1NSHA

Solution structure of rabbit apo-s100a11 (19 models)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
b'SRPTETERCIESLIAVFQKYAGKDGHSVTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNSDGQLDFQEFLNLIGGLAVACHESFVKAAPPQKRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calgizzarin
publication title Unmasking the Annexin I Interaction from the structure of apo-S100A11
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Metal binding protein
total genus 18
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nshA00
1JF2A 3SIBA 3WHTB 1WRZA 1IQ5A 1B4CA 2BECA 2BCAA 2L51A 1F54A 3VROA 1BG1A 1SW8A 2AMIA 1KFUL 2FJUB 3EK7A 1IJ5A 2MHHA 2MRDA 1B47A 4QJ3B 3I5HB 2EC6C 1SR6C 1QJTA 2MBXA 3DVMA 3SG2A 2I2RE 2LLSA 1MXLC 3OP0A 4GFTA 1BJFA 1FBVA 4MRYA 2KAYA 2R2IA 5K89A 4JQ0D 4MZKA 4DIRA 2M7NA 1Y1XA 1YX7A 1IRJA 1WRKA 4I5KA 1LINA 4PE7A 2GGZA 2CNPA 4YGEB 3BUWB 2HQ8A 3AKAA 5HKWA 3VRNA 2NXQA 1TNQA 3FS7A 1GQMA 3JVTC 3VRQA 1NCYA 2ZN8A 1NCZA 5KSZA 1IKUA 1CLLA 1OSAA 1JFKA 2ZN9A 1J7QA 1HQVA 1F4OA 1B7TZ 2K7CA 4GBAA 3PM8A 1R6PA 2LVKA 4CPVA 1CFCA 4PHMA 4DRWA 1JUOA 2CTNA 1XO5A 2KYCA 2MLFC 3BQ3A 1DVIA 3DVJA 3M0WA 3SG6A 3AAKA 2JTTA 3NSOA 5HLVA 1SL8A 2M1KB 4JPZB 1PSRA 5G08A 5J3XA 5I8NA 1NX1A 1K9KA 1NIWA 3ZNIA 1S6CA 1Y0VH 3LK1A 1QV1A 1OMRA 1TCOB 2A4JA 4YGAA 3KO0A 4ZCUA 2LMUA 4C0KA 2L2EA 2LHIA 4YGCB 3NXAA 2V53A 1PVAA 1QX5B 3DVKA 4PDZA 2ISDA 2KI4B 1CDNA 1IJ6A 3TUYC 4P2YB 4UPGA 5DKRA 1YVLA 1PALA 1L2OC 2KHNA 4OR9B 2KGRA 4YI9A 1CFPA 2NZ0A 1ALWA 2BKIB 1S3PA 1AJ4A 2BL0C 1S5GY 2LMTA 4P5OE 1B8LA 2WORA 3NSLA 4XJKA 2KSPA 1M39A 2NCPA 3I5IC 1DJGA 1BOCA 1NX3A 3I5IB 1MUXA 3JTDB 1IGVA 1NUBA 2RGIA 1IH0A 1UHJA 1K8UA 2OS8C 4M2OA 1K93D 2AAOA 2M29A 1QX2A 2ZNEA 3IQQA 1M45A 1V1GA 3TDIA 2E30A 1H4BA 2L4HA 2H61C 3D0YB 4MBEA 2EGDA 1KK7Y 2I94A 2QACA 3EK8A 5HYDA 2BBNA 1A2XA 2JT0A 2K7DA 2NLNA 1BLQA 2D8NA 2H2KA 2FCDA 1PULA 1ODBA 2IS9A 1YRTB 1DF0A 1N2DA 4MVFA 1XYDA 1KFUS 1KK8B 1DJWA 2L50A 1J7OA 3EVUA 1YX8A 4USLA 2BKHB 2JNFA 1SNLA 1SRAA 1LVCD 1TOPA 2LNKA 2JTZA 1ZACA 2GV5A 1NX0A 3O78A 3SG7A 5PALA 1TCFA 3TS5B 2M3WA 2PVBA 4ORAB 1SCMC 3I5FB 4PHJA 1KWOC 3SG4A 1BT6A 4CIDA 2ZFDA 4GPLB 5I2QA 1DTLA 1XVJA 1A4PA 2WOSA 3PATA 1KSMA 2G9BA 1UWOA 1ZMZA 4YGBB 1RROA 3LLEA 2LC5A 4FQOA 1GGZA 1YR5A 4PHNA 2KYFA 1N65A 1D1OA 2JPTA 1A75B 3SIAA 3D10A 1V1FA 4L9MA 1LKJA 4M2QA 3FWCA 1U5IA 2LUCA 3I5HC 3IQOA 1F70A 2KOTA 1JSAA 3GK2A 2PALA 3IF7A 1A75A 2BCBA 4PCWA 1QVIY 1ZUZA 2KBIA 1DJZA 2F2PA 2Y4QA 5AFPA 1K2HA 5I2LA 3WXAA 2Y1NA 4A4BA 3EK4A 4ORBB 2HPSA 1QIWA 4OVNF 4GGFA 2L98A 3SJSA 1XA5A 4MZLA 1FPWA 5CSNA 1QS7A 4PE4A 3CLNA 3BUNB 3RM1A 1A03A 1EG3A 2MJWB 2E6WA 2HF5A 3PN7B 5CSFA 1XK4C 4E68A 3CS1A 5D69A 4QJ5B 2K8MB 1C7WA 1JF0A 1KCYA 1CM4A 4GUKA 1M46A 3KF9A 2LV7A 1KQVA 3EKJA 2KAXA 3I5GC 4ORCB 3I5GB 2F2OA 2TN4A 2PRUA 4HREE 2M0RA 1QX7A 3HX4A 5DKQA 5TNCA 2NCOA 1IQ3A 3KPXA 2VRGA 1EXRA 3BUOB 3OHMB 2LUXA 1FI5A 5I2OA 2CT9A 3SG5A 1J1DA 1AJ5A 4F0ZB 4D1EA 1TTXA 2FCEA 5HKYA 1EH2A 2LLTA 2KI4C 1K96A 1X02A 3EVRA 4PE0A 2JU0A 1N0YA 2JXCA 2KFFA 2Q91A 2K0JA 3BXKA 4XJKB 4YBHB 3CWGA 4OKHA 1B7TY 1KFXL 1YURA 2LVJA 4PALA 2PMYA 5D7FA 3TDUA 4DS7A 3OX5A 1K9UA 1XFXO 2LMVA 3F45A 5HKZA 3GOFA 3H4SE 2WC8A 1G8IA 3BOWA 3JTDC 3PFVA 4GNKB 1LXFC 3HCMA 4ZCVA 5AANA 4ETOA 3C1VA 2SASA 1IWQA 2BE6A 5AEQA 5BPJA 1BMOA 1CLMA 2KQ6A 3O2PA 2LANA 1VRKA 4OCIA 1PSBA 3OB2B 2Q4UA 5CSJA 4AQJA 1HT9A 3BUMB 1DF0B 2KFHA 3SG3A 3EVVA 1YUTA 4MLWA 2KGBC 4AQIA 3LK0A 1CB1A 4PHKA 5AERA 2P6BB 1OE9B 1KK8C 4C0LA 3NSIA 1JC2A 2HQWA 1BF5A 4NQGA 1DGUA 2JULA 4YRUA 2M49B 2F3ZA 2BBMA 4DUQA 2ZRTA 3CTNA 3GK4X 1J55A 1RK9A 3RLZA 3TS5C 2KI6D 3I5FC 2SCPA 3A8RA 1YVHA 3TZ1A 2BCXA 1DT7B 1J7PA 1DJIA 4MZJA 5ER4X 1KQMC 2LVIA 1RECA 1CDLA 1KQMB 2WCBA 1UHKA 3PSRA 1SL9A 4PE1A 1MR8A 1JFJA 2CCMA 2G2BA 2JNXA 1BODA 2JRFA 1MQ1A 1DMOA 4NDDA 1J1EA 1QXPA 2ZRSA 5DKNA 1SYMA 1U5IB 1OMVA 1GGWA 1L7ZA 1YRUB 1CFFA 1K9PA 1BR1B 3OX6A 2OTGB 2MA2A 3OB1B 3FIAA 1UHNA 3K21A 2KFGA 3BYAA 5GQQC 1UURA 1MHOA 1LA3A 2JQ6A 2CBLA 1SY9A 1WDCB 1ZFSA 2K2FA 4GGFC 2DOQA 1Y6WA 1UP5A 2F3YA 4A4CA 4WQ3A 1PK0D 3AAJA 1K95A 1S26D 1QLSA 1S6IA 1OZOA 3FWBA 2M8UA 4HRHA 1ALVA 2K2AA 1CTRA 3ICBA 2K7OA 2M9GA 1AK8A 2BE4A 4BY4A 3DVEA 3NSKA 1RJVA 2CXJA 3O6BA 3PN7C 1K94A 5CSIA 1YUSA 2WCEA 4U8DA 3VRRA 1TNPA 1FI6A 5B8IB 2KNEA 4MEWA 1CDMA 2LHLA 1KFXS 1OOJA 2PSRA 2EC6B 1SR6B 3KHEA 2JC2A 4CFQA 4DCKA 1NCXA 3CR4X 5KU1A 1Y1AA 4NDCA 4AOMA 1DJHA 1ZOTB 2JXLA 2MLEC 1EL4A 3AKBA 5FYXA 2LM5A 4GGNA 1TRFA 1CMGA 1BU3A 1CMFA 1IG5A 4I5JA 2FOTA 2KBMA 4MSPA 4MN0A 4N1GA 1JWDA 3PALA 2JZIA 2ZKMX 4I5NB 4MRXA 1G33A 3JVTB 3GK1A 1CNPA 2MAZA 1XFZO 2M7LA 1UUSA 2KI6C 4YGDB 4HRGA 1Y1UA 4NDBA 1S5GZ 1XK4A 2F33A 1AP4A 1QASA 1S1EA 2LP2A 1AVSA 1FW4A 1QV0A 1F8HA 1WRLA 2AUCA 1EJ3A 1FF1A 1S6JA 1UHIA 3BOWB 1YUUA 3WNXB 1C07A 2PASA 1JBAA 1UHHA 2B1UA 5AXIA 1QATA 1BR4B 1YTZC 1KK7Z 5HLOA 3ZWHA 1SK6D 2JOJA 2LCPA 3TDZA 2QPTA 4I5LB 4WRIA 1EG4A 1S36A 3TUYB 1SKTA 2JT3A 1M63B 1C7VA 5JOLA 4OV2A 3A4UB 4CFRA 2OPOA 2HETA 4TNCA 1RTP1 1L2OB 2WCFA 2O5GA 4WQ2A 1CDPA 1XFUO 1WY9A 1DGVA 1XFWO 1XFVO 4YI8A 4XYNA 1QLKA 1A29A 1OZSA 1WLZA 1NP8A 3LCPC 3VGOA 1AUIB 1B8RA 1GJYA 2BL0B 5F6TA 1PVBA 2LP3A 3QRXA 2LAPA 1AHRA 1TNXA 2JT8A 2KQYA 1OMDA 4IL1A 3MSEB 1DJYA 1J7RA 1KSOA 2F8PA 4JWQA 5CPVA 1TNWA 2K7BA 1SPYA 1OQPA 2EHBA 2GGMA 1B1GA 1Q80A 2OS8B 3CR5X 1QIVA 1F71A 3PLFB 1K90D 1CM1A 1TIZA 3CGAA 3DD4A 3DF0B 4R1EA 1RFJA 4FTGA 1NYAA 1R2UA 2WNDA 4GAOA 1E8AA 3WHUB 1CLBA 1H8BA 1PRWA 2Y1MA 1W7JB 1LA0A 4Q04A 2LLUA 1CKKA 4HSZA 2KDHA 1XFYO 1B9AA 1SBJA 3DF0A 4C0JA 3D0YA 2H61A 1CFDA 3BUXB 3KEVA 2L5XB 1SMGA 3CZTX 1NSHA 1RWYA 3VRPA 1MWNA 1SCVA 1B8CA 2COLB 5IBWA 2M97A 2ZNDA 3CR2A 1QVIZ 1MXEA 2OTGC 5JJGA 1F55A 5KTYA 2KAVA 4N5XA 1TN4A 2I7AA 1NWDA 1SL7A 2JWWA 4BY5A 1NPQA 1WDCC 2K61A 3E3RA 1NX2A 1SCMB 2Y5IA 1DJXA 5ER5A 1KWOB 1M31A 1QTXA 2O60A 2LVVA 4CLNA 2M1UA 1WLMA 4ICBA 1G4YR 4M2PA 4QJ4B 1MF8B 3O4YA 2L0PA 4N1FA 3EKHA 2LE9B 2I18A 1W7IB 1F4QA 2L4IA 3LL8B
chains in the Genus database with same CATH superfamily
1JF2A 3DZTA 3SIBA 1TUJA 2WCJA 3WHTB 1WRZA 1IQ5A 1B4CA 3BFHA 2BECA 2BCAA 2L51A 1F54A 3VROA 1BG1A 1SW8A 2AMIA 1KFUL 2FJUB 3EK7A 1IJ5A 3R1VA 2MHHA 2MRDA 1B47A 4QJ3B 3I5HB 2EC6C 1SR6C 1QJTA 2MBXA 2KLDA 3DVMA 3SG2A 2I2RE 2LLSA 1MXLC 3OP0A 4GFTA 1BJFA 1FBVA 4MRYA 2KAYA 2R2IA 5K89A 4JQ0D 4MZKA 1OOIX 4DIRA 2M7NA 1Y1XA 1YX7A 1IRJA 1WRKA 4I5KA 1LINA 4PE7A 4GNKB 2GGZA 2CNPA 4YGEB 3BUWB 2HQ8A 3AKAA 5HKWA 3VRNA 2PQLA 2NXQA 1TNQA 2P70A 1GQMA 3FS7A 3JVTC 3VRQA 1NCYA 2ZN8A 1NCZA 5KSZA 1IKUA 1CLLA 1OSAA 1JFKA 2ZN9A 1J7QA 1HQVA 2QEBA 1F4OA 1B7TZ 2K7CA 4GBAA 1DELA 1R6PA 2LVKA 3PM8A 4CPVA 1CFCA 4PHMA 5FI7A 1JUOA 2CTNA 1XO5A 2KYCA 2MLFC 3BQ3A 1DVIA 3DVJA 3M0WA 3SG6A 2PYQA 3AAKA 2JTTA 3NSOA 5HLVA 1SL8A 2M1KB 4JPZB 1PSRA 5G08A 5J3XA 5I8NA 1NX1A 1K9KA 1NIWA 3ZNIA 1S6CA 4KYNA 1Y0VH 3LK1A 1QV1A 1OMRA 1TCOB 2A4JA 3B86A 3KO0A 4YGAA 2LMUA 4ZCUA 4C0KA 2L2EA 2LHIA 4YGCB 3NXAA 2V53A 3FE8A 1PVAA 3R72A 1QX5B 3DVKA 4PDZA 2ISDA 2K60A 2KI4B 1CDNA 1IJ6A 3TUYC 4P2YB 4UPGA 5DKRA 1YVLA 1PALA 1L2OC 2KHNA 1OOHA 4OR9B 2KGRA 3CDNA 4YI9A 1W9ZA 3N7HA 1CFPA 2NZ0A 1ALWA 2BKIB 1S3PA 1AJ4A 3DY9A 2BL0C 1S5GY 2LMTA 4P5OE 1B8LA 2YGUA 2WORA 3NSLA 4XJKA 2KSPA 2KLEA 1M39A 2NCPA 3I5IC 1DJGA 1BOCA 1NX3A 3I5IB 1MUXA 3JTDB 1IGVA 1NUBA 2RGIA 1IH0A 1UHJA 1K8UA 2OS8C 4M2OA 1K93D 2AAOA 2M29A 2JPOA 1QX2A 2ZNEA 3IQQA 1M45A 1V1GA 3TDIA 2E30A 3VB1A 2L4HA 2H61C 1H4BA 3D0YB 4MBEA 2EGDA 1KK7Y 2I94A 2QACA 3EK8A 5HYDA 2BBNA 1A2XA 2JT0A 2K7DA 2NLNA 3CZ0A 3CABA 1BLQA 2D8NA 2H2KA 2FCDA 1PULA 1ODBA 2IS9A 1YRTB 1DF0A 1N2DA 4MVFA 1XYDA 1KFUS 1KK8B 3EG5B 4INXA 1DJWA 2L50A 1J7OA 3EVUA 1YX8A 4USLA 2BKHB 2JNFA 1SNLA 1SRAA 3CZ1A 1LVCD 1TOPA 2LNKA 2JTZA 3S0GA 1ZACA 2GV5A 3IVTA 1NX0A 3O78A 3SG7A 2QDIA 5PALA 1TCFA 3TS5B 2L2CA 2M3WA 2PVBA 4ORAB 1SCMC 3I5FB 4PHJA 1KWOC 3SG4A 1BT6A 1DQEA 4CIDA 2ZFDA 3NHIA 4GPLB 5I2QA 1DTLA 1XVJA 1A4PA 2WOSA 3PATA 3R1OA 1KSMA 2G9BA 1UWOA 1ZMZA 4YGBB 1RROA 3LLEA 2LC5A 4FQOA 1GGZA 3FE6A 1YR5A 3BJHA 4PHNA 2KYFA 1N65A 1D1OA 2JPTA 1A75B 3SIAA 3D10A 1V1FA 4L9MA 1LKJA 4M2QA 3B87A 2KPHA 3FWCA 1U5IA 4JKTA 2LUCA 3I5HC 3IQOA 1F70A 2KOTA 1Z2CB 3CZ2A 3GK2A 1JSAA 2PALA 3IF7A 1A75A 2BCBA 4PCWA 1QVIY 1ZUZA 2KBIA 1DJZA 2F2PA 2Y4QA 5AFPA 1K2HA 5I2LA 3WXAA 3D75A 2Y1NA 4OZDA 4A4BA 3EK4A 4ORBB 3B88A 2HPSA 1QIWA 2BAPA 4OVNF 4GGFA 2L98A 3SJSA 1XA5A 4MZLA 1FPWA 5CSNA 1QS7A 4PE4A 4PT1A 3CLNA 3BUNB 3RM1A 1A03A 1EG3A 2MJWB 2E6WA 2HF5A 3PN7B 5CSFA 1XK4C 4FQTA 4E68A 3CS1A 5D69A 4QJ5B 2K8MB 1C7WA 1JF0A 1KCYA 1CM4A 4GUKA 1M46A 3KF9A 2LV7A 1KQVA 2L5YA 2P71A 2KAXA 3B6XA 3EKJA 3I5GC 4ORCB 3BFAA 3I5GB 2F2OA 2TN4A 4DRWA 2PRUA 4HREE 2M0RA 4DCKA 1QX7A 3HX4A 3PJIA 5DKQA 5TNCA 2NCOA 1IQ3A 3KPXA 3O4XA 2VRGA 1EXRA 3BUOB 3OHMB 2LUXA 3Q8IA 1P28A 1FI5A 5I2OA 2CT9A 3SG5A 1J1DA 5FI6A 1AJ5A 4F0ZB 4D1EA 1TTXA 2FCEA 5HKYA 1EH2A 2LLTA 2KI4C 1K96A 1X02A 3B7AA 3EVRA 4PE0A 2JU0A 1N0YA 2JXCA 2KFFA 2Q91A 5HL1A 2K0JA 3BXKA 4XJKB 4YBHB 1Z4HA 3QMEA 3CWGA 3L47A 4OKHA 1B7TY 1KFXL 1YURA 2WCMA 2LVJA 4PALA 2PMYA 5D7FA 3TDUA 4DS7A 3OX5A 1K9UA 1OW4A 1XFXO 2LMVA 3F45A 5HKZA 1QWVA 3GOFA 3H4SE 2WC8A 1G8IA 1OOGA 3BOWA 3JTDC 3PFVA 1LXFC 3BFBA 3HCMA 4ZCVA 5AANA 4ETOA 1IIOA 3C1VA 4F7FA 2H8VA 1IWQA 2BE6A 2SASA 5FI2A 5AEQA 5BPJA 1BMOA 1CLMA 2KQ6A 3O2PA 2LANA 1VRKA 4OCIA 1PSBA 3OB2B 2Q4UA 5CSJA 3FE9A 4AQJA 1HT9A 3BUMB 1DF0B 2KFHA 3OBVA 3SG3A 1TUZA 3EVVA 1YUTA 4MLWA 2KGBC 4AQIA 3LK0A 1CB1A 3D74A 3NGVA 4PHKA 5AERA 2P6BB 1OE9B 1KK8C 4C0LA 2GTEA 3NSIA 3D77A 1JC2A 2HQWA 1BF5A 4NQGA 5D3OA 1DGUA 2JULA 4YRUA 2M49B 2F3ZA 2BBMA 4DUQA 2ZRTA 3CTNA 3GK4X 1J55A 1RK9A 3RLZA 3TS5C 2QEHA 1XFRA 2KI6D 3I5FC 2SCPA 3A8RA 1YVHA 3TZ1A 2BCXA 1DT7B 1J7PA 3V2LA 1DJIA 4MZJA 5ER4X 3S0FA 1KQMC 2LVIA 3DXLA 1RECA 1CDLA 1KQMB 2WCBA 1UHKA 3PSRA 1SL9A 4PE1A 1MR8A 1JFJA 2CCMA 1C3ZA 2G2BA 2JNXA 3D73A 1BODA 2JRFA 1MQ1A 1DMOA 4NDDA 1C3YA 1J1EA 1QXPA 2ZRSA 5DKNA 1SYMA 1U5IB 1OMVA 1GGWA 1L7ZA 1YRUB 1CFFA 1K9PA 3DYEA 1BR1B 3OX6A 2OTGB 2MA2A 3OB1B 3FIAA 1UHNA 3K21A 2KFGA 3BYAA 5GQQC 1UURA 1MHOA 1LA3A 2JQ6A 2CBLA 1SY9A 1WDCB 1ZFSA 2K2FA 4GGFC 2DOQA 1Y6WA 1UP5A 2F3YA 4A4CA 4WQ3A 1PK0D 3AAJA 3RZSA 1K95A 1S26D 2QEVA 3S0EA 1QLSA 1S6IA 1OZOA 3FWBA 2M8UA 3NHTA 4HRHA 1ALVA 2K2AA 1CTRA 3ICBA 3D76A 2K7OA 2M9GA 1AK8A 2BE4A 4BY4A 3DVEA 3NSKA 1RJVA 2CXJA 3O6BA 3PN7C 1DC1A 1K94A 5CSIA 1YUSA 2WC6A 4IJ7A 2WCEA 4U8DA 1TWOA 3VRRA 1TNPA 3K1EA 5B8IB 1FI6A 1GM0A 2KNEA 4MEWA 1CDMA 2LHLA 1KFXS 1OOJA 2PSRA 2EC6B 1SR6B 3KHEA 2JC2A 2WCKA 3UO9A 1NCXA 4CFQA 3CR4X 2WCLA 5KU1A 1Y1AA 4NDCA 3SS4A 4AOMA 1DJHA 1ZOTB 2JXLA 2MLEC 1EL4A 3AKBA 5FYXA 2LM5A 4GGNA 1TRFA 1CMGA 1BU3A 1CMFA 1IG5A 2FJYA 4I5JA 2FOTA 2KBMA 4MSPA 4MN0A 4N1GA 1JWDA 3PALA 2JZIA 2ZKMX 4I5NB 4MRXA 1G33A 3JVTB 3GK1A 3S0AA 1CNPA 2ERBA 2MAZA 1XFZO 2M7LA 1UUSA 2KI6C 4YGDB 4HRGA 1SSEB 1Y1UA 4NDBA 4JD9A 1S5GZ 1XK4A 2F33A 1AP4A 1QASA 3R1PA 1S1EA 2LP2A 1AVSA 1FW4A 1QV0A 3S0BA 1F8HA 3L4AA 1WRLA 2AUCA 3UNWA 1EJ3A 1FF1A 1S6JA 2WC5A 1UHIA 3BOWB 1YUUA 3WNXB 1C07A 2PASA 1DEKA 1JBAA 1UHHA 2B1UA 5AXIA 1QATA 1BR4B 1YTZC 1KK7Z 3PM2A 5HLOA 3ZWHA 1SK6D 2JOJA 1ORGA 2LCPA 3CYZA 3TDZA 2QPTA 4I5LB 4WRIA 3S0DA 1EG4A 1S36A 3TUYB 1SKTA 2JT3A 1M63B 1C7VA 5JOLA 4OV2A 3A4UB 4CFRA 2OPOA 2HETA 4TNCA 1RTP1 1L2OB 5DICA 2WCFA 2O5GA 4WQ2A 1CDPA 1XFUO 1WY9A 1DGVA 1XFWO 1XFVO 4YI8A 4XYNA 1QLKA 1A29A 1OZSA 1WLZA 1NP8A 3LCPC 3VGOA 1AUIB 1B8RA 1GJYA 2BL0B 5F6TA 1PVBA 2LP3A 3QRXA 2LAPA 1AHRA 1TNXA 2JT8A 2KQYA 1OMDA 4IL1A 2BNXA 3MSEB 1DJYA 1J7RA 1KSOA 1T14A 2F8PA 4JWQA 1TNWA 2K7BA 5CPVA 5EL2A 1SPYA 1OQPA 2EHBA 2GGMA 1B1GA 1Q80A 2OS8B 3CR5X 1QIVA 1F71A 3PLFB 1K90D 1CM1A 1TIZA 3CGAA 3DD4A 3DF0B 4R1EA 1RFJA 4FTGA 1NYAA 1R2UA 2WNDA 4GAOA 1E8AA 3WHUB 1CLBA 1H8BA 1PRWA 2Y1MA 1W7JB 1LA0A 4Q04A 2LLUA 1CKKA 4HSZA 2KDHA 1XFYO 1B9AA 1SBJA 3DF0A 3L4LA 4C0JA 3D0YA 2H61A 1CFDA 3BUXB 3KEVA 2L5XB 1SMGA 3CZTX 1NSHA 1RWYA 2QEOA 3VRPA 3OGNA 1MWNA 1SCVA 1B8CA 2COLB 5IBWA 2M97A 3D78A 2ZNDA 3CR2A 1QVIZ 1MXEA 2OTGC 5JJGA 1F55A 5KTYA 2KAVA 3SS5A 4N5XA 1TN4A 2I7AA 1NWDA 1SL7A 2JWWA 5I94A 4BY5A 1NPQA 1WDCC 2K61A 2WCHA 3E3RA 1NX2A 1SCMB 2Y5IA 1DJXA 5ER5A 1KWOB 1M31A 1QTXA 2O60A 2LVVA 4INWA 2M1UA 1WLMA 4ICBA 4CLNA 1G4YR 4M2PA 3SS3A 1LS8A 4QJ4B 1MF8B 3O4YA 2L0PA 4N1FA 3EKHA 1OOFA 2LE9B 2I18A 1W7IB 1F4QA 2L4IA 3LL8B
chains in the Genus database with same CATH topology
1JF2A 3SIBA 3WHTB 1WRZA 1IQ5A 1B4CA 2BECA 2BCAA 2L51A 1F54A 3VROA 1BG1A 1SW8A 2AMIA 1KFUL 2FJUB 3EK7A 1IJ5A 2MHHA 2MRDA 1B47A 4QJ3B 3I5HB 2EC6C 1SR6C 1QJTA 2MBXA 3DVMA 3SG2A 2I2RE 2LLSA 1MXLC 3OP0A 4GFTA 1BJFA 1FBVA 4MRYA 2KAYA 2R2IA 5K89A 4JQ0D 4MZKA 4DIRA 2M7NA 1Y1XA 1YX7A 1IRJA 1WRKA 4I5KA 1LINA 4PE7A 2GGZA 2CNPA 4YGEB 3BUWB 2HQ8A 3AKAA 5HKWA 3VRNA 2NXQA 1TNQA 3FS7A 1GQMA 3JVTC 3VRQA 1NCYA 2ZN8A 1NCZA 5KSZA 1IKUA 1CLLA 1OSAA 1JFKA 2ZN9A 1J7QA 1HQVA 1F4OA 1B7TZ 2K7CA 4GBAA 3PM8A 1R6PA 2LVKA 4CPVA 1CFCA 4PHMA 4DRWA 1JUOA 2CTNA 1XO5A 2KYCA 2MLFC 3BQ3A 1DVIA 3DVJA 3M0WA 3SG6A 3AAKA 2JTTA 3NSOA 5HLVA 1SL8A 2M1KB 4JPZB 1PSRA 5G08A 5J3XA 5I8NA 1NX1A 1K9KA 1NIWA 3ZNIA 1S6CA 1Y0VH 3LK1A 1QV1A 1OMRA 1TCOB 2A4JA 4YGAA 3KO0A 4ZCUA 2LMUA 4C0KA 2L2EA 2LHIA 4YGCB 3NXAA 2V53A 1PVAA 1QX5B 3DVKA 4PDZA 2ISDA 2KI4B 1CDNA 1IJ6A 3TUYC 4P2YB 4UPGA 5DKRA 1YVLA 1PALA 1L2OC 2KHNA 4OR9B 2KGRA 4YI9A 1CFPA 2NZ0A 1ALWA 2BKIB 1S3PA 1AJ4A 2BL0C 1S5GY 2LMTA 4P5OE 1B8LA 2WORA 3NSLA 4XJKA 2KSPA 1M39A 2NCPA 3I5IC 1DJGA 1BOCA 1NX3A 3I5IB 1MUXA 3JTDB 1IGVA 1NUBA 2RGIA 1IH0A 1UHJA 1K8UA 2OS8C 4M2OA 1K93D 2AAOA 2M29A 1QX2A 2ZNEA 3IQQA 1M45A 1V1GA 3TDIA 2E30A 1H4BA 2L4HA 2H61C 3D0YB 4MBEA 2EGDA 1KK7Y 2I94A 2QACA 3EK8A 5HYDA 2BBNA 1A2XA 2JT0A 2K7DA 2NLNA 1BLQA 2D8NA 2H2KA 2FCDA 1PULA 1ODBA 2IS9A 1YRTB 1DF0A 1N2DA 4MVFA 1XYDA 1KFUS 1KK8B 1DJWA 2L50A 1J7OA 3EVUA 1YX8A 4USLA 2BKHB 2JNFA 1SNLA 1SRAA 1LVCD 1TOPA 2LNKA 2JTZA 1ZACA 2GV5A 1NX0A 3O78A 3SG7A 5PALA 1TCFA 3TS5B 2M3WA 2PVBA 4ORAB 1SCMC 3I5FB 4PHJA 1KWOC 3SG4A 1BT6A 4CIDA 2ZFDA 4GPLB 5I2QA 1DTLA 1XVJA 1A4PA 2WOSA 3PATA 1KSMA 2G9BA 1UWOA 1ZMZA 4YGBB 1RROA 3LLEA 2LC5A 4FQOA 1GGZA 1YR5A 4PHNA 2KYFA 1N65A 1D1OA 2JPTA 1A75B 3SIAA 3D10A 1V1FA 4L9MA 1LKJA 4M2QA 3FWCA 1U5IA 2LUCA 3I5HC 3IQOA 1F70A 2KOTA 1JSAA 3GK2A 2PALA 3IF7A 1A75A 2BCBA 4PCWA 1QVIY 1ZUZA 2KBIA 1DJZA 2F2PA 2Y4QA 5AFPA 1K2HA 5I2LA 3WXAA 2Y1NA 4A4BA 3EK4A 4ORBB 2HPSA 1QIWA 4OVNF 4GGFA 2L98A 3SJSA 1XA5A 4MZLA 1FPWA 5CSNA 1QS7A 4PE4A 3CLNA 3BUNB 3RM1A 1A03A 1EG3A 2MJWB 2E6WA 2HF5A 3PN7B 5CSFA 1XK4C 4E68A 3CS1A 5D69A 4QJ5B 2K8MB 1C7WA 1JF0A 1KCYA 1CM4A 4GUKA 1M46A 3KF9A 2LV7A 1KQVA 3EKJA 2KAXA 3I5GC 4ORCB 3I5GB 2F2OA 2TN4A 2PRUA 4HREE 2M0RA 1QX7A 3HX4A 5DKQA 5TNCA 2NCOA 1IQ3A 3KPXA 2VRGA 1EXRA 3BUOB 3OHMB 2LUXA 1FI5A 5I2OA 2CT9A 3SG5A 1J1DA 1AJ5A 4F0ZB 4D1EA 1TTXA 2FCEA 5HKYA 1EH2A 2LLTA 2KI4C 1K96A 1X02A 3EVRA 4PE0A 2JU0A 1N0YA 2JXCA 2KFFA 2Q91A 2K0JA 3BXKA 4XJKB 4YBHB 3CWGA 4OKHA 1B7TY 1KFXL 1YURA 2LVJA 4PALA 2PMYA 5D7FA 3TDUA 4DS7A 3OX5A 1K9UA 1XFXO 2LMVA 3F45A 5HKZA 3GOFA 3H4SE 2WC8A 1G8IA 3BOWA 3JTDC 3PFVA 4GNKB 1LXFC 3HCMA 4ZCVA 5AANA 4ETOA 3C1VA 2SASA 1IWQA 2BE6A 5AEQA 5BPJA 1BMOA 1CLMA 2KQ6A 3O2PA 2LANA 1VRKA 4OCIA 1PSBA 3OB2B 2Q4UA 5CSJA 4AQJA 1HT9A 3BUMB 1DF0B 2KFHA 3SG3A 3EVVA 1YUTA 4MLWA 2KGBC 4AQIA 3LK0A 1CB1A 4PHKA 5AERA 2P6BB 1OE9B 1KK8C 4C0LA 3NSIA 1JC2A 2HQWA 1BF5A 4NQGA 1DGUA 2JULA 4YRUA 2M49B 2F3ZA 2BBMA 4DUQA 2ZRTA 3CTNA 3GK4X 1J55A 1RK9A 3RLZA 3TS5C 2KI6D 3I5FC 2SCPA 3A8RA 1YVHA 3TZ1A 2BCXA 1DT7B 1J7PA 1DJIA 4MZJA 5ER4X 1KQMC 2LVIA 1RECA 1CDLA 1KQMB 2WCBA 1UHKA 3PSRA 1SL9A 4PE1A 1MR8A 1JFJA 2CCMA 2G2BA 2JNXA 1BODA 2JRFA 1MQ1A 1DMOA 4NDDA 1J1EA 1QXPA 2ZRSA 5DKNA 1SYMA 1U5IB 1OMVA 1GGWA 1L7ZA 1YRUB 1CFFA 1K9PA 1BR1B 3OX6A 2OTGB 2MA2A 3OB1B 3FIAA 1UHNA 3K21A 2KFGA 3BYAA 5GQQC 1UURA 1MHOA 1LA3A 2JQ6A 2CBLA 1SY9A 1WDCB 1ZFSA 2K2FA 4GGFC 2DOQA 1Y6WA 1UP5A 2F3YA 4A4CA 4WQ3A 1PK0D 3AAJA 1K95A 1S26D 1QLSA 1S6IA 1OZOA 3FWBA 2M8UA 4HRHA 1ALVA 2K2AA 1CTRA 3ICBA 2K7OA 2M9GA 1AK8A 2BE4A 4BY4A 3DVEA 3NSKA 1RJVA 2CXJA 3O6BA 3PN7C 1K94A 5CSIA 1YUSA 2WCEA 4U8DA 3VRRA 1TNPA 1FI6A 5B8IB 2KNEA 4MEWA 1CDMA 2LHLA 1KFXS 1OOJA 2PSRA 2EC6B 1SR6B 3KHEA 2JC2A 4CFQA 4DCKA 1NCXA 3CR4X 5KU1A 1Y1AA 4NDCA 4AOMA 1DJHA 1ZOTB 2JXLA 2MLEC 1EL4A 3AKBA 5FYXA 2LM5A 4GGNA 1TRFA 1CMGA 1BU3A 1CMFA 1IG5A 4I5JA 2FOTA 2KBMA 4MSPA 4MN0A 4N1GA 1JWDA 3PALA 2JZIA 2ZKMX 4I5NB 4MRXA 1G33A 3JVTB 3GK1A 1CNPA 2MAZA 1XFZO 2M7LA 1UUSA 2KI6C 4YGDB 4HRGA 1Y1UA 4NDBA 1S5GZ 1XK4A 2F33A 1AP4A 1QASA 1S1EA 2LP2A 1AVSA 1FW4A 1QV0A 1F8HA 1WRLA 2AUCA 1EJ3A 1FF1A 1S6JA 1UHIA 3BOWB 1YUUA 3WNXB 1C07A 2PASA 1JBAA 1UHHA 2B1UA 5AXIA 1QATA 1BR4B 1YTZC 1KK7Z 5HLOA 3ZWHA 1SK6D 2JOJA 2LCPA 3TDZA 2QPTA 4I5LB 4WRIA 1EG4A 1S36A 3TUYB 1SKTA 2JT3A 1M63B 1C7VA 5JOLA 4OV2A 3A4UB 4CFRA 2OPOA 2HETA 4TNCA 1RTP1 1L2OB 2WCFA 2O5GA 4WQ2A 1CDPA 1XFUO 1WY9A 1DGVA 1XFWO 1XFVO 4YI8A 4XYNA 1QLKA 1A29A 1OZSA 1WLZA 1NP8A 3LCPC 3VGOA 1AUIB 1B8RA 1GJYA 2BL0B 5F6TA 1PVBA 2LP3A 3QRXA 2LAPA 1AHRA 1TNXA 2JT8A 2KQYA 1OMDA 4IL1A 3MSEB 1DJYA 1J7RA 1KSOA 2F8PA 4JWQA 5CPVA 1TNWA 2K7BA 1SPYA 1OQPA 2EHBA 2GGMA 1B1GA 1Q80A 2OS8B 3CR5X 1QIVA 1F71A 3PLFB 1K90D 1CM1A 1TIZA 3CGAA 3DD4A 3DF0B 4R1EA 1RFJA 4FTGA 1NYAA 1R2UA 2WNDA 4GAOA 1E8AA 3WHUB 1CLBA 1H8BA 1PRWA 2Y1MA 1W7JB 1LA0A 4Q04A 2LLUA 1CKKA 4HSZA 2KDHA 1XFYO 1B9AA 1SBJA 3DF0A 4C0JA 3D0YA 2H61A 1CFDA 3BUXB 3KEVA 2L5XB 1SMGA 3CZTX 1NSHA 1RWYA 3VRPA 1MWNA 1SCVA 1B8CA 2COLB 5IBWA 2M97A 2ZNDA 3CR2A 1QVIZ 1MXEA 2OTGC 5JJGA 1F55A 5KTYA 2KAVA 4N5XA 1TN4A 2I7AA 1NWDA 1SL7A 2JWWA 4BY5A 1NPQA 1WDCC 2K61A 3E3RA 1NX2A 1SCMB 2Y5IA 1DJXA 5ER5A 1KWOB 1M31A 1QTXA 2O60A 2LVVA 4CLNA 2M1UA 1WLMA 4ICBA 1G4YR 4M2PA 4QJ4B 1MF8B 3O4YA 2L0PA 4N1FA 3EKHA 2LE9B 2I18A 1W7IB 1F4QA 2L4IA 3LL8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JF2 A;  3SIB A;  3WHT B;  1WRZ A;  1IQ5 A;  1B4C A;  2BEC A;  2BCA A;  2L51 A;  1F54 A;  3VRO A;  1BG1 A;  1SW8 A;  2AMI A;  1KFU L;  2FJU B;  3EK7 A;  1IJ5 A;  2MHH A;  2MRD A;  1B47 A;  4QJ3 B;  3I5H B;  2EC6 C;  1SR6 C;  1QJT A;  2MBX A;  3DVM A;  3SG2 A;  2I2R E;  2LLS A;  1MXL C;  3OP0 A;  4GFT A;  1BJF A;  1FBV A;  4MRY A;  2KAY A;  2R2I A;  5K89 A;  4JQ0 D;  4MZK A;  4DIR A;  2M7N A;  1Y1X A;  1YX7 A;  1IRJ A;  1WRK A;  4I5K A;  1LIN A;  4PE7 A;  2GGZ A;  2CNP A;  4YGE B;  3BUW B;  2HQ8 A;  3AKA A;  5HKW A;  3VRN A;  2NXQ A;  1TNQ A;  3FS7 A;  1GQM A;  3JVT C;  3VRQ A;  1NCY A;  2ZN8 A;  1NCZ A;  5KSZ A;  1IKU A;  1CLL A;  1OSA A;  1JFK A;  2ZN9 A;  1J7Q A;  1HQV A;  1F4O A;  1B7T Z;  2K7C A;  4GBA A;  3PM8 A;  1R6P A;  2LVK A;  4CPV A;  1CFC A;  4PHM A;  4DRW A;  1JUO A;  2CTN A;  1XO5 A;  2KYC A;  2MLF C;  3BQ3 A;  1DVI A;  3DVJ A;  3M0W A;  3SG6 A;  3AAK A;  2JTT A;  3NSO A;  5HLV A;  1SL8 A;  2M1K B;  4JPZ B;  1PSR A;  5G08 A;  5J3X A;  5I8N A;  1NX1 A;  1K9K A;  1NIW A;  3ZNI A;  1S6C A;  1Y0V H;  3LK1 A;  1QV1 A;  1OMR A;  1TCO B;  2A4J A;  4YGA A;  3KO0 A;  4ZCU A;  2LMU A;  4C0K A;  2L2E A;  2LHI A;  4YGC B;  3NXA A;  2V53 A;  1PVA A;  1QX5 B;  3DVK A;  4PDZ A;  2ISD A;  2KI4 B;  1CDN A;  1IJ6 A;  3TUY C;  4P2Y B;  4UPG A;  5DKR A;  1YVL A;  1PAL A;  1L2O C;  2KHN A;  4OR9 B;  2KGR A;  4YI9 A;  1CFP A;  2NZ0 A;  1ALW A;  2BKI B;  1S3P A;  1AJ4 A;  2BL0 C;  1S5G Y;  2LMT A;  4P5O E;  1B8L A;  2WOR A;  3NSL A;  4XJK A;  2KSP A;  1M39 A;  2NCP A;  3I5I C;  1DJG A;  1BOC A;  1NX3 A;  3I5I B;  1MUX A;  3JTD B;  1IGV A;  1NUB A;  2RGI A;  1IH0 A;  1UHJ A;  1K8U A;  2OS8 C;  4M2O A;  1K93 D;  2AAO A;  2M29 A;  1QX2 A;  2ZNE A;  3IQQ A;  1M45 A;  1V1G A;  3TDI A;  2E30 A;  1H4B A;  2L4H A;  2H61 C;  3D0Y B;  4MBE A;  2EGD A;  1KK7 Y;  2I94 A;  2QAC A;  3EK8 A;  5HYD A;  2BBN A;  1A2X A;  2JT0 A;  2K7D A;  2NLN A;  1BLQ A;  2D8N A;  2H2K A;  2FCD A;  1PUL A;  1ODB A;  2IS9 A;  1YRT B;  1DF0 A;  1N2D A;  4MVF A;  1XYD A;  1KFU S;  1KK8 B;  1DJW A;  2L50 A;  1J7O A;  3EVU A;  1YX8 A;  4USL A;  2BKH B;  2JNF A;  1SNL A;  1SRA A;  1LVC D;  1TOP A;  2LNK A;  2JTZ A;  1ZAC A;  2GV5 A;  1NX0 A;  3O78 A;  3SG7 A;  5PAL A;  1TCF A;  3TS5 B;  2M3W A;  2PVB A;  4ORA B;  1SCM C;  3I5F B;  4PHJ A;  1KWO C;  3SG4 A;  1BT6 A;  4CID A;  2ZFD A;  4GPL B;  5I2Q A;  1DTL A;  1XVJ A;  1A4P A;  2WOS A;  3PAT A;  1KSM A;  2G9B A;  1UWO A;  1ZMZ A;  4YGB B;  1RRO A;  3LLE A;  2LC5 A;  4FQO A;  1GGZ A;  1YR5 A;  4PHN A;  2KYF A;  1N65 A;  1D1O A;  2JPT A;  1A75 B;  3SIA A;  3D10 A;  1V1F A;  4L9M A;  1LKJ A;  4M2Q A;  3FWC A;  1U5I A;  2LUC A;  3I5H C;  3IQO A;  1F70 A;  2KOT A;  1JSA A;  3GK2 A;  2PAL A;  3IF7 A;  1A75 A;  2BCB A;  4PCW A;  1QVI Y;  1ZUZ A;  2KBI A;  1DJZ A;  2F2P A;  2Y4Q A;  5AFP A;  1K2H A;  5I2L A;  3WXA A;  2Y1N A;  4A4B A;  3EK4 A;  4ORB B;  2HPS A;  1QIW A;  4OVN F;  4GGF A;  2L98 A;  3SJS A;  1XA5 A;  4MZL A;  1FPW A;  5CSN A;  1QS7 A;  4PE4 A;  3CLN A;  3BUN B;  3RM1 A;  1A03 A;  1EG3 A;  2MJW B;  2E6W A;  2HF5 A;  3PN7 B;  5CSF A;  1XK4 C;  4E68 A;  3CS1 A;  5D69 A;  4QJ5 B;  2K8M B;  1C7W A;  1JF0 A;  1KCY A;  1CM4 A;  4GUK A;  1M46 A;  3KF9 A;  2LV7 A;  1KQV A;  3EKJ A;  2KAX A;  3I5G C;  4ORC B;  3I5G B;  2F2O A;  2TN4 A;  2PRU A;  4HRE E;  2M0R A;  1QX7 A;  3HX4 A;  5DKQ A;  5TNC A;  2NCO A;  1IQ3 A;  3KPX A;  2VRG A;  1EXR A;  3BUO B;  3OHM B;  2LUX A;  1FI5 A;  5I2O A;  2CT9 A;  3SG5 A;  1J1D A;  1AJ5 A;  4F0Z B;  4D1E A;  1TTX A;  2FCE A;  5HKY A;  1EH2 A;  2LLT A;  2KI4 C;  1K96 A;  1X02 A;  3EVR A;  4PE0 A;  2JU0 A;  1N0Y A;  2JXC A;  2KFF A;  2Q91 A;  2K0J A;  3BXK A;  4XJK B;  4YBH B;  3CWG A;  4OKH A;  1B7T Y;  1KFX L;  1YUR A;  2LVJ A;  4PAL A;  2PMY A;  5D7F A;  3TDU A;  4DS7 A;  3OX5 A;  1K9U A;  1XFX O;  2LMV A;  3F45 A;  5HKZ A;  3GOF A;  3H4S E;  2WC8 A;  1G8I A;  3BOW A;  3JTD C;  3PFV A;  4GNK B;  1LXF C;  3HCM A;  4ZCV A;  5AAN A;  4ETO A;  3C1V A;  2SAS A;  1IWQ A;  2BE6 A;  5AEQ A;  5BPJ A;  1BMO A;  1CLM A;  2KQ6 A;  3O2P A;  2LAN A;  1VRK A;  4OCI A;  1PSB A;  3OB2 B;  2Q4U A;  5CSJ A;  4AQJ A;  1HT9 A;  3BUM B;  1DF0 B;  2KFH A;  3SG3 A;  3EVV A;  1YUT A;  4MLW A;  2KGB C;  4AQI A;  3LK0 A;  1CB1 A;  4PHK A;  5AER A;  2P6B B;  1OE9 B;  1KK8 C;  4C0L A;  3NSI A;  1JC2 A;  2HQW A;  1BF5 A;  4NQG A;  1DGU A;  2JUL A;  4YRU A;  2M49 B;  2F3Z A;  2BBM A;  4DUQ A;  2ZRT A;  3CTN A;  3GK4 X;  1J55 A;  1RK9 A;  3RLZ A;  3TS5 C;  2KI6 D;  3I5F C;  2SCP A;  3A8R A;  1YVH A;  3TZ1 A;  2BCX A;  1DT7 B;  1J7P A;  1DJI A;  4MZJ A;  5ER4 X;  1KQM C;  2LVI A;  1REC A;  1CDL A;  1KQM B;  2WCB A;  1UHK A;  3PSR A;  1SL9 A;  4PE1 A;  1MR8 A;  1JFJ A;  2CCM A;  2G2B A;  2JNX A;  1BOD A;  2JRF A;  1MQ1 A;  1DMO A;  4NDD A;  1J1E A;  1QXP A;  2ZRS A;  5DKN A;  1SYM A;  1U5I B;  1OMV A;  1GGW A;  1L7Z A;  1YRU B;  1CFF A;  1K9P A;  1BR1 B;  3OX6 A;  2OTG B;  2MA2 A;  3OB1 B;  3FIA A;  1UHN A;  3K21 A;  2KFG A;  3BYA A;  5GQQ C;  1UUR A;  1MHO A;  1LA3 A;  2JQ6 A;  2CBL A;  1SY9 A;  1WDC B;  1ZFS A;  2K2F A;  4GGF C;  2DOQ A;  1Y6W A;  1UP5 A;  2F3Y A;  4A4C A;  4WQ3 A;  1PK0 D;  3AAJ A;  1K95 A;  1S26 D;  1QLS A;  1S6I A;  1OZO A;  3FWB A;  2M8U A;  4HRH A;  1ALV A;  2K2A A;  1CTR A;  3ICB A;  2K7O A;  2M9G A;  1AK8 A;  2BE4 A;  4BY4 A;  3DVE A;  3NSK A;  1RJV A;  2CXJ A;  3O6B A;  3PN7 C;  1K94 A;  5CSI A;  1YUS A;  2WCE A;  4U8D A;  3VRR A;  1TNP A;  1FI6 A;  5B8I B;  2KNE A;  4MEW A;  1CDM A;  2LHL A;  1KFX S;  1OOJ A;  2PSR A;  2EC6 B;  1SR6 B;  3KHE A;  2JC2 A;  4CFQ A;  4DCK A;  1NCX A;  3CR4 X;  5KU1 A;  1Y1A A;  4NDC A;  4AOM A;  1DJH A;  1ZOT B;  2JXL A;  2MLE C;  1EL4 A;  3AKB A;  5FYX A;  2LM5 A;  4GGN A;  1TRF A;  1CMG A;  1BU3 A;  1CMF A;  1IG5 A;  4I5J A;  2FOT A;  2KBM A;  4MSP A;  4MN0 A;  4N1G A;  1JWD A;  3PAL A;  2JZI A;  2ZKM X;  4I5N B;  4MRX A;  1G33 A;  3JVT B;  3GK1 A;  1CNP A;  2MAZ A;  1XFZ O;  2M7L A;  1UUS A;  2KI6 C;  4YGD B;  4HRG A;  1Y1U A;  4NDB A;  1S5G Z;  1XK4 A;  2F33 A;  1AP4 A;  1QAS A;  1S1E A;  2LP2 A;  1AVS A;  1FW4 A;  1QV0 A;  1F8H A;  1WRL A;  2AUC A;  1EJ3 A;  1FF1 A;  1S6J A;  1UHI A;  3BOW B;  1YUU A;  3WNX B;  1C07 A;  2PAS A;  1JBA A;  1UHH A;  2B1U A;  5AXI A;  1QAT A;  1BR4 B;  1YTZ C;  1KK7 Z;  5HLO A;  3ZWH A;  1SK6 D;  2JOJ A;  2LCP A;  3TDZ A;  2QPT A;  4I5L B;  4WRI A;  1EG4 A;  1S36 A;  3TUY B;  1SKT A;  2JT3 A;  1M63 B;  1C7V A;  5JOL A;  4OV2 A;  3A4U B;  4CFR A;  2OPO A;  2HET A;  4TNC A;  1RTP 1;  1L2O B;  2WCF A;  2O5G A;  4WQ2 A;  1CDP A;  1XFU O;  1WY9 A;  1DGV A;  1XFW O;  1XFV O;  4YI8 A;  4XYN A;  1QLK A;  1A29 A;  1OZS A;  1WLZ A;  1NP8 A;  3LCP C;  3VGO A;  1AUI B;  1B8R A;  1GJY A;  2BL0 B;  5F6T A;  1PVB A;  2LP3 A;  3QRX A;  2LAP A;  1AHR A;  1TNX A;  2JT8 A;  2KQY A;  1OMD A;  4IL1 A;  3MSE B;  1DJY A;  1J7R A;  1KSO A;  2F8P A;  4JWQ A;  5CPV A;  1TNW A;  2K7B A;  1SPY A;  1OQP A;  2EHB A;  2GGM A;  1B1G A;  1Q80 A;  2OS8 B;  3CR5 X;  1QIV A;  1F71 A;  3PLF B;  1K90 D;  1CM1 A;  1TIZ A;  3CGA A;  3DD4 A;  3DF0 B;  4R1E A;  1RFJ A;  4FTG A;  1NYA A;  1R2U A;  2WND A;  4GAO A;  1E8A A;  3WHU B;  1CLB A;  1H8B A;  1PRW A;  2Y1M A;  1W7J B;  1LA0 A;  4Q04 A;  2LLU A;  1CKK A;  4HSZ A;  2KDH A;  1XFY O;  1B9A A;  1SBJ A;  3DF0 A;  4C0J A;  3D0Y A;  2H61 A;  1CFD A;  3BUX B;  3KEV A;  2L5X B;  1SMG A;  3CZT X;  1NSH A;  1RWY A;  3VRP A;  1MWN A;  1SCV A;  1B8C A;  2COL B;  5IBW A;  2M97 A;  2ZND A;  3CR2 A;  1QVI Z;  1MXE A;  2OTG C;  5JJG A;  1F55 A;  5KTY A;  2KAV A;  4N5X A;  1TN4 A;  2I7A A;  1NWD A;  1SL7 A;  2JWW A;  4BY5 A;  1NPQ A;  1WDC C;  2K61 A;  3E3R A;  1NX2 A;  1SCM B;  2Y5I A;  1DJX A;  5ER5 A;  1KWO B;  1M31 A;  1QTX A;  2O60 A;  2LVV A;  4CLN A;  2M1U A;  1WLM A;  4ICB A;  1G4Y R;  4M2P A;  4QJ4 B;  1MF8 B;  3O4Y A;  2L0P A;  4N1F A;  3EKH A;  2LE9 B;  2I18 A;  1W7I B;  1F4Q A;  2L4I A;  3LL8 B; 
#chains in the Genus database with same CATH topology
 1JF2 A;  3DZT A;  3SIB A;  1TUJ A;  2WCJ A;  3WHT B;  1WRZ A;  1IQ5 A;  1B4C A;  3BFH A;  2BEC A;  2BCA A;  2L51 A;  1F54 A;  3VRO A;  1BG1 A;  1SW8 A;  2AMI A;  1KFU L;  2FJU B;  3EK7 A;  1IJ5 A;  3R1V A;  2MHH A;  2MRD A;  1B47 A;  4QJ3 B;  3I5H B;  2EC6 C;  1SR6 C;  1QJT A;  2MBX A;  2KLD A;  3DVM A;  3SG2 A;  2I2R E;  2LLS A;  1MXL C;  3OP0 A;  4GFT A;  1BJF A;  1FBV A;  4MRY A;  2KAY A;  2R2I A;  5K89 A;  4JQ0 D;  4MZK A;  1OOI X;  4DIR A;  2M7N A;  1Y1X A;  1YX7 A;  1IRJ A;  1WRK A;  4I5K A;  1LIN A;  4PE7 A;  4GNK B;  2GGZ A;  2CNP A;  4YGE B;  3BUW B;  2HQ8 A;  3AKA A;  5HKW A;  3VRN A;  2PQL A;  2NXQ A;  1TNQ A;  2P70 A;  1GQM A;  3FS7 A;  3JVT C;  3VRQ A;  1NCY A;  2ZN8 A;  1NCZ A;  5KSZ A;  1IKU A;  1CLL A;  1OSA A;  1JFK A;  2ZN9 A;  1J7Q A;  1HQV A;  2QEB A;  1F4O A;  1B7T Z;  2K7C A;  4GBA A;  1DEL A;  1R6P A;  2LVK A;  3PM8 A;  4CPV A;  1CFC A;  4PHM A;  5FI7 A;  1JUO A;  2CTN A;  1XO5 A;  2KYC A;  2MLF C;  3BQ3 A;  1DVI A;  3DVJ A;  3M0W A;  3SG6 A;  2PYQ A;  3AAK A;  2JTT A;  3NSO A;  5HLV A;  1SL8 A;  2M1K B;  4JPZ B;  1PSR A;  5G08 A;  5J3X A;  5I8N A;  1NX1 A;  1K9K A;  1NIW A;  3ZNI A;  1S6C A;  4KYN A;  1Y0V H;  3LK1 A;  1QV1 A;  1OMR A;  1TCO B;  2A4J A;  3B86 A;  3KO0 A;  4YGA A;  2LMU A;  4ZCU A;  4C0K A;  2L2E A;  2LHI A;  4YGC B;  3NXA A;  2V53 A;  3FE8 A;  1PVA A;  3R72 A;  1QX5 B;  3DVK A;  4PDZ A;  2ISD A;  2K60 A;  2KI4 B;  1CDN A;  1IJ6 A;  3TUY C;  4P2Y B;  4UPG A;  5DKR A;  1YVL A;  1PAL A;  1L2O C;  2KHN A;  1OOH A;  4OR9 B;  2KGR A;  3CDN A;  4YI9 A;  1W9Z A;  3N7H A;  1CFP A;  2NZ0 A;  1ALW A;  2BKI B;  1S3P A;  1AJ4 A;  3DY9 A;  2BL0 C;  1S5G Y;  2LMT A;  4P5O E;  1B8L A;  2YGU A;  2WOR A;  3NSL A;  4XJK A;  2KSP A;  2KLE A;  1M39 A;  2NCP A;  3I5I C;  1DJG A;  1BOC A;  1NX3 A;  3I5I B;  1MUX A;  3JTD B;  1IGV A;  1NUB A;  2RGI A;  1IH0 A;  1UHJ A;  1K8U A;  2OS8 C;  4M2O A;  1K93 D;  2AAO A;  2M29 A;  2JPO A;  1QX2 A;  2ZNE A;  3IQQ A;  1M45 A;  1V1G A;  3TDI A;  2E30 A;  3VB1 A;  2L4H A;  2H61 C;  1H4B A;  3D0Y B;  4MBE A;  2EGD A;  1KK7 Y;  2I94 A;  2QAC A;  3EK8 A;  5HYD A;  2BBN A;  1A2X A;  2JT0 A;  2K7D A;  2NLN A;  3CZ0 A;  3CAB A;  1BLQ A;  2D8N A;  2H2K A;  2FCD A;  1PUL A;  1ODB A;  2IS9 A;  1YRT B;  1DF0 A;  1N2D A;  4MVF A;  1XYD A;  1KFU S;  1KK8 B;  3EG5 B;  4INX A;  1DJW A;  2L50 A;  1J7O A;  3EVU A;  1YX8 A;  4USL A;  2BKH B;  2JNF A;  1SNL A;  1SRA A;  3CZ1 A;  1LVC D;  1TOP A;  2LNK A;  2JTZ A;  3S0G A;  1ZAC A;  2GV5 A;  3IVT A;  1NX0 A;  3O78 A;  3SG7 A;  2QDI A;  5PAL A;  1TCF A;  3TS5 B;  2L2C A;  2M3W A;  2PVB A;  4ORA B;  1SCM C;  3I5F B;  4PHJ A;  1KWO C;  3SG4 A;  1BT6 A;  1DQE A;  4CID A;  2ZFD A;  3NHI A;  4GPL B;  5I2Q A;  1DTL A;  1XVJ A;  1A4P A;  2WOS A;  3PAT A;  3R1O A;  1KSM A;  2G9B A;  1UWO A;  1ZMZ A;  4YGB B;  1RRO A;  3LLE A;  2LC5 A;  4FQO A;  1GGZ A;  3FE6 A;  1YR5 A;  3BJH A;  4PHN A;  2KYF A;  1N65 A;  1D1O A;  2JPT A;  1A75 B;  3SIA A;  3D10 A;  1V1F A;  4L9M A;  1LKJ A;  4M2Q A;  3B87 A;  2KPH A;  3FWC A;  1U5I A;  4JKT A;  2LUC A;  3I5H C;  3IQO A;  1F70 A;  2KOT A;  1Z2C B;  3CZ2 A;  3GK2 A;  1JSA A;  2PAL A;  3IF7 A;  1A75 A;  2BCB A;  4PCW A;  1QVI Y;  1ZUZ A;  2KBI A;  1DJZ A;  2F2P A;  2Y4Q A;  5AFP A;  1K2H A;  5I2L A;  3WXA A;  3D75 A;  2Y1N A;  4OZD A;  4A4B A;  3EK4 A;  4ORB B;  3B88 A;  2HPS A;  1QIW A;  2BAP A;  4OVN F;  4GGF A;  2L98 A;  3SJS A;  1XA5 A;  4MZL A;  1FPW A;  5CSN A;  1QS7 A;  4PE4 A;  4PT1 A;  3CLN A;  3BUN B;  3RM1 A;  1A03 A;  1EG3 A;  2MJW B;  2E6W A;  2HF5 A;  3PN7 B;  5CSF A;  1XK4 C;  4FQT A;  4E68 A;  3CS1 A;  5D69 A;  4QJ5 B;  2K8M B;  1C7W A;  1JF0 A;  1KCY A;  1CM4 A;  4GUK A;  1M46 A;  3KF9 A;  2LV7 A;  1KQV A;  2L5Y A;  2P71 A;  2KAX A;  3B6X A;  3EKJ A;  3I5G C;  4ORC B;  3BFA A;  3I5G B;  2F2O A;  2TN4 A;  4DRW A;  2PRU A;  4HRE E;  2M0R A;  4DCK A;  1QX7 A;  3HX4 A;  3PJI A;  5DKQ A;  5TNC A;  2NCO A;  1IQ3 A;  3KPX A;  3O4X A;  2VRG A;  1EXR A;  3BUO B;  3OHM B;  2LUX A;  3Q8I A;  1P28 A;  1FI5 A;  5I2O A;  2CT9 A;  3SG5 A;  1J1D A;  5FI6 A;  1AJ5 A;  4F0Z B;  4D1E A;  1TTX A;  2FCE A;  5HKY A;  1EH2 A;  2LLT A;  2KI4 C;  1K96 A;  1X02 A;  3B7A A;  3EVR A;  4PE0 A;  2JU0 A;  1N0Y A;  2JXC A;  2KFF A;  2Q91 A;  5HL1 A;  2K0J A;  3BXK A;  4XJK B;  4YBH B;  1Z4H A;  3QME A;  3CWG A;  3L47 A;  4OKH A;  1B7T Y;  1KFX L;  1YUR A;  2WCM A;  2LVJ A;  4PAL A;  2PMY A;  5D7F A;  3TDU A;  4DS7 A;  3OX5 A;  1K9U A;  1OW4 A;  1XFX O;  2LMV A;  3F45 A;  5HKZ A;  1QWV A;  3GOF A;  3H4S E;  2WC8 A;  1G8I A;  1OOG A;  3BOW A;  3JTD C;  3PFV A;  1LXF C;  3BFB A;  3HCM A;  4ZCV A;  5AAN A;  4ETO A;  1IIO A;  3C1V A;  4F7F A;  2H8V A;  1IWQ A;  2BE6 A;  2SAS A;  5FI2 A;  5AEQ A;  5BPJ A;  1BMO A;  1CLM A;  2KQ6 A;  3O2P A;  2LAN A;  1VRK A;  4OCI A;  1PSB A;  3OB2 B;  2Q4U A;  5CSJ A;  3FE9 A;  4AQJ A;  1HT9 A;  3BUM B;  1DF0 B;  2KFH A;  3OBV A;  3SG3 A;  1TUZ A;  3EVV A;  1YUT A;  4MLW A;  2KGB C;  4AQI A;  3LK0 A;  1CB1 A;  3D74 A;  3NGV A;  4PHK A;  5AER A;  2P6B B;  1OE9 B;  1KK8 C;  4C0L A;  2GTE A;  3NSI A;  3D77 A;  1JC2 A;  2HQW A;  1BF5 A;  4NQG A;  5D3O A;  1DGU A;  2JUL A;  4YRU A;  2M49 B;  2F3Z A;  2BBM A;  4DUQ A;  2ZRT A;  3CTN A;  3GK4 X;  1J55 A;  1RK9 A;  3RLZ A;  3TS5 C;  2QEH A;  1XFR A;  2KI6 D;  3I5F C;  2SCP A;  3A8R A;  1YVH A;  3TZ1 A;  2BCX A;  1DT7 B;  1J7P A;  3V2L A;  1DJI A;  4MZJ A;  5ER4 X;  3S0F A;  1KQM C;  2LVI A;  3DXL A;  1REC A;  1CDL A;  1KQM B;  2WCB A;  1UHK A;  3PSR A;  1SL9 A;  4PE1 A;  1MR8 A;  1JFJ A;  2CCM A;  1C3Z A;  2G2B A;  2JNX A;  3D73 A;  1BOD A;  2JRF A;  1MQ1 A;  1DMO A;  4NDD A;  1C3Y A;  1J1E A;  1QXP A;  2ZRS A;  5DKN A;  1SYM A;  1U5I B;  1OMV A;  1GGW A;  1L7Z A;  1YRU B;  1CFF A;  1K9P A;  3DYE A;  1BR1 B;  3OX6 A;  2OTG B;  2MA2 A;  3OB1 B;  3FIA A;  1UHN A;  3K21 A;  2KFG A;  3BYA A;  5GQQ C;  1UUR A;  1MHO A;  1LA3 A;  2JQ6 A;  2CBL A;  1SY9 A;  1WDC B;  1ZFS A;  2K2F A;  4GGF C;  2DOQ A;  1Y6W A;  1UP5 A;  2F3Y A;  4A4C A;  4WQ3 A;  1PK0 D;  3AAJ A;  3RZS A;  1K95 A;  1S26 D;  2QEV A;  3S0E A;  1QLS A;  1S6I A;  1OZO A;  3FWB A;  2M8U A;  3NHT A;  4HRH A;  1ALV A;  2K2A A;  1CTR A;  3ICB A;  3D76 A;  2K7O A;  2M9G A;  1AK8 A;  2BE4 A;  4BY4 A;  3DVE A;  3NSK A;  1RJV A;  2CXJ A;  3O6B A;  3PN7 C;  1DC1 A;  1K94 A;  5CSI A;  1YUS A;  2WC6 A;  4IJ7 A;  2WCE A;  4U8D A;  1TWO A;  3VRR A;  1TNP A;  3K1E A;  5B8I B;  1FI6 A;  1GM0 A;  2KNE A;  4MEW A;  1CDM A;  2LHL A;  1KFX S;  1OOJ A;  2PSR A;  2EC6 B;  1SR6 B;  3KHE A;  2JC2 A;  2WCK A;  3UO9 A;  1NCX A;  4CFQ A;  3CR4 X;  2WCL A;  5KU1 A;  1Y1A A;  4NDC A;  3SS4 A;  4AOM A;  1DJH A;  1ZOT B;  2JXL A;  2MLE C;  1EL4 A;  3AKB A;  5FYX A;  2LM5 A;  4GGN A;  1TRF A;  1CMG A;  1BU3 A;  1CMF A;  1IG5 A;  2FJY A;  4I5J A;  2FOT A;  2KBM A;  4MSP A;  4MN0 A;  4N1G A;  1JWD A;  3PAL A;  2JZI A;  2ZKM X;  4I5N B;  4MRX A;  1G33 A;  3JVT B;  3GK1 A;  3S0A A;  1CNP A;  2ERB A;  2MAZ A;  1XFZ O;  2M7L A;  1UUS A;  2KI6 C;  4YGD B;  4HRG A;  1SSE B;  1Y1U A;  4NDB A;  4JD9 A;  1S5G Z;  1XK4 A;  2F33 A;  1AP4 A;  1QAS A;  3R1P A;  1S1E A;  2LP2 A;  1AVS A;  1FW4 A;  1QV0 A;  3S0B A;  1F8H A;  3L4A A;  1WRL A;  2AUC A;  3UNW A;  1EJ3 A;  1FF1 A;  1S6J A;  2WC5 A;  1UHI A;  3BOW B;  1YUU A;  3WNX B;  1C07 A;  2PAS A;  1DEK A;  1JBA A;  1UHH A;  2B1U A;  5AXI A;  1QAT A;  1BR4 B;  1YTZ C;  1KK7 Z;  3PM2 A;  5HLO A;  3ZWH A;  1SK6 D;  2JOJ A;  1ORG A;  2LCP A;  3CYZ A;  3TDZ A;  2QPT A;  4I5L B;  4WRI A;  3S0D A;  1EG4 A;  1S36 A;  3TUY B;  1SKT A;  2JT3 A;  1M63 B;  1C7V A;  5JOL A;  4OV2 A;  3A4U B;  4CFR A;  2OPO A;  2HET A;  4TNC A;  1RTP 1;  1L2O B;  5DIC A;  2WCF A;  2O5G A;  4WQ2 A;  1CDP A;  1XFU O;  1WY9 A;  1DGV A;  1XFW O;  1XFV O;  4YI8 A;  4XYN A;  1QLK A;  1A29 A;  1OZS A;  1WLZ A;  1NP8 A;  3LCP C;  3VGO A;  1AUI B;  1B8R A;  1GJY A;  2BL0 B;  5F6T A;  1PVB A;  2LP3 A;  3QRX A;  2LAP A;  1AHR A;  1TNX A;  2JT8 A;  2KQY A;  1OMD A;  4IL1 A;  2BNX A;  3MSE B;  1DJY A;  1J7R A;  1KSO A;  1T14 A;  2F8P A;  4JWQ A;  1TNW A;  2K7B A;  5CPV A;  5EL2 A;  1SPY A;  1OQP A;  2EHB A;  2GGM A;  1B1G A;  1Q80 A;  2OS8 B;  3CR5 X;  1QIV A;  1F71 A;  3PLF B;  1K90 D;  1CM1 A;  1TIZ A;  3CGA A;  3DD4 A;  3DF0 B;  4R1E A;  1RFJ A;  4FTG A;  1NYA A;  1R2U A;  2WND A;  4GAO A;  1E8A A;  3WHU B;  1CLB A;  1H8B A;  1PRW A;  2Y1M A;  1W7J B;  1LA0 A;  4Q04 A;  2LLU A;  1CKK A;  4HSZ A;  2KDH A;  1XFY O;  1B9A A;  1SBJ A;  3DF0 A;  3L4L A;  4C0J A;  3D0Y A;  2H61 A;  1CFD A;  3BUX B;  3KEV A;  2L5X B;  1SMG A;  3CZT X;  1NSH A;  1RWY A;  2QEO A;  3VRP A;  3OGN A;  1MWN A;  1SCV A;  1B8C A;  2COL B;  5IBW A;  2M97 A;  3D78 A;  2ZND A;  3CR2 A;  1QVI Z;  1MXE A;  2OTG C;  5JJG A;  1F55 A;  5KTY A;  2KAV A;  3SS5 A;  4N5X A;  1TN4 A;  2I7A A;  1NWD A;  1SL7 A;  2JWW A;  5I94 A;  4BY5 A;  1NPQ A;  1WDC C;  2K61 A;  2WCH A;  3E3R A;  1NX2 A;  1SCM B;  2Y5I A;  1DJX A;  5ER5 A;  1KWO B;  1M31 A;  1QTX A;  2O60 A;  2LVV A;  4INW A;  2M1U A;  1WLM A;  4ICB A;  4CLN A;  1G4Y R;  4M2P A;  3SS3 A;  1LS8 A;  4QJ4 B;  1MF8 B;  3O4Y A;  2L0P A;  4N1F A;  3EKH A;  1OOF A;  2LE9 B;  2I18 A;  1W7I B;  1F4Q A;  2L4I A;  3LL8 B; 
#chains in the Genus database with same CATH homology
 1JF2 A;  3SIB A;  3WHT B;  1WRZ A;  1IQ5 A;  1B4C A;  2BEC A;  2BCA A;  2L51 A;  1F54 A;  3VRO A;  1BG1 A;  1SW8 A;  2AMI A;  1KFU L;  2FJU B;  3EK7 A;  1IJ5 A;  2MHH A;  2MRD A;  1B47 A;  4QJ3 B;  3I5H B;  2EC6 C;  1SR6 C;  1QJT A;  2MBX A;  3DVM A;  3SG2 A;  2I2R E;  2LLS A;  1MXL C;  3OP0 A;  4GFT A;  1BJF A;  1FBV A;  4MRY A;  2KAY A;  2R2I A;  5K89 A;  4JQ0 D;  4MZK A;  4DIR A;  2M7N A;  1Y1X A;  1YX7 A;  1IRJ A;  1WRK A;  4I5K A;  1LIN A;  4PE7 A;  2GGZ A;  2CNP A;  4YGE B;  3BUW B;  2HQ8 A;  3AKA A;  5HKW A;  3VRN A;  2NXQ A;  1TNQ A;  3FS7 A;  1GQM A;  3JVT C;  3VRQ A;  1NCY A;  2ZN8 A;  1NCZ A;  5KSZ A;  1IKU A;  1CLL A;  1OSA A;  1JFK A;  2ZN9 A;  1J7Q A;  1HQV A;  1F4O A;  1B7T Z;  2K7C A;  4GBA A;  3PM8 A;  1R6P A;  2LVK A;  4CPV A;  1CFC A;  4PHM A;  4DRW A;  1JUO A;  2CTN A;  1XO5 A;  2KYC A;  2MLF C;  3BQ3 A;  1DVI A;  3DVJ A;  3M0W A;  3SG6 A;  3AAK A;  2JTT A;  3NSO A;  5HLV A;  1SL8 A;  2M1K B;  4JPZ B;  1PSR A;  5G08 A;  5J3X A;  5I8N A;  1NX1 A;  1K9K A;  1NIW A;  3ZNI A;  1S6C A;  1Y0V H;  3LK1 A;  1QV1 A;  1OMR A;  1TCO B;  2A4J A;  4YGA A;  3KO0 A;  4ZCU A;  2LMU A;  4C0K A;  2L2E A;  2LHI A;  4YGC B;  3NXA A;  2V53 A;  1PVA A;  1QX5 B;  3DVK A;  4PDZ A;  2ISD A;  2KI4 B;  1CDN A;  1IJ6 A;  3TUY C;  4P2Y B;  4UPG A;  5DKR A;  1YVL A;  1PAL A;  1L2O C;  2KHN A;  4OR9 B;  2KGR A;  4YI9 A;  1CFP A;  2NZ0 A;  1ALW A;  2BKI B;  1S3P A;  1AJ4 A;  2BL0 C;  1S5G Y;  2LMT A;  4P5O E;  1B8L A;  2WOR A;  3NSL A;  4XJK A;  2KSP A;  1M39 A;  2NCP A;  3I5I C;  1DJG A;  1BOC A;  1NX3 A;  3I5I B;  1MUX A;  3JTD B;  1IGV A;  1NUB A;  2RGI A;  1IH0 A;  1UHJ A;  1K8U A;  2OS8 C;  4M2O A;  1K93 D;  2AAO A;  2M29 A;  1QX2 A;  2ZNE A;  3IQQ A;  1M45 A;  1V1G A;  3TDI A;  2E30 A;  1H4B A;  2L4H A;  2H61 C;  3D0Y B;  4MBE A;  2EGD A;  1KK7 Y;  2I94 A;  2QAC A;  3EK8 A;  5HYD A;  2BBN A;  1A2X A;  2JT0 A;  2K7D A;  2NLN A;  1BLQ A;  2D8N A;  2H2K A;  2FCD A;  1PUL A;  1ODB A;  2IS9 A;  1YRT B;  1DF0 A;  1N2D A;  4MVF A;  1XYD A;  1KFU S;  1KK8 B;  1DJW A;  2L50 A;  1J7O A;  3EVU A;  1YX8 A;  4USL A;  2BKH B;  2JNF A;  1SNL A;  1SRA A;  1LVC D;  1TOP A;  2LNK A;  2JTZ A;  1ZAC A;  2GV5 A;  1NX0 A;  3O78 A;  3SG7 A;  5PAL A;  1TCF A;  3TS5 B;  2M3W A;  2PVB A;  4ORA B;  1SCM C;  3I5F B;  4PHJ A;  1KWO C;  3SG4 A;  1BT6 A;  4CID A;  2ZFD A;  4GPL B;  5I2Q A;  1DTL A;  1XVJ A;  1A4P A;  2WOS A;  3PAT A;  1KSM A;  2G9B A;  1UWO A;  1ZMZ A;  4YGB B;  1RRO A;  3LLE A;  2LC5 A;  4FQO A;  1GGZ A;  1YR5 A;  4PHN A;  2KYF A;  1N65 A;  1D1O A;  2JPT A;  1A75 B;  3SIA A;  3D10 A;  1V1F A;  4L9M A;  1LKJ A;  4M2Q A;  3FWC A;  1U5I A;  2LUC A;  3I5H C;  3IQO A;  1F70 A;  2KOT A;  1JSA A;  3GK2 A;  2PAL A;  3IF7 A;  1A75 A;  2BCB A;  4PCW A;  1QVI Y;  1ZUZ A;  2KBI A;  1DJZ A;  2F2P A;  2Y4Q A;  5AFP A;  1K2H A;  5I2L A;  3WXA A;  2Y1N A;  4A4B A;  3EK4 A;  4ORB B;  2HPS A;  1QIW A;  4OVN F;  4GGF A;  2L98 A;  3SJS A;  1XA5 A;  4MZL A;  1FPW A;  5CSN A;  1QS7 A;  4PE4 A;  3CLN A;  3BUN B;  3RM1 A;  1A03 A;  1EG3 A;  2MJW B;  2E6W A;  2HF5 A;  3PN7 B;  5CSF A;  1XK4 C;  4E68 A;  3CS1 A;  5D69 A;  4QJ5 B;  2K8M B;  1C7W A;  1JF0 A;  1KCY A;  1CM4 A;  4GUK A;  1M46 A;  3KF9 A;  2LV7 A;  1KQV A;  3EKJ A;  2KAX A;  3I5G C;  4ORC B;  3I5G B;  2F2O A;  2TN4 A;  2PRU A;  4HRE E;  2M0R A;  1QX7 A;  3HX4 A;  5DKQ A;  5TNC A;  2NCO A;  1IQ3 A;  3KPX A;  2VRG A;  1EXR A;  3BUO B;  3OHM B;  2LUX A;  1FI5 A;  5I2O A;  2CT9 A;  3SG5 A;  1J1D A;  1AJ5 A;  4F0Z B;  4D1E A;  1TTX A;  2FCE A;  5HKY A;  1EH2 A;  2LLT A;  2KI4 C;  1K96 A;  1X02 A;  3EVR A;  4PE0 A;  2JU0 A;  1N0Y A;  2JXC A;  2KFF A;  2Q91 A;  2K0J A;  3BXK A;  4XJK B;  4YBH B;  3CWG A;  4OKH A;  1B7T Y;  1KFX L;  1YUR A;  2LVJ A;  4PAL A;  2PMY A;  5D7F A;  3TDU A;  4DS7 A;  3OX5 A;  1K9U A;  1XFX O;  2LMV A;  3F45 A;  5HKZ A;  3GOF A;  3H4S E;  2WC8 A;  1G8I A;  3BOW A;  3JTD C;  3PFV A;  4GNK B;  1LXF C;  3HCM A;  4ZCV A;  5AAN A;  4ETO A;  3C1V A;  2SAS A;  1IWQ A;  2BE6 A;  5AEQ A;  5BPJ A;  1BMO A;  1CLM A;  2KQ6 A;  3O2P A;  2LAN A;  1VRK A;  4OCI A;  1PSB A;  3OB2 B;  2Q4U A;  5CSJ A;  4AQJ A;  1HT9 A;  3BUM B;  1DF0 B;  2KFH A;  3SG3 A;  3EVV A;  1YUT A;  4MLW A;  2KGB C;  4AQI A;  3LK0 A;  1CB1 A;  4PHK A;  5AER A;  2P6B B;  1OE9 B;  1KK8 C;  4C0L A;  3NSI A;  1JC2 A;  2HQW A;  1BF5 A;  4NQG A;  1DGU A;  2JUL A;  4YRU A;  2M49 B;  2F3Z A;  2BBM A;  4DUQ A;  2ZRT A;  3CTN A;  3GK4 X;  1J55 A;  1RK9 A;  3RLZ A;  3TS5 C;  2KI6 D;  3I5F C;  2SCP A;  3A8R A;  1YVH A;  3TZ1 A;  2BCX A;  1DT7 B;  1J7P A;  1DJI A;  4MZJ A;  5ER4 X;  1KQM C;  2LVI A;  1REC A;  1CDL A;  1KQM B;  2WCB A;  1UHK A;  3PSR A;  1SL9 A;  4PE1 A;  1MR8 A;  1JFJ A;  2CCM A;  2G2B A;  2JNX A;  1BOD A;  2JRF A;  1MQ1 A;  1DMO A;  4NDD A;  1J1E A;  1QXP A;  2ZRS A;  5DKN A;  1SYM A;  1U5I B;  1OMV A;  1GGW A;  1L7Z A;  1YRU B;  1CFF A;  1K9P A;  1BR1 B;  3OX6 A;  2OTG B;  2MA2 A;  3OB1 B;  3FIA A;  1UHN A;  3K21 A;  2KFG A;  3BYA A;  5GQQ C;  1UUR A;  1MHO A;  1LA3 A;  2JQ6 A;  2CBL A;  1SY9 A;  1WDC B;  1ZFS A;  2K2F A;  4GGF C;  2DOQ A;  1Y6W A;  1UP5 A;  2F3Y A;  4A4C A;  4WQ3 A;  1PK0 D;  3AAJ A;  1K95 A;  1S26 D;  1QLS A;  1S6I A;  1OZO A;  3FWB A;  2M8U A;  4HRH A;  1ALV A;  2K2A A;  1CTR A;  3ICB A;  2K7O A;  2M9G A;  1AK8 A;  2BE4 A;  4BY4 A;  3DVE A;  3NSK A;  1RJV A;  2CXJ A;  3O6B A;  3PN7 C;  1K94 A;  5CSI A;  1YUS A;  2WCE A;  4U8D A;  3VRR A;  1TNP A;  1FI6 A;  5B8I B;  2KNE A;  4MEW A;  1CDM A;  2LHL A;  1KFX S;  1OOJ A;  2PSR A;  2EC6 B;  1SR6 B;  3KHE A;  2JC2 A;  4CFQ A;  4DCK A;  1NCX A;  3CR4 X;  5KU1 A;  1Y1A A;  4NDC A;  4AOM A;  1DJH A;  1ZOT B;  2JXL A;  2MLE C;  1EL4 A;  3AKB A;  5FYX A;  2LM5 A;  4GGN A;  1TRF A;  1CMG A;  1BU3 A;  1CMF A;  1IG5 A;  4I5J A;  2FOT A;  2KBM A;  4MSP A;  4MN0 A;  4N1G A;  1JWD A;  3PAL A;  2JZI A;  2ZKM X;  4I5N B;  4MRX A;  1G33 A;  3JVT B;  3GK1 A;  1CNP A;  2MAZ A;  1XFZ O;  2M7L A;  1UUS A;  2KI6 C;  4YGD B;  4HRG A;  1Y1U A;  4NDB A;  1S5G Z;  1XK4 A;  2F33 A;  1AP4 A;  1QAS A;  1S1E A;  2LP2 A;  1AVS A;  1FW4 A;  1QV0 A;  1F8H A;  1WRL A;  2AUC A;  1EJ3 A;  1FF1 A;  1S6J A;  1UHI A;  3BOW B;  1YUU A;  3WNX B;  1C07 A;  2PAS A;  1JBA A;  1UHH A;  2B1U A;  5AXI A;  1QAT A;  1BR4 B;  1YTZ C;  1KK7 Z;  5HLO A;  3ZWH A;  1SK6 D;  2JOJ A;  2LCP A;  3TDZ A;  2QPT A;  4I5L B;  4WRI A;  1EG4 A;  1S36 A;  3TUY B;  1SKT A;  2JT3 A;  1M63 B;  1C7V A;  5JOL A;  4OV2 A;  3A4U B;  4CFR A;  2OPO A;  2HET A;  4TNC A;  1RTP 1;  1L2O B;  2WCF A;  2O5G A;  4WQ2 A;  1CDP A;  1XFU O;  1WY9 A;  1DGV A;  1XFW O;  1XFV O;  4YI8 A;  4XYN A;  1QLK A;  1A29 A;  1OZS A;  1WLZ A;  1NP8 A;  3LCP C;  3VGO A;  1AUI B;  1B8R A;  1GJY A;  2BL0 B;  5F6T A;  1PVB A;  2LP3 A;  3QRX A;  2LAP A;  1AHR A;  1TNX A;  2JT8 A;  2KQY A;  1OMD A;  4IL1 A;  3MSE B;  1DJY A;  1J7R A;  1KSO A;  2F8P A;  4JWQ A;  5CPV A;  1TNW A;  2K7B A;  1SPY A;  1OQP A;  2EHB A;  2GGM A;  1B1G A;  1Q80 A;  2OS8 B;  3CR5 X;  1QIV A;  1F71 A;  3PLF B;  1K90 D;  1CM1 A;  1TIZ A;  3CGA A;  3DD4 A;  3DF0 B;  4R1E A;  1RFJ A;  4FTG A;  1NYA A;  1R2U A;  2WND A;  4GAO A;  1E8A A;  3WHU B;  1CLB A;  1H8B A;  1PRW A;  2Y1M A;  1W7J B;  1LA0 A;  4Q04 A;  2LLU A;  1CKK A;  4HSZ A;  2KDH A;  1XFY O;  1B9A A;  1SBJ A;  3DF0 A;  4C0J A;  3D0Y A;  2H61 A;  1CFD A;  3BUX B;  3KEV A;  2L5X B;  1SMG A;  3CZT X;  1NSH A;  1RWY A;  3VRP A;  1MWN A;  1SCV A;  1B8C A;  2COL B;  5IBW A;  2M97 A;  2ZND A;  3CR2 A;  1QVI Z;  1MXE A;  2OTG C;  5JJG A;  1F55 A;  5KTY A;  2KAV A;  4N5X A;  1TN4 A;  2I7A A;  1NWD A;  1SL7 A;  2JWW A;  4BY5 A;  1NPQ A;  1WDC C;  2K61 A;  3E3R A;  1NX2 A;  1SCM B;  2Y5I A;  1DJX A;  5ER5 A;  1KWO B;  1M31 A;  1QTX A;  2O60 A;  2LVV A;  4CLN A;  2M1U A;  1WLM A;  4ICB A;  1G4Y R;  4M2P A;  4QJ4 B;  1MF8 B;  3O4Y A;  2L0P A;  4N1F A;  3EKH A;  2LE9 B;  2I18 A;  1W7I B;  1F4Q A;  2L4I A;  3LL8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...