  1HT9 A;  2HQ8 A;  1QX2 A;  1XYD A;  1DJH A;  1S5G Z;  4GGF A;  3GK4 X;  1DT7 B;  1BMO A;  4HRH A;  4XYN A;  5JOL A;  5JJG A;  2LUC A;  1J7O A;  1QIV A;  1WDC C;  3EVR A;  1W7I B;  4NDC A;  2BCB A;  5B8I B;  1GGZ A;  2BCX A;  1E8A A;  2JWW A;  4BY5 A;  5CSN A;  1NX2 A;  1BJF A;  1SCM B;  2Q91 A;  1F55 A;  1FW4 A;  1NSH A;  2L2E A;  4I5N B;  3VRO A;  3VRR A;  1FI5 A;  5KU1 A;  2JUL A;  4YGB B;  2MBX A;  3SG3 A;  4C0J A;  4MVF A;  1VRK A;  1YVL A;  4GBA A;  1U5I B;  1L2O C;  2JQ6 A;  2NLN A;  4MRX A;  2MAZ A;  1OQP A;  1IQ5 A;  4PHJ A;  4E68 A;  2L4I A;  4A4B A;  1YR5 A;  4PE1 A;  1TNQ A;  2WCE A;  1S6J A;  2HF5 A;  1RWY A;  1WRZ A;  1IGV A;  1YUR A;  3GOF A;  1K2H A;  1TCF A;  1IQ3 A;  3O78 A;  1RRO A;  2L51 A;  3DVK A;  1CFP A;  1UHJ A;  1B8C A;  2JNX A;  2KDH A;  3SG5 A;  3JTD C;  4N5X A;  1QAS A;  2KQ6 A;  2M8U A;  4MSP A;  1BT6 A;  2KOT A;  2RGI A;  3I5H B;  1N0Y A;  4PHK A;  4R1E A;  4ICB A;  1S3P A;  2M49 B;  4QJ3 B;  4OKH A;  1J7R A;  4YGD B;  3SIA A;  1Y6W A;  5I2O A;  2IS9 A;  1UUS A;  3F45 A;  3AAK A;  1SY9 A;  1XK4 A;  1JFJ A;  2GV5 A;  2LP3 A;  2LV7 A;  2JTT A;  2KHN A;  1KSM A;  1U5I A;  1DJX A;  2EHB A;  5IBW A;  2EC6 B;  1DTL A;  3TDI A;  1ZUZ A;  1YVH A;  1KK7 Y;  2JT3 A;  3E3R A;  1ZMZ A;  1K93 D;  1TCO B;  1NPQ A;  3M0W A;  1DJG A;  2ZFD A;  1ALV A;  1YUU A;  2CBL A;  1NIW A;  4YGE B;  1XFX O;  2CXJ A;  4GGF C;  1CMF A;  5CSI A;  3DVJ A;  4YGA A;  2ZN8 A;  3DVM A;  2M1U A;  2JXL A;  2WC8 A;  4FTG A;  5D7F A;  2Y1N A;  3OB1 B;  5HKY A;  1JC2 A;  2L98 A;  1K9U A;  3PSR A;  1KFX L;  1SKT A;  4P2Y B;  2OS8 C;  3SG6 A;  2SAS A;  1CFD A;  1CFC A;  1ODB A;  2E30 A;  3IF7 A;  2MRD A;  3C1V A;  2E6W A;  1IWQ A;  1OMV A;  2JC2 A;  2JT0 A;  2K8M B;  2L5X B;  3BUX B;  4MZJ A;  3TDU A;  2BL0 C;  2MA2 A;  3NSL A;  1CLL A;  4ORC B;  4CLN A;  3DVE A;  3OP0 A;  1DVI A;  3PN7 C;  4PE0 A;  1B4C A;  1TNX A;  2V53 A;  3TZ1 A;  1SYM A;  2JXC A;  4OCI A;  1AHR A;  1CB1 A;  1AJ5 A;  1FI6 A;  1NX3 A;  4WQ2 A;  4CFR A;  2BBM A;  2QAC A;  2JPT A;  2F3Z A;  1LXF C;  3DD4 A;  2L4H A;  2FCD A;  2AUC A;  5I2Q A;  3PAT A;  3ZWH A;  2KNE A;  3TDZ A;  2JOJ A;  1IJ5 A;  2Q4U A;  2OPO A;  3RLZ A;  1NCX A;  1OZS A;  1KK7 Z;  1QV1 A;  2F2O A;  4WRI A;  2KAY A;  2L50 A;  1KK8 C;  4NQG A;  4DS7 A;  3QRX A;  3A4U B;  1BF5 A;  3I5F C;  1FPW A;  1NCZ A;  1K90 D;  2K2A A;  4OR9 B;  3AAJ A;  1DJI A;  2I2R E;  2KAV A;  4QJ5 B;  1SMG A;  1TTX A;  2BCA A;  3OX5 A;  2JNF A;  3BQ3 A;  1GJY A;  4JWQ A;  4HSZ A;  1G4Y R;  1KQM C;  1OZO A;  2ZRS A;  3IQQ A;  3NSI A;  4N1G A;  2GGM A;  3KO0 A;  1JF0 A;  2F3Y A;  2I7A A;  1J7P A;  4PE4 A;  5G08 A;  1XFZ O;  2KI6 C;  2ZNE A;  2FJU B;  3OHM B;  3CWG A;  1K94 A;  4GFT A;  4YI8 A;  4JPZ B;  1OSA A;  1R6P A;  4F0Z B;  2BKH B;  4MRY A;  1QV0 A;  3HCM A;  1PSB A;  1S6C A;  2CTN A;  3EK8 A;  2OTG B;  1B1G A;  4I5L B;  2CT9 A;  2PRU A;  5AEQ A;  1QVI Y;  1XFU O;  4M2Q A;  1M45 A;  1QX5 B;  1QAT A;  2KI4 B;  1DJZ A;  2PMY A;  3BOW B;  1CDL A;  1SL9 A;  4N1F A;  4USL A;  2CCM A;  2H61 A;  1MF8 B;  4JQ0 D;  1BU3 A;  3NSO A;  2NXQ A;  1OMD A;  1PSR A;  3CZT X;  2LMU A;  2BE6 A;  2MHH A;  1V1G A;  1B7T Z;  5AXI A;  4PHN A;  1FF1 A;  1V1F A;  2COL B;  4CID A;  1J55 A;  5K89 A;  1CKK A;  1CNP A;  3CLN A;  5CPV A;  1NUB A;  1J1E A;  3CR4 X;  2NCP A;  4PAL A;  3CTN A;  4M2O A;  1SBJ A;  1PUL A;  1JWD A;  2K61 A;  1UHK A;  1C7V A;  1TNP A;  3D10 A;  2KFG A;  3EK7 A;  1EG4 A;  2L0P A;  2BKI B;  3O2P A;  3EVU A;  2JTZ A;  2B1U A;  2F2P A;  1J1D A;  1M31 A;  1S26 D;  4MZL A;  1CLB A;  1LVC D;  2VRG A;  2KYF A;  3BOW A;  2KQY A;  1K9P A;  2LE9 B;  4Q04 A;  1KWO C;  2D8N A;  3FWB A;  3I5I B;  3JVT B;  5I8N A;  2PSR A;  3NSK A;  4ORB B;  1SNL A;  3FS7 A;  4MEW A;  3CR5 X;  1YRU B;  1Y1U A;  2KAX A;  2H2K A;  1XA5 A;  3OB2 B;  1XFV O;  2LVJ A;  1WRK A;  2KFH A;  1CTR A;  1IRJ A;  1AK8 A;  3TUY C;  5J3X A;  1MXL C;  3LLE A;  2P6B B;  3OX6 A;  4I5K A;  1J7Q A;  1KCY A;  1WDC B;  4PCW A;  1SPY A;  2LLS A;  3BYA A;  4DCK A;  1DJY A;  1RFJ A;  4C0L A;  2K0J A;  1AVS A;  4ETO A;  3I5G C;  4U8D A;  1EXR A;  1YTZ C;  2ZND A;  2M9G A;  2AAO A;  2LAN A;  1CDM A;  1L7Z A;  1PVB A;  2MJW B;  5KTY A;  2H61 C;  1L2O B;  3KEV A;  2K7O A;  3TS5 C;  3CGA A;  1C7W A;  1SR6 C;  1ZOT B;  2Y5I A;  1LA0 A;  3IQO A;  3BUM B;  2KBI A;  4GNK B;  1HQV A;  3SG4 A;  1TOP A;  3D0Y B;  1LIN A;  1XVJ A;  2KBM A;  1C07 A;  1BR4 B;  3GK1 A;  2M7N A;  1CMG A;  1DF0 B;  1G33 A;  3VRP A;  1ZAC A;  1K9K A;  1YUS A;  2NCO A;  1SW8 A;  1RK9 A;  1S1E A;  1Y1X A;  3VGO A; 
#chains in the Genus database with same CATH topology
 2WCF A;  1BG1 A;  1JFK A;  3KHE A;  4OZD A;  2KGB C;  4DRW A;  1B8R A;  4AQJ A;  3RM1 A;  4JKT A;  3AKA A;  3VRQ A;  3ZNI A;  4A4C A;  5HKW A;  5PAL A;  1SCM C;  1XO5 A;  1RJV A;  2LLT A;  2F33 A;  1DC1 A;  2LMT A;  2LLU A;  2F8P A;  1XK4 C;  4DIR A;  1K95 A;  1NWD A;  1WRL A;  1CDN A;  1F71 A;  1TIZ A;  3DZT A;  1H4B A;  5HKZ A;  2LUX A;  1NYA A;  1GM0 A;  3FWC A;  5HLO A;  1R2U A;  3QME A;  1A03 A;  2LMV A;  1Y0V H;  2SCP A;  3D0Y A;  3S0A A;  1RTP 1;  3WNX B;  3PLF B;  1KFX S;  2H8V A;  1IG5 A;  1H8B A;  3LK0 A;  2ISD A;  5GQQ C;  4QJ4 B;  1YRT B;  2I94 A;  1LA3 A;  2G2B A;  1KFU S;  3WHT B;  1DF0 A;  2G9B A;  3BUN B;  4NDD A;  5AFP A;  2FOT A;  3B87 A;  2LAP A;  3OGN A;  5DKN A;  2KI6 D;  1MQ1 A;  1NX0 A;  2JRF A;  3I5H C;  2OS8 B;  1OE9 B;  3WXA A;  2LVK A;  1B8L A;  2LVV A;  3EKJ A;  1PK0 D;  1LKJ A;  3O4Y A;  3UO9 A;  4C0K A;  1B9A A;  1JF2 A;  1Y1A A;  1QS7 A;  2M3W A;  1OOI X;  4MLW A;  1A75 B;  1P28 A;  3SIB A;  1KSO A;  2L2C A;  1YUT A;  2LHI A;  2BAP A;  1TNW A;  2NZ0 A;  3PN7 B;  3SJS A;  1NP8 A;  3BUO B;  1M39 A;  2HET A;  2EC6 C;  2Y4Q A;  2ZN9 A;  2QPT A;  3WHU B;  3PM8 A;  4AQI A;  1BOD A;  1ZFS A;  5TNC A;  4MBE A;  3Q8I A;  1IKU A;  1B47 A;  2TN4 A;  2PAS A;  2M29 A;  4FQO A;  1NX1 A;  1QXP A;  2R2I A;  2WC6 A;  3LCP C;  5AAN A;  1YX8 A;  4INX A;  1JUO A;  1GQM A;  2Y1M A;  2JT8 A;  1TRF A;  2LNK A;  1YX7 A;  1A29 A;  1KK8 B;  3D73 A;  1KQV A;  5DKR A;  3I5F B;  2PVB A;  2K2F A;  1OMR A;  1CFF A;  3LK1 A;  4L9M A;  1F70 A;  2WND A;  2MLE C;  1A75 A;  1OOG A;  1OOH A;  5CSF A;  1QJT A;  1AP4 A;  3KF9 A;  4HRG A;  1KQM B;  1QIW A;  4NDB A;  1F4O A;  2BBN A;  5F6T A;  1BOC A;  1MXE A;  5ER4 X;  1REC A;  5I2L A;  1A4P A;  1CDP A;  2M97 A;  1F54 A;  1S6I A;  2KGR A;  1PVA A;  3EK4 A;  2ZRT A;  1AUI B;  3R72 A;  1NCY A;  2LHL A;  1WY9 A;  1Q80 A;  3CDN A;  4MN0 A;  1QVI Z;  1S36 A;  5FI2 A;  4CPV A;  4GGN A;  3DF0 B;  1GGW A;  1IJ6 A;  2JZI A;  4I5J A;  4JD9 A;  1FBV A;  5DKQ A;  1PRW A;  5ER5 A;  2KFF A;  3BUW B;  1QTX A;  1M46 A;  2K7C A;  2YGU A;  1CM1 A;  1DGV A;  1K96 A;  1M63 B;  4YGC B;  4GPL B;  3SG2 A;  1D1O A;  4IL1 A;  3SG7 A;  1BR1 B;  4M2P A;  2WCB A;  1DGU A;  1TN4 A;  4P5O E;  1EG3 A;  4MZK A;  3O6B A;  3GK2 A;  4ZCV A;  1PAL A;  2L5Y A;  1K8U A;  1W7J B;  4KYN A;  1SL7 A;  4PE7 A;  2HQW A;  4OV2 A;  3K21 A;  1IH0 A;  5AER A;  1CM4 A;  1SRA A;  3DF0 A;  3S0F A;  1SSE B;  1XFW O;  2LVI A;  4D1E A;  1F4Q A;  4CFQ A;  3JTD B;  3ICB A;  3UNW A;  1EH2 A;  1MR8 A;  4AOM A;  4YBH B;  3BFH A;  2O5G A;  4PT1 A;  4YI9 A;  2OTG C;  1UP5 A;  1N65 A;  1QX7 A;  5KSZ A;  1EJ3 A;  4ZCU A;  2WOR A;  5FI7 A;  1KFU L;  3DYE A;  1UWO A;  3CZ0 A;  3EVV A;  3BXK A;  3HX4 A;  5BPJ A;  3BFB A;  2KI4 C;  2KPH A;  2LP2 A;  1KWO B;  1S5G Y;  2LC5 A;  1SK6 D;  1JBA A;  4DUQ A;  3PFV A;  4XJK B;  2PAL A;  3LL8 B;  4WQ3 A;  2MLF C;  1MWN A;  3FIA A;  1OW4 A;  2BEC A;  4HRE E;  3H4S E;  1XFY O;  4TNC A;  5FYX A;  3AKB A;  2HPS A;  2FJY A;  3NXA A;  3V2L A;  3A8R A;  4ORA B;  4UPG A;  4GUK A;  2FCE A;  4PDZ A;  2KSP A;  3TUY B;  3VRN A;  5HL1 A;  2JPO A;  2JU0 A;  1QLS A;  3PM2 A;  2CNP A;  1B7T Y;  1UHI A;  2LCP A;  1N2D A;  4GAO A;  1MUX A;  2BE4 A;  2O60 A;  5HYD A;  2KYC A;  2M0R A;  1WLZ A;  2BNX A;  3CS1 A;  5D69 A;  1CLM A;  3VB1 A;  3EKH A;  1OOJ A;  2A4J A;  2EGD A;  1G8I A;  3I5G B;  1ALW A;  2AMI A;  2I18 A;  4PHM A;  5CSJ A;  1F8H A;  1DJW A;  3NGV A;  1UHN A;  2WOS A;  3D74 A;  3FE8 A;  1TUZ A;  1JSA A;  1A2X A;  1AJ4 A;  5HLV A;  2K7B A;  3TS5 B;  1SL8 A;  2GTE A;  5DIC A;  2K7D A;  1QLK A;  1DMO A;  1UHH A;  4XJK A;  4OVN F;  1BLQ A;  1SR6 B;  1X02 A;  3MSE B;  2BL0 B;  3I5I C;  1MHO A;  2GGZ A;  2DOQ A;  1WLM A;  2M1K B;  3JVT C;  3CR2 A;  1UUR A;  3KPX A;  1SCV A;  4YRU A;  1EL4 A;  2M7L A;  4BY4 A;  2ZKM X;  3PAL A;  2LM5 A;  1HT9 A;  2HQ8 A;  2PQL A;  1QX2 A;  1XYD A;  1DJH A;  1S5G Z;  4GGF A;  3GK4 X;  1DT7 B;  1BMO A;  4HRH A;  4XYN A;  5JOL A;  5JJG A;  2LUC A;  1J7O A;  3CZ1 A;  1QIV A;  1T14 A;  1WDC C;  3EVR A;  1W7I B;  4NDC A;  2BCB A;  5B8I B;  1GGZ A;  2BCX A;  3CYZ A;  1E8A A;  1OOF A;  2JWW A;  5CSN A;  4BY5 A;  1NX2 A;  1BJF A;  1SCM B;  2Q91 A;  1F55 A;  1C3Z A;  1FW4 A;  1NSH A;  2L2E A;  4I5N B;  2WC5 A;  3VRO A;  3VRR A;  1FI5 A;  5KU1 A;  2JUL A;  3B7A A;  4YGB B;  2MBX A;  3SG3 A;  4C0J A;  1XFR A;  4MVF A;  1VRK A;  1YVL A;  4GBA A;  1U5I B;  1L2O C;  2JQ6 A;  2NLN A;  4MRX A;  2MAZ A;  1OQP A;  1IQ5 A;  4PHJ A;  4E68 A;  2L4I A;  3FE9 A;  3S0E A;  4A4B A;  1YR5 A;  4PE1 A;  1TNQ A;  2WCE A;  1S6J A;  2HF5 A;  1RWY A;  1WRZ A;  1IGV A;  1YUR A;  3GOF A;  1K2H A;  1TCF A;  1IQ3 A;  3O78 A;  1DQE A;  2WCJ A;  1RRO A;  2L51 A;  3DVK A;  1CFP A;  3D76 A;  1UHJ A;  1B8C A;  2JNX A;  2KDH A;  3K1E A;  3SG5 A;  3JTD C;  3L47 A;  4N5X A;  1QAS A;  3S0D A;  2KQ6 A;  2M8U A;  2QEH A;  1BT6 A;  2QDI A;  4MSP A;  2KOT A;  2RGI A;  3I5H B;  1N0Y A;  3R1V A;  4PHK A;  4R1E A;  4ICB A;  1S3P A;  2M49 B;  4QJ3 B;  4OKH A;  1J7R A;  4YGD B;  3SIA A;  1Y6W A;  5I2O A;  2IS9 A;  2PYQ A;  1UUS A;  3F45 A;  3AAK A;  1SY9 A;  3CAB A;  1XK4 A;  1JFJ A;  1ORG A;  2GV5 A;  2LP3 A;  2LV7 A;  2JTT A;  2KHN A;  1KSM A;  1U5I A;  1DJX A;  1W9Z A;  2EHB A;  4INW A;  5IBW A;  2EC6 B;  2P70 A;  1DTL A;  3TDI A;  1ZUZ A;  1YVH A;  1KK7 Y;  2JT3 A;  1IIO A;  3E3R A;  1ZMZ A;  1K93 D;  1TCO B;  1LS8 A;  1NPQ A;  1DJG A;  2P71 A;  3M0W A;  2ZFD A;  1ALV A;  1YUU A;  2CBL A;  1NIW A;  4YGE B;  1XFX O;  2CXJ A;  4GGF C;  1CMF A;  3B6X A;  5CSI A;  3DVJ A;  4YGA A;  3SS5 A;  2ZN8 A;  3DVM A;  2M1U A;  2JXL A;  3L4L A;  2WC8 A;  3D75 A;  4FTG A;  5D7F A;  2Y1N A;  3OB1 B;  5HKY A;  1JC2 A;  2L98 A;  1K9U A;  3PSR A;  3SS3 A;  1KFX L;  1SKT A;  4P2Y B;  2OS8 C;  2QEO A;  3SG6 A;  2SAS A;  1CFD A;  1CFC A;  1ODB A;  2WCM A;  2E30 A;  3IF7 A;  2MRD A;  3N7H A;  3C1V A;  2E6W A;  1IWQ A;  1OMV A;  2JC2 A;  2JT0 A;  2K8M B;  2L5X B;  3BUX B;  4MZJ A;  3TDU A;  2BL0 C;  2MA2 A;  3NSL A;  1CLL A;  4ORC B;  4CLN A;  3DVE A;  3OP0 A;  1DVI A;  3NHI A;  3PN7 C;  4PE0 A;  1B4C A;  1TNX A;  1Z2C B;  2V53 A;  1SYM A;  2JXC A;  4OCI A;  3TZ1 A;  1AHR A;  3DY9 A;  1AJ5 A;  1CB1 A;  1FI6 A;  1NX3 A;  4WQ2 A;  4CFR A;  2BBM A;  2QAC A;  2JPT A;  2F3Z A;  1LXF C;  3DD4 A;  2L4H A;  2FCD A;  2AUC A;  5I2Q A;  3PAT A;  3ZWH A;  2KNE A;  1TUJ A;  5D3O A;  3TDZ A;  2JOJ A;  1IJ5 A;  3B88 A;  2Q4U A;  2OPO A;  3RLZ A;  1NCX A;  1OZS A;  1KK7 Z;  1QV1 A;  2F2O A;  4WRI A;  2KAY A;  2L50 A;  1KK8 C;  4NQG A;  4FQT A;  3QRX A;  4DS7 A;  3A4U B;  1BF5 A;  3I5F C;  1FPW A;  1NCZ A;  1K90 D;  2K2A A;  4OR9 B;  3AAJ A;  1DJI A;  2I2R E;  2KAV A;  4QJ5 B;  1SMG A;  1TTX A;  2BCA A;  3OX5 A;  2JNF A;  3BQ3 A;  1GJY A;  4JWQ A;  2KLE A;  4HSZ A;  1G4Y R;  1KQM C;  1OZO A;  2QEV A;  2ZRS A;  3IQQ A;  3NSI A;  2GGM A;  4N1G A;  3PJI A;  3KO0 A;  1JF0 A;  2F3Y A;  2I7A A;  1J7P A;  4PE4 A;  5G08 A;  1XFZ O;  2KI6 C;  3CZ2 A;  2ZNE A;  2FJU B;  3OHM B;  3CWG A;  1K94 A;  4GFT A;  4YI8 A;  3NHT A;  4JPZ B;  1OSA A;  1R6P A;  4F0Z B;  2BKH B;  4MRY A;  1QV0 A;  3HCM A;  1PSB A;  1S6C A;  2CTN A;  3EK8 A;  2OTG B;  1B1G A;  4I5L B;  3BJH A;  2CT9 A;  2PRU A;  5AEQ A;  1QVI Y;  3O4X A;  1XFU O;  4M2Q A;  1M45 A;  1QX5 B;  1QAT A;  2KI4 B;  3DXL A;  1DJZ A;  3S0B A;  2PMY A;  3B86 A;  1CDL A;  3BOW B;  2WCL A;  1SL9 A;  4N1F A;  4USL A;  2CCM A;  2H61 A;  1MF8 B;  5EL2 A;  4JQ0 D;  1BU3 A;  3NSO A;  2NXQ A;  1OMD A;  1PSR A;  3CZT X;  2LMU A;  2BE6 A;  2MHH A;  1V1G A;  1B7T Z;  5AXI A;  4PHN A;  1FF1 A;  1V1F A;  2COL B;  4CID A;  1J55 A;  5K89 A;  1CKK A;  5FI6 A;  1TWO A;  1Z4H A;  1CNP A;  3CLN A;  5CPV A;  1NUB A;  1J1E A;  3CR4 X;  2NCP A;  4PAL A;  3CTN A;  4M2O A;  1SBJ A;  1PUL A;  1JWD A;  2K61 A;  1UHK A;  1C7V A;  1TNP A;  3D10 A;  2KFG A;  3EG5 B;  3EK7 A;  1EG4 A;  2L0P A;  2BKI B;  3O2P A;  3EVU A;  3SS4 A;  2JTZ A;  2B1U A;  2F2P A;  4IJ7 A;  1J1D A;  1M31 A;  1S26 D;  3RZS A;  4MZL A;  3S0G A;  1CLB A;  1LVC D;  2VRG A;  4F7F A;  2KYF A;  3BOW A;  2KQY A;  1K9P A;  2LE9 B;  4Q04 A;  3L4A A;  1DEL A;  1QWV A;  1C3Y A;  1KWO C;  2D8N A;  3FWB A;  3I5I B;  3R1O A;  3JVT B;  5I8N A;  2PSR A;  3D77 A;  3NSK A;  4ORB B;  2WCK A;  1SNL A;  2QEB A;  3FS7 A;  4MEW A;  1DEK A;  3CR5 X;  1YRU B;  3FE6 A;  1Y1U A;  2KAX A;  2H2K A;  1XA5 A;  3OB2 B;  1XFV O;  2LVJ A;  3OBV A;  3IVT A;  1WRK A;  2KFH A;  1CTR A;  1IRJ A;  1AK8 A;  3TUY C;  5J3X A;  1MXL C;  3LLE A;  2P6B B;  3OX6 A;  4I5K A;  1J7Q A;  1KCY A;  1WDC B;  4PCW A;  1SPY A;  2LLS A;  3BYA A;  4DCK A;  1DJY A;  1RFJ A;  4C0L A;  2K0J A;  1AVS A;  4ETO A;  3I5G C;  4U8D A;  1EXR A;  1YTZ C;  2ZND A;  2M9G A;  2AAO A;  2LAN A;  1CDM A;  1L7Z A;  1PVB A;  2K60 A;  2MJW B;  2WCH A;  5KTY A;  2H61 C;  1L2O B;  3KEV A;  2K7O A;  3BFA A;  3TS5 C;  3CGA A;  3D78 A;  1C7W A;  3R1P A;  1SR6 C;  1ZOT B;  2Y5I A;  1LA0 A;  3IQO A;  3BUM B;  2KBI A;  4GNK B;  1HQV A;  3SG4 A;  1TOP A;  3D0Y B;  1LIN A;  1XVJ A;  2KBM A;  1C07 A;  1BR4 B;  3GK1 A;  2M7N A;  2ERB A;  1CMG A;  1DF0 B;  1G33 A;  2KLD A;  1ZAC A;  1K9K A;  1YUS A;  2NCO A;  3VRP A;  5I94 A;  1SW8 A;  1RK9 A;  1S1E A;  1Y1X A;  3VGO A; 
#chains in the Genus database with same CATH homology
 2WCF A;  1BG1 A;  1JFK A;  3KHE A;  2KGB C;  4DRW A;  1B8R A;  4AQJ A;  3RM1 A;  3VRQ A;  3AKA A;  4A4C A;  3ZNI A;  5HKW A;  5PAL A;  1SCM C;  1XO5 A;  1RJV A;  2LLT A;  2F33 A;  2LMT A;  2LLU A;  2F8P A;  1XK4 C;  4DIR A;  1K95 A;  1NWD A;  1WRL A;  1CDN A;  1F71 A;  1TIZ A;  1H4B A;  5HKZ A;  2LUX A;  1NYA A;  3FWC A;  5HLO A;  1R2U A;  1A03 A;  2LMV A;  1Y0V H;  2SCP A;  3D0Y A;  1RTP 1;  3WNX B;  3PLF B;  1KFX S;  1IG5 A;  1H8B A;  3LK0 A;  2ISD A;  5GQQ C;  4QJ4 B;  1YRT B;  2I94 A;  1LA3 A;  2G2B A;  1KFU S;  3WHT B;  1DF0 A;  2G9B A;  3BUN B;  4NDD A;  5AFP A;  2FOT A;  2LAP A;  5DKN A;  2KI6 D;  1MQ1 A;  1NX0 A;  2JRF A;  3I5H C;  2OS8 B;  1OE9 B;  3WXA A;  2LVK A;  1B8L A;  2LVV A;  3EKJ A;  1PK0 D;  1LKJ A;  3O4Y A;  4C0K A;  1B9A A;  1JF2 A;  1Y1A A;  1QS7 A;  2M3W A;  4MLW A;  1A75 B;  3SIB A;  1KSO A;  1YUT A;  2LHI A;  1TNW A;  2NZ0 A;  3PN7 B;  3SJS A;  1NP8 A;  3BUO B;  1M39 A;  2HET A;  2EC6 C;  2Y4Q A;  2ZN9 A;  2QPT A;  3WHU B;  3PM8 A;  4AQI A;  1BOD A;  1ZFS A;  5TNC A;  4MBE A;  1IKU A;  1B47 A;  2TN4 A;  2PAS A;  2M29 A;  4FQO A;  1NX1 A;  1QXP A;  2R2I A;  3LCP C;  5AAN A;  1YX8 A;  1JUO A;  1GQM A;  2Y1M A;  2JT8 A;  1TRF A;  2LNK A;  1YX7 A;  1A29 A;  1KK8 B;  1KQV A;  5DKR A;  3I5F B;  2PVB A;  2K2F A;  1OMR A;  1CFF A;  3LK1 A;  4L9M A;  1F70 A;  2WND A;  2MLE C;  1A75 A;  5CSF A;  1AP4 A;  1QJT A;  3KF9 A;  4HRG A;  1KQM B;  1QIW A;  4NDB A;  2BBN A;  1F4O A;  5F6T A;  1BOC A;  1MXE A;  5ER4 X;  1REC A;  5I2L A;  1A4P A;  1CDP A;  2M97 A;  1F54 A;  1S6I A;  2KGR A;  1PVA A;  3EK4 A;  2ZRT A;  1AUI B;  1NCY A;  2LHL A;  1WY9 A;  1Q80 A;  4MN0 A;  1QVI Z;  1S36 A;  4CPV A;  4GGN A;  3DF0 B;  1GGW A;  1IJ6 A;  2JZI A;  4I5J A;  1FBV A;  5DKQ A;  1PRW A;  5ER5 A;  2KFF A;  3BUW B;  1QTX A;  1M46 A;  2K7C A;  1CM1 A;  1DGV A;  1K96 A;  1M63 B;  4YGC B;  4GPL B;  3SG2 A;  1D1O A;  4IL1 A;  3SG7 A;  1BR1 B;  4M2P A;  2WCB A;  1DGU A;  1TN4 A;  4P5O E;  1EG3 A;  4MZK A;  3O6B A;  3GK2 A;  4ZCV A;  1PAL A;  1K8U A;  1W7J B;  1SL7 A;  4PE7 A;  2HQW A;  4OV2 A;  3K21 A;  1IH0 A;  5AER A;  1CM4 A;  1SRA A;  3DF0 A;  1XFW O;  2LVI A;  4D1E A;  1F4Q A;  4CFQ A;  3JTD B;  3ICB A;  1EH2 A;  1MR8 A;  4AOM A;  4YBH B;  2O5G A;  4YI9 A;  2OTG C;  1UP5 A;  1N65 A;  1QX7 A;  5KSZ A;  1EJ3 A;  4ZCU A;  2WOR A;  1KFU L;  1UWO A;  3EVV A;  3BXK A;  3HX4 A;  5BPJ A;  2KI4 C;  2LP2 A;  1KWO B;  1S5G Y;  2LC5 A;  1SK6 D;  1JBA A;  4DUQ A;  3PFV A;  4XJK B;  2PAL A;  3LL8 B;  4WQ3 A;  2MLF C;  1MWN A;  3FIA A;  2BEC A;  4HRE E;  3H4S E;  1XFY O;  4TNC A;  5FYX A;  3AKB A;  2HPS A;  3NXA A;  3A8R A;  4ORA B;  4UPG A;  4GUK A;  2FCE A;  4PDZ A;  2KSP A;  3TUY B;  3VRN A;  2JU0 A;  1QLS A;  2CNP A;  1B7T Y;  1UHI A;  2LCP A;  1N2D A;  4GAO A;  1MUX A;  2BE4 A;  2O60 A;  5HYD A;  2KYC A;  2M0R A;  1WLZ A;  3CS1 A;  5D69 A;  1CLM A;  3EKH A;  1OOJ A;  2A4J A;  2EGD A;  1G8I A;  3I5G B;  1ALW A;  2AMI A;  2I18 A;  4PHM A;  5CSJ A;  1F8H A;  1DJW A;  1UHN A;  2WOS A;  1JSA A;  1A2X A;  1AJ4 A;  5HLV A;  2K7B A;  3TS5 B;  1SL8 A;  2K7D A;  1QLK A;  1DMO A;  1UHH A;  4XJK A;  4OVN F;  1BLQ A;  1SR6 B;  1X02 A;  3MSE B;  2BL0 B;  3I5I C;  1MHO A;  2GGZ A;  2DOQ A;  1WLM A;  2M1K B;  3JVT C;  3CR2 A;  1UUR A;  3KPX A;  1SCV A;  4YRU A;  1EL4 A;  2M7L A;  4BY4 A;  2ZKM X;  3PAL A;  2LM5 A;  1HT9 A;  2HQ8 A;  1QX2 A;  1XYD A;  1DJH A;  1S5G Z;  4GGF A;  3GK4 X;  1DT7 B;  1BMO A;  4HRH A;  4XYN A;  5JOL A;  5JJG A;  2LUC A;  1J7O A;  1QIV A;  1WDC C;  3EVR A;  1W7I B;  4NDC A;  2BCB A;  5B8I B;  1GGZ A;  2BCX A;  1E8A A;  2JWW A;  4BY5 A;  5CSN A;  1NX2 A;  1BJF A;  1SCM B;  2Q91 A;  1F55 A;  1FW4 A;  1NSH A;  2L2E A;  4I5N B;  3VRO A;  3VRR A;  1FI5 A;  5KU1 A;  2JUL A;  4YGB B;  2MBX A;  3SG3 A;  4C0J A;  4MVF A;  1VRK A;  1YVL A;  4GBA A;  1U5I B;  1L2O C;  2JQ6 A;  2NLN A;  4MRX A;  2MAZ A;  1OQP A;  1IQ5 A;  4PHJ A;  4E68 A;  2L4I A;  4A4B A;  1YR5 A;  4PE1 A;  1TNQ A;  2WCE A;  1S6J A;  2HF5 A;  1RWY A;  1WRZ A;  1IGV A;  1YUR A;  3GOF A;  1K2H A;  1TCF A;  1IQ3 A;  3O78 A;  1RRO A;  2L51 A;  3DVK A;  1CFP A;  1UHJ A;  1B8C A;  2JNX A;  2KDH A;  3SG5 A;  3JTD C;  4N5X A;  1QAS A;  2KQ6 A;  2M8U A;  4MSP A;  1BT6 A;  2KOT A;  2RGI A;  3I5H B;  1N0Y A;  4PHK A;  4R1E A;  4ICB A;  1S3P A;  2M49 B;  4QJ3 B;  4OKH A;  1J7R A;  4YGD B;  3SIA A;  1Y6W A;  5I2O A;  2IS9 A;  1UUS A;  3F45 A;  3AAK A;  1SY9 A;  1XK4 A;  1JFJ A;  2GV5 A;  2LP3 A;  2LV7 A;  2JTT A;  2KHN A;  1KSM A;  1U5I A;  1DJX A;  2EHB A;  5IBW A;  2EC6 B;  1DTL A;  3TDI A;  1ZUZ A;  1YVH A;  1KK7 Y;  2JT3 A;  3E3R A;  1ZMZ A;  1K93 D;  1TCO B;  1NPQ A;  3M0W A;  1DJG A;  2ZFD A;  1ALV A;  1YUU A;  2CBL A;  1NIW A;  4YGE B;  1XFX O;  2CXJ A;  4GGF C;  1CMF A;  5CSI A;  3DVJ A;  4YGA A;  2ZN8 A;  3DVM A;  2M1U A;  2JXL A;  2WC8 A;  4FTG A;  5D7F A;  2Y1N A;  3OB1 B;  5HKY A;  1JC2 A;  2L98 A;  1K9U A;  3PSR A;  1KFX L;  1SKT A;  4P2Y B;  2OS8 C;  3SG6 A;  2SAS A;  1CFD A;  1CFC A;  1ODB A;  2E30 A;  3IF7 A;  2MRD A;  3C1V A;  2E6W A;  1IWQ A;  1OMV A;  2JC2 A;  2JT0 A;  2K8M B;  2L5X B;  3BUX B;  4MZJ A;  3TDU A;  2BL0 C;  2MA2 A;  3NSL A;  1CLL A;  4ORC B;  4CLN A;  3DVE A;  3OP0 A;  1DVI A;  3PN7 C;  4PE0 A;  1B4C A;  1TNX A;  2V53 A;  3TZ1 A;  1SYM A;  2JXC A;  4OCI A;  1AHR A;  1CB1 A;  1AJ5 A;  1FI6 A;  1NX3 A;  4WQ2 A;  4CFR A;  2BBM A;  2QAC A;  2JPT A;  2F3Z A;  1LXF C;  3DD4 A;  2L4H A;  2FCD A;  2AUC A;  5I2Q A;  3PAT A;  3ZWH A;  2KNE A;  3TDZ A;  2JOJ A;  1IJ5 A;  2Q4U A;  2OPO A;  3RLZ A;  1NCX A;  1OZS A;  1KK7 Z;  1QV1 A;  2F2O A;  4WRI A;  2KAY A;  2L50 A;  1KK8 C;  4NQG A;  4DS7 A;  3QRX A;  3A4U B;  1BF5 A;  3I5F C;  1FPW A;  1NCZ A;  1K90 D;  2K2A A;  4OR9 B;  3AAJ A;  1DJI A;  2I2R E;  2KAV A;  4QJ5 B;  1SMG A;  1TTX A;  2BCA A;  3OX5 A;  2JNF A;  3BQ3 A;  1GJY A;  4JWQ A;  4HSZ A;  1G4Y R;  1KQM C;  1OZO A;  2ZRS A;  3IQQ A;  3NSI A;  4N1G A;  2GGM A;  3KO0 A;  1JF0 A;  2F3Y A;  2I7A A;  1J7P A;  4PE4 A;  5G08 A;  1XFZ O;  2KI6 C;  2ZNE A;  2FJU B;  3OHM B;  3CWG A;  1K94 A;  4GFT A;  4YI8 A;  4JPZ B;  1OSA A;  1R6P A;  4F0Z B;  2BKH B;  4MRY A;  1QV0 A;  3HCM A;  1PSB A;  1S6C A;  2CTN A;  3EK8 A;  2OTG B;  1B1G A;  4I5L B;  2CT9 A;  2PRU A;  5AEQ A;  1QVI Y;  1XFU O;  4M2Q A;  1M45 A;  1QX5 B;  1QAT A;  2KI4 B;  1DJZ A;  2PMY A;  3BOW B;  1CDL A;  1SL9 A;  4N1F A;  4USL A;  2CCM A;  2H61 A;  1MF8 B;  4JQ0 D;  1BU3 A;  3NSO A;  2NXQ A;  1OMD A;  1PSR A;  3CZT X;  2LMU A;  2BE6 A;  2MHH A;  1V1G A;  1B7T Z;  5AXI A;  4PHN A;  1FF1 A;  1V1F A;  2COL B;  4CID A;  1J55 A;  5K89 A;  1CKK A;  1CNP A;  3CLN A;  5CPV A;  1NUB A;  1J1E A;  3CR4 X;  2NCP A;  4PAL A;  3CTN A;  4M2O A;  1SBJ A;  1PUL A;  1JWD A;  2K61 A;  1UHK A;  1C7V A;  1TNP A;  3D10 A;  2KFG A;  3EK7 A;  1EG4 A;  2L0P A;  2BKI B;  3O2P A;  3EVU A;  2JTZ A;  2B1U A;  2F2P A;  1J1D A;  1M31 A;  1S26 D;  4MZL A;  1CLB A;  1LVC D;  2VRG A;  2KYF A;  3BOW A;  2KQY A;  1K9P A;  2LE9 B;  4Q04 A;  1KWO C;  2D8N A;  3FWB A;  3I5I B;  3JVT B;  5I8N A;  2PSR A;  3NSK A;  4ORB B;  1SNL A;  3FS7 A;  4MEW A;  3CR5 X;  1YRU B;  1Y1U A;  2KAX A;  2H2K A;  1XA5 A;  3OB2 B;  1XFV O;  2LVJ A;  1WRK A;  2KFH A;  1CTR A;  1IRJ A;  1AK8 A;  3TUY C;  5J3X A;  1MXL C;  3LLE A;  2P6B B;  3OX6 A;  4I5K A;  1J7Q A;  1KCY A;  1WDC B;  4PCW A;  1SPY A;  2LLS A;  3BYA A;  4DCK A;  1DJY A;  1RFJ A;  4C0L A;  2K0J A;  1AVS A;  4ETO A;  3I5G C;  4U8D A;  1EXR A;  1YTZ C;  2ZND A;  2M9G A;  2AAO A;  2LAN A;  1CDM A;  1L7Z A;  1PVB A;  2MJW B;  5KTY A;  2H61 C;  1L2O B;  3KEV A;  2K7O A;  3TS5 C;  3CGA A;  1C7W A;  1SR6 C;  1ZOT B;  2Y5I A;  1LA0 A;  3IQO A;  3BUM B;  2KBI A;  4GNK B;  1HQV A;  3SG4 A;  1TOP A;  3D0Y B;  1LIN A;  1XVJ A;  2KBM A;  1C07 A;  1BR4 B;  3GK1 A;  2M7N A;  1CMG A;  1DF0 B;  1G33 A;  3VRP A;  1ZAC A;  1K9K A;  1YUS A;  2NCO A;  1SW8 A;  1RK9 A;  1S1E A;  1Y1X A;  3VGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...