3PM2A

Crystal structure of a novel type of odorant binding protein from anopheles gambiae belonging to the c+ class
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
MDNPCLKGPPVPKNAAECCVTPFLVEPSAFMTCHSKWIGQTKRQMAMEGIPRGCCVAECVMNSTSLYSNGKIDREALTKLYLDSTKSMAPEWNKITLDAIDGCFKMADSIKDEIEAGAKLTPAFEGEQICHPISGTILACMGMTLFAECPAKLFTVNDDCNKLKSYHSKCPFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Odorant binding protein (AGAP007287-PA)
publication title Crystal structure of a novel type of odorant-binding protein from Anopheles gambiae, belonging to the C-plus class.
pubmed doi rcsb
source organism Anopheles gambiae
total genus 55
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2010-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.270 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 3pm2A00
3PM2A 4IJ7A 4KYNA
chains in the Genus database with same CATH superfamily
2M1KB 5BPJA 4WQ3A 2PYQA 3GOFA 4M2PA 4MRXA 1C7VA 1BF5A 2ZRTA 2GV5A 4PHMA 1UHIA 1DJWA 1QX7A 2NXQA 2WCLA 3DF0B 3DXLA 3R1OA 1S5GZ 3QRXA 1AK8A 2KLEA 2I18A 1SW8A 2JQ6A 1K94A 1DQEA 3RM1A 3DVJA 3OB1B 3OBVA 2Q91A 2JRFA 3JVTB 1QVIY 3EG5B 3DF0A 1EL4A 2RGIA 3D0YB 5ER4X 1A2XA 1S36A 1T14A 2JXCA 2EHBA 3F45A 5D7FA 4P5OE 3LL8B 2IS9A 4QJ3B 1G4YR 4ORAB 1CDNA 1GM0A 2KDHA 1CM4A 2KYFA 2LCPA 3D0YA 1DGVA 2ZNEA 2WOSA 1A29A 3VRPA 1IIOA 2KAXA 1WRLA 3JVTC 2L0PA 4GBAA 3RLZA 3S0DA 2P70A 1EG4A 1OOGA 4C0KA 5FI2A 2KI4B 3CR4X 1OE9B 3DVMA 3MSEB 3NGVA 4MEWA 1NYAA 1C3ZA 1KSMA 5F6TA 1IKUA 4MRYA 1FBVA 4MLWA 3CYZA 4INWA 2OPOA 1QLSA 2M3WA 3LK0A 1KFUL 3ZWHA 5HYDA 2E6WA 2KGRA 3C1VA 1DJHA 1OOHA 2H61A 1CTRA 1AJ5A 1QX2A 3FE6A 2KFFA 1WRKA 3OGNA 2KI4C 3I5GB 2KAYA 2JULA 1J7QA 5ER5A 2F3YA 2H61C 4HREE 2LE9B 1IJ5A 1B7TZ 2ERBA 2F3ZA 1BR4B 1MWNA 4OKHA 3D10A 2L5XB 3N7HA 1UWOA 1K9UA 1K95A 2BCXA 2KBIA 1TNWA 1OOFA 2JTZA 1FI5A 1JSAA 1S5GY 2PVBA 1Y1AA 4PT1A 3WHTB 1Y1UA 1AVSA 3CWGA 4NDBA 1KWOC 3DYEA 2CNPA 1DTLA 1YVHA 4C0JA 1OOIX 1CNPA 3SS5A 2WC6A 1KK7Y 4YGEB 1ZMZA 3A4UB 2PALA 4CFQA 2KNEA 3R1PA 1NIWA 1TWOA 2KI6C 3BQ3A 1HQVA 2QPTA 2F2PA 2I2RE 2F8PA 1OOJA 1BLQA 4CIDA 2QEHA 2JWWA 3EK4A 4BY4A 1QIWA 2PRUA 1SBJA 3CZ1A 1NPQA 1HT9A 1MUXA 1UP5A 3PSRA 1H8BA 2ZKMX 3S0GA 2KLDA 1LKJA 1MXLC 4INXA 3AAJA 2K2AA 1Q80A 3PM8A 1KQMB 2NCPA 2O5GA 2WCEA 4GNKB 4F0ZB 1TTXA 1JBAA 1ZOTB 3B7AA 1N0YA 2K7CA 3UO9A 1NX2A 1QVIZ 1NX1A 2QDIA 4A4BA 1SSEB 1QJTA 1BOCA 1XFRA 1XK4A 2FCDA 1DF0B 1KFXL 2ZN9A 1NCYA 4JD9A 1B7TY 3DY9A 3EVRA 1NCXA 3SIBA 3S0FA 1M39A 1XFUO 1BT6A 1S26D 4I5JA 4XYNA 4N1GA 1LS8A 4KYNA 2KFHA 1R6PA 2GTEA 1QATA 3NHIA 1DF0A 2LVVA 1BU3A 5JOLA 4CLNA 1KK8B 1MXEA 1CLBA 5KSZA 3PATA 3TUYC 1SL7A 4N5XA 2EC6B 4PALA 1BMOA 4YGBB 4M2OA 1F4OA 5AEQA 1CMFA 2WC5A 4Q04A 3NXAA 1F4QA 1G8IA 1WY9A 2NLNA 3BFAA 3PALA 1YVLA 1DJYA 1A03A 5AANA 1DMOA 3E3RA 1K9KA 2QACA 2L4IA 2WCHA 5HKWA 2L2CA 2JC2A 1SK6D 2DOQA 2JXLA 1IH0A 1SKTA 3WXAA 4AQJA 1LXFC 3OB2B 3CR5X 1SRAA 3IQOA 5TNCA 4CFRA 4PHNA 1IWQA 2PQLA 3I5HB 1XFXO 1KFUS 2OS8C 3SG6A 2ZNDA 4HRHA 4NDDA 3CZ2A 3TS5B 1QXPA 1XVJA 4MZKA 1F8HA 2H8VA 3O2PA 3K21A 4ORBB 1BODA 5KTYA 1H4BA 1LA3A 2LC5A 3BUNB 1TNPA 1TNQA 2Y1MA 3VGOA 2H2KA 3JTDB 2BKIB 3BJHA 3I5FB 3I5HC 2GGZA 1V1FA 4I5KA 1KK7Z 1UHJA 2K2FA 2MAZA 1JFKA 1SL9A 4GAOA 5HL1A 5HKYA 2LLTA 3I5IB 3B6XA 3Q8IA 1OW4A 1QIVA 5DICA 3B87A 2COLB 1XFYO 3OX5A 3LCPC 2K8MB 2L5YA 1K93D 2QEBA 3FE8A 1JWDA 4PE1A 3SJSA 1QLKA 2WCMA 1TUZA 4DCKA 1IQ5A 2Y1NA 1C7WA 2MJWB 3ZNIA 1SNLA 2BCBA 5I2OA 2LMUA 1S6CA 3DVEA 1ALWA 3TDIA 2KSPA 1DT7B 3CZ0A 3IF7A 5D3OA 2M9GA 1SR6B 2P71A 4AQIA 2YGUA 3BUXB 1JUOA 1CLLA 2FOTA 2SCPA 2WC8A 3EVVA 4PE7A 2BE4A 3AKBA 2LHIA 2PMYA 1QV0A 1RFJA 1F70A 3AAKA 2I94A 2L98A 1XA5A 4BY5A 3PJIA 2JNXA 3SIAA 1QV1A 2B1UA 3EKJA 3ICBA 3BXKA 1TNXA 5CSJA 5G08A 4U8DA 2AAOA 1RJVA 1YX7A 3BFBA 4I5NB 1J1EA 1DJIA 2BCAA 5FYXA 4ICBA 2BKHB 2L4HA 3LLEA 1UHKA 1PVBA 2LLUA 3EK7A 1PVAA 1TUJA 3OHMB 2BL0B 2CBLA 3BUWB 5HLVA 3S0AA 2HPSA 2NZ0A 1YX8A 2JU0A 3I5GC 1OQPA 1F55A 1JC2A 3CS1A 2F2OA 4ORCB 3BOWA 5CPVA 1OMRA 4JKTA 1GGWA 1IRJA 3TDZA 1TN4A 3CDNA 1BG1A 3H4SE 5DKRA 4CPVA 1QS7A 1JF2A 3PN7B 3CABA 2EGDA 3SG3A 3O4XA 2WCFA 3KO0A 3O6BA 1XFZO 3L4AA 1AUIB 2JNFA 4XJKB 2KYCA 3PFVA 4MSPA 3CZTX 4YGAA 5I8NA 4M2QA 1CB1A 2JT8A 1P28A 2LHLA 3EKHA 1EXRA 4IL1A 2KBMA 3VB1A 3KEVA 4XJKA 5CSNA 1R2UA 2K7DA 4OZDA 1CFDA 3NSLA 1IG5A 1Y6WA 4JWQA 2VRGA 3NSIA 3S0EA 1NWDA 4PE4A 3DZTA 2BAPA 1AJ4A 1IGVA 3OP0A 4NDCA 1ZACA 1CFPA 1KSOA 2KQYA 1GGZA 1LVCD 1L2OB 1N2DA 2JT3A 4GUKA 5FI6A 2LP2A 4C0LA 2CTNA 3GK1A 5DKQA 2MHHA 1KQMC 2CCMA 2WCKA 3FS7A 3PLFB 3R72A 3SG2A 1YRTB 2LUCA 2KFGA 1YTZC 2QEVA 2QEOA 2WORA 1XK4C 5CSIA 4YGCB 3FWBA 2WNDA 5EL2A 5FI7A 2LVKA 2M7NA 1YUSA 2KAVA 2WCBA 4TNCA 1Y1XA 3FE9A 1L2OC 3QMEA 1PSBA 3L47A 5B8IB 1QTXA 1GJYA 3DD4A 4JPZB 1SCMB 1OSAA 4GGFA 1B4CA 1IJ6A 1DVIA 2TN4A 3NSKA 1RROA 1DGUA 1Y0VH 1J1DA 2JTTA 2K7BA 3SG5A 5I94A 1OZSA 2KHNA 3L4LA 1K8UA 1J7OA 4L9MA 1W7IB 2LAPA 3GK4X 3CR2A 3O78A 1KK8C 3WHUB 1RTP1 3NHTA 3NSOA 1NUBA 2G9BA 4MVFA 1VRKA 1TIZA 3AKAA 4AOMA 2EC6C 5I2LA 1AP4A 2AUCA 1XYDA 1M46A 1MR8A 1WRZA 4MBEA 1F71A 2CXJA 2ZRSA 1DJGA 4PHKA 2OTGB 4OVNF 2JT0A 1CFFA 1FPWA 5HKZA 2LVJA 1TRFA 1CDMA 3BUMB 2G2BA 5HLOA 2KI6D 5I2QA 4GPLB 3BFHA 1U5IB 1DJZA 2MRDA 3DVKA 2WCJA 4N1FA 1CMGA 4HRGA 3O4YA 2KGBC 3TS5C 2M49B 1GQMA 1K9PA 2M7LA 1U5IA 5AFPA 2ISDA 5J3XA 2LP3A 2BNXA 2LV7A 2M8UA 3WNXB 3JTDC 1B9AA 1NSHA 2PSRA 3I5FC 4PE0A 1Z4HA 1BR1B 3I5IC 1MHOA 3CLNA 3FWCA 4PDZA 1UUSA 1SPYA 3VRRA 1CDLA 4OV2A 1C07A 1MF8B 2M1UA 3OX6A 4WQ2A 1FI6A 5PALA 1TOPA 4A4CA 1PULA 1CKKA 5IBWA 1CM1A 4GFTA 2MBXA 4R1EA 1B1GA 3V2LA 3TDUA 1NX0A 4DRWA 2MLFC 1LA0A 3TZ1A 3D74A 1K2HA 1S1EA 1SR6C 1BJFA 2JPOA 2KOTA 4F7FA 4MZLA 1D1OA 1MQ1A 1B47A 2R2IA 4OR9B 1K96A 3LK1A 2LLSA 1L7ZA 3PM2A 3GK2A 4YI8A 4E68A 1J7RA 1QX5B 1A75B 1TCFA 3SS3A 4MZJA 1M45A 3CTNA 4PHJA 4HSZA 3VRNA 1PSRA 3A8RA 3BOWB 1J7PA 1S3PA 1NX3A 1SCVA 1KFXS 4ETOA 1M31A 1A75A 1OMDA 4PCWA 1E8AA 1FW4A 2LUXA 3D75A 4DS7A 1YR5A 3IQQA 1SY9A 4YI9A 3SG4A 4WRIA 1NCZA 2BL0C 1WLZA 4NQGA 3BUOB 1A4PA 1AHRA 3KPXA 1KWOB 1SYMA 1XFWO 1DELA 2LMTA 3EVUA 2SASA 2LANA 1ORGA 3K1EA 3SS4A 1YURA 1ZUZA 2ZN8A 1TCOB 3S0BA 2L51A 2BE6A 2F33A 3D76A 3M0WA 2D8NA 1UURA 1ZFSA 1JF0A 1EJ3A 1RWYA 3PN7C 1V1GA 3SG7A 3B86A 1X02A 1M63B 2MLEC 4QJ4B 1OZOA 2BECA 2V53A 3D77A 3D78A 1PK0D 1EH2A 1WDCB 1YRUB 2HQWA 2K7OA 1ALVA 4FQOA 2LNKA 1CFCA 5D69A 1W7JB 2K60A 2P6BB 2FJYA 2JZIA 3IVTA 4YRUA 3RZSA 3FIAA 2GGMA 1LINA 3R1VA 1KCYA 1CDPA 1QASA 1QWVA 1WLMA 4D1EA 1F54A 1FF1A 2M29A 4YGDB 1WDCC 2M0RA 2LVIA 1PRWA 2PASA 3HX4A 1UHNA 3UNWA 1Z2CB 2LMVA 3B88A 1DEKA 2KPHA 5JJGA 2NCOA 1DC1A 1IQ3A 4MN0A 1C3YA 1B8RA 1KQVA 4DIRA 3CGAA 1SMGA 1OMVA 2HETA 5AERA 1W9ZA 3HCMA 4GGFC 2HQ8A 2JOJA 1ODBA 4ZCUA 4I5LB 4YBHB 5DKNA 5AXIA 1YUUA 2FJUB 1S6IA 1XFVO 1PALA 2O60A 4FTGA 1XO5A 3TUYB 1RECA 1UHHA 2JPTA 4USLA 3KF9A 1SCMC 1YUTA 3VROA 2K61A 3VRQA 2LM5A 1K90D 1SL8A 2CT9A 3EK8A 2I7AA 4FQTA 2Y5IA 4P2YB 2A4JA 1N65A 2L50A 1CLMA 2BBNA 4QJ5B 2M97A 1G33A 1EG3A 2BBMA 1J55A 1B8CA 5CSFA 2MA2A 2ZFDA 3D73A 4GGNA 4UPGA 5K89A 4JQ0D 2OS8B 2K0JA 1B8LA 4DUQA 3BYAA 4ZCVA 5KU1A 1RK9A 1S6JA 4IJ7A 2KQ6A 2HF5A 1DJXA 2E30A 2L2EA 4OCIA 1JFJA 2Q4UA 2AMIA 2OTGC 2FCEA 5GQQC 2Y4QA 1NP8A 3KHEA
chains in the Genus database with same CATH topology
4GBAA 4I5NB 4KYNA 2BNXA 5FI7A 3PM2A 3SS3A 1Z4HA 3KEVA 2KLDA 3UNWA 1Z2CB 5D3OA 1DEKA 5FI2A 2KLEA 1DC1A 4MEWA 2YGUA 3OBVA 3SS5A 3EG5B 2BAPA 4I5KA 1W9ZA 3UO9A 5I94A 4JKTA 5HL1A 4GAOA 4I5LB 4IJ7A 5FI6A 3O4XA 2K60A 2L5YA 3IVTA 1DELA 4I5JA 3SS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PM2 A;  4IJ7 A;  4KYN A; 
#chains in the Genus database with same CATH topology
 2M1K B;  5BPJ A;  4WQ3 A;  2PYQ A;  3GOF A;  4M2P A;  4MRX A;  1C7V A;  1BF5 A;  2ZRT A;  2GV5 A;  4PHM A;  1UHI A;  1DJW A;  1QX7 A;  2NXQ A;  2WCL A;  3DF0 B;  3DXL A;  3R1O A;  1S5G Z;  3QRX A;  1AK8 A;  2KLE A;  2I18 A;  1SW8 A;  2JQ6 A;  1K94 A;  1DQE A;  3RM1 A;  3DVJ A;  3OB1 B;  3OBV A;  2Q91 A;  2JRF A;  3JVT B;  1QVI Y;  3EG5 B;  3DF0 A;  1EL4 A;  2RGI A;  3D0Y B;  5ER4 X;  1A2X A;  1S36 A;  1T14 A;  2JXC A;  2EHB A;  3F45 A;  5D7F A;  4P5O E;  3LL8 B;  2IS9 A;  4QJ3 B;  1G4Y R;  4ORA B;  1CDN A;  1GM0 A;  2KDH A;  1CM4 A;  2KYF A;  2LCP A;  3D0Y A;  1DGV A;  2ZNE A;  2WOS A;  1A29 A;  3VRP A;  1IIO A;  2KAX A;  1WRL A;  3JVT C;  2L0P A;  4GBA A;  3RLZ A;  3S0D A;  2P70 A;  1EG4 A;  1OOG A;  4C0K A;  5FI2 A;  2KI4 B;  3CR4 X;  1OE9 B;  3DVM A;  3MSE B;  3NGV A;  4MEW A;  1NYA A;  1C3Z A;  1KSM A;  5F6T A;  1IKU A;  4MRY A;  1FBV A;  4MLW A;  3CYZ A;  4INW A;  2OPO A;  1QLS A;  2M3W A;  3LK0 A;  1KFU L;  3ZWH A;  5HYD A;  2E6W A;  2KGR A;  3C1V A;  1DJH A;  1OOH A;  2H61 A;  1CTR A;  1AJ5 A;  1QX2 A;  3FE6 A;  2KFF A;  1WRK A;  3OGN A;  2KI4 C;  3I5G B;  2KAY A;  2JUL A;  1J7Q A;  5ER5 A;  2F3Y A;  2H61 C;  4HRE E;  2LE9 B;  1IJ5 A;  1B7T Z;  2ERB A;  2F3Z A;  1BR4 B;  1MWN A;  4OKH A;  3D10 A;  2L5X B;  3N7H A;  1UWO A;  1K9U A;  1K95 A;  2BCX A;  2KBI A;  1TNW A;  1OOF A;  2JTZ A;  1FI5 A;  1JSA A;  1S5G Y;  2PVB A;  1Y1A A;  4PT1 A;  3WHT B;  1Y1U A;  1AVS A;  3CWG A;  4NDB A;  1KWO C;  3DYE A;  2CNP A;  1DTL A;  1YVH A;  4C0J A;  1OOI X;  1CNP A;  3SS5 A;  2WC6 A;  1KK7 Y;  4YGE B;  1ZMZ A;  3A4U B;  2PAL A;  4CFQ A;  2KNE A;  3R1P A;  1NIW A;  1TWO A;  2KI6 C;  3BQ3 A;  1HQV A;  2QPT A;  2F2P A;  2I2R E;  2F8P A;  1OOJ A;  1BLQ A;  4CID A;  2QEH A;  2JWW A;  3EK4 A;  4BY4 A;  1QIW A;  2PRU A;  1SBJ A;  3CZ1 A;  1NPQ A;  1HT9 A;  1MUX A;  1UP5 A;  3PSR A;  1H8B A;  2ZKM X;  3S0G A;  2KLD A;  1LKJ A;  1MXL C;  4INX A;  3AAJ A;  2K2A A;  1Q80 A;  3PM8 A;  1KQM B;  2NCP A;  2O5G A;  2WCE A;  4GNK B;  4F0Z B;  1TTX A;  1JBA A;  1ZOT B;  3B7A A;  1N0Y A;  2K7C A;  3UO9 A;  1NX2 A;  1QVI Z;  1NX1 A;  2QDI A;  4A4B A;  1SSE B;  1QJT A;  1BOC A;  1XFR A;  1XK4 A;  2FCD A;  1DF0 B;  1KFX L;  2ZN9 A;  1NCY A;  4JD9 A;  1B7T Y;  3DY9 A;  3EVR A;  1NCX A;  3SIB A;  3S0F A;  1M39 A;  1XFU O;  1BT6 A;  1S26 D;  4I5J A;  4XYN A;  4N1G A;  1LS8 A;  4KYN A;  2KFH A;  1R6P A;  2GTE A;  1QAT A;  3NHI A;  1DF0 A;  2LVV A;  1BU3 A;  5JOL A;  4CLN A;  1KK8 B;  1MXE A;  1CLB A;  5KSZ A;  3PAT A;  3TUY C;  1SL7 A;  4N5X A;  2EC6 B;  4PAL A;  1BMO A;  4YGB B;  4M2O A;  1F4O A;  5AEQ A;  1CMF A;  2WC5 A;  4Q04 A;  3NXA A;  1F4Q A;  1G8I A;  1WY9 A;  2NLN A;  3BFA A;  3PAL A;  1YVL A;  1DJY A;  1A03 A;  5AAN A;  1DMO A;  3E3R A;  1K9K A;  2QAC A;  2L4I A;  2WCH A;  5HKW A;  2L2C A;  2JC2 A;  1SK6 D;  2DOQ A;  2JXL A;  1IH0 A;  1SKT A;  3WXA A;  4AQJ A;  1LXF C;  3OB2 B;  3CR5 X;  1SRA A;  3IQO A;  5TNC A;  4CFR A;  4PHN A;  1IWQ A;  2PQL A;  3I5H B;  1XFX O;  1KFU S;  2OS8 C;  3SG6 A;  2ZND A;  4HRH A;  4NDD A;  3CZ2 A;  3TS5 B;  1QXP A;  1XVJ A;  4MZK A;  1F8H A;  2H8V A;  3O2P A;  3K21 A;  4ORB B;  1BOD A;  5KTY A;  1H4B A;  1LA3 A;  2LC5 A;  3BUN B;  1TNP A;  1TNQ A;  2Y1M A;  3VGO A;  2H2K A;  3JTD B;  2BKI B;  3BJH A;  3I5F B;  3I5H C;  2GGZ A;  1V1F A;  4I5K A;  1KK7 Z;  1UHJ A;  2K2F A;  2MAZ A;  1JFK A;  1SL9 A;  4GAO A;  5HL1 A;  5HKY A;  2LLT A;  3I5I B;  3B6X A;  3Q8I A;  1OW4 A;  1QIV A;  5DIC A;  3B87 A;  2COL B;  1XFY O;  3OX5 A;  3LCP C;  2K8M B;  2L5Y A;  1K93 D;  2QEB A;  3FE8 A;  1JWD A;  4PE1 A;  3SJS A;  1QLK A;  2WCM A;  1TUZ A;  4DCK A;  1IQ5 A;  2Y1N A;  1C7W A;  2MJW B;  3ZNI A;  1SNL A;  2BCB A;  5I2O A;  2LMU A;  1S6C A;  3DVE A;  1ALW A;  3TDI A;  2KSP A;  1DT7 B;  3CZ0 A;  3IF7 A;  5D3O A;  2M9G A;  1SR6 B;  2P71 A;  4AQI A;  2YGU A;  3BUX B;  1JUO A;  1CLL A;  2FOT A;  2SCP A;  2WC8 A;  3EVV A;  4PE7 A;  2BE4 A;  3AKB A;  2LHI A;  2PMY A;  1QV0 A;  1RFJ A;  1F70 A;  3AAK A;  2I94 A;  2L98 A;  1XA5 A;  4BY5 A;  3PJI A;  2JNX A;  3SIA A;  1QV1 A;  2B1U A;  3EKJ A;  3ICB A;  3BXK A;  1TNX A;  5CSJ A;  5G08 A;  4U8D A;  2AAO A;  1RJV A;  1YX7 A;  3BFB A;  4I5N B;  1J1E A;  1DJI A;  2BCA A;  5FYX A;  4ICB A;  2BKH B;  2L4H A;  3LLE A;  1UHK A;  1PVB A;  2LLU A;  3EK7 A;  1PVA A;  1TUJ A;  3OHM B;  2BL0 B;  2CBL A;  3BUW B;  5HLV A;  3S0A A;  2HPS A;  2NZ0 A;  1YX8 A;  2JU0 A;  3I5G C;  1OQP A;  1F55 A;  1JC2 A;  3CS1 A;  2F2O A;  4ORC B;  3BOW A;  5CPV A;  1OMR A;  4JKT A;  1GGW A;  1IRJ A;  3TDZ A;  1TN4 A;  3CDN A;  1BG1 A;  3H4S E;  5DKR A;  4CPV A;  1QS7 A;  1JF2 A;  3PN7 B;  3CAB A;  2EGD A;  3SG3 A;  3O4X A;  2WCF A;  3KO0 A;  3O6B A;  1XFZ O;  3L4A A;  1AUI B;  2JNF A;  4XJK B;  2KYC A;  3PFV A;  4MSP A;  3CZT X;  4YGA A;  5I8N A;  4M2Q A;  1CB1 A;  2JT8 A;  1P28 A;  2LHL A;  3EKH A;  1EXR A;  4IL1 A;  2KBM A;  3VB1 A;  3KEV A;  4XJK A;  5CSN A;  1R2U A;  2K7D A;  4OZD A;  1CFD A;  3NSL A;  1IG5 A;  1Y6W A;  4JWQ A;  2VRG A;  3NSI A;  3S0E A;  1NWD A;  4PE4 A;  3DZT A;  2BAP A;  1AJ4 A;  1IGV A;  3OP0 A;  4NDC A;  1ZAC A;  1CFP A;  1KSO A;  2KQY A;  1GGZ A;  1LVC D;  1L2O B;  1N2D A;  2JT3 A;  4GUK A;  5FI6 A;  2LP2 A;  4C0L A;  2CTN A;  3GK1 A;  5DKQ A;  2MHH A;  1KQM C;  2CCM A;  2WCK A;  3FS7 A;  3PLF B;  3R72 A;  3SG2 A;  1YRT B;  2LUC A;  2KFG A;  1YTZ C;  2QEV A;  2QEO A;  2WOR A;  1XK4 C;  5CSI A;  4YGC B;  3FWB A;  2WND A;  5EL2 A;  5FI7 A;  2LVK A;  2M7N A;  1YUS A;  2KAV A;  2WCB A;  4TNC A;  1Y1X A;  3FE9 A;  1L2O C;  3QME A;  1PSB A;  3L47 A;  5B8I B;  1QTX A;  1GJY A;  3DD4 A;  4JPZ B;  1SCM B;  1OSA A;  4GGF A;  1B4C A;  1IJ6 A;  1DVI A;  2TN4 A;  3NSK A;  1RRO A;  1DGU A;  1Y0V H;  1J1D A;  2JTT A;  2K7B A;  3SG5 A;  5I94 A;  1OZS A;  2KHN A;  3L4L A;  1K8U A;  1J7O A;  4L9M A;  1W7I B;  2LAP A;  3GK4 X;  3CR2 A;  3O78 A;  1KK8 C;  3WHU B;  1RTP 1;  3NHT A;  3NSO A;  1NUB A;  2G9B A;  4MVF A;  1VRK A;  1TIZ A;  3AKA A;  4AOM A;  2EC6 C;  5I2L A;  1AP4 A;  2AUC A;  1XYD A;  1M46 A;  1MR8 A;  1WRZ A;  4MBE A;  1F71 A;  2CXJ A;  2ZRS A;  1DJG A;  4PHK A;  2OTG B;  4OVN F;  2JT0 A;  1CFF A;  1FPW A;  5HKZ A;  2LVJ A;  1TRF A;  1CDM A;  3BUM B;  2G2B A;  5HLO A;  2KI6 D;  5I2Q A;  4GPL B;  3BFH A;  1U5I B;  1DJZ A;  2MRD A;  3DVK A;  2WCJ A;  4N1F A;  1CMG A;  4HRG A;  3O4Y A;  2KGB C;  3TS5 C;  2M49 B;  1GQM A;  1K9P A;  2M7L A;  1U5I A;  5AFP A;  2ISD A;  5J3X A;  2LP3 A;  2BNX A;  2LV7 A;  2M8U A;  3WNX B;  3JTD C;  1B9A A;  1NSH A;  2PSR A;  3I5F C;  4PE0 A;  1Z4H A;  1BR1 B;  3I5I C;  1MHO A;  3CLN A;  3FWC A;  4PDZ A;  1UUS A;  1SPY A;  3VRR A;  1CDL A;  4OV2 A;  1C07 A;  1MF8 B;  2M1U A;  3OX6 A;  4WQ2 A;  1FI6 A;  5PAL A;  1TOP A;  4A4C A;  1PUL A;  1CKK A;  5IBW A;  1CM1 A;  4GFT A;  2MBX A;  4R1E A;  1B1G A;  3V2L A;  3TDU A;  1NX0 A;  4DRW A;  2MLF C;  1LA0 A;  3TZ1 A;  3D74 A;  1K2H A;  1S1E A;  1SR6 C;  1BJF A;  2JPO A;  2KOT A;  4F7F A;  4MZL A;  1D1O A;  1MQ1 A;  1B47 A;  2R2I A;  4OR9 B;  1K96 A;  3LK1 A;  2LLS A;  1L7Z A;  3PM2 A;  3GK2 A;  4YI8 A;  4E68 A;  1J7R A;  1QX5 B;  1A75 B;  1TCF A;  3SS3 A;  4MZJ A;  1M45 A;  3CTN A;  4PHJ A;  4HSZ A;  3VRN A;  1PSR A;  3A8R A;  3BOW B;  1J7P A;  1S3P A;  1NX3 A;  1SCV A;  1KFX S;  4ETO A;  1M31 A;  1A75 A;  1OMD A;  4PCW A;  1E8A A;  1FW4 A;  2LUX A;  3D75 A;  4DS7 A;  1YR5 A;  3IQQ A;  1SY9 A;  4YI9 A;  3SG4 A;  4WRI A;  1NCZ A;  2BL0 C;  1WLZ A;  4NQG A;  3BUO B;  1A4P A;  1AHR A;  3KPX A;  1KWO B;  1SYM A;  1XFW O;  1DEL A;  2LMT A;  3EVU A;  2SAS A;  2LAN A;  1ORG A;  3K1E A;  3SS4 A;  1YUR A;  1ZUZ A;  2ZN8 A;  1TCO B;  3S0B A;  2L51 A;  2BE6 A;  2F33 A;  3D76 A;  3M0W A;  2D8N A;  1UUR A;  1ZFS A;  1JF0 A;  1EJ3 A;  1RWY A;  3PN7 C;  1V1G A;  3SG7 A;  3B86 A;  1X02 A;  1M63 B;  2MLE C;  4QJ4 B;  1OZO A;  2BEC A;  2V53 A;  3D77 A;  3D78 A;  1PK0 D;  1EH2 A;  1WDC B;  1YRU B;  2HQW A;  2K7O A;  1ALV A;  4FQO A;  2LNK A;  1CFC A;  5D69 A;  1W7J B;  2K60 A;  2P6B B;  2FJY A;  2JZI A;  3IVT A;  4YRU A;  3RZS A;  3FIA A;  2GGM A;  1LIN A;  3R1V A;  1KCY A;  1CDP A;  1QAS A;  1QWV A;  1WLM A;  4D1E A;  1F54 A;  1FF1 A;  2M29 A;  4YGD B;  1WDC C;  2M0R A;  2LVI A;  1PRW A;  2PAS A;  3HX4 A;  1UHN A;  3UNW A;  1Z2C B;  2LMV A;  3B88 A;  1DEK A;  2KPH A;  5JJG A;  2NCO A;  1DC1 A;  1IQ3 A;  4MN0 A;  1C3Y A;  1B8R A;  1KQV A;  4DIR A;  3CGA A;  1SMG A;  1OMV A;  2HET A;  5AER A;  1W9Z A;  3HCM A;  4GGF C;  2HQ8 A;  2JOJ A;  1ODB A;  4ZCU A;  4I5L B;  4YBH B;  5DKN A;  5AXI A;  1YUU A;  2FJU B;  1S6I A;  1XFV O;  1PAL A;  2O60 A;  4FTG A;  1XO5 A;  3TUY B;  1REC A;  1UHH A;  2JPT A;  4USL A;  3KF9 A;  1SCM C;  1YUT A;  3VRO A;  2K61 A;  3VRQ A;  2LM5 A;  1K90 D;  1SL8 A;  2CT9 A;  3EK8 A;  2I7A A;  4FQT A;  2Y5I A;  4P2Y B;  2A4J A;  1N65 A;  2L50 A;  1CLM A;  2BBN A;  4QJ5 B;  2M97 A;  1G33 A;  1EG3 A;  2BBM A;  1J55 A;  1B8C A;  5CSF A;  2MA2 A;  2ZFD A;  3D73 A;  4GGN A;  4UPG A;  5K89 A;  4JQ0 D;  2OS8 B;  2K0J A;  1B8L A;  4DUQ A;  3BYA A;  4ZCV A;  5KU1 A;  1RK9 A;  1S6J A;  4IJ7 A;  2KQ6 A;  2HF5 A;  1DJX A;  2E30 A;  2L2E A;  4OCI A;  1JFJ A;  2Q4U A;  2AMI A;  2OTG C;  2FCE A;  5GQQ C;  2Y4Q A;  1NP8 A;  3KHE A; 
#chains in the Genus database with same CATH homology
 4GBA A;  4I5N B;  4KYN A;  2BNX A;  5FI7 A;  3PM2 A;  3SS3 A;  1Z4H A;  3KEV A;  2KLD A;  3UNW A;  1Z2C B;  5D3O A;  1DEK A;  5FI2 A;  2KLE A;  1DC1 A;  4MEW A;  2YGU A;  3OBV A;  3SS5 A;  3EG5 B;  2BAP A;  4I5K A;  1W9Z A;  3UO9 A;  5I94 A;  4JKT A;  5HL1 A;  4GAO A;  4I5L B;  4IJ7 A;  5FI6 A;  3O4X A;  2K60 A;  2L5Y A;  3IVT A;  1DEL A;  4I5J A;  3SS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...