1NSHA

Solution structure of rabbit apo-s100a11 (19 models)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
SRPTETERCIESLIAVFQKYAGKDGHSVTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNSDGQLDFQEFLNLIGGLAVACHESFVKAAPPQKRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calgizzarin
publication title Unmasking the Annexin I Interaction from the structure of apo-S100A11
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Metal binding protein
total genus 18
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nshA00
4YGAA 3CLNA 1JUOA 1YUSA 1B9AA 1IQ5A 1WRZA 2O60A 1QXPA 1TRFA 4GGFA 1CFDA 1MR8A 2ZRSA 4HREE 1SW8A 2BCXA 1BT6A 1F54A 1DJGA 1JF2A 2LHIA 3PN7C 2I7AA 4PE7A 1TOPA 1UHHA 1WRKA 3CZTX 3O6BA 2D8NA 1ZMZA 2WORA 1HQVA 1IRJA 2KYCA 1NWDA 2KAXA 1B7TZ 1DJWA 2JZIA 2KFFA 4HRGA 1JFKA 1ZUZA 1H8BA 1SCVA 2LV7A 2MLFC 1OMRA 1NX3A 1IG5A 1SNLA 1NX1A 4MRXA 3DVEA 1S6IA 1F8HA 3I5GC 3NSKA 4OKHA 1DGUA 5AEQA 2H61A 4E68A 4JPZB 3EVUA 1CDPA 3I5FB 2AUCA 1YURA 1NYAA 2SCPA 4PHMA 4U8DA 2WC8A 2Y1NA 4I5JA 1J55A 1BLQA 1YVLA 5J3XA 5AXIA 5D69A 4AQJA 2M8UA 2CT9A 1YVHA 2LUCA 3DF0B 1L2OB 2LP3A 2RGIA 3VRRA 1J7QA 1EH2A 1ALVA 1SCMC 2DOQA 1EG4A 1B8RA 2HPSA 1XFUO 5I2QA 1CM4A 1Y1AA 1TNWA 3I5HB 4P2YB 1KK7Z 2ZRTA 1B47A 1ODBA 1UURA 1UUSA 3CWGA 1RROA 3DVMA 3OB1B 3VROA 1A2XA 3OP0A 2B1UA 4MRYA 4I5NB 4GUKA 4MZKA 2K61A 1S6JA 1XFXO 1KFUL 2V53A 1XK4C 2FCDA 1LXFC 2F8PA 2KQ6A 3DVKA 1FI6A 3BUOB 4D1EA 2JOJA 1F4OA 3PM8A 2LMTA 3EK7A 5HKZA 4MLWA 4USLA 5KTYA 1K2HA 2NCOA 1PVAA 4ZCVA 5HLVA 3EVVA 4MBEA 1TN4A 2BCBA 3EKJA 1M63B 1OQPA 5ER5A 1GQMA 1DJYA 1W7JB 3I5IB 2PSRA 1MXLC 1KQVA 1UWOA 3GOFA 3MSEB 3EK8A 5ER4X 2LANA 3AKBA 1PRWA 2MBXA 1C7WA 1Y1UA 2OTGC 1LKJA 2AMIA 2ZN8A 1YUTA 5AFPA 1XFZO 1S5GY 4PHNA 2PASA 1NSHA 3H4SE 4PHKA 1K93D 5KU1A 4PCWA 1NP8A 1DJHA 3FS7A 2K7OA 2JXCA 3TZ1A 2E6WA 3PN7B 1TCOB 4PALA 2M7NA 2ISDA 1CFFA 2NZ0A 1NCXA 1KQMB 1L7ZA 2ZKMX 1PSRA 1PSBA 1OMVA 3BXKA 5I2LA 2BL0B 4CIDA 2LMVA 2M3WA 2I18A 5AANA 4UPGA 1UHIA 2NLNA 2I2RE 2LLUA 4GGFC 3KEVA 2JTZA 1WDCB 2L51A 2K7BA 5DKQA 3I5GB 1LINA 3PFVA 3OX5A 2KAYA 2KI4B 1RTP1 4BY4A 1U5IA 5I2OA 1CM1A 1N65A 2LP2A 4R1EA 4MVFA 4TNCA 2P6BB 1CDNA 2NXQA 1DF0B 1PALA 3KO0A 2KHNA 2K7CA 2L0PA 3FIAA 3SJSA 1K96A 2JNXA 1SKTA 3CR4X 2HF5A 1YTZC 2LMUA 1S6CA 2H61C 4CFQA 1SL9A 1AUIB 2F3ZA 3OX6A 1X02A 3PALA 3QRXA 3EK4A 5CSNA 1NPQA 3BUMB 4XJKB 1SCMB 2JT0A 2E30A 2LUXA 2VRGA 2ZNDA 1OZSA 4P5OE 1CDLA 1CKKA 1BJFA 2PRUA 5JOLA 1CB1A 2GGMA 1NCZA 3SIBA 3JVTB 1KQMC 2BKIB 2CTNA 1DGVA 1Y0VH 3AAKA 2PVBA 1BU3A 3D0YA 2BL0C 1EXRA 2CBLA 4GFTA 3E3RA 1RK9A 1KWOB 2OPOA 1KSOA 2FCEA 3AAJA 4OCIA 5D7FA 2JNFA 1S5GZ 3ZNIA 3M0WA 4A4BA 1UHJA 1WDCC 1VRKA 3CGAA 1PULA 1HT9A 2KI4C 2NCPA 4QJ3B 3VRNA 1IGVA 2L2EA 1MWNA 1YRUB 4C0JA 2K8MB 2M1UA 2GV5A 2KGRA 3OHMB 4PHJA 1KFXL 4MN0A 3VRPA 5IBWA 1E8AA 4CFRA 2OTGB 2F33A 5PALA 4Q04A 4NDBA 1CMGA 1DJZA 2QACA 1QASA 3NXAA 1NX2A 4ETOA 1LVCD 2BCAA 3LK1A 4GNKB 2GGZA 2ZNEA 1NX0A 1DMOA 1G33A 5B8IB 4YBHB 1QX5B 2TN4A 2LLSA 4MEWA 4ZCUA 4BY5A 1BMOA 4JQ0D 2G9BA 3K21A 4N1GA 2K2AA 4C0KA 1J7OA 1F55A 1CDMA 2QPTA 4PE0A 4NDCA 2JU0A 3JVTC 2KI6C 1IJ6A 1RWYA 2L50A 1SL8A 1ZFSA 4M2QA 4YI8A 3O2PA 2JRFA 1KWOC 5I8NA 1XO5A 3CTNA 3BOWA 1CLLA 3A4UB 2MHHA 4NQGA 2WCFA 3C1VA 2A4JA 4PE1A 1N2DA 1Y6WA 4DUQA 1FPWA 1J1DA 1C7VA 2LC5A 1DJIA 1A75A 1R6PA 1FW4A 2SASA 1EG3A 2H2KA 2WNDA 2L4IA 2KBMA 1TNPA 1DT7B 4I5KA 5CSIA 2LLTA 3CS1A 4IL1A 1K9KA 2IS9A 3BUWB 2LVVA 5AERA 1FBVA 2BECA 2JTTA 1JSAA 2CNPA 1RECA 5DKNA 4M2OA 1G8IA 2MLEC 2R2IA 1IQ3A 3KHEA 1OSAA 1SPYA 3O4YA 1F71A 4DRWA 1DVIA 3GK2A 1KSMA 2JT3A 2F2PA 3TS5C 1QV0A 2MAZA 1BG1A 1NUBA 5G08A 4F0ZB 2L98A 4QJ4B 3F45A 4PDZA 3BYAA 1YRTB 1MF8B 1WY9A 2K7DA 1B8CA 4GBAA 4YI9A 3TDUA 4N1FA 1B8LA 1M45A 3WXAA 2LHLA 5TNCA 1QJTA 4ORCB 3KF9A 3IF7A 1AHRA 2MRDA 1CNPA 1SR6B 1RFJA 2FJUB 2EC6C 1QS7A 1QIVA 1S36A 3ZWHA 3WHTB 2Y1MA 1BR4B 2LVJA 2K0JA 1TNXA 2JPTA 1D1OA 2M0RA 1J7RA 1MUXA 4MZJA 3IQOA 1MQ1A 2KFHA 1QIWA 1QVIY 3EKHA 2K2FA 4FQOA 4L9MA 2ZN9A 1SBJA 3GK4X 5HKWA 3PSRA 3NSIA 3CR5X 1B4CA 1WRLA 1CFCA 3BQ3A 2LVKA 4HSZA 3RLZA 1WLZA 1J7PA 2LVIA 2ZFDA 1S1EA 2FOTA 1UHKA 1A03A 1PVBA 1C07A 3DF0A 2KBIA 1AJ4A 1CMFA 4MZLA 2Q4UA 1OMDA 1K95A 3SIAA 5CSFA 1AP4A 3JTDC 1UP5A 1K94A 4ORAB 3NSLA 5GQQC 2HQ8A 4GAOA 2JT8A 1N0YA 1YUUA 1QX7A 4DS7A 1DJXA 5KSZA 1CLMA 1OOJA 2JWWA 1TNQA 1S3PA 1JWDA 4A4CA 1KFXS 2OS8B 5HLOA 3OB2B 1XVJA 1YX8A 3SG5A 4FTGA 1SR6C 3HCMA 1QV1A 4OVNF 3TDZA 4WQ2A 1M39A 1RJVA 2MA2A 1EL4A 2WCEA 4DCKA 3TUYC 1JBAA 1XFWO 2BE6A 1LA3A 2Y5IA 2L4HA 1QX2A 2WCBA 4PE4A 1TIZA 2Y4QA 1V1FA 3D10A 1JF0A 4AOMA 1U5IB 2BE4A 1SYMA 2KI6D 3BUNB 5HYDA 1QATA 3PATA 1BOCA 2JC2A 2Q91A 4C0LA 1FF1A 4WRIA 2M49B 3A8RA 1KFUS 3DD4A 2JXLA 1ZOTB 4ICBA 1TCFA 1WLMA 3ICBA 2HQWA 3TS5B 1GGWA 2HETA 2JULA 3FWBA 1AVSA 1YX7A 2CCMA 1W7IB 2LNKA 3SG3A 1OZOA 1QLSA 2PMYA 1M46A 2L5XB 4YRUA 1IKUA 3AKAA 5BPJA 3EVRA 1XFYO 1QVIZ 1A4PA 1QTXA 3WNXB 4XYNA 5CPVA 1LA0A 2KFGA 2KOTA 3GK1A 2OS8C 1R2UA 2EC6B 1IH0A 3D0YB 1KK8B 1ZACA 3SG4A 1SY9A 2EGDA 2CXJA 1A29A 1GGZA 5K89A 2BKHB 2JQ6A 2O5GA 2F3YA 2COLB 2M29A 1GJYA 4OV2A 1SRAA 4YGCB 2M1KB 1K9UA 1XA5A 1DF0A 2EHBA 2LCPA 3SG2A 3LCPC 5DKRA 2PALA 2BBMA 4QJ5B 1G4YR 4AQIA 2KAVA 3RM1A 4JWQA 4N5XA 1F4QA 4CLNA 4YGEB 4HRHA 1UHNA 3KPXA 2KYFA 1BF5A 3WHUB 5HKYA 1PK0D 1IWQA 2M9GA 1K9PA 3I5FC 2LM5A 3LK0A 2KNEA 4XJKA 4OR9B 3TDIA 3JTDB 2G2BA 5CSJA 2I94A 1JC2A 1MXEA 2M97A 2MJWB 1ALWA 2M7LA 1B1GA 1B7TY 1S26D 3NSOA 2LAPA 1KCYA 1AJ5A 3O78A 2AAOA 4YGBB 4DIRA 1QLKA 1OE9B 3SG7A 1SK6D 3VRQA 1FI5A 5JJGA 3IQQA 1M31A 1L2OC 1XK4A 1BR1B 1J1EA 2BBNA 1H4BA 1MHOA 1IJ5A 1EJ3A 4GGNA 1KK8C 1DTLA 3FWCA 3CR2A 1CFPA 3HX4A 1Y1XA 3BOWB 2KQYA 1CLBA 1F70A 2KSPA 3I5HC 3TUYB 4CPVA 1K90D 3LL8B 1JFJA 5F6TA 2WOSA 4M2PA 3VGOA 3SG6A 1A75B 4I5LB 4NDDA 2KDHA 1TTXA 3DVJA 4WQ3A 1YR5A 1V1GA 1AK8A 1SMGA 4MSPA 1Q80A 4GPLB 1K8UA 4YGDB 1SL7A 1NIWA 1BODA 1XFVO 3I5IC 3BUXB 1NCYA 1KK7Y 2KGBC 2LE9B 1XYDA 2F2OA 1CTRA 3LLEA 3PLFB 4ORBB 5FYXA
chains in the Genus database with same CATH superfamily
4YGAA 3CLNA 1JUOA 1YUSA 1B9AA 1IQ5A 1WRZA 3BFBA 2O60A 3D73A 1QXPA 1TRFA 3D78A 5I94A 3NHTA 4GGFA 1CFDA 1MR8A 2ZRSA 4HREE 1SW8A 2BCXA 1BT6A 3QMEA 1F54A 2QDIA 1DJGA 1JF2A 2LHIA 3PN7C 2I7AA 4PE7A 1TOPA 1UHHA 1WRKA 3CZTX 3O6BA 2D8NA 1ZMZA 2WORA 1HQVA 1IRJA 1DEKA 2KYCA 1NWDA 2KAXA 1B7TZ 1DJWA 2JZIA 2KFFA 4HRGA 1JFKA 1ZUZA 1H8BA 1SCVA 2LV7A 2MLFC 1OMRA 1NX3A 1IG5A 1SNLA 1NX1A 3BFHA 4MRXA 3DVEA 1S6IA 3O4XA 1F8HA 3I5GC 3NSKA 4OKHA 1DGUA 2YGUA 5AEQA 2H61A 3S0DA 4E68A 4JPZB 3EVUA 1CDPA 3I5FB 3N7HA 2AUCA 1YURA 1NYAA 2SCPA 4PHMA 4U8DA 2WC8A 2Y1NA 3CABA 1J55A 4I5JA 1DC1A 1BLQA 1YVLA 5J3XA 4JKTA 5AXIA 5D69A 4AQJA 2M8UA 2CT9A 1YVHA 2LUCA 4OZDA 1OOFA 3DF0B 1L2OB 2LP3A 2RGIA 2P70A 3VRRA 1J7QA 1EH2A 1ALVA 1SCMC 2DOQA 1EG4A 1B8RA 2HPSA 1XFUO 5I2QA 1CM4A 1Y1AA 1TNWA 3I5HB 2KLDA 1KK7Z 4P2YB 2ZRTA 1B47A 1ODBA 1UURA 1UUSA 3CWGA 1RROA 3DVMA 3OB1B 3VROA 1A2XA 3OP0A 2B1UA 4MRYA 4I5NB 4GUKA 4MZKA 2K61A 1Z2CB 5EL2A 1S6JA 1XFXO 1KFUL 2V53A 1XK4C 2FCDA 1LXFC 2F8PA 2KQ6A 3DVKA 1FI6A 3BUOB 4D1EA 2JOJA 1F4OA 3PM8A 2LMTA 3EK7A 5HKZA 2PYQA 4MLWA 4USLA 5KTYA 1K2HA 2NCOA 1PVAA 4ZCVA 5HLVA 3EVVA 4MBEA 1TN4A 2BCBA 3EKJA 1M63B 1OQPA 3B87A 5ER5A 1GQMA 1DJYA 1W7JB 3I5IB 2PSRA 1MXLC 1KQVA 1UWOA 3GOFA 3MSEB 3EK8A 5ER4X 2LANA 3AKBA 1PRWA 2MBXA 1C7WA 1Y1UA 2OTGC 3R1VA 1LKJA 2AMIA 2ZN8A 1YUTA 5AFPA 1XFZO 3S0EA 3S0AA 1S5GY 4PHNA 2PASA 1NSHA 3H4SE 4PHKA 1K93D 5KU1A 5HL1A 2GTEA 4PCWA 1NP8A 1DJHA 3FS7A 2K7OA 2JXCA 3TZ1A 2E6WA 3PN7B 1TCOB 4PALA 2M7NA 2ISDA 1CFFA 2NZ0A 1NCXA 1KQMB 1L7ZA 2ZKMX 1PSRA 1PSBA 2KPHA 1OMVA 3BXKA 5FI7A 5I2LA 2BL0B 4CIDA 2LMVA 2M3WA 2I18A 5AANA 4UPGA 1UHIA 2NLNA 2I2RE 2LLUA 4GGFC 3KEVA 2JTZA 1WDCB 2L51A 2K7BA 3CYZA 5DKQA 3B86A 3I5GB 3R1OA 1LINA 3CZ0A 3PFVA 3OX5A 2KAYA 2KI4B 3SS5A 1RTP1 4BY4A 1U5IA 5I2OA 1CM1A 1N65A 2LP2A 1TUJA 4R1EA 4MVFA 4TNCA 2P6BB 1CDNA 2NXQA 1DF0B 1GM0A 1PALA 2FJYA 3KO0A 2KHNA 2K7CA 2L0PA 3FIAA 3SJSA 1K96A 2JNXA 1SKTA 3CR4X 2HF5A 1YTZC 5DICA 2LMUA 1S6CA 2H61C 4CFQA 1TUZA 3PJIA 1SL9A 1AUIB 2F3ZA 3OX6A 1X02A 3PALA 3QRXA 3EK4A 3DY9A 5CSNA 1NPQA 3BUMB 3K1EA 4XJKB 1SCMB 2JT0A 2E30A 2LUXA 2VRGA 2ZNDA 1OZSA 4P5OE 1CDLA 1CKKA 1BJFA 2PRUA 5JOLA 1CB1A 2GGMA 1NCZA 3SIBA 3JVTB 1KQMC 2BKIB 2CTNA 1DGVA 1Y0VH 3AAKA 2PVBA 3B7AA 1BU3A 3D0YA 2BL0C 1EXRA 2CBLA 1DELA 3E3RA 1RK9A 1KWOB 2OPOA 1KSOA 2FCEA 3AAJA 4GFTA 4OCIA 5D7FA 4JD9A 3NHIA 1LS8A 2JNFA 1S5GZ 2WCHA 5FI2A 2QEVA 3ZNIA 3M0WA 4A4BA 1UHJA 1WDCC 1QWVA 1VRKA 3CGAA 1PULA 1HT9A 2KI4C 2NCPA 4QJ3B 3VRNA 1IGVA 2L2EA 1MWNA 1YRUB 3L4AA 4C0JA 3D76A 2K8MB 2M1UA 2GV5A 2KGRA 3OHMB 4PHJA 1KFXL 4MN0A 3VRPA 5IBWA 1E8AA 4CFRA 3BFAA 2OTGB 2F33A 5PALA 4Q04A 4NDBA 1CMGA 1DJZA 2QACA 1QASA 3NXAA 1NX2A 4ETOA 1LVCD 2BCAA 3LK1A 4GNKB 2GGZA 2ZNEA 1NX0A 1DMOA 1G33A 5B8IB 4YBHB 3D75A 1QX5B 2TN4A 2LLSA 4MEWA 4ZCUA 4BY5A 1BMOA 4JQ0D 2G9BA 3BJHA 3K21A 4N1GA 4INXA 2K2AA 4C0KA 1J7OA 1F55A 1CDMA 2QPTA 4PE0A 4NDCA 2JU0A 3JVTC 2KI6C 1IJ6A 1RWYA 1T14A 2L50A 3NGVA 1SL8A 1ZFSA 2L5YA 4M2QA 4YI8A 3O2PA 2JRFA 1KWOC 5I8NA 1XO5A 3CDNA 3CTNA 3BOWA 1CLLA 1OOGA 3A4UB 2MHHA 4NQGA 2WCFA 3C1VA 2A4JA 4PE1A 1N2DA 1Y6WA 4DUQA 3IVTA 1FPWA 1J1DA 1C7VA 3R72A 2LC5A 1DJIA 1A75A 1R6PA 1FW4A 2SASA 1EG3A 2H2KA 2WNDA 2L4IA 2KBMA 1C3ZA 1TNPA 1DT7B 4I5KA 5CSIA 4PT1A 1TWOA 2LLTA 3CS1A 4IL1A 1K9KA 2ERBA 2IS9A 2LVVA 3BUWB 4FQTA 5AERA 1FBVA 2BECA 2JTTA 2KLEA 1JSAA 2CNPA 1RECA 3SS4A 5DKNA 4M2OA 2QEHA 2BNXA 1G8IA 1XFRA 2MLEC 2R2IA 1IQ3A 3KHEA 1OSAA 1SPYA 3D77A 3O4YA 1F71A 4DRWA 1DVIA 3GK2A 3S0BA 1KSMA 2JT3A 3EG5B 2F2PA 3TS5C 1QV0A 2MAZA 1BG1A 1NUBA 4F7FA 5G08A 4F0ZB 2L98A 4QJ4B 3F45A 4PDZA 3BYAA 3B88A 1YRTB 1MF8B 1WY9A 2K7DA 1B8CA 4GBAA 4YI9A 3TDUA 3DXLA 4N1FA 1B8LA 1M45A 3WXAA 2LHLA 5TNCA 3S0FA 1QJTA 4ORCB 3KF9A 3IF7A 1AHRA 2BAPA 2MRDA 1CNPA 1SR6B 1RFJA 2FJUB 2EC6C 4IJ7A 1QS7A 1QIVA 1W9ZA 1S36A 3UO9A 3WHTB 3ZWHA 2Y1MA 5FI6A 1OOHA 1BR4B 2LVJA 2K0JA 1TNXA 2JPTA 2P71A 1D1OA 2M0RA 1J7RA 1MUXA 2WC6A 4MZJA 3IQOA 1MQ1A 2JPOA 2KFHA 1QIWA 1QVIY 3EKHA 2K2FA 4FQOA 4L9MA 2ZN9A 1SBJA 3GK4X 5HKWA 3PSRA 3NSIA 3CR5X 1B4CA 1WRLA 1CFCA 3BQ3A 2LVKA 3OGNA 4HSZA 1WLZA 3RLZA 2LVIA 2ZFDA 1J7PA 1S1EA 2FOTA 1UHKA 1A03A 1PVBA 1C07A 3DF0A 2WCJA 2KBIA 3OBVA 1AJ4A 1CMFA 4MZLA 2Q4UA 1OMDA 1K95A 3Q8IA 5CSFA 3SIAA 1AP4A 3JTDC 1UP5A 1K94A 4ORAB 3NSLA 5GQQC 2HQ8A 4GAOA 2JT8A 1N0YA 1YUUA 1QX7A 1P28A 4DS7A 1DJXA 5KSZA 2QEBA 1CLMA 1OOJA 2JWWA 1TNQA 1S3PA 1JWDA 4A4CA 3VB1A 1KFXS 2OS8B 5HLOA 3OB2B 1XVJA 3V2LA 1YX8A 3SG5A 4FTGA 1SR6C 3HCMA 1QV1A 4OVNF 1SSEB 3TDZA 3L4LA 4WQ2A 1M39A 1RJVA 2MA2A 1EL4A 1IIOA 3S0GA 2WCEA 4DCKA 3TUYC 1JBAA 1XFWO 2BE6A 1LA3A 2Y5IA 2L4HA 3CZ2A 1QX2A 2WCBA 4PE4A 1TIZA 2Y4QA 1V1FA 3D10A 1JF0A 4AOMA 1DQEA 1U5IB 2BE4A 1SYMA 2KI6D 3BUNB 5HYDA 1QATA 3D74A 1OW4A 2WCLA 3PATA 1BOCA 2JC2A 2Q91A 4C0LA 1FF1A 4WRIA 2M49B 3A8RA 3FE6A 1KFUS 3DD4A 3FE8A 2JXLA 1ZOTB 4ICBA 1TCFA 1WLMA 3ICBA 2HQWA 3TS5B 1GGWA 2HETA 2JULA 3FWBA 1AVSA 1YX7A 1OOIX 2WCKA 2CCMA 1W7IB 2LNKA 3SG3A 1OZOA 1QLSA 2PMYA 1M46A 2L5XB 4YRUA 1IKUA 3AKAA 5BPJA 3EVRA 1XFYO 1QVIZ 1A4PA 1QTXA 3WNXB 4XYNA 5CPVA 1LA0A 2KFGA 2KOTA 3GK1A 2OS8C 1R2UA 2EC6B 1IH0A 3D0YB 1KK8B 1ZACA 2QEOA 3SG4A 1SY9A 2EGDA 2CXJA 1A29A 1GGZA 5K89A 2BKHB 2JQ6A 2O5GA 2F3YA 3DZTA 2COLB 2H8VA 2M29A 2K60A 3R1PA 1GJYA 4OV2A 1Z4HA 2L2CA 1SRAA 4YGCB 2M1KB 1K9UA 1XA5A 1DF0A 2EHBA 2LCPA 3SG2A 3UNWA 3LCPC 5DKRA 2PALA 2BBMA 4QJ5B 1G4YR 4AQIA 2KAVA 3RM1A 4JWQA 4N5XA 1F4QA 4CLNA 4YGEB 4HRHA 1UHNA 3KPXA 2KYFA 1BF5A 3WHUB 5HKYA 1PK0D 1IWQA 2M9GA 1K9PA 3I5FC 2LM5A 2WCMA 3LK0A 2KNEA 4XJKA 4OR9B 3TDIA 3JTDB 2G2BA 5CSJA 2I94A 1JC2A 1MXEA 3DYEA 2M97A 2MJWB 1ALWA 2M7LA 1B1GA 1B7TY 3FE9A 1S26D 3NSOA 2LAPA 1KCYA 1AJ5A 3O78A 2AAOA 4YGBB 4DIRA 1QLKA 1OE9B 3SG7A 1SK6D 3VRQA 1FI5A 5JJGA 3IQQA 1M31A 1L2OC 1XK4A 1BR1B 2WC5A 1J1EA 2BBNA 1H4BA 1MHOA 1IJ5A 2PQLA 1EJ3A 4GGNA 1KK8C 4KYNA 1DTLA 1ORGA 3FWCA 3CR2A 1CFPA 3HX4A 1Y1XA 3BOWB 3CZ1A 2KQYA 1CLBA 1F70A 2KSPA 3I5HC 3TUYB 4CPVA 1C3YA 1K90D 3LL8B 1JFJA 5F6TA 2WOSA 4M2PA 3VGOA 3SG6A 3SS3A 1A75B 4I5LB 4NDDA 3B6XA 2KDHA 1TTXA 3DVJA 3PM2A 1YR5A 1V1GA 3L47A 4WQ3A 5D3OA 1AK8A 1SMGA 4MSPA 4INWA 1Q80A 4GPLB 1K8UA 4YGDB 1SL7A 1NIWA 1BODA 1XFVO 3I5IC 3RZSA 3BUXB 1NCYA 1KK7Y 2KGBC 2LE9B 1XYDA 2F2OA 1CTRA 3LLEA 3PLFB 4ORBB 5FYXA
chains in the Genus database with same CATH topology
4YGAA 3CLNA 1JUOA 1YUSA 1B9AA 1IQ5A 1WRZA 2O60A 1QXPA 1TRFA 4GGFA 1CFDA 1MR8A 2ZRSA 4HREE 1SW8A 2BCXA 1BT6A 1F54A 1DJGA 1JF2A 2LHIA 3PN7C 2I7AA 4PE7A 1TOPA 1UHHA 1WRKA 3CZTX 3O6BA 2D8NA 1ZMZA 2WORA 1HQVA 1IRJA 2KYCA 1NWDA 2KAXA 1B7TZ 1DJWA 2JZIA 2KFFA 4HRGA 1JFKA 1ZUZA 1H8BA 1SCVA 2LV7A 2MLFC 1OMRA 1NX3A 1IG5A 1SNLA 1NX1A 4MRXA 3DVEA 1S6IA 1F8HA 3I5GC 3NSKA 4OKHA 1DGUA 5AEQA 2H61A 4E68A 4JPZB 3EVUA 1CDPA 3I5FB 2AUCA 1YURA 1NYAA 2SCPA 4PHMA 4U8DA 2WC8A 2Y1NA 4I5JA 1J55A 1BLQA 1YVLA 5J3XA 5AXIA 5D69A 4AQJA 2M8UA 2CT9A 1YVHA 2LUCA 3DF0B 1L2OB 2LP3A 2RGIA 3VRRA 1J7QA 1EH2A 1ALVA 1SCMC 2DOQA 1EG4A 1B8RA 2HPSA 1XFUO 5I2QA 1CM4A 1Y1AA 1TNWA 3I5HB 4P2YB 1KK7Z 2ZRTA 1B47A 1ODBA 1UURA 1UUSA 3CWGA 1RROA 3DVMA 3OB1B 3VROA 1A2XA 3OP0A 2B1UA 4MRYA 4I5NB 4GUKA 4MZKA 2K61A 1S6JA 1XFXO 1KFUL 2V53A 1XK4C 2FCDA 1LXFC 2F8PA 2KQ6A 3DVKA 1FI6A 3BUOB 4D1EA 2JOJA 1F4OA 3PM8A 2LMTA 3EK7A 5HKZA 4MLWA 4USLA 5KTYA 1K2HA 2NCOA 1PVAA 4ZCVA 5HLVA 3EVVA 4MBEA 1TN4A 2BCBA 3EKJA 1M63B 1OQPA 5ER5A 1GQMA 1DJYA 1W7JB 3I5IB 2PSRA 1MXLC 1KQVA 1UWOA 3GOFA 3MSEB 3EK8A 5ER4X 2LANA 3AKBA 1PRWA 2MBXA 1C7WA 1Y1UA 2OTGC 1LKJA 2AMIA 2ZN8A 1YUTA 5AFPA 1XFZO 1S5GY 4PHNA 2PASA 1NSHA 3H4SE 4PHKA 1K93D 5KU1A 4PCWA 1NP8A 1DJHA 3FS7A 2K7OA 2JXCA 3TZ1A 2E6WA 3PN7B 1TCOB 4PALA 2M7NA 2ISDA 1CFFA 2NZ0A 1NCXA 1KQMB 1L7ZA 2ZKMX 1PSRA 1PSBA 1OMVA 3BXKA 5I2LA 2BL0B 4CIDA 2LMVA 2M3WA 2I18A 5AANA 4UPGA 1UHIA 2NLNA 2I2RE 2LLUA 4GGFC 3KEVA 2JTZA 1WDCB 2L51A 2K7BA 5DKQA 3I5GB 1LINA 3PFVA 3OX5A 2KAYA 2KI4B 1RTP1 4BY4A 1U5IA 5I2OA 1CM1A 1N65A 2LP2A 4R1EA 4MVFA 4TNCA 2P6BB 1CDNA 2NXQA 1DF0B 1PALA 3KO0A 2KHNA 2K7CA 2L0PA 3FIAA 3SJSA 1K96A 2JNXA 1SKTA 3CR4X 2HF5A 1YTZC 2LMUA 1S6CA 2H61C 4CFQA 1SL9A 1AUIB 2F3ZA 3OX6A 1X02A 3PALA 3QRXA 3EK4A 5CSNA 1NPQA 3BUMB 4XJKB 1SCMB 2JT0A 2E30A 2LUXA 2VRGA 2ZNDA 1OZSA 4P5OE 1CDLA 1CKKA 1BJFA 2PRUA 5JOLA 1CB1A 2GGMA 1NCZA 3SIBA 3JVTB 1KQMC 2BKIB 2CTNA 1DGVA 1Y0VH 3AAKA 2PVBA 1BU3A 3D0YA 2BL0C 1EXRA 2CBLA 4GFTA 3E3RA 1RK9A 1KWOB 2OPOA 1KSOA 2FCEA 3AAJA 4OCIA 5D7FA 2JNFA 1S5GZ 3ZNIA 3M0WA 4A4BA 1UHJA 1WDCC 1VRKA 3CGAA 1PULA 1HT9A 2KI4C 2NCPA 4QJ3B 3VRNA 1IGVA 2L2EA 1MWNA 1YRUB 4C0JA 2K8MB 2M1UA 2GV5A 2KGRA 3OHMB 4PHJA 1KFXL 4MN0A 3VRPA 5IBWA 1E8AA 4CFRA 2OTGB 2F33A 5PALA 4Q04A 4NDBA 1CMGA 1DJZA 2QACA 1QASA 3NXAA 1NX2A 4ETOA 1LVCD 2BCAA 3LK1A 4GNKB 2GGZA 2ZNEA 1NX0A 1DMOA 1G33A 5B8IB 4YBHB 1QX5B 2TN4A 2LLSA 4MEWA 4ZCUA 4BY5A 1BMOA 4JQ0D 2G9BA 3K21A 4N1GA 2K2AA 4C0KA 1J7OA 1F55A 1CDMA 2QPTA 4PE0A 4NDCA 2JU0A 3JVTC 2KI6C 1IJ6A 1RWYA 2L50A 1SL8A 1ZFSA 4M2QA 4YI8A 3O2PA 2JRFA 1KWOC 5I8NA 1XO5A 3CTNA 3BOWA 1CLLA 3A4UB 2MHHA 4NQGA 2WCFA 3C1VA 2A4JA 4PE1A 1N2DA 1Y6WA 4DUQA 1FPWA 1J1DA 1C7VA 2LC5A 1DJIA 1A75A 1R6PA 1FW4A 2SASA 1EG3A 2H2KA 2WNDA 2L4IA 2KBMA 1TNPA 1DT7B 4I5KA 5CSIA 2LLTA 3CS1A 4IL1A 1K9KA 2IS9A 3BUWB 2LVVA 5AERA 1FBVA 2BECA 2JTTA 1JSAA 2CNPA 1RECA 5DKNA 4M2OA 1G8IA 2MLEC 2R2IA 1IQ3A 3KHEA 1OSAA 1SPYA 3O4YA 1F71A 4DRWA 1DVIA 3GK2A 1KSMA 2JT3A 2F2PA 3TS5C 1QV0A 2MAZA 1BG1A 1NUBA 5G08A 4F0ZB 2L98A 4QJ4B 3F45A 4PDZA 3BYAA 1YRTB 1MF8B 1WY9A 2K7DA 1B8CA 4GBAA 4YI9A 3TDUA 4N1FA 1B8LA 1M45A 3WXAA 2LHLA 5TNCA 1QJTA 4ORCB 3KF9A 3IF7A 1AHRA 2MRDA 1CNPA 1SR6B 1RFJA 2FJUB 2EC6C 1QS7A 1QIVA 1S36A 3ZWHA 3WHTB 2Y1MA 1BR4B 2LVJA 2K0JA 1TNXA 2JPTA 1D1OA 2M0RA 1J7RA 1MUXA 4MZJA 3IQOA 1MQ1A 2KFHA 1QIWA 1QVIY 3EKHA 2K2FA 4FQOA 4L9MA 2ZN9A 1SBJA 3GK4X 5HKWA 3PSRA 3NSIA 3CR5X 1B4CA 1WRLA 1CFCA 3BQ3A 2LVKA 4HSZA 3RLZA 1WLZA 1J7PA 2LVIA 2ZFDA 1S1EA 2FOTA 1UHKA 1A03A 1PVBA 1C07A 3DF0A 2KBIA 1AJ4A 1CMFA 4MZLA 2Q4UA 1OMDA 1K95A 3SIAA 5CSFA 1AP4A 3JTDC 1UP5A 1K94A 4ORAB 3NSLA 5GQQC 2HQ8A 4GAOA 2JT8A 1N0YA 1YUUA 1QX7A 4DS7A 1DJXA 5KSZA 1CLMA 1OOJA 2JWWA 1TNQA 1S3PA 1JWDA 4A4CA 1KFXS 2OS8B 5HLOA 3OB2B 1XVJA 1YX8A 3SG5A 4FTGA 1SR6C 3HCMA 1QV1A 4OVNF 3TDZA 4WQ2A 1M39A 1RJVA 2MA2A 1EL4A 2WCEA 4DCKA 3TUYC 1JBAA 1XFWO 2BE6A 1LA3A 2Y5IA 2L4HA 1QX2A 2WCBA 4PE4A 1TIZA 2Y4QA 1V1FA 3D10A 1JF0A 4AOMA 1U5IB 2BE4A 1SYMA 2KI6D 3BUNB 5HYDA 1QATA 3PATA 1BOCA 2JC2A 2Q91A 4C0LA 1FF1A 4WRIA 2M49B 3A8RA 1KFUS 3DD4A 2JXLA 1ZOTB 4ICBA 1TCFA 1WLMA 3ICBA 2HQWA 3TS5B 1GGWA 2HETA 2JULA 3FWBA 1AVSA 1YX7A 2CCMA 1W7IB 2LNKA 3SG3A 1OZOA 1QLSA 2PMYA 1M46A 2L5XB 4YRUA 1IKUA 3AKAA 5BPJA 3EVRA 1XFYO 1QVIZ 1A4PA 1QTXA 3WNXB 4XYNA 5CPVA 1LA0A 2KFGA 2KOTA 3GK1A 2OS8C 1R2UA 2EC6B 1IH0A 3D0YB 1KK8B 1ZACA 3SG4A 1SY9A 2EGDA 2CXJA 1A29A 1GGZA 5K89A 2BKHB 2JQ6A 2O5GA 2F3YA 2COLB 2M29A 1GJYA 4OV2A 1SRAA 4YGCB 2M1KB 1K9UA 1XA5A 1DF0A 2EHBA 2LCPA 3SG2A 3LCPC 5DKRA 2PALA 2BBMA 4QJ5B 1G4YR 4AQIA 2KAVA 3RM1A 4JWQA 4N5XA 1F4QA 4CLNA 4YGEB 4HRHA 1UHNA 3KPXA 2KYFA 1BF5A 3WHUB 5HKYA 1PK0D 1IWQA 2M9GA 1K9PA 3I5FC 2LM5A 3LK0A 2KNEA 4XJKA 4OR9B 3TDIA 3JTDB 2G2BA 5CSJA 2I94A 1JC2A 1MXEA 2M97A 2MJWB 1ALWA 2M7LA 1B1GA 1B7TY 1S26D 3NSOA 2LAPA 1KCYA 1AJ5A 3O78A 2AAOA 4YGBB 4DIRA 1QLKA 1OE9B 3SG7A 1SK6D 3VRQA 1FI5A 5JJGA 3IQQA 1M31A 1L2OC 1XK4A 1BR1B 1J1EA 2BBNA 1H4BA 1MHOA 1IJ5A 1EJ3A 4GGNA 1KK8C 1DTLA 3FWCA 3CR2A 1CFPA 3HX4A 1Y1XA 3BOWB 2KQYA 1CLBA 1F70A 2KSPA 3I5HC 3TUYB 4CPVA 1K90D 3LL8B 1JFJA 5F6TA 2WOSA 4M2PA 3VGOA 3SG6A 1A75B 4I5LB 4NDDA 2KDHA 1TTXA 3DVJA 4WQ3A 1YR5A 1V1GA 1AK8A 1SMGA 4MSPA 1Q80A 4GPLB 1K8UA 4YGDB 1SL7A 1NIWA 1BODA 1XFVO 3I5IC 3BUXB 1NCYA 1KK7Y 2KGBC 2LE9B 1XYDA 2F2OA 1CTRA 3LLEA 3PLFB 4ORBB 5FYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YGA A;  3CLN A;  1JUO A;  1YUS A;  1B9A A;  1IQ5 A;  1WRZ A;  2O60 A;  1QXP A;  1TRF A;  4GGF A;  1CFD A;  1MR8 A;  2ZRS A;  4HRE E;  1SW8 A;  2BCX A;  1BT6 A;  1F54 A;  1DJG A;  1JF2 A;  2LHI A;  3PN7 C;  2I7A A;  4PE7 A;  1TOP A;  1UHH A;  1WRK A;  3CZT X;  3O6B A;  2D8N A;  1ZMZ A;  2WOR A;  1HQV A;  1IRJ A;  2KYC A;  1NWD A;  2KAX A;  1B7T Z;  1DJW A;  2JZI A;  2KFF A;  4HRG A;  1JFK A;  1ZUZ A;  1H8B A;  1SCV A;  2LV7 A;  2MLF C;  1OMR A;  1NX3 A;  1IG5 A;  1SNL A;  1NX1 A;  4MRX A;  3DVE A;  1S6I A;  1F8H A;  3I5G C;  3NSK A;  4OKH A;  1DGU A;  5AEQ A;  2H61 A;  4E68 A;  4JPZ B;  3EVU A;  1CDP A;  3I5F B;  2AUC A;  1YUR A;  1NYA A;  2SCP A;  4PHM A;  4U8D A;  2WC8 A;  2Y1N A;  4I5J A;  1J55 A;  1BLQ A;  1YVL A;  5J3X A;  5AXI A;  5D69 A;  4AQJ A;  2M8U A;  2CT9 A;  1YVH A;  2LUC A;  3DF0 B;  1L2O B;  2LP3 A;  2RGI A;  3VRR A;  1J7Q A;  1EH2 A;  1ALV A;  1SCM C;  2DOQ A;  1EG4 A;  1B8R A;  2HPS A;  1XFU O;  5I2Q A;  1CM4 A;  1Y1A A;  1TNW A;  3I5H B;  4P2Y B;  1KK7 Z;  2ZRT A;  1B47 A;  1ODB A;  1UUR A;  1UUS A;  3CWG A;  1RRO A;  3DVM A;  3OB1 B;  3VRO A;  1A2X A;  3OP0 A;  2B1U A;  4MRY A;  4I5N B;  4GUK A;  4MZK A;  2K61 A;  1S6J A;  1XFX O;  1KFU L;  2V53 A;  1XK4 C;  2FCD A;  1LXF C;  2F8P A;  2KQ6 A;  3DVK A;  1FI6 A;  3BUO B;  4D1E A;  2JOJ A;  1F4O A;  3PM8 A;  2LMT A;  3EK7 A;  5HKZ A;  4MLW A;  4USL A;  5KTY A;  1K2H A;  2NCO A;  1PVA A;  4ZCV A;  5HLV A;  3EVV A;  4MBE A;  1TN4 A;  2BCB A;  3EKJ A;  1M63 B;  1OQP A;  5ER5 A;  1GQM A;  1DJY A;  1W7J B;  3I5I B;  2PSR A;  1MXL C;  1KQV A;  1UWO A;  3GOF A;  3MSE B;  3EK8 A;  5ER4 X;  2LAN A;  3AKB A;  1PRW A;  2MBX A;  1C7W A;  1Y1U A;  2OTG C;  1LKJ A;  2AMI A;  2ZN8 A;  1YUT A;  5AFP A;  1XFZ O;  1S5G Y;  4PHN A;  2PAS A;  1NSH A;  3H4S E;  4PHK A;  1K93 D;  5KU1 A;  4PCW A;  1NP8 A;  1DJH A;  3FS7 A;  2K7O A;  2JXC A;  3TZ1 A;  2E6W A;  3PN7 B;  1TCO B;  4PAL A;  2M7N A;  2ISD A;  1CFF A;  2NZ0 A;  1NCX A;  1KQM B;  1L7Z A;  2ZKM X;  1PSR A;  1PSB A;  1OMV A;  3BXK A;  5I2L A;  2BL0 B;  4CID A;  2LMV A;  2M3W A;  2I18 A;  5AAN A;  4UPG A;  1UHI A;  2NLN A;  2I2R E;  2LLU A;  4GGF C;  3KEV A;  2JTZ A;  1WDC B;  2L51 A;  2K7B A;  5DKQ A;  3I5G B;  1LIN A;  3PFV A;  3OX5 A;  2KAY A;  2KI4 B;  1RTP 1;  4BY4 A;  1U5I A;  5I2O A;  1CM1 A;  1N65 A;  2LP2 A;  4R1E A;  4MVF A;  4TNC A;  2P6B B;  1CDN A;  2NXQ A;  1DF0 B;  1PAL A;  3KO0 A;  2KHN A;  2K7C A;  2L0P A;  3FIA A;  3SJS A;  1K96 A;  2JNX A;  1SKT A;  3CR4 X;  2HF5 A;  1YTZ C;  2LMU A;  1S6C A;  2H61 C;  4CFQ A;  1SL9 A;  1AUI B;  2F3Z A;  3OX6 A;  1X02 A;  3PAL A;  3QRX A;  3EK4 A;  5CSN A;  1NPQ A;  3BUM B;  4XJK B;  1SCM B;  2JT0 A;  2E30 A;  2LUX A;  2VRG A;  2ZND A;  1OZS A;  4P5O E;  1CDL A;  1CKK A;  1BJF A;  2PRU A;  5JOL A;  1CB1 A;  2GGM A;  1NCZ A;  3SIB A;  3JVT B;  1KQM C;  2BKI B;  2CTN A;  1DGV A;  1Y0V H;  3AAK A;  2PVB A;  1BU3 A;  3D0Y A;  2BL0 C;  1EXR A;  2CBL A;  4GFT A;  3E3R A;  1RK9 A;  1KWO B;  2OPO A;  1KSO A;  2FCE A;  3AAJ A;  4OCI A;  5D7F A;  2JNF A;  1S5G Z;  3ZNI A;  3M0W A;  4A4B A;  1UHJ A;  1WDC C;  1VRK A;  3CGA A;  1PUL A;  1HT9 A;  2KI4 C;  2NCP A;  4QJ3 B;  3VRN A;  1IGV A;  2L2E A;  1MWN A;  1YRU B;  4C0J A;  2K8M B;  2M1U A;  2GV5 A;  2KGR A;  3OHM B;  4PHJ A;  1KFX L;  4MN0 A;  3VRP A;  5IBW A;  1E8A A;  4CFR A;  2OTG B;  2F33 A;  5PAL A;  4Q04 A;  4NDB A;  1CMG A;  1DJZ A;  2QAC A;  1QAS A;  3NXA A;  1NX2 A;  4ETO A;  1LVC D;  2BCA A;  3LK1 A;  4GNK B;  2GGZ A;  2ZNE A;  1NX0 A;  1DMO A;  1G33 A;  5B8I B;  4YBH B;  1QX5 B;  2TN4 A;  2LLS A;  4MEW A;  4ZCU A;  4BY5 A;  1BMO A;  4JQ0 D;  2G9B A;  3K21 A;  4N1G A;  2K2A A;  4C0K A;  1J7O A;  1F55 A;  1CDM A;  2QPT A;  4PE0 A;  4NDC A;  2JU0 A;  3JVT C;  2KI6 C;  1IJ6 A;  1RWY A;  2L50 A;  1SL8 A;  1ZFS A;  4M2Q A;  4YI8 A;  3O2P A;  2JRF A;  1KWO C;  5I8N A;  1XO5 A;  3CTN A;  3BOW A;  1CLL A;  3A4U B;  2MHH A;  4NQG A;  2WCF A;  3C1V A;  2A4J A;  4PE1 A;  1N2D A;  1Y6W A;  4DUQ A;  1FPW A;  1J1D A;  1C7V A;  2LC5 A;  1DJI A;  1A75 A;  1R6P A;  1FW4 A;  2SAS A;  1EG3 A;  2H2K A;  2WND A;  2L4I A;  2KBM A;  1TNP A;  1DT7 B;  4I5K A;  5CSI A;  2LLT A;  3CS1 A;  4IL1 A;  1K9K A;  2IS9 A;  3BUW B;  2LVV A;  5AER A;  1FBV A;  2BEC A;  2JTT A;  1JSA A;  2CNP A;  1REC A;  5DKN A;  4M2O A;  1G8I A;  2MLE C;  2R2I A;  1IQ3 A;  3KHE A;  1OSA A;  1SPY A;  3O4Y A;  1F71 A;  4DRW A;  1DVI A;  3GK2 A;  1KSM A;  2JT3 A;  2F2P A;  3TS5 C;  1QV0 A;  2MAZ A;  1BG1 A;  1NUB A;  5G08 A;  4F0Z B;  2L98 A;  4QJ4 B;  3F45 A;  4PDZ A;  3BYA A;  1YRT B;  1MF8 B;  1WY9 A;  2K7D A;  1B8C A;  4GBA A;  4YI9 A;  3TDU A;  4N1F A;  1B8L A;  1M45 A;  3WXA A;  2LHL A;  5TNC A;  1QJT A;  4ORC B;  3KF9 A;  3IF7 A;  1AHR A;  2MRD A;  1CNP A;  1SR6 B;  1RFJ A;  2FJU B;  2EC6 C;  1QS7 A;  1QIV A;  1S36 A;  3ZWH A;  3WHT B;  2Y1M A;  1BR4 B;  2LVJ A;  2K0J A;  1TNX A;  2JPT A;  1D1O A;  2M0R A;  1J7R A;  1MUX A;  4MZJ A;  3IQO A;  1MQ1 A;  2KFH A;  1QIW A;  1QVI Y;  3EKH A;  2K2F A;  4FQO A;  4L9M A;  2ZN9 A;  1SBJ A;  3GK4 X;  5HKW A;  3PSR A;  3NSI A;  3CR5 X;  1B4C A;  1WRL A;  1CFC A;  3BQ3 A;  2LVK A;  4HSZ A;  3RLZ A;  1WLZ A;  1J7P A;  2LVI A;  2ZFD A;  1S1E A;  2FOT A;  1UHK A;  1A03 A;  1PVB A;  1C07 A;  3DF0 A;  2KBI A;  1AJ4 A;  1CMF A;  4MZL A;  2Q4U A;  1OMD A;  1K95 A;  3SIA A;  5CSF A;  1AP4 A;  3JTD C;  1UP5 A;  1K94 A;  4ORA B;  3NSL A;  5GQQ C;  2HQ8 A;  4GAO A;  2JT8 A;  1N0Y A;  1YUU A;  1QX7 A;  4DS7 A;  1DJX A;  5KSZ A;  1CLM A;  1OOJ A;  2JWW A;  1TNQ A;  1S3P A;  1JWD A;  4A4C A;  1KFX S;  2OS8 B;  5HLO A;  3OB2 B;  1XVJ A;  1YX8 A;  3SG5 A;  4FTG A;  1SR6 C;  3HCM A;  1QV1 A;  4OVN F;  3TDZ A;  4WQ2 A;  1M39 A;  1RJV A;  2MA2 A;  1EL4 A;  2WCE A;  4DCK A;  3TUY C;  1JBA A;  1XFW O;  2BE6 A;  1LA3 A;  2Y5I A;  2L4H A;  1QX2 A;  2WCB A;  4PE4 A;  1TIZ A;  2Y4Q A;  1V1F A;  3D10 A;  1JF0 A;  4AOM A;  1U5I B;  2BE4 A;  1SYM A;  2KI6 D;  3BUN B;  5HYD A;  1QAT A;  3PAT A;  1BOC A;  2JC2 A;  2Q91 A;  4C0L A;  1FF1 A;  4WRI A;  2M49 B;  3A8R A;  1KFU S;  3DD4 A;  2JXL A;  1ZOT B;  4ICB A;  1TCF A;  1WLM A;  3ICB A;  2HQW A;  3TS5 B;  1GGW A;  2HET A;  2JUL A;  3FWB A;  1AVS A;  1YX7 A;  2CCM A;  1W7I B;  2LNK A;  3SG3 A;  1OZO A;  1QLS A;  2PMY A;  1M46 A;  2L5X B;  4YRU A;  1IKU A;  3AKA A;  5BPJ A;  3EVR A;  1XFY O;  1QVI Z;  1A4P A;  1QTX A;  3WNX B;  4XYN A;  5CPV A;  1LA0 A;  2KFG A;  2KOT A;  3GK1 A;  2OS8 C;  1R2U A;  2EC6 B;  1IH0 A;  3D0Y B;  1KK8 B;  1ZAC A;  3SG4 A;  1SY9 A;  2EGD A;  2CXJ A;  1A29 A;  1GGZ A;  5K89 A;  2BKH B;  2JQ6 A;  2O5G A;  2F3Y A;  2COL B;  2M29 A;  1GJY A;  4OV2 A;  1SRA A;  4YGC B;  2M1K B;  1K9U A;  1XA5 A;  1DF0 A;  2EHB A;  2LCP A;  3SG2 A;  3LCP C;  5DKR A;  2PAL A;  2BBM A;  4QJ5 B;  1G4Y R;  4AQI A;  2KAV A;  3RM1 A;  4JWQ A;  4N5X A;  1F4Q A;  4CLN A;  4YGE B;  4HRH A;  1UHN A;  3KPX A;  2KYF A;  1BF5 A;  3WHU B;  5HKY A;  1PK0 D;  1IWQ A;  2M9G A;  1K9P A;  3I5F C;  2LM5 A;  3LK0 A;  2KNE A;  4XJK A;  4OR9 B;  3TDI A;  3JTD B;  2G2B A;  5CSJ A;  2I94 A;  1JC2 A;  1MXE A;  2M97 A;  2MJW B;  1ALW A;  2M7L A;  1B1G A;  1B7T Y;  1S26 D;  3NSO A;  2LAP A;  1KCY A;  1AJ5 A;  3O78 A;  2AAO A;  4YGB B;  4DIR A;  1QLK A;  1OE9 B;  3SG7 A;  1SK6 D;  3VRQ A;  1FI5 A;  5JJG A;  3IQQ A;  1M31 A;  1L2O C;  1XK4 A;  1BR1 B;  1J1E A;  2BBN A;  1H4B A;  1MHO A;  1IJ5 A;  1EJ3 A;  4GGN A;  1KK8 C;  1DTL A;  3FWC A;  3CR2 A;  1CFP A;  3HX4 A;  1Y1X A;  3BOW B;  2KQY A;  1CLB A;  1F70 A;  2KSP A;  3I5H C;  3TUY B;  4CPV A;  1K90 D;  3LL8 B;  1JFJ A;  5F6T A;  2WOS A;  4M2P A;  3VGO A;  3SG6 A;  1A75 B;  4I5L B;  4NDD A;  2KDH A;  1TTX A;  3DVJ A;  4WQ3 A;  1YR5 A;  1V1G A;  1AK8 A;  1SMG A;  4MSP A;  1Q80 A;  4GPL B;  1K8U A;  4YGD B;  1SL7 A;  1NIW A;  1BOD A;  1XFV O;  3I5I C;  3BUX B;  1NCY A;  1KK7 Y;  2KGB C;  2LE9 B;  1XYD A;  2F2O A;  1CTR A;  3LLE A;  3PLF B;  4ORB B;  5FYX A; 
#chains in the Genus database with same CATH topology
 4YGA A;  3CLN A;  1JUO A;  1YUS A;  1B9A A;  1IQ5 A;  1WRZ A;  3BFB A;  2O60 A;  3D73 A;  1QXP A;  1TRF A;  3D78 A;  5I94 A;  3NHT A;  4GGF A;  1CFD A;  1MR8 A;  2ZRS A;  4HRE E;  1SW8 A;  2BCX A;  1BT6 A;  3QME A;  1F54 A;  2QDI A;  1DJG A;  1JF2 A;  2LHI A;  3PN7 C;  2I7A A;  4PE7 A;  1TOP A;  1UHH A;  1WRK A;  3CZT X;  3O6B A;  2D8N A;  1ZMZ A;  2WOR A;  1HQV A;  1IRJ A;  1DEK A;  2KYC A;  1NWD A;  2KAX A;  1B7T Z;  1DJW A;  2JZI A;  2KFF A;  4HRG A;  1JFK A;  1ZUZ A;  1H8B A;  1SCV A;  2LV7 A;  2MLF C;  1OMR A;  1NX3 A;  1IG5 A;  1SNL A;  1NX1 A;  3BFH A;  4MRX A;  3DVE A;  1S6I A;  3O4X A;  1F8H A;  3I5G C;  3NSK A;  4OKH A;  1DGU A;  2YGU A;  5AEQ A;  2H61 A;  3S0D A;  4E68 A;  4JPZ B;  3EVU A;  1CDP A;  3I5F B;  3N7H A;  2AUC A;  1YUR A;  1NYA A;  2SCP A;  4PHM A;  4U8D A;  2WC8 A;  2Y1N A;  3CAB A;  1J55 A;  4I5J A;  1DC1 A;  1BLQ A;  1YVL A;  5J3X A;  4JKT A;  5AXI A;  5D69 A;  4AQJ A;  2M8U A;  2CT9 A;  1YVH A;  2LUC A;  4OZD A;  1OOF A;  3DF0 B;  1L2O B;  2LP3 A;  2RGI A;  2P70 A;  3VRR A;  1J7Q A;  1EH2 A;  1ALV A;  1SCM C;  2DOQ A;  1EG4 A;  1B8R A;  2HPS A;  1XFU O;  5I2Q A;  1CM4 A;  1Y1A A;  1TNW A;  3I5H B;  2KLD A;  1KK7 Z;  4P2Y B;  2ZRT A;  1B47 A;  1ODB A;  1UUR A;  1UUS A;  3CWG A;  1RRO A;  3DVM A;  3OB1 B;  3VRO A;  1A2X A;  3OP0 A;  2B1U A;  4MRY A;  4I5N B;  4GUK A;  4MZK A;  2K61 A;  1Z2C B;  5EL2 A;  1S6J A;  1XFX O;  1KFU L;  2V53 A;  1XK4 C;  2FCD A;  1LXF C;  2F8P A;  2KQ6 A;  3DVK A;  1FI6 A;  3BUO B;  4D1E A;  2JOJ A;  1F4O A;  3PM8 A;  2LMT A;  3EK7 A;  5HKZ A;  2PYQ A;  4MLW A;  4USL A;  5KTY A;  1K2H A;  2NCO A;  1PVA A;  4ZCV A;  5HLV A;  3EVV A;  4MBE A;  1TN4 A;  2BCB A;  3EKJ A;  1M63 B;  1OQP A;  3B87 A;  5ER5 A;  1GQM A;  1DJY A;  1W7J B;  3I5I B;  2PSR A;  1MXL C;  1KQV A;  1UWO A;  3GOF A;  3MSE B;  3EK8 A;  5ER4 X;  2LAN A;  3AKB A;  1PRW A;  2MBX A;  1C7W A;  1Y1U A;  2OTG C;  3R1V A;  1LKJ A;  2AMI A;  2ZN8 A;  1YUT A;  5AFP A;  1XFZ O;  3S0E A;  3S0A A;  1S5G Y;  4PHN A;  2PAS A;  1NSH A;  3H4S E;  4PHK A;  1K93 D;  5KU1 A;  5HL1 A;  2GTE A;  4PCW A;  1NP8 A;  1DJH A;  3FS7 A;  2K7O A;  2JXC A;  3TZ1 A;  2E6W A;  3PN7 B;  1TCO B;  4PAL A;  2M7N A;  2ISD A;  1CFF A;  2NZ0 A;  1NCX A;  1KQM B;  1L7Z A;  2ZKM X;  1PSR A;  1PSB A;  2KPH A;  1OMV A;  3BXK A;  5FI7 A;  5I2L A;  2BL0 B;  4CID A;  2LMV A;  2M3W A;  2I18 A;  5AAN A;  4UPG A;  1UHI A;  2NLN A;  2I2R E;  2LLU A;  4GGF C;  3KEV A;  2JTZ A;  1WDC B;  2L51 A;  2K7B A;  3CYZ A;  5DKQ A;  3B86 A;  3I5G B;  3R1O A;  1LIN A;  3CZ0 A;  3PFV A;  3OX5 A;  2KAY A;  2KI4 B;  3SS5 A;  1RTP 1;  4BY4 A;  1U5I A;  5I2O A;  1CM1 A;  1N65 A;  2LP2 A;  1TUJ A;  4R1E A;  4MVF A;  4TNC A;  2P6B B;  1CDN A;  2NXQ A;  1DF0 B;  1GM0 A;  1PAL A;  2FJY A;  3KO0 A;  2KHN A;  2K7C A;  2L0P A;  3FIA A;  3SJS A;  1K96 A;  2JNX A;  1SKT A;  3CR4 X;  2HF5 A;  1YTZ C;  5DIC A;  2LMU A;  1S6C A;  2H61 C;  4CFQ A;  1TUZ A;  3PJI A;  1SL9 A;  1AUI B;  2F3Z A;  3OX6 A;  1X02 A;  3PAL A;  3QRX A;  3EK4 A;  3DY9 A;  5CSN A;  1NPQ A;  3BUM B;  3K1E A;  4XJK B;  1SCM B;  2JT0 A;  2E30 A;  2LUX A;  2VRG A;  2ZND A;  1OZS A;  4P5O E;  1CDL A;  1CKK A;  1BJF A;  2PRU A;  5JOL A;  1CB1 A;  2GGM A;  1NCZ A;  3SIB A;  3JVT B;  1KQM C;  2BKI B;  2CTN A;  1DGV A;  1Y0V H;  3AAK A;  2PVB A;  3B7A A;  1BU3 A;  3D0Y A;  2BL0 C;  1EXR A;  2CBL A;  1DEL A;  3E3R A;  1RK9 A;  1KWO B;  2OPO A;  1KSO A;  2FCE A;  3AAJ A;  4GFT A;  4OCI A;  5D7F A;  4JD9 A;  3NHI A;  1LS8 A;  2JNF A;  1S5G Z;  2WCH A;  5FI2 A;  2QEV A;  3ZNI A;  3M0W A;  4A4B A;  1UHJ A;  1WDC C;  1QWV A;  1VRK A;  3CGA A;  1PUL A;  1HT9 A;  2KI4 C;  2NCP A;  4QJ3 B;  3VRN A;  1IGV A;  2L2E A;  1MWN A;  1YRU B;  3L4A A;  4C0J A;  3D76 A;  2K8M B;  2M1U A;  2GV5 A;  2KGR A;  3OHM B;  4PHJ A;  1KFX L;  4MN0 A;  3VRP A;  5IBW A;  1E8A A;  4CFR A;  3BFA A;  2OTG B;  2F33 A;  5PAL A;  4Q04 A;  4NDB A;  1CMG A;  1DJZ A;  2QAC A;  1QAS A;  3NXA A;  1NX2 A;  4ETO A;  1LVC D;  2BCA A;  3LK1 A;  4GNK B;  2GGZ A;  2ZNE A;  1NX0 A;  1DMO A;  1G33 A;  5B8I B;  4YBH B;  3D75 A;  1QX5 B;  2TN4 A;  2LLS A;  4MEW A;  4ZCU A;  4BY5 A;  1BMO A;  4JQ0 D;  2G9B A;  3BJH A;  3K21 A;  4N1G A;  4INX A;  2K2A A;  4C0K A;  1J7O A;  1F55 A;  1CDM A;  2QPT A;  4PE0 A;  4NDC A;  2JU0 A;  3JVT C;  2KI6 C;  1IJ6 A;  1RWY A;  1T14 A;  2L50 A;  3NGV A;  1SL8 A;  1ZFS A;  2L5Y A;  4M2Q A;  4YI8 A;  3O2P A;  2JRF A;  1KWO C;  5I8N A;  1XO5 A;  3CDN A;  3CTN A;  3BOW A;  1CLL A;  1OOG A;  3A4U B;  2MHH A;  4NQG A;  2WCF A;  3C1V A;  2A4J A;  4PE1 A;  1N2D A;  1Y6W A;  4DUQ A;  3IVT A;  1FPW A;  1J1D A;  1C7V A;  3R72 A;  2LC5 A;  1DJI A;  1A75 A;  1R6P A;  1FW4 A;  2SAS A;  1EG3 A;  2H2K A;  2WND A;  2L4I A;  2KBM A;  1C3Z A;  1TNP A;  1DT7 B;  4I5K A;  5CSI A;  4PT1 A;  1TWO A;  2LLT A;  3CS1 A;  4IL1 A;  1K9K A;  2ERB A;  2IS9 A;  2LVV A;  3BUW B;  4FQT A;  5AER A;  1FBV A;  2BEC A;  2JTT A;  2KLE A;  1JSA A;  2CNP A;  1REC A;  3SS4 A;  5DKN A;  4M2O A;  2QEH A;  2BNX A;  1G8I A;  1XFR A;  2MLE C;  2R2I A;  1IQ3 A;  3KHE A;  1OSA A;  1SPY A;  3D77 A;  3O4Y A;  1F71 A;  4DRW A;  1DVI A;  3GK2 A;  3S0B A;  1KSM A;  2JT3 A;  3EG5 B;  2F2P A;  3TS5 C;  1QV0 A;  2MAZ A;  1BG1 A;  1NUB A;  4F7F A;  5G08 A;  4F0Z B;  2L98 A;  4QJ4 B;  3F45 A;  4PDZ A;  3BYA A;  3B88 A;  1YRT B;  1MF8 B;  1WY9 A;  2K7D A;  1B8C A;  4GBA A;  4YI9 A;  3TDU A;  3DXL A;  4N1F A;  1B8L A;  1M45 A;  3WXA A;  2LHL A;  5TNC A;  3S0F A;  1QJT A;  4ORC B;  3KF9 A;  3IF7 A;  1AHR A;  2BAP A;  2MRD A;  1CNP A;  1SR6 B;  1RFJ A;  2FJU B;  2EC6 C;  4IJ7 A;  1QS7 A;  1QIV A;  1W9Z A;  1S36 A;  3UO9 A;  3WHT B;  3ZWH A;  2Y1M A;  5FI6 A;  1OOH A;  1BR4 B;  2LVJ A;  2K0J A;  1TNX A;  2JPT A;  2P71 A;  1D1O A;  2M0R A;  1J7R A;  1MUX A;  2WC6 A;  4MZJ A;  3IQO A;  1MQ1 A;  2JPO A;  2KFH A;  1QIW A;  1QVI Y;  3EKH A;  2K2F A;  4FQO A;  4L9M A;  2ZN9 A;  1SBJ A;  3GK4 X;  5HKW A;  3PSR A;  3NSI A;  3CR5 X;  1B4C A;  1WRL A;  1CFC A;  3BQ3 A;  2LVK A;  3OGN A;  4HSZ A;  1WLZ A;  3RLZ A;  2LVI A;  2ZFD A;  1J7P A;  1S1E A;  2FOT A;  1UHK A;  1A03 A;  1PVB A;  1C07 A;  3DF0 A;  2WCJ A;  2KBI A;  3OBV A;  1AJ4 A;  1CMF A;  4MZL A;  2Q4U A;  1OMD A;  1K95 A;  3Q8I A;  5CSF A;  3SIA A;  1AP4 A;  3JTD C;  1UP5 A;  1K94 A;  4ORA B;  3NSL A;  5GQQ C;  2HQ8 A;  4GAO A;  2JT8 A;  1N0Y A;  1YUU A;  1QX7 A;  1P28 A;  4DS7 A;  1DJX A;  5KSZ A;  2QEB A;  1CLM A;  1OOJ A;  2JWW A;  1TNQ A;  1S3P A;  1JWD A;  4A4C A;  3VB1 A;  1KFX S;  2OS8 B;  5HLO A;  3OB2 B;  1XVJ A;  3V2L A;  1YX8 A;  3SG5 A;  4FTG A;  1SR6 C;  3HCM A;  1QV1 A;  4OVN F;  1SSE B;  3TDZ A;  3L4L A;  4WQ2 A;  1M39 A;  1RJV A;  2MA2 A;  1EL4 A;  1IIO A;  3S0G A;  2WCE A;  4DCK A;  3TUY C;  1JBA A;  1XFW O;  2BE6 A;  1LA3 A;  2Y5I A;  2L4H A;  3CZ2 A;  1QX2 A;  2WCB A;  4PE4 A;  1TIZ A;  2Y4Q A;  1V1F A;  3D10 A;  1JF0 A;  4AOM A;  1DQE A;  1U5I B;  2BE4 A;  1SYM A;  2KI6 D;  3BUN B;  5HYD A;  1QAT A;  3D74 A;  1OW4 A;  2WCL A;  3PAT A;  1BOC A;  2JC2 A;  2Q91 A;  4C0L A;  1FF1 A;  4WRI A;  2M49 B;  3A8R A;  3FE6 A;  1KFU S;  3DD4 A;  3FE8 A;  2JXL A;  1ZOT B;  4ICB A;  1TCF A;  1WLM A;  3ICB A;  2HQW A;  3TS5 B;  1GGW A;  2HET A;  2JUL A;  3FWB A;  1AVS A;  1YX7 A;  1OOI X;  2WCK A;  2CCM A;  1W7I B;  2LNK A;  3SG3 A;  1OZO A;  1QLS A;  2PMY A;  1M46 A;  2L5X B;  4YRU A;  1IKU A;  3AKA A;  5BPJ A;  3EVR A;  1XFY O;  1QVI Z;  1A4P A;  1QTX A;  3WNX B;  4XYN A;  5CPV A;  1LA0 A;  2KFG A;  2KOT A;  3GK1 A;  2OS8 C;  1R2U A;  2EC6 B;  1IH0 A;  3D0Y B;  1KK8 B;  1ZAC A;  2QEO A;  3SG4 A;  1SY9 A;  2EGD A;  2CXJ A;  1A29 A;  1GGZ A;  5K89 A;  2BKH B;  2JQ6 A;  2O5G A;  2F3Y A;  3DZT A;  2COL B;  2H8V A;  2M29 A;  2K60 A;  3R1P A;  1GJY A;  4OV2 A;  1Z4H A;  2L2C A;  1SRA A;  4YGC B;  2M1K B;  1K9U A;  1XA5 A;  1DF0 A;  2EHB A;  2LCP A;  3SG2 A;  3UNW A;  3LCP C;  5DKR A;  2PAL A;  2BBM A;  4QJ5 B;  1G4Y R;  4AQI A;  2KAV A;  3RM1 A;  4JWQ A;  4N5X A;  1F4Q A;  4CLN A;  4YGE B;  4HRH A;  1UHN A;  3KPX A;  2KYF A;  1BF5 A;  3WHU B;  5HKY A;  1PK0 D;  1IWQ A;  2M9G A;  1K9P A;  3I5F C;  2LM5 A;  2WCM A;  3LK0 A;  2KNE A;  4XJK A;  4OR9 B;  3TDI A;  3JTD B;  2G2B A;  5CSJ A;  2I94 A;  1JC2 A;  1MXE A;  3DYE A;  2M97 A;  2MJW B;  1ALW A;  2M7L A;  1B1G A;  1B7T Y;  3FE9 A;  1S26 D;  3NSO A;  2LAP A;  1KCY A;  1AJ5 A;  3O78 A;  2AAO A;  4YGB B;  4DIR A;  1QLK A;  1OE9 B;  3SG7 A;  1SK6 D;  3VRQ A;  1FI5 A;  5JJG A;  3IQQ A;  1M31 A;  1L2O C;  1XK4 A;  1BR1 B;  2WC5 A;  1J1E A;  2BBN A;  1H4B A;  1MHO A;  1IJ5 A;  2PQL A;  1EJ3 A;  4GGN A;  1KK8 C;  4KYN A;  1DTL A;  1ORG A;  3FWC A;  3CR2 A;  1CFP A;  3HX4 A;  1Y1X A;  3BOW B;  3CZ1 A;  2KQY A;  1CLB A;  1F70 A;  2KSP A;  3I5H C;  3TUY B;  4CPV A;  1C3Y A;  1K90 D;  3LL8 B;  1JFJ A;  5F6T A;  2WOS A;  4M2P A;  3VGO A;  3SG6 A;  3SS3 A;  1A75 B;  4I5L B;  4NDD A;  3B6X A;  2KDH A;  1TTX A;  3DVJ A;  3PM2 A;  1YR5 A;  1V1G A;  3L47 A;  4WQ3 A;  5D3O A;  1AK8 A;  1SMG A;  4MSP A;  4INW A;  1Q80 A;  4GPL B;  1K8U A;  4YGD B;  1SL7 A;  1NIW A;  1BOD A;  1XFV O;  3I5I C;  3RZS A;  3BUX B;  1NCY A;  1KK7 Y;  2KGB C;  2LE9 B;  1XYD A;  2F2O A;  1CTR A;  3LLE A;  3PLF B;  4ORB B;  5FYX A; 
#chains in the Genus database with same CATH homology
 4YGA A;  3CLN A;  1JUO A;  1YUS A;  1B9A A;  1IQ5 A;  1WRZ A;  2O60 A;  1QXP A;  1TRF A;  4GGF A;  1CFD A;  1MR8 A;  2ZRS A;  4HRE E;  1SW8 A;  2BCX A;  1BT6 A;  1F54 A;  1DJG A;  1JF2 A;  2LHI A;  3PN7 C;  2I7A A;  4PE7 A;  1TOP A;  1UHH A;  1WRK A;  3CZT X;  3O6B A;  2D8N A;  1ZMZ A;  2WOR A;  1HQV A;  1IRJ A;  2KYC A;  1NWD A;  2KAX A;  1B7T Z;  1DJW A;  2JZI A;  2KFF A;  4HRG A;  1JFK A;  1ZUZ A;  1H8B A;  1SCV A;  2LV7 A;  2MLF C;  1OMR A;  1NX3 A;  1IG5 A;  1SNL A;  1NX1 A;  4MRX A;  3DVE A;  1S6I A;  1F8H A;  3I5G C;  3NSK A;  4OKH A;  1DGU A;  5AEQ A;  2H61 A;  4E68 A;  4JPZ B;  3EVU A;  1CDP A;  3I5F B;  2AUC A;  1YUR A;  1NYA A;  2SCP A;  4PHM A;  4U8D A;  2WC8 A;  2Y1N A;  4I5J A;  1J55 A;  1BLQ A;  1YVL A;  5J3X A;  5AXI A;  5D69 A;  4AQJ A;  2M8U A;  2CT9 A;  1YVH A;  2LUC A;  3DF0 B;  1L2O B;  2LP3 A;  2RGI A;  3VRR A;  1J7Q A;  1EH2 A;  1ALV A;  1SCM C;  2DOQ A;  1EG4 A;  1B8R A;  2HPS A;  1XFU O;  5I2Q A;  1CM4 A;  1Y1A A;  1TNW A;  3I5H B;  4P2Y B;  1KK7 Z;  2ZRT A;  1B47 A;  1ODB A;  1UUR A;  1UUS A;  3CWG A;  1RRO A;  3DVM A;  3OB1 B;  3VRO A;  1A2X A;  3OP0 A;  2B1U A;  4MRY A;  4I5N B;  4GUK A;  4MZK A;  2K61 A;  1S6J A;  1XFX O;  1KFU L;  2V53 A;  1XK4 C;  2FCD A;  1LXF C;  2F8P A;  2KQ6 A;  3DVK A;  1FI6 A;  3BUO B;  4D1E A;  2JOJ A;  1F4O A;  3PM8 A;  2LMT A;  3EK7 A;  5HKZ A;  4MLW A;  4USL A;  5KTY A;  1K2H A;  2NCO A;  1PVA A;  4ZCV A;  5HLV A;  3EVV A;  4MBE A;  1TN4 A;  2BCB A;  3EKJ A;  1M63 B;  1OQP A;  5ER5 A;  1GQM A;  1DJY A;  1W7J B;  3I5I B;  2PSR A;  1MXL C;  1KQV A;  1UWO A;  3GOF A;  3MSE B;  3EK8 A;  5ER4 X;  2LAN A;  3AKB A;  1PRW A;  2MBX A;  1C7W A;  1Y1U A;  2OTG C;  1LKJ A;  2AMI A;  2ZN8 A;  1YUT A;  5AFP A;  1XFZ O;  1S5G Y;  4PHN A;  2PAS A;  1NSH A;  3H4S E;  4PHK A;  1K93 D;  5KU1 A;  4PCW A;  1NP8 A;  1DJH A;  3FS7 A;  2K7O A;  2JXC A;  3TZ1 A;  2E6W A;  3PN7 B;  1TCO B;  4PAL A;  2M7N A;  2ISD A;  1CFF A;  2NZ0 A;  1NCX A;  1KQM B;  1L7Z A;  2ZKM X;  1PSR A;  1PSB A;  1OMV A;  3BXK A;  5I2L A;  2BL0 B;  4CID A;  2LMV A;  2M3W A;  2I18 A;  5AAN A;  4UPG A;  1UHI A;  2NLN A;  2I2R E;  2LLU A;  4GGF C;  3KEV A;  2JTZ A;  1WDC B;  2L51 A;  2K7B A;  5DKQ A;  3I5G B;  1LIN A;  3PFV A;  3OX5 A;  2KAY A;  2KI4 B;  1RTP 1;  4BY4 A;  1U5I A;  5I2O A;  1CM1 A;  1N65 A;  2LP2 A;  4R1E A;  4MVF A;  4TNC A;  2P6B B;  1CDN A;  2NXQ A;  1DF0 B;  1PAL A;  3KO0 A;  2KHN A;  2K7C A;  2L0P A;  3FIA A;  3SJS A;  1K96 A;  2JNX A;  1SKT A;  3CR4 X;  2HF5 A;  1YTZ C;  2LMU A;  1S6C A;  2H61 C;  4CFQ A;  1SL9 A;  1AUI B;  2F3Z A;  3OX6 A;  1X02 A;  3PAL A;  3QRX A;  3EK4 A;  5CSN A;  1NPQ A;  3BUM B;  4XJK B;  1SCM B;  2JT0 A;  2E30 A;  2LUX A;  2VRG A;  2ZND A;  1OZS A;  4P5O E;  1CDL A;  1CKK A;  1BJF A;  2PRU A;  5JOL A;  1CB1 A;  2GGM A;  1NCZ A;  3SIB A;  3JVT B;  1KQM C;  2BKI B;  2CTN A;  1DGV A;  1Y0V H;  3AAK A;  2PVB A;  1BU3 A;  3D0Y A;  2BL0 C;  1EXR A;  2CBL A;  4GFT A;  3E3R A;  1RK9 A;  1KWO B;  2OPO A;  1KSO A;  2FCE A;  3AAJ A;  4OCI A;  5D7F A;  2JNF A;  1S5G Z;  3ZNI A;  3M0W A;  4A4B A;  1UHJ A;  1WDC C;  1VRK A;  3CGA A;  1PUL A;  1HT9 A;  2KI4 C;  2NCP A;  4QJ3 B;  3VRN A;  1IGV A;  2L2E A;  1MWN A;  1YRU B;  4C0J A;  2K8M B;  2M1U A;  2GV5 A;  2KGR A;  3OHM B;  4PHJ A;  1KFX L;  4MN0 A;  3VRP A;  5IBW A;  1E8A A;  4CFR A;  2OTG B;  2F33 A;  5PAL A;  4Q04 A;  4NDB A;  1CMG A;  1DJZ A;  2QAC A;  1QAS A;  3NXA A;  1NX2 A;  4ETO A;  1LVC D;  2BCA A;  3LK1 A;  4GNK B;  2GGZ A;  2ZNE A;  1NX0 A;  1DMO A;  1G33 A;  5B8I B;  4YBH B;  1QX5 B;  2TN4 A;  2LLS A;  4MEW A;  4ZCU A;  4BY5 A;  1BMO A;  4JQ0 D;  2G9B A;  3K21 A;  4N1G A;  2K2A A;  4C0K A;  1J7O A;  1F55 A;  1CDM A;  2QPT A;  4PE0 A;  4NDC A;  2JU0 A;  3JVT C;  2KI6 C;  1IJ6 A;  1RWY A;  2L50 A;  1SL8 A;  1ZFS A;  4M2Q A;  4YI8 A;  3O2P A;  2JRF A;  1KWO C;  5I8N A;  1XO5 A;  3CTN A;  3BOW A;  1CLL A;  3A4U B;  2MHH A;  4NQG A;  2WCF A;  3C1V A;  2A4J A;  4PE1 A;  1N2D A;  1Y6W A;  4DUQ A;  1FPW A;  1J1D A;  1C7V A;  2LC5 A;  1DJI A;  1A75 A;  1R6P A;  1FW4 A;  2SAS A;  1EG3 A;  2H2K A;  2WND A;  2L4I A;  2KBM A;  1TNP A;  1DT7 B;  4I5K A;  5CSI A;  2LLT A;  3CS1 A;  4IL1 A;  1K9K A;  2IS9 A;  3BUW B;  2LVV A;  5AER A;  1FBV A;  2BEC A;  2JTT A;  1JSA A;  2CNP A;  1REC A;  5DKN A;  4M2O A;  1G8I A;  2MLE C;  2R2I A;  1IQ3 A;  3KHE A;  1OSA A;  1SPY A;  3O4Y A;  1F71 A;  4DRW A;  1DVI A;  3GK2 A;  1KSM A;  2JT3 A;  2F2P A;  3TS5 C;  1QV0 A;  2MAZ A;  1BG1 A;  1NUB A;  5G08 A;  4F0Z B;  2L98 A;  4QJ4 B;  3F45 A;  4PDZ A;  3BYA A;  1YRT B;  1MF8 B;  1WY9 A;  2K7D A;  1B8C A;  4GBA A;  4YI9 A;  3TDU A;  4N1F A;  1B8L A;  1M45 A;  3WXA A;  2LHL A;  5TNC A;  1QJT A;  4ORC B;  3KF9 A;  3IF7 A;  1AHR A;  2MRD A;  1CNP A;  1SR6 B;  1RFJ A;  2FJU B;  2EC6 C;  1QS7 A;  1QIV A;  1S36 A;  3ZWH A;  3WHT B;  2Y1M A;  1BR4 B;  2LVJ A;  2K0J A;  1TNX A;  2JPT A;  1D1O A;  2M0R A;  1J7R A;  1MUX A;  4MZJ A;  3IQO A;  1MQ1 A;  2KFH A;  1QIW A;  1QVI Y;  3EKH A;  2K2F A;  4FQO A;  4L9M A;  2ZN9 A;  1SBJ A;  3GK4 X;  5HKW A;  3PSR A;  3NSI A;  3CR5 X;  1B4C A;  1WRL A;  1CFC A;  3BQ3 A;  2LVK A;  4HSZ A;  3RLZ A;  1WLZ A;  1J7P A;  2LVI A;  2ZFD A;  1S1E A;  2FOT A;  1UHK A;  1A03 A;  1PVB A;  1C07 A;  3DF0 A;  2KBI A;  1AJ4 A;  1CMF A;  4MZL A;  2Q4U A;  1OMD A;  1K95 A;  3SIA A;  5CSF A;  1AP4 A;  3JTD C;  1UP5 A;  1K94 A;  4ORA B;  3NSL A;  5GQQ C;  2HQ8 A;  4GAO A;  2JT8 A;  1N0Y A;  1YUU A;  1QX7 A;  4DS7 A;  1DJX A;  5KSZ A;  1CLM A;  1OOJ A;  2JWW A;  1TNQ A;  1S3P A;  1JWD A;  4A4C A;  1KFX S;  2OS8 B;  5HLO A;  3OB2 B;  1XVJ A;  1YX8 A;  3SG5 A;  4FTG A;  1SR6 C;  3HCM A;  1QV1 A;  4OVN F;  3TDZ A;  4WQ2 A;  1M39 A;  1RJV A;  2MA2 A;  1EL4 A;  2WCE A;  4DCK A;  3TUY C;  1JBA A;  1XFW O;  2BE6 A;  1LA3 A;  2Y5I A;  2L4H A;  1QX2 A;  2WCB A;  4PE4 A;  1TIZ A;  2Y4Q A;  1V1F A;  3D10 A;  1JF0 A;  4AOM A;  1U5I B;  2BE4 A;  1SYM A;  2KI6 D;  3BUN B;  5HYD A;  1QAT A;  3PAT A;  1BOC A;  2JC2 A;  2Q91 A;  4C0L A;  1FF1 A;  4WRI A;  2M49 B;  3A8R A;  1KFU S;  3DD4 A;  2JXL A;  1ZOT B;  4ICB A;  1TCF A;  1WLM A;  3ICB A;  2HQW A;  3TS5 B;  1GGW A;  2HET A;  2JUL A;  3FWB A;  1AVS A;  1YX7 A;  2CCM A;  1W7I B;  2LNK A;  3SG3 A;  1OZO A;  1QLS A;  2PMY A;  1M46 A;  2L5X B;  4YRU A;  1IKU A;  3AKA A;  5BPJ A;  3EVR A;  1XFY O;  1QVI Z;  1A4P A;  1QTX A;  3WNX B;  4XYN A;  5CPV A;  1LA0 A;  2KFG A;  2KOT A;  3GK1 A;  2OS8 C;  1R2U A;  2EC6 B;  1IH0 A;  3D0Y B;  1KK8 B;  1ZAC A;  3SG4 A;  1SY9 A;  2EGD A;  2CXJ A;  1A29 A;  1GGZ A;  5K89 A;  2BKH B;  2JQ6 A;  2O5G A;  2F3Y A;  2COL B;  2M29 A;  1GJY A;  4OV2 A;  1SRA A;  4YGC B;  2M1K B;  1K9U A;  1XA5 A;  1DF0 A;  2EHB A;  2LCP A;  3SG2 A;  3LCP C;  5DKR A;  2PAL A;  2BBM A;  4QJ5 B;  1G4Y R;  4AQI A;  2KAV A;  3RM1 A;  4JWQ A;  4N5X A;  1F4Q A;  4CLN A;  4YGE B;  4HRH A;  1UHN A;  3KPX A;  2KYF A;  1BF5 A;  3WHU B;  5HKY A;  1PK0 D;  1IWQ A;  2M9G A;  1K9P A;  3I5F C;  2LM5 A;  3LK0 A;  2KNE A;  4XJK A;  4OR9 B;  3TDI A;  3JTD B;  2G2B A;  5CSJ A;  2I94 A;  1JC2 A;  1MXE A;  2M97 A;  2MJW B;  1ALW A;  2M7L A;  1B1G A;  1B7T Y;  1S26 D;  3NSO A;  2LAP A;  1KCY A;  1AJ5 A;  3O78 A;  2AAO A;  4YGB B;  4DIR A;  1QLK A;  1OE9 B;  3SG7 A;  1SK6 D;  3VRQ A;  1FI5 A;  5JJG A;  3IQQ A;  1M31 A;  1L2O C;  1XK4 A;  1BR1 B;  1J1E A;  2BBN A;  1H4B A;  1MHO A;  1IJ5 A;  1EJ3 A;  4GGN A;  1KK8 C;  1DTL A;  3FWC A;  3CR2 A;  1CFP A;  3HX4 A;  1Y1X A;  3BOW B;  2KQY A;  1CLB A;  1F70 A;  2KSP A;  3I5H C;  3TUY B;  4CPV A;  1K90 D;  3LL8 B;  1JFJ A;  5F6T A;  2WOS A;  4M2P A;  3VGO A;  3SG6 A;  1A75 B;  4I5L B;  4NDD A;  2KDH A;  1TTX A;  3DVJ A;  4WQ3 A;  1YR5 A;  1V1G A;  1AK8 A;  1SMG A;  4MSP A;  1Q80 A;  4GPL B;  1K8U A;  4YGD B;  1SL7 A;  1NIW A;  1BOD A;  1XFV O;  3I5I C;  3BUX B;  1NCY A;  1KK7 Y;  2KGB C;  2LE9 B;  1XYD A;  2F2O A;  1CTR A;  3LLE A;  3PLF B;  4ORB B;  5FYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...