3PM2A

Crystal structure of a novel type of odorant binding protein from anopheles gambiae belonging to the c+ class
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
MDNPCLKGPPVPKNAAECCVTPFLVEPSAFMTCHSKWIGQTKRQMAMEGIPRGCCVAECVMNSTSLYSNGKIDREALTKLYLDSTKSMAPEWNKITLDAIDGCFKMADSIKDEIEAGAKLTPAFEGEQICHPISGTILACMGMTLFAECPAKLFTVNDDCNKLKSYHSKCPFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein (AGAP007287-PA)
publication title Crystal structure of a novel type of odorant-binding protein from Anopheles gambiae, belonging to the C-plus class.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 55
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2010-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.270 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 3pm2A00
4KYNA 4IJ7A 3PM2A
chains in the Genus database with same CATH superfamily
3JTDB 1RTP1 1BLQA 3O2PA 2BKIB 3K21A 2JWWA 2LLSA 1CKKA 1C3ZA 1QIVA 3EKJA 2KI6D 1M31A 1TUZA 2JULA 1FPWA 5FI6A 1CLMA 2KFGA 2OPOA 1IH0A 1SR6C 2JXCA 5AEQA 3TDIA 3BJHA 1B4CA 4ORCB 3JTDC 1UURA 2CT9A 1XFVO 1IQ3A 1AJ4A 1OOHA 2KBMA 2JPTA 3UO9A 1HQVA 1XFZO 1TNXA 1Q80A 1NUBA 2G9BA 3FE6A 2L50A 2KAYA 1Y1UA 1DF0B 3SG7A 1IQ5A 2WCBA 4GUKA 1K9UA 1ODBA 3EK4A 4PHKA 1OOIX 4YBHB 1J1EA 2JQ6A 3L4AA 4INXA 4DCKA 3S0AA 2M29A 3EK8A 1ALVA 2BE6A 1F71A 2ZN8A 2L5YA 3CYZA 2GGZA 5ER4X 4CFRA 2JZIA 5KSZA 3BFBA 3BOWA 2LC5A 1UUSA 3DYEA 2E30A 5AFPA 3B88A 2H61C 3D73A 2EGDA 2M3WA 1CM4A 2M1KB 2AAOA 1KFXL 1SNLA 3A4UB 1SYMA 2ISDA 1AJ5A 2JNXA 4AQJA 2I18A 3TUYB 3LL8B 3PJIA 1UP5A 2KAXA 3QRXA 4NDDA 1TCFA 4OKHA 1WRKA 1OSAA 5D3OA 1KFXS 2WCJA 1S5GZ 3RLZA 2KDHA 1KFUS 2L51A 2LHLA 2FCDA 2LE9B 3NSLA 3TUYC 1NCXA 1TIZA 1AVSA 3BFHA 4ICBA 1LKJA 2PMYA 3SG4A 1N2DA 3MSEB 2LVKA 3FIAA 4DUQA 4R1EA 1GQMA 1RFJA 4WQ2A 2BBNA 1S6IA 2GV5A 1SK6D 1M39A 3SG6A 3FS7A 4IJ7A 5I2LA 5I8NA 1AK8A 1NSHA 2EHBA 3D78A 3VRNA 3FWCA 3BXKA 4KYNA 1V1GA 3TDUA 4QJ4B 4JPZB 4GFTA 5TNCA 3S0FA 5CSNA 1DQEA 2CBLA 2K2FA 3F45A 5DKNA 4ZCUA 3V2LA 1T14A 2LCPA 1NX3A 5KU1A 1QX5B 1FBVA 2BECA 2KLDA 1QIWA 4OVNF 2JXLA 4PDZA 1QATA 1QTXA 3CZ0A 1BG1A 1NP8A 1CMGA 1XFYO 1YVLA 1XFWO 1XO5A 3L47A 1OMDA 4MRYA 1QV0A 4GGFC 3CS1A 4MN0A 1LS8A 5CSIA 2LV7A 3D0YA 1JC2A 4A4CA 3EVUA 3GK4X 3R72A 1MUXA 1TN4A 2WCKA 4MZJA 2CCMA 4PHMA 1B8RA 3PFVA 2Y1MA 2K7DA 2KOTA 4CIDA 1JBAA 1A29A 5DKRA 2FJUB 1S6JA 1A75A 3S0EA 1CFPA 2MRDA 2M0RA 3DZTA 2K0JA 4QJ3B 1DJXA 2SCPA 1SPYA 3LK0A 3VB1A 1BJFA 1PALA 3S0BA 2JTZA 1QWVA 2BE4A 1S5GY 2LVJA 1UHNA 2M8UA 2MAZA 1QV1A 1QLKA 2F3ZA 3VRQA 3CR4X 1QVIZ 1F4QA 1WLMA 2FOTA 3GK1A 4CLNA 2ZRTA 3LK1A 1JUOA 2L0PA 2HPSA 4XYNA 1CLLA 4C0LA 1CLBA 1H8BA 2FJYA 2K7BA 1J7QA 1TCOB 1BODA 1XYDA 1NPQA 1Z4HA 3OP0A 2WC6A 1MQ1A 1K90D 2WORA 3E3RA 2BL0C 2F33A 4F7FA 3KPXA 1SR6B 1B7TY 1QLSA 2AUCA 2JU0A 3AAKA 4PHJA 1E8AA 1WY9A 3RZSA 1PK0D 2KPHA 3CR5X 3I5IC 5HLOA 3EVVA 1G8IA 1KCYA 1K94A 1K95A 1MXLC 1UHKA 3PATA 1ORGA 4P2YB 5AXIA 1DC1A 2WCLA 1IJ6A 5KTYA 1Y1AA 1DEKA 1AHRA 1K9PA 3LLEA 4IL1A 1SBJA 1CFCA 1XA5A 2LANA 5CPVA 2JT8A 1F54A 2B1UA 1JF2A 2P71A 1TWOA 1SKTA 2BCAA 1MR8A 3BYAA 4HRHA 3WNXB 2KI6C 3NHTA 1FW4A 1GGWA 3IF7A 1DJGA 4PE1A 3D10A 1YR5A 1TOPA 2K7CA 1C7VA 2F3YA 3NSOA 4MZKA 3R1PA 3ZNIA 1IIOA 3I5FB 1PVBA 2ZFDA 1YRUB 1YUSA 1ZACA 3SS5A 4D1EA 1YUUA 1B8LA 1SL7A 3KEVA 2LNKA 2O60A 2CXJA 1XK4A 1B1GA 1DF0A 3BQ3A 3NGVA 3OBVA 4MBEA 3RM1A 4YGAA 2F8PA 2M97A 1DVIA 3AKAA 2IS9A 1KQVA 3NXAA 2V53A 2MLEC 1SL9A 1F8HA 2KQYA 3EVRA 4MRXA 1WRLA 2MHHA 3KF9A 3I5FC 3S0GA 4JWQA 1KFUL 2KFFA 2KHNA 5I2OA 3AKBA 2JT0A 1KK7Y 1IJ5A 4OCIA 2M9GA 1QS7A 3AAJA 1RWYA 1DELA 1WDCB 3VROA 4C0JA 1DT7B 3B6XA 3GOFA 4BY4A 2PASA 1BU3A 2NCPA 1N65A 3I5HB 1NCYA 5HL1A 2LMUA 2WCMA 1WDCC 3BFAA 1B47A 2M7NA 5JOLA 1CM1A 5I94A 1J7PA 1F55A 3B7AA 4OR9B 1W9ZA 3HCMA 1LA0A 3WXAA 1SRAA 4UPGA 3CZ2A 4FQOA 4A4BA 1FI6A 3I5HC 3OB2B 4DS7A 1IWQA 1X02A 2HQWA 3OX5A 5HKYA 1OOJA 4GAOA 4I5JA 2E6WA 4N5XA 5HLVA 1U5IA 1RECA 2BNXA 2CTNA 5F6TA 2A4JA 1A4PA 2FCEA 3DVMA 4WQ3A 5FYXA 1G33A 4NDBA 3ZWHA 1IRJA 2NCOA 3DVEA 4PALA 2WCFA 3BUNB 3SG5A 1Y1XA 1J55A 2JOJA 2WCHA 2PALA 1KSMA 2LAPA 3DY9A 3IQOA 1ZMZA 5AANA 1BOCA 2NXQA 3SIAA 1M45A 4L9MA 2ZRSA 4GGNA 1BF5A 1K2HA 3NHIA 2QACA 2LVIA 1NYAA 1SSEB 5DKQA 2I94A 1NIWA 2O5GA 1G4YR 2L98A 4FTGA 1OZSA 1XFUO 1IG5A 4GNKB 4XJKA 1GGZA 4USLA 1IGVA 1W7JB 3KHEA 1J1DA 1BR1B 2PQLA 1XFRA 4MVFA 1JFJA 1PSBA 3CWGA 3SS4A 4YI9A 3BUMB 2BAPA 1EXRA 1CNPA 1K96A 2P70A 1BT6A 2HF5A 3PLFB 2PSRA 3B87A 1IKUA 2H2KA 3C1VA 1DJHA 3DD4A 4MEWA 2K8MB 3PN7C 4P5OE 2BL0B 5HYDA 2LMVA 2ERBA 4YGBB 2I7AA 2OTGB 2NLNA 4HSZA 1ZFSA 3ICBA 3VGOA 2MJWB 4DRWA 3UNWA 2BKHB 3I5IB 3DF0A 3PM8A 2BCBA 1MHOA 3IQQA 4JD9A 3SG3A 1D1OA 4N1FA 3PM2A 3SIBA 2PRUA 2QEBA 4ORBB 1SCMC 2OTGC 3OB1B 2LHIA 4ORAB 3B86A 5EL2A 5GQQC 3EK7A 1C07A 1OMRA 1S26D 3TZ1A 2KGRA 1TRFA 1EH2A 1FI5A 3DVKA 1R6PA 1NX1A 1JF0A 1MWNA 1OMVA 3CR2A 4I5NB 2JPOA 2P6BB 1AUIB 2JTTA 4FQTA 4PE0A 3FE8A 1LINA 2Q91A 1Z2CB 1DJWA 1DGVA 1QJTA 3L4LA 4ETOA 3A8RA 3N7HA 1SCVA 4JKTA 2F2OA 2JC2A 4GBAA 1UHHA 3CABA 2M1UA 1K9KA 2LP2A 1KWOC 1OW4A 4M2OA 1OOGA 2SASA 1XFXO 1PSRA 1NX0A 3CGAA 3LCPC 4M2PA 1W7IB 1L2OC 3O4YA 3PALA 5D69A 1CTRA 4OV2A 5HKWA 1ZUZA 1N0YA 1PVAA 2ZKMX 2LVVA 1QX2A 1CMFA 4I5LB 3D76A 1NCZA 2KQ6A 1EG4A 1DJIA 5CSJA 1JWDA 2JNFA 3SG2A 1UHIA 3CDNA 2JT3A 3OGNA 2LMTA 1TNQA 1YX7A 2WC8A 1H4BA 1SY9A 1VRKA 1ZOTB 2Y1NA 3OX6A 4NQGA 1M63B 3BOWB 1K93D 2M49B 1NWDA 1QVIY 2LUXA 1TNPA 1L7ZA 2L2EA 1NX2A 2H61A 1TUJA 3CZTX 1P28A 2WC5A 1R2UA 2YGUA 1EG3A 2KBIA 3NSIA 2KAVA 2TN4A 1V1FA 2DOQA 3O6BA 1ALWA 1WLZA 2QDIA 1PULA 3R1OA 2K60A 1KK8B 4JQ0D 2R2IA 4E68A 1XK4C 2KNEA 2LLUA 1YVHA 4ZCVA 2Q4UA 4GPLB 1B9AA 2CNPA 2H8VA 3O4XA 1Y0VH 2QEOA 1CDMA 4U8DA 5D7FA 3DXLA 2LLTA 3SS3A 1C3YA 1RK9A 3VRPA 5ER5A 3Q8IA 2BBMA 1CDPA 1LXFC 2L5XB 3EG5B 3S0DA 3WHTB 1KK8C 2LUCA 4PT1A 4AOMA 5JJGA 1Y6WA 5I2QA 1OE9B 2AMIA 3KO0A 4MLWA 1BR4B 1K8UA 1CDLA 1KQMB 1MXEA 1XVJA 5DICA 2LM5A 2EC6B 3FE9A 5J3XA 4C0KA 1OZOA 2OS8B 2WNDA 3FWBA 3H4SE 3JVTB 2MBXA 2HQ8A 4YRUA 5IBWA 1F70A 2F2PA 3BUXB 2I2RE 4MSPA 3CLNA 1DJZA 5BPJA 1SL8A 1AP4A 1QX7A 1UWOA 4YI8A 3GK2A 2M7LA 1KQMC 2MLFC 3TS5B 3M0WA 2EC6C 4CFQA 2BCXA 3WHUB 1U5IB 2LP3A 2MA2A 1RROA 2OS8C 2VRGA 3D75A 3JVTC 3PSRA 2K7OA 3R1VA 1F4OA 2KFHA 4PE4A 5FI7A 5G08A 1TNWA 2RGIA 4AQIA 2KI4B 2KYCA 1SMGA 1YRTB 2D8NA 1JFKA 3TS5C 1B7TZ 3BUOB 3DVJA 1DJYA 4HREE 1HT9A 1GJYA 3TDZA 4GGFA 1CFDA 1TTXA 3NSKA 1B8CA 1DGUA 2L4IA 2KGBC 5HKZA 1DMOA 2L4HA 3D0YB 1J7RA 5AERA 1MF8B 4HRGA 1S3PA 2KI4C 3QMEA 1BMOA 2GTEA 3PN7B 1S1EA 2PYQA 4XJKB 5K89A 4YGEB 2WCEA 2WOSA 5B8IB 1S36A 4Q04A 1QASA 1YTZC 5CSFA 3O78A 4INWA 4MZLA 1A75B 1KSOA 1PRWA 1QXPA 2JRFA 2ZNEA 1C7WA 4QJ5B 3D74A 5FI2A 1J7OA 2NZ0A 1M46A 1SCMB 3D77A 1GM0A 1EL4A 1RJVA 1SW8A 2K61A 2K2AA 1YUTA 1CDNA 1FF1A 2QPTA 2COLB 2Y4QA 1CB1A 4CPVA 2Y5IA 1A2XA 2HETA 3DF0B 1DTLA 3IVTA 1S6CA 2QEVA 1JSAA 3OHMB 4PE7A 3HX4A 4OZDA 5PALA 1CFFA 2PVBA 1YX8A 3CZ1A 3I5GB 2KLEA 1YURA 4WRIA 1A03A 2KSPA 4YGCB 2ZN9A 1WRZA 1KK7Z 3K1EA 1KWOB 2GGMA 2QEHA 4I5KA 1LVCD 1L2OB 1LA3A 2ZNDA 3EKHA 3VRRA 4DIRA 4N1GA 3CTNA 4M2QA 4NDCA 2G2BA 4YGDB 4BY5A 4F0ZB 1OQPA 3I5GC 3BUWB 2L2CA 1OOFA 2KYFA 4PHNA 4PCWA 3SJSA 1UHJA 4TNCA 1EJ3A
chains in the Genus database with same CATH topology
1DELA 2BNXA 5D3OA 3IVTA 3SS4A 2KLDA 2BAPA 2K60A 4I5LB 1DC1A 2L5YA 1DEKA 4I5NB 5FI6A 5HL1A 3O4XA 2KLEA 4MEWA 3SS5A 3SS3A 3KEVA 5FI2A 4GAOA 5FI7A 3EG5B 1Z2CB 3OBVA 5I94A 4IJ7A 4I5KA 3UO9A 1W9ZA 3UNWA 4JKTA 4KYNA 4GBAA 1Z4HA 3PM2A 2YGUA 4I5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KYN A;  4IJ7 A;  3PM2 A; 
#chains in the Genus database with same CATH topology
 3JTD B;  1RTP 1;  1BLQ A;  3O2P A;  2BKI B;  3K21 A;  2JWW A;  2LLS A;  1CKK A;  1C3Z A;  1QIV A;  3EKJ A;  2KI6 D;  1M31 A;  1TUZ A;  2JUL A;  1FPW A;  5FI6 A;  1CLM A;  2KFG A;  2OPO A;  1IH0 A;  1SR6 C;  2JXC A;  5AEQ A;  3TDI A;  3BJH A;  1B4C A;  4ORC B;  3JTD C;  1UUR A;  2CT9 A;  1XFV O;  1IQ3 A;  1AJ4 A;  1OOH A;  2KBM A;  2JPT A;  3UO9 A;  1HQV A;  1XFZ O;  1TNX A;  1Q80 A;  1NUB A;  2G9B A;  3FE6 A;  2L50 A;  2KAY A;  1Y1U A;  1DF0 B;  3SG7 A;  1IQ5 A;  2WCB A;  4GUK A;  1K9U A;  1ODB A;  3EK4 A;  4PHK A;  1OOI X;  4YBH B;  1J1E A;  2JQ6 A;  3L4A A;  4INX A;  4DCK A;  3S0A A;  2M29 A;  3EK8 A;  1ALV A;  2BE6 A;  1F71 A;  2ZN8 A;  2L5Y A;  3CYZ A;  2GGZ A;  5ER4 X;  4CFR A;  2JZI A;  5KSZ A;  3BFB A;  3BOW A;  2LC5 A;  1UUS A;  3DYE A;  2E30 A;  5AFP A;  3B88 A;  2H61 C;  3D73 A;  2EGD A;  2M3W A;  1CM4 A;  2M1K B;  2AAO A;  1KFX L;  1SNL A;  3A4U B;  1SYM A;  2ISD A;  1AJ5 A;  2JNX A;  4AQJ A;  2I18 A;  3TUY B;  3LL8 B;  3PJI A;  1UP5 A;  2KAX A;  3QRX A;  4NDD A;  1TCF A;  4OKH A;  1WRK A;  1OSA A;  5D3O A;  1KFX S;  2WCJ A;  1S5G Z;  3RLZ A;  2KDH A;  1KFU S;  2L51 A;  2LHL A;  2FCD A;  2LE9 B;  3NSL A;  3TUY C;  1NCX A;  1TIZ A;  1AVS A;  3BFH A;  4ICB A;  1LKJ A;  2PMY A;  3SG4 A;  1N2D A;  3MSE B;  2LVK A;  3FIA A;  4DUQ A;  4R1E A;  1GQM A;  1RFJ A;  4WQ2 A;  2BBN A;  1S6I A;  2GV5 A;  1SK6 D;  1M39 A;  3SG6 A;  3FS7 A;  4IJ7 A;  5I2L A;  5I8N A;  1AK8 A;  1NSH A;  2EHB A;  3D78 A;  3VRN A;  3FWC A;  3BXK A;  4KYN A;  1V1G A;  3TDU A;  4QJ4 B;  4JPZ B;  4GFT A;  5TNC A;  3S0F A;  5CSN A;  1DQE A;  2CBL A;  2K2F A;  3F45 A;  5DKN A;  4ZCU A;  3V2L A;  1T14 A;  2LCP A;  1NX3 A;  5KU1 A;  1QX5 B;  1FBV A;  2BEC A;  2KLD A;  1QIW A;  4OVN F;  2JXL A;  4PDZ A;  1QAT A;  1QTX A;  3CZ0 A;  1BG1 A;  1NP8 A;  1CMG A;  1XFY O;  1YVL A;  1XFW O;  1XO5 A;  3L47 A;  1OMD A;  4MRY A;  1QV0 A;  4GGF C;  3CS1 A;  4MN0 A;  1LS8 A;  5CSI A;  2LV7 A;  3D0Y A;  1JC2 A;  4A4C A;  3EVU A;  3GK4 X;  3R72 A;  1MUX A;  1TN4 A;  2WCK A;  4MZJ A;  2CCM A;  4PHM A;  1B8R A;  3PFV A;  2Y1M A;  2K7D A;  2KOT A;  4CID A;  1JBA A;  1A29 A;  5DKR A;  2FJU B;  1S6J A;  1A75 A;  3S0E A;  1CFP A;  2MRD A;  2M0R A;  3DZT A;  2K0J A;  4QJ3 B;  1DJX A;  2SCP A;  1SPY A;  3LK0 A;  3VB1 A;  1BJF A;  1PAL A;  3S0B A;  2JTZ A;  1QWV A;  2BE4 A;  1S5G Y;  2LVJ A;  1UHN A;  2M8U A;  2MAZ A;  1QV1 A;  1QLK A;  2F3Z A;  3VRQ A;  3CR4 X;  1QVI Z;  1F4Q A;  1WLM A;  2FOT A;  3GK1 A;  4CLN A;  2ZRT A;  3LK1 A;  1JUO A;  2L0P A;  2HPS A;  4XYN A;  1CLL A;  4C0L A;  1CLB A;  1H8B A;  2FJY A;  2K7B A;  1J7Q A;  1TCO B;  1BOD A;  1XYD A;  1NPQ A;  1Z4H A;  3OP0 A;  2WC6 A;  1MQ1 A;  1K90 D;  2WOR A;  3E3R A;  2BL0 C;  2F33 A;  4F7F A;  3KPX A;  1SR6 B;  1B7T Y;  1QLS A;  2AUC A;  2JU0 A;  3AAK A;  4PHJ A;  1E8A A;  1WY9 A;  3RZS A;  1PK0 D;  2KPH A;  3CR5 X;  3I5I C;  5HLO A;  3EVV A;  1G8I A;  1KCY A;  1K94 A;  1K95 A;  1MXL C;  1UHK A;  3PAT A;  1ORG A;  4P2Y B;  5AXI A;  1DC1 A;  2WCL A;  1IJ6 A;  5KTY A;  1Y1A A;  1DEK A;  1AHR A;  1K9P A;  3LLE A;  4IL1 A;  1SBJ A;  1CFC A;  1XA5 A;  2LAN A;  5CPV A;  2JT8 A;  1F54 A;  2B1U A;  1JF2 A;  2P71 A;  1TWO A;  1SKT A;  2BCA A;  1MR8 A;  3BYA A;  4HRH A;  3WNX B;  2KI6 C;  3NHT A;  1FW4 A;  1GGW A;  3IF7 A;  1DJG A;  4PE1 A;  3D10 A;  1YR5 A;  1TOP A;  2K7C A;  1C7V A;  2F3Y A;  3NSO A;  4MZK A;  3R1P A;  3ZNI A;  1IIO A;  3I5F B;  1PVB A;  2ZFD A;  1YRU B;  1YUS A;  1ZAC A;  3SS5 A;  4D1E A;  1YUU A;  1B8L A;  1SL7 A;  3KEV A;  2LNK A;  2O60 A;  2CXJ A;  1XK4 A;  1B1G A;  1DF0 A;  3BQ3 A;  3NGV A;  3OBV A;  4MBE A;  3RM1 A;  4YGA A;  2F8P A;  2M97 A;  1DVI A;  3AKA A;  2IS9 A;  1KQV A;  3NXA A;  2V53 A;  2MLE C;  1SL9 A;  1F8H A;  2KQY A;  3EVR A;  4MRX A;  1WRL A;  2MHH A;  3KF9 A;  3I5F C;  3S0G A;  4JWQ A;  1KFU L;  2KFF A;  2KHN A;  5I2O A;  3AKB A;  2JT0 A;  1KK7 Y;  1IJ5 A;  4OCI A;  2M9G A;  1QS7 A;  3AAJ A;  1RWY A;  1DEL A;  1WDC B;  3VRO A;  4C0J A;  1DT7 B;  3B6X A;  3GOF A;  4BY4 A;  2PAS A;  1BU3 A;  2NCP A;  1N65 A;  3I5H B;  1NCY A;  5HL1 A;  2LMU A;  2WCM A;  1WDC C;  3BFA A;  1B47 A;  2M7N A;  5JOL A;  1CM1 A;  5I94 A;  1J7P A;  1F55 A;  3B7A A;  4OR9 B;  1W9Z A;  3HCM A;  1LA0 A;  3WXA A;  1SRA A;  4UPG A;  3CZ2 A;  4FQO A;  4A4B A;  1FI6 A;  3I5H C;  3OB2 B;  4DS7 A;  1IWQ A;  1X02 A;  2HQW A;  3OX5 A;  5HKY A;  1OOJ A;  4GAO A;  4I5J A;  2E6W A;  4N5X A;  5HLV A;  1U5I A;  1REC A;  2BNX A;  2CTN A;  5F6T A;  2A4J A;  1A4P A;  2FCE A;  3DVM A;  4WQ3 A;  5FYX A;  1G33 A;  4NDB A;  3ZWH A;  1IRJ A;  2NCO A;  3DVE A;  4PAL A;  2WCF A;  3BUN B;  3SG5 A;  1Y1X A;  1J55 A;  2JOJ A;  2WCH A;  2PAL A;  1KSM A;  2LAP A;  3DY9 A;  3IQO A;  1ZMZ A;  5AAN A;  1BOC A;  2NXQ A;  3SIA A;  1M45 A;  4L9M A;  2ZRS A;  4GGN A;  1BF5 A;  1K2H A;  3NHI A;  2QAC A;  2LVI A;  1NYA A;  1SSE B;  5DKQ A;  2I94 A;  1NIW A;  2O5G A;  1G4Y R;  2L98 A;  4FTG A;  1OZS A;  1XFU O;  1IG5 A;  4GNK B;  4XJK A;  1GGZ A;  4USL A;  1IGV A;  1W7J B;  3KHE A;  1J1D A;  1BR1 B;  2PQL A;  1XFR A;  4MVF A;  1JFJ A;  1PSB A;  3CWG A;  3SS4 A;  4YI9 A;  3BUM B;  2BAP A;  1EXR A;  1CNP A;  1K96 A;  2P70 A;  1BT6 A;  2HF5 A;  3PLF B;  2PSR A;  3B87 A;  1IKU A;  2H2K A;  3C1V A;  1DJH A;  3DD4 A;  4MEW A;  2K8M B;  3PN7 C;  4P5O E;  2BL0 B;  5HYD A;  2LMV A;  2ERB A;  4YGB B;  2I7A A;  2OTG B;  2NLN A;  4HSZ A;  1ZFS A;  3ICB A;  3VGO A;  2MJW B;  4DRW A;  3UNW A;  2BKH B;  3I5I B;  3DF0 A;  3PM8 A;  2BCB A;  1MHO A;  3IQQ A;  4JD9 A;  3SG3 A;  1D1O A;  4N1F A;  3PM2 A;  3SIB A;  2PRU A;  2QEB A;  4ORB B;  1SCM C;  2OTG C;  3OB1 B;  2LHI A;  4ORA B;  3B86 A;  5EL2 A;  5GQQ C;  3EK7 A;  1C07 A;  1OMR A;  1S26 D;  3TZ1 A;  2KGR A;  1TRF A;  1EH2 A;  1FI5 A;  3DVK A;  1R6P A;  1NX1 A;  1JF0 A;  1MWN A;  1OMV A;  3CR2 A;  4I5N B;  2JPO A;  2P6B B;  1AUI B;  2JTT A;  4FQT A;  4PE0 A;  3FE8 A;  1LIN A;  2Q91 A;  1Z2C B;  1DJW A;  1DGV A;  1QJT A;  3L4L A;  4ETO A;  3A8R A;  3N7H A;  1SCV A;  4JKT A;  2F2O A;  2JC2 A;  4GBA A;  1UHH A;  3CAB A;  2M1U A;  1K9K A;  2LP2 A;  1KWO C;  1OW4 A;  4M2O A;  1OOG A;  2SAS A;  1XFX O;  1PSR A;  1NX0 A;  3CGA A;  3LCP C;  4M2P A;  1W7I B;  1L2O C;  3O4Y A;  3PAL A;  5D69 A;  1CTR A;  4OV2 A;  5HKW A;  1ZUZ A;  1N0Y A;  1PVA A;  2ZKM X;  2LVV A;  1QX2 A;  1CMF A;  4I5L B;  3D76 A;  1NCZ A;  2KQ6 A;  1EG4 A;  1DJI A;  5CSJ A;  1JWD A;  2JNF A;  3SG2 A;  1UHI A;  3CDN A;  2JT3 A;  3OGN A;  2LMT A;  1TNQ A;  1YX7 A;  2WC8 A;  1H4B A;  1SY9 A;  1VRK A;  1ZOT B;  2Y1N A;  3OX6 A;  4NQG A;  1M63 B;  3BOW B;  1K93 D;  2M49 B;  1NWD A;  1QVI Y;  2LUX A;  1TNP A;  1L7Z A;  2L2E A;  1NX2 A;  2H61 A;  1TUJ A;  3CZT X;  1P28 A;  2WC5 A;  1R2U A;  2YGU A;  1EG3 A;  2KBI A;  3NSI A;  2KAV A;  2TN4 A;  1V1F A;  2DOQ A;  3O6B A;  1ALW A;  1WLZ A;  2QDI A;  1PUL A;  3R1O A;  2K60 A;  1KK8 B;  4JQ0 D;  2R2I A;  4E68 A;  1XK4 C;  2KNE A;  2LLU A;  1YVH A;  4ZCV A;  2Q4U A;  4GPL B;  1B9A A;  2CNP A;  2H8V A;  3O4X A;  1Y0V H;  2QEO A;  1CDM A;  4U8D A;  5D7F A;  3DXL A;  2LLT A;  3SS3 A;  1C3Y A;  1RK9 A;  3VRP A;  5ER5 A;  3Q8I A;  2BBM A;  1CDP A;  1LXF C;  2L5X B;  3EG5 B;  3S0D A;  3WHT B;  1KK8 C;  2LUC A;  4PT1 A;  4AOM A;  5JJG A;  1Y6W A;  5I2Q A;  1OE9 B;  2AMI A;  3KO0 A;  4MLW A;  1BR4 B;  1K8U A;  1CDL A;  1KQM B;  1MXE A;  1XVJ A;  5DIC A;  2LM5 A;  2EC6 B;  3FE9 A;  5J3X A;  4C0K A;  1OZO A;  2OS8 B;  2WND A;  3FWB A;  3H4S E;  3JVT B;  2MBX A;  2HQ8 A;  4YRU A;  5IBW A;  1F70 A;  2F2P A;  3BUX B;  2I2R E;  4MSP A;  3CLN A;  1DJZ A;  5BPJ A;  1SL8 A;  1AP4 A;  1QX7 A;  1UWO A;  4YI8 A;  3GK2 A;  2M7L A;  1KQM C;  2MLF C;  3TS5 B;  3M0W A;  2EC6 C;  4CFQ A;  2BCX A;  3WHU B;  1U5I B;  2LP3 A;  2MA2 A;  1RRO A;  2OS8 C;  2VRG A;  3D75 A;  3JVT C;  3PSR A;  2K7O A;  3R1V A;  1F4O A;  2KFH A;  4PE4 A;  5FI7 A;  5G08 A;  1TNW A;  2RGI A;  4AQI A;  2KI4 B;  2KYC A;  1SMG A;  1YRT B;  2D8N A;  1JFK A;  3TS5 C;  1B7T Z;  3BUO B;  3DVJ A;  1DJY A;  4HRE E;  1HT9 A;  1GJY A;  3TDZ A;  4GGF A;  1CFD A;  1TTX A;  3NSK A;  1B8C A;  1DGU A;  2L4I A;  2KGB C;  5HKZ A;  1DMO A;  2L4H A;  3D0Y B;  1J7R A;  5AER A;  1MF8 B;  4HRG A;  1S3P A;  2KI4 C;  3QME A;  1BMO A;  2GTE A;  3PN7 B;  1S1E A;  2PYQ A;  4XJK B;  5K89 A;  4YGE B;  2WCE A;  2WOS A;  5B8I B;  1S36 A;  4Q04 A;  1QAS A;  1YTZ C;  5CSF A;  3O78 A;  4INW A;  4MZL A;  1A75 B;  1KSO A;  1PRW A;  1QXP A;  2JRF A;  2ZNE A;  1C7W A;  4QJ5 B;  3D74 A;  5FI2 A;  1J7O A;  2NZ0 A;  1M46 A;  1SCM B;  3D77 A;  1GM0 A;  1EL4 A;  1RJV A;  1SW8 A;  2K61 A;  2K2A A;  1YUT A;  1CDN A;  1FF1 A;  2QPT A;  2COL B;  2Y4Q A;  1CB1 A;  4CPV A;  2Y5I A;  1A2X A;  2HET A;  3DF0 B;  1DTL A;  3IVT A;  1S6C A;  2QEV A;  1JSA A;  3OHM B;  4PE7 A;  3HX4 A;  4OZD A;  5PAL A;  1CFF A;  2PVB A;  1YX8 A;  3CZ1 A;  3I5G B;  2KLE A;  1YUR A;  4WRI A;  1A03 A;  2KSP A;  4YGC B;  2ZN9 A;  1WRZ A;  1KK7 Z;  3K1E A;  1KWO B;  2GGM A;  2QEH A;  4I5K A;  1LVC D;  1L2O B;  1LA3 A;  2ZND A;  3EKH A;  3VRR A;  4DIR A;  4N1G A;  3CTN A;  4M2Q A;  4NDC A;  2G2B A;  4YGD B;  4BY5 A;  4F0Z B;  1OQP A;  3I5G C;  3BUW B;  2L2C A;  1OOF A;  2KYF A;  4PHN A;  4PCW A;  3SJS A;  1UHJ A;  4TNC A;  1EJ3 A; 
#chains in the Genus database with same CATH homology
 1DEL A;  2BNX A;  5D3O A;  3IVT A;  3SS4 A;  2KLD A;  2BAP A;  2K60 A;  4I5L B;  1DC1 A;  2L5Y A;  1DEK A;  4I5N B;  5FI6 A;  5HL1 A;  3O4X A;  2KLE A;  4MEW A;  3SS5 A;  3SS3 A;  3KEV A;  5FI2 A;  4GAO A;  5FI7 A;  3EG5 B;  1Z2C B;  3OBV A;  5I94 A;  4IJ7 A;  4I5K A;  3UO9 A;  1W9Z A;  3UNW A;  4JKT A;  4KYN A;  4GBA A;  1Z4H A;  3PM2 A;  2YGU A;  4I5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...