1NSHA

Solution structure of rabbit apo-s100a11 (19 models)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
SRPTETERCIESLIAVFQKYAGKDGHSVTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNSDGQLDFQEFLNLIGGLAVACHESFVKAAPPQKRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unmasking the Annexin I Interaction from the structure of apo-S100A11
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Metal binding protein
molecule keywords Calgizzarin
total genus 18
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nshA00
1KK7Z 3NXAA 3A4UB 1S26D 2O5GA 1IG5A 2LP3A 4GGFA 2LHIA 1UP5A 4DIRA 2JC2A 2LMVA 1TNXA 4M2OA 1DVIA 4BY4A 1DJGA 1WRKA 1AJ4A 2WCFA 5IBWA 2LMUA 1SNLA 1LA0A 2CCMA 1BR4B 2MJWB 3CR2A 2CT9A 1QX5B 1A2XA 2HQWA 1YVLA 4YGEB 1K2HA 1A75B 3QRXA 1YRUB 3EK4A 2M1UA 3D0YB 2P6BB 2WOSA 4MRXA 1XA5A 2FOTA 3I5GB 3O78A 2OS8B 1CM1A 2H61C 2NLNA 2MAZA 2WNDA 5DKRA 1OMRA 1S36A 1B1GA 1XO5A 1JFJA 1JWDA 4ORCB 1J1DA 1AHRA 4M2QA 1DTLA 4MN0A 3I5FC 4GBAA 2F2PA 3JVTB 1OE9B 3CTNA 4C0KA 2MLFC 4YI8A 2NZ0A 3EVUA 4D1EA 1F70A 1MHOA 1QJTA 2WORA 1SBJA 1QX2A 2ZNEA 1Y1XA 1ZACA 3CZTX 2OPOA 1RECA 2EC6C 1H8BA 1FI5A 1J55A 1BT6A 1G33A 5CSIA 1CDLA 2K8MB 5BPJA 1TN4A 1TRFA 1UWOA 3AKAA 3FWCA 1SCMB 1G4YR 1CLLA 3DVMA 1PK0D 1UHNA 2FCEA 1L7ZA 3BYAA 4ICBA 2MHHA 3LK0A 5I2QA 4YGBB 2DOQA 1PSBA 2KGRA 1K96A 3DF0A 1BG1A 2KSPA 5HLVA 3SG7A 1NCZA 1QS7A 1PVAA 1F4OA 1CNPA 4Q04A 4FTGA 3AAJA 2K7CA 1MXLC 1KCYA 3EK8A 3GK2A 3JVTC 5CSNA 4N1GA 2ISDA 1MQ1A 2AMIA 4WQ2A 4U8DA 2Y1MA 1NWDA 1PRWA 5HLOA 1OOJA 3OX6A 4YGAA 1IRJA 4P2YB 1SK6D 5HKZA 2K2FA 3F45A 4F0ZB 1S6IA 4QJ4B 2ZFDA 2AUCA 4DCKA 2H61A 1EG3A 2MA2A 3I5GC 1JFKA 4YRUA 1DT7B 1C07A 1XK4A 4A4BA 5KTYA 1RTP1 4MZJA 2BCAA 2BBNA 4GGFC 2M8UA 4MLWA 1Q80A 2B1UA 1DF0B 1J7OA 3CR4X 2L4IA 2LC5A 4MSPA 4GFTA 2M7LA 1HQVA 3SG6A 3TDZA 1S3PA 2F3YA 1F71A 1IH0A 2M49B 2NXQA 3KF9A 2F8PA 3WNXB 2L0PA 1OQPA 1JSAA 4A4CA 2K7OA 3BXKA 2M29A 1TNPA 1YURA 3IQOA 2KYFA 1ZMZA 3SG3A 3LCPC 2AAOA 2WC8A 3MSEB 4PCWA 1J7QA 3BUNB 3SIAA 1NYAA 1QIWA 4PHKA 4I5LB 1CKKA 1AJ5A 4YBHB 1CDPA 3E3RA 1E8AA 1SL7A 4TNCA 1CDNA 1CLMA 3I5HC 1K8UA 2M7NA 1KFXS 1WDCC 2F3ZA 4JQ0D 1YRTB 1ZFSA 3SG4A 1IWQA 3O4YA 1R6PA 4WQ3A 3ZWHA 3SIBA 5KU1A 3GK4X 2KFHA 1BODA 2BE4A 2M3WA 1DJYA 1WLZA 1JF0A 1SRAA 2KNEA 1M39A 4R1EA 4GGNA 1K95A 4GAOA 4MRYA 3TDIA 1D1OA 1M63B 2I18A 3DVJA 1F8HA 5ER4X 2K61A 2LLSA 4UPGA 1H4BA 3BUXB 3VRRA 2K7BA 5AERA 4ZCVA 1MXEA 1B7TZ 2RGIA 4OKHA 1KSOA 1A29A 3OB1B 2JT3A 4PHJA 1AVSA 1KWOC 1XFYO 4I5KA 1BU3A 1IGVA 4PE7A 1BF5A 4YGCB 4PDZA 1QLKA 1OSAA 1KFUL 4DRWA 4PALA 2Y1NA 2Y4QA 2GGMA 4ZCUA 4ORAB 2JZIA 1S1EA 4HRHA 4MEWA 3GOFA 4OCIA 1UURA 2LLTA 1UUSA 3TUYC 2KI4C 1SW8A 1MR8A 4OVNF 3OP0A 4PHMA 3PN7C 1B47A 1WRLA 3NSLA 1B4CA 5AFPA 1CLBA 4USLA 2FCDA 1BR1B 4DS7A 1KK7Y 3FIAA 2CBLA 1K9UA 1LA3A 1TTXA 1YX7A 2SASA 1DJXA 1QV0A 1SR6B 2KFFA 4QJ3B 2JRFA 1K93D 2QPTA 2KQ6A 1SY9A 1MUXA 2D8NA 1KQMB 1JC2A 1IJ6A 2LANA 1G8IA 1LVCD 3I5IC 5PALA 4CPVA 2COLB 2CNPA 5CPVA 1YUSA 1RK9A 1ALVA 1PSRA 2MRDA 3H4SE 2BL0B 5GQQC 5I8NA 3NSIA 1EL4A 1YUUA 1ODBA 1HT9A 1UHKA 3FWBA 2ZN8A 3PATA 3SG2A 2KAXA 3LK1A 1TIZA 3TS5B 2M1KB 1BMOA 1UHIA 1K9KA 1Y1UA 2GGZA 3DF0B 1BOCA 1RFJA 4OR9B 3VROA 1QTXA 2M9GA 3D10A 2K0JA 3WHTB 1V1GA 2PSRA 1MWNA 1M46A 1QX7A 2ZKMX 1OMDA 2A4JA 1V1FA 3VGOA 3OB2B 3O6BA 2PRUA 1RWYA 2HETA 1A75A 2SCPA 2KOTA 1K94A 2O60A 1M45A 2PASA 4MZLA 5K89A 2LVJA 1NSHA 2OTGC 1B8LA 2JULA 2OTGB 1FPWA 1DGVA 1SKTA 1K9PA 3TDUA 3RM1A 3VRPA 2JT0A 2KGBC 3VRQA 4HRGA 1NPQA 1NX0A 2G9BA 3SJSA 1OZSA 1N65A 2G2BA 1SL8A 3HX4A 4N1FA 2K2AA 1A03A 1F54A 1BLQA 1F55A 2BE6A 1YTZC 4L9MA 2WCEA 4AOMA 3PM8A 1S5GZ 1Y1AA 2I2RE 1BJFA 4MVFA 3KHEA 4CFRA 1UHHA 1XFVO 2JXLA 2I94A 4NQGA 2L4HA 5D7FA 3HCMA 3NSKA 2LVVA 3KEVA 3TS5C 1TOPA 4XJKB 3OHMB 4PHNA 1SL9A 2Y5IA 5D69A 2ZRSA 2LLUA 1DJZA 1C7WA 2BL0C 4HSZA 1UHJA 4YI9A 3EVVA 3A8RA 1TNWA 1NX3A 1QIVA 3NSOA 1LINA 2LV7A 4OV2A 2JTTA 5F6TA 1NX2A 3WXAA 2E30A 1NX1A 2BKIB 3JTDB 1CMGA 1X02A 2ZNDA 1L2OC 1N2DA 1W7JB 5I2OA 5G08A 5ER5A 1KK8C 1SR6C 1J7PA 1B7TY 4PE0A 2LUXA 1SCVA 2BECA 2ZN9A 3EK7A 1YR5A 2JTZA 2L50A 3BQ3A 4M2PA 1WLMA 1YX8A 3AKBA 3EKJA 1XFXO 1R2UA 1EH2A 1OMVA 1PULA 2Q91A 5B8IB 3PFVA 1EG4A 2ZRTA 4WRIA 4BY5A 2KYCA 1CTRA 2JXCA 5AEQA 1DJIA 2JPTA 5JJGA 3BOWA 2JWWA 3OX5A 1IQ5A 2LE9B 1QXPA 2KHNA 1CMFA 1KK8B 1DGUA 3ICBA 2M97A 1SMGA 1KWOB 1L2OB 1EXRA 2LAPA 3JTDC 3EVRA 3RLZA 4E68A 2EHBA 3DD4A 2KBMA 1GJYA 4PE4A 1AUIB 1CFCA 2L2EA 1KFXL 1Y6WA 1CB1A 1MF8B 2KBIA 4GUKA 1B8RA 2WCBA 5JOLA 1U5IB 2TN4A 1DJHA 2K7DA 3KO0A 1FI6A 2R2IA 3WHUB 4MBEA 1C7VA 1QLSA 2GV5A 2F33A 3FS7A 1RJVA 1QV1A 2LMTA 2NCPA 2MBXA 5HKYA 1RROA 1YUTA 3CWGA 2LNKA 2E6WA 1XK4C 2IS9A 4FQOA 1DMOA 2L51A 5AANA 2PMYA 3PALA 1QVIZ 3CR5X 1A4PA 3BUOB 1XVJA 1FW4A 2JQ6A 2LVIA 1NUBA 1AP4A 5FYXA 4I5JA 2HPSA 1IJ5A 2Q4UA 1LXFC 4I5NB 4MZKA 2LVKA 1PVBA 1KFUS 3GK1A 2MLEC 2LP2A 4GPLB 3CS1A 1B8CA 2BCBA 2KFGA 3O2PA 3C1VA 1Y0VH 1TNQA 2NCOA 3VRNA 1NCYA 3CLNA 4YGDB 5CSFA 3DVKA 4JWQA 1TCOB 1XYDA 4NDCA 1WY9A 2KI6C 1IQ3A 1EJ3A 2JT8A 3LL8B 2CTNA 1WRZA 2HF5A 2KAVA 3LLEA 1YVHA 1N0YA 3EKHA 4HREE 1QATA 3I5IB 1KQMC 3AAKA 4CLNA 1S6JA 2L98A 1QASA 1JUOA 1QVIY 4DUQA 1SPYA 4QJ5B 3DVEA 4AQIA 3PLFB 5HKWA 3PN7B 5J3XA 3K21A 2LM5A 1NCXA 2KI4B 3BOWB 5TNCA 4PE1A 3TUYB 1ALWA 4XYNA 1CFFA 1CDMA 2L5XB 2EGDA 1S5GY 1B9AA 3M0WA 4N5XA 1JBAA 1AK8A 1FBVA 2H2KA 1XFUO 2LCPA 1CFDA 1ZUZA 2I7AA 2LUCA 2KQYA 1CFPA 4NDBA 1GGWA 1NIWA 2KAYA 2JNXA 1J7RA 1KSMA 3IQQA 1FF1A 1DJWA 4GNKB 2PALA 5AXIA 1TCFA 4NDDA 4C0LA 4ETOA 1SCMC 1SYMA 2CXJA 2BBMA 5DKQA 2KDHA 2M0RA 2PVBA 1DF0A 3BUWB 1J1EA 2LHLA 1NP8A 1F4QA 2EC6B 2FJUB 4JPZB 2BKHB 1GQMA 2BCXA 3CGAA 1K90D 3ZNIA 3BUMB 4XJKA 3PSRA 4CFQA 1U5IA 1W7IB 2VRGA 2JNFA 4CIDA 2QACA 3SG5A 1IKUA 3KPXA 5KSZA 1WDCB 5CSJA 4ORBB 3D0YA 3IF7A 1XFZO 1M31A 3I5FB 1CM4A 3I5HB 1XFWO 4P5OE 1PALA 2JOJA 1ZOTB 1VRKA 4IL1A 2V53A 1OZOA 2HQ8A 1LKJA 5HYDA 2KI6D 2F2OA 5I2LA 1S6CA 1GGZA 2OS8C 1KQVA 4AQJA 5DKNA 1JF2A 3TZ1A 4C0JA 2JU0A
chains in the Genus database with same CATH superfamily
1KK7Z 2KLEA 3NXAA 3A4UB 1S26D 3S0BA 2O5GA 1IG5A 2LP3A 4GGFA 2LHIA 1UP5A 4DIRA 2P70A 2JC2A 2LMVA 3S0EA 1TNXA 4JKTA 4M2OA 3UO9A 1DVIA 4BY4A 1DJGA 1WRKA 1AJ4A 2WCFA 5IBWA 2LMUA 1SNLA 1LA0A 2CCMA 1BR4B 3S0AA 2MJWB 4INXA 3CR2A 2CT9A 1QX5B 1A2XA 2HQWA 1YVLA 2WCMA 4YGEB 1A75B 3B87A 3QRXA 1YRUB 3EK4A 1K2HA 2M1UA 2K60A 3D0YB 2P6BB 2WOSA 4MRXA 1XA5A 3SS4A 2FOTA 3I5GB 3O78A 2OS8B 1CM1A 2H61C 2NLNA 2MAZA 2WNDA 5DKRA 1OMRA 1S36A 1B1GA 1XO5A 1JFJA 1JWDA 4ORCB 1J1DA 3FE9A 1AHRA 4M2QA 1DTLA 2QEOA 4MN0A 3I5FC 4GBAA 2F2PA 2JPOA 3JVTB 1OE9B 3CTNA 1T14A 4C0KA 2MLFC 4YI8A 2NZ0A 3S0GA 3EVUA 4D1EA 1F70A 1MHOA 1QJTA 2WCJA 2WORA 1OOHA 1SBJA 1QX2A 2BNXA 1Y1XA 1ZACA 2ZNEA 2OPOA 3CZTX 1RECA 2EC6C 1H8BA 1FI5A 3R1PA 1J55A 1BT6A 1G33A 5CSIA 1CDLA 2K8MB 2QEHA 4FQTA 5BPJA 1TN4A 1TRFA 1UWOA 3AKAA 3FWCA 3B88A 1SCMB 1G4YR 1CLLA 3DVMA 3DY9A 1PK0D 1UHNA 5D3OA 2FCEA 1L7ZA 2PQLA 3BYAA 4ICBA 4OZDA 3D76A 2YGUA 2MHHA 3LK0A 5I2QA 4YGBB 2DOQA 1PSBA 2KGRA 1K96A 3DF0A 1BG1A 2KSPA 5HLVA 3SG7A 1OOIX 1NCZA 1QS7A 1PVAA 1F4OA 2WCHA 1CNPA 4Q04A 4FTGA 3AAJA 2K7CA 1MXLC 1KCYA 3EK8A 3GK2A 3JVTC 5CSNA 4N1GA 2ISDA 1MQ1A 2AMIA 4WQ2A 4U8DA 2Y1MA 1NWDA 1PRWA 5HLOA 1OOJA 3OX6A 4YGAA 1IRJA 4P2YB 1SK6D 3FE8A 2K2FA 3F45A 5HKZA 4F0ZB 1S6IA 4QJ4B 2ZFDA 2AUCA 4DCKA 2H61A 1EG3A 2MA2A 4IJ7A 3I5GC 1JFKA 4YRUA 1DT7B 2P71A 1C07A 3CZ2A 1XK4A 4A4BA 5KTYA 1RTP1 2WC5A 4MZJA 3CYZA 2BCAA 2BBNA 4GGFC 2M8UA 4MLWA 1Q80A 2B1UA 1DF0B 5I94A 1J7OA 3CR4X 2L4IA 2LC5A 4MSPA 4GFTA 2M7LA 1HQVA 3SG6A 3TDZA 1S3PA 2F3YA 1F71A 2WCLA 1IH0A 3BFAA 2M49B 2NXQA 3KF9A 5EL2A 2F8PA 1TUJA 3WNXB 2L0PA 1OQPA 1JSAA 4A4CA 2K7OA 3CDNA 3BXKA 2L2CA 2M29A 1TNPA 1YURA 3IQOA 2KYFA 1ZMZA 3SG3A 1OOGA 1Z4HA 3LCPC 2AAOA 2WC8A 3MSEB 4PCWA 1J7QA 3BUNB 3BFBA 1NYAA 1QIWA 4PHKA 4I5LB 3SIAA 1CKKA 1AJ5A 3SS5A 4QJ3B 4YBHB 1CDPA 3E3RA 1E8AA 1SL7A 4TNCA 1CDNA 1CLMA 3I5HC 1K8UA 2KLDA 2M7NA 2QEVA 1KFXS 3RZSA 1WDCC 2F3ZA 4JQ0D 1YRTB 1ZFSA 3SG4A 1IWQA 3O4YA 1R6PA 4WQ3A 3ZWHA 3SIBA 1DEKA 5KU1A 3GK4X 1ORGA 2KFHA 1BODA 2BE4A 3QMEA 2M3WA 1DJYA 1WLZA 1JF0A 1SRAA 2KNEA 1M39A 4R1EA 3V2LA 4GGNA 1K95A 3CZ0A 3R72A 4GAOA 3D75A 4MRYA 3TDIA 1D1OA 1M63B 2I18A 3DVJA 3L4LA 1F8HA 5ER4X 1C3YA 2K61A 2LLSA 3O4XA 4UPGA 1H4BA 3BUXB 3VRRA 1TUZA 1SSEB 2K7BA 5AERA 4ZCVA 1MXEA 1B7TZ 2RGIA 4OKHA 1KSOA 1A29A 3OB1B 2JT3A 4PHJA 1AVSA 1KWOC 3CABA 1XFYO 3SS3A 4I5KA 1BU3A 1IGVA 4PE7A 1BF5A 4YGCB 4PDZA 1QLKA 1OSAA 1KFUL 4DRWA 5DICA 4PALA 2Y1NA 2Y4QA 2GGMA 4ZCUA 4ORAB 2JZIA 1S1EA 4HRHA 4MEWA 3GOFA 4OCIA 1UURA 2LLTA 1UUSA 3TUYC 2KI4C 1SW8A 1MR8A 4OVNF 3OP0A 4PHMA 3PN7C 1B47A 1WRLA 3Q8IA 3NSLA 1B4CA 5AFPA 1CLBA 4USLA 3BFHA 2FCDA 1BR1B 3PM2A 4DS7A 1KK7Y 1QWVA 3FIAA 2CBLA 1K9UA 1LA3A 1TTXA 1YX7A 2SASA 1DJXA 1QV0A 1SR6B 2KFFA 3D73A 2JRFA 1K93D 2QPTA 5FI7A 2KQ6A 1SY9A 1MUXA 2D8NA 1KQMB 1JC2A 1IJ6A 2LANA 1G8IA 1LVCD 3I5IC 5PALA 4CPVA 2COLB 2CNPA 5CPVA 1YUSA 1RK9A 1ALVA 1PSRA 2MRDA 3H4SE 2BL0B 5GQQC 2ERBA 3NSIA 1EL4A 5I8NA 1YUUA 1ODBA 1HT9A 1UHKA 3FWBA 2ZN8A 3PATA 3SG2A 2KAXA 3LK1A 4INWA 1TIZA 3TS5B 2M1KB 1BMOA 1UHIA 1K9KA 1Y1UA 2GGZA 3D74A 3DF0B 1RFJA 4OR9B 3VROA 1BOCA 1QTXA 2M9GA 3D10A 2K0JA 3CZ1A 2H8VA 3WHTB 1V1GA 2PSRA 1MWNA 1M46A 1QX7A 2ZKMX 1OMDA 2A4JA 3S0DA 1V1FA 3VGOA 3OB2B 3O6BA 2PRUA 1RWYA 2HETA 1A75A 2SCPA 2KOTA 1K94A 2O60A 1M45A 2PASA 4MZLA 5K89A 2LVJA 1NSHA 2OTGC 1B8LA 2JULA 2OTGB 1FPWA 1DGVA 1SKTA 1K9PA 3TDUA 3RM1A 3VRPA 2JT0A 2KGBC 3VRQA 4HRGA 1NPQA 1NX0A 2G9BA 3SJSA 3NHIA 1OZSA 1N65A 2G2BA 1SL8A 3HX4A 4N1FA 2K2AA 1A03A 1F54A 1BLQA 1F55A 2BE6A 1YTZC 4L9MA 2WCEA 4AOMA 3PM8A 1S5GZ 1Y1AA 2I2RE 1BJFA 4MVFA 3D77A 3KHEA 1UHHA 1XFVO 3NGVA 4CFRA 2JXLA 2I94A 4NQGA 2L4HA 3B7AA 3HCMA 5D7FA 3NSKA 2LVVA 3KEVA 3TS5C 3L4AA 1TOPA 2WCKA 3OHMB 4PHNA 4XJKB 1SL9A 2Y5IA 5D69A 1XFRA 2ZRSA 2LLUA 1DJZA 1C7WA 2BL0C 3DXLA 1UHJA 4HSZA 4YI9A 3EVVA 3A8RA 1TNWA 1NX3A 1QIVA 3NSOA 1LINA 2LV7A 3DYEA 4OV2A 2JTTA 5F6TA 1NX2A 3WXAA 2E30A 1NX1A 2BKIB 3JTDB 3B6XA 1CMGA 1X02A 2PYQA 2ZNDA 1L2OC 1N2DA 1W7JB 5I2OA 4PT1A 5G08A 1C3ZA 1KK8C 1SR6C 3K1EA 5ER5A 1J7PA 2FJYA 1B7TY 4PE0A 1DC1A 2LUXA 1SCVA 2BECA 2ZN9A 3EK7A 1W9ZA 3N7HA 1YR5A 2JTZA 2L50A 3BQ3A 4M2PA 1WLMA 1YX8A 3AKBA 2KPHA 3EKJA 1XFXO 1R2UA 1EH2A 1OMVA 1Z2CB 1PULA 2Q91A 5B8IB 3PFVA 1EG4A 2ZRTA 4WRIA 4BY5A 2KYCA 1CTRA 2JXCA 5AEQA 1DJIA 2JPTA 5JJGA 3BOWA 2JWWA 3OX5A 1IQ5A 2LE9B 1QXPA 2KHNA 1CMFA 4F7FA 1KK8B 1DGUA 3ICBA 2M97A 1SMGA 1KWOB 1L2OB 1EXRA 2LAPA 3JTDC 3EVRA 3RLZA 4E68A 2EHBA 2GTEA 3DD4A 2QDIA 3FE6A 1GM0A 2KBMA 1GJYA 4PE4A 1AUIB 1CFCA 2QEBA 2L2EA 1KFXL 1TWOA 1Y6WA 1CB1A 1MF8B 2KBIA 4GUKA 1B8RA 2WCBA 5JOLA 1U5IB 2TN4A 1DJHA 2K7DA 3KO0A 3L47A 2R2IA 3WHUB 1FI6A 4MBEA 1C7VA 1QLSA 2GV5A 2F33A 3FS7A 1DQEA 1QV1A 1RJVA 2LMTA 2NCPA 3IVTA 2MBXA 5HKYA 1RROA 1YUTA 3CWGA 5FI6A 2LNKA 2E6WA 1XK4C 2IS9A 4FQOA 1DMOA 2L51A 3DZTA 2PMYA 3PALA 5AANA 1QVIZ 3CR5X 1A4PA 3BUOB 1XVJA 1FW4A 2JQ6A 2LVIA 1NUBA 1AP4A 5FYXA 4I5JA 2HPSA 1IJ5A 2Q4UA 1LXFC 4I5NB 4MZKA 2LVKA 1PVBA 1KFUS 3GK1A 2MLEC 2LP2A 4GPLB 3CS1A 4KYNA 1B8CA 2BCBA 2KFGA 3O2PA 3C1VA 2WC6A 1Y0VH 1TNQA 2NCOA 3VRNA 3R1OA 1NCYA 3CLNA 4YGDB 5CSFA 3DVKA 4JWQA 3NHTA 1OW4A 1TCOB 1XYDA 3S0FA 4NDCA 1WY9A 2KI6C 1IQ3A 1EJ3A 2JT8A 3D78A 2CTNA 1OOFA 1WRZA 2HF5A 2KAVA 3LL8B 1YVHA 3LLEA 1N0YA 3EKHA 4HREE 1QATA 3I5IB 1KQMC 3EG5B 3AAKA 4CLNA 1S6JA 2L98A 1QASA 1JUOA 3BJHA 1QVIY 4DUQA 1SPYA 4QJ5B 3DVEA 4AQIA 5FI2A 3PLFB 5HKWA 3PN7B 2L5YA 5J3XA 3K21A 2LM5A 1NCXA 2KI4B 3BOWB 5TNCA 4PE1A 1P28A 1ALWA 4XYNA 3TUYB 1CFFA 1CDMA 2L5XB 2EGDA 1S5GY 1B9AA 3M0WA 4N5XA 1JBAA 1AK8A 1FBVA 2H2KA 1XFUO 2LCPA 1CFDA 1ZUZA 2I7AA 2LUCA 2KQYA 4JD9A 4NDBA 1CFPA 1GGWA 1NIWA 2KAYA 2JNXA 1J7RA 1KSMA 3IQQA 1FF1A 1DJWA 4GNKB 2PALA 5AXIA 1TCFA 4NDDA 4C0LA 4ETOA 1SCMC 1IIOA 1SYMA 2CXJA 2BBMA 5DKQA 2KDHA 2M0RA 2PVBA 1DF0A 3UNWA 3BUWB 1J1EA 2LHLA 1NP8A 1F4QA 2EC6B 2FJUB 3OGNA 3B86A 4JPZB 1LS8A 2BKHB 1GQMA 2BCXA 3CGAA 1DELA 1K90D 3ZNIA 2BAPA 3BUMB 4XJKA 3PSRA 4CFQA 1U5IA 1W7IB 2VRGA 2JNFA 4CIDA 2QACA 3SG5A 1IKUA 3KPXA 5KSZA 1WDCB 3OBVA 5CSJA 4ORBB 3D0YA 3IF7A 1XFZO 1M31A 3I5FB 1CM4A 3I5HB 1XFWO 4P5OE 1PALA 2JOJA 1ZOTB 1VRKA 4IL1A 5HL1A 2V53A 1OZOA 2HQ8A 1LKJA 5HYDA 2KI6D 2F2OA 5I2LA 3PJIA 1S6CA 1GGZA 2OS8C 1KQVA 3VB1A 3R1VA 4AQJA 5DKNA 1JF2A 3TZ1A 4C0JA 2JU0A
chains in the Genus database with same CATH topology
1KK7Z 3NXAA 3A4UB 1S26D 2O5GA 1IG5A 2LP3A 4GGFA 2LHIA 1UP5A 4DIRA 2JC2A 2LMVA 1TNXA 4M2OA 1DVIA 4BY4A 1DJGA 1WRKA 1AJ4A 2WCFA 5IBWA 2LMUA 1SNLA 1LA0A 2CCMA 1BR4B 2MJWB 3CR2A 2CT9A 1QX5B 1A2XA 2HQWA 1YVLA 4YGEB 1K2HA 1A75B 3QRXA 1YRUB 3EK4A 2M1UA 3D0YB 2P6BB 2WOSA 4MRXA 1XA5A 2FOTA 3I5GB 3O78A 2OS8B 1CM1A 2H61C 2NLNA 2MAZA 2WNDA 5DKRA 1OMRA 1S36A 1B1GA 1XO5A 1JFJA 1JWDA 4ORCB 1J1DA 1AHRA 4M2QA 1DTLA 4MN0A 3I5FC 4GBAA 2F2PA 3JVTB 1OE9B 3CTNA 4C0KA 2MLFC 4YI8A 2NZ0A 3EVUA 4D1EA 1F70A 1MHOA 1QJTA 2WORA 1SBJA 1QX2A 2ZNEA 1Y1XA 1ZACA 3CZTX 2OPOA 1RECA 2EC6C 1H8BA 1FI5A 1J55A 1BT6A 1G33A 5CSIA 1CDLA 2K8MB 5BPJA 1TN4A 1TRFA 1UWOA 3AKAA 3FWCA 1SCMB 1G4YR 1CLLA 3DVMA 1PK0D 1UHNA 2FCEA 1L7ZA 3BYAA 4ICBA 2MHHA 3LK0A 5I2QA 4YGBB 2DOQA 1PSBA 2KGRA 1K96A 3DF0A 1BG1A 2KSPA 5HLVA 3SG7A 1NCZA 1QS7A 1PVAA 1F4OA 1CNPA 4Q04A 4FTGA 3AAJA 2K7CA 1MXLC 1KCYA 3EK8A 3GK2A 3JVTC 5CSNA 4N1GA 2ISDA 1MQ1A 2AMIA 4WQ2A 4U8DA 2Y1MA 1NWDA 1PRWA 5HLOA 1OOJA 3OX6A 4YGAA 1IRJA 4P2YB 1SK6D 5HKZA 2K2FA 3F45A 4F0ZB 1S6IA 4QJ4B 2ZFDA 2AUCA 4DCKA 2H61A 1EG3A 2MA2A 3I5GC 1JFKA 4YRUA 1DT7B 1C07A 1XK4A 4A4BA 5KTYA 1RTP1 4MZJA 2BCAA 2BBNA 4GGFC 2M8UA 4MLWA 1Q80A 2B1UA 1DF0B 1J7OA 3CR4X 2L4IA 2LC5A 4MSPA 4GFTA 2M7LA 1HQVA 3SG6A 3TDZA 1S3PA 2F3YA 1F71A 1IH0A 2M49B 2NXQA 3KF9A 2F8PA 3WNXB 2L0PA 1OQPA 1JSAA 4A4CA 2K7OA 3BXKA 2M29A 1TNPA 1YURA 3IQOA 2KYFA 1ZMZA 3SG3A 3LCPC 2AAOA 2WC8A 3MSEB 4PCWA 1J7QA 3BUNB 3SIAA 1NYAA 1QIWA 4PHKA 4I5LB 1CKKA 1AJ5A 4YBHB 1CDPA 3E3RA 1E8AA 1SL7A 4TNCA 1CDNA 1CLMA 3I5HC 1K8UA 2M7NA 1KFXS 1WDCC 2F3ZA 4JQ0D 1YRTB 1ZFSA 3SG4A 1IWQA 3O4YA 1R6PA 4WQ3A 3ZWHA 3SIBA 5KU1A 3GK4X 2KFHA 1BODA 2BE4A 2M3WA 1DJYA 1WLZA 1JF0A 1SRAA 2KNEA 1M39A 4R1EA 4GGNA 1K95A 4GAOA 4MRYA 3TDIA 1D1OA 1M63B 2I18A 3DVJA 1F8HA 5ER4X 2K61A 2LLSA 4UPGA 1H4BA 3BUXB 3VRRA 2K7BA 5AERA 4ZCVA 1MXEA 1B7TZ 2RGIA 4OKHA 1KSOA 1A29A 3OB1B 2JT3A 4PHJA 1AVSA 1KWOC 1XFYO 4I5KA 1BU3A 1IGVA 4PE7A 1BF5A 4YGCB 4PDZA 1QLKA 1OSAA 1KFUL 4DRWA 4PALA 2Y1NA 2Y4QA 2GGMA 4ZCUA 4ORAB 2JZIA 1S1EA 4HRHA 4MEWA 3GOFA 4OCIA 1UURA 2LLTA 1UUSA 3TUYC 2KI4C 1SW8A 1MR8A 4OVNF 3OP0A 4PHMA 3PN7C 1B47A 1WRLA 3NSLA 1B4CA 5AFPA 1CLBA 4USLA 2FCDA 1BR1B 4DS7A 1KK7Y 3FIAA 2CBLA 1K9UA 1LA3A 1TTXA 1YX7A 2SASA 1DJXA 1QV0A 1SR6B 2KFFA 4QJ3B 2JRFA 1K93D 2QPTA 2KQ6A 1SY9A 1MUXA 2D8NA 1KQMB 1JC2A 1IJ6A 2LANA 1G8IA 1LVCD 3I5IC 5PALA 4CPVA 2COLB 2CNPA 5CPVA 1YUSA 1RK9A 1ALVA 1PSRA 2MRDA 3H4SE 2BL0B 5GQQC 5I8NA 3NSIA 1EL4A 1YUUA 1ODBA 1HT9A 1UHKA 3FWBA 2ZN8A 3PATA 3SG2A 2KAXA 3LK1A 1TIZA 3TS5B 2M1KB 1BMOA 1UHIA 1K9KA 1Y1UA 2GGZA 3DF0B 1BOCA 1RFJA 4OR9B 3VROA 1QTXA 2M9GA 3D10A 2K0JA 3WHTB 1V1GA 2PSRA 1MWNA 1M46A 1QX7A 2ZKMX 1OMDA 2A4JA 1V1FA 3VGOA 3OB2B 3O6BA 2PRUA 1RWYA 2HETA 1A75A 2SCPA 2KOTA 1K94A 2O60A 1M45A 2PASA 4MZLA 5K89A 2LVJA 1NSHA 2OTGC 1B8LA 2JULA 2OTGB 1FPWA 1DGVA 1SKTA 1K9PA 3TDUA 3RM1A 3VRPA 2JT0A 2KGBC 3VRQA 4HRGA 1NPQA 1NX0A 2G9BA 3SJSA 1OZSA 1N65A 2G2BA 1SL8A 3HX4A 4N1FA 2K2AA 1A03A 1F54A 1BLQA 1F55A 2BE6A 1YTZC 4L9MA 2WCEA 4AOMA 3PM8A 1S5GZ 1Y1AA 2I2RE 1BJFA 4MVFA 3KHEA 4CFRA 1UHHA 1XFVO 2JXLA 2I94A 4NQGA 2L4HA 5D7FA 3HCMA 3NSKA 2LVVA 3KEVA 3TS5C 1TOPA 4XJKB 3OHMB 4PHNA 1SL9A 2Y5IA 5D69A 2ZRSA 2LLUA 1DJZA 1C7WA 2BL0C 4HSZA 1UHJA 4YI9A 3EVVA 3A8RA 1TNWA 1NX3A 1QIVA 3NSOA 1LINA 2LV7A 4OV2A 2JTTA 5F6TA 1NX2A 3WXAA 2E30A 1NX1A 2BKIB 3JTDB 1CMGA 1X02A 2ZNDA 1L2OC 1N2DA 1W7JB 5I2OA 5G08A 5ER5A 1KK8C 1SR6C 1J7PA 1B7TY 4PE0A 2LUXA 1SCVA 2BECA 2ZN9A 3EK7A 1YR5A 2JTZA 2L50A 3BQ3A 4M2PA 1WLMA 1YX8A 3AKBA 3EKJA 1XFXO 1R2UA 1EH2A 1OMVA 1PULA 2Q91A 5B8IB 3PFVA 1EG4A 2ZRTA 4WRIA 4BY5A 2KYCA 1CTRA 2JXCA 5AEQA 1DJIA 2JPTA 5JJGA 3BOWA 2JWWA 3OX5A 1IQ5A 2LE9B 1QXPA 2KHNA 1CMFA 1KK8B 1DGUA 3ICBA 2M97A 1SMGA 1KWOB 1L2OB 1EXRA 2LAPA 3JTDC 3EVRA 3RLZA 4E68A 2EHBA 3DD4A 2KBMA 1GJYA 4PE4A 1AUIB 1CFCA 2L2EA 1KFXL 1Y6WA 1CB1A 1MF8B 2KBIA 4GUKA 1B8RA 2WCBA 5JOLA 1U5IB 2TN4A 1DJHA 2K7DA 3KO0A 1FI6A 2R2IA 3WHUB 4MBEA 1C7VA 1QLSA 2GV5A 2F33A 3FS7A 1RJVA 1QV1A 2LMTA 2NCPA 2MBXA 5HKYA 1RROA 1YUTA 3CWGA 2LNKA 2E6WA 1XK4C 2IS9A 4FQOA 1DMOA 2L51A 5AANA 2PMYA 3PALA 1QVIZ 3CR5X 1A4PA 3BUOB 1XVJA 1FW4A 2JQ6A 2LVIA 1NUBA 1AP4A 5FYXA 4I5JA 2HPSA 1IJ5A 2Q4UA 1LXFC 4I5NB 4MZKA 2LVKA 1PVBA 1KFUS 3GK1A 2MLEC 2LP2A 4GPLB 3CS1A 1B8CA 2BCBA 2KFGA 3O2PA 3C1VA 1Y0VH 1TNQA 2NCOA 3VRNA 1NCYA 3CLNA 4YGDB 5CSFA 3DVKA 4JWQA 1TCOB 1XYDA 4NDCA 1WY9A 2KI6C 1IQ3A 1EJ3A 2JT8A 3LL8B 2CTNA 1WRZA 2HF5A 2KAVA 3LLEA 1YVHA 1N0YA 3EKHA 4HREE 1QATA 3I5IB 1KQMC 3AAKA 4CLNA 1S6JA 2L98A 1QASA 1JUOA 1QVIY 4DUQA 1SPYA 4QJ5B 3DVEA 4AQIA 3PLFB 5HKWA 3PN7B 5J3XA 3K21A 2LM5A 1NCXA 2KI4B 3BOWB 5TNCA 4PE1A 3TUYB 1ALWA 4XYNA 1CFFA 1CDMA 2L5XB 2EGDA 1S5GY 1B9AA 3M0WA 4N5XA 1JBAA 1AK8A 1FBVA 2H2KA 1XFUO 2LCPA 1CFDA 1ZUZA 2I7AA 2LUCA 2KQYA 1CFPA 4NDBA 1GGWA 1NIWA 2KAYA 2JNXA 1J7RA 1KSMA 3IQQA 1FF1A 1DJWA 4GNKB 2PALA 5AXIA 1TCFA 4NDDA 4C0LA 4ETOA 1SCMC 1SYMA 2CXJA 2BBMA 5DKQA 2KDHA 2M0RA 2PVBA 1DF0A 3BUWB 1J1EA 2LHLA 1NP8A 1F4QA 2EC6B 2FJUB 4JPZB 2BKHB 1GQMA 2BCXA 3CGAA 1K90D 3ZNIA 3BUMB 4XJKA 3PSRA 4CFQA 1U5IA 1W7IB 2VRGA 2JNFA 4CIDA 2QACA 3SG5A 1IKUA 3KPXA 5KSZA 1WDCB 5CSJA 4ORBB 3D0YA 3IF7A 1XFZO 1M31A 3I5FB 1CM4A 3I5HB 1XFWO 4P5OE 1PALA 2JOJA 1ZOTB 1VRKA 4IL1A 2V53A 1OZOA 2HQ8A 1LKJA 5HYDA 2KI6D 2F2OA 5I2LA 1S6CA 1GGZA 2OS8C 1KQVA 4AQJA 5DKNA 1JF2A 3TZ1A 4C0JA 2JU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KK7 Z;  3NXA A;  3A4U B;  1S26 D;  2O5G A;  1IG5 A;  2LP3 A;  4GGF A;  2LHI A;  1UP5 A;  4DIR A;  2JC2 A;  2LMV A;  1TNX A;  4M2O A;  1DVI A;  4BY4 A;  1DJG A;  1WRK A;  1AJ4 A;  2WCF A;  5IBW A;  2LMU A;  1SNL A;  1LA0 A;  2CCM A;  1BR4 B;  2MJW B;  3CR2 A;  2CT9 A;  1QX5 B;  1A2X A;  2HQW A;  1YVL A;  4YGE B;  1K2H A;  1A75 B;  3QRX A;  1YRU B;  3EK4 A;  2M1U A;  3D0Y B;  2P6B B;  2WOS A;  4MRX A;  1XA5 A;  2FOT A;  3I5G B;  3O78 A;  2OS8 B;  1CM1 A;  2H61 C;  2NLN A;  2MAZ A;  2WND A;  5DKR A;  1OMR A;  1S36 A;  1B1G A;  1XO5 A;  1JFJ A;  1JWD A;  4ORC B;  1J1D A;  1AHR A;  4M2Q A;  1DTL A;  4MN0 A;  3I5F C;  4GBA A;  2F2P A;  3JVT B;  1OE9 B;  3CTN A;  4C0K A;  2MLF C;  4YI8 A;  2NZ0 A;  3EVU A;  4D1E A;  1F70 A;  1MHO A;  1QJT A;  2WOR A;  1SBJ A;  1QX2 A;  2ZNE A;  1Y1X A;  1ZAC A;  3CZT X;  2OPO A;  1REC A;  2EC6 C;  1H8B A;  1FI5 A;  1J55 A;  1BT6 A;  1G33 A;  5CSI A;  1CDL A;  2K8M B;  5BPJ A;  1TN4 A;  1TRF A;  1UWO A;  3AKA A;  3FWC A;  1SCM B;  1G4Y R;  1CLL A;  3DVM A;  1PK0 D;  1UHN A;  2FCE A;  1L7Z A;  3BYA A;  4ICB A;  2MHH A;  3LK0 A;  5I2Q A;  4YGB B;  2DOQ A;  1PSB A;  2KGR A;  1K96 A;  3DF0 A;  1BG1 A;  2KSP A;  5HLV A;  3SG7 A;  1NCZ A;  1QS7 A;  1PVA A;  1F4O A;  1CNP A;  4Q04 A;  4FTG A;  3AAJ A;  2K7C A;  1MXL C;  1KCY A;  3EK8 A;  3GK2 A;  3JVT C;  5CSN A;  4N1G A;  2ISD A;  1MQ1 A;  2AMI A;  4WQ2 A;  4U8D A;  2Y1M A;  1NWD A;  1PRW A;  5HLO A;  1OOJ A;  3OX6 A;  4YGA A;  1IRJ A;  4P2Y B;  1SK6 D;  5HKZ A;  2K2F A;  3F45 A;  4F0Z B;  1S6I A;  4QJ4 B;  2ZFD A;  2AUC A;  4DCK A;  2H61 A;  1EG3 A;  2MA2 A;  3I5G C;  1JFK A;  4YRU A;  1DT7 B;  1C07 A;  1XK4 A;  4A4B A;  5KTY A;  1RTP 1;  4MZJ A;  2BCA A;  2BBN A;  4GGF C;  2M8U A;  4MLW A;  1Q80 A;  2B1U A;  1DF0 B;  1J7O A;  3CR4 X;  2L4I A;  2LC5 A;  4MSP A;  4GFT A;  2M7L A;  1HQV A;  3SG6 A;  3TDZ A;  1S3P A;  2F3Y A;  1F71 A;  1IH0 A;  2M49 B;  2NXQ A;  3KF9 A;  2F8P A;  3WNX B;  2L0P A;  1OQP A;  1JSA A;  4A4C A;  2K7O A;  3BXK A;  2M29 A;  1TNP A;  1YUR A;  3IQO A;  2KYF A;  1ZMZ A;  3SG3 A;  3LCP C;  2AAO A;  2WC8 A;  3MSE B;  4PCW A;  1J7Q A;  3BUN B;  3SIA A;  1NYA A;  1QIW A;  4PHK A;  4I5L B;  1CKK A;  1AJ5 A;  4YBH B;  1CDP A;  3E3R A;  1E8A A;  1SL7 A;  4TNC A;  1CDN A;  1CLM A;  3I5H C;  1K8U A;  2M7N A;  1KFX S;  1WDC C;  2F3Z A;  4JQ0 D;  1YRT B;  1ZFS A;  3SG4 A;  1IWQ A;  3O4Y A;  1R6P A;  4WQ3 A;  3ZWH A;  3SIB A;  5KU1 A;  3GK4 X;  2KFH A;  1BOD A;  2BE4 A;  2M3W A;  1DJY A;  1WLZ A;  1JF0 A;  1SRA A;  2KNE A;  1M39 A;  4R1E A;  4GGN A;  1K95 A;  4GAO A;  4MRY A;  3TDI A;  1D1O A;  1M63 B;  2I18 A;  3DVJ A;  1F8H A;  5ER4 X;  2K61 A;  2LLS A;  4UPG A;  1H4B A;  3BUX B;  3VRR A;  2K7B A;  5AER A;  4ZCV A;  1MXE A;  1B7T Z;  2RGI A;  4OKH A;  1KSO A;  1A29 A;  3OB1 B;  2JT3 A;  4PHJ A;  1AVS A;  1KWO C;  1XFY O;  4I5K A;  1BU3 A;  1IGV A;  4PE7 A;  1BF5 A;  4YGC B;  4PDZ A;  1QLK A;  1OSA A;  1KFU L;  4DRW A;  4PAL A;  2Y1N A;  2Y4Q A;  2GGM A;  4ZCU A;  4ORA B;  2JZI A;  1S1E A;  4HRH A;  4MEW A;  3GOF A;  4OCI A;  1UUR A;  2LLT A;  1UUS A;  3TUY C;  2KI4 C;  1SW8 A;  1MR8 A;  4OVN F;  3OP0 A;  4PHM A;  3PN7 C;  1B47 A;  1WRL A;  3NSL A;  1B4C A;  5AFP A;  1CLB A;  4USL A;  2FCD A;  1BR1 B;  4DS7 A;  1KK7 Y;  3FIA A;  2CBL A;  1K9U A;  1LA3 A;  1TTX A;  1YX7 A;  2SAS A;  1DJX A;  1QV0 A;  1SR6 B;  2KFF A;  4QJ3 B;  2JRF A;  1K93 D;  2QPT A;  2KQ6 A;  1SY9 A;  1MUX A;  2D8N A;  1KQM B;  1JC2 A;  1IJ6 A;  2LAN A;  1G8I A;  1LVC D;  3I5I C;  5PAL A;  4CPV A;  2COL B;  2CNP A;  5CPV A;  1YUS A;  1RK9 A;  1ALV A;  1PSR A;  2MRD A;  3H4S E;  2BL0 B;  5GQQ C;  5I8N A;  3NSI A;  1EL4 A;  1YUU A;  1ODB A;  1HT9 A;  1UHK A;  3FWB A;  2ZN8 A;  3PAT A;  3SG2 A;  2KAX A;  3LK1 A;  1TIZ A;  3TS5 B;  2M1K B;  1BMO A;  1UHI A;  1K9K A;  1Y1U A;  2GGZ A;  3DF0 B;  1BOC A;  1RFJ A;  4OR9 B;  3VRO A;  1QTX A;  2M9G A;  3D10 A;  2K0J A;  3WHT B;  1V1G A;  2PSR A;  1MWN A;  1M46 A;  1QX7 A;  2ZKM X;  1OMD A;  2A4J A;  1V1F A;  3VGO A;  3OB2 B;  3O6B A;  2PRU A;  1RWY A;  2HET A;  1A75 A;  2SCP A;  2KOT A;  1K94 A;  2O60 A;  1M45 A;  2PAS A;  4MZL A;  5K89 A;  2LVJ A;  1NSH A;  2OTG C;  1B8L A;  2JUL A;  2OTG B;  1FPW A;  1DGV A;  1SKT A;  1K9P A;  3TDU A;  3RM1 A;  3VRP A;  2JT0 A;  2KGB C;  3VRQ A;  4HRG A;  1NPQ A;  1NX0 A;  2G9B A;  3SJS A;  1OZS A;  1N65 A;  2G2B A;  1SL8 A;  3HX4 A;  4N1F A;  2K2A A;  1A03 A;  1F54 A;  1BLQ A;  1F55 A;  2BE6 A;  1YTZ C;  4L9M A;  2WCE A;  4AOM A;  3PM8 A;  1S5G Z;  1Y1A A;  2I2R E;  1BJF A;  4MVF A;  3KHE A;  4CFR A;  1UHH A;  1XFV O;  2JXL A;  2I94 A;  4NQG A;  2L4H A;  5D7F A;  3HCM A;  3NSK A;  2LVV A;  3KEV A;  3TS5 C;  1TOP A;  4XJK B;  3OHM B;  4PHN A;  1SL9 A;  2Y5I A;  5D69 A;  2ZRS A;  2LLU A;  1DJZ A;  1C7W A;  2BL0 C;  4HSZ A;  1UHJ A;  4YI9 A;  3EVV A;  3A8R A;  1TNW A;  1NX3 A;  1QIV A;  3NSO A;  1LIN A;  2LV7 A;  4OV2 A;  2JTT A;  5F6T A;  1NX2 A;  3WXA A;  2E30 A;  1NX1 A;  2BKI B;  3JTD B;  1CMG A;  1X02 A;  2ZND A;  1L2O C;  1N2D A;  1W7J B;  5I2O A;  5G08 A;  5ER5 A;  1KK8 C;  1SR6 C;  1J7P A;  1B7T Y;  4PE0 A;  2LUX A;  1SCV A;  2BEC A;  2ZN9 A;  3EK7 A;  1YR5 A;  2JTZ A;  2L50 A;  3BQ3 A;  4M2P A;  1WLM A;  1YX8 A;  3AKB A;  3EKJ A;  1XFX O;  1R2U A;  1EH2 A;  1OMV A;  1PUL A;  2Q91 A;  5B8I B;  3PFV A;  1EG4 A;  2ZRT A;  4WRI A;  4BY5 A;  2KYC A;  1CTR A;  2JXC A;  5AEQ A;  1DJI A;  2JPT A;  5JJG A;  3BOW A;  2JWW A;  3OX5 A;  1IQ5 A;  2LE9 B;  1QXP A;  2KHN A;  1CMF A;  1KK8 B;  1DGU A;  3ICB A;  2M97 A;  1SMG A;  1KWO B;  1L2O B;  1EXR A;  2LAP A;  3JTD C;  3EVR A;  3RLZ A;  4E68 A;  2EHB A;  3DD4 A;  2KBM A;  1GJY A;  4PE4 A;  1AUI B;  1CFC A;  2L2E A;  1KFX L;  1Y6W A;  1CB1 A;  1MF8 B;  2KBI A;  4GUK A;  1B8R A;  2WCB A;  5JOL A;  1U5I B;  2TN4 A;  1DJH A;  2K7D A;  3KO0 A;  1FI6 A;  2R2I A;  3WHU B;  4MBE A;  1C7V A;  1QLS A;  2GV5 A;  2F33 A;  3FS7 A;  1RJV A;  1QV1 A;  2LMT A;  2NCP A;  2MBX A;  5HKY A;  1RRO A;  1YUT A;  3CWG A;  2LNK A;  2E6W A;  1XK4 C;  2IS9 A;  4FQO A;  1DMO A;  2L51 A;  5AAN A;  2PMY A;  3PAL A;  1QVI Z;  3CR5 X;  1A4P A;  3BUO B;  1XVJ A;  1FW4 A;  2JQ6 A;  2LVI A;  1NUB A;  1AP4 A;  5FYX A;  4I5J A;  2HPS A;  1IJ5 A;  2Q4U A;  1LXF C;  4I5N B;  4MZK A;  2LVK A;  1PVB A;  1KFU S;  3GK1 A;  2MLE C;  2LP2 A;  4GPL B;  3CS1 A;  1B8C A;  2BCB A;  2KFG A;  3O2P A;  3C1V A;  1Y0V H;  1TNQ A;  2NCO A;  3VRN A;  1NCY A;  3CLN A;  4YGD B;  5CSF A;  3DVK A;  4JWQ A;  1TCO B;  1XYD A;  4NDC A;  1WY9 A;  2KI6 C;  1IQ3 A;  1EJ3 A;  2JT8 A;  3LL8 B;  2CTN A;  1WRZ A;  2HF5 A;  2KAV A;  3LLE A;  1YVH A;  1N0Y A;  3EKH A;  4HRE E;  1QAT A;  3I5I B;  1KQM C;  3AAK A;  4CLN A;  1S6J A;  2L98 A;  1QAS A;  1JUO A;  1QVI Y;  4DUQ A;  1SPY A;  4QJ5 B;  3DVE A;  4AQI A;  3PLF B;  5HKW A;  3PN7 B;  5J3X A;  3K21 A;  2LM5 A;  1NCX A;  2KI4 B;  3BOW B;  5TNC A;  4PE1 A;  3TUY B;  1ALW A;  4XYN A;  1CFF A;  1CDM A;  2L5X B;  2EGD A;  1S5G Y;  1B9A A;  3M0W A;  4N5X A;  1JBA A;  1AK8 A;  1FBV A;  2H2K A;  1XFU O;  2LCP A;  1CFD A;  1ZUZ A;  2I7A A;  2LUC A;  2KQY A;  1CFP A;  4NDB A;  1GGW A;  1NIW A;  2KAY A;  2JNX A;  1J7R A;  1KSM A;  3IQQ A;  1FF1 A;  1DJW A;  4GNK B;  2PAL A;  5AXI A;  1TCF A;  4NDD A;  4C0L A;  4ETO A;  1SCM C;  1SYM A;  2CXJ A;  2BBM A;  5DKQ A;  2KDH A;  2M0R A;  2PVB A;  1DF0 A;  3BUW B;  1J1E A;  2LHL A;  1NP8 A;  1F4Q A;  2EC6 B;  2FJU B;  4JPZ B;  2BKH B;  1GQM A;  2BCX A;  3CGA A;  1K90 D;  3ZNI A;  3BUM B;  4XJK A;  3PSR A;  4CFQ A;  1U5I A;  1W7I B;  2VRG A;  2JNF A;  4CID A;  2QAC A;  3SG5 A;  1IKU A;  3KPX A;  5KSZ A;  1WDC B;  5CSJ A;  4ORB B;  3D0Y A;  3IF7 A;  1XFZ O;  1M31 A;  3I5F B;  1CM4 A;  3I5H B;  1XFW O;  4P5O E;  1PAL A;  2JOJ A;  1ZOT B;  1VRK A;  4IL1 A;  2V53 A;  1OZO A;  2HQ8 A;  1LKJ A;  5HYD A;  2KI6 D;  2F2O A;  5I2L A;  1S6C A;  1GGZ A;  2OS8 C;  1KQV A;  4AQJ A;  5DKN A;  1JF2 A;  3TZ1 A;  4C0J A;  2JU0 A; 
#chains in the Genus database with same CATH topology
 1KK7 Z;  2KLE A;  3NXA A;  3A4U B;  1S26 D;  3S0B A;  2O5G A;  1IG5 A;  2LP3 A;  4GGF A;  2LHI A;  1UP5 A;  4DIR A;  2P70 A;  2JC2 A;  2LMV A;  3S0E A;  1TNX A;  4JKT A;  4M2O A;  3UO9 A;  1DVI A;  4BY4 A;  1DJG A;  1WRK A;  1AJ4 A;  2WCF A;  5IBW A;  2LMU A;  1SNL A;  1LA0 A;  2CCM A;  1BR4 B;  3S0A A;  2MJW B;  4INX A;  3CR2 A;  2CT9 A;  1QX5 B;  1A2X A;  2HQW A;  1YVL A;  2WCM A;  4YGE B;  1A75 B;  3B87 A;  3QRX A;  1YRU B;  3EK4 A;  1K2H A;  2M1U A;  2K60 A;  3D0Y B;  2P6B B;  2WOS A;  4MRX A;  1XA5 A;  3SS4 A;  2FOT A;  3I5G B;  3O78 A;  2OS8 B;  1CM1 A;  2H61 C;  2NLN A;  2MAZ A;  2WND A;  5DKR A;  1OMR A;  1S36 A;  1B1G A;  1XO5 A;  1JFJ A;  1JWD A;  4ORC B;  1J1D A;  3FE9 A;  1AHR A;  4M2Q A;  1DTL A;  2QEO A;  4MN0 A;  3I5F C;  4GBA A;  2F2P A;  2JPO A;  3JVT B;  1OE9 B;  3CTN A;  1T14 A;  4C0K A;  2MLF C;  4YI8 A;  2NZ0 A;  3S0G A;  3EVU A;  4D1E A;  1F70 A;  1MHO A;  1QJT A;  2WCJ A;  2WOR A;  1OOH A;  1SBJ A;  1QX2 A;  2BNX A;  1Y1X A;  1ZAC A;  2ZNE A;  2OPO A;  3CZT X;  1REC A;  2EC6 C;  1H8B A;  1FI5 A;  3R1P A;  1J55 A;  1BT6 A;  1G33 A;  5CSI A;  1CDL A;  2K8M B;  2QEH A;  4FQT A;  5BPJ A;  1TN4 A;  1TRF A;  1UWO A;  3AKA A;  3FWC A;  3B88 A;  1SCM B;  1G4Y R;  1CLL A;  3DVM A;  3DY9 A;  1PK0 D;  1UHN A;  5D3O A;  2FCE A;  1L7Z A;  2PQL A;  3BYA A;  4ICB A;  4OZD A;  3D76 A;  2YGU A;  2MHH A;  3LK0 A;  5I2Q A;  4YGB B;  2DOQ A;  1PSB A;  2KGR A;  1K96 A;  3DF0 A;  1BG1 A;  2KSP A;  5HLV A;  3SG7 A;  1OOI X;  1NCZ A;  1QS7 A;  1PVA A;  1F4O A;  2WCH A;  1CNP A;  4Q04 A;  4FTG A;  3AAJ A;  2K7C A;  1MXL C;  1KCY A;  3EK8 A;  3GK2 A;  3JVT C;  5CSN A;  4N1G A;  2ISD A;  1MQ1 A;  2AMI A;  4WQ2 A;  4U8D A;  2Y1M A;  1NWD A;  1PRW A;  5HLO A;  1OOJ A;  3OX6 A;  4YGA A;  1IRJ A;  4P2Y B;  1SK6 D;  3FE8 A;  2K2F A;  3F45 A;  5HKZ A;  4F0Z B;  1S6I A;  4QJ4 B;  2ZFD A;  2AUC A;  4DCK A;  2H61 A;  1EG3 A;  2MA2 A;  4IJ7 A;  3I5G C;  1JFK A;  4YRU A;  1DT7 B;  2P71 A;  1C07 A;  3CZ2 A;  1XK4 A;  4A4B A;  5KTY A;  1RTP 1;  2WC5 A;  4MZJ A;  3CYZ A;  2BCA A;  2BBN A;  4GGF C;  2M8U A;  4MLW A;  1Q80 A;  2B1U A;  1DF0 B;  5I94 A;  1J7O A;  3CR4 X;  2L4I A;  2LC5 A;  4MSP A;  4GFT A;  2M7L A;  1HQV A;  3SG6 A;  3TDZ A;  1S3P A;  2F3Y A;  1F71 A;  2WCL A;  1IH0 A;  3BFA A;  2M49 B;  2NXQ A;  3KF9 A;  5EL2 A;  2F8P A;  1TUJ A;  3WNX B;  2L0P A;  1OQP A;  1JSA A;  4A4C A;  2K7O A;  3CDN A;  3BXK A;  2L2C A;  2M29 A;  1TNP A;  1YUR A;  3IQO A;  2KYF A;  1ZMZ A;  3SG3 A;  1OOG A;  1Z4H A;  3LCP C;  2AAO A;  2WC8 A;  3MSE B;  4PCW A;  1J7Q A;  3BUN B;  3BFB A;  1NYA A;  1QIW A;  4PHK A;  4I5L B;  3SIA A;  1CKK A;  1AJ5 A;  3SS5 A;  4QJ3 B;  4YBH B;  1CDP A;  3E3R A;  1E8A A;  1SL7 A;  4TNC A;  1CDN A;  1CLM A;  3I5H C;  1K8U A;  2KLD A;  2M7N A;  2QEV A;  1KFX S;  3RZS A;  1WDC C;  2F3Z A;  4JQ0 D;  1YRT B;  1ZFS A;  3SG4 A;  1IWQ A;  3O4Y A;  1R6P A;  4WQ3 A;  3ZWH A;  3SIB A;  1DEK A;  5KU1 A;  3GK4 X;  1ORG A;  2KFH A;  1BOD A;  2BE4 A;  3QME A;  2M3W A;  1DJY A;  1WLZ A;  1JF0 A;  1SRA A;  2KNE A;  1M39 A;  4R1E A;  3V2L A;  4GGN A;  1K95 A;  3CZ0 A;  3R72 A;  4GAO A;  3D75 A;  4MRY A;  3TDI A;  1D1O A;  1M63 B;  2I18 A;  3DVJ A;  3L4L A;  1F8H A;  5ER4 X;  1C3Y A;  2K61 A;  2LLS A;  3O4X A;  4UPG A;  1H4B A;  3BUX B;  3VRR A;  1TUZ A;  1SSE B;  2K7B A;  5AER A;  4ZCV A;  1MXE A;  1B7T Z;  2RGI A;  4OKH A;  1KSO A;  1A29 A;  3OB1 B;  2JT3 A;  4PHJ A;  1AVS A;  1KWO C;  3CAB A;  1XFY O;  3SS3 A;  4I5K A;  1BU3 A;  1IGV A;  4PE7 A;  1BF5 A;  4YGC B;  4PDZ A;  1QLK A;  1OSA A;  1KFU L;  4DRW A;  5DIC A;  4PAL A;  2Y1N A;  2Y4Q A;  2GGM A;  4ZCU A;  4ORA B;  2JZI A;  1S1E A;  4HRH A;  4MEW A;  3GOF A;  4OCI A;  1UUR A;  2LLT A;  1UUS A;  3TUY C;  2KI4 C;  1SW8 A;  1MR8 A;  4OVN F;  3OP0 A;  4PHM A;  3PN7 C;  1B47 A;  1WRL A;  3Q8I A;  3NSL A;  1B4C A;  5AFP A;  1CLB A;  4USL A;  3BFH A;  2FCD A;  1BR1 B;  3PM2 A;  4DS7 A;  1KK7 Y;  1QWV A;  3FIA A;  2CBL A;  1K9U A;  1LA3 A;  1TTX A;  1YX7 A;  2SAS A;  1DJX A;  1QV0 A;  1SR6 B;  2KFF A;  3D73 A;  2JRF A;  1K93 D;  2QPT A;  5FI7 A;  2KQ6 A;  1SY9 A;  1MUX A;  2D8N A;  1KQM B;  1JC2 A;  1IJ6 A;  2LAN A;  1G8I A;  1LVC D;  3I5I C;  5PAL A;  4CPV A;  2COL B;  2CNP A;  5CPV A;  1YUS A;  1RK9 A;  1ALV A;  1PSR A;  2MRD A;  3H4S E;  2BL0 B;  5GQQ C;  2ERB A;  3NSI A;  1EL4 A;  5I8N A;  1YUU A;  1ODB A;  1HT9 A;  1UHK A;  3FWB A;  2ZN8 A;  3PAT A;  3SG2 A;  2KAX A;  3LK1 A;  4INW A;  1TIZ A;  3TS5 B;  2M1K B;  1BMO A;  1UHI A;  1K9K A;  1Y1U A;  2GGZ A;  3D74 A;  3DF0 B;  1RFJ A;  4OR9 B;  3VRO A;  1BOC A;  1QTX A;  2M9G A;  3D10 A;  2K0J A;  3CZ1 A;  2H8V A;  3WHT B;  1V1G A;  2PSR A;  1MWN A;  1M46 A;  1QX7 A;  2ZKM X;  1OMD A;  2A4J A;  3S0D A;  1V1F A;  3VGO A;  3OB2 B;  3O6B A;  2PRU A;  1RWY A;  2HET A;  1A75 A;  2SCP A;  2KOT A;  1K94 A;  2O60 A;  1M45 A;  2PAS A;  4MZL A;  5K89 A;  2LVJ A;  1NSH A;  2OTG C;  1B8L A;  2JUL A;  2OTG B;  1FPW A;  1DGV A;  1SKT A;  1K9P A;  3TDU A;  3RM1 A;  3VRP A;  2JT0 A;  2KGB C;  3VRQ A;  4HRG A;  1NPQ A;  1NX0 A;  2G9B A;  3SJS A;  3NHI A;  1OZS A;  1N65 A;  2G2B A;  1SL8 A;  3HX4 A;  4N1F A;  2K2A A;  1A03 A;  1F54 A;  1BLQ A;  1F55 A;  2BE6 A;  1YTZ C;  4L9M A;  2WCE A;  4AOM A;  3PM8 A;  1S5G Z;  1Y1A A;  2I2R E;  1BJF A;  4MVF A;  3D77 A;  3KHE A;  1UHH A;  1XFV O;  3NGV A;  4CFR A;  2JXL A;  2I94 A;  4NQG A;  2L4H A;  3B7A A;  3HCM A;  5D7F A;  3NSK A;  2LVV A;  3KEV A;  3TS5 C;  3L4A A;  1TOP A;  2WCK A;  3OHM B;  4PHN A;  4XJK B;  1SL9 A;  2Y5I A;  5D69 A;  1XFR A;  2ZRS A;  2LLU A;  1DJZ A;  1C7W A;  2BL0 C;  3DXL A;  1UHJ A;  4HSZ A;  4YI9 A;  3EVV A;  3A8R A;  1TNW A;  1NX3 A;  1QIV A;  3NSO A;  1LIN A;  2LV7 A;  3DYE A;  4OV2 A;  2JTT A;  5F6T A;  1NX2 A;  3WXA A;  2E30 A;  1NX1 A;  2BKI B;  3JTD B;  3B6X A;  1CMG A;  1X02 A;  2PYQ A;  2ZND A;  1L2O C;  1N2D A;  1W7J B;  5I2O A;  4PT1 A;  5G08 A;  1C3Z A;  1KK8 C;  1SR6 C;  3K1E A;  5ER5 A;  1J7P A;  2FJY A;  1B7T Y;  4PE0 A;  1DC1 A;  2LUX A;  1SCV A;  2BEC A;  2ZN9 A;  3EK7 A;  1W9Z A;  3N7H A;  1YR5 A;  2JTZ A;  2L50 A;  3BQ3 A;  4M2P A;  1WLM A;  1YX8 A;  3AKB A;  2KPH A;  3EKJ A;  1XFX O;  1R2U A;  1EH2 A;  1OMV A;  1Z2C B;  1PUL A;  2Q91 A;  5B8I B;  3PFV A;  1EG4 A;  2ZRT A;  4WRI A;  4BY5 A;  2KYC A;  1CTR A;  2JXC A;  5AEQ A;  1DJI A;  2JPT A;  5JJG A;  3BOW A;  2JWW A;  3OX5 A;  1IQ5 A;  2LE9 B;  1QXP A;  2KHN A;  1CMF A;  4F7F A;  1KK8 B;  1DGU A;  3ICB A;  2M97 A;  1SMG A;  1KWO B;  1L2O B;  1EXR A;  2LAP A;  3JTD C;  3EVR A;  3RLZ A;  4E68 A;  2EHB A;  2GTE A;  3DD4 A;  2QDI A;  3FE6 A;  1GM0 A;  2KBM A;  1GJY A;  4PE4 A;  1AUI B;  1CFC A;  2QEB A;  2L2E A;  1KFX L;  1TWO A;  1Y6W A;  1CB1 A;  1MF8 B;  2KBI A;  4GUK A;  1B8R A;  2WCB A;  5JOL A;  1U5I B;  2TN4 A;  1DJH A;  2K7D A;  3KO0 A;  3L47 A;  2R2I A;  3WHU B;  1FI6 A;  4MBE A;  1C7V A;  1QLS A;  2GV5 A;  2F33 A;  3FS7 A;  1DQE A;  1QV1 A;  1RJV A;  2LMT A;  2NCP A;  3IVT A;  2MBX A;  5HKY A;  1RRO A;  1YUT A;  3CWG A;  5FI6 A;  2LNK A;  2E6W A;  1XK4 C;  2IS9 A;  4FQO A;  1DMO A;  2L51 A;  3DZT A;  2PMY A;  3PAL A;  5AAN A;  1QVI Z;  3CR5 X;  1A4P A;  3BUO B;  1XVJ A;  1FW4 A;  2JQ6 A;  2LVI A;  1NUB A;  1AP4 A;  5FYX A;  4I5J A;  2HPS A;  1IJ5 A;  2Q4U A;  1LXF C;  4I5N B;  4MZK A;  2LVK A;  1PVB A;  1KFU S;  3GK1 A;  2MLE C;  2LP2 A;  4GPL B;  3CS1 A;  4KYN A;  1B8C A;  2BCB A;  2KFG A;  3O2P A;  3C1V A;  2WC6 A;  1Y0V H;  1TNQ A;  2NCO A;  3VRN A;  3R1O A;  1NCY A;  3CLN A;  4YGD B;  5CSF A;  3DVK A;  4JWQ A;  3NHT A;  1OW4 A;  1TCO B;  1XYD A;  3S0F A;  4NDC A;  1WY9 A;  2KI6 C;  1IQ3 A;  1EJ3 A;  2JT8 A;  3D78 A;  2CTN A;  1OOF A;  1WRZ A;  2HF5 A;  2KAV A;  3LL8 B;  1YVH A;  3LLE A;  1N0Y A;  3EKH A;  4HRE E;  1QAT A;  3I5I B;  1KQM C;  3EG5 B;  3AAK A;  4CLN A;  1S6J A;  2L98 A;  1QAS A;  1JUO A;  3BJH A;  1QVI Y;  4DUQ A;  1SPY A;  4QJ5 B;  3DVE A;  4AQI A;  5FI2 A;  3PLF B;  5HKW A;  3PN7 B;  2L5Y A;  5J3X A;  3K21 A;  2LM5 A;  1NCX A;  2KI4 B;  3BOW B;  5TNC A;  4PE1 A;  1P28 A;  1ALW A;  4XYN A;  3TUY B;  1CFF A;  1CDM A;  2L5X B;  2EGD A;  1S5G Y;  1B9A A;  3M0W A;  4N5X A;  1JBA A;  1AK8 A;  1FBV A;  2H2K A;  1XFU O;  2LCP A;  1CFD A;  1ZUZ A;  2I7A A;  2LUC A;  2KQY A;  4JD9 A;  4NDB A;  1CFP A;  1GGW A;  1NIW A;  2KAY A;  2JNX A;  1J7R A;  1KSM A;  3IQQ A;  1FF1 A;  1DJW A;  4GNK B;  2PAL A;  5AXI A;  1TCF A;  4NDD A;  4C0L A;  4ETO A;  1SCM C;  1IIO A;  1SYM A;  2CXJ A;  2BBM A;  5DKQ A;  2KDH A;  2M0R A;  2PVB A;  1DF0 A;  3UNW A;  3BUW B;  1J1E A;  2LHL A;  1NP8 A;  1F4Q A;  2EC6 B;  2FJU B;  3OGN A;  3B86 A;  4JPZ B;  1LS8 A;  2BKH B;  1GQM A;  2BCX A;  3CGA A;  1DEL A;  1K90 D;  3ZNI A;  2BAP A;  3BUM B;  4XJK A;  3PSR A;  4CFQ A;  1U5I A;  1W7I B;  2VRG A;  2JNF A;  4CID A;  2QAC A;  3SG5 A;  1IKU A;  3KPX A;  5KSZ A;  1WDC B;  3OBV A;  5CSJ A;  4ORB B;  3D0Y A;  3IF7 A;  1XFZ O;  1M31 A;  3I5F B;  1CM4 A;  3I5H B;  1XFW O;  4P5O E;  1PAL A;  2JOJ A;  1ZOT B;  1VRK A;  4IL1 A;  5HL1 A;  2V53 A;  1OZO A;  2HQ8 A;  1LKJ A;  5HYD A;  2KI6 D;  2F2O A;  5I2L A;  3PJI A;  1S6C A;  1GGZ A;  2OS8 C;  1KQV A;  3VB1 A;  3R1V A;  4AQJ A;  5DKN A;  1JF2 A;  3TZ1 A;  4C0J A;  2JU0 A; 
#chains in the Genus database with same CATH homology
 1KK7 Z;  3NXA A;  3A4U B;  1S26 D;  2O5G A;  1IG5 A;  2LP3 A;  4GGF A;  2LHI A;  1UP5 A;  4DIR A;  2JC2 A;  2LMV A;  1TNX A;  4M2O A;  1DVI A;  4BY4 A;  1DJG A;  1WRK A;  1AJ4 A;  2WCF A;  5IBW A;  2LMU A;  1SNL A;  1LA0 A;  2CCM A;  1BR4 B;  2MJW B;  3CR2 A;  2CT9 A;  1QX5 B;  1A2X A;  2HQW A;  1YVL A;  4YGE B;  1K2H A;  1A75 B;  3QRX A;  1YRU B;  3EK4 A;  2M1U A;  3D0Y B;  2P6B B;  2WOS A;  4MRX A;  1XA5 A;  2FOT A;  3I5G B;  3O78 A;  2OS8 B;  1CM1 A;  2H61 C;  2NLN A;  2MAZ A;  2WND A;  5DKR A;  1OMR A;  1S36 A;  1B1G A;  1XO5 A;  1JFJ A;  1JWD A;  4ORC B;  1J1D A;  1AHR A;  4M2Q A;  1DTL A;  4MN0 A;  3I5F C;  4GBA A;  2F2P A;  3JVT B;  1OE9 B;  3CTN A;  4C0K A;  2MLF C;  4YI8 A;  2NZ0 A;  3EVU A;  4D1E A;  1F70 A;  1MHO A;  1QJT A;  2WOR A;  1SBJ A;  1QX2 A;  2ZNE A;  1Y1X A;  1ZAC A;  3CZT X;  2OPO A;  1REC A;  2EC6 C;  1H8B A;  1FI5 A;  1J55 A;  1BT6 A;  1G33 A;  5CSI A;  1CDL A;  2K8M B;  5BPJ A;  1TN4 A;  1TRF A;  1UWO A;  3AKA A;  3FWC A;  1SCM B;  1G4Y R;  1CLL A;  3DVM A;  1PK0 D;  1UHN A;  2FCE A;  1L7Z A;  3BYA A;  4ICB A;  2MHH A;  3LK0 A;  5I2Q A;  4YGB B;  2DOQ A;  1PSB A;  2KGR A;  1K96 A;  3DF0 A;  1BG1 A;  2KSP A;  5HLV A;  3SG7 A;  1NCZ A;  1QS7 A;  1PVA A;  1F4O A;  1CNP A;  4Q04 A;  4FTG A;  3AAJ A;  2K7C A;  1MXL C;  1KCY A;  3EK8 A;  3GK2 A;  3JVT C;  5CSN A;  4N1G A;  2ISD A;  1MQ1 A;  2AMI A;  4WQ2 A;  4U8D A;  2Y1M A;  1NWD A;  1PRW A;  5HLO A;  1OOJ A;  3OX6 A;  4YGA A;  1IRJ A;  4P2Y B;  1SK6 D;  5HKZ A;  2K2F A;  3F45 A;  4F0Z B;  1S6I A;  4QJ4 B;  2ZFD A;  2AUC A;  4DCK A;  2H61 A;  1EG3 A;  2MA2 A;  3I5G C;  1JFK A;  4YRU A;  1DT7 B;  1C07 A;  1XK4 A;  4A4B A;  5KTY A;  1RTP 1;  4MZJ A;  2BCA A;  2BBN A;  4GGF C;  2M8U A;  4MLW A;  1Q80 A;  2B1U A;  1DF0 B;  1J7O A;  3CR4 X;  2L4I A;  2LC5 A;  4MSP A;  4GFT A;  2M7L A;  1HQV A;  3SG6 A;  3TDZ A;  1S3P A;  2F3Y A;  1F71 A;  1IH0 A;  2M49 B;  2NXQ A;  3KF9 A;  2F8P A;  3WNX B;  2L0P A;  1OQP A;  1JSA A;  4A4C A;  2K7O A;  3BXK A;  2M29 A;  1TNP A;  1YUR A;  3IQO A;  2KYF A;  1ZMZ A;  3SG3 A;  3LCP C;  2AAO A;  2WC8 A;  3MSE B;  4PCW A;  1J7Q A;  3BUN B;  3SIA A;  1NYA A;  1QIW A;  4PHK A;  4I5L B;  1CKK A;  1AJ5 A;  4YBH B;  1CDP A;  3E3R A;  1E8A A;  1SL7 A;  4TNC A;  1CDN A;  1CLM A;  3I5H C;  1K8U A;  2M7N A;  1KFX S;  1WDC C;  2F3Z A;  4JQ0 D;  1YRT B;  1ZFS A;  3SG4 A;  1IWQ A;  3O4Y A;  1R6P A;  4WQ3 A;  3ZWH A;  3SIB A;  5KU1 A;  3GK4 X;  2KFH A;  1BOD A;  2BE4 A;  2M3W A;  1DJY A;  1WLZ A;  1JF0 A;  1SRA A;  2KNE A;  1M39 A;  4R1E A;  4GGN A;  1K95 A;  4GAO A;  4MRY A;  3TDI A;  1D1O A;  1M63 B;  2I18 A;  3DVJ A;  1F8H A;  5ER4 X;  2K61 A;  2LLS A;  4UPG A;  1H4B A;  3BUX B;  3VRR A;  2K7B A;  5AER A;  4ZCV A;  1MXE A;  1B7T Z;  2RGI A;  4OKH A;  1KSO A;  1A29 A;  3OB1 B;  2JT3 A;  4PHJ A;  1AVS A;  1KWO C;  1XFY O;  4I5K A;  1BU3 A;  1IGV A;  4PE7 A;  1BF5 A;  4YGC B;  4PDZ A;  1QLK A;  1OSA A;  1KFU L;  4DRW A;  4PAL A;  2Y1N A;  2Y4Q A;  2GGM A;  4ZCU A;  4ORA B;  2JZI A;  1S1E A;  4HRH A;  4MEW A;  3GOF A;  4OCI A;  1UUR A;  2LLT A;  1UUS A;  3TUY C;  2KI4 C;  1SW8 A;  1MR8 A;  4OVN F;  3OP0 A;  4PHM A;  3PN7 C;  1B47 A;  1WRL A;  3NSL A;  1B4C A;  5AFP A;  1CLB A;  4USL A;  2FCD A;  1BR1 B;  4DS7 A;  1KK7 Y;  3FIA A;  2CBL A;  1K9U A;  1LA3 A;  1TTX A;  1YX7 A;  2SAS A;  1DJX A;  1QV0 A;  1SR6 B;  2KFF A;  4QJ3 B;  2JRF A;  1K93 D;  2QPT A;  2KQ6 A;  1SY9 A;  1MUX A;  2D8N A;  1KQM B;  1JC2 A;  1IJ6 A;  2LAN A;  1G8I A;  1LVC D;  3I5I C;  5PAL A;  4CPV A;  2COL B;  2CNP A;  5CPV A;  1YUS A;  1RK9 A;  1ALV A;  1PSR A;  2MRD A;  3H4S E;  2BL0 B;  5GQQ C;  5I8N A;  3NSI A;  1EL4 A;  1YUU A;  1ODB A;  1HT9 A;  1UHK A;  3FWB A;  2ZN8 A;  3PAT A;  3SG2 A;  2KAX A;  3LK1 A;  1TIZ A;  3TS5 B;  2M1K B;  1BMO A;  1UHI A;  1K9K A;  1Y1U A;  2GGZ A;  3DF0 B;  1BOC A;  1RFJ A;  4OR9 B;  3VRO A;  1QTX A;  2M9G A;  3D10 A;  2K0J A;  3WHT B;  1V1G A;  2PSR A;  1MWN A;  1M46 A;  1QX7 A;  2ZKM X;  1OMD A;  2A4J A;  1V1F A;  3VGO A;  3OB2 B;  3O6B A;  2PRU A;  1RWY A;  2HET A;  1A75 A;  2SCP A;  2KOT A;  1K94 A;  2O60 A;  1M45 A;  2PAS A;  4MZL A;  5K89 A;  2LVJ A;  1NSH A;  2OTG C;  1B8L A;  2JUL A;  2OTG B;  1FPW A;  1DGV A;  1SKT A;  1K9P A;  3TDU A;  3RM1 A;  3VRP A;  2JT0 A;  2KGB C;  3VRQ A;  4HRG A;  1NPQ A;  1NX0 A;  2G9B A;  3SJS A;  1OZS A;  1N65 A;  2G2B A;  1SL8 A;  3HX4 A;  4N1F A;  2K2A A;  1A03 A;  1F54 A;  1BLQ A;  1F55 A;  2BE6 A;  1YTZ C;  4L9M A;  2WCE A;  4AOM A;  3PM8 A;  1S5G Z;  1Y1A A;  2I2R E;  1BJF A;  4MVF A;  3KHE A;  4CFR A;  1UHH A;  1XFV O;  2JXL A;  2I94 A;  4NQG A;  2L4H A;  5D7F A;  3HCM A;  3NSK A;  2LVV A;  3KEV A;  3TS5 C;  1TOP A;  4XJK B;  3OHM B;  4PHN A;  1SL9 A;  2Y5I A;  5D69 A;  2ZRS A;  2LLU A;  1DJZ A;  1C7W A;  2BL0 C;  4HSZ A;  1UHJ A;  4YI9 A;  3EVV A;  3A8R A;  1TNW A;  1NX3 A;  1QIV A;  3NSO A;  1LIN A;  2LV7 A;  4OV2 A;  2JTT A;  5F6T A;  1NX2 A;  3WXA A;  2E30 A;  1NX1 A;  2BKI B;  3JTD B;  1CMG A;  1X02 A;  2ZND A;  1L2O C;  1N2D A;  1W7J B;  5I2O A;  5G08 A;  5ER5 A;  1KK8 C;  1SR6 C;  1J7P A;  1B7T Y;  4PE0 A;  2LUX A;  1SCV A;  2BEC A;  2ZN9 A;  3EK7 A;  1YR5 A;  2JTZ A;  2L50 A;  3BQ3 A;  4M2P A;  1WLM A;  1YX8 A;  3AKB A;  3EKJ A;  1XFX O;  1R2U A;  1EH2 A;  1OMV A;  1PUL A;  2Q91 A;  5B8I B;  3PFV A;  1EG4 A;  2ZRT A;  4WRI A;  4BY5 A;  2KYC A;  1CTR A;  2JXC A;  5AEQ A;  1DJI A;  2JPT A;  5JJG A;  3BOW A;  2JWW A;  3OX5 A;  1IQ5 A;  2LE9 B;  1QXP A;  2KHN A;  1CMF A;  1KK8 B;  1DGU A;  3ICB A;  2M97 A;  1SMG A;  1KWO B;  1L2O B;  1EXR A;  2LAP A;  3JTD C;  3EVR A;  3RLZ A;  4E68 A;  2EHB A;  3DD4 A;  2KBM A;  1GJY A;  4PE4 A;  1AUI B;  1CFC A;  2L2E A;  1KFX L;  1Y6W A;  1CB1 A;  1MF8 B;  2KBI A;  4GUK A;  1B8R A;  2WCB A;  5JOL A;  1U5I B;  2TN4 A;  1DJH A;  2K7D A;  3KO0 A;  1FI6 A;  2R2I A;  3WHU B;  4MBE A;  1C7V A;  1QLS A;  2GV5 A;  2F33 A;  3FS7 A;  1RJV A;  1QV1 A;  2LMT A;  2NCP A;  2MBX A;  5HKY A;  1RRO A;  1YUT A;  3CWG A;  2LNK A;  2E6W A;  1XK4 C;  2IS9 A;  4FQO A;  1DMO A;  2L51 A;  5AAN A;  2PMY A;  3PAL A;  1QVI Z;  3CR5 X;  1A4P A;  3BUO B;  1XVJ A;  1FW4 A;  2JQ6 A;  2LVI A;  1NUB A;  1AP4 A;  5FYX A;  4I5J A;  2HPS A;  1IJ5 A;  2Q4U A;  1LXF C;  4I5N B;  4MZK A;  2LVK A;  1PVB A;  1KFU S;  3GK1 A;  2MLE C;  2LP2 A;  4GPL B;  3CS1 A;  1B8C A;  2BCB A;  2KFG A;  3O2P A;  3C1V A;  1Y0V H;  1TNQ A;  2NCO A;  3VRN A;  1NCY A;  3CLN A;  4YGD B;  5CSF A;  3DVK A;  4JWQ A;  1TCO B;  1XYD A;  4NDC A;  1WY9 A;  2KI6 C;  1IQ3 A;  1EJ3 A;  2JT8 A;  3LL8 B;  2CTN A;  1WRZ A;  2HF5 A;  2KAV A;  3LLE A;  1YVH A;  1N0Y A;  3EKH A;  4HRE E;  1QAT A;  3I5I B;  1KQM C;  3AAK A;  4CLN A;  1S6J A;  2L98 A;  1QAS A;  1JUO A;  1QVI Y;  4DUQ A;  1SPY A;  4QJ5 B;  3DVE A;  4AQI A;  3PLF B;  5HKW A;  3PN7 B;  5J3X A;  3K21 A;  2LM5 A;  1NCX A;  2KI4 B;  3BOW B;  5TNC A;  4PE1 A;  3TUY B;  1ALW A;  4XYN A;  1CFF A;  1CDM A;  2L5X B;  2EGD A;  1S5G Y;  1B9A A;  3M0W A;  4N5X A;  1JBA A;  1AK8 A;  1FBV A;  2H2K A;  1XFU O;  2LCP A;  1CFD A;  1ZUZ A;  2I7A A;  2LUC A;  2KQY A;  1CFP A;  4NDB A;  1GGW A;  1NIW A;  2KAY A;  2JNX A;  1J7R A;  1KSM A;  3IQQ A;  1FF1 A;  1DJW A;  4GNK B;  2PAL A;  5AXI A;  1TCF A;  4NDD A;  4C0L A;  4ETO A;  1SCM C;  1SYM A;  2CXJ A;  2BBM A;  5DKQ A;  2KDH A;  2M0R A;  2PVB A;  1DF0 A;  3BUW B;  1J1E A;  2LHL A;  1NP8 A;  1F4Q A;  2EC6 B;  2FJU B;  4JPZ B;  2BKH B;  1GQM A;  2BCX A;  3CGA A;  1K90 D;  3ZNI A;  3BUM B;  4XJK A;  3PSR A;  4CFQ A;  1U5I A;  1W7I B;  2VRG A;  2JNF A;  4CID A;  2QAC A;  3SG5 A;  1IKU A;  3KPX A;  5KSZ A;  1WDC B;  5CSJ A;  4ORB B;  3D0Y A;  3IF7 A;  1XFZ O;  1M31 A;  3I5F B;  1CM4 A;  3I5H B;  1XFW O;  4P5O E;  1PAL A;  2JOJ A;  1ZOT B;  1VRK A;  4IL1 A;  2V53 A;  1OZO A;  2HQ8 A;  1LKJ A;  5HYD A;  2KI6 D;  2F2O A;  5I2L A;  1S6C A;  1GGZ A;  2OS8 C;  1KQV A;  4AQJ A;  5DKN A;  1JF2 A;  3TZ1 A;  4C0J A;  2JU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...