1W7IB

Crystal structure of myosin v motor without nucleotide soaked in 10 mm mgadp
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
148
structure length
145
Chain Sequence
EFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Motor protein
molecule keywords MYOSIN VA
publication title Three Myosin V Structures Delineate Essential Features of Chemo-Mechanical Transduction
pubmed doi rcsb
source organism Gallus gallus
total genus 35
structure length 145
sequence length 148
ec nomenclature
pdb deposition date 2004-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1w7iB02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1w7iB01
3BUMB 1TCFA 1QX5B 2CTNA 3D0YA 1BR1B 2GGZA 3KO0A 2MAZA 4HRHA 1BJFA 1N2DA 1XK4A 2AAOA 2H61A 2PSRA 3CR5X 3OB1B 1CB1A 1RECA 2BBNA 3D0YB 4P2YB 1BLQA 2BKHB 1TN4A 1KK7Z 2O5GA 2FCEA 1SK6D 1KSMA 2ZNDA 1CFPA 1M63B 1R6PA 5D7FA 1XFUO 2I7AA 3TDUA 2M8UA 3HCMA 1AVSA 1QLSA 1QATA 1L2OC 1SPYA 2LC5A 4WRIA 1KK8B 5CPVA 1WRKA 3D10A 1OQPA 2IS9A 3H4SE 1QXPA 3TS5B 1NYAA 2LP3A 2M0RA 1ZMZA 1WLZA 1K9KA 3VRRA 4C0KA 3BUNB 1YX7A 2G2BA 4CPVA 1IGVA 3ICBA 1NX1A 4GGFA 2KFFA 1UHJA 1AUIB 4OVNF 2JRFA 1UP5A 1TTXA 2VRGA 2MJWB 5CSNA 4ZCUA 1B8RA 2BCXA 1OE9B 2AMIA 4DIRA 2KHNA 2NZ0A 1K95A 1TRFA 1DJIA 1IRJA 3IQOA 1SR6C 1IJ5A 3JVTC 1OSAA 2Y1NA 5I8NA 1BMOA 2WCFA 2JC2A 4DUQA 1F8HA 2L50A 4YGEB 1UHNA 3C1VA 1DJYA 2F3ZA 1GGWA 1L2OB 3LCPC 2LM5A 3NSOA 4Q04A 1NX0A 3O78A 4C0LA 2GV5A 1E8AA 3A4UB 2LANA 3SG7A 4NQGA 5KU1A 1QX7A 1B7TY 4A4BA 2KBMA 1SW8A 2LHIA 1CDMA 3E3RA 3I5IC 1G4YR 2BE6A 3BOWA 3SG6A 2LVJA 2JT3A 5HKZA 2ZRTA 1ODBA 2JT0A 3VRNA 1YUSA 1YVLA 3EK8A 1B8CA 3BOWB 2NCPA 1KWOB 2Q91A 1YUUA 4HREE 4ORAB 1RROA 3JTDC 1F54A 1B9AA 1UHIA 5DKQA 2WC8A 2TN4A 2OS8C 1OOJA 2ZN8A 3O4YA 2QPTA 4FTGA 3DVEA 1TIZA 2LUXA 4QJ5B 1SBJA 3BYAA 3IF7A 2KQ6A 4OR9B 3CR4X 4MBEA 1G33A 4MZLA 4GFTA 1X02A 4USLA 1VRKA 2I18A 1GQMA 3SJSA 1IH0A 2CBLA 1J7RA 1ZOTB 2KGBC 1MXLC 1NX3A 4DCKA 4MRYA 1QASA 1XO5A 3NXAA 1F4OA 2M7NA 2L4HA 1UHHA 1W7JB 2KAXA 3I5FC 5CSJA 1AK8A 3PFVA 4IL1A 3DD4A 2I94A 1S6CA 2LAPA 2OS8B 2K8MB 2O60A 5FYXA 3VGOA 4GUKA 3I5HC 1A2XA 2BCBA 1WDCC 3AKAA 4YRUA 1OZSA 3SIBA 4MRXA 3RM1A 1KFXS 4AOMA 5AEQA 3GK2A 4YGAA 5I2OA 1TNPA 4XYNA 3KPXA 1JC2A 1LKJA 4NDCA 4HRGA 2L51A 3CLNA 4GGNA 4ORCB 2PMYA 1TNQA 2KSPA 1R2UA 2CCMA 1SKTA 3SG5A 5D69A 3CS1A 3O2PA 1MXEA 1XFYO 5DKRA 2HQ8A 1SCMC 2SCPA 1SL9A 4M2QA 1A03A 2KAYA 1EH2A 4P5OE 1Y6WA 2ZN9A 2D8NA 2F33A 1J1EA 1IG5A 1Y1XA 4GGFC 3I5FB 3GOFA 1QS7A 1JBAA 2ZKMX 1MWNA 3AAJA 1FI6A 1DMOA 1XFVO 2M49B 3I5HB 1WDCB 2KOTA 2Q4UA 3TZ1A 3AAKA 3QRXA 4PALA 1S5GY 4PHNA 1A75A 1EL4A 1XFXO 1QX2A 1YURA 2F2PA 1OMDA 1Q80A 2F8PA 5HLVA 1QIWA 5JOLA 2JU0A 2KI6D 3OB2B 1A75B 2K7OA 3GK1A 4M2PA 1QIVA 3OX6A 2LV7A 4GAOA 1V1GA 1ZACA 5IBWA 1NSHA 4CFQA 1RK9A 4I5JA 1CFFA 2WNDA 1SCMB 1ALWA 4ORBB 1FPWA 1DGUA 3BQ3A 5ER5A 4D1EA 1CLMA 3FWBA 4NDDA 1KWOC 1N65A 1JWDA 3LLEA 2Y1MA 1SY9A 2LVIA 2BECA 4YI9A 5J3XA 5AFPA 1NWDA 3EKJA 1MR8A 5F6TA 1KCYA 3VRPA 2KYCA 2MLFC 2NLNA 2V53A 3ZNIA 1F4QA 4GBAA 2LP2A 1RFJA 3A8RA 2L98A 2ZNEA 2MBXA 1EG3A 5ER4X 2PALA 4PDZA 1AHRA 1QLKA 4MZKA 1F55A 1IKUA 3IQQA 1CTRA 5I2QA 2L4IA 4N5XA 1DT7B 2CNPA 5PALA 5AERA 1B4CA 1ZUZA 4DS7A 2PASA 1YR5A 4F0ZB 2JOJA 3PALA 5CSFA 1K9PA 1TNWA 4WQ2A 3PLFB 5HLOA 1PVAA 3EK7A 1C7VA 1WLMA 1B7TZ 1LA0A 3ZWHA 1B1GA 4OCIA 5CSIA 1M31A 5K89A 1IQ5A 1TOPA 4DRWA 3SIAA 1M45A 1M46A 1AP4A 1PSRA 5B8IB 1OMVA 2KI6C 2E6WA 3WHUB 1DVIA 1XA5A 4YGCB 1SCVA 3LL8B 2SASA 4PHMA 1UURA 3F45A 1KQMC 1FBVA 2L2EA 3TUYC 2L5XB 1W7IB 1KFXL 4U8DA 2ZFDA 4M2OA 2K7DA 1NCXA 2M7LA 2LVKA 4YGBB 2B1UA 4ZCVA 1N0YA 1PK0D 3KEVA 2M97A 5KTYA 1RWYA 1HT9A 1CNPA 4GNKB 3HX4A 4BY5A 3FIAA 1TNXA 1B8LA 2WORA 4WQ3A 1AJ5A 1J1DA 1RJVA 1U5IA 2L0PA 2M29A 2BCAA 3PM8A 1DJGA 1FW4A 1DJWA 3MSEB 1K93D 1J55A 2M3WA 3PN7C 2FOTA 4I5NB 1U5IB 2FCDA 5GQQC 2LLUA 3PATA 1A4PA 1CLLA 1QJTA 2MA2A 4ETOA 2BKIB 2CXJA 3NSIA 2JULA 1OZOA 1QTXA 4YI8A 4TNCA 3EK4A 1PSBA 1KQMB 1Y1UA 2HQWA 1YRTB 1CDLA 3TUYB 4I5KA 5BPJA 1CMFA 1S6IA 1Y0VH 2LMVA 2LVVA 1BOCA 3EVRA 2CT9A 1J7PA 2Y5IA 4PCWA 1CFDA 1SRAA 1DJZA 1SNLA 1JFJA 1F70A 4PHKA 4N1FA 4CFRA 2JT8A 1NP8A 2LMTA 1LXFC 3CZTX 3EVUA 1OMRA 2KYFA 4MZJA 5JJGA 2E30A 2KI4C 1G8IA 3O6BA 3PN7B 1L7ZA 1GJYA 5DKNA 1QV0A 2F2OA 2KQYA 1B47A 1S36A 1DGVA 3BUOB 2OTGC 3CR2A 3DVJA 4MSPA 2JNXA 1WRLA 1A29A 5TNCA 4PE1A 2K7BA 2NXQA 4AQIA 2EHBA 1BODA 4GPLB 1WY9A 4JWQA 2H2KA 2LUCA 4ICBA 1Y1AA 1DJHA 2I2RE 1TCOB 4QJ4B 1QV1A 1XYDA 2AUCA 3NSKA 4MN0A 1YVHA 1JF2A 3OX5A 1IWQA 2JZIA 4R1EA 2LLSA 1BU3A 1IJ6A 3CTNA 1S5GZ 1BR4B 2M9GA 1F71A 4PE4A 2KI4B 2HPSA 1CFCA 1H4BA 2KNEA 5KSZA 1KFUL 1C7WA 4FQOA 2PRUA 3CGAA 2OTGB 3TDIA 2JQ6A 2M1UA 4PE7A 1YUTA 2EC6B 4NDBA 1S1EA 2K61A 4I5LB 2ZRSA 4YGDB 1PALA 1NCYA 3DF0A 4MEWA 2K0JA 1SL7A 3VRQA 1CDPA 3KF9A 1HQVA 4PHJA 3DF0B 2JTTA 3DVMA 4XJKA 2G9BA 2MHHA 2BL0C 2KBIA 1C07A 1JF0A 2PVBA 1D1OA 4XJKB 1KFUS 1MQ1A 3DVKA 3GK4X 4N1GA 2KAVA 5HYDA 1FF1A 2JWWA 1S26D 2LMUA 2JTZA 3SG4A 3WXAA 1NCZA 5I2LA 2DOQA 1NPQA 4OKHA 4MLWA 4L9MA 2A4JA 1CDNA 2JXCA 1UWOA 2QACA 4A4CA 2LLTA 2RGIA 3CWGA 1BF5A 2K2AA 1DF0A 2JXLA 4YBHB 2WCBA 3FS7A 2R2IA 3VROA 2MRDA 2NCOA 1S3PA 3LK0A 1DF0B 4E68A 2FJUB 5AXIA 1JUOA 2BBMA 5HKYA 1EJ3A 3K21A 5AANA 2COLB 1FI5A 1DJXA 2BL0B 3BUWB 1K2HA 1M39A 1SR6B 3JVTB 1MUXA 3EVVA 4CIDA 4PE0A 2HETA 4UPGA 1UHKA 4JQ0D 1CLBA 4C0JA 1LA3A 1CMGA 1MHOA 3LK1A 1XFZO 1LVCD 3RLZA 1WRZA 1UUSA 4HSZA 1LINA 1XVJA 1NX2A 2LHLA 3I5GC 1CM1A 1DTLA 2KDHA 2BE4A 1BT6A 1ALVA 2KFGA 1H8BA 1MF8B 1NUBA 3I5IB 1PRWA 1K94A 2LNKA 3AKBA 2LCPA 3OP0A 1PULA 5HKWA 4CLNA 1RTP1 1ZFSA 1QVIY 2KFHA 1JSAA 4MVFA 4JPZB 1BG1A 1PVBA 3FWCA 1KSOA 2ISDA 1J7QA 3BUXB 1KQVA 1K8UA 1GGZA 1SMGA 1SL8A 3JTDB 3OHMB 1K90D 2M1KB 2GGMA 5G08A 3SG3A 1EG4A 1V1FA 4OV2A 2Y4QA 1EXRA 3BXKA 2JNFA 1S6JA 4QJ3B 2MLEC 2OPOA 1XK4C 2H61C 4AQJA 1AJ4A 3WHTB 2JPTA 1QVIZ 3NSLA 1YRUB 4BY4A 3M0WA 1XFWO 1YTZC 3I5GB 3TDZA 1K96A 1IQ3A 2K7CA 1KK8C 1J7OA 1CM4A 2P6BB 3KHEA 3WNXB 2KGRA 2K2FA 3SG2A 1NIWA 3TS5C 1KK7Y 2WCEA 2HF5A 3EKHA 1CKKA 3PSRA 2EGDA 1JFKA 1YX8A 2EC6C 2F3YA 2WOSA 1K9UA 2LE9B 1SYMA
chains in the Genus database with same CATH superfamily
3BUMB 1TCFA 1QX5B 2CTNA 3D0YA 3UO9A 1BR1B 2GGZA 3KO0A 2MAZA 4HRHA 1BJFA 1N2DA 1XK4A 2AAOA 2H61A 2PSRA 3CR5X 3OB1B 1CB1A 1DC1A 1RECA 2BBNA 3D0YB 4P2YB 4F7FA 1BLQA 2BKHB 1TN4A 1KK7Z 2O5GA 2FCEA 1SK6D 1KSMA 2ZNDA 1CFPA 1M63B 1R6PA 3FE8A 3R1VA 5D7FA 1XFUO 3QMEA 2I7AA 3TDUA 2M8UA 3HCMA 1AVSA 1QLSA 1QATA 3B7AA 1L2OC 1SPYA 2LC5A 4WRIA 1KK8B 5CPVA 1WRKA 3D10A 5FI7A 1OQPA 2IS9A 3H4SE 1QXPA 3TS5B 1NYAA 3D76A 2LP3A 2M0RA 1ZMZA 1WLZA 1K9KA 3VRRA 4C0KA 3BUNB 3O4XA 1YX7A 2G2BA 4CPVA 1IGVA 3B6XA 3ICBA 1NX1A 4GGFA 2KFFA 1UHJA 1AUIB 1OOIX 4OVNF 2JRFA 1UP5A 1TTXA 2VRGA 2MJWB 5CSNA 4ZCUA 3S0FA 1B8RA 2BCXA 1OE9B 2AMIA 4DIRA 5DICA 2KHNA 2NZ0A 1K95A 1TRFA 1DJIA 1IRJA 3IQOA 1SR6C 1IJ5A 3JVTC 1OSAA 1IIOA 2Y1NA 5I8NA 1BMOA 2WCFA 2JC2A 4DUQA 1F8HA 2L50A 4YGEB 1UHNA 3R72A 3C1VA 1DJYA 2F3ZA 1GGWA 1L2OB 3L4LA 2LM5A 3LCPC 3NSOA 4Q04A 1NX0A 3O78A 4KYNA 4C0LA 2GV5A 1E8AA 3R1OA 3A4UB 2LANA 3SG7A 1LS8A 4NQGA 5KU1A 1QX7A 3B87A 1B7TY 3L4AA 4A4BA 2KBMA 2ERBA 1QWVA 1SW8A 2LHIA 3SS3A 1CDMA 1GM0A 3E3RA 3I5IC 1G4YR 2BE6A 3BOWA 3SG6A 2LVJA 2JT3A 3NHIA 2ZRTA 1ODBA 2JT0A 5HKZA 3VRNA 1YUSA 1YVLA 3EK8A 1B8CA 3BOWB 2NCPA 1KWOB 2Q91A 1YUUA 4HREE 4ORAB 1RROA 3JTDC 1F54A 1B9AA 1UHIA 3FE9A 2WCHA 1Z2CB 5DKQA 2WC8A 2TN4A 4INWA 2OS8C 1OOJA 2ZN8A 3O4YA 2QPTA 4FTGA 3DVEA 1TIZA 2LUXA 4QJ5B 1SBJA 3BYAA 3IF7A 2KQ6A 4OR9B 3CR4X 4MBEA 1G33A 4MZLA 4GFTA 1X02A 4USLA 1VRKA 2I18A 1GQMA 2QEBA 3SJSA 1IH0A 2CBLA 1J7RA 1ZOTB 3CZ1A 4FQTA 2KGBC 1MXLC 1NX3A 4DCKA 2QEOA 4OZDA 1ORGA 4MRYA 1QASA 1XO5A 3NXAA 1F4OA 2M7NA 1XFRA 2L4HA 1UHHA 1W7JB 2KAXA 3I5FC 5CSJA 1AK8A 3PFVA 3Q8IA 4IL1A 3DD4A 2I94A 1S6CA 2LAPA 2OS8B 2K8MB 2PQLA 2O60A 5FYXA 3VGOA 4GUKA 3I5HC 1A2XA 2BCBA 1WDCC 3AKAA 4YRUA 1OZSA 3BFBA 3SIBA 4MRXA 3RM1A 1KFXS 4AOMA 5AEQA 3GK2A 4YGAA 5I2OA 1TNPA 4XYNA 1DELA 2WCLA 1LKJA 3KPXA 4NDCA 4HRGA 1JC2A 2L51A 3CLNA 4GGNA 4ORCB 3N7HA 2PMYA 1TNQA 2KSPA 1R2UA 2CCMA 1SKTA 3SG5A 5D69A 3CS1A 3O2PA 1MXEA 1XFYO 5DKRA 2HQ8A 1SCMC 2SCPA 3S0DA 2WCMA 1SL9A 4M2QA 1A03A 2KAYA 1EH2A 4P5OE 1Y6WA 2ZN9A 2D8NA 2F33A 1J1EA 1IG5A 1Y1XA 4GGFC 3I5FB 2KLEA 3GOFA 1QS7A 1SSEB 3IVTA 1JBAA 3D75A 3L47A 3UNWA 2ZKMX 1MWNA 3AAJA 1FI6A 1DMOA 1XFVO 2M49B 3I5HB 1WDCB 2KOTA 2Q4UA 4JD9A 3AAKA 3TZ1A 3QRXA 4PALA 1S5GY 4PHNA 2P70A 1A75A 1EL4A 1XFXO 1QX2A 1YURA 2F2PA 1OMDA 1Q80A 2F8PA 5HLVA 1QIWA 5JOLA 2JU0A 2KI6D 3OB2B 1A75B 2K7OA 5FI2A 3GK1A 4M2PA 2YGUA 1QIVA 3OX6A 2LV7A 4GAOA 1V1GA 1ZACA 5IBWA 3S0BA 1NSHA 4CFQA 1RK9A 4I5JA 1CFFA 2WNDA 1SCMB 1ALWA 4ORBB 1FPWA 1DGUA 5D3OA 3BQ3A 5ER5A 4JKTA 4D1EA 1CLMA 3FWBA 4NDDA 1KWOC 1N65A 1JWDA 3LLEA 2Y1MA 1SY9A 1DEKA 3D78A 2LVIA 2BECA 4YI9A 5J3XA 5AFPA 1NWDA 3EKJA 1MR8A 1DQEA 5F6TA 3VRPA 1KCYA 2KYCA 2MLFC 2NLNA 2V53A 3ZNIA 1F4QA 4GBAA 2LP2A 1RFJA 3A8RA 2L98A 2ZNEA 2MBXA 1EG3A 5ER4X 2PALA 4PDZA 1AHRA 1QLKA 4MZKA 1F55A 2L2CA 1IKUA 3IQQA 1CTRA 5I2QA 2L4IA 4N5XA 1DT7B 2CNPA 5PALA 5AERA 1B4CA 1ZUZA 4DS7A 2PASA 1YR5A 4F0ZB 2JOJA 3PALA 5CSFA 1K9PA 1TNWA 4WQ2A 3PLFB 5HLOA 1PVAA 3EK7A 5I94A 1TUZA 1WLMA 1C7VA 1B7TZ 1LA0A 3ZWHA 1B1GA 4OCIA 1C3YA 5CSIA 1M31A 3RZSA 5K89A 1IQ5A 1TOPA 4DRWA 3SIAA 1M45A 1M46A 1AP4A 1PSRA 5B8IB 1OMVA 2KI6C 2E6WA 3WHUB 1DVIA 1XA5A 2PYQA 4YGCB 1SCVA 3LL8B 2SASA 4PHMA 1UURA 3F45A 1KQMC 1FBVA 2L2EA 3TUYC 2L5XB 1W7IB 1KFXL 4U8DA 2ZFDA 4M2OA 2K7DA 3DY9A 5HL1A 1NCXA 2M7LA 2LVKA 4YGBB 1TUJA 2B1UA 4ZCVA 1N0YA 1PK0D 3D74A 3KEVA 2FJYA 2M97A 5KTYA 1RWYA 1HT9A 1CNPA 2WCKA 4GNKB 3HX4A 4BY5A 3FIAA 1TNXA 1B8LA 2WORA 4WQ3A 3SS5A 1AJ5A 1J1DA 1RJVA 1U5IA 2L0PA 2M29A 2BCAA 3PM8A 1DJGA 1FW4A 1DJWA 3MSEB 1K93D 1J55A 2M3WA 3PN7C 2FOTA 4I5NB 1U5IB 2FCDA 5GQQC 2LLUA 3PATA 1A4PA 1CLLA 1QJTA 2MA2A 4ETOA 2BKIB 2CXJA 3NSIA 3OGNA 2JULA 3CZ2A 1OZOA 1QTXA 4YI8A 4TNCA 3EK4A 1PSBA 1KQMB 1Y1UA 2HQWA 1YRTB 1CDLA 3TUYB 4I5KA 5BPJA 1CMFA 1S6IA 1Y0VH 2LMVA 2LVVA 1BOCA 3EVRA 2CT9A 1J7PA 2Y5IA 4PCWA 1CFDA 1SRAA 1W9ZA 1DJZA 3CYZA 1SNLA 1JFJA 1F70A 4PHKA 4N1FA 4CFRA 2JT8A 1OOFA 1NP8A 2LMTA 1LXFC 3CZTX 3EVUA 1OMRA 2KYFA 4MZJA 2P71A 2E30A 2KI4C 1G8IA 5JJGA 3O6BA 3PN7B 1L7ZA 1GJYA 5DKNA 1QV0A 2F2OA 2KQYA 1B47A 1S36A 1DGVA 3BUOB 2OTGC 3CR2A 3DVJA 2BNXA 2JNXA 1WRLA 1A29A 4MSPA 5TNCA 4PE1A 2K7BA 2NXQA 4AQIA 2L5YA 2QEHA 2EHBA 1BODA 4GPLB 1WY9A 2WC6A 4JWQA 2H2KA 2LUCA 4ICBA 1Y1AA 1DJHA 2I2RE 1TCOB 3B88A 3K1EA 4QJ4B 1QV1A 1XYDA 2AUCA 3NSKA 4MN0A 1YVHA 1JF2A 3OX5A 1IWQA 2JZIA 4R1EA 2LLSA 1BU3A 1IJ6A 2WC5A 3CTNA 1S5GZ 1BR4B 2M9GA 1F71A 4PE4A 2KI4B 2HPSA 1CFCA 1H4BA 2KNEA 5KSZA 1KFUL 1C7WA 3SS4A 4FQOA 2PRUA 3CGAA 2OTGB 3TDIA 2JQ6A 2M1UA 3D77A 4PE7A 2WCJA 1YUTA 1T14A 2EC6B 3FE6A 4NDBA 1S1EA 2K61A 4I5LB 2ZRSA 3D73A 1PALA 1NCYA 4YGDB 2K60A 3DF0A 4MEWA 2K0JA 4PT1A 4INXA 1SL7A 2KPHA 3VRQA 1CDPA 3KF9A 1HQVA 4PHJA 5FI6A 3DF0B 2JTTA 3DVMA 3OBVA 4XJKA 2G9BA 3BJHA 2MHHA 2BL0C 3DYEA 2KBIA 1TWOA 1C07A 1JF0A 2PVBA 3V2LA 4XJKB 1D1OA 1KFUS 1MQ1A 3DVKA 3GK4X 4N1GA 2KAVA 5HYDA 1FF1A 2JWWA 1S26D 2BAPA 5EL2A 2LMUA 2JTZA 3SG4A 3WXAA 1NCZA 5I2LA 2DOQA 1NPQA 4OKHA 2H8VA 4MLWA 4L9MA 2A4JA 3S0EA 1CDNA 1OOGA 2JXCA 1UWOA 2QACA 3PM2A 4A4CA 2LLTA 2RGIA 3CWGA 1BF5A 2K2AA 1DF0A 2JXLA 4YBHB 2WCBA 3FS7A 2R2IA 3VROA 2MRDA 2NCOA 1S3PA 3LK0A 4IJ7A 1DF0B 3PJIA 4E68A 2FJUB 5AXIA 1JUOA 2BBMA 2QDIA 5HKYA 1EJ3A 3K21A 5AANA 2COLB 1FI5A 1DJXA 2BL0B 1CKKA 3BUWB 1K2HA 1M39A 1SR6B 3JVTB 1MUXA 3EVVA 4CIDA 1Z4HA 4PE0A 2HETA 4UPGA 1UHKA 4JQ0D 1CLBA 4C0JA 1LA3A 1CMGA 1MHOA 3LK1A 1XFZO 1LVCD 3RLZA 1WRZA 1UUSA 3EG5B 4HSZA 1LINA 1XVJA 1NX2A 2LHLA 3I5GC 1CM1A 1DTLA 3CZ0A 2KDHA 2BE4A 1BT6A 3BFAA 1ALVA 2KFGA 1H8BA 3DZTA 1P28A 1MF8B 1NUBA 3I5IB 1PRWA 1K94A 2LNKA 3AKBA 2LCPA 3OP0A 1PULA 5HKWA 4CLNA 1RTP1 1ZFSA 1QVIY 2KFHA 1JSAA 3BFHA 4MVFA 4JPZB 1BG1A 1PVBA 3FWCA 1C3ZA 3NHTA 1KSOA 2ISDA 1J7QA 3BUXB 1OOHA 1K8UA 1GGZA 3CABA 1KQVA 1SMGA 3S0GA 1SL8A 3JTDB 3OHMB 2QEVA 1K90D 2M1KB 2GGMA 5G08A 3SG3A 1EG4A 1V1FA 4OV2A 2Y4QA 1EXRA 3BXKA 2JNFA 3S0AA 1S6JA 4QJ3B 2MLEC 2OPOA 1XK4C 2H61C 3VB1A 4AQJA 1AJ4A 3WHTB 2JPTA 1QVIZ 3NSLA 1YRUB 3B86A 4BY4A 3M0WA 1XFWO 1YTZC 3I5GB 3TDZA 1K96A 1IQ3A 2K7CA 2KLDA 3R1PA 1KK8C 1J7OA 1CM4A 2P6BB 3KHEA 3WNXB 2KGRA 2K2FA 3SG2A 2JPOA 1NIWA 3TS5C 1KK7Y 2WCEA 2HF5A 3CDNA 3EKHA 3PSRA 2GTEA 2EGDA 1JFKA 1YX8A 2EC6C 3NGVA 2F3YA 2WOSA 1OW4A 1K9UA 2LE9B 1SYMA 3DXLA
chains in the Genus database with same CATH topology
3BUMB 1TCFA 1QX5B 2CTNA 3D0YA 1BR1B 2GGZA 3KO0A 2MAZA 4HRHA 1BJFA 1N2DA 1XK4A 2AAOA 2H61A 2PSRA 3CR5X 3OB1B 1CB1A 1RECA 2BBNA 3D0YB 4P2YB 1BLQA 2BKHB 1TN4A 1KK7Z 2O5GA 2FCEA 1SK6D 1KSMA 2ZNDA 1CFPA 1M63B 1R6PA 5D7FA 1XFUO 2I7AA 3TDUA 2M8UA 3HCMA 1AVSA 1QLSA 1QATA 1L2OC 1SPYA 2LC5A 4WRIA 1KK8B 5CPVA 1WRKA 3D10A 1OQPA 2IS9A 3H4SE 1QXPA 3TS5B 1NYAA 2LP3A 2M0RA 1ZMZA 1WLZA 1K9KA 3VRRA 4C0KA 3BUNB 1YX7A 2G2BA 4CPVA 1IGVA 3ICBA 1NX1A 4GGFA 2KFFA 1UHJA 1AUIB 4OVNF 2JRFA 1UP5A 1TTXA 2VRGA 2MJWB 5CSNA 4ZCUA 1B8RA 2BCXA 1OE9B 2AMIA 4DIRA 2KHNA 2NZ0A 1K95A 1TRFA 1DJIA 1IRJA 3IQOA 1SR6C 1IJ5A 3JVTC 1OSAA 2Y1NA 5I8NA 1BMOA 2WCFA 2JC2A 4DUQA 1F8HA 2L50A 4YGEB 1UHNA 3C1VA 1DJYA 2F3ZA 1GGWA 1L2OB 3LCPC 2LM5A 3NSOA 4Q04A 1NX0A 3O78A 4C0LA 2GV5A 1E8AA 3A4UB 2LANA 3SG7A 4NQGA 5KU1A 1QX7A 1B7TY 4A4BA 2KBMA 1SW8A 2LHIA 1CDMA 3E3RA 3I5IC 1G4YR 2BE6A 3BOWA 3SG6A 2LVJA 2JT3A 5HKZA 2ZRTA 1ODBA 2JT0A 3VRNA 1YUSA 1YVLA 3EK8A 1B8CA 3BOWB 2NCPA 1KWOB 2Q91A 1YUUA 4HREE 4ORAB 1RROA 3JTDC 1F54A 1B9AA 1UHIA 5DKQA 2WC8A 2TN4A 2OS8C 1OOJA 2ZN8A 3O4YA 2QPTA 4FTGA 3DVEA 1TIZA 2LUXA 4QJ5B 1SBJA 3BYAA 3IF7A 2KQ6A 4OR9B 3CR4X 4MBEA 1G33A 4MZLA 4GFTA 1X02A 4USLA 1VRKA 2I18A 1GQMA 3SJSA 1IH0A 2CBLA 1J7RA 1ZOTB 2KGBC 1MXLC 1NX3A 4DCKA 4MRYA 1QASA 1XO5A 3NXAA 1F4OA 2M7NA 2L4HA 1UHHA 1W7JB 2KAXA 3I5FC 5CSJA 1AK8A 3PFVA 4IL1A 3DD4A 2I94A 1S6CA 2LAPA 2OS8B 2K8MB 2O60A 5FYXA 3VGOA 4GUKA 3I5HC 1A2XA 2BCBA 1WDCC 3AKAA 4YRUA 1OZSA 3SIBA 4MRXA 3RM1A 1KFXS 4AOMA 5AEQA 3GK2A 4YGAA 5I2OA 1TNPA 4XYNA 3KPXA 1JC2A 1LKJA 4NDCA 4HRGA 2L51A 3CLNA 4GGNA 4ORCB 2PMYA 1TNQA 2KSPA 1R2UA 2CCMA 1SKTA 3SG5A 5D69A 3CS1A 3O2PA 1MXEA 1XFYO 5DKRA 2HQ8A 1SCMC 2SCPA 1SL9A 4M2QA 1A03A 2KAYA 1EH2A 4P5OE 1Y6WA 2ZN9A 2D8NA 2F33A 1J1EA 1IG5A 1Y1XA 4GGFC 3I5FB 3GOFA 1QS7A 1JBAA 2ZKMX 1MWNA 3AAJA 1FI6A 1DMOA 1XFVO 2M49B 3I5HB 1WDCB 2KOTA 2Q4UA 3TZ1A 3AAKA 3QRXA 4PALA 1S5GY 4PHNA 1A75A 1EL4A 1XFXO 1QX2A 1YURA 2F2PA 1OMDA 1Q80A 2F8PA 5HLVA 1QIWA 5JOLA 2JU0A 2KI6D 3OB2B 1A75B 2K7OA 3GK1A 4M2PA 1QIVA 3OX6A 2LV7A 4GAOA 1V1GA 1ZACA 5IBWA 1NSHA 4CFQA 1RK9A 4I5JA 1CFFA 2WNDA 1SCMB 1ALWA 4ORBB 1FPWA 1DGUA 3BQ3A 5ER5A 4D1EA 1CLMA 3FWBA 4NDDA 1KWOC 1N65A 1JWDA 3LLEA 2Y1MA 1SY9A 2LVIA 2BECA 4YI9A 5J3XA 5AFPA 1NWDA 3EKJA 1MR8A 5F6TA 1KCYA 3VRPA 2KYCA 2MLFC 2NLNA 2V53A 3ZNIA 1F4QA 4GBAA 2LP2A 1RFJA 3A8RA 2L98A 2ZNEA 2MBXA 1EG3A 5ER4X 2PALA 4PDZA 1AHRA 1QLKA 4MZKA 1F55A 1IKUA 3IQQA 1CTRA 5I2QA 2L4IA 4N5XA 1DT7B 2CNPA 5PALA 5AERA 1B4CA 1ZUZA 4DS7A 2PASA 1YR5A 4F0ZB 2JOJA 3PALA 5CSFA 1K9PA 1TNWA 4WQ2A 3PLFB 5HLOA 1PVAA 3EK7A 1C7VA 1WLMA 1B7TZ 1LA0A 3ZWHA 1B1GA 4OCIA 5CSIA 1M31A 5K89A 1IQ5A 1TOPA 4DRWA 3SIAA 1M45A 1M46A 1AP4A 1PSRA 5B8IB 1OMVA 2KI6C 2E6WA 3WHUB 1DVIA 1XA5A 4YGCB 1SCVA 3LL8B 2SASA 4PHMA 1UURA 3F45A 1KQMC 1FBVA 2L2EA 3TUYC 2L5XB 1W7IB 1KFXL 4U8DA 2ZFDA 4M2OA 2K7DA 1NCXA 2M7LA 2LVKA 4YGBB 2B1UA 4ZCVA 1N0YA 1PK0D 3KEVA 2M97A 5KTYA 1RWYA 1HT9A 1CNPA 4GNKB 3HX4A 4BY5A 3FIAA 1TNXA 1B8LA 2WORA 4WQ3A 1AJ5A 1J1DA 1RJVA 1U5IA 2L0PA 2M29A 2BCAA 3PM8A 1DJGA 1FW4A 1DJWA 3MSEB 1K93D 1J55A 2M3WA 3PN7C 2FOTA 4I5NB 1U5IB 2FCDA 5GQQC 2LLUA 3PATA 1A4PA 1CLLA 1QJTA 2MA2A 4ETOA 2BKIB 2CXJA 3NSIA 2JULA 1OZOA 1QTXA 4YI8A 4TNCA 3EK4A 1PSBA 1KQMB 1Y1UA 2HQWA 1YRTB 1CDLA 3TUYB 4I5KA 5BPJA 1CMFA 1S6IA 1Y0VH 2LMVA 2LVVA 1BOCA 3EVRA 2CT9A 1J7PA 2Y5IA 4PCWA 1CFDA 1SRAA 1DJZA 1SNLA 1JFJA 1F70A 4PHKA 4N1FA 4CFRA 2JT8A 1NP8A 2LMTA 1LXFC 3CZTX 3EVUA 1OMRA 2KYFA 4MZJA 5JJGA 2E30A 2KI4C 1G8IA 3O6BA 3PN7B 1L7ZA 1GJYA 5DKNA 1QV0A 2F2OA 2KQYA 1B47A 1S36A 1DGVA 3BUOB 2OTGC 3CR2A 3DVJA 4MSPA 2JNXA 1WRLA 1A29A 5TNCA 4PE1A 2K7BA 2NXQA 4AQIA 2EHBA 1BODA 4GPLB 1WY9A 4JWQA 2H2KA 2LUCA 4ICBA 1Y1AA 1DJHA 2I2RE 1TCOB 4QJ4B 1QV1A 1XYDA 2AUCA 3NSKA 4MN0A 1YVHA 1JF2A 3OX5A 1IWQA 2JZIA 4R1EA 2LLSA 1BU3A 1IJ6A 3CTNA 1S5GZ 1BR4B 2M9GA 1F71A 4PE4A 2KI4B 2HPSA 1CFCA 1H4BA 2KNEA 5KSZA 1KFUL 1C7WA 4FQOA 2PRUA 3CGAA 2OTGB 3TDIA 2JQ6A 2M1UA 4PE7A 1YUTA 2EC6B 4NDBA 1S1EA 2K61A 4I5LB 2ZRSA 4YGDB 1PALA 1NCYA 3DF0A 4MEWA 2K0JA 1SL7A 3VRQA 1CDPA 3KF9A 1HQVA 4PHJA 3DF0B 2JTTA 3DVMA 4XJKA 2G9BA 2MHHA 2BL0C 2KBIA 1C07A 1JF0A 2PVBA 1D1OA 4XJKB 1KFUS 1MQ1A 3DVKA 3GK4X 4N1GA 2KAVA 5HYDA 1FF1A 2JWWA 1S26D 2LMUA 2JTZA 3SG4A 3WXAA 1NCZA 5I2LA 2DOQA 1NPQA 4OKHA 4MLWA 4L9MA 2A4JA 1CDNA 2JXCA 1UWOA 2QACA 4A4CA 2LLTA 2RGIA 3CWGA 1BF5A 2K2AA 1DF0A 2JXLA 4YBHB 2WCBA 3FS7A 2R2IA 3VROA 2MRDA 2NCOA 1S3PA 3LK0A 1DF0B 4E68A 2FJUB 5AXIA 1JUOA 2BBMA 5HKYA 1EJ3A 3K21A 5AANA 2COLB 1FI5A 1DJXA 2BL0B 3BUWB 1K2HA 1M39A 1SR6B 3JVTB 1MUXA 3EVVA 4CIDA 4PE0A 2HETA 4UPGA 1UHKA 4JQ0D 1CLBA 4C0JA 1LA3A 1CMGA 1MHOA 3LK1A 1XFZO 1LVCD 3RLZA 1WRZA 1UUSA 4HSZA 1LINA 1XVJA 1NX2A 2LHLA 3I5GC 1CM1A 1DTLA 2KDHA 2BE4A 1BT6A 1ALVA 2KFGA 1H8BA 1MF8B 1NUBA 3I5IB 1PRWA 1K94A 2LNKA 3AKBA 2LCPA 3OP0A 1PULA 5HKWA 4CLNA 1RTP1 1ZFSA 1QVIY 2KFHA 1JSAA 4MVFA 4JPZB 1BG1A 1PVBA 3FWCA 1KSOA 2ISDA 1J7QA 3BUXB 1KQVA 1K8UA 1GGZA 1SMGA 1SL8A 3JTDB 3OHMB 1K90D 2M1KB 2GGMA 5G08A 3SG3A 1EG4A 1V1FA 4OV2A 2Y4QA 1EXRA 3BXKA 2JNFA 1S6JA 4QJ3B 2MLEC 2OPOA 1XK4C 2H61C 4AQJA 1AJ4A 3WHTB 2JPTA 1QVIZ 3NSLA 1YRUB 4BY4A 3M0WA 1XFWO 1YTZC 3I5GB 3TDZA 1K96A 1IQ3A 2K7CA 1KK8C 1J7OA 1CM4A 2P6BB 3KHEA 3WNXB 2KGRA 2K2FA 3SG2A 1NIWA 3TS5C 1KK7Y 2WCEA 2HF5A 3EKHA 1CKKA 3PSRA 2EGDA 1JFKA 1YX8A 2EC6C 2F3YA 2WOSA 1K9UA 2LE9B 1SYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BUM B;  1TCF A;  1QX5 B;  2CTN A;  3D0Y A;  1BR1 B;  2GGZ A;  3KO0 A;  2MAZ A;  4HRH A;  1BJF A;  1N2D A;  1XK4 A;  2AAO A;  2H61 A;  2PSR A;  3CR5 X;  3OB1 B;  1CB1 A;  1REC A;  2BBN A;  3D0Y B;  4P2Y B;  1BLQ A;  2BKH B;  1TN4 A;  1KK7 Z;  2O5G A;  2FCE A;  1SK6 D;  1KSM A;  2ZND A;  1CFP A;  1M63 B;  1R6P A;  5D7F A;  1XFU O;  2I7A A;  3TDU A;  2M8U A;  3HCM A;  1AVS A;  1QLS A;  1QAT A;  1L2O C;  1SPY A;  2LC5 A;  4WRI A;  1KK8 B;  5CPV A;  1WRK A;  3D10 A;  1OQP A;  2IS9 A;  3H4S E;  1QXP A;  3TS5 B;  1NYA A;  2LP3 A;  2M0R A;  1ZMZ A;  1WLZ A;  1K9K A;  3VRR A;  4C0K A;  3BUN B;  1YX7 A;  2G2B A;  4CPV A;  1IGV A;  3ICB A;  1NX1 A;  4GGF A;  2KFF A;  1UHJ A;  1AUI B;  4OVN F;  2JRF A;  1UP5 A;  1TTX A;  2VRG A;  2MJW B;  5CSN A;  4ZCU A;  1B8R A;  2BCX A;  1OE9 B;  2AMI A;  4DIR A;  2KHN A;  2NZ0 A;  1K95 A;  1TRF A;  1DJI A;  1IRJ A;  3IQO A;  1SR6 C;  1IJ5 A;  3JVT C;  1OSA A;  2Y1N A;  5I8N A;  1BMO A;  2WCF A;  2JC2 A;  4DUQ A;  1F8H A;  2L50 A;  4YGE B;  1UHN A;  3C1V A;  1DJY A;  2F3Z A;  1GGW A;  1L2O B;  3LCP C;  2LM5 A;  3NSO A;  4Q04 A;  1NX0 A;  3O78 A;  4C0L A;  2GV5 A;  1E8A A;  3A4U B;  2LAN A;  3SG7 A;  4NQG A;  5KU1 A;  1QX7 A;  1B7T Y;  4A4B A;  2KBM A;  1SW8 A;  2LHI A;  1CDM A;  3E3R A;  3I5I C;  1G4Y R;  2BE6 A;  3BOW A;  3SG6 A;  2LVJ A;  2JT3 A;  5HKZ A;  2ZRT A;  1ODB A;  2JT0 A;  3VRN A;  1YUS A;  1YVL A;  3EK8 A;  1B8C A;  3BOW B;  2NCP A;  1KWO B;  2Q91 A;  1YUU A;  4HRE E;  4ORA B;  1RRO A;  3JTD C;  1F54 A;  1B9A A;  1UHI A;  5DKQ A;  2WC8 A;  2TN4 A;  2OS8 C;  1OOJ A;  2ZN8 A;  3O4Y A;  2QPT A;  4FTG A;  3DVE A;  1TIZ A;  2LUX A;  4QJ5 B;  1SBJ A;  3BYA A;  3IF7 A;  2KQ6 A;  4OR9 B;  3CR4 X;  4MBE A;  1G33 A;  4MZL A;  4GFT A;  1X02 A;  4USL A;  1VRK A;  2I18 A;  1GQM A;  3SJS A;  1IH0 A;  2CBL A;  1J7R A;  1ZOT B;  2KGB C;  1MXL C;  1NX3 A;  4DCK A;  4MRY A;  1QAS A;  1XO5 A;  3NXA A;  1F4O A;  2M7N A;  2L4H A;  1UHH A;  1W7J B;  2KAX A;  3I5F C;  5CSJ A;  1AK8 A;  3PFV A;  4IL1 A;  3DD4 A;  2I94 A;  1S6C A;  2LAP A;  2OS8 B;  2K8M B;  2O60 A;  5FYX A;  3VGO A;  4GUK A;  3I5H C;  1A2X A;  2BCB A;  1WDC C;  3AKA A;  4YRU A;  1OZS A;  3SIB A;  4MRX A;  3RM1 A;  1KFX S;  4AOM A;  5AEQ A;  3GK2 A;  4YGA A;  5I2O A;  1TNP A;  4XYN A;  3KPX A;  1JC2 A;  1LKJ A;  4NDC A;  4HRG A;  2L51 A;  3CLN A;  4GGN A;  4ORC B;  2PMY A;  1TNQ A;  2KSP A;  1R2U A;  2CCM A;  1SKT A;  3SG5 A;  5D69 A;  3CS1 A;  3O2P A;  1MXE A;  1XFY O;  5DKR A;  2HQ8 A;  1SCM C;  2SCP A;  1SL9 A;  4M2Q A;  1A03 A;  2KAY A;  1EH2 A;  4P5O E;  1Y6W A;  2ZN9 A;  2D8N A;  2F33 A;  1J1E A;  1IG5 A;  1Y1X A;  4GGF C;  3I5F B;  3GOF A;  1QS7 A;  1JBA A;  2ZKM X;  1MWN A;  3AAJ A;  1FI6 A;  1DMO A;  1XFV O;  2M49 B;  3I5H B;  1WDC B;  2KOT A;  2Q4U A;  3TZ1 A;  3AAK A;  3QRX A;  4PAL A;  1S5G Y;  4PHN A;  1A75 A;  1EL4 A;  1XFX O;  1QX2 A;  1YUR A;  2F2P A;  1OMD A;  1Q80 A;  2F8P A;  5HLV A;  1QIW A;  5JOL A;  2JU0 A;  2KI6 D;  3OB2 B;  1A75 B;  2K7O A;  3GK1 A;  4M2P A;  1QIV A;  3OX6 A;  2LV7 A;  4GAO A;  1V1G A;  1ZAC A;  5IBW A;  1NSH A;  4CFQ A;  1RK9 A;  4I5J A;  1CFF A;  2WND A;  1SCM B;  1ALW A;  4ORB B;  1FPW A;  1DGU A;  3BQ3 A;  5ER5 A;  4D1E A;  1CLM A;  3FWB A;  4NDD A;  1KWO C;  1N65 A;  1JWD A;  3LLE A;  2Y1M A;  1SY9 A;  2LVI A;  2BEC A;  4YI9 A;  5J3X A;  5AFP A;  1NWD A;  3EKJ A;  1MR8 A;  5F6T A;  1KCY A;  3VRP A;  2KYC A;  2MLF C;  2NLN A;  2V53 A;  3ZNI A;  1F4Q A;  4GBA A;  2LP2 A;  1RFJ A;  3A8R A;  2L98 A;  2ZNE A;  2MBX A;  1EG3 A;  5ER4 X;  2PAL A;  4PDZ A;  1AHR A;  1QLK A;  4MZK A;  1F55 A;  1IKU A;  3IQQ A;  1CTR A;  5I2Q A;  2L4I A;  4N5X A;  1DT7 B;  2CNP A;  5PAL A;  5AER A;  1B4C A;  1ZUZ A;  4DS7 A;  2PAS A;  1YR5 A;  4F0Z B;  2JOJ A;  3PAL A;  5CSF A;  1K9P A;  1TNW A;  4WQ2 A;  3PLF B;  5HLO A;  1PVA A;  3EK7 A;  1C7V A;  1WLM A;  1B7T Z;  1LA0 A;  3ZWH A;  1B1G A;  4OCI A;  5CSI A;  1M31 A;  5K89 A;  1IQ5 A;  1TOP A;  4DRW A;  3SIA A;  1M45 A;  1M46 A;  1AP4 A;  1PSR A;  5B8I B;  1OMV A;  2KI6 C;  2E6W A;  3WHU B;  1DVI A;  1XA5 A;  4YGC B;  1SCV A;  3LL8 B;  2SAS A;  4PHM A;  1UUR A;  3F45 A;  1KQM C;  1FBV A;  2L2E A;  3TUY C;  2L5X B;  1W7I B;  1KFX L;  4U8D A;  2ZFD A;  4M2O A;  2K7D A;  1NCX A;  2M7L A;  2LVK A;  4YGB B;  2B1U A;  4ZCV A;  1N0Y A;  1PK0 D;  3KEV A;  2M97 A;  5KTY A;  1RWY A;  1HT9 A;  1CNP A;  4GNK B;  3HX4 A;  4BY5 A;  3FIA A;  1TNX A;  1B8L A;  2WOR A;  4WQ3 A;  1AJ5 A;  1J1D A;  1RJV A;  1U5I A;  2L0P A;  2M29 A;  2BCA A;  3PM8 A;  1DJG A;  1FW4 A;  1DJW A;  3MSE B;  1K93 D;  1J55 A;  2M3W A;  3PN7 C;  2FOT A;  4I5N B;  1U5I B;  2FCD A;  5GQQ C;  2LLU A;  3PAT A;  1A4P A;  1CLL A;  1QJT A;  2MA2 A;  4ETO A;  2BKI B;  2CXJ A;  3NSI A;  2JUL A;  1OZO A;  1QTX A;  4YI8 A;  4TNC A;  3EK4 A;  1PSB A;  1KQM B;  1Y1U A;  2HQW A;  1YRT B;  1CDL A;  3TUY B;  4I5K A;  5BPJ A;  1CMF A;  1S6I A;  1Y0V H;  2LMV A;  2LVV A;  1BOC A;  3EVR A;  2CT9 A;  1J7P A;  2Y5I A;  4PCW A;  1CFD A;  1SRA A;  1DJZ A;  1SNL A;  1JFJ A;  1F70 A;  4PHK A;  4N1F A;  4CFR A;  2JT8 A;  1NP8 A;  2LMT A;  1LXF C;  3CZT X;  3EVU A;  1OMR A;  2KYF A;  4MZJ A;  5JJG A;  2E30 A;  2KI4 C;  1G8I A;  3O6B A;  3PN7 B;  1L7Z A;  1GJY A;  5DKN A;  1QV0 A;  2F2O A;  2KQY A;  1B47 A;  1S36 A;  1DGV A;  3BUO B;  2OTG C;  3CR2 A;  3DVJ A;  4MSP A;  2JNX A;  1WRL A;  1A29 A;  5TNC A;  4PE1 A;  2K7B A;  2NXQ A;  4AQI A;  2EHB A;  1BOD A;  4GPL B;  1WY9 A;  4JWQ A;  2H2K A;  2LUC A;  4ICB A;  1Y1A A;  1DJH A;  2I2R E;  1TCO B;  4QJ4 B;  1QV1 A;  1XYD A;  2AUC A;  3NSK A;  4MN0 A;  1YVH A;  1JF2 A;  3OX5 A;  1IWQ A;  2JZI A;  4R1E A;  2LLS A;  1BU3 A;  1IJ6 A;  3CTN A;  1S5G Z;  1BR4 B;  2M9G A;  1F71 A;  4PE4 A;  2KI4 B;  2HPS A;  1CFC A;  1H4B A;  2KNE A;  5KSZ A;  1KFU L;  1C7W A;  4FQO A;  2PRU A;  3CGA A;  2OTG B;  3TDI A;  2JQ6 A;  2M1U A;  4PE7 A;  1YUT A;  2EC6 B;  4NDB A;  1S1E A;  2K61 A;  4I5L B;  2ZRS A;  4YGD B;  1PAL A;  1NCY A;  3DF0 A;  4MEW A;  2K0J A;  1SL7 A;  3VRQ A;  1CDP A;  3KF9 A;  1HQV A;  4PHJ A;  3DF0 B;  2JTT A;  3DVM A;  4XJK A;  2G9B A;  2MHH A;  2BL0 C;  2KBI A;  1C07 A;  1JF0 A;  2PVB A;  1D1O A;  4XJK B;  1KFU S;  1MQ1 A;  3DVK A;  3GK4 X;  4N1G A;  2KAV A;  5HYD A;  1FF1 A;  2JWW A;  1S26 D;  2LMU A;  2JTZ A;  3SG4 A;  3WXA A;  1NCZ A;  5I2L A;  2DOQ A;  1NPQ A;  4OKH A;  4MLW A;  4L9M A;  2A4J A;  1CDN A;  2JXC A;  1UWO A;  2QAC A;  4A4C A;  2LLT A;  2RGI A;  3CWG A;  1BF5 A;  2K2A A;  1DF0 A;  2JXL A;  4YBH B;  2WCB A;  3FS7 A;  2R2I A;  3VRO A;  2MRD A;  2NCO A;  1S3P A;  3LK0 A;  1DF0 B;  4E68 A;  2FJU B;  5AXI A;  1JUO A;  2BBM A;  5HKY A;  1EJ3 A;  3K21 A;  5AAN A;  2COL B;  1FI5 A;  1DJX A;  2BL0 B;  3BUW B;  1K2H A;  1M39 A;  1SR6 B;  3JVT B;  1MUX A;  3EVV A;  4CID A;  4PE0 A;  2HET A;  4UPG A;  1UHK A;  4JQ0 D;  1CLB A;  4C0J A;  1LA3 A;  1CMG A;  1MHO A;  3LK1 A;  1XFZ O;  1LVC D;  3RLZ A;  1WRZ A;  1UUS A;  4HSZ A;  1LIN A;  1XVJ A;  1NX2 A;  2LHL A;  3I5G C;  1CM1 A;  1DTL A;  2KDH A;  2BE4 A;  1BT6 A;  1ALV A;  2KFG A;  1H8B A;  1MF8 B;  1NUB A;  3I5I B;  1PRW A;  1K94 A;  2LNK A;  3AKB A;  2LCP A;  3OP0 A;  1PUL A;  5HKW A;  4CLN A;  1RTP 1;  1ZFS A;  1QVI Y;  2KFH A;  1JSA A;  4MVF A;  4JPZ B;  1BG1 A;  1PVB A;  3FWC A;  1KSO A;  2ISD A;  1J7Q A;  3BUX B;  1KQV A;  1K8U A;  1GGZ A;  1SMG A;  1SL8 A;  3JTD B;  3OHM B;  1K90 D;  2M1K B;  2GGM A;  5G08 A;  3SG3 A;  1EG4 A;  1V1F A;  4OV2 A;  2Y4Q A;  1EXR A;  3BXK A;  2JNF A;  1S6J A;  4QJ3 B;  2MLE C;  2OPO A;  1XK4 C;  2H61 C;  4AQJ A;  1AJ4 A;  3WHT B;  2JPT A;  1QVI Z;  3NSL A;  1YRU B;  4BY4 A;  3M0W A;  1XFW O;  1YTZ C;  3I5G B;  3TDZ A;  1K96 A;  1IQ3 A;  2K7C A;  1KK8 C;  1J7O A;  1CM4 A;  2P6B B;  3KHE A;  3WNX B;  2KGR A;  2K2F A;  3SG2 A;  1NIW A;  3TS5 C;  1KK7 Y;  2WCE A;  2HF5 A;  3EKH A;  1CKK A;  3PSR A;  2EGD A;  1JFK A;  1YX8 A;  2EC6 C;  2F3Y A;  2WOS A;  1K9U A;  2LE9 B;  1SYM A; 
#chains in the Genus database with same CATH topology
 3BUM B;  1TCF A;  1QX5 B;  2CTN A;  3D0Y A;  3UO9 A;  1BR1 B;  2GGZ A;  3KO0 A;  2MAZ A;  4HRH A;  1BJF A;  1N2D A;  1XK4 A;  2AAO A;  2H61 A;  2PSR A;  3CR5 X;  3OB1 B;  1CB1 A;  1DC1 A;  1REC A;  2BBN A;  3D0Y B;  4P2Y B;  4F7F A;  1BLQ A;  2BKH B;  1TN4 A;  1KK7 Z;  2O5G A;  2FCE A;  1SK6 D;  1KSM A;  2ZND A;  1CFP A;  1M63 B;  1R6P A;  3FE8 A;  3R1V A;  5D7F A;  1XFU O;  3QME A;  2I7A A;  3TDU A;  2M8U A;  3HCM A;  1AVS A;  1QLS A;  1QAT A;  3B7A A;  1L2O C;  1SPY A;  2LC5 A;  4WRI A;  1KK8 B;  5CPV A;  1WRK A;  3D10 A;  5FI7 A;  1OQP A;  2IS9 A;  3H4S E;  1QXP A;  3TS5 B;  1NYA A;  3D76 A;  2LP3 A;  2M0R A;  1ZMZ A;  1WLZ A;  1K9K A;  3VRR A;  4C0K A;  3BUN B;  3O4X A;  1YX7 A;  2G2B A;  4CPV A;  1IGV A;  3B6X A;  3ICB A;  1NX1 A;  4GGF A;  2KFF A;  1UHJ A;  1AUI B;  1OOI X;  4OVN F;  2JRF A;  1UP5 A;  1TTX A;  2VRG A;  2MJW B;  5CSN A;  4ZCU A;  3S0F A;  1B8R A;  2BCX A;  1OE9 B;  2AMI A;  4DIR A;  5DIC A;  2KHN A;  2NZ0 A;  1K95 A;  1TRF A;  1DJI A;  1IRJ A;  3IQO A;  1SR6 C;  1IJ5 A;  3JVT C;  1OSA A;  1IIO A;  2Y1N A;  5I8N A;  1BMO A;  2WCF A;  2JC2 A;  4DUQ A;  1F8H A;  2L50 A;  4YGE B;  1UHN A;  3R72 A;  3C1V A;  1DJY A;  2F3Z A;  1GGW A;  1L2O B;  3L4L A;  2LM5 A;  3LCP C;  3NSO A;  4Q04 A;  1NX0 A;  3O78 A;  4KYN A;  4C0L A;  2GV5 A;  1E8A A;  3R1O A;  3A4U B;  2LAN A;  3SG7 A;  1LS8 A;  4NQG A;  5KU1 A;  1QX7 A;  3B87 A;  1B7T Y;  3L4A A;  4A4B A;  2KBM A;  2ERB A;  1QWV A;  1SW8 A;  2LHI A;  3SS3 A;  1CDM A;  1GM0 A;  3E3R A;  3I5I C;  1G4Y R;  2BE6 A;  3BOW A;  3SG6 A;  2LVJ A;  2JT3 A;  3NHI A;  2ZRT A;  1ODB A;  2JT0 A;  5HKZ A;  3VRN A;  1YUS A;  1YVL A;  3EK8 A;  1B8C A;  3BOW B;  2NCP A;  1KWO B;  2Q91 A;  1YUU A;  4HRE E;  4ORA B;  1RRO A;  3JTD C;  1F54 A;  1B9A A;  1UHI A;  3FE9 A;  2WCH A;  1Z2C B;  5DKQ A;  2WC8 A;  2TN4 A;  4INW A;  2OS8 C;  1OOJ A;  2ZN8 A;  3O4Y A;  2QPT A;  4FTG A;  3DVE A;  1TIZ A;  2LUX A;  4QJ5 B;  1SBJ A;  3BYA A;  3IF7 A;  2KQ6 A;  4OR9 B;  3CR4 X;  4MBE A;  1G33 A;  4MZL A;  4GFT A;  1X02 A;  4USL A;  1VRK A;  2I18 A;  1GQM A;  2QEB A;  3SJS A;  1IH0 A;  2CBL A;  1J7R A;  1ZOT B;  3CZ1 A;  4FQT A;  2KGB C;  1MXL C;  1NX3 A;  4DCK A;  2QEO A;  4OZD A;  1ORG A;  4MRY A;  1QAS A;  1XO5 A;  3NXA A;  1F4O A;  2M7N A;  1XFR A;  2L4H A;  1UHH A;  1W7J B;  2KAX A;  3I5F C;  5CSJ A;  1AK8 A;  3PFV A;  3Q8I A;  4IL1 A;  3DD4 A;  2I94 A;  1S6C A;  2LAP A;  2OS8 B;  2K8M B;  2PQL A;  2O60 A;  5FYX A;  3VGO A;  4GUK A;  3I5H C;  1A2X A;  2BCB A;  1WDC C;  3AKA A;  4YRU A;  1OZS A;  3BFB A;  3SIB A;  4MRX A;  3RM1 A;  1KFX S;  4AOM A;  5AEQ A;  3GK2 A;  4YGA A;  5I2O A;  1TNP A;  4XYN A;  1DEL A;  2WCL A;  1LKJ A;  3KPX A;  4NDC A;  4HRG A;  1JC2 A;  2L51 A;  3CLN A;  4GGN A;  4ORC B;  3N7H A;  2PMY A;  1TNQ A;  2KSP A;  1R2U A;  2CCM A;  1SKT A;  3SG5 A;  5D69 A;  3CS1 A;  3O2P A;  1MXE A;  1XFY O;  5DKR A;  2HQ8 A;  1SCM C;  2SCP A;  3S0D A;  2WCM A;  1SL9 A;  4M2Q A;  1A03 A;  2KAY A;  1EH2 A;  4P5O E;  1Y6W A;  2ZN9 A;  2D8N A;  2F33 A;  1J1E A;  1IG5 A;  1Y1X A;  4GGF C;  3I5F B;  2KLE A;  3GOF A;  1QS7 A;  1SSE B;  3IVT A;  1JBA A;  3D75 A;  3L47 A;  3UNW A;  2ZKM X;  1MWN A;  3AAJ A;  1FI6 A;  1DMO A;  1XFV O;  2M49 B;  3I5H B;  1WDC B;  2KOT A;  2Q4U A;  4JD9 A;  3AAK A;  3TZ1 A;  3QRX A;  4PAL A;  1S5G Y;  4PHN A;  2P70 A;  1A75 A;  1EL4 A;  1XFX O;  1QX2 A;  1YUR A;  2F2P A;  1OMD A;  1Q80 A;  2F8P A;  5HLV A;  1QIW A;  5JOL A;  2JU0 A;  2KI6 D;  3OB2 B;  1A75 B;  2K7O A;  5FI2 A;  3GK1 A;  4M2P A;  2YGU A;  1QIV A;  3OX6 A;  2LV7 A;  4GAO A;  1V1G A;  1ZAC A;  5IBW A;  3S0B A;  1NSH A;  4CFQ A;  1RK9 A;  4I5J A;  1CFF A;  2WND A;  1SCM B;  1ALW A;  4ORB B;  1FPW A;  1DGU A;  5D3O A;  3BQ3 A;  5ER5 A;  4JKT A;  4D1E A;  1CLM A;  3FWB A;  4NDD A;  1KWO C;  1N65 A;  1JWD A;  3LLE A;  2Y1M A;  1SY9 A;  1DEK A;  3D78 A;  2LVI A;  2BEC A;  4YI9 A;  5J3X A;  5AFP A;  1NWD A;  3EKJ A;  1MR8 A;  1DQE A;  5F6T A;  3VRP A;  1KCY A;  2KYC A;  2MLF C;  2NLN A;  2V53 A;  3ZNI A;  1F4Q A;  4GBA A;  2LP2 A;  1RFJ A;  3A8R A;  2L98 A;  2ZNE A;  2MBX A;  1EG3 A;  5ER4 X;  2PAL A;  4PDZ A;  1AHR A;  1QLK A;  4MZK A;  1F55 A;  2L2C A;  1IKU A;  3IQQ A;  1CTR A;  5I2Q A;  2L4I A;  4N5X A;  1DT7 B;  2CNP A;  5PAL A;  5AER A;  1B4C A;  1ZUZ A;  4DS7 A;  2PAS A;  1YR5 A;  4F0Z B;  2JOJ A;  3PAL A;  5CSF A;  1K9P A;  1TNW A;  4WQ2 A;  3PLF B;  5HLO A;  1PVA A;  3EK7 A;  5I94 A;  1TUZ A;  1WLM A;  1C7V A;  1B7T Z;  1LA0 A;  3ZWH A;  1B1G A;  4OCI A;  1C3Y A;  5CSI A;  1M31 A;  3RZS A;  5K89 A;  1IQ5 A;  1TOP A;  4DRW A;  3SIA A;  1M45 A;  1M46 A;  1AP4 A;  1PSR A;  5B8I B;  1OMV A;  2KI6 C;  2E6W A;  3WHU B;  1DVI A;  1XA5 A;  2PYQ A;  4YGC B;  1SCV A;  3LL8 B;  2SAS A;  4PHM A;  1UUR A;  3F45 A;  1KQM C;  1FBV A;  2L2E A;  3TUY C;  2L5X B;  1W7I B;  1KFX L;  4U8D A;  2ZFD A;  4M2O A;  2K7D A;  3DY9 A;  5HL1 A;  1NCX A;  2M7L A;  2LVK A;  4YGB B;  1TUJ A;  2B1U A;  4ZCV A;  1N0Y A;  1PK0 D;  3D74 A;  3KEV A;  2FJY A;  2M97 A;  5KTY A;  1RWY A;  1HT9 A;  1CNP A;  2WCK A;  4GNK B;  3HX4 A;  4BY5 A;  3FIA A;  1TNX A;  1B8L A;  2WOR A;  4WQ3 A;  3SS5 A;  1AJ5 A;  1J1D A;  1RJV A;  1U5I A;  2L0P A;  2M29 A;  2BCA A;  3PM8 A;  1DJG A;  1FW4 A;  1DJW A;  3MSE B;  1K93 D;  1J55 A;  2M3W A;  3PN7 C;  2FOT A;  4I5N B;  1U5I B;  2FCD A;  5GQQ C;  2LLU A;  3PAT A;  1A4P A;  1CLL A;  1QJT A;  2MA2 A;  4ETO A;  2BKI B;  2CXJ A;  3NSI A;  3OGN A;  2JUL A;  3CZ2 A;  1OZO A;  1QTX A;  4YI8 A;  4TNC A;  3EK4 A;  1PSB A;  1KQM B;  1Y1U A;  2HQW A;  1YRT B;  1CDL A;  3TUY B;  4I5K A;  5BPJ A;  1CMF A;  1S6I A;  1Y0V H;  2LMV A;  2LVV A;  1BOC A;  3EVR A;  2CT9 A;  1J7P A;  2Y5I A;  4PCW A;  1CFD A;  1SRA A;  1W9Z A;  1DJZ A;  3CYZ A;  1SNL A;  1JFJ A;  1F70 A;  4PHK A;  4N1F A;  4CFR A;  2JT8 A;  1OOF A;  1NP8 A;  2LMT A;  1LXF C;  3CZT X;  3EVU A;  1OMR A;  2KYF A;  4MZJ A;  2P71 A;  2E30 A;  2KI4 C;  1G8I A;  5JJG A;  3O6B A;  3PN7 B;  1L7Z A;  1GJY A;  5DKN A;  1QV0 A;  2F2O A;  2KQY A;  1B47 A;  1S36 A;  1DGV A;  3BUO B;  2OTG C;  3CR2 A;  3DVJ A;  2BNX A;  2JNX A;  1WRL A;  1A29 A;  4MSP A;  5TNC A;  4PE1 A;  2K7B A;  2NXQ A;  4AQI A;  2L5Y A;  2QEH A;  2EHB A;  1BOD A;  4GPL B;  1WY9 A;  2WC6 A;  4JWQ A;  2H2K A;  2LUC A;  4ICB A;  1Y1A A;  1DJH A;  2I2R E;  1TCO B;  3B88 A;  3K1E A;  4QJ4 B;  1QV1 A;  1XYD A;  2AUC A;  3NSK A;  4MN0 A;  1YVH A;  1JF2 A;  3OX5 A;  1IWQ A;  2JZI A;  4R1E A;  2LLS A;  1BU3 A;  1IJ6 A;  2WC5 A;  3CTN A;  1S5G Z;  1BR4 B;  2M9G A;  1F71 A;  4PE4 A;  2KI4 B;  2HPS A;  1CFC A;  1H4B A;  2KNE A;  5KSZ A;  1KFU L;  1C7W A;  3SS4 A;  4FQO A;  2PRU A;  3CGA A;  2OTG B;  3TDI A;  2JQ6 A;  2M1U A;  3D77 A;  4PE7 A;  2WCJ A;  1YUT A;  1T14 A;  2EC6 B;  3FE6 A;  4NDB A;  1S1E A;  2K61 A;  4I5L B;  2ZRS A;  3D73 A;  1PAL A;  1NCY A;  4YGD B;  2K60 A;  3DF0 A;  4MEW A;  2K0J A;  4PT1 A;  4INX A;  1SL7 A;  2KPH A;  3VRQ A;  1CDP A;  3KF9 A;  1HQV A;  4PHJ A;  5FI6 A;  3DF0 B;  2JTT A;  3DVM A;  3OBV A;  4XJK A;  2G9B A;  3BJH A;  2MHH A;  2BL0 C;  3DYE A;  2KBI A;  1TWO A;  1C07 A;  1JF0 A;  2PVB A;  3V2L A;  4XJK B;  1D1O A;  1KFU S;  1MQ1 A;  3DVK A;  3GK4 X;  4N1G A;  2KAV A;  5HYD A;  1FF1 A;  2JWW A;  1S26 D;  2BAP A;  5EL2 A;  2LMU A;  2JTZ A;  3SG4 A;  3WXA A;  1NCZ A;  5I2L A;  2DOQ A;  1NPQ A;  4OKH A;  2H8V A;  4MLW A;  4L9M A;  2A4J A;  3S0E A;  1CDN A;  1OOG A;  2JXC A;  1UWO A;  2QAC A;  3PM2 A;  4A4C A;  2LLT A;  2RGI A;  3CWG A;  1BF5 A;  2K2A A;  1DF0 A;  2JXL A;  4YBH B;  2WCB A;  3FS7 A;  2R2I A;  3VRO A;  2MRD A;  2NCO A;  1S3P A;  3LK0 A;  4IJ7 A;  1DF0 B;  3PJI A;  4E68 A;  2FJU B;  5AXI A;  1JUO A;  2BBM A;  2QDI A;  5HKY A;  1EJ3 A;  3K21 A;  5AAN A;  2COL B;  1FI5 A;  1DJX A;  2BL0 B;  1CKK A;  3BUW B;  1K2H A;  1M39 A;  1SR6 B;  3JVT B;  1MUX A;  3EVV A;  4CID A;  1Z4H A;  4PE0 A;  2HET A;  4UPG A;  1UHK A;  4JQ0 D;  1CLB A;  4C0J A;  1LA3 A;  1CMG A;  1MHO A;  3LK1 A;  1XFZ O;  1LVC D;  3RLZ A;  1WRZ A;  1UUS A;  3EG5 B;  4HSZ A;  1LIN A;  1XVJ A;  1NX2 A;  2LHL A;  3I5G C;  1CM1 A;  1DTL A;  3CZ0 A;  2KDH A;  2BE4 A;  1BT6 A;  3BFA A;  1ALV A;  2KFG A;  1H8B A;  3DZT A;  1P28 A;  1MF8 B;  1NUB A;  3I5I B;  1PRW A;  1K94 A;  2LNK A;  3AKB A;  2LCP A;  3OP0 A;  1PUL A;  5HKW A;  4CLN A;  1RTP 1;  1ZFS A;  1QVI Y;  2KFH A;  1JSA A;  3BFH A;  4MVF A;  4JPZ B;  1BG1 A;  1PVB A;  3FWC A;  1C3Z A;  3NHT A;  1KSO A;  2ISD A;  1J7Q A;  3BUX B;  1OOH A;  1K8U A;  1GGZ A;  3CAB A;  1KQV A;  1SMG A;  3S0G A;  1SL8 A;  3JTD B;  3OHM B;  2QEV A;  1K90 D;  2M1K B;  2GGM A;  5G08 A;  3SG3 A;  1EG4 A;  1V1F A;  4OV2 A;  2Y4Q A;  1EXR A;  3BXK A;  2JNF A;  3S0A A;  1S6J A;  4QJ3 B;  2MLE C;  2OPO A;  1XK4 C;  2H61 C;  3VB1 A;  4AQJ A;  1AJ4 A;  3WHT B;  2JPT A;  1QVI Z;  3NSL A;  1YRU B;  3B86 A;  4BY4 A;  3M0W A;  1XFW O;  1YTZ C;  3I5G B;  3TDZ A;  1K96 A;  1IQ3 A;  2K7C A;  2KLD A;  3R1P A;  1KK8 C;  1J7O A;  1CM4 A;  2P6B B;  3KHE A;  3WNX B;  2KGR A;  2K2F A;  3SG2 A;  2JPO A;  1NIW A;  3TS5 C;  1KK7 Y;  2WCE A;  2HF5 A;  3CDN A;  3EKH A;  3PSR A;  2GTE A;  2EGD A;  1JFK A;  1YX8 A;  2EC6 C;  3NGV A;  2F3Y A;  2WOS A;  1OW4 A;  1K9U A;  2LE9 B;  1SYM A;  3DXL A; 
#chains in the Genus database with same CATH homology
 3BUM B;  1TCF A;  1QX5 B;  2CTN A;  3D0Y A;  1BR1 B;  2GGZ A;  3KO0 A;  2MAZ A;  4HRH A;  1BJF A;  1N2D A;  1XK4 A;  2AAO A;  2H61 A;  2PSR A;  3CR5 X;  3OB1 B;  1CB1 A;  1REC A;  2BBN A;  3D0Y B;  4P2Y B;  1BLQ A;  2BKH B;  1TN4 A;  1KK7 Z;  2O5G A;  2FCE A;  1SK6 D;  1KSM A;  2ZND A;  1CFP A;  1M63 B;  1R6P A;  5D7F A;  1XFU O;  2I7A A;  3TDU A;  2M8U A;  3HCM A;  1AVS A;  1QLS A;  1QAT A;  1L2O C;  1SPY A;  2LC5 A;  4WRI A;  1KK8 B;  5CPV A;  1WRK A;  3D10 A;  1OQP A;  2IS9 A;  3H4S E;  1QXP A;  3TS5 B;  1NYA A;  2LP3 A;  2M0R A;  1ZMZ A;  1WLZ A;  1K9K A;  3VRR A;  4C0K A;  3BUN B;  1YX7 A;  2G2B A;  4CPV A;  1IGV A;  3ICB A;  1NX1 A;  4GGF A;  2KFF A;  1UHJ A;  1AUI B;  4OVN F;  2JRF A;  1UP5 A;  1TTX A;  2VRG A;  2MJW B;  5CSN A;  4ZCU A;  1B8R A;  2BCX A;  1OE9 B;  2AMI A;  4DIR A;  2KHN A;  2NZ0 A;  1K95 A;  1TRF A;  1DJI A;  1IRJ A;  3IQO A;  1SR6 C;  1IJ5 A;  3JVT C;  1OSA A;  2Y1N A;  5I8N A;  1BMO A;  2WCF A;  2JC2 A;  4DUQ A;  1F8H A;  2L50 A;  4YGE B;  1UHN A;  3C1V A;  1DJY A;  2F3Z A;  1GGW A;  1L2O B;  3LCP C;  2LM5 A;  3NSO A;  4Q04 A;  1NX0 A;  3O78 A;  4C0L A;  2GV5 A;  1E8A A;  3A4U B;  2LAN A;  3SG7 A;  4NQG A;  5KU1 A;  1QX7 A;  1B7T Y;  4A4B A;  2KBM A;  1SW8 A;  2LHI A;  1CDM A;  3E3R A;  3I5I C;  1G4Y R;  2BE6 A;  3BOW A;  3SG6 A;  2LVJ A;  2JT3 A;  5HKZ A;  2ZRT A;  1ODB A;  2JT0 A;  3VRN A;  1YUS A;  1YVL A;  3EK8 A;  1B8C A;  3BOW B;  2NCP A;  1KWO B;  2Q91 A;  1YUU A;  4HRE E;  4ORA B;  1RRO A;  3JTD C;  1F54 A;  1B9A A;  1UHI A;  5DKQ A;  2WC8 A;  2TN4 A;  2OS8 C;  1OOJ A;  2ZN8 A;  3O4Y A;  2QPT A;  4FTG A;  3DVE A;  1TIZ A;  2LUX A;  4QJ5 B;  1SBJ A;  3BYA A;  3IF7 A;  2KQ6 A;  4OR9 B;  3CR4 X;  4MBE A;  1G33 A;  4MZL A;  4GFT A;  1X02 A;  4USL A;  1VRK A;  2I18 A;  1GQM A;  3SJS A;  1IH0 A;  2CBL A;  1J7R A;  1ZOT B;  2KGB C;  1MXL C;  1NX3 A;  4DCK A;  4MRY A;  1QAS A;  1XO5 A;  3NXA A;  1F4O A;  2M7N A;  2L4H A;  1UHH A;  1W7J B;  2KAX A;  3I5F C;  5CSJ A;  1AK8 A;  3PFV A;  4IL1 A;  3DD4 A;  2I94 A;  1S6C A;  2LAP A;  2OS8 B;  2K8M B;  2O60 A;  5FYX A;  3VGO A;  4GUK A;  3I5H C;  1A2X A;  2BCB A;  1WDC C;  3AKA A;  4YRU A;  1OZS A;  3SIB A;  4MRX A;  3RM1 A;  1KFX S;  4AOM A;  5AEQ A;  3GK2 A;  4YGA A;  5I2O A;  1TNP A;  4XYN A;  3KPX A;  1JC2 A;  1LKJ A;  4NDC A;  4HRG A;  2L51 A;  3CLN A;  4GGN A;  4ORC B;  2PMY A;  1TNQ A;  2KSP A;  1R2U A;  2CCM A;  1SKT A;  3SG5 A;  5D69 A;  3CS1 A;  3O2P A;  1MXE A;  1XFY O;  5DKR A;  2HQ8 A;  1SCM C;  2SCP A;  1SL9 A;  4M2Q A;  1A03 A;  2KAY A;  1EH2 A;  4P5O E;  1Y6W A;  2ZN9 A;  2D8N A;  2F33 A;  1J1E A;  1IG5 A;  1Y1X A;  4GGF C;  3I5F B;  3GOF A;  1QS7 A;  1JBA A;  2ZKM X;  1MWN A;  3AAJ A;  1FI6 A;  1DMO A;  1XFV O;  2M49 B;  3I5H B;  1WDC B;  2KOT A;  2Q4U A;  3TZ1 A;  3AAK A;  3QRX A;  4PAL A;  1S5G Y;  4PHN A;  1A75 A;  1EL4 A;  1XFX O;  1QX2 A;  1YUR A;  2F2P A;  1OMD A;  1Q80 A;  2F8P A;  5HLV A;  1QIW A;  5JOL A;  2JU0 A;  2KI6 D;  3OB2 B;  1A75 B;  2K7O A;  3GK1 A;  4M2P A;  1QIV A;  3OX6 A;  2LV7 A;  4GAO A;  1V1G A;  1ZAC A;  5IBW A;  1NSH A;  4CFQ A;  1RK9 A;  4I5J A;  1CFF A;  2WND A;  1SCM B;  1ALW A;  4ORB B;  1FPW A;  1DGU A;  3BQ3 A;  5ER5 A;  4D1E A;  1CLM A;  3FWB A;  4NDD A;  1KWO C;  1N65 A;  1JWD A;  3LLE A;  2Y1M A;  1SY9 A;  2LVI A;  2BEC A;  4YI9 A;  5J3X A;  5AFP A;  1NWD A;  3EKJ A;  1MR8 A;  5F6T A;  1KCY A;  3VRP A;  2KYC A;  2MLF C;  2NLN A;  2V53 A;  3ZNI A;  1F4Q A;  4GBA A;  2LP2 A;  1RFJ A;  3A8R A;  2L98 A;  2ZNE A;  2MBX A;  1EG3 A;  5ER4 X;  2PAL A;  4PDZ A;  1AHR A;  1QLK A;  4MZK A;  1F55 A;  1IKU A;  3IQQ A;  1CTR A;  5I2Q A;  2L4I A;  4N5X A;  1DT7 B;  2CNP A;  5PAL A;  5AER A;  1B4C A;  1ZUZ A;  4DS7 A;  2PAS A;  1YR5 A;  4F0Z B;  2JOJ A;  3PAL A;  5CSF A;  1K9P A;  1TNW A;  4WQ2 A;  3PLF B;  5HLO A;  1PVA A;  3EK7 A;  1C7V A;  1WLM A;  1B7T Z;  1LA0 A;  3ZWH A;  1B1G A;  4OCI A;  5CSI A;  1M31 A;  5K89 A;  1IQ5 A;  1TOP A;  4DRW A;  3SIA A;  1M45 A;  1M46 A;  1AP4 A;  1PSR A;  5B8I B;  1OMV A;  2KI6 C;  2E6W A;  3WHU B;  1DVI A;  1XA5 A;  4YGC B;  1SCV A;  3LL8 B;  2SAS A;  4PHM A;  1UUR A;  3F45 A;  1KQM C;  1FBV A;  2L2E A;  3TUY C;  2L5X B;  1W7I B;  1KFX L;  4U8D A;  2ZFD A;  4M2O A;  2K7D A;  1NCX A;  2M7L A;  2LVK A;  4YGB B;  2B1U A;  4ZCV A;  1N0Y A;  1PK0 D;  3KEV A;  2M97 A;  5KTY A;  1RWY A;  1HT9 A;  1CNP A;  4GNK B;  3HX4 A;  4BY5 A;  3FIA A;  1TNX A;  1B8L A;  2WOR A;  4WQ3 A;  1AJ5 A;  1J1D A;  1RJV A;  1U5I A;  2L0P A;  2M29 A;  2BCA A;  3PM8 A;  1DJG A;  1FW4 A;  1DJW A;  3MSE B;  1K93 D;  1J55 A;  2M3W A;  3PN7 C;  2FOT A;  4I5N B;  1U5I B;  2FCD A;  5GQQ C;  2LLU A;  3PAT A;  1A4P A;  1CLL A;  1QJT A;  2MA2 A;  4ETO A;  2BKI B;  2CXJ A;  3NSI A;  2JUL A;  1OZO A;  1QTX A;  4YI8 A;  4TNC A;  3EK4 A;  1PSB A;  1KQM B;  1Y1U A;  2HQW A;  1YRT B;  1CDL A;  3TUY B;  4I5K A;  5BPJ A;  1CMF A;  1S6I A;  1Y0V H;  2LMV A;  2LVV A;  1BOC A;  3EVR A;  2CT9 A;  1J7P A;  2Y5I A;  4PCW A;  1CFD A;  1SRA A;  1DJZ A;  1SNL A;  1JFJ A;  1F70 A;  4PHK A;  4N1F A;  4CFR A;  2JT8 A;  1NP8 A;  2LMT A;  1LXF C;  3CZT X;  3EVU A;  1OMR A;  2KYF A;  4MZJ A;  5JJG A;  2E30 A;  2KI4 C;  1G8I A;  3O6B A;  3PN7 B;  1L7Z A;  1GJY A;  5DKN A;  1QV0 A;  2F2O A;  2KQY A;  1B47 A;  1S36 A;  1DGV A;  3BUO B;  2OTG C;  3CR2 A;  3DVJ A;  4MSP A;  2JNX A;  1WRL A;  1A29 A;  5TNC A;  4PE1 A;  2K7B A;  2NXQ A;  4AQI A;  2EHB A;  1BOD A;  4GPL B;  1WY9 A;  4JWQ A;  2H2K A;  2LUC A;  4ICB A;  1Y1A A;  1DJH A;  2I2R E;  1TCO B;  4QJ4 B;  1QV1 A;  1XYD A;  2AUC A;  3NSK A;  4MN0 A;  1YVH A;  1JF2 A;  3OX5 A;  1IWQ A;  2JZI A;  4R1E A;  2LLS A;  1BU3 A;  1IJ6 A;  3CTN A;  1S5G Z;  1BR4 B;  2M9G A;  1F71 A;  4PE4 A;  2KI4 B;  2HPS A;  1CFC A;  1H4B A;  2KNE A;  5KSZ A;  1KFU L;  1C7W A;  4FQO A;  2PRU A;  3CGA A;  2OTG B;  3TDI A;  2JQ6 A;  2M1U A;  4PE7 A;  1YUT A;  2EC6 B;  4NDB A;  1S1E A;  2K61 A;  4I5L B;  2ZRS A;  4YGD B;  1PAL A;  1NCY A;  3DF0 A;  4MEW A;  2K0J A;  1SL7 A;  3VRQ A;  1CDP A;  3KF9 A;  1HQV A;  4PHJ A;  3DF0 B;  2JTT A;  3DVM A;  4XJK A;  2G9B A;  2MHH A;  2BL0 C;  2KBI A;  1C07 A;  1JF0 A;  2PVB A;  1D1O A;  4XJK B;  1KFU S;  1MQ1 A;  3DVK A;  3GK4 X;  4N1G A;  2KAV A;  5HYD A;  1FF1 A;  2JWW A;  1S26 D;  2LMU A;  2JTZ A;  3SG4 A;  3WXA A;  1NCZ A;  5I2L A;  2DOQ A;  1NPQ A;  4OKH A;  4MLW A;  4L9M A;  2A4J A;  1CDN A;  2JXC A;  1UWO A;  2QAC A;  4A4C A;  2LLT A;  2RGI A;  3CWG A;  1BF5 A;  2K2A A;  1DF0 A;  2JXL A;  4YBH B;  2WCB A;  3FS7 A;  2R2I A;  3VRO A;  2MRD A;  2NCO A;  1S3P A;  3LK0 A;  1DF0 B;  4E68 A;  2FJU B;  5AXI A;  1JUO A;  2BBM A;  5HKY A;  1EJ3 A;  3K21 A;  5AAN A;  2COL B;  1FI5 A;  1DJX A;  2BL0 B;  3BUW B;  1K2H A;  1M39 A;  1SR6 B;  3JVT B;  1MUX A;  3EVV A;  4CID A;  4PE0 A;  2HET A;  4UPG A;  1UHK A;  4JQ0 D;  1CLB A;  4C0J A;  1LA3 A;  1CMG A;  1MHO A;  3LK1 A;  1XFZ O;  1LVC D;  3RLZ A;  1WRZ A;  1UUS A;  4HSZ A;  1LIN A;  1XVJ A;  1NX2 A;  2LHL A;  3I5G C;  1CM1 A;  1DTL A;  2KDH A;  2BE4 A;  1BT6 A;  1ALV A;  2KFG A;  1H8B A;  1MF8 B;  1NUB A;  3I5I B;  1PRW A;  1K94 A;  2LNK A;  3AKB A;  2LCP A;  3OP0 A;  1PUL A;  5HKW A;  4CLN A;  1RTP 1;  1ZFS A;  1QVI Y;  2KFH A;  1JSA A;  4MVF A;  4JPZ B;  1BG1 A;  1PVB A;  3FWC A;  1KSO A;  2ISD A;  1J7Q A;  3BUX B;  1KQV A;  1K8U A;  1GGZ A;  1SMG A;  1SL8 A;  3JTD B;  3OHM B;  1K90 D;  2M1K B;  2GGM A;  5G08 A;  3SG3 A;  1EG4 A;  1V1F A;  4OV2 A;  2Y4Q A;  1EXR A;  3BXK A;  2JNF A;  1S6J A;  4QJ3 B;  2MLE C;  2OPO A;  1XK4 C;  2H61 C;  4AQJ A;  1AJ4 A;  3WHT B;  2JPT A;  1QVI Z;  3NSL A;  1YRU B;  4BY4 A;  3M0W A;  1XFW O;  1YTZ C;  3I5G B;  3TDZ A;  1K96 A;  1IQ3 A;  2K7C A;  1KK8 C;  1J7O A;  1CM4 A;  2P6B B;  3KHE A;  3WNX B;  2KGR A;  2K2F A;  3SG2 A;  1NIW A;  3TS5 C;  1KK7 Y;  2WCE A;  2HF5 A;  3EKH A;  1CKK A;  3PSR A;  2EGD A;  1JFK A;  1YX8 A;  2EC6 C;  2F3Y A;  2WOS A;  1K9U A;  2LE9 B;  1SYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...