3PM2A

Crystal structure of a novel type of odorant binding protein from anopheles gambiae belonging to the c+ class
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
MDNPCLKGPPVPKNAAECCVTPFLVEPSAFMTCHSKWIGQTKRQMAMEGIPRGCCVAECVMNSTSLYSNGKIDREALTKLYLDSTKSMAPEWNKITLDAIDGCFKMADSIKDEIEAGAKLTPAFEGEQICHPISGTILACMGMTLFAECPAKLFTVNDDCNKLKSYHSKCPFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein (AGAP007287-PA)
publication title Crystal structure of a novel type of odorant-binding protein from Anopheles gambiae, belonging to the C-plus class.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 55
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2010-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.270 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 3pm2A00
4KYNA 4IJ7A 3PM2A
chains in the Genus database with same CATH superfamily
1XO5A 2BCAA 1CM4A 1KQVA 3PJIA 3QMEA 1BG1A 2KSPA 4NDCA 1MQ1A 1U5IB 3B6XA 4PHMA 4N1GA 1WDCC 1SBJA 4XYNA 1DGUA 1S26D 2WCMA 1RWYA 1C7VA 2F8PA 2KYFA 1ZUZA 2WCJA 2JU0A 1KK7Z 2WCBA 3OP0A 1RJVA 2KFGA 2JZIA 2L2EA 3L4LA 3LK0A 1DJIA 1F70A 1DJWA 2M1UA 1DF0B 2ERBA 1BODA 4YGBB 3SS5A 3CZ0A 1TUJA 1CTRA 3HX4A 3NHTA 1G8IA 3O6BA 4OVNF 3OGNA 1HQVA 1SCMB 4ICBA 4IL1A 5I2QA 4F7FA 1T14A 3E3RA 3KO0A 3DY9A 1IIOA 1G33A 1UWOA 3IF7A 3S0EA 3K1EA 4N1FA 1CFFA 4WQ2A 1UHJA 3EKJA 4FQOA 1U5IA 4PE4A 1B8LA 1TTXA 3GOFA 1F4QA 3AKAA 1PVBA 1LA3A 1UHIA 2LLUA 1QX2A 3DVEA 3HCMA 1AK8A 2KLEA 2MLFC 1TRFA 1F8HA 3LL8B 1F54A 3TS5B 1OOGA 2CCMA 3BFAA 2WC5A 1YRUB 2LNKA 3FE8A 2JPOA 2EHBA 2LUCA 3I5HC 5AANA 1DF0A 3FS7A 4MN0A 2I7AA 3CR2A 1KK8B 1S5GZ 1PULA 1TUZA 2QEBA 4GFTA 1S36A 5F6TA 3O4YA 2I18A 1J7OA 2KOTA 3PATA 1KWOC 2NCPA 2OTGC 4DRWA 3SG5A 1FI6A 1WLMA 1Z2CB 1QVIY 1SW8A 4A4BA 1CLBA 2K61A 2ZRTA 2VRGA 1PSRA 1SCVA 3SG2A 1K90D 3CYZA 2GTEA 2L0PA 1B47A 2M8UA 1MF8B 4ORBB 1QASA 4TNCA 1TN4A 4HSZA 1EL4A 3F45A 1A03A 5HLVA 2O60A 1SSEB 1JC2A 1CM1A 1NWDA 1OOJA 2BCXA 1EJ3A 1IGVA 3B87A 1KSOA 3B88A 2LLTA 2NZ0A 3S0AA 1YR5A 2DOQA 3WHUB 4NQGA 5I2LA 4MEWA 1TNWA 1KSMA 1NX2A 3CLNA 1JFJA 1WRLA 2PVBA 3GK4X 2QEOA 1A4PA 4MRYA 3D76A 3I5IB 5IBWA 1K9UA 2P70A 3CDNA 3CR5X 4A4CA 2CBLA 2BBMA 1IJ5A 4MZJA 1LINA 2KLDA 5FI7A 2P6BB 2BAPA 1KFUS 2KBMA 4MZLA 1KK7Y 2AAOA 2Y1MA 2F2PA 1NP8A 2LCPA 3DYEA 1QATA 1W7IB 1ZFSA 2ZRSA 1QWVA 2KI4B 4BY4A 3NSKA 1K95A 3AAKA 1E8AA 3VRRA 4P5OE 3PM2A 1KFXL 1VRKA 1TNPA 2MRDA 3PALA 5JJGA 3I5HB 1K2HA 3JTDC 1SCMC 1NCZA 3D75A 3SS3A 1YVHA 4WQ3A 2NXQA 2HQWA 2H8VA 1MWNA 2F3ZA 2QDIA 4QJ4B 3KPXA 2BCBA 4U8DA 1DMOA 2WCKA 3L4AA 5HLOA 2JT3A 2FCDA 4I5LB 2OTGB 3PLFB 1OZSA 1SL7A 3NSOA 1DJGA 2K7DA 1YRTB 1YX8A 1M63B 2IS9A 1CLMA 2KQYA 3IVTA 1M39A 2L4HA 4ZCUA 2CNPA 1W9ZA 3IQOA 2KGBC 3CZ1A 3VROA 2KAXA 3I5FB 2L5YA 1IG5A 5KSZA 4AOMA 2M0RA 4PE0A 2H2KA 4GPLB 1CDLA 1OMRA 3DXLA 1OE9B 1QX5B 2FJYA 5HKZA 2V53A 3R1OA 4PE1A 1S5GY 1XFYO 1DGVA 2FJUB 5TNCA 1ORGA 1MR8A 3B86A 3FE9A 1XFVO 1FPWA 1PRWA 1WRZA 1K8UA 2JNFA 3O2PA 4MSPA 1C3YA 3S0DA 3PN7B 3H4SE 4PHJA 1RECA 2LUXA 3KF9A 1C07A 2BE4A 2CT9A 1QTXA 4PDZA 1NUBA 1IQ5A 2KI6D 4M2OA 1F4OA 4MVFA 2JULA 1WRKA 1LKJA 5CSIA 4DIRA 2Q91A 4USLA 1EXRA 3D78A 2K60A 1HT9A 2QPTA 3LK1A 5AEQA 5DKQA 1BMOA 5FYXA 2LANA 3OHMB 2JPTA 3N7HA 4PE7A 1C7WA 1QX7A 4DS7A 2HETA 2JXLA 3JTDB 2ZFDA 1BR4B 1N65A 2ZN9A 1PSBA 1R6PA 4QJ3B 4C0JA 5BPJA 1F55A 1IH0A 1SYMA 2K7OA 3DVJA 3LCPC 3BQ3A 1ALWA 2AMIA 1XFZO 4HREE 1OOHA 2BL0C 3I5IC 2KDHA 2WCFA 4YBHB 1GM0A 1OMVA 1UURA 3CZTX 4OZDA 5D69A 1DJXA 1Y1AA 1CFCA 1C3ZA 1FF1A 2LVVA 1GGWA 3WHTB 5CSNA 1PALA 1XFWO 5ER5A 3O78A 3D10A 4DUQA 2KI4C 3R1PA 1M31A 2LM5A 2WC8A 3CTNA 2BKIB 2JXCA 4XJKB 1CMGA 1AUIB 3I5GB 2M97A 1ZMZA 1H8BA 1FBVA 1RFJA 2LAPA 2M1KB 1DTLA 5HYDA 1X02A 3VGOA 2L5XB 3CGAA 2Y5IA 3OX5A 1BLQA 3EVVA 2E6WA 4Q04A 3BFHA 1NCXA 2L98A 3BUXB 1PVAA 2SCPA 4CIDA 1J1DA 2MLEC 1L2OC 4OCIA 1YX7A 2BE6A 2ZNEA 1Y0VH 5GQQC 4UPGA 1SK6D 5I2OA 4M2QA 4YGEB 1DELA 4DCKA 1G4YR 4YI9A 1Z4HA 2H61A 4ZCVA 1JF0A 1SRAA 1XFUO 1EH2A 2L2CA 2G2BA 4PHKA 2KGRA 1EG3A 3I5FC 4JQ0D 1DT7B 1V1FA 2LE9B 3S0BA 2YGUA 2K7CA 3KHEA 1Q80A 4FQTA 2F2OA 1NX1A 2WCHA 3A4UB 3EK4A 4NDBA 4XJKA 5DKNA 1S3PA 3CWGA 5CSFA 1ALVA 1XYDA 3V2LA 1A75B 1LA0A 1A2XA 1CDPA 1TOPA 3OBVA 3PN7C 1W7JB 3VB1A 1GQMA 2BL0B 4D1EA 4GUKA 1KCYA 3PSRA 1CKKA 3M0WA 3DVMA 3FWCA 3QRXA 1IJ6A 1B9AA 2JWWA 2KAVA 1K96A 3BUMB 1A29A 4M2PA 1B4CA 1MXEA 3FWBA 1XVJA 4KYNA 1BT6A 1NCYA 4YGAA 5PALA 5KU1A 3RZSA 1CFPA 3JVTC 1DJZA 2QEVA 4MBEA 1DQEA 1OMDA 1TNXA 1JUOA 1YTZC 1CNPA 3GK1A 4INXA 5HL1A 5G08A 2KQ6A 3R72A 1SL8A 5CPVA 2FOTA 1SMGA 3IQQA 4GGFA 2KI6C 4CPVA 1AJ4A 1S6IA 1K9PA 1L2OB 2FCEA 3D73A 4I5NB 1J55A 1SPYA 2H61C 3RLZA 1J7PA 4NDDA 5KTYA 2QACA 3TDUA 2NLNA 1A75A 1LS8A 4E68A 1DEKA 1IWQA 2M49B 3TDIA 5K89A 3CABA 2O5GA 4OKHA 1NX0A 1MUXA 2EC6B 5D3OA 2HF5A 1N0YA 3ICBA 4IJ7A 4OR9B 2COLB 2E30A 3SG3A 3I5GC 1JFKA 2JT8A 3BUNB 2F3YA 1AHRA 3MSEB 4OV2A 5FI6A 2WNDA 1CMFA 5ER4X 3BYAA 2JNXA 4JKTA 4MLWA 1ZACA 2LP2A 2I2RE 1LVCD 1UP5A 2PSRA 1FW4A 2A4JA 3EKHA 4PHNA 2LHIA 1J7QA 1YUTA 1XK4C 1J1EA 3TZ1A 1TWOA 3D77A 3KEVA 3OB1B 5D7FA 1KQMC 1QIVA 3TDZA 1B8RA 1SR6C 1K9KA 1PK0D 3NSIA 4YI8A 3PFVA 2JOJA 2BKHB 2ZKMX 1RTP1 3SG6A 2BNXA 5HKWA 2K7BA 4PT1A 1XFXO 2AUCA 4CLNA 1Y1XA 2MHHA 3SIBA 1CDNA 1J7RA 2OS8B 1V1GA 1TNQA 3JVTB 2M7LA 2MBXA 2Y1NA 4C0LA 1B7TZ 4GGFC 1AJ5A 2Y4QA 1M46A 3CZ2A 1B1GA 2L4IA 1OZOA 2WCLA 1RK9A 1TIZA 4I5KA 3VRNA 1SNLA 1UHHA 2BBNA 4C0KA 5CSJA 4MRXA 4CFRA 3EK8A 1S6CA 1DVIA 2PALA 2ISDA 1AVSA 1XA5A 5FI2A 1TCOB 1SY9A 2JC2A 2L50A 3GK2A 3S0FA 1IKUA 4N5XA 1RROA 3R1VA 2WCEA 5J3XA 2LMVA 3SIAA 2K2AA 3B7AA 4AQIA 2R2IA 3VRPA 1BR1B 4JD9A 4P2YB 1JF2A 4L9MA 4FTGA 5AXIA 3PM8A 2HPSA 1SL9A 1GJYA 2WC6A 2WOSA 3EVUA 3ZWHA 4CFQA 3C1VA 5I8NA 2LC5A 2SASA 4ORAB 1QJTA 2MJWB 1DC1A 1QS7A 2LV7A 3K21A 2KPHA 1S1EA 3RM1A 3S0GA 3D0YB 3NGVA 5JOLA 4PCWA 1QLSA 3L47A 5DICA 1N2DA 3BUWB 1BJFA 3UO9A 1B8CA 1LXFC 3DVKA 1WLZA 1KQMB 1XFRA 4AQJA 3BOWB 3DD4A 1SR6B 2B1UA 2K2FA 3FE6A 1YUSA 5DKRA 4YGDB 1FI5A 2EC6C 1BOCA 1QIWA 1BU3A 1QXPA 2EGDA 1KFXS 2CTNA 1Y1UA 1JBAA 1CLLA 3WXAA 3BFBA 1ODBA 3A8RA 2F33A 4PALA 1EG4A 1H4BA 1YVLA 1R2UA 2M3WA 2RGIA 1UUSA 3AKBA 4INWA 1NX3A 1WDCB 2JT0A 3NSLA 4MZKA 3NXAA 1YUUA 1L7ZA 4YGCB 4R1EA 2P71A 2G9BA 3TUYC 1K94A 5HKYA 1OOIX 3D0YA 1NYAA 3UNWA 1MXLC 2KNEA 1UHNA 2LMTA 3VRQA 3D74A 5B8IB 4QJ5B 1OW4A 1NSHA 3EVRA 1XK4A 4WRIA 2KFHA 2BECA 2M29A 2MAZA 3SJSA 2M9GA 3FIAA 1WY9A 4GGNA 3BOWA 1M45A 4HRHA 3DF0B 4GNKB 1CB1A 2GGZA 1OQPA 4F0ZB 5AFPA 1CFDA 1D1OA 2OS8C 1AP4A 1QV0A 2PYQA 3AAJA 2PQLA 1GGZA 1QV1A 3CR4X 1B7TY 2JTTA 2KAYA 2LVJA 1TCFA 2LMUA 1JSAA 1NPQA 3DZTA 5EL2A 1S6JA 1UHKA 4GAOA 2KHNA 2KYCA 1IQ3A 1Y6WA 2LLSA 1ZOTB 3Q8IA 3SG4A 2ZN8A 4GBAA 2QEHA 4I5JA 3WNXB 1MHOA 4JWQA 1BF5A 2PASA 2WORA 4HRGA 2K8MB 2Q4UA 1JWDA 1IRJA 4YRUA 2GGMA 3DF0A 4BY5A 2LVIA 1DJHA 3ZNIA 2PMYA 2LHLA 3BUOB 3EG5B 3EK7A 2KFFA 2OPOA 2MA2A 3O4XA 4ETOA 3CS1A 1KWOB 2JQ6A 1OSAA 1QVIZ 1QLKA 1DJYA 1P28A 2LVKA 2TN4A 3BJHA 1NIWA 5I94A 2PRUA 5AERA 3OB2B 3TUYB 2L51A 1CDMA 3LLEA 1KFUL 2D8NA 2GV5A 1K93D 2K0JA 2LP3A 2NCOA 3BXKA 3NHIA 1F71A 3TS5C 1OOFA 2M7NA 3OX6A 1SKTA 2CXJA 2I94A 2HQ8A 2JRFA 1YURA 3SG7A 3SS4A 2KBIA 2JTZA 4JPZB 2ZNDA 4ORCB 1KK8C
chains in the Genus database with same CATH topology
3SS3A 4I5KA 4MEWA 5FI6A 5HL1A 1DC1A 3EG5B 3O4XA 4JKTA 4I5LB 3OBVA 4I5NB 1Z2CB 5I94A 4GAOA 3UO9A 1DELA 5FI2A 2KLDA 3KEVA 5FI7A 1DEKA 2BAPA 3UNWA 1Z4HA 3IVTA 2KLEA 4GBAA 1W9ZA 5D3OA 4I5JA 2L5YA 2K60A 3SS4A 4IJ7A 3PM2A 2BNXA 3SS5A 4KYNA 2YGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KYN A;  4IJ7 A;  3PM2 A; 
#chains in the Genus database with same CATH topology
 1XO5 A;  2BCA A;  1CM4 A;  1KQV A;  3PJI A;  3QME A;  1BG1 A;  2KSP A;  4NDC A;  1MQ1 A;  1U5I B;  3B6X A;  4PHM A;  4N1G A;  1WDC C;  1SBJ A;  4XYN A;  1DGU A;  1S26 D;  2WCM A;  1RWY A;  1C7V A;  2F8P A;  2KYF A;  1ZUZ A;  2WCJ A;  2JU0 A;  1KK7 Z;  2WCB A;  3OP0 A;  1RJV A;  2KFG A;  2JZI A;  2L2E A;  3L4L A;  3LK0 A;  1DJI A;  1F70 A;  1DJW A;  2M1U A;  1DF0 B;  2ERB A;  1BOD A;  4YGB B;  3SS5 A;  3CZ0 A;  1TUJ A;  1CTR A;  3HX4 A;  3NHT A;  1G8I A;  3O6B A;  4OVN F;  3OGN A;  1HQV A;  1SCM B;  4ICB A;  4IL1 A;  5I2Q A;  4F7F A;  1T14 A;  3E3R A;  3KO0 A;  3DY9 A;  1IIO A;  1G33 A;  1UWO A;  3IF7 A;  3S0E A;  3K1E A;  4N1F A;  1CFF A;  4WQ2 A;  1UHJ A;  3EKJ A;  4FQO A;  1U5I A;  4PE4 A;  1B8L A;  1TTX A;  3GOF A;  1F4Q A;  3AKA A;  1PVB A;  1LA3 A;  1UHI A;  2LLU A;  1QX2 A;  3DVE A;  3HCM A;  1AK8 A;  2KLE A;  2MLF C;  1TRF A;  1F8H A;  3LL8 B;  1F54 A;  3TS5 B;  1OOG A;  2CCM A;  3BFA A;  2WC5 A;  1YRU B;  2LNK A;  3FE8 A;  2JPO A;  2EHB A;  2LUC A;  3I5H C;  5AAN A;  1DF0 A;  3FS7 A;  4MN0 A;  2I7A A;  3CR2 A;  1KK8 B;  1S5G Z;  1PUL A;  1TUZ A;  2QEB A;  4GFT A;  1S36 A;  5F6T A;  3O4Y A;  2I18 A;  1J7O A;  2KOT A;  3PAT A;  1KWO C;  2NCP A;  2OTG C;  4DRW A;  3SG5 A;  1FI6 A;  1WLM A;  1Z2C B;  1QVI Y;  1SW8 A;  4A4B A;  1CLB A;  2K61 A;  2ZRT A;  2VRG A;  1PSR A;  1SCV A;  3SG2 A;  1K90 D;  3CYZ A;  2GTE A;  2L0P A;  1B47 A;  2M8U A;  1MF8 B;  4ORB B;  1QAS A;  4TNC A;  1TN4 A;  4HSZ A;  1EL4 A;  3F45 A;  1A03 A;  5HLV A;  2O60 A;  1SSE B;  1JC2 A;  1CM1 A;  1NWD A;  1OOJ A;  2BCX A;  1EJ3 A;  1IGV A;  3B87 A;  1KSO A;  3B88 A;  2LLT A;  2NZ0 A;  3S0A A;  1YR5 A;  2DOQ A;  3WHU B;  4NQG A;  5I2L A;  4MEW A;  1TNW A;  1KSM A;  1NX2 A;  3CLN A;  1JFJ A;  1WRL A;  2PVB A;  3GK4 X;  2QEO A;  1A4P A;  4MRY A;  3D76 A;  3I5I B;  5IBW A;  1K9U A;  2P70 A;  3CDN A;  3CR5 X;  4A4C A;  2CBL A;  2BBM A;  1IJ5 A;  4MZJ A;  1LIN A;  2KLD A;  5FI7 A;  2P6B B;  2BAP A;  1KFU S;  2KBM A;  4MZL A;  1KK7 Y;  2AAO A;  2Y1M A;  2F2P A;  1NP8 A;  2LCP A;  3DYE A;  1QAT A;  1W7I B;  1ZFS A;  2ZRS A;  1QWV A;  2KI4 B;  4BY4 A;  3NSK A;  1K95 A;  3AAK A;  1E8A A;  3VRR A;  4P5O E;  3PM2 A;  1KFX L;  1VRK A;  1TNP A;  2MRD A;  3PAL A;  5JJG A;  3I5H B;  1K2H A;  3JTD C;  1SCM C;  1NCZ A;  3D75 A;  3SS3 A;  1YVH A;  4WQ3 A;  2NXQ A;  2HQW A;  2H8V A;  1MWN A;  2F3Z A;  2QDI A;  4QJ4 B;  3KPX A;  2BCB A;  4U8D A;  1DMO A;  2WCK A;  3L4A A;  5HLO A;  2JT3 A;  2FCD A;  4I5L B;  2OTG B;  3PLF B;  1OZS A;  1SL7 A;  3NSO A;  1DJG A;  2K7D A;  1YRT B;  1YX8 A;  1M63 B;  2IS9 A;  1CLM A;  2KQY A;  3IVT A;  1M39 A;  2L4H A;  4ZCU A;  2CNP A;  1W9Z A;  3IQO A;  2KGB C;  3CZ1 A;  3VRO A;  2KAX A;  3I5F B;  2L5Y A;  1IG5 A;  5KSZ A;  4AOM A;  2M0R A;  4PE0 A;  2H2K A;  4GPL B;  1CDL A;  1OMR A;  3DXL A;  1OE9 B;  1QX5 B;  2FJY A;  5HKZ A;  2V53 A;  3R1O A;  4PE1 A;  1S5G Y;  1XFY O;  1DGV A;  2FJU B;  5TNC A;  1ORG A;  1MR8 A;  3B86 A;  3FE9 A;  1XFV O;  1FPW A;  1PRW A;  1WRZ A;  1K8U A;  2JNF A;  3O2P A;  4MSP A;  1C3Y A;  3S0D A;  3PN7 B;  3H4S E;  4PHJ A;  1REC A;  2LUX A;  3KF9 A;  1C07 A;  2BE4 A;  2CT9 A;  1QTX A;  4PDZ A;  1NUB A;  1IQ5 A;  2KI6 D;  4M2O A;  1F4O A;  4MVF A;  2JUL A;  1WRK A;  1LKJ A;  5CSI A;  4DIR A;  2Q91 A;  4USL A;  1EXR A;  3D78 A;  2K60 A;  1HT9 A;  2QPT A;  3LK1 A;  5AEQ A;  5DKQ A;  1BMO A;  5FYX A;  2LAN A;  3OHM B;  2JPT A;  3N7H A;  4PE7 A;  1C7W A;  1QX7 A;  4DS7 A;  2HET A;  2JXL A;  3JTD B;  2ZFD A;  1BR4 B;  1N65 A;  2ZN9 A;  1PSB A;  1R6P A;  4QJ3 B;  4C0J A;  5BPJ A;  1F55 A;  1IH0 A;  1SYM A;  2K7O A;  3DVJ A;  3LCP C;  3BQ3 A;  1ALW A;  2AMI A;  1XFZ O;  4HRE E;  1OOH A;  2BL0 C;  3I5I C;  2KDH A;  2WCF A;  4YBH B;  1GM0 A;  1OMV A;  1UUR A;  3CZT X;  4OZD A;  5D69 A;  1DJX A;  1Y1A A;  1CFC A;  1C3Z A;  1FF1 A;  2LVV A;  1GGW A;  3WHT B;  5CSN A;  1PAL A;  1XFW O;  5ER5 A;  3O78 A;  3D10 A;  4DUQ A;  2KI4 C;  3R1P A;  1M31 A;  2LM5 A;  2WC8 A;  3CTN A;  2BKI B;  2JXC A;  4XJK B;  1CMG A;  1AUI B;  3I5G B;  2M97 A;  1ZMZ A;  1H8B A;  1FBV A;  1RFJ A;  2LAP A;  2M1K B;  1DTL A;  5HYD A;  1X02 A;  3VGO A;  2L5X B;  3CGA A;  2Y5I A;  3OX5 A;  1BLQ A;  3EVV A;  2E6W A;  4Q04 A;  3BFH A;  1NCX A;  2L98 A;  3BUX B;  1PVA A;  2SCP A;  4CID A;  1J1D A;  2MLE C;  1L2O C;  4OCI A;  1YX7 A;  2BE6 A;  2ZNE A;  1Y0V H;  5GQQ C;  4UPG A;  1SK6 D;  5I2O A;  4M2Q A;  4YGE B;  1DEL A;  4DCK A;  1G4Y R;  4YI9 A;  1Z4H A;  2H61 A;  4ZCV A;  1JF0 A;  1SRA A;  1XFU O;  1EH2 A;  2L2C A;  2G2B A;  4PHK A;  2KGR A;  1EG3 A;  3I5F C;  4JQ0 D;  1DT7 B;  1V1F A;  2LE9 B;  3S0B A;  2YGU A;  2K7C A;  3KHE A;  1Q80 A;  4FQT A;  2F2O A;  1NX1 A;  2WCH A;  3A4U B;  3EK4 A;  4NDB A;  4XJK A;  5DKN A;  1S3P A;  3CWG A;  5CSF A;  1ALV A;  1XYD A;  3V2L A;  1A75 B;  1LA0 A;  1A2X A;  1CDP A;  1TOP A;  3OBV A;  3PN7 C;  1W7J B;  3VB1 A;  1GQM A;  2BL0 B;  4D1E A;  4GUK A;  1KCY A;  3PSR A;  1CKK A;  3M0W A;  3DVM A;  3FWC A;  3QRX A;  1IJ6 A;  1B9A A;  2JWW A;  2KAV A;  1K96 A;  3BUM B;  1A29 A;  4M2P A;  1B4C A;  1MXE A;  3FWB A;  1XVJ A;  4KYN A;  1BT6 A;  1NCY A;  4YGA A;  5PAL A;  5KU1 A;  3RZS A;  1CFP A;  3JVT C;  1DJZ A;  2QEV A;  4MBE A;  1DQE A;  1OMD A;  1TNX A;  1JUO A;  1YTZ C;  1CNP A;  3GK1 A;  4INX A;  5HL1 A;  5G08 A;  2KQ6 A;  3R72 A;  1SL8 A;  5CPV A;  2FOT A;  1SMG A;  3IQQ A;  4GGF A;  2KI6 C;  4CPV A;  1AJ4 A;  1S6I A;  1K9P A;  1L2O B;  2FCE A;  3D73 A;  4I5N B;  1J55 A;  1SPY A;  2H61 C;  3RLZ A;  1J7P A;  4NDD A;  5KTY A;  2QAC A;  3TDU A;  2NLN A;  1A75 A;  1LS8 A;  4E68 A;  1DEK A;  1IWQ A;  2M49 B;  3TDI A;  5K89 A;  3CAB A;  2O5G A;  4OKH A;  1NX0 A;  1MUX A;  2EC6 B;  5D3O A;  2HF5 A;  1N0Y A;  3ICB A;  4IJ7 A;  4OR9 B;  2COL B;  2E30 A;  3SG3 A;  3I5G C;  1JFK A;  2JT8 A;  3BUN B;  2F3Y A;  1AHR A;  3MSE B;  4OV2 A;  5FI6 A;  2WND A;  1CMF A;  5ER4 X;  3BYA A;  2JNX A;  4JKT A;  4MLW A;  1ZAC A;  2LP2 A;  2I2R E;  1LVC D;  1UP5 A;  2PSR A;  1FW4 A;  2A4J A;  3EKH A;  4PHN A;  2LHI A;  1J7Q A;  1YUT A;  1XK4 C;  1J1E A;  3TZ1 A;  1TWO A;  3D77 A;  3KEV A;  3OB1 B;  5D7F A;  1KQM C;  1QIV A;  3TDZ A;  1B8R A;  1SR6 C;  1K9K A;  1PK0 D;  3NSI A;  4YI8 A;  3PFV A;  2JOJ A;  2BKH B;  2ZKM X;  1RTP 1;  3SG6 A;  2BNX A;  5HKW A;  2K7B A;  4PT1 A;  1XFX O;  2AUC A;  4CLN A;  1Y1X A;  2MHH A;  3SIB A;  1CDN A;  1J7R A;  2OS8 B;  1V1G A;  1TNQ A;  3JVT B;  2M7L A;  2MBX A;  2Y1N A;  4C0L A;  1B7T Z;  4GGF C;  1AJ5 A;  2Y4Q A;  1M46 A;  3CZ2 A;  1B1G A;  2L4I A;  1OZO A;  2WCL A;  1RK9 A;  1TIZ A;  4I5K A;  3VRN A;  1SNL A;  1UHH A;  2BBN A;  4C0K A;  5CSJ A;  4MRX A;  4CFR A;  3EK8 A;  1S6C A;  1DVI A;  2PAL A;  2ISD A;  1AVS A;  1XA5 A;  5FI2 A;  1TCO B;  1SY9 A;  2JC2 A;  2L50 A;  3GK2 A;  3S0F A;  1IKU A;  4N5X A;  1RRO A;  3R1V A;  2WCE A;  5J3X A;  2LMV A;  3SIA A;  2K2A A;  3B7A A;  4AQI A;  2R2I A;  3VRP A;  1BR1 B;  4JD9 A;  4P2Y B;  1JF2 A;  4L9M A;  4FTG A;  5AXI A;  3PM8 A;  2HPS A;  1SL9 A;  1GJY A;  2WC6 A;  2WOS A;  3EVU A;  3ZWH A;  4CFQ A;  3C1V A;  5I8N A;  2LC5 A;  2SAS A;  4ORA B;  1QJT A;  2MJW B;  1DC1 A;  1QS7 A;  2LV7 A;  3K21 A;  2KPH A;  1S1E A;  3RM1 A;  3S0G A;  3D0Y B;  3NGV A;  5JOL A;  4PCW A;  1QLS A;  3L47 A;  5DIC A;  1N2D A;  3BUW B;  1BJF A;  3UO9 A;  1B8C A;  1LXF C;  3DVK A;  1WLZ A;  1KQM B;  1XFR A;  4AQJ A;  3BOW B;  3DD4 A;  1SR6 B;  2B1U A;  2K2F A;  3FE6 A;  1YUS A;  5DKR A;  4YGD B;  1FI5 A;  2EC6 C;  1BOC A;  1QIW A;  1BU3 A;  1QXP A;  2EGD A;  1KFX S;  2CTN A;  1Y1U A;  1JBA A;  1CLL A;  3WXA A;  3BFB A;  1ODB A;  3A8R A;  2F33 A;  4PAL A;  1EG4 A;  1H4B A;  1YVL A;  1R2U A;  2M3W A;  2RGI A;  1UUS A;  3AKB A;  4INW A;  1NX3 A;  1WDC B;  2JT0 A;  3NSL A;  4MZK A;  3NXA A;  1YUU A;  1L7Z A;  4YGC B;  4R1E A;  2P71 A;  2G9B A;  3TUY C;  1K94 A;  5HKY A;  1OOI X;  3D0Y A;  1NYA A;  3UNW A;  1MXL C;  2KNE A;  1UHN A;  2LMT A;  3VRQ A;  3D74 A;  5B8I B;  4QJ5 B;  1OW4 A;  1NSH A;  3EVR A;  1XK4 A;  4WRI A;  2KFH A;  2BEC A;  2M29 A;  2MAZ A;  3SJS A;  2M9G A;  3FIA A;  1WY9 A;  4GGN A;  3BOW A;  1M45 A;  4HRH A;  3DF0 B;  4GNK B;  1CB1 A;  2GGZ A;  1OQP A;  4F0Z B;  5AFP A;  1CFD A;  1D1O A;  2OS8 C;  1AP4 A;  1QV0 A;  2PYQ A;  3AAJ A;  2PQL A;  1GGZ A;  1QV1 A;  3CR4 X;  1B7T Y;  2JTT A;  2KAY A;  2LVJ A;  1TCF A;  2LMU A;  1JSA A;  1NPQ A;  3DZT A;  5EL2 A;  1S6J A;  1UHK A;  4GAO A;  2KHN A;  2KYC A;  1IQ3 A;  1Y6W A;  2LLS A;  1ZOT B;  3Q8I A;  3SG4 A;  2ZN8 A;  4GBA A;  2QEH A;  4I5J A;  3WNX B;  1MHO A;  4JWQ A;  1BF5 A;  2PAS A;  2WOR A;  4HRG A;  2K8M B;  2Q4U A;  1JWD A;  1IRJ A;  4YRU A;  2GGM A;  3DF0 A;  4BY5 A;  2LVI A;  1DJH A;  3ZNI A;  2PMY A;  2LHL A;  3BUO B;  3EG5 B;  3EK7 A;  2KFF A;  2OPO A;  2MA2 A;  3O4X A;  4ETO A;  3CS1 A;  1KWO B;  2JQ6 A;  1OSA A;  1QVI Z;  1QLK A;  1DJY A;  1P28 A;  2LVK A;  2TN4 A;  3BJH A;  1NIW A;  5I94 A;  2PRU A;  5AER A;  3OB2 B;  3TUY B;  2L51 A;  1CDM A;  3LLE A;  1KFU L;  2D8N A;  2GV5 A;  1K93 D;  2K0J A;  2LP3 A;  2NCO A;  3BXK A;  3NHI A;  1F71 A;  3TS5 C;  1OOF A;  2M7N A;  3OX6 A;  1SKT A;  2CXJ A;  2I94 A;  2HQ8 A;  2JRF A;  1YUR A;  3SG7 A;  3SS4 A;  2KBI A;  2JTZ A;  4JPZ B;  2ZND A;  4ORC B;  1KK8 C; 
#chains in the Genus database with same CATH homology
 3SS3 A;  4I5K A;  4MEW A;  5FI6 A;  5HL1 A;  1DC1 A;  3EG5 B;  3O4X A;  4JKT A;  4I5L B;  3OBV A;  4I5N B;  1Z2C B;  5I94 A;  4GAO A;  3UO9 A;  1DEL A;  5FI2 A;  2KLD A;  3KEV A;  5FI7 A;  1DEK A;  2BAP A;  3UNW A;  1Z4H A;  3IVT A;  2KLE A;  4GBA A;  1W9Z A;  5D3O A;  4I5J A;  2L5Y A;  2K60 A;  3SS4 A;  4IJ7 A;  3PM2 A;  2BNX A;  3SS5 A;  4KYN A;  2YGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...