1NSHA

Solution structure of rabbit apo-s100a11 (19 models)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
SRPTETERCIESLIAVFQKYAGKDGHSVTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNSDGQLDFQEFLNLIGGLAVACHESFVKAAPPQKRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calgizzarin
publication title Unmasking the Annexin I Interaction from the structure of apo-S100A11
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 18
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nshA00
1BJFA 2L2EA 2AMIA 1S6CA 2LUCA 2Q91A 2KYCA 1WRLA 4MBEA 2KBIA 1SW8A 4GGNA 4PHKA 3BUWB 1CLBA 1YUUA 2LMTA 2I2RE 2BCAA 4YGEB 2BBNA 2IS9A 4DIRA 1LA3A 2K61A 5I8NA 1XA5A 3EK8A 4D1EA 1TCOB 1K90D 2L98A 4OCIA 1JUOA 1NCZA 2P6BB 2KBMA 5FYXA 1RECA 4BY5A 3FWCA 1ZFSA 3TDZA 1UHHA 2QACA 3LK0A 1XFXO 1LVCD 2M49B 1PULA 1LKJA 1N65A 3DVMA 1MUXA 1LA0A 3EVVA 1AP4A 2KGBC 1YR5A 2LCPA 4R1EA 4C0LA 2BE6A 1XFYO 2JXLA 2MA2A 4MZKA 2LHLA 2Y5IA 2LHIA 1K9KA 4M2OA 2JNFA 2H2KA 1JSAA 2MBXA 1F4QA 2KNEA 2CXJA 1QLKA 3PN7C 1PALA 2I94A 1Y1XA 1SL9A 3DD4A 2R2IA 1A2XA 2WCEA 4ORBB 4JQ0D 4N1GA 4NDDA 5AXIA 1M31A 1DJXA 1OOJA 1CFPA 3FWBA 1J7OA 4C0JA 1NSHA 2G9BA 5I2OA 1LINA 2M7NA 2F2OA 2L0PA 1DJZA 2LUXA 1NX1A 4P2YB 2LAPA 2O60A 4NDCA 4YI9A 4MSPA 4PE7A 1AHRA 3CR5X 3CWGA 1PVBA 1L2OC 1N2DA 2KSPA 2KFHA 4MZJA 1K2HA 3DVEA 4FTGA 3PSRA 1Y1AA 1AJ5A 2AAOA 2L50A 2LVIA 5AFPA 4GUKA 1QASA 4JPZB 1M46A 2WCFA 2FOTA 5ER4X 2KAXA 4OV2A 1NX2A 2K8MB 1A03A 1J7PA 2KYFA 1ODBA 1F4OA 1Q80A 1KCYA 1MXEA 3NXAA 1TNQA 4GGFC 2D8NA 1QIVA 3HCMA 1XYDA 1RROA 2AUCA 2K7DA 1Y0VH 5KSZA 1CM4A 1OSAA 1TNWA 3GOFA 2LVVA 4GPLB 1V1FA 1H8BA 3HX4A 2BBMA 1DGVA 1C07A 1BODA 3JVTB 1DJWA 4PE4A 1TOPA 1B9AA 3CTNA 4Q04A 1IWQA 3ZNIA 3EVUA 1J7RA 1SY9A 1NWDA 4HRHA 1OZSA 5K89A 1WLZA 2NCOA 1B8RA 1FPWA 1JWDA 1MQ1A 4JWQA 1A4PA 2M97A 4MRYA 1C7WA 5AEQA 2KGRA 2CT9A 2HQ8A 1KFUS 5HKWA 2WNDA 3I5IC 2LVKA 2K7CA 2JXCA 4IL1A 5I2LA 2PVBA 1JF0A 1G4YR 3BXKA 1DF0B 1M45A 1SK6D 1TCFA 1J7QA 4ETOA 3VGOA 5JOLA 1YTZC 3I5HC 1KFXS 1QLSA 2F33A 2TN4A 4GAOA 3KEVA 5HLOA 1IG5A 2PMYA 5CSNA 1WDCB 1GQMA 2ZNDA 3GK1A 3BUNB 1NP8A 2EC6C 3VRRA 1NYAA 5D7FA 2OS8B 1TTXA 4PE1A 2KAYA 1OQPA 1IGVA 1AK8A 1SCMB 3BYAA 4A4CA 5DKRA 2CCMA 1OMRA 2ZN8A 3EK4A 1NUBA 4FQOA 3GK2A 3K21A 4HSZA 4ICBA 4U8DA 5HYDA 1NPQA 4PHMA 4F0ZB 3CR4X 4MVFA 3SJSA 3O78A 2M29A 5D69A 1J1EA 3FIAA 4ZCVA 4MZLA 3VROA 3C1VA 4WQ3A 5PALA 2F3ZA 1GJYA 4YBHB 1EG4A 1TNXA 2HPSA 4DRWA 1N0YA 1UWOA 1QV0A 2JT8A 2KHNA 3I5FC 3NSLA 2M1KB 1QXPA 2ZRTA 2I18A 3LCPC 1GGZA 1CB1A 1QV1A 2EHBA 3PLFB 2LP3A 2LLTA 1KWOB 3WHUB 5DKNA 1YVHA 2BCBA 2BCXA 2FCEA 2KI4B 4XJKA 1DGUA 1ZUZA 1ALWA 1KSMA 3WHTB 1YUTA 4GFTA 4DS7A 2NCPA 1K95A 2KQYA 1KK8B 1CLLA 2BL0C 3BUMB 4CPVA 1CM1A 4YGCB 1E8AA 1OMVA 3M0WA 1JFJA 3I5IB 2EGDA 4GGFA 1K94A 2F3YA 3IF7A 1QS7A 5CSJA 2OTGC 3RLZA 3TDUA 2JULA 3BUXB 4P5OE 1FI6A 3TDIA 1S5GY 2HETA 1GGWA 3KHEA 1J55A 2KOTA 1D1OA 2PALA 1AJ4A 1KFUL 2M7LA 3SIBA 3DVKA 2MHHA 1CNPA 2CTNA 3SG6A 1K93D 1CDNA 1EG3A 2BE4A 1UUSA 1CLMA 1SNLA 1K8UA 2F2PA 3VRPA 1IH0A 2M3WA 4E68A 1IQ3A 1U5IA 2COLB 1CFDA 1QX2A 2E30A 2MRDA 3I5GB 1AVSA 5BPJA 1H4BA 1WRZA 1KFXL 3IQQA 4ORCB 3TS5C 2PASA 2JQ6A 3AKAA 3NSOA 1S26D 3H4SE 5J3XA 2LP2A 2BKIB 4GBAA 1TN4A 4TNCA 4DCKA 1QJTA 4CLNA 1F8HA 4ORAB 1DJYA 1YRUB 3DF0A 4GNKB 1F54A 2JU0A 4WQ2A 2BECA 3BUOB 1XO5A 2JRFA 1BOCA 2ZNEA 1M39A 1NX0A 4BY4A 2K0JA 1UHNA 4OKHA 1NX3A 4I5KA 2MLEC 1BR4B 4WRIA 1KK7Y 1XK4C 1B8CA 1SL7A 1QVIY 1OZOA 4PHJA 2SASA 1BLQA 4MEWA 2JT0A 1ZOTB 3OB1B 1XFZO 2PSRA 1RK9A 1KSOA 2NLNA 1BG1A 1DJGA 1F55A 1CDMA 1S3PA 2VRGA 2WORA 3OB2B 2I7AA 3QRXA 3SG5A 3E3RA 1EJ3A 1F71A 2K7OA 4PHNA 3PN7B 1KQVA 1CKKA 1PK0D 1IKUA 1XFUO 3O6BA 3RM1A 1BMOA 1C7VA 1DJIA 2DOQA 3D0YA 1WY9A 3OX5A 1CMFA 1M63B 2K2FA 2LV7A 4C0KA 1FF1A 1S5GZ 1B4CA 3OHMB 3JTDC 2ZN9A 1SL8A 3LLEA 1MF8B 4CIDA 4PDZA 2NZ0A 3AAKA 2MAZA 3CS1A 1YUSA 3SG4A 1R6PA 1B8LA 1SMGA 1BF5A 2LMVA 5HKYA 2K2AA 1MWNA 3EK7A 1BR1B 3O2PA 1L2OB 1PVAA 4XJKB 3SIAA 1FBVA 4XYNA 1MXLC 4PE0A 5CPVA 3VRQA 4N5XA 2KAVA 1DTLA 2KDHA 1Y6WA 2JC2A 4YI8A 3WXAA 4DUQA 1QATA 1ZMZA 4CFRA 5KTYA 1SCVA 2LE9B 2Q4UA 4CFQA 2KQ6A 1PSRA 1WRKA 1OMDA 2LVJA 1A75B 1SPYA 1YVLA 1HQVA 2LLSA 1SR6C 2JT3A 4AOMA 4L9MA 1CMGA 4M2QA 1DMOA 2F8PA 3ZWHA 1J1DA 1KQMC 5TNCA 1S1EA 1TRFA 3OX6A 2JZIA 1K9PA 3LK1A 1B1GA 1KK7Z 2L51A 4M2PA 1K96A 1QVIZ 1BT6A 4YGBB 5JJGA 4QJ3B 4I5JA 2WCBA 4MN0A 1JFKA 3SG7A 2M1UA 5G08A 1L7ZA 1K9UA 2KFGA 1U5IB 1FW4A 1RJVA 1F70A 1A75A 2KI6C 2LC5A 1HT9A 3F45A 1S6IA 3PM8A 3TUYC 1YURA 5AERA 1TIZA 1YRTB 3JVTC 3I5HB 5F6TA 4QJ4B 2ZRSA 2RGIA 1MR8A 1XK4A 4HREE 2LLUA 2JOJA 3DF0B 3OP0A 3JTDB 4USLA 1XVJA 3CLNA 2EC6B 4OVNF 1JC2A 4MRXA 2H61C 1AUIB 2KI6D 2HF5A 4AQIA 4YGDB 1G33A 3EKHA 1QX7A 4MLWA 1S6JA 1UP5A 5HLVA 5KU1A 1PSBA 2V53A 3EVRA 4OR9B 3PALA 4AQJA 1S36A 3ICBA 1DVIA 4NDBA 1RFJA 2PRUA 1SRAA 1Y1UA 1X02A 5CSFA 1IJ5A 3GK4X 1CTRA 3DVJA 3I5FB 3TZ1A 3AAJA 1LXFC 1WDCC 1SR6B 3CZTX 1G8IA 1UHIA 1ZACA 2M9GA 1BU3A 2A4JA 2OS8C 1B47A 4A4BA 2LANA 2M8UA 1KQMB 1B7TY 4PALA 5I2QA 3D0YB 4I5NB 2JNXA 3A4UB 1QIWA 1RTP1 1SCMC 2FCDA 1TNPA 1A29A 2BKHB 4YRUA 1JBAA 1QX5B 5HKZA 2WOSA 3KO0A 1IJ6A 2BL0B 2MLFC 4YGAA 1XFWO 3D10A 2MJWB 1SKTA 1SBJA 3A8RA 2L4HA 1IRJA 2GGZA 3O4YA 1R2UA 4UPGA 1V1GA 2L5XB 1NCYA 1SYMA 2GGMA 1NCXA 4ZCUA 2LNKA 1EL4A 1OE9B 3CR2A 1DJHA 5B8IB 3VRNA 2OTGB 2CNPA 2JTZA 3TUYB 1NIWA 3PATA 5CSIA 4QJ5B 1QTXA 1MHOA 3EKJA 1KWOC 5AANA 1RWYA 2JWWA 2L4IA 3NSKA 1IQ5A 4HRGA 2KI4C 1EXRA 3IQOA 1EH2A 5IBWA 2SCPA 1UHJA 2CBLA 1YX7A 3NSIA 1KK8C 3MSEB 2ZKMX 1DT7B 2JTTA 2O5GA 2ZFDA 1VRKA 2GV5A 1UHKA 3BOWB 3PFVA 1PRWA 3WNXB 2B1UA 2KFFA 2G2BA 2HQWA 1CDPA 1W7IB 3TS5B 3SG2A 2NXQA 3LL8B 2JPTA 3CGAA 1CFCA 2M0RA 1YX8A 4I5LB 1W7JB 3FS7A 2Y4QA 2ISDA 3SG3A 2Y1NA 3KF9A 2Y1MA 5DKQA 2OPOA 1UURA 2FJUB 3KPXA 2H61A 2K7BA 4N1FA 2WC8A 1FI5A 2E6WA 3BOWA 4NQGA 1ALVA 2QPTA 3AKBA 4PCWA 1JF2A 1B7TZ 1XFVO 3BQ3A 2LM5A 3I5GC 1CFFA 1CDLA 2LMUA 1WLMA 5GQQC 5ER5A 1DF0A
chains in the Genus database with same CATH superfamily
1BJFA 2L2EA 2AMIA 1S6CA 2LUCA 2Q91A 2KYCA 1WRLA 4MBEA 2KBIA 1SW8A 4GGNA 4PHKA 3BUWB 1CLBA 1YUUA 2WCJA 2LMTA 2I2RE 2BCAA 4YGEB 2BBNA 2IS9A 4DIRA 1LA3A 2K61A 5I8NA 1XA5A 3EK8A 4D1EA 1TCOB 1K90D 2L98A 4OCIA 3UNWA 1JUOA 1NCZA 2P6BB 2KBMA 5FYXA 1RECA 4BY5A 3FWCA 1ZFSA 3TDZA 1UHHA 2QACA 3LK0A 1XFXO 1LVCD 2M49B 1PULA 1LKJA 1TUJA 1N65A 2KLDA 1MUXA 3DVMA 3D73A 2QEOA 1LA0A 3EVVA 1AP4A 2KGBC 1YR5A 2LCPA 4R1EA 4C0LA 2BE6A 1XFYO 2JXLA 2MA2A 4MZKA 2LHLA 2Y5IA 2LHIA 1K9KA 4M2OA 2JNFA 2H2KA 1JSAA 2MBXA 1F4QA 2KNEA 2CXJA 1QLKA 3PN7C 1PALA 2I94A 1Y1XA 3VRRA 1SL9A 3DD4A 2R2IA 1A2XA 2WCEA 4ORBB 4JQ0D 4N1GA 4NDDA 5AXIA 1M31A 1DJXA 2ERBA 5FI6A 1OOJA 3BFHA 2PYQA 3B88A 1CFPA 2P70A 3FWBA 1OOGA 4C0JA 1J7OA 1NSHA 2G9BA 5I2OA 1LINA 2M7NA 3B7AA 2F2OA 2L0PA 1DJZA 2LUXA 1NX1A 4P2YB 2LAPA 2O60A 2WCLA 4NDCA 4MSPA 3R1OA 4PE7A 4YI9A 1AHRA 3CR5X 3CWGA 2GTEA 1PVBA 1L2OC 1N2DA 2KSPA 2KFHA 4MZJA 1K2HA 3DVEA 4FTGA 3PSRA 3QMEA 1Y1AA 1AJ5A 2AAOA 2L50A 2LVIA 5AFPA 4GUKA 1QASA 4JPZB 1M46A 2WCFA 2FOTA 5ER4X 2KAXA 4OV2A 1NX2A 2K8MB 4KYNA 3SS4A 1A03A 1J7PA 2KYFA 1ODBA 1F4OA 1Q80A 1KCYA 1MXEA 3NXAA 1TNQA 4GGFC 2D8NA 1QIVA 3B6XA 1XYDA 1RROA 2AUCA 2K7DA 1Y0VH 3HCMA 3NHTA 1CM4A 1OSAA 1TNWA 3GOFA 2LVVA 4GPLB 1V1FA 1H8BA 3HX4A 2BBMA 1DGVA 4IJ7A 1C07A 1BODA 3JVTB 1DJWA 4PE4A 1TOPA 3FE8A 4INXA 1B9AA 3CTNA 4Q04A 1IWQA 3ZNIA 3EVUA 1J7RA 5D3OA 1SY9A 1NWDA 4HRHA 1OZSA 5K89A 1WLZA 3O4XA 1Z4HA 2NCOA 1B8RA 2QDIA 1FPWA 1JWDA 3N7HA 1MQ1A 4JWQA 1A4PA 2M97A 4MRYA 1C7WA 5AEQA 2KGRA 3PM2A 2CT9A 1W9ZA 1KFUS 2HQ8A 5HKWA 2WNDA 2YGUA 3I5IC 3CZ0A 2LVKA 2K7CA 2JXCA 4IL1A 5I2LA 2PVBA 1JF0A 1G4YR 5DICA 3BXKA 1DF0B 1M45A 1SK6D 1TCFA 3CABA 1J7QA 4ETOA 3VGOA 4INWA 5JOLA 1YTZC 3I5HC 1KFXS 1QLSA 2F33A 2TN4A 4GAOA 3KEVA 5HLOA 1IG5A 2PMYA 5CSNA 1WDCB 1GQMA 2ZNDA 3GK1A 3BUNB 1NP8A 2EC6C 3NGVA 1NYAA 4JD9A 5D7FA 2OS8B 3S0AA 1TTXA 4PE1A 2KAYA 1OQPA 1IGVA 1AK8A 3R1VA 1LS8A 1SCMB 3BYAA 4A4CA 3B87A 5DKRA 1ORGA 1OMRA 2CCMA 2ZN8A 1NUBA 1Z2CB 3EK4A 3GK2A 3K21A 4FQOA 4HSZA 4ICBA 4U8DA 5HYDA 1NPQA 4PHMA 4F0ZB 3CR4X 4MVFA 3SJSA 3O78A 2M29A 5D69A 1J1EA 3FIAA 3L47A 4MZLA 4ZCVA 3VROA 3C1VA 4WQ3A 5PALA 2F3ZA 1GJYA 4YBHB 5I94A 1EG4A 1TNXA 2HPSA 4DRWA 1N0YA 1UWOA 1QV0A 2JT8A 2KHNA 3I5FC 3NSLA 2M1KB 1QXPA 2ZRTA 2I18A 3R1PA 3LCPC 1GGZA 1CB1A 1QV1A 2EHBA 3PLFB 4F7FA 2LP3A 2LLTA 1KWOB 3WHUB 1OW4A 5DKNA 1YVHA 2BCBA 2BCXA 2FCEA 2KI4B 1TUZA 4XJKA 1DGUA 1ZUZA 1ALWA 1KSMA 3WHTB 1YUTA 4GFTA 4DS7A 4JKTA 1DELA 1K95A 2KQYA 1KK8B 2NCPA 1CLLA 3R72A 2BL0C 3DY9A 3BUMB 4CPVA 1CM1A 3D78A 4YGCB 1E8AA 1OMVA 3M0WA 1JFJA 3I5IB 3BFAA 2EGDA 3CYZA 4GGFA 1K94A 2F3YA 3IF7A 1QS7A 3UO9A 5CSJA 2OTGC 3RLZA 3TDUA 2JULA 3BUXB 4P5OE 1FI6A 3TDIA 1S5GY 2HETA 1GGWA 3KHEA 1J55A 2KOTA 1D1OA 2PALA 5HL1A 1AJ4A 2QEHA 1KFUL 2M7LA 3SIBA 3DVKA 2MHHA 1CNPA 2CTNA 1T14A 3SG6A 1K93D 1CDNA 3BFBA 1EG3A 3DXLA 2BE4A 1UUSA 2P71A 1CLMA 1SNLA 1K8UA 2F2PA 3VRPA 1IH0A 2M3WA 4E68A 1IQ3A 1U5IA 1TWOA 1CFDA 1QX2A 2COLB 2E30A 2MRDA 3I5GB 1AVSA 5BPJA 1H4BA 1WRZA 1KFXL 3IQQA 4ORCB 3TS5C 2PASA 2JQ6A 3AKAA 3NSOA 1S26D 3H4SE 5J3XA 2LP2A 2BKIB 4GBAA 1TN4A 4TNCA 4DCKA 1QJTA 4CLNA 1F8HA 1QWVA 2L2CA 1DJYA 4ORAB 1YRUB 2WC5A 3DF0A 4GNKB 1F54A 2JU0A 4WQ2A 2BECA 3BUOB 1XO5A 3NHIA 1OOIX 2JRFA 1BOCA 2ZNEA 1M39A 1NX0A 4BY4A 2K0JA 1UHNA 4OKHA 1NX3A 4I5KA 2MLEC 1BR4B 4WRIA 1KK7Y 1XK4C 1B8CA 1SL7A 1QVIY 1OZOA 4PHJA 2SASA 1BLQA 4MEWA 2JT0A 1ZOTB 3OB1B 1XFZO 2PSRA 1RK9A 1KSOA 3S0EA 2NLNA 1BG1A 1DJGA 3K1EA 1F55A 1CDMA 1S3PA 2VRGA 2WORA 3OB2B 2I7AA 3QRXA 3SG5A 3E3RA 1EJ3A 3S0GA 1F71A 2K7OA 4PHNA 3PN7B 1KQVA 1CKKA 1PK0D 1IKUA 1GM0A 1XFUO 3O6BA 3RM1A 1BMOA 1C7VA 1DJIA 2DOQA 3D0YA 1WY9A 3OX5A 1CMFA 1M63B 3V2LA 2K2FA 2LV7A 4C0KA 1FF1A 1S5GZ 1B4CA 1OOHA 3OHMB 3JTDC 2ZN9A 1SL8A 3LLEA 1MF8B 4CIDA 4PDZA 2NZ0A 3AAKA 2MAZA 2QEVA 1IIOA 3CS1A 1YUSA 3SG4A 2L5YA 1R6PA 1B8LA 1SMGA 1BF5A 2LMVA 5HKYA 2K2AA 1MWNA 3EK7A 1BR1B 3O2PA 1L2OB 3B86A 1PVAA 4XJKB 2K60A 3SIAA 1FBVA 4XYNA 1MXLC 4PE0A 5CPVA 3VRQA 4N5XA 2KAVA 5KSZA 1DTLA 1SSEB 2KDHA 1Y6WA 4PT1A 2JC2A 4YI8A 3WXAA 4DUQA 3SS5A 1QATA 1ZMZA 4CFRA 5KTYA 1SCVA 2LE9B 2Q4UA 4CFQA 2KQ6A 1PSRA 1WRKA 1OMDA 2LVJA 1A75B 1SPYA 1YVLA 1HQVA 2LLSA 1SR6C 2JT3A 4AOMA 4L9MA 1CMGA 4M2QA 3FE9A 1DMOA 2F8PA 3ZWHA 1J1DA 1KQMC 1C3ZA 5TNCA 1S1EA 1TRFA 3OX6A 2JZIA 1K9PA 3LK1A 1B1GA 3CZ1A 4FQTA 3SS3A 3CZ2A 3D76A 1KK7Z 2L51A 4M2PA 1K96A 1QVIZ 1BT6A 4YGBB 3D75A 5JJGA 4QJ3B 4I5JA 2WCBA 4MN0A 1JFKA 3SG7A 2M1UA 5G08A 3BJHA 1L7ZA 1K9UA 5FI7A 2KFGA 1U5IB 1FW4A 1RJVA 2WC6A 1F70A 2FJYA 1A75A 2KI6C 2LC5A 1HT9A 3F45A 1S6IA 1XFRA 3PM8A 3TUYC 1YURA 5AERA 1TIZA 1YRTB 3JVTC 3I5HB 5F6TA 4QJ4B 2ZRSA 2RGIA 1MR8A 1DQEA 1XK4A 2LLUA 4HREE 2BNXA 2JOJA 3DF0B 3JTDB 3OP0A 4USLA 1XVJA 3CLNA 3FE6A 4OZDA 2EC6B 4OVNF 2PQLA 1JC2A 4MRXA 2JPOA 2H61C 1AUIB 2KI6D 2HF5A 3PJIA 4YGDB 4AQIA 1G33A 3EKHA 1QX7A 4MLWA 1S6JA 1UP5A 5HLVA 5KU1A 1PSBA 2V53A 1P28A 3EVRA 4OR9B 3PALA 4AQJA 1S36A 3ICBA 1DC1A 1DVIA 2WCKA 3CDNA 4NDBA 1RFJA 2WCHA 2PRUA 3D74A 3L4AA 1SRAA 1Y1UA 1X02A 5CSFA 1IJ5A 3GK4X 1CTRA 3DVJA 3I5FB 3TZ1A 3AAJA 1LXFC 1WDCC 3VB1A 1SR6B 2KLEA 3CZTX 1G8IA 1UHIA 1ZACA 2M9GA 1BU3A 2A4JA 2OS8C 1B47A 4A4BA 2LANA 2M8UA 1KQMB 1B7TY 4PALA 5EL2A 3D0YB 4I5NB 2JNXA 3A4UB 1QIWA 1RTP1 1SCMC 5I2QA 2FCDA 1TNPA 3DZTA 1A29A 2BKHB 4YRUA 1JBAA 1QX5B 5HKZA 2WOSA 3KO0A 1DEKA 1IJ6A 2BL0B 2MLFC 4YGAA 1XFWO 3D10A 2MJWB 1SKTA 1SBJA 3Q8IA 3A8RA 2L4HA 1IRJA 2GGZA 3O4YA 1R2UA 4UPGA 1V1GA 2L5XB 1NCYA 1SYMA 2GGMA 1NCXA 3OBVA 4ZCUA 2LNKA 1EL4A 3RZSA 1OE9B 3CR2A 1DJHA 5B8IB 3VRNA 2OTGB 3S0DA 2CNPA 2JTZA 3TUYB 1NIWA 3PATA 5CSIA 3S0BA 4QJ5B 1QTXA 1MHOA 3EKJA 1KWOC 5AANA 1RWYA 2JWWA 2L4IA 3DYEA 3NSKA 1IQ5A 4HRGA 2KI4C 1EXRA 3IQOA 1EH2A 5IBWA 2SCPA 2KPHA 1UHJA 2CBLA 1YX7A 3NSIA 1KK8C 3MSEB 2ZKMX 1DT7B 2JTTA 2O5GA 2ZFDA 1VRKA 2GV5A 3IVTA 1UHKA 3BOWB 3PFVA 1PRWA 3WNXB 2B1UA 2KFFA 2G2BA 2QEBA 2HQWA 1CDPA 1W7IB 3TS5B 3SG2A 2NXQA 3EG5B 3D77A 3LL8B 3OGNA 2JPTA 3CGAA 1CFCA 2M0RA 1YX8A 4I5LB 1W7JB 3FS7A 2Y4QA 2ISDA 5FI2A 3SG3A 2Y1NA 3KF9A 2Y1MA 5DKQA 2OPOA 1UURA 1C3YA 2FJUB 3KPXA 2H61A 2K7BA 3L4LA 4N1FA 2WCMA 2WC8A 3S0FA 1FI5A 2E6WA 3BOWA 4NQGA 1ALVA 2QPTA 3AKBA 4PCWA 1JF2A 1B7TZ 1XFVO 3BQ3A 2LM5A 3I5GC 1CFFA 1CDLA 2H8VA 2LMUA 1WLMA 1OOFA 2BAPA 5GQQC 5ER5A 1DF0A
chains in the Genus database with same CATH topology
1BJFA 2L2EA 2AMIA 1S6CA 2LUCA 2Q91A 2KYCA 1WRLA 4MBEA 2KBIA 1SW8A 4GGNA 4PHKA 3BUWB 1CLBA 1YUUA 2LMTA 2I2RE 2BCAA 4YGEB 2BBNA 2IS9A 4DIRA 1LA3A 2K61A 5I8NA 1XA5A 3EK8A 4D1EA 1TCOB 1K90D 2L98A 4OCIA 1JUOA 1NCZA 2P6BB 2KBMA 5FYXA 1RECA 4BY5A 3FWCA 1ZFSA 3TDZA 1UHHA 2QACA 3LK0A 1XFXO 1LVCD 2M49B 1PULA 1LKJA 1N65A 3DVMA 1MUXA 1LA0A 3EVVA 1AP4A 2KGBC 1YR5A 2LCPA 4R1EA 4C0LA 2BE6A 1XFYO 2JXLA 2MA2A 4MZKA 2LHLA 2Y5IA 2LHIA 1K9KA 4M2OA 2JNFA 2H2KA 1JSAA 2MBXA 1F4QA 2KNEA 2CXJA 1QLKA 3PN7C 1PALA 2I94A 1Y1XA 1SL9A 3DD4A 2R2IA 1A2XA 2WCEA 4ORBB 4JQ0D 4N1GA 4NDDA 5AXIA 1M31A 1DJXA 1OOJA 1CFPA 3FWBA 1J7OA 4C0JA 1NSHA 2G9BA 5I2OA 1LINA 2M7NA 2F2OA 2L0PA 1DJZA 2LUXA 1NX1A 4P2YB 2LAPA 2O60A 4NDCA 4YI9A 4MSPA 4PE7A 1AHRA 3CR5X 3CWGA 1PVBA 1L2OC 1N2DA 2KSPA 2KFHA 4MZJA 1K2HA 3DVEA 4FTGA 3PSRA 1Y1AA 1AJ5A 2AAOA 2L50A 2LVIA 5AFPA 4GUKA 1QASA 4JPZB 1M46A 2WCFA 2FOTA 5ER4X 2KAXA 4OV2A 1NX2A 2K8MB 1A03A 1J7PA 2KYFA 1ODBA 1F4OA 1Q80A 1KCYA 1MXEA 3NXAA 1TNQA 4GGFC 2D8NA 1QIVA 3HCMA 1XYDA 1RROA 2AUCA 2K7DA 1Y0VH 5KSZA 1CM4A 1OSAA 1TNWA 3GOFA 2LVVA 4GPLB 1V1FA 1H8BA 3HX4A 2BBMA 1DGVA 1C07A 1BODA 3JVTB 1DJWA 4PE4A 1TOPA 1B9AA 3CTNA 4Q04A 1IWQA 3ZNIA 3EVUA 1J7RA 1SY9A 1NWDA 4HRHA 1OZSA 5K89A 1WLZA 2NCOA 1B8RA 1FPWA 1JWDA 1MQ1A 4JWQA 1A4PA 2M97A 4MRYA 1C7WA 5AEQA 2KGRA 2CT9A 2HQ8A 1KFUS 5HKWA 2WNDA 3I5IC 2LVKA 2K7CA 2JXCA 4IL1A 5I2LA 2PVBA 1JF0A 1G4YR 3BXKA 1DF0B 1M45A 1SK6D 1TCFA 1J7QA 4ETOA 3VGOA 5JOLA 1YTZC 3I5HC 1KFXS 1QLSA 2F33A 2TN4A 4GAOA 3KEVA 5HLOA 1IG5A 2PMYA 5CSNA 1WDCB 1GQMA 2ZNDA 3GK1A 3BUNB 1NP8A 2EC6C 3VRRA 1NYAA 5D7FA 2OS8B 1TTXA 4PE1A 2KAYA 1OQPA 1IGVA 1AK8A 1SCMB 3BYAA 4A4CA 5DKRA 2CCMA 1OMRA 2ZN8A 3EK4A 1NUBA 4FQOA 3GK2A 3K21A 4HSZA 4ICBA 4U8DA 5HYDA 1NPQA 4PHMA 4F0ZB 3CR4X 4MVFA 3SJSA 3O78A 2M29A 5D69A 1J1EA 3FIAA 4ZCVA 4MZLA 3VROA 3C1VA 4WQ3A 5PALA 2F3ZA 1GJYA 4YBHB 1EG4A 1TNXA 2HPSA 4DRWA 1N0YA 1UWOA 1QV0A 2JT8A 2KHNA 3I5FC 3NSLA 2M1KB 1QXPA 2ZRTA 2I18A 3LCPC 1GGZA 1CB1A 1QV1A 2EHBA 3PLFB 2LP3A 2LLTA 1KWOB 3WHUB 5DKNA 1YVHA 2BCBA 2BCXA 2FCEA 2KI4B 4XJKA 1DGUA 1ZUZA 1ALWA 1KSMA 3WHTB 1YUTA 4GFTA 4DS7A 2NCPA 1K95A 2KQYA 1KK8B 1CLLA 2BL0C 3BUMB 4CPVA 1CM1A 4YGCB 1E8AA 1OMVA 3M0WA 1JFJA 3I5IB 2EGDA 4GGFA 1K94A 2F3YA 3IF7A 1QS7A 5CSJA 2OTGC 3RLZA 3TDUA 2JULA 3BUXB 4P5OE 1FI6A 3TDIA 1S5GY 2HETA 1GGWA 3KHEA 1J55A 2KOTA 1D1OA 2PALA 1AJ4A 1KFUL 2M7LA 3SIBA 3DVKA 2MHHA 1CNPA 2CTNA 3SG6A 1K93D 1CDNA 1EG3A 2BE4A 1UUSA 1CLMA 1SNLA 1K8UA 2F2PA 3VRPA 1IH0A 2M3WA 4E68A 1IQ3A 1U5IA 2COLB 1CFDA 1QX2A 2E30A 2MRDA 3I5GB 1AVSA 5BPJA 1H4BA 1WRZA 1KFXL 3IQQA 4ORCB 3TS5C 2PASA 2JQ6A 3AKAA 3NSOA 1S26D 3H4SE 5J3XA 2LP2A 2BKIB 4GBAA 1TN4A 4TNCA 4DCKA 1QJTA 4CLNA 1F8HA 4ORAB 1DJYA 1YRUB 3DF0A 4GNKB 1F54A 2JU0A 4WQ2A 2BECA 3BUOB 1XO5A 2JRFA 1BOCA 2ZNEA 1M39A 1NX0A 4BY4A 2K0JA 1UHNA 4OKHA 1NX3A 4I5KA 2MLEC 1BR4B 4WRIA 1KK7Y 1XK4C 1B8CA 1SL7A 1QVIY 1OZOA 4PHJA 2SASA 1BLQA 4MEWA 2JT0A 1ZOTB 3OB1B 1XFZO 2PSRA 1RK9A 1KSOA 2NLNA 1BG1A 1DJGA 1F55A 1CDMA 1S3PA 2VRGA 2WORA 3OB2B 2I7AA 3QRXA 3SG5A 3E3RA 1EJ3A 1F71A 2K7OA 4PHNA 3PN7B 1KQVA 1CKKA 1PK0D 1IKUA 1XFUO 3O6BA 3RM1A 1BMOA 1C7VA 1DJIA 2DOQA 3D0YA 1WY9A 3OX5A 1CMFA 1M63B 2K2FA 2LV7A 4C0KA 1FF1A 1S5GZ 1B4CA 3OHMB 3JTDC 2ZN9A 1SL8A 3LLEA 1MF8B 4CIDA 4PDZA 2NZ0A 3AAKA 2MAZA 3CS1A 1YUSA 3SG4A 1R6PA 1B8LA 1SMGA 1BF5A 2LMVA 5HKYA 2K2AA 1MWNA 3EK7A 1BR1B 3O2PA 1L2OB 1PVAA 4XJKB 3SIAA 1FBVA 4XYNA 1MXLC 4PE0A 5CPVA 3VRQA 4N5XA 2KAVA 1DTLA 2KDHA 1Y6WA 2JC2A 4YI8A 3WXAA 4DUQA 1QATA 1ZMZA 4CFRA 5KTYA 1SCVA 2LE9B 2Q4UA 4CFQA 2KQ6A 1PSRA 1WRKA 1OMDA 2LVJA 1A75B 1SPYA 1YVLA 1HQVA 2LLSA 1SR6C 2JT3A 4AOMA 4L9MA 1CMGA 4M2QA 1DMOA 2F8PA 3ZWHA 1J1DA 1KQMC 5TNCA 1S1EA 1TRFA 3OX6A 2JZIA 1K9PA 3LK1A 1B1GA 1KK7Z 2L51A 4M2PA 1K96A 1QVIZ 1BT6A 4YGBB 5JJGA 4QJ3B 4I5JA 2WCBA 4MN0A 1JFKA 3SG7A 2M1UA 5G08A 1L7ZA 1K9UA 2KFGA 1U5IB 1FW4A 1RJVA 1F70A 1A75A 2KI6C 2LC5A 1HT9A 3F45A 1S6IA 3PM8A 3TUYC 1YURA 5AERA 1TIZA 1YRTB 3JVTC 3I5HB 5F6TA 4QJ4B 2ZRSA 2RGIA 1MR8A 1XK4A 4HREE 2LLUA 2JOJA 3DF0B 3OP0A 3JTDB 4USLA 1XVJA 3CLNA 2EC6B 4OVNF 1JC2A 4MRXA 2H61C 1AUIB 2KI6D 2HF5A 4AQIA 4YGDB 1G33A 3EKHA 1QX7A 4MLWA 1S6JA 1UP5A 5HLVA 5KU1A 1PSBA 2V53A 3EVRA 4OR9B 3PALA 4AQJA 1S36A 3ICBA 1DVIA 4NDBA 1RFJA 2PRUA 1SRAA 1Y1UA 1X02A 5CSFA 1IJ5A 3GK4X 1CTRA 3DVJA 3I5FB 3TZ1A 3AAJA 1LXFC 1WDCC 1SR6B 3CZTX 1G8IA 1UHIA 1ZACA 2M9GA 1BU3A 2A4JA 2OS8C 1B47A 4A4BA 2LANA 2M8UA 1KQMB 1B7TY 4PALA 5I2QA 3D0YB 4I5NB 2JNXA 3A4UB 1QIWA 1RTP1 1SCMC 2FCDA 1TNPA 1A29A 2BKHB 4YRUA 1JBAA 1QX5B 5HKZA 2WOSA 3KO0A 1IJ6A 2BL0B 2MLFC 4YGAA 1XFWO 3D10A 2MJWB 1SKTA 1SBJA 3A8RA 2L4HA 1IRJA 2GGZA 3O4YA 1R2UA 4UPGA 1V1GA 2L5XB 1NCYA 1SYMA 2GGMA 1NCXA 4ZCUA 2LNKA 1EL4A 1OE9B 3CR2A 1DJHA 5B8IB 3VRNA 2OTGB 2CNPA 2JTZA 3TUYB 1NIWA 3PATA 5CSIA 4QJ5B 1QTXA 1MHOA 3EKJA 1KWOC 5AANA 1RWYA 2JWWA 2L4IA 3NSKA 1IQ5A 4HRGA 2KI4C 1EXRA 3IQOA 1EH2A 5IBWA 2SCPA 1UHJA 2CBLA 1YX7A 3NSIA 1KK8C 3MSEB 2ZKMX 1DT7B 2JTTA 2O5GA 2ZFDA 1VRKA 2GV5A 1UHKA 3BOWB 3PFVA 1PRWA 3WNXB 2B1UA 2KFFA 2G2BA 2HQWA 1CDPA 1W7IB 3TS5B 3SG2A 2NXQA 3LL8B 2JPTA 3CGAA 1CFCA 2M0RA 1YX8A 4I5LB 1W7JB 3FS7A 2Y4QA 2ISDA 3SG3A 2Y1NA 3KF9A 2Y1MA 5DKQA 2OPOA 1UURA 2FJUB 3KPXA 2H61A 2K7BA 4N1FA 2WC8A 1FI5A 2E6WA 3BOWA 4NQGA 1ALVA 2QPTA 3AKBA 4PCWA 1JF2A 1B7TZ 1XFVO 3BQ3A 2LM5A 3I5GC 1CFFA 1CDLA 2LMUA 1WLMA 5GQQC 5ER5A 1DF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BJF A;  2L2E A;  2AMI A;  1S6C A;  2LUC A;  2Q91 A;  2KYC A;  1WRL A;  4MBE A;  2KBI A;  1SW8 A;  4GGN A;  4PHK A;  3BUW B;  1CLB A;  1YUU A;  2LMT A;  2I2R E;  2BCA A;  4YGE B;  2BBN A;  2IS9 A;  4DIR A;  1LA3 A;  2K61 A;  5I8N A;  1XA5 A;  3EK8 A;  4D1E A;  1TCO B;  1K90 D;  2L98 A;  4OCI A;  1JUO A;  1NCZ A;  2P6B B;  2KBM A;  5FYX A;  1REC A;  4BY5 A;  3FWC A;  1ZFS A;  3TDZ A;  1UHH A;  2QAC A;  3LK0 A;  1XFX O;  1LVC D;  2M49 B;  1PUL A;  1LKJ A;  1N65 A;  3DVM A;  1MUX A;  1LA0 A;  3EVV A;  1AP4 A;  2KGB C;  1YR5 A;  2LCP A;  4R1E A;  4C0L A;  2BE6 A;  1XFY O;  2JXL A;  2MA2 A;  4MZK A;  2LHL A;  2Y5I A;  2LHI A;  1K9K A;  4M2O A;  2JNF A;  2H2K A;  1JSA A;  2MBX A;  1F4Q A;  2KNE A;  2CXJ A;  1QLK A;  3PN7 C;  1PAL A;  2I94 A;  1Y1X A;  1SL9 A;  3DD4 A;  2R2I A;  1A2X A;  2WCE A;  4ORB B;  4JQ0 D;  4N1G A;  4NDD A;  5AXI A;  1M31 A;  1DJX A;  1OOJ A;  1CFP A;  3FWB A;  1J7O A;  4C0J A;  1NSH A;  2G9B A;  5I2O A;  1LIN A;  2M7N A;  2F2O A;  2L0P A;  1DJZ A;  2LUX A;  1NX1 A;  4P2Y B;  2LAP A;  2O60 A;  4NDC A;  4YI9 A;  4MSP A;  4PE7 A;  1AHR A;  3CR5 X;  3CWG A;  1PVB A;  1L2O C;  1N2D A;  2KSP A;  2KFH A;  4MZJ A;  1K2H A;  3DVE A;  4FTG A;  3PSR A;  1Y1A A;  1AJ5 A;  2AAO A;  2L50 A;  2LVI A;  5AFP A;  4GUK A;  1QAS A;  4JPZ B;  1M46 A;  2WCF A;  2FOT A;  5ER4 X;  2KAX A;  4OV2 A;  1NX2 A;  2K8M B;  1A03 A;  1J7P A;  2KYF A;  1ODB A;  1F4O A;  1Q80 A;  1KCY A;  1MXE A;  3NXA A;  1TNQ A;  4GGF C;  2D8N A;  1QIV A;  3HCM A;  1XYD A;  1RRO A;  2AUC A;  2K7D A;  1Y0V H;  5KSZ A;  1CM4 A;  1OSA A;  1TNW A;  3GOF A;  2LVV A;  4GPL B;  1V1F A;  1H8B A;  3HX4 A;  2BBM A;  1DGV A;  1C07 A;  1BOD A;  3JVT B;  1DJW A;  4PE4 A;  1TOP A;  1B9A A;  3CTN A;  4Q04 A;  1IWQ A;  3ZNI A;  3EVU A;  1J7R A;  1SY9 A;  1NWD A;  4HRH A;  1OZS A;  5K89 A;  1WLZ A;  2NCO A;  1B8R A;  1FPW A;  1JWD A;  1MQ1 A;  4JWQ A;  1A4P A;  2M97 A;  4MRY A;  1C7W A;  5AEQ A;  2KGR A;  2CT9 A;  2HQ8 A;  1KFU S;  5HKW A;  2WND A;  3I5I C;  2LVK A;  2K7C A;  2JXC A;  4IL1 A;  5I2L A;  2PVB A;  1JF0 A;  1G4Y R;  3BXK A;  1DF0 B;  1M45 A;  1SK6 D;  1TCF A;  1J7Q A;  4ETO A;  3VGO A;  5JOL A;  1YTZ C;  3I5H C;  1KFX S;  1QLS A;  2F33 A;  2TN4 A;  4GAO A;  3KEV A;  5HLO A;  1IG5 A;  2PMY A;  5CSN A;  1WDC B;  1GQM A;  2ZND A;  3GK1 A;  3BUN B;  1NP8 A;  2EC6 C;  3VRR A;  1NYA A;  5D7F A;  2OS8 B;  1TTX A;  4PE1 A;  2KAY A;  1OQP A;  1IGV A;  1AK8 A;  1SCM B;  3BYA A;  4A4C A;  5DKR A;  2CCM A;  1OMR A;  2ZN8 A;  3EK4 A;  1NUB A;  4FQO A;  3GK2 A;  3K21 A;  4HSZ A;  4ICB A;  4U8D A;  5HYD A;  1NPQ A;  4PHM A;  4F0Z B;  3CR4 X;  4MVF A;  3SJS A;  3O78 A;  2M29 A;  5D69 A;  1J1E A;  3FIA A;  4ZCV A;  4MZL A;  3VRO A;  3C1V A;  4WQ3 A;  5PAL A;  2F3Z A;  1GJY A;  4YBH B;  1EG4 A;  1TNX A;  2HPS A;  4DRW A;  1N0Y A;  1UWO A;  1QV0 A;  2JT8 A;  2KHN A;  3I5F C;  3NSL A;  2M1K B;  1QXP A;  2ZRT A;  2I18 A;  3LCP C;  1GGZ A;  1CB1 A;  1QV1 A;  2EHB A;  3PLF B;  2LP3 A;  2LLT A;  1KWO B;  3WHU B;  5DKN A;  1YVH A;  2BCB A;  2BCX A;  2FCE A;  2KI4 B;  4XJK A;  1DGU A;  1ZUZ A;  1ALW A;  1KSM A;  3WHT B;  1YUT A;  4GFT A;  4DS7 A;  2NCP A;  1K95 A;  2KQY A;  1KK8 B;  1CLL A;  2BL0 C;  3BUM B;  4CPV A;  1CM1 A;  4YGC B;  1E8A A;  1OMV A;  3M0W A;  1JFJ A;  3I5I B;  2EGD A;  4GGF A;  1K94 A;  2F3Y A;  3IF7 A;  1QS7 A;  5CSJ A;  2OTG C;  3RLZ A;  3TDU A;  2JUL A;  3BUX B;  4P5O E;  1FI6 A;  3TDI A;  1S5G Y;  2HET A;  1GGW A;  3KHE A;  1J55 A;  2KOT A;  1D1O A;  2PAL A;  1AJ4 A;  1KFU L;  2M7L A;  3SIB A;  3DVK A;  2MHH A;  1CNP A;  2CTN A;  3SG6 A;  1K93 D;  1CDN A;  1EG3 A;  2BE4 A;  1UUS A;  1CLM A;  1SNL A;  1K8U A;  2F2P A;  3VRP A;  1IH0 A;  2M3W A;  4E68 A;  1IQ3 A;  1U5I A;  2COL B;  1CFD A;  1QX2 A;  2E30 A;  2MRD A;  3I5G B;  1AVS A;  5BPJ A;  1H4B A;  1WRZ A;  1KFX L;  3IQQ A;  4ORC B;  3TS5 C;  2PAS A;  2JQ6 A;  3AKA A;  3NSO A;  1S26 D;  3H4S E;  5J3X A;  2LP2 A;  2BKI B;  4GBA A;  1TN4 A;  4TNC A;  4DCK A;  1QJT A;  4CLN A;  1F8H A;  4ORA B;  1DJY A;  1YRU B;  3DF0 A;  4GNK B;  1F54 A;  2JU0 A;  4WQ2 A;  2BEC A;  3BUO B;  1XO5 A;  2JRF A;  1BOC A;  2ZNE A;  1M39 A;  1NX0 A;  4BY4 A;  2K0J A;  1UHN A;  4OKH A;  1NX3 A;  4I5K A;  2MLE C;  1BR4 B;  4WRI A;  1KK7 Y;  1XK4 C;  1B8C A;  1SL7 A;  1QVI Y;  1OZO A;  4PHJ A;  2SAS A;  1BLQ A;  4MEW A;  2JT0 A;  1ZOT B;  3OB1 B;  1XFZ O;  2PSR A;  1RK9 A;  1KSO A;  2NLN A;  1BG1 A;  1DJG A;  1F55 A;  1CDM A;  1S3P A;  2VRG A;  2WOR A;  3OB2 B;  2I7A A;  3QRX A;  3SG5 A;  3E3R A;  1EJ3 A;  1F71 A;  2K7O A;  4PHN A;  3PN7 B;  1KQV A;  1CKK A;  1PK0 D;  1IKU A;  1XFU O;  3O6B A;  3RM1 A;  1BMO A;  1C7V A;  1DJI A;  2DOQ A;  3D0Y A;  1WY9 A;  3OX5 A;  1CMF A;  1M63 B;  2K2F A;  2LV7 A;  4C0K A;  1FF1 A;  1S5G Z;  1B4C A;  3OHM B;  3JTD C;  2ZN9 A;  1SL8 A;  3LLE A;  1MF8 B;  4CID A;  4PDZ A;  2NZ0 A;  3AAK A;  2MAZ A;  3CS1 A;  1YUS A;  3SG4 A;  1R6P A;  1B8L A;  1SMG A;  1BF5 A;  2LMV A;  5HKY A;  2K2A A;  1MWN A;  3EK7 A;  1BR1 B;  3O2P A;  1L2O B;  1PVA A;  4XJK B;  3SIA A;  1FBV A;  4XYN A;  1MXL C;  4PE0 A;  5CPV A;  3VRQ A;  4N5X A;  2KAV A;  1DTL A;  2KDH A;  1Y6W A;  2JC2 A;  4YI8 A;  3WXA A;  4DUQ A;  1QAT A;  1ZMZ A;  4CFR A;  5KTY A;  1SCV A;  2LE9 B;  2Q4U A;  4CFQ A;  2KQ6 A;  1PSR A;  1WRK A;  1OMD A;  2LVJ A;  1A75 B;  1SPY A;  1YVL A;  1HQV A;  2LLS A;  1SR6 C;  2JT3 A;  4AOM A;  4L9M A;  1CMG A;  4M2Q A;  1DMO A;  2F8P A;  3ZWH A;  1J1D A;  1KQM C;  5TNC A;  1S1E A;  1TRF A;  3OX6 A;  2JZI A;  1K9P A;  3LK1 A;  1B1G A;  1KK7 Z;  2L51 A;  4M2P A;  1K96 A;  1QVI Z;  1BT6 A;  4YGB B;  5JJG A;  4QJ3 B;  4I5J A;  2WCB A;  4MN0 A;  1JFK A;  3SG7 A;  2M1U A;  5G08 A;  1L7Z A;  1K9U A;  2KFG A;  1U5I B;  1FW4 A;  1RJV A;  1F70 A;  1A75 A;  2KI6 C;  2LC5 A;  1HT9 A;  3F45 A;  1S6I A;  3PM8 A;  3TUY C;  1YUR A;  5AER A;  1TIZ A;  1YRT B;  3JVT C;  3I5H B;  5F6T A;  4QJ4 B;  2ZRS A;  2RGI A;  1MR8 A;  1XK4 A;  4HRE E;  2LLU A;  2JOJ A;  3DF0 B;  3OP0 A;  3JTD B;  4USL A;  1XVJ A;  3CLN A;  2EC6 B;  4OVN F;  1JC2 A;  4MRX A;  2H61 C;  1AUI B;  2KI6 D;  2HF5 A;  4AQI A;  4YGD B;  1G33 A;  3EKH A;  1QX7 A;  4MLW A;  1S6J A;  1UP5 A;  5HLV A;  5KU1 A;  1PSB A;  2V53 A;  3EVR A;  4OR9 B;  3PAL A;  4AQJ A;  1S36 A;  3ICB A;  1DVI A;  4NDB A;  1RFJ A;  2PRU A;  1SRA A;  1Y1U A;  1X02 A;  5CSF A;  1IJ5 A;  3GK4 X;  1CTR A;  3DVJ A;  3I5F B;  3TZ1 A;  3AAJ A;  1LXF C;  1WDC C;  1SR6 B;  3CZT X;  1G8I A;  1UHI A;  1ZAC A;  2M9G A;  1BU3 A;  2A4J A;  2OS8 C;  1B47 A;  4A4B A;  2LAN A;  2M8U A;  1KQM B;  1B7T Y;  4PAL A;  5I2Q A;  3D0Y B;  4I5N B;  2JNX A;  3A4U B;  1QIW A;  1RTP 1;  1SCM C;  2FCD A;  1TNP A;  1A29 A;  2BKH B;  4YRU A;  1JBA A;  1QX5 B;  5HKZ A;  2WOS A;  3KO0 A;  1IJ6 A;  2BL0 B;  2MLF C;  4YGA A;  1XFW O;  3D10 A;  2MJW B;  1SKT A;  1SBJ A;  3A8R A;  2L4H A;  1IRJ A;  2GGZ A;  3O4Y A;  1R2U A;  4UPG A;  1V1G A;  2L5X B;  1NCY A;  1SYM A;  2GGM A;  1NCX A;  4ZCU A;  2LNK A;  1EL4 A;  1OE9 B;  3CR2 A;  1DJH A;  5B8I B;  3VRN A;  2OTG B;  2CNP A;  2JTZ A;  3TUY B;  1NIW A;  3PAT A;  5CSI A;  4QJ5 B;  1QTX A;  1MHO A;  3EKJ A;  1KWO C;  5AAN A;  1RWY A;  2JWW A;  2L4I A;  3NSK A;  1IQ5 A;  4HRG A;  2KI4 C;  1EXR A;  3IQO A;  1EH2 A;  5IBW A;  2SCP A;  1UHJ A;  2CBL A;  1YX7 A;  3NSI A;  1KK8 C;  3MSE B;  2ZKM X;  1DT7 B;  2JTT A;  2O5G A;  2ZFD A;  1VRK A;  2GV5 A;  1UHK A;  3BOW B;  3PFV A;  1PRW A;  3WNX B;  2B1U A;  2KFF A;  2G2B A;  2HQW A;  1CDP A;  1W7I B;  3TS5 B;  3SG2 A;  2NXQ A;  3LL8 B;  2JPT A;  3CGA A;  1CFC A;  2M0R A;  1YX8 A;  4I5L B;  1W7J B;  3FS7 A;  2Y4Q A;  2ISD A;  3SG3 A;  2Y1N A;  3KF9 A;  2Y1M A;  5DKQ A;  2OPO A;  1UUR A;  2FJU B;  3KPX A;  2H61 A;  2K7B A;  4N1F A;  2WC8 A;  1FI5 A;  2E6W A;  3BOW A;  4NQG A;  1ALV A;  2QPT A;  3AKB A;  4PCW A;  1JF2 A;  1B7T Z;  1XFV O;  3BQ3 A;  2LM5 A;  3I5G C;  1CFF A;  1CDL A;  2LMU A;  1WLM A;  5GQQ C;  5ER5 A;  1DF0 A; 
#chains in the Genus database with same CATH topology
 1BJF A;  2L2E A;  2AMI A;  1S6C A;  2LUC A;  2Q91 A;  2KYC A;  1WRL A;  4MBE A;  2KBI A;  1SW8 A;  4GGN A;  4PHK A;  3BUW B;  1CLB A;  1YUU A;  2WCJ A;  2LMT A;  2I2R E;  2BCA A;  4YGE B;  2BBN A;  2IS9 A;  4DIR A;  1LA3 A;  2K61 A;  5I8N A;  1XA5 A;  3EK8 A;  4D1E A;  1TCO B;  1K90 D;  2L98 A;  4OCI A;  3UNW A;  1JUO A;  1NCZ A;  2P6B B;  2KBM A;  5FYX A;  1REC A;  4BY5 A;  3FWC A;  1ZFS A;  3TDZ A;  1UHH A;  2QAC A;  3LK0 A;  1XFX O;  1LVC D;  2M49 B;  1PUL A;  1LKJ A;  1TUJ A;  1N65 A;  2KLD A;  1MUX A;  3DVM A;  3D73 A;  2QEO A;  1LA0 A;  3EVV A;  1AP4 A;  2KGB C;  1YR5 A;  2LCP A;  4R1E A;  4C0L A;  2BE6 A;  1XFY O;  2JXL A;  2MA2 A;  4MZK A;  2LHL A;  2Y5I A;  2LHI A;  1K9K A;  4M2O A;  2JNF A;  2H2K A;  1JSA A;  2MBX A;  1F4Q A;  2KNE A;  2CXJ A;  1QLK A;  3PN7 C;  1PAL A;  2I94 A;  1Y1X A;  3VRR A;  1SL9 A;  3DD4 A;  2R2I A;  1A2X A;  2WCE A;  4ORB B;  4JQ0 D;  4N1G A;  4NDD A;  5AXI A;  1M31 A;  1DJX A;  2ERB A;  5FI6 A;  1OOJ A;  3BFH A;  2PYQ A;  3B88 A;  1CFP A;  2P70 A;  3FWB A;  1OOG A;  4C0J A;  1J7O A;  1NSH A;  2G9B A;  5I2O A;  1LIN A;  2M7N A;  3B7A A;  2F2O A;  2L0P A;  1DJZ A;  2LUX A;  1NX1 A;  4P2Y B;  2LAP A;  2O60 A;  2WCL A;  4NDC A;  4MSP A;  3R1O A;  4PE7 A;  4YI9 A;  1AHR A;  3CR5 X;  3CWG A;  2GTE A;  1PVB A;  1L2O C;  1N2D A;  2KSP A;  2KFH A;  4MZJ A;  1K2H A;  3DVE A;  4FTG A;  3PSR A;  3QME A;  1Y1A A;  1AJ5 A;  2AAO A;  2L50 A;  2LVI A;  5AFP A;  4GUK A;  1QAS A;  4JPZ B;  1M46 A;  2WCF A;  2FOT A;  5ER4 X;  2KAX A;  4OV2 A;  1NX2 A;  2K8M B;  4KYN A;  3SS4 A;  1A03 A;  1J7P A;  2KYF A;  1ODB A;  1F4O A;  1Q80 A;  1KCY A;  1MXE A;  3NXA A;  1TNQ A;  4GGF C;  2D8N A;  1QIV A;  3B6X A;  1XYD A;  1RRO A;  2AUC A;  2K7D A;  1Y0V H;  3HCM A;  3NHT A;  1CM4 A;  1OSA A;  1TNW A;  3GOF A;  2LVV A;  4GPL B;  1V1F A;  1H8B A;  3HX4 A;  2BBM A;  1DGV A;  4IJ7 A;  1C07 A;  1BOD A;  3JVT B;  1DJW A;  4PE4 A;  1TOP A;  3FE8 A;  4INX A;  1B9A A;  3CTN A;  4Q04 A;  1IWQ A;  3ZNI A;  3EVU A;  1J7R A;  5D3O A;  1SY9 A;  1NWD A;  4HRH A;  1OZS A;  5K89 A;  1WLZ A;  3O4X A;  1Z4H A;  2NCO A;  1B8R A;  2QDI A;  1FPW A;  1JWD A;  3N7H A;  1MQ1 A;  4JWQ A;  1A4P A;  2M97 A;  4MRY A;  1C7W A;  5AEQ A;  2KGR A;  3PM2 A;  2CT9 A;  1W9Z A;  1KFU S;  2HQ8 A;  5HKW A;  2WND A;  2YGU A;  3I5I C;  3CZ0 A;  2LVK A;  2K7C A;  2JXC A;  4IL1 A;  5I2L A;  2PVB A;  1JF0 A;  1G4Y R;  5DIC A;  3BXK A;  1DF0 B;  1M45 A;  1SK6 D;  1TCF A;  3CAB A;  1J7Q A;  4ETO A;  3VGO A;  4INW A;  5JOL A;  1YTZ C;  3I5H C;  1KFX S;  1QLS A;  2F33 A;  2TN4 A;  4GAO A;  3KEV A;  5HLO A;  1IG5 A;  2PMY A;  5CSN A;  1WDC B;  1GQM A;  2ZND A;  3GK1 A;  3BUN B;  1NP8 A;  2EC6 C;  3NGV A;  1NYA A;  4JD9 A;  5D7F A;  2OS8 B;  3S0A A;  1TTX A;  4PE1 A;  2KAY A;  1OQP A;  1IGV A;  1AK8 A;  3R1V A;  1LS8 A;  1SCM B;  3BYA A;  4A4C A;  3B87 A;  5DKR A;  1ORG A;  1OMR A;  2CCM A;  2ZN8 A;  1NUB A;  1Z2C B;  3EK4 A;  3GK2 A;  3K21 A;  4FQO A;  4HSZ A;  4ICB A;  4U8D A;  5HYD A;  1NPQ A;  4PHM A;  4F0Z B;  3CR4 X;  4MVF A;  3SJS A;  3O78 A;  2M29 A;  5D69 A;  1J1E A;  3FIA A;  3L47 A;  4MZL A;  4ZCV A;  3VRO A;  3C1V A;  4WQ3 A;  5PAL A;  2F3Z A;  1GJY A;  4YBH B;  5I94 A;  1EG4 A;  1TNX A;  2HPS A;  4DRW A;  1N0Y A;  1UWO A;  1QV0 A;  2JT8 A;  2KHN A;  3I5F C;  3NSL A;  2M1K B;  1QXP A;  2ZRT A;  2I18 A;  3R1P A;  3LCP C;  1GGZ A;  1CB1 A;  1QV1 A;  2EHB A;  3PLF B;  4F7F A;  2LP3 A;  2LLT A;  1KWO B;  3WHU B;  1OW4 A;  5DKN A;  1YVH A;  2BCB A;  2BCX A;  2FCE A;  2KI4 B;  1TUZ A;  4XJK A;  1DGU A;  1ZUZ A;  1ALW A;  1KSM A;  3WHT B;  1YUT A;  4GFT A;  4DS7 A;  4JKT A;  1DEL A;  1K95 A;  2KQY A;  1KK8 B;  2NCP A;  1CLL A;  3R72 A;  2BL0 C;  3DY9 A;  3BUM B;  4CPV A;  1CM1 A;  3D78 A;  4YGC B;  1E8A A;  1OMV A;  3M0W A;  1JFJ A;  3I5I B;  3BFA A;  2EGD A;  3CYZ A;  4GGF A;  1K94 A;  2F3Y A;  3IF7 A;  1QS7 A;  3UO9 A;  5CSJ A;  2OTG C;  3RLZ A;  3TDU A;  2JUL A;  3BUX B;  4P5O E;  1FI6 A;  3TDI A;  1S5G Y;  2HET A;  1GGW A;  3KHE A;  1J55 A;  2KOT A;  1D1O A;  2PAL A;  5HL1 A;  1AJ4 A;  2QEH A;  1KFU L;  2M7L A;  3SIB A;  3DVK A;  2MHH A;  1CNP A;  2CTN A;  1T14 A;  3SG6 A;  1K93 D;  1CDN A;  3BFB A;  1EG3 A;  3DXL A;  2BE4 A;  1UUS A;  2P71 A;  1CLM A;  1SNL A;  1K8U A;  2F2P A;  3VRP A;  1IH0 A;  2M3W A;  4E68 A;  1IQ3 A;  1U5I A;  1TWO A;  1CFD A;  1QX2 A;  2COL B;  2E30 A;  2MRD A;  3I5G B;  1AVS A;  5BPJ A;  1H4B A;  1WRZ A;  1KFX L;  3IQQ A;  4ORC B;  3TS5 C;  2PAS A;  2JQ6 A;  3AKA A;  3NSO A;  1S26 D;  3H4S E;  5J3X A;  2LP2 A;  2BKI B;  4GBA A;  1TN4 A;  4TNC A;  4DCK A;  1QJT A;  4CLN A;  1F8H A;  1QWV A;  2L2C A;  1DJY A;  4ORA B;  1YRU B;  2WC5 A;  3DF0 A;  4GNK B;  1F54 A;  2JU0 A;  4WQ2 A;  2BEC A;  3BUO B;  1XO5 A;  3NHI A;  1OOI X;  2JRF A;  1BOC A;  2ZNE A;  1M39 A;  1NX0 A;  4BY4 A;  2K0J A;  1UHN A;  4OKH A;  1NX3 A;  4I5K A;  2MLE C;  1BR4 B;  4WRI A;  1KK7 Y;  1XK4 C;  1B8C A;  1SL7 A;  1QVI Y;  1OZO A;  4PHJ A;  2SAS A;  1BLQ A;  4MEW A;  2JT0 A;  1ZOT B;  3OB1 B;  1XFZ O;  2PSR A;  1RK9 A;  1KSO A;  3S0E A;  2NLN A;  1BG1 A;  1DJG A;  3K1E A;  1F55 A;  1CDM A;  1S3P A;  2VRG A;  2WOR A;  3OB2 B;  2I7A A;  3QRX A;  3SG5 A;  3E3R A;  1EJ3 A;  3S0G A;  1F71 A;  2K7O A;  4PHN A;  3PN7 B;  1KQV A;  1CKK A;  1PK0 D;  1IKU A;  1GM0 A;  1XFU O;  3O6B A;  3RM1 A;  1BMO A;  1C7V A;  1DJI A;  2DOQ A;  3D0Y A;  1WY9 A;  3OX5 A;  1CMF A;  1M63 B;  3V2L A;  2K2F A;  2LV7 A;  4C0K A;  1FF1 A;  1S5G Z;  1B4C A;  1OOH A;  3OHM B;  3JTD C;  2ZN9 A;  1SL8 A;  3LLE A;  1MF8 B;  4CID A;  4PDZ A;  2NZ0 A;  3AAK A;  2MAZ A;  2QEV A;  1IIO A;  3CS1 A;  1YUS A;  3SG4 A;  2L5Y A;  1R6P A;  1B8L A;  1SMG A;  1BF5 A;  2LMV A;  5HKY A;  2K2A A;  1MWN A;  3EK7 A;  1BR1 B;  3O2P A;  1L2O B;  3B86 A;  1PVA A;  4XJK B;  2K60 A;  3SIA A;  1FBV A;  4XYN A;  1MXL C;  4PE0 A;  5CPV A;  3VRQ A;  4N5X A;  2KAV A;  5KSZ A;  1DTL A;  1SSE B;  2KDH A;  1Y6W A;  4PT1 A;  2JC2 A;  4YI8 A;  3WXA A;  4DUQ A;  3SS5 A;  1QAT A;  1ZMZ A;  4CFR A;  5KTY A;  1SCV A;  2LE9 B;  2Q4U A;  4CFQ A;  2KQ6 A;  1PSR A;  1WRK A;  1OMD A;  2LVJ A;  1A75 B;  1SPY A;  1YVL A;  1HQV A;  2LLS A;  1SR6 C;  2JT3 A;  4AOM A;  4L9M A;  1CMG A;  4M2Q A;  3FE9 A;  1DMO A;  2F8P A;  3ZWH A;  1J1D A;  1KQM C;  1C3Z A;  5TNC A;  1S1E A;  1TRF A;  3OX6 A;  2JZI A;  1K9P A;  3LK1 A;  1B1G A;  3CZ1 A;  4FQT A;  3SS3 A;  3CZ2 A;  3D76 A;  1KK7 Z;  2L51 A;  4M2P A;  1K96 A;  1QVI Z;  1BT6 A;  4YGB B;  3D75 A;  5JJG A;  4QJ3 B;  4I5J A;  2WCB A;  4MN0 A;  1JFK A;  3SG7 A;  2M1U A;  5G08 A;  3BJH A;  1L7Z A;  1K9U A;  5FI7 A;  2KFG A;  1U5I B;  1FW4 A;  1RJV A;  2WC6 A;  1F70 A;  2FJY A;  1A75 A;  2KI6 C;  2LC5 A;  1HT9 A;  3F45 A;  1S6I A;  1XFR A;  3PM8 A;  3TUY C;  1YUR A;  5AER A;  1TIZ A;  1YRT B;  3JVT C;  3I5H B;  5F6T A;  4QJ4 B;  2ZRS A;  2RGI A;  1MR8 A;  1DQE A;  1XK4 A;  2LLU A;  4HRE E;  2BNX A;  2JOJ A;  3DF0 B;  3JTD B;  3OP0 A;  4USL A;  1XVJ A;  3CLN A;  3FE6 A;  4OZD A;  2EC6 B;  4OVN F;  2PQL A;  1JC2 A;  4MRX A;  2JPO A;  2H61 C;  1AUI B;  2KI6 D;  2HF5 A;  3PJI A;  4YGD B;  4AQI A;  1G33 A;  3EKH A;  1QX7 A;  4MLW A;  1S6J A;  1UP5 A;  5HLV A;  5KU1 A;  1PSB A;  2V53 A;  1P28 A;  3EVR A;  4OR9 B;  3PAL A;  4AQJ A;  1S36 A;  3ICB A;  1DC1 A;  1DVI A;  2WCK A;  3CDN A;  4NDB A;  1RFJ A;  2WCH A;  2PRU A;  3D74 A;  3L4A A;  1SRA A;  1Y1U A;  1X02 A;  5CSF A;  1IJ5 A;  3GK4 X;  1CTR A;  3DVJ A;  3I5F B;  3TZ1 A;  3AAJ A;  1LXF C;  1WDC C;  3VB1 A;  1SR6 B;  2KLE A;  3CZT X;  1G8I A;  1UHI A;  1ZAC A;  2M9G A;  1BU3 A;  2A4J A;  2OS8 C;  1B47 A;  4A4B A;  2LAN A;  2M8U A;  1KQM B;  1B7T Y;  4PAL A;  5EL2 A;  3D0Y B;  4I5N B;  2JNX A;  3A4U B;  1QIW A;  1RTP 1;  1SCM C;  5I2Q A;  2FCD A;  1TNP A;  3DZT A;  1A29 A;  2BKH B;  4YRU A;  1JBA A;  1QX5 B;  5HKZ A;  2WOS A;  3KO0 A;  1DEK A;  1IJ6 A;  2BL0 B;  2MLF C;  4YGA A;  1XFW O;  3D10 A;  2MJW B;  1SKT A;  1SBJ A;  3Q8I A;  3A8R A;  2L4H A;  1IRJ A;  2GGZ A;  3O4Y A;  1R2U A;  4UPG A;  1V1G A;  2L5X B;  1NCY A;  1SYM A;  2GGM A;  1NCX A;  3OBV A;  4ZCU A;  2LNK A;  1EL4 A;  3RZS A;  1OE9 B;  3CR2 A;  1DJH A;  5B8I B;  3VRN A;  2OTG B;  3S0D A;  2CNP A;  2JTZ A;  3TUY B;  1NIW A;  3PAT A;  5CSI A;  3S0B A;  4QJ5 B;  1QTX A;  1MHO A;  3EKJ A;  1KWO C;  5AAN A;  1RWY A;  2JWW A;  2L4I A;  3DYE A;  3NSK A;  1IQ5 A;  4HRG A;  2KI4 C;  1EXR A;  3IQO A;  1EH2 A;  5IBW A;  2SCP A;  2KPH A;  1UHJ A;  2CBL A;  1YX7 A;  3NSI A;  1KK8 C;  3MSE B;  2ZKM X;  1DT7 B;  2JTT A;  2O5G A;  2ZFD A;  1VRK A;  2GV5 A;  3IVT A;  1UHK A;  3BOW B;  3PFV A;  1PRW A;  3WNX B;  2B1U A;  2KFF A;  2G2B A;  2QEB A;  2HQW A;  1CDP A;  1W7I B;  3TS5 B;  3SG2 A;  2NXQ A;  3EG5 B;  3D77 A;  3LL8 B;  3OGN A;  2JPT A;  3CGA A;  1CFC A;  2M0R A;  1YX8 A;  4I5L B;  1W7J B;  3FS7 A;  2Y4Q A;  2ISD A;  5FI2 A;  3SG3 A;  2Y1N A;  3KF9 A;  2Y1M A;  5DKQ A;  2OPO A;  1UUR A;  1C3Y A;  2FJU B;  3KPX A;  2H61 A;  2K7B A;  3L4L A;  4N1F A;  2WCM A;  2WC8 A;  3S0F A;  1FI5 A;  2E6W A;  3BOW A;  4NQG A;  1ALV A;  2QPT A;  3AKB A;  4PCW A;  1JF2 A;  1B7T Z;  1XFV O;  3BQ3 A;  2LM5 A;  3I5G C;  1CFF A;  1CDL A;  2H8V A;  2LMU A;  1WLM A;  1OOF A;  2BAP A;  5GQQ C;  5ER5 A;  1DF0 A; 
#chains in the Genus database with same CATH homology
 1BJF A;  2L2E A;  2AMI A;  1S6C A;  2LUC A;  2Q91 A;  2KYC A;  1WRL A;  4MBE A;  2KBI A;  1SW8 A;  4GGN A;  4PHK A;  3BUW B;  1CLB A;  1YUU A;  2LMT A;  2I2R E;  2BCA A;  4YGE B;  2BBN A;  2IS9 A;  4DIR A;  1LA3 A;  2K61 A;  5I8N A;  1XA5 A;  3EK8 A;  4D1E A;  1TCO B;  1K90 D;  2L98 A;  4OCI A;  1JUO A;  1NCZ A;  2P6B B;  2KBM A;  5FYX A;  1REC A;  4BY5 A;  3FWC A;  1ZFS A;  3TDZ A;  1UHH A;  2QAC A;  3LK0 A;  1XFX O;  1LVC D;  2M49 B;  1PUL A;  1LKJ A;  1N65 A;  3DVM A;  1MUX A;  1LA0 A;  3EVV A;  1AP4 A;  2KGB C;  1YR5 A;  2LCP A;  4R1E A;  4C0L A;  2BE6 A;  1XFY O;  2JXL A;  2MA2 A;  4MZK A;  2LHL A;  2Y5I A;  2LHI A;  1K9K A;  4M2O A;  2JNF A;  2H2K A;  1JSA A;  2MBX A;  1F4Q A;  2KNE A;  2CXJ A;  1QLK A;  3PN7 C;  1PAL A;  2I94 A;  1Y1X A;  1SL9 A;  3DD4 A;  2R2I A;  1A2X A;  2WCE A;  4ORB B;  4JQ0 D;  4N1G A;  4NDD A;  5AXI A;  1M31 A;  1DJX A;  1OOJ A;  1CFP A;  3FWB A;  1J7O A;  4C0J A;  1NSH A;  2G9B A;  5I2O A;  1LIN A;  2M7N A;  2F2O A;  2L0P A;  1DJZ A;  2LUX A;  1NX1 A;  4P2Y B;  2LAP A;  2O60 A;  4NDC A;  4YI9 A;  4MSP A;  4PE7 A;  1AHR A;  3CR5 X;  3CWG A;  1PVB A;  1L2O C;  1N2D A;  2KSP A;  2KFH A;  4MZJ A;  1K2H A;  3DVE A;  4FTG A;  3PSR A;  1Y1A A;  1AJ5 A;  2AAO A;  2L50 A;  2LVI A;  5AFP A;  4GUK A;  1QAS A;  4JPZ B;  1M46 A;  2WCF A;  2FOT A;  5ER4 X;  2KAX A;  4OV2 A;  1NX2 A;  2K8M B;  1A03 A;  1J7P A;  2KYF A;  1ODB A;  1F4O A;  1Q80 A;  1KCY A;  1MXE A;  3NXA A;  1TNQ A;  4GGF C;  2D8N A;  1QIV A;  3HCM A;  1XYD A;  1RRO A;  2AUC A;  2K7D A;  1Y0V H;  5KSZ A;  1CM4 A;  1OSA A;  1TNW A;  3GOF A;  2LVV A;  4GPL B;  1V1F A;  1H8B A;  3HX4 A;  2BBM A;  1DGV A;  1C07 A;  1BOD A;  3JVT B;  1DJW A;  4PE4 A;  1TOP A;  1B9A A;  3CTN A;  4Q04 A;  1IWQ A;  3ZNI A;  3EVU A;  1J7R A;  1SY9 A;  1NWD A;  4HRH A;  1OZS A;  5K89 A;  1WLZ A;  2NCO A;  1B8R A;  1FPW A;  1JWD A;  1MQ1 A;  4JWQ A;  1A4P A;  2M97 A;  4MRY A;  1C7W A;  5AEQ A;  2KGR A;  2CT9 A;  2HQ8 A;  1KFU S;  5HKW A;  2WND A;  3I5I C;  2LVK A;  2K7C A;  2JXC A;  4IL1 A;  5I2L A;  2PVB A;  1JF0 A;  1G4Y R;  3BXK A;  1DF0 B;  1M45 A;  1SK6 D;  1TCF A;  1J7Q A;  4ETO A;  3VGO A;  5JOL A;  1YTZ C;  3I5H C;  1KFX S;  1QLS A;  2F33 A;  2TN4 A;  4GAO A;  3KEV A;  5HLO A;  1IG5 A;  2PMY A;  5CSN A;  1WDC B;  1GQM A;  2ZND A;  3GK1 A;  3BUN B;  1NP8 A;  2EC6 C;  3VRR A;  1NYA A;  5D7F A;  2OS8 B;  1TTX A;  4PE1 A;  2KAY A;  1OQP A;  1IGV A;  1AK8 A;  1SCM B;  3BYA A;  4A4C A;  5DKR A;  2CCM A;  1OMR A;  2ZN8 A;  3EK4 A;  1NUB A;  4FQO A;  3GK2 A;  3K21 A;  4HSZ A;  4ICB A;  4U8D A;  5HYD A;  1NPQ A;  4PHM A;  4F0Z B;  3CR4 X;  4MVF A;  3SJS A;  3O78 A;  2M29 A;  5D69 A;  1J1E A;  3FIA A;  4ZCV A;  4MZL A;  3VRO A;  3C1V A;  4WQ3 A;  5PAL A;  2F3Z A;  1GJY A;  4YBH B;  1EG4 A;  1TNX A;  2HPS A;  4DRW A;  1N0Y A;  1UWO A;  1QV0 A;  2JT8 A;  2KHN A;  3I5F C;  3NSL A;  2M1K B;  1QXP A;  2ZRT A;  2I18 A;  3LCP C;  1GGZ A;  1CB1 A;  1QV1 A;  2EHB A;  3PLF B;  2LP3 A;  2LLT A;  1KWO B;  3WHU B;  5DKN A;  1YVH A;  2BCB A;  2BCX A;  2FCE A;  2KI4 B;  4XJK A;  1DGU A;  1ZUZ A;  1ALW A;  1KSM A;  3WHT B;  1YUT A;  4GFT A;  4DS7 A;  2NCP A;  1K95 A;  2KQY A;  1KK8 B;  1CLL A;  2BL0 C;  3BUM B;  4CPV A;  1CM1 A;  4YGC B;  1E8A A;  1OMV A;  3M0W A;  1JFJ A;  3I5I B;  2EGD A;  4GGF A;  1K94 A;  2F3Y A;  3IF7 A;  1QS7 A;  5CSJ A;  2OTG C;  3RLZ A;  3TDU A;  2JUL A;  3BUX B;  4P5O E;  1FI6 A;  3TDI A;  1S5G Y;  2HET A;  1GGW A;  3KHE A;  1J55 A;  2KOT A;  1D1O A;  2PAL A;  1AJ4 A;  1KFU L;  2M7L A;  3SIB A;  3DVK A;  2MHH A;  1CNP A;  2CTN A;  3SG6 A;  1K93 D;  1CDN A;  1EG3 A;  2BE4 A;  1UUS A;  1CLM A;  1SNL A;  1K8U A;  2F2P A;  3VRP A;  1IH0 A;  2M3W A;  4E68 A;  1IQ3 A;  1U5I A;  2COL B;  1CFD A;  1QX2 A;  2E30 A;  2MRD A;  3I5G B;  1AVS A;  5BPJ A;  1H4B A;  1WRZ A;  1KFX L;  3IQQ A;  4ORC B;  3TS5 C;  2PAS A;  2JQ6 A;  3AKA A;  3NSO A;  1S26 D;  3H4S E;  5J3X A;  2LP2 A;  2BKI B;  4GBA A;  1TN4 A;  4TNC A;  4DCK A;  1QJT A;  4CLN A;  1F8H A;  4ORA B;  1DJY A;  1YRU B;  3DF0 A;  4GNK B;  1F54 A;  2JU0 A;  4WQ2 A;  2BEC A;  3BUO B;  1XO5 A;  2JRF A;  1BOC A;  2ZNE A;  1M39 A;  1NX0 A;  4BY4 A;  2K0J A;  1UHN A;  4OKH A;  1NX3 A;  4I5K A;  2MLE C;  1BR4 B;  4WRI A;  1KK7 Y;  1XK4 C;  1B8C A;  1SL7 A;  1QVI Y;  1OZO A;  4PHJ A;  2SAS A;  1BLQ A;  4MEW A;  2JT0 A;  1ZOT B;  3OB1 B;  1XFZ O;  2PSR A;  1RK9 A;  1KSO A;  2NLN A;  1BG1 A;  1DJG A;  1F55 A;  1CDM A;  1S3P A;  2VRG A;  2WOR A;  3OB2 B;  2I7A A;  3QRX A;  3SG5 A;  3E3R A;  1EJ3 A;  1F71 A;  2K7O A;  4PHN A;  3PN7 B;  1KQV A;  1CKK A;  1PK0 D;  1IKU A;  1XFU O;  3O6B A;  3RM1 A;  1BMO A;  1C7V A;  1DJI A;  2DOQ A;  3D0Y A;  1WY9 A;  3OX5 A;  1CMF A;  1M63 B;  2K2F A;  2LV7 A;  4C0K A;  1FF1 A;  1S5G Z;  1B4C A;  3OHM B;  3JTD C;  2ZN9 A;  1SL8 A;  3LLE A;  1MF8 B;  4CID A;  4PDZ A;  2NZ0 A;  3AAK A;  2MAZ A;  3CS1 A;  1YUS A;  3SG4 A;  1R6P A;  1B8L A;  1SMG A;  1BF5 A;  2LMV A;  5HKY A;  2K2A A;  1MWN A;  3EK7 A;  1BR1 B;  3O2P A;  1L2O B;  1PVA A;  4XJK B;  3SIA A;  1FBV A;  4XYN A;  1MXL C;  4PE0 A;  5CPV A;  3VRQ A;  4N5X A;  2KAV A;  1DTL A;  2KDH A;  1Y6W A;  2JC2 A;  4YI8 A;  3WXA A;  4DUQ A;  1QAT A;  1ZMZ A;  4CFR A;  5KTY A;  1SCV A;  2LE9 B;  2Q4U A;  4CFQ A;  2KQ6 A;  1PSR A;  1WRK A;  1OMD A;  2LVJ A;  1A75 B;  1SPY A;  1YVL A;  1HQV A;  2LLS A;  1SR6 C;  2JT3 A;  4AOM A;  4L9M A;  1CMG A;  4M2Q A;  1DMO A;  2F8P A;  3ZWH A;  1J1D A;  1KQM C;  5TNC A;  1S1E A;  1TRF A;  3OX6 A;  2JZI A;  1K9P A;  3LK1 A;  1B1G A;  1KK7 Z;  2L51 A;  4M2P A;  1K96 A;  1QVI Z;  1BT6 A;  4YGB B;  5JJG A;  4QJ3 B;  4I5J A;  2WCB A;  4MN0 A;  1JFK A;  3SG7 A;  2M1U A;  5G08 A;  1L7Z A;  1K9U A;  2KFG A;  1U5I B;  1FW4 A;  1RJV A;  1F70 A;  1A75 A;  2KI6 C;  2LC5 A;  1HT9 A;  3F45 A;  1S6I A;  3PM8 A;  3TUY C;  1YUR A;  5AER A;  1TIZ A;  1YRT B;  3JVT C;  3I5H B;  5F6T A;  4QJ4 B;  2ZRS A;  2RGI A;  1MR8 A;  1XK4 A;  4HRE E;  2LLU A;  2JOJ A;  3DF0 B;  3OP0 A;  3JTD B;  4USL A;  1XVJ A;  3CLN A;  2EC6 B;  4OVN F;  1JC2 A;  4MRX A;  2H61 C;  1AUI B;  2KI6 D;  2HF5 A;  4AQI A;  4YGD B;  1G33 A;  3EKH A;  1QX7 A;  4MLW A;  1S6J A;  1UP5 A;  5HLV A;  5KU1 A;  1PSB A;  2V53 A;  3EVR A;  4OR9 B;  3PAL A;  4AQJ A;  1S36 A;  3ICB A;  1DVI A;  4NDB A;  1RFJ A;  2PRU A;  1SRA A;  1Y1U A;  1X02 A;  5CSF A;  1IJ5 A;  3GK4 X;  1CTR A;  3DVJ A;  3I5F B;  3TZ1 A;  3AAJ A;  1LXF C;  1WDC C;  1SR6 B;  3CZT X;  1G8I A;  1UHI A;  1ZAC A;  2M9G A;  1BU3 A;  2A4J A;  2OS8 C;  1B47 A;  4A4B A;  2LAN A;  2M8U A;  1KQM B;  1B7T Y;  4PAL A;  5I2Q A;  3D0Y B;  4I5N B;  2JNX A;  3A4U B;  1QIW A;  1RTP 1;  1SCM C;  2FCD A;  1TNP A;  1A29 A;  2BKH B;  4YRU A;  1JBA A;  1QX5 B;  5HKZ A;  2WOS A;  3KO0 A;  1IJ6 A;  2BL0 B;  2MLF C;  4YGA A;  1XFW O;  3D10 A;  2MJW B;  1SKT A;  1SBJ A;  3A8R A;  2L4H A;  1IRJ A;  2GGZ A;  3O4Y A;  1R2U A;  4UPG A;  1V1G A;  2L5X B;  1NCY A;  1SYM A;  2GGM A;  1NCX A;  4ZCU A;  2LNK A;  1EL4 A;  1OE9 B;  3CR2 A;  1DJH A;  5B8I B;  3VRN A;  2OTG B;  2CNP A;  2JTZ A;  3TUY B;  1NIW A;  3PAT A;  5CSI A;  4QJ5 B;  1QTX A;  1MHO A;  3EKJ A;  1KWO C;  5AAN A;  1RWY A;  2JWW A;  2L4I A;  3NSK A;  1IQ5 A;  4HRG A;  2KI4 C;  1EXR A;  3IQO A;  1EH2 A;  5IBW A;  2SCP A;  1UHJ A;  2CBL A;  1YX7 A;  3NSI A;  1KK8 C;  3MSE B;  2ZKM X;  1DT7 B;  2JTT A;  2O5G A;  2ZFD A;  1VRK A;  2GV5 A;  1UHK A;  3BOW B;  3PFV A;  1PRW A;  3WNX B;  2B1U A;  2KFF A;  2G2B A;  2HQW A;  1CDP A;  1W7I B;  3TS5 B;  3SG2 A;  2NXQ A;  3LL8 B;  2JPT A;  3CGA A;  1CFC A;  2M0R A;  1YX8 A;  4I5L B;  1W7J B;  3FS7 A;  2Y4Q A;  2ISD A;  3SG3 A;  2Y1N A;  3KF9 A;  2Y1M A;  5DKQ A;  2OPO A;  1UUR A;  2FJU B;  3KPX A;  2H61 A;  2K7B A;  4N1F A;  2WC8 A;  1FI5 A;  2E6W A;  3BOW A;  4NQG A;  1ALV A;  2QPT A;  3AKB A;  4PCW A;  1JF2 A;  1B7T Z;  1XFV O;  3BQ3 A;  2LM5 A;  3I5G C;  1CFF A;  1CDL A;  2LMU A;  1WLM A;  5GQQ C;  5ER5 A;  1DF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...