1NSHA

Solution structure of rabbit apo-s100a11 (19 models)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
b'SRPTETERCIESLIAVFQKYAGKDGHSVTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNSDGQLDFQEFLNLIGGLAVACHESFVKAAPPQKRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calgizzarin
molecule tags Metal binding protein
source organism Oryctolagus cuniculus
publication title Unmasking the Annexin I Interaction from the structure of apo-S100A11
pubmed doi rcsb
total genus 18
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nshA00
3IQOA 3KHEA 1G8IA 1K8UA 3SG7A 3I5GC 1BR1B 2A4JA 3OB1B 3CWGA 5AEQA 2JWWA 1A4PA 1SBJA 1CMGA 2I94A 3CR5X 5DKRA 5HKZA 2M7LA 1W7IB 1MR8A 1GGZA 3BUNB 4BY5A 5D69A 1UHJA 2BKHB 1JBAA 4MEWA 2MLEC 1NCXA 3CS1A 2LLSA 3WXAA 1Y0VH 2COLB 1GQMA 1HT9A 1WDCC 2KDHA 1PRWA 4PDZA 1CLMA 2KI6D 1DTLA 1OZSA 2JOJA 2NCOA 2LVKA 4DUQA 4PCWA 2Y1NA 3NSLA 4P5OE 3BUMB 2F8PA 1DJYA 1LXFC 2Y5IA 1TIZA 1BT6A 2QPTA 3GK2A 2PRUA 2MHHA 1LINA 4MRYA 1BR4B 4IL1A 2BE4A 5JJGA 1Y6WA 1ZUZA 1ZFSA 3D0YB 2F2PA 1OMVA 2OTGB 4OKHA 2KI4B 2JT3A 3HCMA 3VRQA 1QS7A 1PALA 2HQWA 1CDNA 5TNCA 3BUWB 4E68A 1ZMZA 1OZOA 1B1GA 4PE4A 1U5IB 1NCZA 1GGWA 4C0KA 1M45A 3MSEB 2E30A 1EG4A 3DD4A 3I5HC 1XFWO 1BU3A 2PMYA 3I5IB 2ZN8A 2M9GA 5K89A 4MZKA 2MBXA 1CNPA 1OOJA 3D0YA 3AAKA 1BG1A 2GV5A 1TRFA 3NXAA 3TDUA 1AHRA 1YUUA 2L4IA 4N1FA 2JTZA 3O6BA 2KI6C 2K7CA 1MXLC 1PSRA 4QJ4B 3M0WA 2KYCA 2BCAA 2SCPA 3CLNA 1A75A 4XJKB 2JPTA 3RM1A 1CDLA 2MLFC 3NSKA 2KSPA 5DKQA 4PE1A 5JOLA 1L7ZA 3LK1A 1XK4A 1KK7Y 1FI5A 2LV7A 3TDZA 1DF0B 5KSZA 3FS7A 1JF2A 2EC6B 3EKHA 1MQ1A 2KGRA 1NUBA 2JC2A 1XFVO 1MHOA 1XYDA 2KNEA 3CR4X 1F71A 1S6JA 2ISDA 2OTGC 3DVMA 3AAJA 2KI4C 1YTZC 3TUYB 2LP3A 5KTYA 2M0RA 2I18A 4DS7A 1DJZA 3LLEA 1QLSA 2WOSA 1A03A 1B7TZ 2K8MB 1OE9B 1C7WA 2LVJA 2L4HA 1SMGA 4OV2A 4YI8A 1Y1UA 1H8BA 1NX0A 5DKNA 1B4CA 1YUSA 3AKBA 4NDBA 3EK7A 4N5XA 5D7FA 2LNKA 2PSRA 1ALWA 3CTNA 4FQOA 3SJSA 1OMDA 1QX7A 2LUXA 3PLFB 1FBVA 2CXJA 3KO0A 5HLVA 1NYAA 4YGBB 2TN4A 1XVJA 1GJYA 2K0JA 5F6TA 2O60A 3C1VA 3DVEA 4DCKA 1CFFA 1RECA 2NCPA 1DGUA 2K7OA 1K9PA 1SK6D 1SRAA 1AJ4A 4MBEA 1JFKA 2JULA 3SG6A 3O4YA 1EH2A 1RTP1 5HKWA 1CFCA 3SG2A 1QATA 2NXQA 1UHHA 2P6BB 1S6IA 2CBLA 5KU1A 1JSAA 4QJ3B 4AQIA 1SL9A 1XA5A 1KQMC 4NDCA 2BL0C 2M1KB 3A8RA 2M49B 4QJ5B 1KK8C 3LK0A 3VRPA 5I8NA 2K2AA 1SYMA 4YRUA 1K2HA 2LHIA 3TUYC 1YRTB 1F55A 2FJUB 2BBNA 2BCXA 2K7BA 1IJ5A 2JNXA 1KFUS 3OP0A 1TOPA 3WHUB 1CFPA 2B1UA 4M2OA 3EVUA 3H4SE 1B8CA 3WHTB 1B8LA 2KQ6A 3DVKA 1ZACA 2E6WA 2LANA 4GGFC 2L51A 4M2QA 2FCEA 1TNQA 2M8UA 1RROA 3ICBA 1QIWA 1RWYA 1EJ3A 1Y1AA 1MF8B 4I5NB 2L98A 1J7RA 2L50A 1QX5B 1DJHA 1J55A 4MZJA 5AANA 1CB1A 2VRGA 1AJ5A 4I5LB 4C0LA 1F54A 1EXRA 1OSAA 1SCMB 2CCMA 2KAXA 3RLZA 1UP5A 2JQ6A 4CLNA 2LP2A 2LCPA 1IWQA 3FIAA 1DGVA 1D1OA 3BOWB 2KHNA 2JRFA 3DF0A 1V1GA 4OVNF 3KEVA 1KK8B 3TS5C 1S5GZ 2HETA 1WRKA 4DIRA 4UPGA 2L5XB 1RFJA 3I5FB 2BE6A 2O5GA 1N0YA 1B9AA 1E8AA 3BUOB 1LKJA 1Y1XA 3SG4A 4BY4A 1BF5A 1MXEA 1IH0A 3IF7A 4AQJA 4PE0A 3OX6A 1K96A 1TCFA 1IKUA 3HX4A 2ZRSA 5B8IB 1AK8A 1CKKA 1Q80A 2SASA 2KBIA 5CSNA 2KFFA 4CFQA 1F70A 1K95A 1KSMA 2MRDA 2K61A 2M1UA 2OPOA 3FWCA 1M39A 3WNXB 1IQ3A 1AP4A 1FW4A 1SR6B 3BQ3A 5FYXA 4HRGA 1XFUO 1YX8A 2MA2A 1V1FA 4YI9A 4Q04A 1W7JB 3VGOA 1TNXA 4GBAA 2NZ0A 2LE9B 2ZN9A 2IS9A 3PN7C 1SCVA 3EVVA 1KWOC 4ORBB 3OX5A 2G9BA 1ALVA 1CM1A 1WY9A 2Q91A 4PHJA 2BBMA 4CPVA 1K94A 1K9KA 4PHMA 3VRRA 1C07A 1NX2A 1LVCD 2I7AA 1XFXO 2BECA 1QVIY 2WCFA 3BXKA 4TNCA 5CSJA 3KF9A 2MJWB 1WLMA 2WCEA 1JFJA 2AAOA 2L0PA 2JNFA 3FWBA 4ICBA 1A2XA 4XYNA 1DJXA 1KFXL 4ORCB 2KAVA 5AXIA 2EHBA 3O78A 1JWDA 1CTRA 3CGAA 2LMTA 1XFZO 1B8RA 1L2OB 2CT9A 1N2DA 1NIWA 4CIDA 2WCBA 4GAOA 1H4BA 1S1EA 3EK8A 1S26D 2G2BA 3EK4A 3ZWHA 4HREE 4ZCUA 2ZKMX 1F4OA 1KSOA 2JXCA 4P2YB 5ER4X 4PHNA 2GGMA 2JT0A 1DVIA 3VROA 4U8DA 1ODBA 2PVBA 1JUOA 1BODA 4R1EA 1J7QA 2F2OA 4MLWA 1LA0A 5AFPA 1SR6C 2LVIA 1EG3A 1G33A 1PULA 3SIAA 1EL4A 1ZOTB 2L2EA 2PASA 2R2IA 1MUXA 4HSZA 2LAPA 1CDMA 2Y1MA 5I2OA 2H61C 4WRIA 3ZNIA 2KFGA 2MAZA 3GK1A 3PN7B 4FTGA 4NDDA 5HKYA 3I5IC 1NWDA 2LC5A 2LLUA 3I5HB 2LM5A 1DT7B 1CM4A 1FF1A 2PALA 3LL8B 1SPYA 5GQQC 3E3RA 4JPZB 4DRWA 1HQVA 2OS8B 3JVTC 4GUKA 1RK9A 1SW8A 4ETOA 2WNDA 3CZTX 3BUXB 1U5IA 3QRXA 1B7TY 1PK0D 1UHKA 2K2FA 3TDIA 4F0ZB 1QTXA 2H61A 1IG5A 3KPXA 1PVAA 1L2OC 4JWQA 1K9UA 2ZRTA 2BKIB 2D8NA 2EC6C 1LA3A 4YBHB 1N65A 1TTXA 4N1GA 5J3XA 1K93D 4GGNA 2KYFA 4M2PA 4PHKA 1YVHA 4I5KA 3TZ1A 2QACA 1WRLA 4WQ2A 1NX1A 4MN0A 1S3PA 4NQGA 1J1DA 1DF0A 4YGDB 2F3YA 2HPSA 2JU0A 3JTDB 1PVBA 1R2UA 2LMUA 2DOQA 2EGDA 4MRXA 2Q4UA 5CSIA 4YGAA 2LMVA 1DJGA 3D10A 1R6PA 1QASA 1XO5A 3PALA 3PSRA 1C7VA 1XK4C 2F33A 1CMFA 2F3ZA 4GNKB 1AUIB 3OB2B 1X02A 4MZLA 1KFUL 1A29A 1NSHA 1KK7Z 1IQ5A 4HRHA 1G4YR 3PM8A 4GPLB 1BOCA 2M97A 2ZFDA 1J7OA 2JZIA 1OMRA 2KGBC 1B47A 3BOWA 2ZNDA 4AOMA 2RGIA 4JQ0D 5I2LA 4PE7A 1UURA 2KBMA 2K7DA 2JTTA 1QXPA 3A4UB 3PATA 1F4QA 2CTNA 2V53A 2OS8C 2BCBA 3JVTB 5CSFA 4PALA 4YGCB 1KCYA 1TNPA 1VRKA 2NLNA 1NP8A 5HLOA 1MWNA 1SY9A 3F45A 5PALA 3SG3A 1UUSA 1DJIA 2JT8A 3LCPC 2GGZA 4GFTA 1KQVA 3SG5A 1TNWA 1YRUB 4MVFA 1S36A 1UHNA 4OCIA 4A4CA 5IBWA 2BL0B 4ZCVA 2KFHA 1S5GY 2H2KA 1KQMB 3K21A 4MSPA 1M46A 4C0JA 1J7PA 3JTDC 2HF5A 2AUCA 1JF0A 1AVSA 4OR9B 5HYDA 3DVJA 1FI6A 1QV1A 1NCYA 1QX2A 4A4BA 1DMOA 3AKAA 1OQPA 3GOFA 2LHLA 1WLZA 1XFYO 1TCOB 4USLA 1UWOA 1IJ6A 2FOTA 1DJWA 1QJTA 1SL7A 1BLQA 2M7NA 1SKTA 2M3WA 1YVLA 2I2RE 1S6CA 2ZNEA 2KQYA 4WQ3A 4L9MA 1YUTA 3SIBA 2LLTA 1IRJA 2HQ8A 1PSBA 2WC8A 3I5GB 1SCMC 2JXLA 3O2PA 5G08A 1FPWA 4GGFA 4I5JA 2LUCA 5I2QA 1BMOA 1RJVA 4D1EA 3NSOA 1SNLA 3IQQA 1WDCB 2KOTA 3I5FC 1K90D 1NPQA 1YR5A 1CLLA 3TS5B 1KFXS 3CR2A 3GK4X 5AERA 1NX3A 1TN4A 5BPJA 1JC2A 3DF0B 2AMIA 2KAYA 1QIVA 3EKJA 3EVRA 2WORA 2CNPA 3NSIA 1CLBA 1M31A 1F8HA 1SL8A 2M29A 1CDPA 1QVIZ 3BYAA 1WRZA 3VRNA 4CFRA 2LVVA 5ER5A 5CPVA 1YX7A 1IGVA 1QV0A 1J1EA 3PFVA 3OHMB 4YGEB 2Y4QA 1M63B 4ORAB 1A75B 2FCDA 4XJKA 1BJFA 1UHIA 1CFDA 1YURA 1KWOB 1QLKA
chains in the Genus database with same CATH superfamily
3IQOA 3KHEA 1G8IA 1K8UA 3SG7A 3I5GC 1BR1B 2A4JA 3OB1B 3CWGA 5AEQA 2JWWA 1A4PA 1SBJA 1CMGA 2I94A 3CR5X 5DKRA 5HKZA 2M7LA 3PJIA 1W7IB 1MR8A 1GGZA 3CABA 3BUNB 4BY5A 5D69A 1UHJA 2BKHB 1JBAA 4MEWA 2MLEC 2WC6A 1NCXA 3CS1A 2LLSA 3WXAA 1Y0VH 3CZ2A 2COLB 1GQMA 1HT9A 1WDCC 2KDHA 1PRWA 4PDZA 1CLMA 2KI6D 1DTLA 1OZSA 2JOJA 2NCOA 2LVKA 4DUQA 3S0AA 2QEBA 4PCWA 2Y1NA 3DYEA 3NSLA 4P5OE 3BUMB 2F8PA 1DJYA 1LXFC 2Y5IA 1TIZA 1BT6A 2QPTA 3D76A 2PRUA 3GK2A 2MHHA 1LINA 4MRYA 1BR4B 4IL1A 2BE4A 1OOFA 5JJGA 1Y6WA 1ZUZA 1ZFSA 3D0YB 2F2PA 3S0GA 1OMVA 2OTGB 3R72A 4OKHA 2KI4B 2JT3A 3HCMA 3VRQA 1QS7A 1PALA 2HQWA 1QWVA 1CDNA 5TNCA 3BUWB 3PM2A 3CZ1A 4KYNA 4E68A 1ZMZA 1OZOA 1B1GA 1OOHA 4PE4A 1U5IB 3BFAA 1NCZA 1GGWA 4C0KA 1M45A 3MSEB 2E30A 1EG4A 3DD4A 3I5HC 1XFWO 1BU3A 3BFHA 2PMYA 3I5IB 2ZN8A 2M9GA 5K89A 4MZKA 2MBXA 1CNPA 2QEVA 1OOJA 2KLEA 2WCHA 3D0YA 3AAKA 3SS5A 1BG1A 2GV5A 1TRFA 3NXAA 3TDUA 1AHRA 1DEKA 1YUUA 2L4IA 4N1FA 2JTZA 3O6BA 2KI6C 2K7CA 1MXLC 1PSRA 4QJ4B 3M0WA 2KYCA 2BCAA 2SCPA 3CLNA 1A75A 4XJKB 3S0BA 2JPTA 3RM1A 1CDLA 2MLFC 4INXA 3NSKA 2KSPA 5DKQA 4PE1A 5FI2A 5JOLA 1L7ZA 3LK1A 1XK4A 1KK7Y 1FI5A 2LV7A 3TDZA 1DF0B 3R1PA 5KSZA 2GTEA 3FS7A 1JF2A 2EC6B 3EKHA 1MQ1A 2KGRA 2K60A 1IIOA 1NUBA 2JC2A 3D78A 3L4LA 1XFVO 1MHOA 1XYDA 2KNEA 3CDNA 3CR4X 5FI6A 1F71A 1S6JA 2ISDA 2OTGC 3DVMA 3AAJA 2KI4C 1YTZC 3TUYB 2LP3A 3SS4A 5KTYA 2M0RA 2I18A 4DS7A 1DJZA 3EG5B 3LLEA 1QLSA 2WOSA 1A03A 1B7TZ 2K8MB 1OE9B 1C7WA 2LVJA 2L4HA 1SMGA 2WC5A 4OV2A 3SS3A 4YI8A 1W9ZA 1Y1UA 1H8BA 1NX0A 5DKNA 1B4CA 1YUSA 3AKBA 4NDBA 3EK7A 4N5XA 5D7FA 2LNKA 2PSRA 5HL1A 1ALWA 3CTNA 4FQOA 3SJSA 1OMDA 1QX7A 2LUXA 3PLFB 1FBVA 5D3OA 2CXJA 3KO0A 5HLVA 1NYAA 3V2LA 4YGBB 2TN4A 1XVJA 1GJYA 2K0JA 5FI7A 5F6TA 4F7FA 2O60A 3C1VA 3DVEA 2QDIA 4DCKA 1CFFA 1RECA 2NCPA 1DGUA 2K7OA 1K9PA 1SK6D 1SRAA 1AJ4A 4MBEA 1JFKA 2JULA 3SG6A 3O4YA 1EH2A 3OBVA 1RTP1 5HKWA 3CYZA 1CFCA 3SG2A 1QATA 2NXQA 1UHHA 2P6BB 1S6IA 2CBLA 5KU1A 1JSAA 4QJ3B 4AQIA 1SL9A 1XA5A 1KQMC 4NDCA 2BL0C 2M1KB 3A8RA 2M49B 4QJ5B 1KK8C 3LK0A 3VRPA 5I8NA 2K2AA 1SYMA 3IVTA 4YRUA 1K2HA 1C3YA 3NHIA 3D75A 2LHIA 3TUYC 1YRTB 1F55A 2FJUB 3DY9A 2BBNA 2BCXA 2K7BA 1IJ5A 2JNXA 1KFUS 3OP0A 1TOPA 3BFBA 3WHUB 1CFPA 1XFRA 2B1UA 4M2OA 3EVUA 3H4SE 1B8CA 3WHTB 1B8LA 2KQ6A 3DVKA 1ZACA 2E6WA 2LANA 4GGFC 2L51A 3D74A 2FCEA 4M2QA 1TNQA 2M8UA 1RROA 3ICBA 1QIWA 1RWYA 2ERBA 1EJ3A 3S0DA 1Y1AA 1MF8B 4I5NB 2L98A 1J7RA 1LS8A 2KLDA 2L50A 1QX5B 2WCMA 1DJHA 1J55A 4MZJA 3NGVA 5AANA 1CB1A 2VRGA 1AJ5A 4I5LB 4C0LA 1ORGA 2JPOA 1F54A 1EXRA 1OSAA 1SCMB 2WCJA 3VB1A 2CCMA 2KAXA 3RLZA 1UP5A 2JQ6A 4CLNA 2LP2A 3B88A 2LCPA 1IWQA 3FIAA 1DGVA 1D1OA 3BOWB 4JD9A 2KHNA 2JRFA 3DF0A 1V1GA 3FE6A 4OVNF 3KEVA 1KK8B 3TS5C 2L2CA 1S5GZ 1WRKA 2HETA 4DIRA 4UPGA 2L5XB 1RFJA 3I5FB 3QMEA 2BE6A 2O5GA 1N0YA 3DXLA 1B9AA 1E8AA 3BUOB 1LKJA 1Y1XA 5CSFA 3SG4A 4BY4A 1MXEA 1BF5A 1IH0A 3IF7A 4AQJA 4PE0A 3OX6A 1K96A 1TCFA 1IKUA 3HX4A 2ZRSA 5B8IB 1AK8A 1CKKA 1Q80A 2SASA 2KBIA 5CSNA 2KFFA 4CFQA 1F70A 1K95A 1KSMA 2MRDA 2K61A 2M1UA 2OPOA 3B86A 2BNXA 1M39A 3FWCA 3WNXB 3L47A 1IQ3A 1AP4A 1FW4A 1SR6B 3BQ3A 5FYXA 4HRGA 5DICA 1XFUO 1YX8A 1OW4A 2QEHA 2MA2A 1V1FA 4YI9A 4Q04A 4FQTA 1W7JB 3VGOA 1TNXA 4GBAA 2NZ0A 2LE9B 2ZN9A 2IS9A 3PN7C 1SCVA 3EVVA 1KWOC 4ORBB 3OX5A 2G9BA 1ALVA 3DZTA 1CM1A 1WY9A 2Q91A 4PHJA 2BBMA 4CPVA 1K94A 1K9KA 4PHMA 3VRRA 1TUJA 1NX2A 1C07A 2FJYA 4JKTA 2KPHA 2P70A 3S0FA 1LVCD 2I7AA 1XFXO 2BECA 1QVIY 2WCFA 3BXKA 4TNCA 5CSJA 3KF9A 1TWOA 1WLMA 2MJWB 2WCEA 1JFJA 2AAOA 2L0PA 2JNFA 3B7AA 3FWBA 4ICBA 1A2XA 4XYNA 1DJXA 1KFXL 4ORCB 2KAVA 5AXIA 2EHBA 3O78A 1JWDA 1CTRA 3CGAA 2LMTA 1XFZO 1B8RA 3UO9A 1L2OB 2CT9A 1N2DA 1NIWA 4CIDA 2WCBA 4GAOA 4INWA 1H4BA 2YGUA 1S1EA 3EK8A 1S26D 2H8VA 2G2BA 3EK4A 3ZWHA 4HREE 4ZCUA 2ZKMX 1F4OA 1KSOA 2JXCA 4P2YB 5ER4X 4PHNA 2GGMA 2JT0A 1DVIA 3VROA 4U8DA 1ODBA 2PVBA 1JUOA 1BODA 4R1EA 1J7QA 2F2OA 4MLWA 1P28A 3K1EA 1LA0A 5AFPA 1SR6C 2LVIA 1EG3A 1G33A 1PULA 3SIAA 1EL4A 1ZOTB 2L2EA 2PASA 2R2IA 1MUXA 4HSZA 2LAPA 1CDMA 2Y1MA 5I2OA 2H61C 4WRIA 3ZNIA 2KFGA 2MAZA 3GK1A 3PN7B 4FTGA 4NDDA 5HKYA 3I5IC 1NWDA 2LC5A 2LLUA 3I5HB 2LM5A 1DT7B 1CM4A 1FF1A 2PALA 3LL8B 1SPYA 1DC1A 5GQQC 3E3RA 4JPZB 4DRWA 1HQVA 2OS8B 3JVTC 4GUKA 1RK9A 1SW8A 4ETOA 3CZ0A 3R1VA 2WNDA 3CZTX 3BUXB 1U5IA 3QRXA 1B7TY 1PK0D 1UHKA 2K2FA 3TDIA 4F0ZB 1QTXA 2H61A 3N7HA 1IG5A 3KPXA 1PVAA 1L2OC 4JWQA 1K9UA 2ZRTA 2BKIB 2D8NA 2EC6C 1LA3A 4YBHB 1N65A 1TTXA 4N1GA 5J3XA 1K93D 4GGNA 2KYFA 4M2PA 4PHKA 1YVHA 4I5KA 3TZ1A 2QACA 1WRLA 4WQ2A 1NX1A 4MN0A 1S3PA 4NQGA 1J1DA 1DF0A 3UNWA 4YGDB 2F3YA 2HPSA 2JU0A 3JTDB 1PVBA 1R2UA 2LMUA 2DOQA 2EGDA 4MRXA 2Q4UA 2WCKA 5CSIA 4YGAA 2LMVA 1DJGA 3D10A 1R6PA 1QASA 1XO5A 3PALA 3PSRA 1C7VA 1XK4C 2F33A 1CMFA 2F3ZA 4GNKB 1AUIB 2L5YA 3OB2B 1X02A 4MZLA 1KFUL 1A29A 1NSHA 1KK7Z 1IQ5A 4HRHA 1G4YR 3PM8A 4GPLB 1BOCA 2M97A 2ZFDA 3B6XA 1J7OA 2JZIA 1OMRA 2KGBC 3B87A 1B47A 3BOWA 2ZNDA 4AOMA 2RGIA 4JQ0D 5I2LA 4PE7A 1UURA 1Z2CB 2KBMA 2K7DA 2JTTA 1QXPA 3A4UB 3PATA 1F4QA 2CTNA 2V53A 2OS8C 2BCBA 3JVTB 3L4AA 4PALA 4YGCB 1KCYA 1TNPA 1VRKA 2NLNA 3D73A 1NP8A 5HLOA 1MWNA 3R1OA 1SY9A 3F45A 5PALA 3SG3A 1UUSA 1DJIA 2JT8A 3LCPC 2GGZA 4GFTA 1KQVA 3SG5A 1TNWA 1YRUB 4MVFA 2BAPA 1S36A 1UHNA 4IJ7A 4OCIA 4A4CA 5IBWA 2BL0B 4ZCVA 1GM0A 2KFHA 1S5GY 2H2KA 3RZSA 1KQMB 3K21A 4MSPA 2PQLA 1M46A 1OOIX 4C0JA 1J7PA 3JTDC 2HF5A 2AUCA 1JF0A 1AVSA 3S0EA 4OR9B 5HYDA 3DVJA 1FI6A 1QV1A 1NCYA 1QX2A 3Q8IA 4A4BA 1DMOA 3AKAA 1OQPA 3GOFA 2LHLA 1WLZA 1XFYO 1TCOB 4USLA 1UWOA 1IJ6A 2FOTA 1DJWA 1QJTA 1SL7A 1BLQA 2M7NA 1SKTA 2M3WA 1YVLA 2I2RE 1S6CA 2ZNEA 2KQYA 4WQ3A 1TUZA 4L9MA 1YUTA 3SIBA 2LLTA 1IRJA 2PYQA 3O4XA 2HQ8A 1PSBA 2WC8A 2QEOA 1DQEA 3I5GB 1Z4HA 1OOGA 1SCMC 2JXLA 3O2PA 5G08A 1C3ZA 1FPWA 4GGFA 4I5JA 3FE9A 2LUCA 4PT1A 2P71A 5I2QA 1BMOA 1RJVA 4D1EA 3NSOA 1SNLA 3IQQA 1WDCB 2KOTA 3I5FC 1K90D 1NPQA 1YR5A 1CLLA 4OZDA 1SSEB 2WCLA 3TS5B 1KFXS 3OGNA 5I94A 3CR2A 3GK4X 5AERA 1NX3A 1TN4A 5BPJA 1JC2A 3DF0B 3NHTA 1T14A 2AMIA 2KAYA 1QIVA 3EKJA 3EVRA 2WORA 2CNPA 3NSIA 1CLBA 1M31A 1F8HA 1SL8A 2M29A 1CDPA 1QVIZ 3BYAA 1WRZA 3D77A 3BJHA 5EL2A 3VRNA 4CFRA 1DELA 2LVVA 5ER5A 5CPVA 1YX7A 1IGVA 1QV0A 1J1EA 3PFVA 3OHMB 4YGEB 2Y4QA 1M63B 4ORAB 1A75B 2FCDA 4XJKA 1BJFA 3FE8A 1UHIA 1CFDA 1YURA 1KWOB 1QLKA
chains in the Genus database with same CATH topology
3IQOA 3KHEA 1G8IA 1K8UA 3SG7A 3I5GC 1BR1B 2A4JA 3OB1B 3CWGA 5AEQA 2JWWA 1A4PA 1SBJA 1CMGA 2I94A 3CR5X 5DKRA 5HKZA 2M7LA 1W7IB 1MR8A 1GGZA 3BUNB 4BY5A 5D69A 1UHJA 2BKHB 1JBAA 4MEWA 2MLEC 1NCXA 3CS1A 2LLSA 3WXAA 1Y0VH 2COLB 1GQMA 1HT9A 1WDCC 2KDHA 1PRWA 4PDZA 1CLMA 2KI6D 1DTLA 1OZSA 2JOJA 2NCOA 2LVKA 4DUQA 4PCWA 2Y1NA 3NSLA 4P5OE 3BUMB 2F8PA 1DJYA 1LXFC 2Y5IA 1TIZA 1BT6A 2QPTA 3GK2A 2PRUA 2MHHA 1LINA 4MRYA 1BR4B 4IL1A 2BE4A 5JJGA 1Y6WA 1ZUZA 1ZFSA 3D0YB 2F2PA 1OMVA 2OTGB 4OKHA 2KI4B 2JT3A 3HCMA 3VRQA 1QS7A 1PALA 2HQWA 1CDNA 5TNCA 3BUWB 4E68A 1ZMZA 1OZOA 1B1GA 4PE4A 1U5IB 1NCZA 1GGWA 4C0KA 1M45A 3MSEB 2E30A 1EG4A 3DD4A 3I5HC 1XFWO 1BU3A 2PMYA 3I5IB 2ZN8A 2M9GA 5K89A 4MZKA 2MBXA 1CNPA 1OOJA 3D0YA 3AAKA 1BG1A 2GV5A 1TRFA 3NXAA 3TDUA 1AHRA 1YUUA 2L4IA 4N1FA 2JTZA 3O6BA 2KI6C 2K7CA 1MXLC 1PSRA 4QJ4B 3M0WA 2KYCA 2BCAA 2SCPA 3CLNA 1A75A 4XJKB 2JPTA 3RM1A 1CDLA 2MLFC 3NSKA 2KSPA 5DKQA 4PE1A 5JOLA 1L7ZA 3LK1A 1XK4A 1KK7Y 1FI5A 2LV7A 3TDZA 1DF0B 5KSZA 3FS7A 1JF2A 2EC6B 3EKHA 1MQ1A 2KGRA 1NUBA 2JC2A 1XFVO 1MHOA 1XYDA 2KNEA 3CR4X 1F71A 1S6JA 2ISDA 2OTGC 3DVMA 3AAJA 2KI4C 1YTZC 3TUYB 2LP3A 5KTYA 2M0RA 2I18A 4DS7A 1DJZA 3LLEA 1QLSA 2WOSA 1A03A 1B7TZ 2K8MB 1OE9B 1C7WA 2LVJA 2L4HA 1SMGA 4OV2A 4YI8A 1Y1UA 1H8BA 1NX0A 5DKNA 1B4CA 1YUSA 3AKBA 4NDBA 3EK7A 4N5XA 5D7FA 2LNKA 2PSRA 1ALWA 3CTNA 4FQOA 3SJSA 1OMDA 1QX7A 2LUXA 3PLFB 1FBVA 2CXJA 3KO0A 5HLVA 1NYAA 4YGBB 2TN4A 1XVJA 1GJYA 2K0JA 5F6TA 2O60A 3C1VA 3DVEA 4DCKA 1CFFA 1RECA 2NCPA 1DGUA 2K7OA 1K9PA 1SK6D 1SRAA 1AJ4A 4MBEA 1JFKA 2JULA 3SG6A 3O4YA 1EH2A 1RTP1 5HKWA 1CFCA 3SG2A 1QATA 2NXQA 1UHHA 2P6BB 1S6IA 2CBLA 5KU1A 1JSAA 4QJ3B 4AQIA 1SL9A 1XA5A 1KQMC 4NDCA 2BL0C 2M1KB 3A8RA 2M49B 4QJ5B 1KK8C 3LK0A 3VRPA 5I8NA 2K2AA 1SYMA 4YRUA 1K2HA 2LHIA 3TUYC 1YRTB 1F55A 2FJUB 2BBNA 2BCXA 2K7BA 1IJ5A 2JNXA 1KFUS 3OP0A 1TOPA 3WHUB 1CFPA 2B1UA 4M2OA 3EVUA 3H4SE 1B8CA 3WHTB 1B8LA 2KQ6A 3DVKA 1ZACA 2E6WA 2LANA 4GGFC 2L51A 4M2QA 2FCEA 1TNQA 2M8UA 1RROA 3ICBA 1QIWA 1RWYA 1EJ3A 1Y1AA 1MF8B 4I5NB 2L98A 1J7RA 2L50A 1QX5B 1DJHA 1J55A 4MZJA 5AANA 1CB1A 2VRGA 1AJ5A 4I5LB 4C0LA 1F54A 1EXRA 1OSAA 1SCMB 2CCMA 2KAXA 3RLZA 1UP5A 2JQ6A 4CLNA 2LP2A 2LCPA 1IWQA 3FIAA 1DGVA 1D1OA 3BOWB 2KHNA 2JRFA 3DF0A 1V1GA 4OVNF 3KEVA 1KK8B 3TS5C 1S5GZ 2HETA 1WRKA 4DIRA 4UPGA 2L5XB 1RFJA 3I5FB 2BE6A 2O5GA 1N0YA 1B9AA 1E8AA 3BUOB 1LKJA 1Y1XA 3SG4A 4BY4A 1BF5A 1MXEA 1IH0A 3IF7A 4AQJA 4PE0A 3OX6A 1K96A 1TCFA 1IKUA 3HX4A 2ZRSA 5B8IB 1AK8A 1CKKA 1Q80A 2SASA 2KBIA 5CSNA 2KFFA 4CFQA 1F70A 1K95A 1KSMA 2MRDA 2K61A 2M1UA 2OPOA 3FWCA 1M39A 3WNXB 1IQ3A 1AP4A 1FW4A 1SR6B 3BQ3A 5FYXA 4HRGA 1XFUO 1YX8A 2MA2A 1V1FA 4YI9A 4Q04A 1W7JB 3VGOA 1TNXA 4GBAA 2NZ0A 2LE9B 2ZN9A 2IS9A 3PN7C 1SCVA 3EVVA 1KWOC 4ORBB 3OX5A 2G9BA 1ALVA 1CM1A 1WY9A 2Q91A 4PHJA 2BBMA 4CPVA 1K94A 1K9KA 4PHMA 3VRRA 1C07A 1NX2A 1LVCD 2I7AA 1XFXO 2BECA 1QVIY 2WCFA 3BXKA 4TNCA 5CSJA 3KF9A 2MJWB 1WLMA 2WCEA 1JFJA 2AAOA 2L0PA 2JNFA 3FWBA 4ICBA 1A2XA 4XYNA 1DJXA 1KFXL 4ORCB 2KAVA 5AXIA 2EHBA 3O78A 1JWDA 1CTRA 3CGAA 2LMTA 1XFZO 1B8RA 1L2OB 2CT9A 1N2DA 1NIWA 4CIDA 2WCBA 4GAOA 1H4BA 1S1EA 3EK8A 1S26D 2G2BA 3EK4A 3ZWHA 4HREE 4ZCUA 2ZKMX 1F4OA 1KSOA 2JXCA 4P2YB 5ER4X 4PHNA 2GGMA 2JT0A 1DVIA 3VROA 4U8DA 1ODBA 2PVBA 1JUOA 1BODA 4R1EA 1J7QA 2F2OA 4MLWA 1LA0A 5AFPA 1SR6C 2LVIA 1EG3A 1G33A 1PULA 3SIAA 1EL4A 1ZOTB 2L2EA 2PASA 2R2IA 1MUXA 4HSZA 2LAPA 1CDMA 2Y1MA 5I2OA 2H61C 4WRIA 3ZNIA 2KFGA 2MAZA 3GK1A 3PN7B 4FTGA 4NDDA 5HKYA 3I5IC 1NWDA 2LC5A 2LLUA 3I5HB 2LM5A 1DT7B 1CM4A 1FF1A 2PALA 3LL8B 1SPYA 5GQQC 3E3RA 4JPZB 4DRWA 1HQVA 2OS8B 3JVTC 4GUKA 1RK9A 1SW8A 4ETOA 2WNDA 3CZTX 3BUXB 1U5IA 3QRXA 1B7TY 1PK0D 1UHKA 2K2FA 3TDIA 4F0ZB 1QTXA 2H61A 1IG5A 3KPXA 1PVAA 1L2OC 4JWQA 1K9UA 2ZRTA 2BKIB 2D8NA 2EC6C 1LA3A 4YBHB 1N65A 1TTXA 4N1GA 5J3XA 1K93D 4GGNA 2KYFA 4M2PA 4PHKA 1YVHA 4I5KA 3TZ1A 2QACA 1WRLA 4WQ2A 1NX1A 4MN0A 1S3PA 4NQGA 1J1DA 1DF0A 4YGDB 2F3YA 2HPSA 2JU0A 3JTDB 1PVBA 1R2UA 2LMUA 2DOQA 2EGDA 4MRXA 2Q4UA 5CSIA 4YGAA 2LMVA 1DJGA 3D10A 1R6PA 1QASA 1XO5A 3PALA 3PSRA 1C7VA 1XK4C 2F33A 1CMFA 2F3ZA 4GNKB 1AUIB 3OB2B 1X02A 4MZLA 1KFUL 1A29A 1NSHA 1KK7Z 1IQ5A 4HRHA 1G4YR 3PM8A 4GPLB 1BOCA 2M97A 2ZFDA 1J7OA 2JZIA 1OMRA 2KGBC 1B47A 3BOWA 2ZNDA 4AOMA 2RGIA 4JQ0D 5I2LA 4PE7A 1UURA 2KBMA 2K7DA 2JTTA 1QXPA 3A4UB 3PATA 1F4QA 2CTNA 2V53A 2OS8C 2BCBA 3JVTB 5CSFA 4PALA 4YGCB 1KCYA 1TNPA 1VRKA 2NLNA 1NP8A 5HLOA 1MWNA 1SY9A 3F45A 5PALA 3SG3A 1UUSA 1DJIA 2JT8A 3LCPC 2GGZA 4GFTA 1KQVA 3SG5A 1TNWA 1YRUB 4MVFA 1S36A 1UHNA 4OCIA 4A4CA 5IBWA 2BL0B 4ZCVA 2KFHA 1S5GY 2H2KA 1KQMB 3K21A 4MSPA 1M46A 4C0JA 1J7PA 3JTDC 2HF5A 2AUCA 1JF0A 1AVSA 4OR9B 5HYDA 3DVJA 1FI6A 1QV1A 1NCYA 1QX2A 4A4BA 1DMOA 3AKAA 1OQPA 3GOFA 2LHLA 1WLZA 1XFYO 1TCOB 4USLA 1UWOA 1IJ6A 2FOTA 1DJWA 1QJTA 1SL7A 1BLQA 2M7NA 1SKTA 2M3WA 1YVLA 2I2RE 1S6CA 2ZNEA 2KQYA 4WQ3A 4L9MA 1YUTA 3SIBA 2LLTA 1IRJA 2HQ8A 1PSBA 2WC8A 3I5GB 1SCMC 2JXLA 3O2PA 5G08A 1FPWA 4GGFA 4I5JA 2LUCA 5I2QA 1BMOA 1RJVA 4D1EA 3NSOA 1SNLA 3IQQA 1WDCB 2KOTA 3I5FC 1K90D 1NPQA 1YR5A 1CLLA 3TS5B 1KFXS 3CR2A 3GK4X 5AERA 1NX3A 1TN4A 5BPJA 1JC2A 3DF0B 2AMIA 2KAYA 1QIVA 3EKJA 3EVRA 2WORA 2CNPA 3NSIA 1CLBA 1M31A 1F8HA 1SL8A 2M29A 1CDPA 1QVIZ 3BYAA 1WRZA 3VRNA 4CFRA 2LVVA 5ER5A 5CPVA 1YX7A 1IGVA 1QV0A 1J1EA 3PFVA 3OHMB 4YGEB 2Y4QA 1M63B 4ORAB 1A75B 2FCDA 4XJKA 1BJFA 1UHIA 1CFDA 1YURA 1KWOB 1QLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IQO A;  3KHE A;  1G8I A;  1K8U A;  3SG7 A;  3I5G C;  1BR1 B;  2A4J A;  3OB1 B;  3CWG A;  5AEQ A;  2JWW A;  1A4P A;  1SBJ A;  1CMG A;  2I94 A;  3CR5 X;  5DKR A;  5HKZ A;  2M7L A;  1W7I B;  1MR8 A;  1GGZ A;  3BUN B;  4BY5 A;  5D69 A;  1UHJ A;  2BKH B;  1JBA A;  4MEW A;  2MLE C;  1NCX A;  3CS1 A;  2LLS A;  3WXA A;  1Y0V H;  2COL B;  1GQM A;  1HT9 A;  1WDC C;  2KDH A;  1PRW A;  4PDZ A;  1CLM A;  2KI6 D;  1DTL A;  1OZS A;  2JOJ A;  2NCO A;  2LVK A;  4DUQ A;  4PCW A;  2Y1N A;  3NSL A;  4P5O E;  3BUM B;  2F8P A;  1DJY A;  1LXF C;  2Y5I A;  1TIZ A;  1BT6 A;  2QPT A;  3GK2 A;  2PRU A;  2MHH A;  1LIN A;  4MRY A;  1BR4 B;  4IL1 A;  2BE4 A;  5JJG A;  1Y6W A;  1ZUZ A;  1ZFS A;  3D0Y B;  2F2P A;  1OMV A;  2OTG B;  4OKH A;  2KI4 B;  2JT3 A;  3HCM A;  3VRQ A;  1QS7 A;  1PAL A;  2HQW A;  1CDN A;  5TNC A;  3BUW B;  4E68 A;  1ZMZ A;  1OZO A;  1B1G A;  4PE4 A;  1U5I B;  1NCZ A;  1GGW A;  4C0K A;  1M45 A;  3MSE B;  2E30 A;  1EG4 A;  3DD4 A;  3I5H C;  1XFW O;  1BU3 A;  2PMY A;  3I5I B;  2ZN8 A;  2M9G A;  5K89 A;  4MZK A;  2MBX A;  1CNP A;  1OOJ A;  3D0Y A;  3AAK A;  1BG1 A;  2GV5 A;  1TRF A;  3NXA A;  3TDU A;  1AHR A;  1YUU A;  2L4I A;  4N1F A;  2JTZ A;  3O6B A;  2KI6 C;  2K7C A;  1MXL C;  1PSR A;  4QJ4 B;  3M0W A;  2KYC A;  2BCA A;  2SCP A;  3CLN A;  1A75 A;  4XJK B;  2JPT A;  3RM1 A;  1CDL A;  2MLF C;  3NSK A;  2KSP A;  5DKQ A;  4PE1 A;  5JOL A;  1L7Z A;  3LK1 A;  1XK4 A;  1KK7 Y;  1FI5 A;  2LV7 A;  3TDZ A;  1DF0 B;  5KSZ A;  3FS7 A;  1JF2 A;  2EC6 B;  3EKH A;  1MQ1 A;  2KGR A;  1NUB A;  2JC2 A;  1XFV O;  1MHO A;  1XYD A;  2KNE A;  3CR4 X;  1F71 A;  1S6J A;  2ISD A;  2OTG C;  3DVM A;  3AAJ A;  2KI4 C;  1YTZ C;  3TUY B;  2LP3 A;  5KTY A;  2M0R A;  2I18 A;  4DS7 A;  1DJZ A;  3LLE A;  1QLS A;  2WOS A;  1A03 A;  1B7T Z;  2K8M B;  1OE9 B;  1C7W A;  2LVJ A;  2L4H A;  1SMG A;  4OV2 A;  4YI8 A;  1Y1U A;  1H8B A;  1NX0 A;  5DKN A;  1B4C A;  1YUS A;  3AKB A;  4NDB A;  3EK7 A;  4N5X A;  5D7F A;  2LNK A;  2PSR A;  1ALW A;  3CTN A;  4FQO A;  3SJS A;  1OMD A;  1QX7 A;  2LUX A;  3PLF B;  1FBV A;  2CXJ A;  3KO0 A;  5HLV A;  1NYA A;  4YGB B;  2TN4 A;  1XVJ A;  1GJY A;  2K0J A;  5F6T A;  2O60 A;  3C1V A;  3DVE A;  4DCK A;  1CFF A;  1REC A;  2NCP A;  1DGU A;  2K7O A;  1K9P A;  1SK6 D;  1SRA A;  1AJ4 A;  4MBE A;  1JFK A;  2JUL A;  3SG6 A;  3O4Y A;  1EH2 A;  1RTP 1;  5HKW A;  1CFC A;  3SG2 A;  1QAT A;  2NXQ A;  1UHH A;  2P6B B;  1S6I A;  2CBL A;  5KU1 A;  1JSA A;  4QJ3 B;  4AQI A;  1SL9 A;  1XA5 A;  1KQM C;  4NDC A;  2BL0 C;  2M1K B;  3A8R A;  2M49 B;  4QJ5 B;  1KK8 C;  3LK0 A;  3VRP A;  5I8N A;  2K2A A;  1SYM A;  4YRU A;  1K2H A;  2LHI A;  3TUY C;  1YRT B;  1F55 A;  2FJU B;  2BBN A;  2BCX A;  2K7B A;  1IJ5 A;  2JNX A;  1KFU S;  3OP0 A;  1TOP A;  3WHU B;  1CFP A;  2B1U A;  4M2O A;  3EVU A;  3H4S E;  1B8C A;  3WHT B;  1B8L A;  2KQ6 A;  3DVK A;  1ZAC A;  2E6W A;  2LAN A;  4GGF C;  2L51 A;  4M2Q A;  2FCE A;  1TNQ A;  2M8U A;  1RRO A;  3ICB A;  1QIW A;  1RWY A;  1EJ3 A;  1Y1A A;  1MF8 B;  4I5N B;  2L98 A;  1J7R A;  2L50 A;  1QX5 B;  1DJH A;  1J55 A;  4MZJ A;  5AAN A;  1CB1 A;  2VRG A;  1AJ5 A;  4I5L B;  4C0L A;  1F54 A;  1EXR A;  1OSA A;  1SCM B;  2CCM A;  2KAX A;  3RLZ A;  1UP5 A;  2JQ6 A;  4CLN A;  2LP2 A;  2LCP A;  1IWQ A;  3FIA A;  1DGV A;  1D1O A;  3BOW B;  2KHN A;  2JRF A;  3DF0 A;  1V1G A;  4OVN F;  3KEV A;  1KK8 B;  3TS5 C;  1S5G Z;  2HET A;  1WRK A;  4DIR A;  4UPG A;  2L5X B;  1RFJ A;  3I5F B;  2BE6 A;  2O5G A;  1N0Y A;  1B9A A;  1E8A A;  3BUO B;  1LKJ A;  1Y1X A;  3SG4 A;  4BY4 A;  1BF5 A;  1MXE A;  1IH0 A;  3IF7 A;  4AQJ A;  4PE0 A;  3OX6 A;  1K96 A;  1TCF A;  1IKU A;  3HX4 A;  2ZRS A;  5B8I B;  1AK8 A;  1CKK A;  1Q80 A;  2SAS A;  2KBI A;  5CSN A;  2KFF A;  4CFQ A;  1F70 A;  1K95 A;  1KSM A;  2MRD A;  2K61 A;  2M1U A;  2OPO A;  3FWC A;  1M39 A;  3WNX B;  1IQ3 A;  1AP4 A;  1FW4 A;  1SR6 B;  3BQ3 A;  5FYX A;  4HRG A;  1XFU O;  1YX8 A;  2MA2 A;  1V1F A;  4YI9 A;  4Q04 A;  1W7J B;  3VGO A;  1TNX A;  4GBA A;  2NZ0 A;  2LE9 B;  2ZN9 A;  2IS9 A;  3PN7 C;  1SCV A;  3EVV A;  1KWO C;  4ORB B;  3OX5 A;  2G9B A;  1ALV A;  1CM1 A;  1WY9 A;  2Q91 A;  4PHJ A;  2BBM A;  4CPV A;  1K94 A;  1K9K A;  4PHM A;  3VRR A;  1C07 A;  1NX2 A;  1LVC D;  2I7A A;  1XFX O;  2BEC A;  1QVI Y;  2WCF A;  3BXK A;  4TNC A;  5CSJ A;  3KF9 A;  2MJW B;  1WLM A;  2WCE A;  1JFJ A;  2AAO A;  2L0P A;  2JNF A;  3FWB A;  4ICB A;  1A2X A;  4XYN A;  1DJX A;  1KFX L;  4ORC B;  2KAV A;  5AXI A;  2EHB A;  3O78 A;  1JWD A;  1CTR A;  3CGA A;  2LMT A;  1XFZ O;  1B8R A;  1L2O B;  2CT9 A;  1N2D A;  1NIW A;  4CID A;  2WCB A;  4GAO A;  1H4B A;  1S1E A;  3EK8 A;  1S26 D;  2G2B A;  3EK4 A;  3ZWH A;  4HRE E;  4ZCU A;  2ZKM X;  1F4O A;  1KSO A;  2JXC A;  4P2Y B;  5ER4 X;  4PHN A;  2GGM A;  2JT0 A;  1DVI A;  3VRO A;  4U8D A;  1ODB A;  2PVB A;  1JUO A;  1BOD A;  4R1E A;  1J7Q A;  2F2O A;  4MLW A;  1LA0 A;  5AFP A;  1SR6 C;  2LVI A;  1EG3 A;  1G33 A;  1PUL A;  3SIA A;  1EL4 A;  1ZOT B;  2L2E A;  2PAS A;  2R2I A;  1MUX A;  4HSZ A;  2LAP A;  1CDM A;  2Y1M A;  5I2O A;  2H61 C;  4WRI A;  3ZNI A;  2KFG A;  2MAZ A;  3GK1 A;  3PN7 B;  4FTG A;  4NDD A;  5HKY A;  3I5I C;  1NWD A;  2LC5 A;  2LLU A;  3I5H B;  2LM5 A;  1DT7 B;  1CM4 A;  1FF1 A;  2PAL A;  3LL8 B;  1SPY A;  5GQQ C;  3E3R A;  4JPZ B;  4DRW A;  1HQV A;  2OS8 B;  3JVT C;  4GUK A;  1RK9 A;  1SW8 A;  4ETO A;  2WND A;  3CZT X;  3BUX B;  1U5I A;  3QRX A;  1B7T Y;  1PK0 D;  1UHK A;  2K2F A;  3TDI A;  4F0Z B;  1QTX A;  2H61 A;  1IG5 A;  3KPX A;  1PVA A;  1L2O C;  4JWQ A;  1K9U A;  2ZRT A;  2BKI B;  2D8N A;  2EC6 C;  1LA3 A;  4YBH B;  1N65 A;  1TTX A;  4N1G A;  5J3X A;  1K93 D;  4GGN A;  2KYF A;  4M2P A;  4PHK A;  1YVH A;  4I5K A;  3TZ1 A;  2QAC A;  1WRL A;  4WQ2 A;  1NX1 A;  4MN0 A;  1S3P A;  4NQG A;  1J1D A;  1DF0 A;  4YGD B;  2F3Y A;  2HPS A;  2JU0 A;  3JTD B;  1PVB A;  1R2U A;  2LMU A;  2DOQ A;  2EGD A;  4MRX A;  2Q4U A;  5CSI A;  4YGA A;  2LMV A;  1DJG A;  3D10 A;  1R6P A;  1QAS A;  1XO5 A;  3PAL A;  3PSR A;  1C7V A;  1XK4 C;  2F33 A;  1CMF A;  2F3Z A;  4GNK B;  1AUI B;  3OB2 B;  1X02 A;  4MZL A;  1KFU L;  1A29 A;  1NSH A;  1KK7 Z;  1IQ5 A;  4HRH A;  1G4Y R;  3PM8 A;  4GPL B;  1BOC A;  2M97 A;  2ZFD A;  1J7O A;  2JZI A;  1OMR A;  2KGB C;  1B47 A;  3BOW A;  2ZND A;  4AOM A;  2RGI A;  4JQ0 D;  5I2L A;  4PE7 A;  1UUR A;  2KBM A;  2K7D A;  2JTT A;  1QXP A;  3A4U B;  3PAT A;  1F4Q A;  2CTN A;  2V53 A;  2OS8 C;  2BCB A;  3JVT B;  5CSF A;  4PAL A;  4YGC B;  1KCY A;  1TNP A;  1VRK A;  2NLN A;  1NP8 A;  5HLO A;  1MWN A;  1SY9 A;  3F45 A;  5PAL A;  3SG3 A;  1UUS A;  1DJI A;  2JT8 A;  3LCP C;  2GGZ A;  4GFT A;  1KQV A;  3SG5 A;  1TNW A;  1YRU B;  4MVF A;  1S36 A;  1UHN A;  4OCI A;  4A4C A;  5IBW A;  2BL0 B;  4ZCV A;  2KFH A;  1S5G Y;  2H2K A;  1KQM B;  3K21 A;  4MSP A;  1M46 A;  4C0J A;  1J7P A;  3JTD C;  2HF5 A;  2AUC A;  1JF0 A;  1AVS A;  4OR9 B;  5HYD A;  3DVJ A;  1FI6 A;  1QV1 A;  1NCY A;  1QX2 A;  4A4B A;  1DMO A;  3AKA A;  1OQP A;  3GOF A;  2LHL A;  1WLZ A;  1XFY O;  1TCO B;  4USL A;  1UWO A;  1IJ6 A;  2FOT A;  1DJW A;  1QJT A;  1SL7 A;  1BLQ A;  2M7N A;  1SKT A;  2M3W A;  1YVL A;  2I2R E;  1S6C A;  2ZNE A;  2KQY A;  4WQ3 A;  4L9M A;  1YUT A;  3SIB A;  2LLT A;  1IRJ A;  2HQ8 A;  1PSB A;  2WC8 A;  3I5G B;  1SCM C;  2JXL A;  3O2P A;  5G08 A;  1FPW A;  4GGF A;  4I5J A;  2LUC A;  5I2Q A;  1BMO A;  1RJV A;  4D1E A;  3NSO A;  1SNL A;  3IQQ A;  1WDC B;  2KOT A;  3I5F C;  1K90 D;  1NPQ A;  1YR5 A;  1CLL A;  3TS5 B;  1KFX S;  3CR2 A;  3GK4 X;  5AER A;  1NX3 A;  1TN4 A;  5BPJ A;  1JC2 A;  3DF0 B;  2AMI A;  2KAY A;  1QIV A;  3EKJ A;  3EVR A;  2WOR A;  2CNP A;  3NSI A;  1CLB A;  1M31 A;  1F8H A;  1SL8 A;  2M29 A;  1CDP A;  1QVI Z;  3BYA A;  1WRZ A;  3VRN A;  4CFR A;  2LVV A;  5ER5 A;  5CPV A;  1YX7 A;  1IGV A;  1QV0 A;  1J1E A;  3PFV A;  3OHM B;  4YGE B;  2Y4Q A;  1M63 B;  4ORA B;  1A75 B;  2FCD A;  4XJK A;  1BJF A;  1UHI A;  1CFD A;  1YUR A;  1KWO B;  1QLK A; 
#chains in the Genus database with same CATH topology
 3IQO A;  3KHE A;  1G8I A;  1K8U A;  3SG7 A;  3I5G C;  1BR1 B;  2A4J A;  3OB1 B;  3CWG A;  5AEQ A;  2JWW A;  1A4P A;  1SBJ A;  1CMG A;  2I94 A;  3CR5 X;  5DKR A;  5HKZ A;  2M7L A;  3PJI A;  1W7I B;  1MR8 A;  1GGZ A;  3CAB A;  3BUN B;  4BY5 A;  5D69 A;  1UHJ A;  2BKH B;  1JBA A;  4MEW A;  2MLE C;  2WC6 A;  1NCX A;  3CS1 A;  2LLS A;  3WXA A;  1Y0V H;  3CZ2 A;  2COL B;  1GQM A;  1HT9 A;  1WDC C;  2KDH A;  1PRW A;  4PDZ A;  1CLM A;  2KI6 D;  1DTL A;  1OZS A;  2JOJ A;  2NCO A;  2LVK A;  4DUQ A;  3S0A A;  2QEB A;  4PCW A;  2Y1N A;  3DYE A;  3NSL A;  4P5O E;  3BUM B;  2F8P A;  1DJY A;  1LXF C;  2Y5I A;  1TIZ A;  1BT6 A;  2QPT A;  3D76 A;  2PRU A;  3GK2 A;  2MHH A;  1LIN A;  4MRY A;  1BR4 B;  4IL1 A;  2BE4 A;  1OOF A;  5JJG A;  1Y6W A;  1ZUZ A;  1ZFS A;  3D0Y B;  2F2P A;  3S0G A;  1OMV A;  2OTG B;  3R72 A;  4OKH A;  2KI4 B;  2JT3 A;  3HCM A;  3VRQ A;  1QS7 A;  1PAL A;  2HQW A;  1QWV A;  1CDN A;  5TNC A;  3BUW B;  3PM2 A;  3CZ1 A;  4KYN A;  4E68 A;  1ZMZ A;  1OZO A;  1B1G A;  1OOH A;  4PE4 A;  1U5I B;  3BFA A;  1NCZ A;  1GGW A;  4C0K A;  1M45 A;  3MSE B;  2E30 A;  1EG4 A;  3DD4 A;  3I5H C;  1XFW O;  1BU3 A;  3BFH A;  2PMY A;  3I5I B;  2ZN8 A;  2M9G A;  5K89 A;  4MZK A;  2MBX A;  1CNP A;  2QEV A;  1OOJ A;  2KLE A;  2WCH A;  3D0Y A;  3AAK A;  3SS5 A;  1BG1 A;  2GV5 A;  1TRF A;  3NXA A;  3TDU A;  1AHR A;  1DEK A;  1YUU A;  2L4I A;  4N1F A;  2JTZ A;  3O6B A;  2KI6 C;  2K7C A;  1MXL C;  1PSR A;  4QJ4 B;  3M0W A;  2KYC A;  2BCA A;  2SCP A;  3CLN A;  1A75 A;  4XJK B;  3S0B A;  2JPT A;  3RM1 A;  1CDL A;  2MLF C;  4INX A;  3NSK A;  2KSP A;  5DKQ A;  4PE1 A;  5FI2 A;  5JOL A;  1L7Z A;  3LK1 A;  1XK4 A;  1KK7 Y;  1FI5 A;  2LV7 A;  3TDZ A;  1DF0 B;  3R1P A;  5KSZ A;  2GTE A;  3FS7 A;  1JF2 A;  2EC6 B;  3EKH A;  1MQ1 A;  2KGR A;  2K60 A;  1IIO A;  1NUB A;  2JC2 A;  3D78 A;  3L4L A;  1XFV O;  1MHO A;  1XYD A;  2KNE A;  3CDN A;  3CR4 X;  5FI6 A;  1F71 A;  1S6J A;  2ISD A;  2OTG C;  3DVM A;  3AAJ A;  2KI4 C;  1YTZ C;  3TUY B;  2LP3 A;  3SS4 A;  5KTY A;  2M0R A;  2I18 A;  4DS7 A;  1DJZ A;  3EG5 B;  3LLE A;  1QLS A;  2WOS A;  1A03 A;  1B7T Z;  2K8M B;  1OE9 B;  1C7W A;  2LVJ A;  2L4H A;  1SMG A;  2WC5 A;  4OV2 A;  3SS3 A;  4YI8 A;  1W9Z A;  1Y1U A;  1H8B A;  1NX0 A;  5DKN A;  1B4C A;  1YUS A;  3AKB A;  4NDB A;  3EK7 A;  4N5X A;  5D7F A;  2LNK A;  2PSR A;  5HL1 A;  1ALW A;  3CTN A;  4FQO A;  3SJS A;  1OMD A;  1QX7 A;  2LUX A;  3PLF B;  1FBV A;  5D3O A;  2CXJ A;  3KO0 A;  5HLV A;  1NYA A;  3V2L A;  4YGB B;  2TN4 A;  1XVJ A;  1GJY A;  2K0J A;  5FI7 A;  5F6T A;  4F7F A;  2O60 A;  3C1V A;  3DVE A;  2QDI A;  4DCK A;  1CFF A;  1REC A;  2NCP A;  1DGU A;  2K7O A;  1K9P A;  1SK6 D;  1SRA A;  1AJ4 A;  4MBE A;  1JFK A;  2JUL A;  3SG6 A;  3O4Y A;  1EH2 A;  3OBV A;  1RTP 1;  5HKW A;  3CYZ A;  1CFC A;  3SG2 A;  1QAT A;  2NXQ A;  1UHH A;  2P6B B;  1S6I A;  2CBL A;  5KU1 A;  1JSA A;  4QJ3 B;  4AQI A;  1SL9 A;  1XA5 A;  1KQM C;  4NDC A;  2BL0 C;  2M1K B;  3A8R A;  2M49 B;  4QJ5 B;  1KK8 C;  3LK0 A;  3VRP A;  5I8N A;  2K2A A;  1SYM A;  3IVT A;  4YRU A;  1K2H A;  1C3Y A;  3NHI A;  3D75 A;  2LHI A;  3TUY C;  1YRT B;  1F55 A;  2FJU B;  3DY9 A;  2BBN A;  2BCX A;  2K7B A;  1IJ5 A;  2JNX A;  1KFU S;  3OP0 A;  1TOP A;  3BFB A;  3WHU B;  1CFP A;  1XFR A;  2B1U A;  4M2O A;  3EVU A;  3H4S E;  1B8C A;  3WHT B;  1B8L A;  2KQ6 A;  3DVK A;  1ZAC A;  2E6W A;  2LAN A;  4GGF C;  2L51 A;  3D74 A;  2FCE A;  4M2Q A;  1TNQ A;  2M8U A;  1RRO A;  3ICB A;  1QIW A;  1RWY A;  2ERB A;  1EJ3 A;  3S0D A;  1Y1A A;  1MF8 B;  4I5N B;  2L98 A;  1J7R A;  1LS8 A;  2KLD A;  2L50 A;  1QX5 B;  2WCM A;  1DJH A;  1J55 A;  4MZJ A;  3NGV A;  5AAN A;  1CB1 A;  2VRG A;  1AJ5 A;  4I5L B;  4C0L A;  1ORG A;  2JPO A;  1F54 A;  1EXR A;  1OSA A;  1SCM B;  2WCJ A;  3VB1 A;  2CCM A;  2KAX A;  3RLZ A;  1UP5 A;  2JQ6 A;  4CLN A;  2LP2 A;  3B88 A;  2LCP A;  1IWQ A;  3FIA A;  1DGV A;  1D1O A;  3BOW B;  4JD9 A;  2KHN A;  2JRF A;  3DF0 A;  1V1G A;  3FE6 A;  4OVN F;  3KEV A;  1KK8 B;  3TS5 C;  2L2C A;  1S5G Z;  1WRK A;  2HET A;  4DIR A;  4UPG A;  2L5X B;  1RFJ A;  3I5F B;  3QME A;  2BE6 A;  2O5G A;  1N0Y A;  3DXL A;  1B9A A;  1E8A A;  3BUO B;  1LKJ A;  1Y1X A;  5CSF A;  3SG4 A;  4BY4 A;  1MXE A;  1BF5 A;  1IH0 A;  3IF7 A;  4AQJ A;  4PE0 A;  3OX6 A;  1K96 A;  1TCF A;  1IKU A;  3HX4 A;  2ZRS A;  5B8I B;  1AK8 A;  1CKK A;  1Q80 A;  2SAS A;  2KBI A;  5CSN A;  2KFF A;  4CFQ A;  1F70 A;  1K95 A;  1KSM A;  2MRD A;  2K61 A;  2M1U A;  2OPO A;  3B86 A;  2BNX A;  1M39 A;  3FWC A;  3WNX B;  3L47 A;  1IQ3 A;  1AP4 A;  1FW4 A;  1SR6 B;  3BQ3 A;  5FYX A;  4HRG A;  5DIC A;  1XFU O;  1YX8 A;  1OW4 A;  2QEH A;  2MA2 A;  1V1F A;  4YI9 A;  4Q04 A;  4FQT A;  1W7J B;  3VGO A;  1TNX A;  4GBA A;  2NZ0 A;  2LE9 B;  2ZN9 A;  2IS9 A;  3PN7 C;  1SCV A;  3EVV A;  1KWO C;  4ORB B;  3OX5 A;  2G9B A;  1ALV A;  3DZT A;  1CM1 A;  1WY9 A;  2Q91 A;  4PHJ A;  2BBM A;  4CPV A;  1K94 A;  1K9K A;  4PHM A;  3VRR A;  1TUJ A;  1NX2 A;  1C07 A;  2FJY A;  4JKT A;  2KPH A;  2P70 A;  3S0F A;  1LVC D;  2I7A A;  1XFX O;  2BEC A;  1QVI Y;  2WCF A;  3BXK A;  4TNC A;  5CSJ A;  3KF9 A;  1TWO A;  1WLM A;  2MJW B;  2WCE A;  1JFJ A;  2AAO A;  2L0P A;  2JNF A;  3B7A A;  3FWB A;  4ICB A;  1A2X A;  4XYN A;  1DJX A;  1KFX L;  4ORC B;  2KAV A;  5AXI A;  2EHB A;  3O78 A;  1JWD A;  1CTR A;  3CGA A;  2LMT A;  1XFZ O;  1B8R A;  3UO9 A;  1L2O B;  2CT9 A;  1N2D A;  1NIW A;  4CID A;  2WCB A;  4GAO A;  4INW A;  1H4B A;  2YGU A;  1S1E A;  3EK8 A;  1S26 D;  2H8V A;  2G2B A;  3EK4 A;  3ZWH A;  4HRE E;  4ZCU A;  2ZKM X;  1F4O A;  1KSO A;  2JXC A;  4P2Y B;  5ER4 X;  4PHN A;  2GGM A;  2JT0 A;  1DVI A;  3VRO A;  4U8D A;  1ODB A;  2PVB A;  1JUO A;  1BOD A;  4R1E A;  1J7Q A;  2F2O A;  4MLW A;  1P28 A;  3K1E A;  1LA0 A;  5AFP A;  1SR6 C;  2LVI A;  1EG3 A;  1G33 A;  1PUL A;  3SIA A;  1EL4 A;  1ZOT B;  2L2E A;  2PAS A;  2R2I A;  1MUX A;  4HSZ A;  2LAP A;  1CDM A;  2Y1M A;  5I2O A;  2H61 C;  4WRI A;  3ZNI A;  2KFG A;  2MAZ A;  3GK1 A;  3PN7 B;  4FTG A;  4NDD A;  5HKY A;  3I5I C;  1NWD A;  2LC5 A;  2LLU A;  3I5H B;  2LM5 A;  1DT7 B;  1CM4 A;  1FF1 A;  2PAL A;  3LL8 B;  1SPY A;  1DC1 A;  5GQQ C;  3E3R A;  4JPZ B;  4DRW A;  1HQV A;  2OS8 B;  3JVT C;  4GUK A;  1RK9 A;  1SW8 A;  4ETO A;  3CZ0 A;  3R1V A;  2WND A;  3CZT X;  3BUX B;  1U5I A;  3QRX A;  1B7T Y;  1PK0 D;  1UHK A;  2K2F A;  3TDI A;  4F0Z B;  1QTX A;  2H61 A;  3N7H A;  1IG5 A;  3KPX A;  1PVA A;  1L2O C;  4JWQ A;  1K9U A;  2ZRT A;  2BKI B;  2D8N A;  2EC6 C;  1LA3 A;  4YBH B;  1N65 A;  1TTX A;  4N1G A;  5J3X A;  1K93 D;  4GGN A;  2KYF A;  4M2P A;  4PHK A;  1YVH A;  4I5K A;  3TZ1 A;  2QAC A;  1WRL A;  4WQ2 A;  1NX1 A;  4MN0 A;  1S3P A;  4NQG A;  1J1D A;  1DF0 A;  3UNW A;  4YGD B;  2F3Y A;  2HPS A;  2JU0 A;  3JTD B;  1PVB A;  1R2U A;  2LMU A;  2DOQ A;  2EGD A;  4MRX A;  2Q4U A;  2WCK A;  5CSI A;  4YGA A;  2LMV A;  1DJG A;  3D10 A;  1R6P A;  1QAS A;  1XO5 A;  3PAL A;  3PSR A;  1C7V A;  1XK4 C;  2F33 A;  1CMF A;  2F3Z A;  4GNK B;  1AUI B;  2L5Y A;  3OB2 B;  1X02 A;  4MZL A;  1KFU L;  1A29 A;  1NSH A;  1KK7 Z;  1IQ5 A;  4HRH A;  1G4Y R;  3PM8 A;  4GPL B;  1BOC A;  2M97 A;  2ZFD A;  3B6X A;  1J7O A;  2JZI A;  1OMR A;  2KGB C;  3B87 A;  1B47 A;  3BOW A;  2ZND A;  4AOM A;  2RGI A;  4JQ0 D;  5I2L A;  4PE7 A;  1UUR A;  1Z2C B;  2KBM A;  2K7D A;  2JTT A;  1QXP A;  3A4U B;  3PAT A;  1F4Q A;  2CTN A;  2V53 A;  2OS8 C;  2BCB A;  3JVT B;  3L4A A;  4PAL A;  4YGC B;  1KCY A;  1TNP A;  1VRK A;  2NLN A;  3D73 A;  1NP8 A;  5HLO A;  1MWN A;  3R1O A;  1SY9 A;  3F45 A;  5PAL A;  3SG3 A;  1UUS A;  1DJI A;  2JT8 A;  3LCP C;  2GGZ A;  4GFT A;  1KQV A;  3SG5 A;  1TNW A;  1YRU B;  4MVF A;  2BAP A;  1S36 A;  1UHN A;  4IJ7 A;  4OCI A;  4A4C A;  5IBW A;  2BL0 B;  4ZCV A;  1GM0 A;  2KFH A;  1S5G Y;  2H2K A;  3RZS A;  1KQM B;  3K21 A;  4MSP A;  2PQL A;  1M46 A;  1OOI X;  4C0J A;  1J7P A;  3JTD C;  2HF5 A;  2AUC A;  1JF0 A;  1AVS A;  3S0E A;  4OR9 B;  5HYD A;  3DVJ A;  1FI6 A;  1QV1 A;  1NCY A;  1QX2 A;  3Q8I A;  4A4B A;  1DMO A;  3AKA A;  1OQP A;  3GOF A;  2LHL A;  1WLZ A;  1XFY O;  1TCO B;  4USL A;  1UWO A;  1IJ6 A;  2FOT A;  1DJW A;  1QJT A;  1SL7 A;  1BLQ A;  2M7N A;  1SKT A;  2M3W A;  1YVL A;  2I2R E;  1S6C A;  2ZNE A;  2KQY A;  4WQ3 A;  1TUZ A;  4L9M A;  1YUT A;  3SIB A;  2LLT A;  1IRJ A;  2PYQ A;  3O4X A;  2HQ8 A;  1PSB A;  2WC8 A;  2QEO A;  1DQE A;  3I5G B;  1Z4H A;  1OOG A;  1SCM C;  2JXL A;  3O2P A;  5G08 A;  1C3Z A;  1FPW A;  4GGF A;  4I5J A;  3FE9 A;  2LUC A;  4PT1 A;  2P71 A;  5I2Q A;  1BMO A;  1RJV A;  4D1E A;  3NSO A;  1SNL A;  3IQQ A;  1WDC B;  2KOT A;  3I5F C;  1K90 D;  1NPQ A;  1YR5 A;  1CLL A;  4OZD A;  1SSE B;  2WCL A;  3TS5 B;  1KFX S;  3OGN A;  5I94 A;  3CR2 A;  3GK4 X;  5AER A;  1NX3 A;  1TN4 A;  5BPJ A;  1JC2 A;  3DF0 B;  3NHT A;  1T14 A;  2AMI A;  2KAY A;  1QIV A;  3EKJ A;  3EVR A;  2WOR A;  2CNP A;  3NSI A;  1CLB A;  1M31 A;  1F8H A;  1SL8 A;  2M29 A;  1CDP A;  1QVI Z;  3BYA A;  1WRZ A;  3D77 A;  3BJH A;  5EL2 A;  3VRN A;  4CFR A;  1DEL A;  2LVV A;  5ER5 A;  5CPV A;  1YX7 A;  1IGV A;  1QV0 A;  1J1E A;  3PFV A;  3OHM B;  4YGE B;  2Y4Q A;  1M63 B;  4ORA B;  1A75 B;  2FCD A;  4XJK A;  1BJF A;  3FE8 A;  1UHI A;  1CFD A;  1YUR A;  1KWO B;  1QLK A; 
#chains in the Genus database with same CATH homology
 3IQO A;  3KHE A;  1G8I A;  1K8U A;  3SG7 A;  3I5G C;  1BR1 B;  2A4J A;  3OB1 B;  3CWG A;  5AEQ A;  2JWW A;  1A4P A;  1SBJ A;  1CMG A;  2I94 A;  3CR5 X;  5DKR A;  5HKZ A;  2M7L A;  1W7I B;  1MR8 A;  1GGZ A;  3BUN B;  4BY5 A;  5D69 A;  1UHJ A;  2BKH B;  1JBA A;  4MEW A;  2MLE C;  1NCX A;  3CS1 A;  2LLS A;  3WXA A;  1Y0V H;  2COL B;  1GQM A;  1HT9 A;  1WDC C;  2KDH A;  1PRW A;  4PDZ A;  1CLM A;  2KI6 D;  1DTL A;  1OZS A;  2JOJ A;  2NCO A;  2LVK A;  4DUQ A;  4PCW A;  2Y1N A;  3NSL A;  4P5O E;  3BUM B;  2F8P A;  1DJY A;  1LXF C;  2Y5I A;  1TIZ A;  1BT6 A;  2QPT A;  3GK2 A;  2PRU A;  2MHH A;  1LIN A;  4MRY A;  1BR4 B;  4IL1 A;  2BE4 A;  5JJG A;  1Y6W A;  1ZUZ A;  1ZFS A;  3D0Y B;  2F2P A;  1OMV A;  2OTG B;  4OKH A;  2KI4 B;  2JT3 A;  3HCM A;  3VRQ A;  1QS7 A;  1PAL A;  2HQW A;  1CDN A;  5TNC A;  3BUW B;  4E68 A;  1ZMZ A;  1OZO A;  1B1G A;  4PE4 A;  1U5I B;  1NCZ A;  1GGW A;  4C0K A;  1M45 A;  3MSE B;  2E30 A;  1EG4 A;  3DD4 A;  3I5H C;  1XFW O;  1BU3 A;  2PMY A;  3I5I B;  2ZN8 A;  2M9G A;  5K89 A;  4MZK A;  2MBX A;  1CNP A;  1OOJ A;  3D0Y A;  3AAK A;  1BG1 A;  2GV5 A;  1TRF A;  3NXA A;  3TDU A;  1AHR A;  1YUU A;  2L4I A;  4N1F A;  2JTZ A;  3O6B A;  2KI6 C;  2K7C A;  1MXL C;  1PSR A;  4QJ4 B;  3M0W A;  2KYC A;  2BCA A;  2SCP A;  3CLN A;  1A75 A;  4XJK B;  2JPT A;  3RM1 A;  1CDL A;  2MLF C;  3NSK A;  2KSP A;  5DKQ A;  4PE1 A;  5JOL A;  1L7Z A;  3LK1 A;  1XK4 A;  1KK7 Y;  1FI5 A;  2LV7 A;  3TDZ A;  1DF0 B;  5KSZ A;  3FS7 A;  1JF2 A;  2EC6 B;  3EKH A;  1MQ1 A;  2KGR A;  1NUB A;  2JC2 A;  1XFV O;  1MHO A;  1XYD A;  2KNE A;  3CR4 X;  1F71 A;  1S6J A;  2ISD A;  2OTG C;  3DVM A;  3AAJ A;  2KI4 C;  1YTZ C;  3TUY B;  2LP3 A;  5KTY A;  2M0R A;  2I18 A;  4DS7 A;  1DJZ A;  3LLE A;  1QLS A;  2WOS A;  1A03 A;  1B7T Z;  2K8M B;  1OE9 B;  1C7W A;  2LVJ A;  2L4H A;  1SMG A;  4OV2 A;  4YI8 A;  1Y1U A;  1H8B A;  1NX0 A;  5DKN A;  1B4C A;  1YUS A;  3AKB A;  4NDB A;  3EK7 A;  4N5X A;  5D7F A;  2LNK A;  2PSR A;  1ALW A;  3CTN A;  4FQO A;  3SJS A;  1OMD A;  1QX7 A;  2LUX A;  3PLF B;  1FBV A;  2CXJ A;  3KO0 A;  5HLV A;  1NYA A;  4YGB B;  2TN4 A;  1XVJ A;  1GJY A;  2K0J A;  5F6T A;  2O60 A;  3C1V A;  3DVE A;  4DCK A;  1CFF A;  1REC A;  2NCP A;  1DGU A;  2K7O A;  1K9P A;  1SK6 D;  1SRA A;  1AJ4 A;  4MBE A;  1JFK A;  2JUL A;  3SG6 A;  3O4Y A;  1EH2 A;  1RTP 1;  5HKW A;  1CFC A;  3SG2 A;  1QAT A;  2NXQ A;  1UHH A;  2P6B B;  1S6I A;  2CBL A;  5KU1 A;  1JSA A;  4QJ3 B;  4AQI A;  1SL9 A;  1XA5 A;  1KQM C;  4NDC A;  2BL0 C;  2M1K B;  3A8R A;  2M49 B;  4QJ5 B;  1KK8 C;  3LK0 A;  3VRP A;  5I8N A;  2K2A A;  1SYM A;  4YRU A;  1K2H A;  2LHI A;  3TUY C;  1YRT B;  1F55 A;  2FJU B;  2BBN A;  2BCX A;  2K7B A;  1IJ5 A;  2JNX A;  1KFU S;  3OP0 A;  1TOP A;  3WHU B;  1CFP A;  2B1U A;  4M2O A;  3EVU A;  3H4S E;  1B8C A;  3WHT B;  1B8L A;  2KQ6 A;  3DVK A;  1ZAC A;  2E6W A;  2LAN A;  4GGF C;  2L51 A;  4M2Q A;  2FCE A;  1TNQ A;  2M8U A;  1RRO A;  3ICB A;  1QIW A;  1RWY A;  1EJ3 A;  1Y1A A;  1MF8 B;  4I5N B;  2L98 A;  1J7R A;  2L50 A;  1QX5 B;  1DJH A;  1J55 A;  4MZJ A;  5AAN A;  1CB1 A;  2VRG A;  1AJ5 A;  4I5L B;  4C0L A;  1F54 A;  1EXR A;  1OSA A;  1SCM B;  2CCM A;  2KAX A;  3RLZ A;  1UP5 A;  2JQ6 A;  4CLN A;  2LP2 A;  2LCP A;  1IWQ A;  3FIA A;  1DGV A;  1D1O A;  3BOW B;  2KHN A;  2JRF A;  3DF0 A;  1V1G A;  4OVN F;  3KEV A;  1KK8 B;  3TS5 C;  1S5G Z;  2HET A;  1WRK A;  4DIR A;  4UPG A;  2L5X B;  1RFJ A;  3I5F B;  2BE6 A;  2O5G A;  1N0Y A;  1B9A A;  1E8A A;  3BUO B;  1LKJ A;  1Y1X A;  3SG4 A;  4BY4 A;  1BF5 A;  1MXE A;  1IH0 A;  3IF7 A;  4AQJ A;  4PE0 A;  3OX6 A;  1K96 A;  1TCF A;  1IKU A;  3HX4 A;  2ZRS A;  5B8I B;  1AK8 A;  1CKK A;  1Q80 A;  2SAS A;  2KBI A;  5CSN A;  2KFF A;  4CFQ A;  1F70 A;  1K95 A;  1KSM A;  2MRD A;  2K61 A;  2M1U A;  2OPO A;  3FWC A;  1M39 A;  3WNX B;  1IQ3 A;  1AP4 A;  1FW4 A;  1SR6 B;  3BQ3 A;  5FYX A;  4HRG A;  1XFU O;  1YX8 A;  2MA2 A;  1V1F A;  4YI9 A;  4Q04 A;  1W7J B;  3VGO A;  1TNX A;  4GBA A;  2NZ0 A;  2LE9 B;  2ZN9 A;  2IS9 A;  3PN7 C;  1SCV A;  3EVV A;  1KWO C;  4ORB B;  3OX5 A;  2G9B A;  1ALV A;  1CM1 A;  1WY9 A;  2Q91 A;  4PHJ A;  2BBM A;  4CPV A;  1K94 A;  1K9K A;  4PHM A;  3VRR A;  1C07 A;  1NX2 A;  1LVC D;  2I7A A;  1XFX O;  2BEC A;  1QVI Y;  2WCF A;  3BXK A;  4TNC A;  5CSJ A;  3KF9 A;  2MJW B;  1WLM A;  2WCE A;  1JFJ A;  2AAO A;  2L0P A;  2JNF A;  3FWB A;  4ICB A;  1A2X A;  4XYN A;  1DJX A;  1KFX L;  4ORC B;  2KAV A;  5AXI A;  2EHB A;  3O78 A;  1JWD A;  1CTR A;  3CGA A;  2LMT A;  1XFZ O;  1B8R A;  1L2O B;  2CT9 A;  1N2D A;  1NIW A;  4CID A;  2WCB A;  4GAO A;  1H4B A;  1S1E A;  3EK8 A;  1S26 D;  2G2B A;  3EK4 A;  3ZWH A;  4HRE E;  4ZCU A;  2ZKM X;  1F4O A;  1KSO A;  2JXC A;  4P2Y B;  5ER4 X;  4PHN A;  2GGM A;  2JT0 A;  1DVI A;  3VRO A;  4U8D A;  1ODB A;  2PVB A;  1JUO A;  1BOD A;  4R1E A;  1J7Q A;  2F2O A;  4MLW A;  1LA0 A;  5AFP A;  1SR6 C;  2LVI A;  1EG3 A;  1G33 A;  1PUL A;  3SIA A;  1EL4 A;  1ZOT B;  2L2E A;  2PAS A;  2R2I A;  1MUX A;  4HSZ A;  2LAP A;  1CDM A;  2Y1M A;  5I2O A;  2H61 C;  4WRI A;  3ZNI A;  2KFG A;  2MAZ A;  3GK1 A;  3PN7 B;  4FTG A;  4NDD A;  5HKY A;  3I5I C;  1NWD A;  2LC5 A;  2LLU A;  3I5H B;  2LM5 A;  1DT7 B;  1CM4 A;  1FF1 A;  2PAL A;  3LL8 B;  1SPY A;  5GQQ C;  3E3R A;  4JPZ B;  4DRW A;  1HQV A;  2OS8 B;  3JVT C;  4GUK A;  1RK9 A;  1SW8 A;  4ETO A;  2WND A;  3CZT X;  3BUX B;  1U5I A;  3QRX A;  1B7T Y;  1PK0 D;  1UHK A;  2K2F A;  3TDI A;  4F0Z B;  1QTX A;  2H61 A;  1IG5 A;  3KPX A;  1PVA A;  1L2O C;  4JWQ A;  1K9U A;  2ZRT A;  2BKI B;  2D8N A;  2EC6 C;  1LA3 A;  4YBH B;  1N65 A;  1TTX A;  4N1G A;  5J3X A;  1K93 D;  4GGN A;  2KYF A;  4M2P A;  4PHK A;  1YVH A;  4I5K A;  3TZ1 A;  2QAC A;  1WRL A;  4WQ2 A;  1NX1 A;  4MN0 A;  1S3P A;  4NQG A;  1J1D A;  1DF0 A;  4YGD B;  2F3Y A;  2HPS A;  2JU0 A;  3JTD B;  1PVB A;  1R2U A;  2LMU A;  2DOQ A;  2EGD A;  4MRX A;  2Q4U A;  5CSI A;  4YGA A;  2LMV A;  1DJG A;  3D10 A;  1R6P A;  1QAS A;  1XO5 A;  3PAL A;  3PSR A;  1C7V A;  1XK4 C;  2F33 A;  1CMF A;  2F3Z A;  4GNK B;  1AUI B;  3OB2 B;  1X02 A;  4MZL A;  1KFU L;  1A29 A;  1NSH A;  1KK7 Z;  1IQ5 A;  4HRH A;  1G4Y R;  3PM8 A;  4GPL B;  1BOC A;  2M97 A;  2ZFD A;  1J7O A;  2JZI A;  1OMR A;  2KGB C;  1B47 A;  3BOW A;  2ZND A;  4AOM A;  2RGI A;  4JQ0 D;  5I2L A;  4PE7 A;  1UUR A;  2KBM A;  2K7D A;  2JTT A;  1QXP A;  3A4U B;  3PAT A;  1F4Q A;  2CTN A;  2V53 A;  2OS8 C;  2BCB A;  3JVT B;  5CSF A;  4PAL A;  4YGC B;  1KCY A;  1TNP A;  1VRK A;  2NLN A;  1NP8 A;  5HLO A;  1MWN A;  1SY9 A;  3F45 A;  5PAL A;  3SG3 A;  1UUS A;  1DJI A;  2JT8 A;  3LCP C;  2GGZ A;  4GFT A;  1KQV A;  3SG5 A;  1TNW A;  1YRU B;  4MVF A;  1S36 A;  1UHN A;  4OCI A;  4A4C A;  5IBW A;  2BL0 B;  4ZCV A;  2KFH A;  1S5G Y;  2H2K A;  1KQM B;  3K21 A;  4MSP A;  1M46 A;  4C0J A;  1J7P A;  3JTD C;  2HF5 A;  2AUC A;  1JF0 A;  1AVS A;  4OR9 B;  5HYD A;  3DVJ A;  1FI6 A;  1QV1 A;  1NCY A;  1QX2 A;  4A4B A;  1DMO A;  3AKA A;  1OQP A;  3GOF A;  2LHL A;  1WLZ A;  1XFY O;  1TCO B;  4USL A;  1UWO A;  1IJ6 A;  2FOT A;  1DJW A;  1QJT A;  1SL7 A;  1BLQ A;  2M7N A;  1SKT A;  2M3W A;  1YVL A;  2I2R E;  1S6C A;  2ZNE A;  2KQY A;  4WQ3 A;  4L9M A;  1YUT A;  3SIB A;  2LLT A;  1IRJ A;  2HQ8 A;  1PSB A;  2WC8 A;  3I5G B;  1SCM C;  2JXL A;  3O2P A;  5G08 A;  1FPW A;  4GGF A;  4I5J A;  2LUC A;  5I2Q A;  1BMO A;  1RJV A;  4D1E A;  3NSO A;  1SNL A;  3IQQ A;  1WDC B;  2KOT A;  3I5F C;  1K90 D;  1NPQ A;  1YR5 A;  1CLL A;  3TS5 B;  1KFX S;  3CR2 A;  3GK4 X;  5AER A;  1NX3 A;  1TN4 A;  5BPJ A;  1JC2 A;  3DF0 B;  2AMI A;  2KAY A;  1QIV A;  3EKJ A;  3EVR A;  2WOR A;  2CNP A;  3NSI A;  1CLB A;  1M31 A;  1F8H A;  1SL8 A;  2M29 A;  1CDP A;  1QVI Z;  3BYA A;  1WRZ A;  3VRN A;  4CFR A;  2LVV A;  5ER5 A;  5CPV A;  1YX7 A;  1IGV A;  1QV0 A;  1J1E A;  3PFV A;  3OHM B;  4YGE B;  2Y4Q A;  1M63 B;  4ORA B;  1A75 B;  2FCD A;  4XJK A;  1BJF A;  1UHI A;  1CFD A;  1YUR A;  1KWO B;  1QLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...