2KGBC

Nmr solution of the regulatory domain cardiac f77w-troponin c in complex with the cardiac troponin i 144-163 switch peptide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
89
structure length
89
Chain Sequence
b'MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEWLVMMVRCMKDDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title The effect of the cosolvent trifluoroethanol on a tryptophan side chain orientation in the hydrophobic core of troponin C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein/ca binding protein
total genus 21
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kgbC00
2WCBA 1R2UA 2JTTA 1B9AA 4MZJA 2KYFA 4A4BA 1GGZA 1MQ1A 1BMOA 3WHTB 1CFPA 5JJGA 1RROA 1CM1A 1NX0A 1XFZO 2BE4A 2KDHA 1M45A 2FJUB 4C0JA 4ICBA 4PCWA 3SIAA 1K93D 1QLSA 2HF5A 3K21A 2FOTA 4WRIA 3IQQA 5F6TA 2HETA 2L51A 1UHHA 2K7CA 2L5XB 4U8DA 4ZCUA 3TS5C 2L2EA 1J55A 2LCPA 2LHIA 4CFRA 2MRDA 1YUUA 3LCPC 2WOSA 4CPVA 2KAXA 1VRKA 2JNXA 5GQQC 1JSAA 1QX2A 1V1FA 1F71A 2BBNA 3KPXA 2KI6C 4YBHB 1Y0VH 2M1KB 3I5GB 3WXAA 4GNKB 1B4CA 1KK7Y 1K96A 2JPTA 3TUYC 1N0YA 2JT3A 2BL0C 1QIWA 1SL9A 5AEQA 3I5IC 1KFXL 1RFJA 1J7RA 1NX1A 2PALA 4GUKA 1G33A 3DVEA 2JULA 4C0LA 1WDCC 1N65A 5ER4X 1V1GA 3DF0B 3GK2A 1LKJA 3RM1A 2M9GA 2MA2A 1D1OA 1EL4A 5ER5A 3LLEA 3FWBA 2F8PA 1MR8A 4PE1A 3CR2A 2NXQA 5DKNA 1ZOTB 1CDLA 3CTNA 4I5LB 5CSJA 1EJ3A 1TCOB 2KQ6A 1YRUB 1FBVA 3AAJA 1KWOB 1SBJA 1UUSA 5AFPA 1NCZA 2HQWA 5HKYA 3EKHA 4BY5A 4MEWA 2LE9B 2QACA 3DD4A 1UHKA 2CBLA 4PHMA 5BPJA 2KOTA 3CR4X 1DGVA 1S3PA 4OCIA 1NIWA 1QX7A 3O78A 1AK8A 2EC6B 1J7PA 2BCAA 4M2PA 3QRXA 2BKHB 3CZTX 3EK4A 4ORBB 3O6BA 1R6PA 1CDPA 4OV2A 1UHJA 2Q4UA 4UPGA 4ORCB 1DF0A 1XA5A 1LINA 1SR6B 1KFXS 2B1UA 2LVIA 3DF0A 3SG4A 2HQ8A 1FW4A 2KI6D 1LA0A 4ETOA 4CLNA 1NUBA 1L7ZA 4USLA 1B7TZ 1K9KA 1MF8B 1N2DA 1CLLA 1NX2A 1SNLA 3TDIA 1TNQA 1CDMA 1A75B 1F55A 2OPOA 2LAPA 5CSFA 2K0JA 4WQ2A 5DKRA 1DMOA 2KFFA 5KSZA 4YGEB 1IGVA 2JT8A 1FI5A 2KBIA 1OE9B 2I18A 4ZCVA 2LV7A 2KFHA 3NSLA 1A29A 1YR5A 1CFFA 2JOJA 3TDZA 3OX6A 1HQVA 1PK0D 2KYCA 4N5XA 2O5GA 1M63B 1SMGA 1NX3A 2M1UA 2ZNEA 1KQMB 1CLBA 2PMYA 4OVNF 5DKQA 2JWWA 3TDUA 2PSRA 3DVKA 1ZACA 3JTDC 1C7WA 5AXIA 3A8RA 3CS1A 1M46A 1K95A 2JNFA 1ZUZA 2JZIA 2A4JA 1B7TY 2FCDA 1KK7Z 2M97A 5G08A 2CT9A 3PN7C 3SJSA 3GK4X 1TIZA 2K61A 1OQPA 3EKJA 4TNCA 1QXPA 4Q04A 2EHBA 1PVAA 2JU0A 5I2LA 1SK6D 1XK4C 2KGRA 2NLNA 1CKKA 5IBWA 1F8HA 1TCFA 3FS7A 2L98A 1Y1XA 4PE7A 1H4BA 1DJGA 3MSEB 4YI9A 2K7BA 4PE4A 4XYNA 1OSAA 1XYDA 2OS8B 2H2KA 1KFUL 2KSPA 3WHUB 4AOMA 1DT7B 3SG6A 3I5FB 3BOWB 2F3ZA 2EGDA 2BCXA 1UWOA 2K8MB 1SYMA 3JVTB 3VRPA 4PE0A 1RJVA 4MRXA 1TTXA 1NPQA 1YUSA 1U5IA 1OMRA 1BR1B 2LMUA 1IJ6A 2PASA 2JRFA 2KFGA 1GQMA 2WCFA 2ZRSA 4NDBA 1CTRA 1MXLC 4DUQA 1IJ5A 1CFDA 2M0RA 3EK8A 1DGUA 1QX5B 1SKTA 1YX7A 1L2OC 1YX8A 3O2PA 4M2OA 1J1DA 3BUWB 4N1FA 2M29A 4HRHA 2CTNA 2LMVA 2LVKA 1SCMC 1XK4A 3PM8A 4QJ4B 1F54A 1LXFC 3BQ3A 2E30A 3CR5X 1QS7A 3TS5B 2KI4B 5HKWA 1ZFSA 1EG4A 2K7DA 1TOPA 4OKHA 4E68A 2M49B 2MBXA 3CWGA 1XVJA 2NZ0A 1KWOC 2BECA 3C1VA 4NDCA 1K2HA 5TNCA 2L4HA 1M31A 5CSIA 1E8AA 1KFUS 4MLWA 2KNEA 5AERA 3GK1A 2EC6C 2WORA 2BBMA 1NCXA 4I5KA 2O60A 5J3XA 2LHLA 1KSOA 5AANA 3IF7A 4NDDA 2H61C 1WDCB 4GAOA 1UHNA 1X02A 1CLMA 2ZN9A 4MRYA 2LM5A 3EVUA 4YRUA 1AHRA 3BUMB 1SR6C 2BCBA 5FYXA 1S1EA 1RTP1 2GGZA 3D0YB 2LP3A 1WRKA 1IWQA 1UP5A 1G4YR 2E6WA 2KQYA 1SW8A 1A2XA 2AMIA 4YI8A 3OB2B 2HPSA 1K90D 3KF9A 2VRGA 1JBAA 1YTZC 1IQ3A 4JPZB 2LC5A 4HREE 4PHJA 1RECA 1UHIA 1BU3A 1OMVA 1QTXA 2LLTA 4CIDA 3LL8B 1BR4B 3ICBA 1DJWA 4XJKB 1XFVO 2LUXA 3BYAA 2OTGC 1PULA 2WC8A 4GGFC 4R1EA 4YGCB 1MXEA 3I5HB 3PLFB 3VRQA 1A4PA 3LK0A 5I2OA 1QV1A 2MHHA 3KO0A 1JF2A 1EXRA 1ZMZA 2L4IA 2NCPA 2H61A 1RWYA 1KQMC 1SRAA 1DTLA 2L50A 4C0KA 2Y1MA 1PSRA 4I5NB 1IKUA 1RK9A 1NP8A 2F2PA 1CMGA 2LLUA 3SG2A 1XFWO 4YGAA 1BT6A 1XFYO 2AUCA 3FWCA 4HSZA 2K2AA 4PALA 3FIAA 1TNWA 2G9BA 4MZKA 1BG1A 2COLB 1K9UA 3EK7A 2F3YA 2AAOA 1PRWA 3TZ1A 5CSNA 4IL1A 1NCYA 1A75A 2DOQA 5I2QA 4YGBB 1BOCA 2I2RE 1PSBA 3D10A 4AQJA 4A4CA 3LK1A 2MJWB 2ZRTA 4GGFA 2JXLA 2ZKMX 2OS8C 1KK8B 1K8UA 1QLKA 1YURA 1OOJA 1AJ4A 2G2BA 1CB1A 2CNPA 1S6CA 1S5GY 3I5FC 2F33A 1J7OA 1MUXA 1DJXA 1QVIY 4N1GA 3OB1B 1A03A 3BUNB 3E3RA 2MAZA 3HCMA 1KCYA 1HT9A 1OZOA 1XFUO 4GBAA 1F70A 3PFVA 4DS7A 5CPVA 1B1GA 3I5GC 1FI6A 1KSMA 2LNKA 1SCVA 4M2QA 1QASA 2Y1NA 1SL7A 2KBMA 2ZNDA 4D1EA 1NYAA 3KHEA 4OR9B 2I7AA 5D69A 5D7FA 4MSPA 1H8BA 2F2OA 1OMDA 5KU1A 3RLZA 4WQ3A 1J1EA 1F4QA 3GOFA 3WNXB 3AKBA 1CMFA 2KI4C 1TRFA 2JT0A 3NSOA 1S6JA 4PHKA 1NSHA 1MWNA 1YVHA 2PVBA 1Y1UA 2IS9A 2LUCA 4GFTA 2V53A 3PALA 1DJIA 1UURA 5JOLA 2LLSA 2LP2A 1IG5A 4HRGA 1WRZA 2Y4QA 4FQOA 2BE6A 3NSKA 1FPWA 3BOWA 3SG7A 3BUOB 4QJ3B 1JFKA 3PSRA 1BJFA 3TUYB 1DF0B 4YGDB 1PVBA 2BL0B 3AAKA 3SG5A 1W7JB 1DVIA 3F45A 1C07A 3CLNA 3I5IB 2KAYA 5B8IB 5HLVA 1M39A 1LA3A 2ISDA 3ZNIA 1L2OB 4DRWA 1FF1A 1Y6WA 4DIRA 4AQIA 2GV5A 1ALVA 1SCMB 1SY9A 1KQVA 1EH2A 3OHMB 3OP0A 1IRJA 5K89A 2SASA 1BODA 4MVFA 1WLZA 2MLEC 1B8LA 3NXAA 2KHNA 3VGOA 1GJYA 2FCEA 3KEVA 1SL8A 1MHOA 1IH0A 1JWDA 2GGMA 3VROA 1B8RA 2Q91A 2CCMA 5I8NA 2K7OA 1LVCD 4PHNA 1ODBA 3VRRA 4F0ZB 1SPYA 3EVVA 1GGWA 1WY9A 2P6BB 1Q80A 3ZWHA 1CM4A 4P5OE 1G8IA 2WNDA 1CDNA 2LANA 3I5HC 4MZLA 1Y1AA 1QV0A 4MBEA 2SCPA 4CFQA 1IQ5A 2JXCA 2PRUA 1DJZA 2WCEA 5KTYA 1PALA 1BF5A 1CNPA 5HLOA 2K2FA 2R2IA 3HX4A 1QJTA 2ZN8A 5PALA 2M8UA 4BY4A 2I94A 3EVRA 2ZFDA 5HYDA 1J7QA 1S5GZ 1DJYA 1C7VA 4I5JA 1XO5A 2LMTA 1QVIZ 3AKAA 1JUOA 1W7IB 3NSIA 3D0YA 2TN4A 1JC2A 1TNXA 2M7LA 1QIVA 1XFXO 3SIBA 1JF0A 1TN4A 2CXJA 2KAVA 3BUXB 2D8NA 2OTGB 4ORAB 2BKIB 1K94A 1JFJA 1S26D 1F4OA 3IQOA 1YVLA 1S36A 1S6IA 3BXKA 3O4YA 2Y5IA 2MLFC 5HKZA 1WLMA 1AP4A 3A4UB 4XJKA 2M3WA 4DCKA 1QATA 1YUTA 2JC2A 2JTZA 4P2YB 4MN0A 2QPTA 2L0PA 3CGAA 1ALWA 4NQGA 1AVSA 1KK8C 1CFCA 4QJ5B 1EG3A 3H4SE 2LVVA 4FTGA 2M7NA 1YRTB 3PATA 1AJ5A 1OZSA 1TNPA 2LVJA 3JTDB 4GGNA 2RGIA 1BLQA 4PDZA 1DJHA 1U5IB 1B8CA 2KGBC 4GPLB 4L9MA 3DVJA 1WRLA 3JVTC 3M0WA 1B47A 2NCOA 3OX5A 4JQ0D 4JWQA 3SG3A 1K9PA 3PN7B 3DVMA 1NWDA 3VRNA 2JQ6A 1AUIB
chains in the Genus database with same CATH superfamily
2WCBA 1R2UA 2JTTA 3OBVA 1B9AA 4MZJA 2KYFA 2KLDA 4A4BA 1GGZA 1TUZA 1MQ1A 1BMOA 3WHTB 1CFPA 5JJGA 1RROA 1CM1A 1T14A 1NX0A 1XFZO 2BE4A 2KDHA 1M45A 2FJUB 4C0JA 4ICBA 4PCWA 3SIAA 1K93D 1QLSA 2HF5A 3K21A 2FOTA 4WRIA 3IQQA 5F6TA 2HETA 1W9ZA 1UHHA 2K7CA 2L51A 2L5XB 4U8DA 4ZCUA 2L2EA 1J55A 2LCPA 2LHIA 3BFHA 2MRDA 1YUUA 3DY9A 3LCPC 2WOSA 4CPVA 2KAXA 1VRKA 2JNXA 5GQQC 1JSAA 1QX2A 1V1FA 1F71A 2BBNA 3KPXA 2KI6C 4YBHB 3UO9A 1Y0VH 2M1KB 3I5GB 3S0BA 3WXAA 4GNKB 1B4CA 1KK7Y 3L4LA 1K96A 2JPTA 3TUYC 1N0YA 3NHTA 2JT3A 2BL0C 1QIWA 1SL9A 5AEQA 1XFRA 3I5IC 1KFXL 1RFJA 1J7RA 1NX1A 3CZ1A 2PALA 4GUKA 1G33A 1Z4HA 3DVEA 2JULA 4C0LA 1WDCC 1N65A 5ER4X 1V1GA 3DF0B 3GK2A 1LKJA 3RM1A 2M9GA 2MA2A 1D1OA 1EL4A 5ER5A 3LLEA 3FWBA 2F8PA 1MR8A 4PE1A 3CR2A 2NXQA 5DKNA 1ZOTB 1CDLA 3CTNA 3R72A 4I5LB 5CSJA 1EJ3A 1TCOB 2KQ6A 1YRUB 1FBVA 3AAJA 1KWOB 3V2LA 1SBJA 1UUSA 5AFPA 1NCZA 2HQWA 2YGUA 3EKHA 4BY5A 5HKYA 2WC5A 4MEWA 2LE9B 2QACA 3DD4A 3CDNA 1UHKA 2CBLA 3NHIA 3R1OA 2KOTA 3CR4X 1DGVA 4PHMA 1S3PA 4OCIA 1NIWA 1QX7A 3O78A 1AK8A 2EC6B 1J7PA 1DELA 2BCAA 4M2PA 3QRXA 2BKHB 3CZTX 3EK4A 4ORBB 3O6BA 3SS5A 1R6PA 1CDPA 4OV2A 1UHJA 3TS5C 2Q4UA 4UPGA 4ORCB 1DF0A 1XA5A 1SR6B 1KFXS 2B1UA 2LVIA 3DF0A 3SG4A 2HQ8A 1FW4A 2KI6D 1LA0A 4ETOA 4CLNA 1NUBA 1L7ZA 1P28A 4USLA 1B7TZ 1K9KA 1QWVA 1MF8B 1N2DA 1CLLA 1NX2A 1SNLA 3S0EA 3TDIA 1TNQA 1CDMA 1A75B 1F55A 2OPOA 2LAPA 5CSFA 2K0JA 3S0FA 4WQ2A 5DKRA 1DMOA 2KFFA 5KSZA 4YGEB 3O4XA 1IGVA 2JT8A 1FI5A 1Z2CB 2KBIA 4FQTA 1OE9B 2I18A 4ZCVA 2LV7A 2KFHA 2L2CA 1A29A 1YR5A 3NSLA 1CFFA 2JOJA 2WCHA 4CFRA 3B86A 3TDZA 3OX6A 1HQVA 1PK0D 2KYCA 4N5XA 2O5GA 1M63B 1SMGA 5D3OA 1NX3A 2M1UA 2BNXA 2JPOA 2ZNEA 1KQMB 1CLBA 2PMYA 4OVNF 5DKQA 2JWWA 3TDUA 2PSRA 3DVKA 1ZACA 3JTDC 1C7WA 5AXIA 3A8RA 3CS1A 1M46A 1K95A 2PYQA 2JNFA 2FJYA 1ZUZA 2JZIA 2A4JA 1B7TY 2FCDA 1KK7Z 2M97A 5G08A 2CT9A 3PN7C 3SJSA 3UNWA 3B7AA 5FI7A 3GK4X 1TIZA 2K61A 1OQPA 3EKJA 2P70A 4TNCA 1QXPA 4Q04A 2EHBA 1PVAA 2JU0A 5I2LA 1SK6D 1XK4C 2KGRA 2NLNA 1CKKA 5IBWA 2QEVA 1F8HA 1TCFA 3FS7A 2L98A 1Y1XA 4PE7A 1H4BA 1DJGA 3MSEB 4YI9A 2K7BA 4PE4A 4XYNA 1OSAA 1XYDA 2OS8B 2H2KA 1KFUL 2KSPA 3WHUB 4AOMA 1DT7B 1SSEB 3SG6A 3I5FB 3BOWB 2F3ZA 2EGDA 4JKTA 2BCXA 1UWOA 2K8MB 4PT1A 1SYMA 3JVTB 3VRPA 4PE0A 1RJVA 1AUIB 1ORGA 2QDIA 2WCMA 4MRXA 3D74A 1TTXA 1NPQA 1YUSA 1U5IA 1OMRA 2P71A 1BR1B 3BFAA 2LMUA 1IJ6A 2PASA 2JRFA 2KFGA 1GQMA 2WCFA 2ZRSA 4NDBA 1CTRA 1MXLC 4DUQA 1IJ5A 1CFDA 2M0RA 3EK8A 1DGUA 3N7HA 1QX5B 1SKTA 1YX7A 1L2OC 1YX8A 2QEHA 3O2PA 1J1DA 3BUWB 4M2OA 4N1FA 2M29A 4HRHA 2CTNA 2LMVA 2LVKA 3D76A 1SCMC 1XK4A 3EG5B 3PM8A 4QJ4B 1LXFC 2K60A 2E30A 3BQ3A 3CR5X 3CYZA 5I94A 1F54A 4INWA 1QS7A 3TS5B 2KI4B 5HKWA 1ZFSA 1EG4A 2K7DA 1TOPA 3K1EA 4OKHA 4E68A 1IIOA 2M49B 2MBXA 3CWGA 1XVJA 2NZ0A 1KWOC 2BECA 3C1VA 4NDCA 1K2HA 5TNCA 2L4HA 1M31A 5CSIA 1E8AA 1KFUS 1TWOA 4MLWA 2KNEA 5AERA 3GK1A 2EC6C 2WORA 2BBMA 1NCXA 4I5KA 2O60A 5J3XA 2LHLA 1KSOA 5AANA 3IF7A 4NDDA 2H61C 3S0AA 3S0DA 1WDCB 4GAOA 1UHNA 1X02A 1CLMA 2ZN9A 4MRYA 2LM5A 3EVUA 4YRUA 1AHRA 3BUMB 1SR6C 2BCBA 5FYXA 1S1EA 1RTP1 1DQEA 2GGZA 2LP3A 3D0YB 1WRKA 1IWQA 1UP5A 1G4YR 2E6WA 2KQYA 1SW8A 1A2XA 2AMIA 4YI8A 3OB2B 2HPSA 1K90D 3KF9A 2WCLA 2VRGA 1JBAA 1YTZC 1IQ3A 4JPZB 2QEOA 2LC5A 3B6XA 4HREE 4PHJA 1RECA 1GM0A 1UHIA 1BU3A 1OMVA 1QTXA 2LLTA 4CIDA 3LL8B 1BR4B 3ICBA 1DJWA 4XJKB 1XFVO 2LUXA 3BYAA 2OTGC 1PULA 2WC8A 4GGFC 3DYEA 4R1EA 1MXEA 4YGCB 3I5HB 3PLFB 3VRQA 2H8VA 1A4PA 3LK0A 5EL2A 1QV1A 3OGNA 5I2OA 2MHHA 3KO0A 1JF2A 1EXRA 1ZMZA 2L4IA 2NCPA 2H61A 1RWYA 1KQMC 1SRAA 1DTLA 2L50A 4C0KA 3S0GA 2Y1MA 1PSRA 1C3ZA 4I5NB 1IKUA 1RK9A 1NP8A 2F2PA 1CMGA 2LLUA 3SG2A 1XFWO 4YGAA 1BT6A 1XFYO 2AUCA 3FWCA 4HSZA 2K2AA 4PALA 1OW4A 3FIAA 1TNWA 2G9BA 4MZKA 1BG1A 4KYNA 5DICA 2COLB 1K9UA 3EK7A 2F3YA 2AAOA 1PRWA 3TZ1A 5CSNA 4IL1A 1NCYA 1A75A 2DOQA 5I2QA 4YGBB 1BOCA 2I2RE 1PSBA 3D10A 4AQJA 4A4CA 3LK1A 3PJIA 2MJWB 2ZRTA 3BFBA 4GGFA 2JXLA 2ZKMX 2OS8C 1KK8B 1K8UA 1QLKA 3RZSA 1YURA 3D77A 1OOJA 1AJ4A 2G2BA 1CB1A 2CNPA 1TUJA 1S6CA 1S5GY 3FE9A 3I5FC 4INXA 2F33A 1J7OA 3D78A 1MUXA 3CZ2A 1DJXA 1QVIY 4N1GA 3OB1B 1A03A 3BUNB 3E3RA 2MAZA 3HCMA 1KCYA 1HT9A 1OZOA 1XFUO 4GBAA 1F70A 3PFVA 4DS7A 5CPVA 1B1GA 3SS3A 3I5GC 4F7FA 2GTEA 2QEBA 1FI6A 1KSMA 2WCJA 2LNKA 1SCVA 4M2QA 1QASA 2Y1NA 1SL7A 2KBMA 2KLEA 2ZNDA 4D1EA 1NYAA 3KHEA 4OZDA 4OR9B 2I7AA 5D69A 5D7FA 4MSPA 1H8BA 2F2OA 1OMDA 5KU1A 3RLZA 4WQ3A 1J1EA 1F4QA 3GOFA 3WNXB 3AKBA 1CMFA 2KI4C 1TRFA 2JT0A 3NSOA 3SS4A 1S6JA 4PHKA 1OOHA 1NSHA 1MWNA 1YVHA 2PVBA 1Y1UA 2IS9A 2LUCA 4GFTA 2V53A 3PALA 1DJIA 1UURA 5JOLA 2LLSA 2LP2A 1IG5A 4HRGA 1WRZA 2Y4QA 4FQOA 3L47A 2BE6A 3NSKA 1FPWA 3BOWA 3SG7A 3BUOB 4QJ3B 1JFKA 3PSRA 1BJFA 3TUYB 1DF0B 4YGDB 1LS8A 1PVBA 2BL0B 3AAKA 3SG5A 1W7JB 1DVIA 3F45A 1C07A 3CLNA 3I5IB 3PM2A 2KAYA 3DXLA 5B8IB 5HLVA 1M39A 1LA3A 2ISDA 3ZNIA 1L2OB 3B87A 4DRWA 1FF1A 1Y6WA 4DIRA 4AQIA 2GV5A 1ALVA 1SCMB 1SY9A 1KQVA 1EH2A 3OHMB 3OP0A 1IRJA 5K89A 2SASA 1BODA 3CABA 4MVFA 1WLZA 2MLEC 1B8LA 3NXAA 2KHNA 3VGOA 1GJYA 2FCEA 3KEVA 1SL8A 1MHOA 1IH0A 1JWDA 2GGMA 3VROA 1B8RA 2Q91A 5FI2A 2CCMA 5I8NA 2K7OA 3Q8IA 1LVCD 4PHNA 1ODBA 3VRRA 5FI6A 4JD9A 2WCKA 4F0ZB 1SPYA 3EVVA 1GGWA 1WY9A 2P6BB 1Q80A 3QMEA 3ZWHA 1CM4A 4P5OE 1G8IA 2WNDA 1CDNA 2LANA 3I5HC 4IJ7A 1Y1AA 4MZLA 1QV0A 4MBEA 2SCPA 4CFQA 1OOIX 1IQ5A 2JXCA 2PRUA 1DJZA 2WCEA 2WC6A 5KTYA 2BAPA 1PALA 1BF5A 1CNPA 5HLOA 5HL1A 2K2FA 2R2IA 3HX4A 1QJTA 2KPHA 2ZN8A 3L4AA 2M8UA 5PALA 2I94A 3EVRA 2ZFDA 4BY4A 2L5YA 5HYDA 1J7QA 5BPJA 1S5GZ 1DJYA 3VB1A 1C7VA 1OOGA 4I5JA 1XO5A 2LMTA 1QVIZ 3AKAA 1JUOA 1W7IB 1DEKA 3NSIA 1C3YA 3D0YA 2TN4A 1JC2A 1TNXA 3NGVA 2M7LA 1QIVA 1XFXO 3SIBA 3D75A 1JF0A 1TN4A 2CXJA 2KAVA 3BUXB 1DC1A 2D8NA 2OTGB 3D73A 2BKIB 1K94A 4ORAB 1JFJA 1S26D 1F4OA 3IQOA 1YVLA 1S36A 1S6IA 3BXKA 3FE6A 2Y5IA 3O4YA 2MLFC 5HKZA 3FE8A 1WLMA 1AP4A 3A4UB 2ERBA 3CZ0A 2M3WA 4XJKA 1QATA 1YUTA 2JC2A 4DCKA 2JTZA 3DZTA 4MN0A 4P2YB 2QPTA 2L0PA 3CGAA 1ALWA 4NQGA 1AVSA 1KK8C 1CFCA 4QJ5B 1EG3A 3H4SE 2LVVA 4FTGA 1OOFA 2M7NA 1YRTB 3B88A 2PQLA 3PATA 1AJ5A 1OZSA 1TNPA 2LVJA 3JTDB 4GGNA 2RGIA 1BLQA 4PDZA 1DJHA 1U5IB 3R1PA 1B8CA 2KGBC 3BJHA 4GPLB 4L9MA 3DVJA 1WRLA 3JVTC 3M0WA 3IVTA 1B47A 2NCOA 3OX5A 4JQ0D 3R1VA 4JWQA 3SG3A 1K9PA 3PN7B 3DVMA 1NWDA 3VRNA 2JQ6A 1LINA
chains in the Genus database with same CATH topology
2WCBA 1R2UA 2JTTA 1B9AA 4MZJA 2KYFA 4A4BA 1GGZA 1MQ1A 1BMOA 3WHTB 1CFPA 5JJGA 1RROA 1CM1A 1NX0A 1XFZO 2BE4A 2KDHA 1M45A 2FJUB 4C0JA 4ICBA 4PCWA 3SIAA 1K93D 1QLSA 2HF5A 3K21A 2FOTA 4WRIA 3IQQA 5F6TA 2HETA 2L51A 1UHHA 2K7CA 2L5XB 4U8DA 4ZCUA 3TS5C 2L2EA 1J55A 2LCPA 2LHIA 4CFRA 2MRDA 1YUUA 3LCPC 2WOSA 4CPVA 2KAXA 1VRKA 2JNXA 5GQQC 1JSAA 1QX2A 1V1FA 1F71A 2BBNA 3KPXA 2KI6C 4YBHB 1Y0VH 2M1KB 3I5GB 3WXAA 4GNKB 1B4CA 1KK7Y 1K96A 2JPTA 3TUYC 1N0YA 2JT3A 2BL0C 1QIWA 1SL9A 5AEQA 3I5IC 1KFXL 1RFJA 1J7RA 1NX1A 2PALA 4GUKA 1G33A 3DVEA 2JULA 4C0LA 1WDCC 1N65A 5ER4X 1V1GA 3DF0B 3GK2A 1LKJA 3RM1A 2M9GA 2MA2A 1D1OA 1EL4A 5ER5A 3LLEA 3FWBA 2F8PA 1MR8A 4PE1A 3CR2A 2NXQA 5DKNA 1ZOTB 1CDLA 3CTNA 4I5LB 5CSJA 1EJ3A 1TCOB 2KQ6A 1YRUB 1FBVA 3AAJA 1KWOB 1SBJA 1UUSA 5AFPA 1NCZA 2HQWA 5HKYA 3EKHA 4BY5A 4MEWA 2LE9B 2QACA 3DD4A 1UHKA 2CBLA 4PHMA 5BPJA 2KOTA 3CR4X 1DGVA 1S3PA 4OCIA 1NIWA 1QX7A 3O78A 1AK8A 2EC6B 1J7PA 2BCAA 4M2PA 3QRXA 2BKHB 3CZTX 3EK4A 4ORBB 3O6BA 1R6PA 1CDPA 4OV2A 1UHJA 2Q4UA 4UPGA 4ORCB 1DF0A 1XA5A 1LINA 1SR6B 1KFXS 2B1UA 2LVIA 3DF0A 3SG4A 2HQ8A 1FW4A 2KI6D 1LA0A 4ETOA 4CLNA 1NUBA 1L7ZA 4USLA 1B7TZ 1K9KA 1MF8B 1N2DA 1CLLA 1NX2A 1SNLA 3TDIA 1TNQA 1CDMA 1A75B 1F55A 2OPOA 2LAPA 5CSFA 2K0JA 4WQ2A 5DKRA 1DMOA 2KFFA 5KSZA 4YGEB 1IGVA 2JT8A 1FI5A 2KBIA 1OE9B 2I18A 4ZCVA 2LV7A 2KFHA 3NSLA 1A29A 1YR5A 1CFFA 2JOJA 3TDZA 3OX6A 1HQVA 1PK0D 2KYCA 4N5XA 2O5GA 1M63B 1SMGA 1NX3A 2M1UA 2ZNEA 1KQMB 1CLBA 2PMYA 4OVNF 5DKQA 2JWWA 3TDUA 2PSRA 3DVKA 1ZACA 3JTDC 1C7WA 5AXIA 3A8RA 3CS1A 1M46A 1K95A 2JNFA 1ZUZA 2JZIA 2A4JA 1B7TY 2FCDA 1KK7Z 2M97A 5G08A 2CT9A 3PN7C 3SJSA 3GK4X 1TIZA 2K61A 1OQPA 3EKJA 4TNCA 1QXPA 4Q04A 2EHBA 1PVAA 2JU0A 5I2LA 1SK6D 1XK4C 2KGRA 2NLNA 1CKKA 5IBWA 1F8HA 1TCFA 3FS7A 2L98A 1Y1XA 4PE7A 1H4BA 1DJGA 3MSEB 4YI9A 2K7BA 4PE4A 4XYNA 1OSAA 1XYDA 2OS8B 2H2KA 1KFUL 2KSPA 3WHUB 4AOMA 1DT7B 3SG6A 3I5FB 3BOWB 2F3ZA 2EGDA 2BCXA 1UWOA 2K8MB 1SYMA 3JVTB 3VRPA 4PE0A 1RJVA 4MRXA 1TTXA 1NPQA 1YUSA 1U5IA 1OMRA 1BR1B 2LMUA 1IJ6A 2PASA 2JRFA 2KFGA 1GQMA 2WCFA 2ZRSA 4NDBA 1CTRA 1MXLC 4DUQA 1IJ5A 1CFDA 2M0RA 3EK8A 1DGUA 1QX5B 1SKTA 1YX7A 1L2OC 1YX8A 3O2PA 4M2OA 1J1DA 3BUWB 4N1FA 2M29A 4HRHA 2CTNA 2LMVA 2LVKA 1SCMC 1XK4A 3PM8A 4QJ4B 1F54A 1LXFC 3BQ3A 2E30A 3CR5X 1QS7A 3TS5B 2KI4B 5HKWA 1ZFSA 1EG4A 2K7DA 1TOPA 4OKHA 4E68A 2M49B 2MBXA 3CWGA 1XVJA 2NZ0A 1KWOC 2BECA 3C1VA 4NDCA 1K2HA 5TNCA 2L4HA 1M31A 5CSIA 1E8AA 1KFUS 4MLWA 2KNEA 5AERA 3GK1A 2EC6C 2WORA 2BBMA 1NCXA 4I5KA 2O60A 5J3XA 2LHLA 1KSOA 5AANA 3IF7A 4NDDA 2H61C 1WDCB 4GAOA 1UHNA 1X02A 1CLMA 2ZN9A 4MRYA 2LM5A 3EVUA 4YRUA 1AHRA 3BUMB 1SR6C 2BCBA 5FYXA 1S1EA 1RTP1 2GGZA 3D0YB 2LP3A 1WRKA 1IWQA 1UP5A 1G4YR 2E6WA 2KQYA 1SW8A 1A2XA 2AMIA 4YI8A 3OB2B 2HPSA 1K90D 3KF9A 2VRGA 1JBAA 1YTZC 1IQ3A 4JPZB 2LC5A 4HREE 4PHJA 1RECA 1UHIA 1BU3A 1OMVA 1QTXA 2LLTA 4CIDA 3LL8B 1BR4B 3ICBA 1DJWA 4XJKB 1XFVO 2LUXA 3BYAA 2OTGC 1PULA 2WC8A 4GGFC 4R1EA 4YGCB 1MXEA 3I5HB 3PLFB 3VRQA 1A4PA 3LK0A 5I2OA 1QV1A 2MHHA 3KO0A 1JF2A 1EXRA 1ZMZA 2L4IA 2NCPA 2H61A 1RWYA 1KQMC 1SRAA 1DTLA 2L50A 4C0KA 2Y1MA 1PSRA 4I5NB 1IKUA 1RK9A 1NP8A 2F2PA 1CMGA 2LLUA 3SG2A 1XFWO 4YGAA 1BT6A 1XFYO 2AUCA 3FWCA 4HSZA 2K2AA 4PALA 3FIAA 1TNWA 2G9BA 4MZKA 1BG1A 2COLB 1K9UA 3EK7A 2F3YA 2AAOA 1PRWA 3TZ1A 5CSNA 4IL1A 1NCYA 1A75A 2DOQA 5I2QA 4YGBB 1BOCA 2I2RE 1PSBA 3D10A 4AQJA 4A4CA 3LK1A 2MJWB 2ZRTA 4GGFA 2JXLA 2ZKMX 2OS8C 1KK8B 1K8UA 1QLKA 1YURA 1OOJA 1AJ4A 2G2BA 1CB1A 2CNPA 1S6CA 1S5GY 3I5FC 2F33A 1J7OA 1MUXA 1DJXA 1QVIY 4N1GA 3OB1B 1A03A 3BUNB 3E3RA 2MAZA 3HCMA 1KCYA 1HT9A 1OZOA 1XFUO 4GBAA 1F70A 3PFVA 4DS7A 5CPVA 1B1GA 3I5GC 1FI6A 1KSMA 2LNKA 1SCVA 4M2QA 1QASA 2Y1NA 1SL7A 2KBMA 2ZNDA 4D1EA 1NYAA 3KHEA 4OR9B 2I7AA 5D69A 5D7FA 4MSPA 1H8BA 2F2OA 1OMDA 5KU1A 3RLZA 4WQ3A 1J1EA 1F4QA 3GOFA 3WNXB 3AKBA 1CMFA 2KI4C 1TRFA 2JT0A 3NSOA 1S6JA 4PHKA 1NSHA 1MWNA 1YVHA 2PVBA 1Y1UA 2IS9A 2LUCA 4GFTA 2V53A 3PALA 1DJIA 1UURA 5JOLA 2LLSA 2LP2A 1IG5A 4HRGA 1WRZA 2Y4QA 4FQOA 2BE6A 3NSKA 1FPWA 3BOWA 3SG7A 3BUOB 4QJ3B 1JFKA 3PSRA 1BJFA 3TUYB 1DF0B 4YGDB 1PVBA 2BL0B 3AAKA 3SG5A 1W7JB 1DVIA 3F45A 1C07A 3CLNA 3I5IB 2KAYA 5B8IB 5HLVA 1M39A 1LA3A 2ISDA 3ZNIA 1L2OB 4DRWA 1FF1A 1Y6WA 4DIRA 4AQIA 2GV5A 1ALVA 1SCMB 1SY9A 1KQVA 1EH2A 3OHMB 3OP0A 1IRJA 5K89A 2SASA 1BODA 4MVFA 1WLZA 2MLEC 1B8LA 3NXAA 2KHNA 3VGOA 1GJYA 2FCEA 3KEVA 1SL8A 1MHOA 1IH0A 1JWDA 2GGMA 3VROA 1B8RA 2Q91A 2CCMA 5I8NA 2K7OA 1LVCD 4PHNA 1ODBA 3VRRA 4F0ZB 1SPYA 3EVVA 1GGWA 1WY9A 2P6BB 1Q80A 3ZWHA 1CM4A 4P5OE 1G8IA 2WNDA 1CDNA 2LANA 3I5HC 4MZLA 1Y1AA 1QV0A 4MBEA 2SCPA 4CFQA 1IQ5A 2JXCA 2PRUA 1DJZA 2WCEA 5KTYA 1PALA 1BF5A 1CNPA 5HLOA 2K2FA 2R2IA 3HX4A 1QJTA 2ZN8A 5PALA 2M8UA 4BY4A 2I94A 3EVRA 2ZFDA 5HYDA 1J7QA 1S5GZ 1DJYA 1C7VA 4I5JA 1XO5A 2LMTA 1QVIZ 3AKAA 1JUOA 1W7IB 3NSIA 3D0YA 2TN4A 1JC2A 1TNXA 2M7LA 1QIVA 1XFXO 3SIBA 1JF0A 1TN4A 2CXJA 2KAVA 3BUXB 2D8NA 2OTGB 4ORAB 2BKIB 1K94A 1JFJA 1S26D 1F4OA 3IQOA 1YVLA 1S36A 1S6IA 3BXKA 3O4YA 2Y5IA 2MLFC 5HKZA 1WLMA 1AP4A 3A4UB 4XJKA 2M3WA 4DCKA 1QATA 1YUTA 2JC2A 2JTZA 4P2YB 4MN0A 2QPTA 2L0PA 3CGAA 1ALWA 4NQGA 1AVSA 1KK8C 1CFCA 4QJ5B 1EG3A 3H4SE 2LVVA 4FTGA 2M7NA 1YRTB 3PATA 1AJ5A 1OZSA 1TNPA 2LVJA 3JTDB 4GGNA 2RGIA 1BLQA 4PDZA 1DJHA 1U5IB 1B8CA 2KGBC 4GPLB 4L9MA 3DVJA 1WRLA 3JVTC 3M0WA 1B47A 2NCOA 3OX5A 4JQ0D 4JWQA 3SG3A 1K9PA 3PN7B 3DVMA 1NWDA 3VRNA 2JQ6A 1AUIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCB A;  1R2U A;  2JTT A;  1B9A A;  4MZJ A;  2KYF A;  4A4B A;  1GGZ A;  1MQ1 A;  1BMO A;  3WHT B;  1CFP A;  5JJG A;  1RRO A;  1CM1 A;  1NX0 A;  1XFZ O;  2BE4 A;  2KDH A;  1M45 A;  2FJU B;  4C0J A;  4ICB A;  4PCW A;  3SIA A;  1K93 D;  1QLS A;  2HF5 A;  3K21 A;  2FOT A;  4WRI A;  3IQQ A;  5F6T A;  2HET A;  2L51 A;  1UHH A;  2K7C A;  2L5X B;  4U8D A;  4ZCU A;  3TS5 C;  2L2E A;  1J55 A;  2LCP A;  2LHI A;  4CFR A;  2MRD A;  1YUU A;  3LCP C;  2WOS A;  4CPV A;  2KAX A;  1VRK A;  2JNX A;  5GQQ C;  1JSA A;  1QX2 A;  1V1F A;  1F71 A;  2BBN A;  3KPX A;  2KI6 C;  4YBH B;  1Y0V H;  2M1K B;  3I5G B;  3WXA A;  4GNK B;  1B4C A;  1KK7 Y;  1K96 A;  2JPT A;  3TUY C;  1N0Y A;  2JT3 A;  2BL0 C;  1QIW A;  1SL9 A;  5AEQ A;  3I5I C;  1KFX L;  1RFJ A;  1J7R A;  1NX1 A;  2PAL A;  4GUK A;  1G33 A;  3DVE A;  2JUL A;  4C0L A;  1WDC C;  1N65 A;  5ER4 X;  1V1G A;  3DF0 B;  3GK2 A;  1LKJ A;  3RM1 A;  2M9G A;  2MA2 A;  1D1O A;  1EL4 A;  5ER5 A;  3LLE A;  3FWB A;  2F8P A;  1MR8 A;  4PE1 A;  3CR2 A;  2NXQ A;  5DKN A;  1ZOT B;  1CDL A;  3CTN A;  4I5L B;  5CSJ A;  1EJ3 A;  1TCO B;  2KQ6 A;  1YRU B;  1FBV A;  3AAJ A;  1KWO B;  1SBJ A;  1UUS A;  5AFP A;  1NCZ A;  2HQW A;  5HKY A;  3EKH A;  4BY5 A;  4MEW A;  2LE9 B;  2QAC A;  3DD4 A;  1UHK A;  2CBL A;  4PHM A;  5BPJ A;  2KOT A;  3CR4 X;  1DGV A;  1S3P A;  4OCI A;  1NIW A;  1QX7 A;  3O78 A;  1AK8 A;  2EC6 B;  1J7P A;  2BCA A;  4M2P A;  3QRX A;  2BKH B;  3CZT X;  3EK4 A;  4ORB B;  3O6B A;  1R6P A;  1CDP A;  4OV2 A;  1UHJ A;  2Q4U A;  4UPG A;  4ORC B;  1DF0 A;  1XA5 A;  1LIN A;  1SR6 B;  1KFX S;  2B1U A;  2LVI A;  3DF0 A;  3SG4 A;  2HQ8 A;  1FW4 A;  2KI6 D;  1LA0 A;  4ETO A;  4CLN A;  1NUB A;  1L7Z A;  4USL A;  1B7T Z;  1K9K A;  1MF8 B;  1N2D A;  1CLL A;  1NX2 A;  1SNL A;  3TDI A;  1TNQ A;  1CDM A;  1A75 B;  1F55 A;  2OPO A;  2LAP A;  5CSF A;  2K0J A;  4WQ2 A;  5DKR A;  1DMO A;  2KFF A;  5KSZ A;  4YGE B;  1IGV A;  2JT8 A;  1FI5 A;  2KBI A;  1OE9 B;  2I18 A;  4ZCV A;  2LV7 A;  2KFH A;  3NSL A;  1A29 A;  1YR5 A;  1CFF A;  2JOJ A;  3TDZ A;  3OX6 A;  1HQV A;  1PK0 D;  2KYC A;  4N5X A;  2O5G A;  1M63 B;  1SMG A;  1NX3 A;  2M1U A;  2ZNE A;  1KQM B;  1CLB A;  2PMY A;  4OVN F;  5DKQ A;  2JWW A;  3TDU A;  2PSR A;  3DVK A;  1ZAC A;  3JTD C;  1C7W A;  5AXI A;  3A8R A;  3CS1 A;  1M46 A;  1K95 A;  2JNF A;  1ZUZ A;  2JZI A;  2A4J A;  1B7T Y;  2FCD A;  1KK7 Z;  2M97 A;  5G08 A;  2CT9 A;  3PN7 C;  3SJS A;  3GK4 X;  1TIZ A;  2K61 A;  1OQP A;  3EKJ A;  4TNC A;  1QXP A;  4Q04 A;  2EHB A;  1PVA A;  2JU0 A;  5I2L A;  1SK6 D;  1XK4 C;  2KGR A;  2NLN A;  1CKK A;  5IBW A;  1F8H A;  1TCF A;  3FS7 A;  2L98 A;  1Y1X A;  4PE7 A;  1H4B A;  1DJG A;  3MSE B;  4YI9 A;  2K7B A;  4PE4 A;  4XYN A;  1OSA A;  1XYD A;  2OS8 B;  2H2K A;  1KFU L;  2KSP A;  3WHU B;  4AOM A;  1DT7 B;  3SG6 A;  3I5F B;  3BOW B;  2F3Z A;  2EGD A;  2BCX A;  1UWO A;  2K8M B;  1SYM A;  3JVT B;  3VRP A;  4PE0 A;  1RJV A;  4MRX A;  1TTX A;  1NPQ A;  1YUS A;  1U5I A;  1OMR A;  1BR1 B;  2LMU A;  1IJ6 A;  2PAS A;  2JRF A;  2KFG A;  1GQM A;  2WCF A;  2ZRS A;  4NDB A;  1CTR A;  1MXL C;  4DUQ A;  1IJ5 A;  1CFD A;  2M0R A;  3EK8 A;  1DGU A;  1QX5 B;  1SKT A;  1YX7 A;  1L2O C;  1YX8 A;  3O2P A;  4M2O A;  1J1D A;  3BUW B;  4N1F A;  2M29 A;  4HRH A;  2CTN A;  2LMV A;  2LVK A;  1SCM C;  1XK4 A;  3PM8 A;  4QJ4 B;  1F54 A;  1LXF C;  3BQ3 A;  2E30 A;  3CR5 X;  1QS7 A;  3TS5 B;  2KI4 B;  5HKW A;  1ZFS A;  1EG4 A;  2K7D A;  1TOP A;  4OKH A;  4E68 A;  2M49 B;  2MBX A;  3CWG A;  1XVJ A;  2NZ0 A;  1KWO C;  2BEC A;  3C1V A;  4NDC A;  1K2H A;  5TNC A;  2L4H A;  1M31 A;  5CSI A;  1E8A A;  1KFU S;  4MLW A;  2KNE A;  5AER A;  3GK1 A;  2EC6 C;  2WOR A;  2BBM A;  1NCX A;  4I5K A;  2O60 A;  5J3X A;  2LHL A;  1KSO A;  5AAN A;  3IF7 A;  4NDD A;  2H61 C;  1WDC B;  4GAO A;  1UHN A;  1X02 A;  1CLM A;  2ZN9 A;  4MRY A;  2LM5 A;  3EVU A;  4YRU A;  1AHR A;  3BUM B;  1SR6 C;  2BCB A;  5FYX A;  1S1E A;  1RTP 1;  2GGZ A;  3D0Y B;  2LP3 A;  1WRK A;  1IWQ A;  1UP5 A;  1G4Y R;  2E6W A;  2KQY A;  1SW8 A;  1A2X A;  2AMI A;  4YI8 A;  3OB2 B;  2HPS A;  1K90 D;  3KF9 A;  2VRG A;  1JBA A;  1YTZ C;  1IQ3 A;  4JPZ B;  2LC5 A;  4HRE E;  4PHJ A;  1REC A;  1UHI A;  1BU3 A;  1OMV A;  1QTX A;  2LLT A;  4CID A;  3LL8 B;  1BR4 B;  3ICB A;  1DJW A;  4XJK B;  1XFV O;  2LUX A;  3BYA A;  2OTG C;  1PUL A;  2WC8 A;  4GGF C;  4R1E A;  4YGC B;  1MXE A;  3I5H B;  3PLF B;  3VRQ A;  1A4P A;  3LK0 A;  5I2O A;  1QV1 A;  2MHH A;  3KO0 A;  1JF2 A;  1EXR A;  1ZMZ A;  2L4I A;  2NCP A;  2H61 A;  1RWY A;  1KQM C;  1SRA A;  1DTL A;  2L50 A;  4C0K A;  2Y1M A;  1PSR A;  4I5N B;  1IKU A;  1RK9 A;  1NP8 A;  2F2P A;  1CMG A;  2LLU A;  3SG2 A;  1XFW O;  4YGA A;  1BT6 A;  1XFY O;  2AUC A;  3FWC A;  4HSZ A;  2K2A A;  4PAL A;  3FIA A;  1TNW A;  2G9B A;  4MZK A;  1BG1 A;  2COL B;  1K9U A;  3EK7 A;  2F3Y A;  2AAO A;  1PRW A;  3TZ1 A;  5CSN A;  4IL1 A;  1NCY A;  1A75 A;  2DOQ A;  5I2Q A;  4YGB B;  1BOC A;  2I2R E;  1PSB A;  3D10 A;  4AQJ A;  4A4C A;  3LK1 A;  2MJW B;  2ZRT A;  4GGF A;  2JXL A;  2ZKM X;  2OS8 C;  1KK8 B;  1K8U A;  1QLK A;  1YUR A;  1OOJ A;  1AJ4 A;  2G2B A;  1CB1 A;  2CNP A;  1S6C A;  1S5G Y;  3I5F C;  2F33 A;  1J7O A;  1MUX A;  1DJX A;  1QVI Y;  4N1G A;  3OB1 B;  1A03 A;  3BUN B;  3E3R A;  2MAZ A;  3HCM A;  1KCY A;  1HT9 A;  1OZO A;  1XFU O;  4GBA A;  1F70 A;  3PFV A;  4DS7 A;  5CPV A;  1B1G A;  3I5G C;  1FI6 A;  1KSM A;  2LNK A;  1SCV A;  4M2Q A;  1QAS A;  2Y1N A;  1SL7 A;  2KBM A;  2ZND A;  4D1E A;  1NYA A;  3KHE A;  4OR9 B;  2I7A A;  5D69 A;  5D7F A;  4MSP A;  1H8B A;  2F2O A;  1OMD A;  5KU1 A;  3RLZ A;  4WQ3 A;  1J1E A;  1F4Q A;  3GOF A;  3WNX B;  3AKB A;  1CMF A;  2KI4 C;  1TRF A;  2JT0 A;  3NSO A;  1S6J A;  4PHK A;  1NSH A;  1MWN A;  1YVH A;  2PVB A;  1Y1U A;  2IS9 A;  2LUC A;  4GFT A;  2V53 A;  3PAL A;  1DJI A;  1UUR A;  5JOL A;  2LLS A;  2LP2 A;  1IG5 A;  4HRG A;  1WRZ A;  2Y4Q A;  4FQO A;  2BE6 A;  3NSK A;  1FPW A;  3BOW A;  3SG7 A;  3BUO B;  4QJ3 B;  1JFK A;  3PSR A;  1BJF A;  3TUY B;  1DF0 B;  4YGD B;  1PVB A;  2BL0 B;  3AAK A;  3SG5 A;  1W7J B;  1DVI A;  3F45 A;  1C07 A;  3CLN A;  3I5I B;  2KAY A;  5B8I B;  5HLV A;  1M39 A;  1LA3 A;  2ISD A;  3ZNI A;  1L2O B;  4DRW A;  1FF1 A;  1Y6W A;  4DIR A;  4AQI A;  2GV5 A;  1ALV A;  1SCM B;  1SY9 A;  1KQV A;  1EH2 A;  3OHM B;  3OP0 A;  1IRJ A;  5K89 A;  2SAS A;  1BOD A;  4MVF A;  1WLZ A;  2MLE C;  1B8L A;  3NXA A;  2KHN A;  3VGO A;  1GJY A;  2FCE A;  3KEV A;  1SL8 A;  1MHO A;  1IH0 A;  1JWD A;  2GGM A;  3VRO A;  1B8R A;  2Q91 A;  2CCM A;  5I8N A;  2K7O A;  1LVC D;  4PHN A;  1ODB A;  3VRR A;  4F0Z B;  1SPY A;  3EVV A;  1GGW A;  1WY9 A;  2P6B B;  1Q80 A;  3ZWH A;  1CM4 A;  4P5O E;  1G8I A;  2WND A;  1CDN A;  2LAN A;  3I5H C;  4MZL A;  1Y1A A;  1QV0 A;  4MBE A;  2SCP A;  4CFQ A;  1IQ5 A;  2JXC A;  2PRU A;  1DJZ A;  2WCE A;  5KTY A;  1PAL A;  1BF5 A;  1CNP A;  5HLO A;  2K2F A;  2R2I A;  3HX4 A;  1QJT A;  2ZN8 A;  5PAL A;  2M8U A;  4BY4 A;  2I94 A;  3EVR A;  2ZFD A;  5HYD A;  1J7Q A;  1S5G Z;  1DJY A;  1C7V A;  4I5J A;  1XO5 A;  2LMT A;  1QVI Z;  3AKA A;  1JUO A;  1W7I B;  3NSI A;  3D0Y A;  2TN4 A;  1JC2 A;  1TNX A;  2M7L A;  1QIV A;  1XFX O;  3SIB A;  1JF0 A;  1TN4 A;  2CXJ A;  2KAV A;  3BUX B;  2D8N A;  2OTG B;  4ORA B;  2BKI B;  1K94 A;  1JFJ A;  1S26 D;  1F4O A;  3IQO A;  1YVL A;  1S36 A;  1S6I A;  3BXK A;  3O4Y A;  2Y5I A;  2MLF C;  5HKZ A;  1WLM A;  1AP4 A;  3A4U B;  4XJK A;  2M3W A;  4DCK A;  1QAT A;  1YUT A;  2JC2 A;  2JTZ A;  4P2Y B;  4MN0 A;  2QPT A;  2L0P A;  3CGA A;  1ALW A;  4NQG A;  1AVS A;  1KK8 C;  1CFC A;  4QJ5 B;  1EG3 A;  3H4S E;  2LVV A;  4FTG A;  2M7N A;  1YRT B;  3PAT A;  1AJ5 A;  1OZS A;  1TNP A;  2LVJ A;  3JTD B;  4GGN A;  2RGI A;  1BLQ A;  4PDZ A;  1DJH A;  1U5I B;  1B8C A;  2KGB C;  4GPL B;  4L9M A;  3DVJ A;  1WRL A;  3JVT C;  3M0W A;  1B47 A;  2NCO A;  3OX5 A;  4JQ0 D;  4JWQ A;  3SG3 A;  1K9P A;  3PN7 B;  3DVM A;  1NWD A;  3VRN A;  2JQ6 A;  1AUI B; 
#chains in the Genus database with same CATH topology
 2WCB A;  1R2U A;  2JTT A;  3OBV A;  1B9A A;  4MZJ A;  2KYF A;  2KLD A;  4A4B A;  1GGZ A;  1TUZ A;  1MQ1 A;  1BMO A;  3WHT B;  1CFP A;  5JJG A;  1RRO A;  1CM1 A;  1T14 A;  1NX0 A;  1XFZ O;  2BE4 A;  2KDH A;  1M45 A;  2FJU B;  4C0J A;  4ICB A;  4PCW A;  3SIA A;  1K93 D;  1QLS A;  2HF5 A;  3K21 A;  2FOT A;  4WRI A;  3IQQ A;  5F6T A;  2HET A;  1W9Z A;  1UHH A;  2K7C A;  2L51 A;  2L5X B;  4U8D A;  4ZCU A;  2L2E A;  1J55 A;  2LCP A;  2LHI A;  3BFH A;  2MRD A;  1YUU A;  3DY9 A;  3LCP C;  2WOS A;  4CPV A;  2KAX A;  1VRK A;  2JNX A;  5GQQ C;  1JSA A;  1QX2 A;  1V1F A;  1F71 A;  2BBN A;  3KPX A;  2KI6 C;  4YBH B;  3UO9 A;  1Y0V H;  2M1K B;  3I5G B;  3S0B A;  3WXA A;  4GNK B;  1B4C A;  1KK7 Y;  3L4L A;  1K96 A;  2JPT A;  3TUY C;  1N0Y A;  3NHT A;  2JT3 A;  2BL0 C;  1QIW A;  1SL9 A;  5AEQ A;  1XFR A;  3I5I C;  1KFX L;  1RFJ A;  1J7R A;  1NX1 A;  3CZ1 A;  2PAL A;  4GUK A;  1G33 A;  1Z4H A;  3DVE A;  2JUL A;  4C0L A;  1WDC C;  1N65 A;  5ER4 X;  1V1G A;  3DF0 B;  3GK2 A;  1LKJ A;  3RM1 A;  2M9G A;  2MA2 A;  1D1O A;  1EL4 A;  5ER5 A;  3LLE A;  3FWB A;  2F8P A;  1MR8 A;  4PE1 A;  3CR2 A;  2NXQ A;  5DKN A;  1ZOT B;  1CDL A;  3CTN A;  3R72 A;  4I5L B;  5CSJ A;  1EJ3 A;  1TCO B;  2KQ6 A;  1YRU B;  1FBV A;  3AAJ A;  1KWO B;  3V2L A;  1SBJ A;  1UUS A;  5AFP A;  1NCZ A;  2HQW A;  2YGU A;  3EKH A;  4BY5 A;  5HKY A;  2WC5 A;  4MEW A;  2LE9 B;  2QAC A;  3DD4 A;  3CDN A;  1UHK A;  2CBL A;  3NHI A;  3R1O A;  2KOT A;  3CR4 X;  1DGV A;  4PHM A;  1S3P A;  4OCI A;  1NIW A;  1QX7 A;  3O78 A;  1AK8 A;  2EC6 B;  1J7P A;  1DEL A;  2BCA A;  4M2P A;  3QRX A;  2BKH B;  3CZT X;  3EK4 A;  4ORB B;  3O6B A;  3SS5 A;  1R6P A;  1CDP A;  4OV2 A;  1UHJ A;  3TS5 C;  2Q4U A;  4UPG A;  4ORC B;  1DF0 A;  1XA5 A;  1SR6 B;  1KFX S;  2B1U A;  2LVI A;  3DF0 A;  3SG4 A;  2HQ8 A;  1FW4 A;  2KI6 D;  1LA0 A;  4ETO A;  4CLN A;  1NUB A;  1L7Z A;  1P28 A;  4USL A;  1B7T Z;  1K9K A;  1QWV A;  1MF8 B;  1N2D A;  1CLL A;  1NX2 A;  1SNL A;  3S0E A;  3TDI A;  1TNQ A;  1CDM A;  1A75 B;  1F55 A;  2OPO A;  2LAP A;  5CSF A;  2K0J A;  3S0F A;  4WQ2 A;  5DKR A;  1DMO A;  2KFF A;  5KSZ A;  4YGE B;  3O4X A;  1IGV A;  2JT8 A;  1FI5 A;  1Z2C B;  2KBI A;  4FQT A;  1OE9 B;  2I18 A;  4ZCV A;  2LV7 A;  2KFH A;  2L2C A;  1A29 A;  1YR5 A;  3NSL A;  1CFF A;  2JOJ A;  2WCH A;  4CFR A;  3B86 A;  3TDZ A;  3OX6 A;  1HQV A;  1PK0 D;  2KYC A;  4N5X A;  2O5G A;  1M63 B;  1SMG A;  5D3O A;  1NX3 A;  2M1U A;  2BNX A;  2JPO A;  2ZNE A;  1KQM B;  1CLB A;  2PMY A;  4OVN F;  5DKQ A;  2JWW A;  3TDU A;  2PSR A;  3DVK A;  1ZAC A;  3JTD C;  1C7W A;  5AXI A;  3A8R A;  3CS1 A;  1M46 A;  1K95 A;  2PYQ A;  2JNF A;  2FJY A;  1ZUZ A;  2JZI A;  2A4J A;  1B7T Y;  2FCD A;  1KK7 Z;  2M97 A;  5G08 A;  2CT9 A;  3PN7 C;  3SJS A;  3UNW A;  3B7A A;  5FI7 A;  3GK4 X;  1TIZ A;  2K61 A;  1OQP A;  3EKJ A;  2P70 A;  4TNC A;  1QXP A;  4Q04 A;  2EHB A;  1PVA A;  2JU0 A;  5I2L A;  1SK6 D;  1XK4 C;  2KGR A;  2NLN A;  1CKK A;  5IBW A;  2QEV A;  1F8H A;  1TCF A;  3FS7 A;  2L98 A;  1Y1X A;  4PE7 A;  1H4B A;  1DJG A;  3MSE B;  4YI9 A;  2K7B A;  4PE4 A;  4XYN A;  1OSA A;  1XYD A;  2OS8 B;  2H2K A;  1KFU L;  2KSP A;  3WHU B;  4AOM A;  1DT7 B;  1SSE B;  3SG6 A;  3I5F B;  3BOW B;  2F3Z A;  2EGD A;  4JKT A;  2BCX A;  1UWO A;  2K8M B;  4PT1 A;  1SYM A;  3JVT B;  3VRP A;  4PE0 A;  1RJV A;  1AUI B;  1ORG A;  2QDI A;  2WCM A;  4MRX A;  3D74 A;  1TTX A;  1NPQ A;  1YUS A;  1U5I A;  1OMR A;  2P71 A;  1BR1 B;  3BFA A;  2LMU A;  1IJ6 A;  2PAS A;  2JRF A;  2KFG A;  1GQM A;  2WCF A;  2ZRS A;  4NDB A;  1CTR A;  1MXL C;  4DUQ A;  1IJ5 A;  1CFD A;  2M0R A;  3EK8 A;  1DGU A;  3N7H A;  1QX5 B;  1SKT A;  1YX7 A;  1L2O C;  1YX8 A;  2QEH A;  3O2P A;  1J1D A;  3BUW B;  4M2O A;  4N1F A;  2M29 A;  4HRH A;  2CTN A;  2LMV A;  2LVK A;  3D76 A;  1SCM C;  1XK4 A;  3EG5 B;  3PM8 A;  4QJ4 B;  1LXF C;  2K60 A;  2E30 A;  3BQ3 A;  3CR5 X;  3CYZ A;  5I94 A;  1F54 A;  4INW A;  1QS7 A;  3TS5 B;  2KI4 B;  5HKW A;  1ZFS A;  1EG4 A;  2K7D A;  1TOP A;  3K1E A;  4OKH A;  4E68 A;  1IIO A;  2M49 B;  2MBX A;  3CWG A;  1XVJ A;  2NZ0 A;  1KWO C;  2BEC A;  3C1V A;  4NDC A;  1K2H A;  5TNC A;  2L4H A;  1M31 A;  5CSI A;  1E8A A;  1KFU S;  1TWO A;  4MLW A;  2KNE A;  5AER A;  3GK1 A;  2EC6 C;  2WOR A;  2BBM A;  1NCX A;  4I5K A;  2O60 A;  5J3X A;  2LHL A;  1KSO A;  5AAN A;  3IF7 A;  4NDD A;  2H61 C;  3S0A A;  3S0D A;  1WDC B;  4GAO A;  1UHN A;  1X02 A;  1CLM A;  2ZN9 A;  4MRY A;  2LM5 A;  3EVU A;  4YRU A;  1AHR A;  3BUM B;  1SR6 C;  2BCB A;  5FYX A;  1S1E A;  1RTP 1;  1DQE A;  2GGZ A;  2LP3 A;  3D0Y B;  1WRK A;  1IWQ A;  1UP5 A;  1G4Y R;  2E6W A;  2KQY A;  1SW8 A;  1A2X A;  2AMI A;  4YI8 A;  3OB2 B;  2HPS A;  1K90 D;  3KF9 A;  2WCL A;  2VRG A;  1JBA A;  1YTZ C;  1IQ3 A;  4JPZ B;  2QEO A;  2LC5 A;  3B6X A;  4HRE E;  4PHJ A;  1REC A;  1GM0 A;  1UHI A;  1BU3 A;  1OMV A;  1QTX A;  2LLT A;  4CID A;  3LL8 B;  1BR4 B;  3ICB A;  1DJW A;  4XJK B;  1XFV O;  2LUX A;  3BYA A;  2OTG C;  1PUL A;  2WC8 A;  4GGF C;  3DYE A;  4R1E A;  1MXE A;  4YGC B;  3I5H B;  3PLF B;  3VRQ A;  2H8V A;  1A4P A;  3LK0 A;  5EL2 A;  1QV1 A;  3OGN A;  5I2O A;  2MHH A;  3KO0 A;  1JF2 A;  1EXR A;  1ZMZ A;  2L4I A;  2NCP A;  2H61 A;  1RWY A;  1KQM C;  1SRA A;  1DTL A;  2L50 A;  4C0K A;  3S0G A;  2Y1M A;  1PSR A;  1C3Z A;  4I5N B;  1IKU A;  1RK9 A;  1NP8 A;  2F2P A;  1CMG A;  2LLU A;  3SG2 A;  1XFW O;  4YGA A;  1BT6 A;  1XFY O;  2AUC A;  3FWC A;  4HSZ A;  2K2A A;  4PAL A;  1OW4 A;  3FIA A;  1TNW A;  2G9B A;  4MZK A;  1BG1 A;  4KYN A;  5DIC A;  2COL B;  1K9U A;  3EK7 A;  2F3Y A;  2AAO A;  1PRW A;  3TZ1 A;  5CSN A;  4IL1 A;  1NCY A;  1A75 A;  2DOQ A;  5I2Q A;  4YGB B;  1BOC A;  2I2R E;  1PSB A;  3D10 A;  4AQJ A;  4A4C A;  3LK1 A;  3PJI A;  2MJW B;  2ZRT A;  3BFB A;  4GGF A;  2JXL A;  2ZKM X;  2OS8 C;  1KK8 B;  1K8U A;  1QLK A;  3RZS A;  1YUR A;  3D77 A;  1OOJ A;  1AJ4 A;  2G2B A;  1CB1 A;  2CNP A;  1TUJ A;  1S6C A;  1S5G Y;  3FE9 A;  3I5F C;  4INX A;  2F33 A;  1J7O A;  3D78 A;  1MUX A;  3CZ2 A;  1DJX A;  1QVI Y;  4N1G A;  3OB1 B;  1A03 A;  3BUN B;  3E3R A;  2MAZ A;  3HCM A;  1KCY A;  1HT9 A;  1OZO A;  1XFU O;  4GBA A;  1F70 A;  3PFV A;  4DS7 A;  5CPV A;  1B1G A;  3SS3 A;  3I5G C;  4F7F A;  2GTE A;  2QEB A;  1FI6 A;  1KSM A;  2WCJ A;  2LNK A;  1SCV A;  4M2Q A;  1QAS A;  2Y1N A;  1SL7 A;  2KBM A;  2KLE A;  2ZND A;  4D1E A;  1NYA A;  3KHE A;  4OZD A;  4OR9 B;  2I7A A;  5D69 A;  5D7F A;  4MSP A;  1H8B A;  2F2O A;  1OMD A;  5KU1 A;  3RLZ A;  4WQ3 A;  1J1E A;  1F4Q A;  3GOF A;  3WNX B;  3AKB A;  1CMF A;  2KI4 C;  1TRF A;  2JT0 A;  3NSO A;  3SS4 A;  1S6J A;  4PHK A;  1OOH A;  1NSH A;  1MWN A;  1YVH A;  2PVB A;  1Y1U A;  2IS9 A;  2LUC A;  4GFT A;  2V53 A;  3PAL A;  1DJI A;  1UUR A;  5JOL A;  2LLS A;  2LP2 A;  1IG5 A;  4HRG A;  1WRZ A;  2Y4Q A;  4FQO A;  3L47 A;  2BE6 A;  3NSK A;  1FPW A;  3BOW A;  3SG7 A;  3BUO B;  4QJ3 B;  1JFK A;  3PSR A;  1BJF A;  3TUY B;  1DF0 B;  4YGD B;  1LS8 A;  1PVB A;  2BL0 B;  3AAK A;  3SG5 A;  1W7J B;  1DVI A;  3F45 A;  1C07 A;  3CLN A;  3I5I B;  3PM2 A;  2KAY A;  3DXL A;  5B8I B;  5HLV A;  1M39 A;  1LA3 A;  2ISD A;  3ZNI A;  1L2O B;  3B87 A;  4DRW A;  1FF1 A;  1Y6W A;  4DIR A;  4AQI A;  2GV5 A;  1ALV A;  1SCM B;  1SY9 A;  1KQV A;  1EH2 A;  3OHM B;  3OP0 A;  1IRJ A;  5K89 A;  2SAS A;  1BOD A;  3CAB A;  4MVF A;  1WLZ A;  2MLE C;  1B8L A;  3NXA A;  2KHN A;  3VGO A;  1GJY A;  2FCE A;  3KEV A;  1SL8 A;  1MHO A;  1IH0 A;  1JWD A;  2GGM A;  3VRO A;  1B8R A;  2Q91 A;  5FI2 A;  2CCM A;  5I8N A;  2K7O A;  3Q8I A;  1LVC D;  4PHN A;  1ODB A;  3VRR A;  5FI6 A;  4JD9 A;  2WCK A;  4F0Z B;  1SPY A;  3EVV A;  1GGW A;  1WY9 A;  2P6B B;  1Q80 A;  3QME A;  3ZWH A;  1CM4 A;  4P5O E;  1G8I A;  2WND A;  1CDN A;  2LAN A;  3I5H C;  4IJ7 A;  1Y1A A;  4MZL A;  1QV0 A;  4MBE A;  2SCP A;  4CFQ A;  1OOI X;  1IQ5 A;  2JXC A;  2PRU A;  1DJZ A;  2WCE A;  2WC6 A;  5KTY A;  2BAP A;  1PAL A;  1BF5 A;  1CNP A;  5HLO A;  5HL1 A;  2K2F A;  2R2I A;  3HX4 A;  1QJT A;  2KPH A;  2ZN8 A;  3L4A A;  2M8U A;  5PAL A;  2I94 A;  3EVR A;  2ZFD A;  4BY4 A;  2L5Y A;  5HYD A;  1J7Q A;  5BPJ A;  1S5G Z;  1DJY A;  3VB1 A;  1C7V A;  1OOG A;  4I5J A;  1XO5 A;  2LMT A;  1QVI Z;  3AKA A;  1JUO A;  1W7I B;  1DEK A;  3NSI A;  1C3Y A;  3D0Y A;  2TN4 A;  1JC2 A;  1TNX A;  3NGV A;  2M7L A;  1QIV A;  1XFX O;  3SIB A;  3D75 A;  1JF0 A;  1TN4 A;  2CXJ A;  2KAV A;  3BUX B;  1DC1 A;  2D8N A;  2OTG B;  3D73 A;  2BKI B;  1K94 A;  4ORA B;  1JFJ A;  1S26 D;  1F4O A;  3IQO A;  1YVL A;  1S36 A;  1S6I A;  3BXK A;  3FE6 A;  2Y5I A;  3O4Y A;  2MLF C;  5HKZ A;  3FE8 A;  1WLM A;  1AP4 A;  3A4U B;  2ERB A;  3CZ0 A;  2M3W A;  4XJK A;  1QAT A;  1YUT A;  2JC2 A;  4DCK A;  2JTZ A;  3DZT A;  4MN0 A;  4P2Y B;  2QPT A;  2L0P A;  3CGA A;  1ALW A;  4NQG A;  1AVS A;  1KK8 C;  1CFC A;  4QJ5 B;  1EG3 A;  3H4S E;  2LVV A;  4FTG A;  1OOF A;  2M7N A;  1YRT B;  3B88 A;  2PQL A;  3PAT A;  1AJ5 A;  1OZS A;  1TNP A;  2LVJ A;  3JTD B;  4GGN A;  2RGI A;  1BLQ A;  4PDZ A;  1DJH A;  1U5I B;  3R1P A;  1B8C A;  2KGB C;  3BJH A;  4GPL B;  4L9M A;  3DVJ A;  1WRL A;  3JVT C;  3M0W A;  3IVT A;  1B47 A;  2NCO A;  3OX5 A;  4JQ0 D;  3R1V A;  4JWQ A;  3SG3 A;  1K9P A;  3PN7 B;  3DVM A;  1NWD A;  3VRN A;  2JQ6 A;  1LIN A; 
#chains in the Genus database with same CATH homology
 2WCB A;  1R2U A;  2JTT A;  1B9A A;  4MZJ A;  2KYF A;  4A4B A;  1GGZ A;  1MQ1 A;  1BMO A;  3WHT B;  1CFP A;  5JJG A;  1RRO A;  1CM1 A;  1NX0 A;  1XFZ O;  2BE4 A;  2KDH A;  1M45 A;  2FJU B;  4C0J A;  4ICB A;  4PCW A;  3SIA A;  1K93 D;  1QLS A;  2HF5 A;  3K21 A;  2FOT A;  4WRI A;  3IQQ A;  5F6T A;  2HET A;  2L51 A;  1UHH A;  2K7C A;  2L5X B;  4U8D A;  4ZCU A;  3TS5 C;  2L2E A;  1J55 A;  2LCP A;  2LHI A;  4CFR A;  2MRD A;  1YUU A;  3LCP C;  2WOS A;  4CPV A;  2KAX A;  1VRK A;  2JNX A;  5GQQ C;  1JSA A;  1QX2 A;  1V1F A;  1F71 A;  2BBN A;  3KPX A;  2KI6 C;  4YBH B;  1Y0V H;  2M1K B;  3I5G B;  3WXA A;  4GNK B;  1B4C A;  1KK7 Y;  1K96 A;  2JPT A;  3TUY C;  1N0Y A;  2JT3 A;  2BL0 C;  1QIW A;  1SL9 A;  5AEQ A;  3I5I C;  1KFX L;  1RFJ A;  1J7R A;  1NX1 A;  2PAL A;  4GUK A;  1G33 A;  3DVE A;  2JUL A;  4C0L A;  1WDC C;  1N65 A;  5ER4 X;  1V1G A;  3DF0 B;  3GK2 A;  1LKJ A;  3RM1 A;  2M9G A;  2MA2 A;  1D1O A;  1EL4 A;  5ER5 A;  3LLE A;  3FWB A;  2F8P A;  1MR8 A;  4PE1 A;  3CR2 A;  2NXQ A;  5DKN A;  1ZOT B;  1CDL A;  3CTN A;  4I5L B;  5CSJ A;  1EJ3 A;  1TCO B;  2KQ6 A;  1YRU B;  1FBV A;  3AAJ A;  1KWO B;  1SBJ A;  1UUS A;  5AFP A;  1NCZ A;  2HQW A;  5HKY A;  3EKH A;  4BY5 A;  4MEW A;  2LE9 B;  2QAC A;  3DD4 A;  1UHK A;  2CBL A;  4PHM A;  5BPJ A;  2KOT A;  3CR4 X;  1DGV A;  1S3P A;  4OCI A;  1NIW A;  1QX7 A;  3O78 A;  1AK8 A;  2EC6 B;  1J7P A;  2BCA A;  4M2P A;  3QRX A;  2BKH B;  3CZT X;  3EK4 A;  4ORB B;  3O6B A;  1R6P A;  1CDP A;  4OV2 A;  1UHJ A;  2Q4U A;  4UPG A;  4ORC B;  1DF0 A;  1XA5 A;  1LIN A;  1SR6 B;  1KFX S;  2B1U A;  2LVI A;  3DF0 A;  3SG4 A;  2HQ8 A;  1FW4 A;  2KI6 D;  1LA0 A;  4ETO A;  4CLN A;  1NUB A;  1L7Z A;  4USL A;  1B7T Z;  1K9K A;  1MF8 B;  1N2D A;  1CLL A;  1NX2 A;  1SNL A;  3TDI A;  1TNQ A;  1CDM A;  1A75 B;  1F55 A;  2OPO A;  2LAP A;  5CSF A;  2K0J A;  4WQ2 A;  5DKR A;  1DMO A;  2KFF A;  5KSZ A;  4YGE B;  1IGV A;  2JT8 A;  1FI5 A;  2KBI A;  1OE9 B;  2I18 A;  4ZCV A;  2LV7 A;  2KFH A;  3NSL A;  1A29 A;  1YR5 A;  1CFF A;  2JOJ A;  3TDZ A;  3OX6 A;  1HQV A;  1PK0 D;  2KYC A;  4N5X A;  2O5G A;  1M63 B;  1SMG A;  1NX3 A;  2M1U A;  2ZNE A;  1KQM B;  1CLB A;  2PMY A;  4OVN F;  5DKQ A;  2JWW A;  3TDU A;  2PSR A;  3DVK A;  1ZAC A;  3JTD C;  1C7W A;  5AXI A;  3A8R A;  3CS1 A;  1M46 A;  1K95 A;  2JNF A;  1ZUZ A;  2JZI A;  2A4J A;  1B7T Y;  2FCD A;  1KK7 Z;  2M97 A;  5G08 A;  2CT9 A;  3PN7 C;  3SJS A;  3GK4 X;  1TIZ A;  2K61 A;  1OQP A;  3EKJ A;  4TNC A;  1QXP A;  4Q04 A;  2EHB A;  1PVA A;  2JU0 A;  5I2L A;  1SK6 D;  1XK4 C;  2KGR A;  2NLN A;  1CKK A;  5IBW A;  1F8H A;  1TCF A;  3FS7 A;  2L98 A;  1Y1X A;  4PE7 A;  1H4B A;  1DJG A;  3MSE B;  4YI9 A;  2K7B A;  4PE4 A;  4XYN A;  1OSA A;  1XYD A;  2OS8 B;  2H2K A;  1KFU L;  2KSP A;  3WHU B;  4AOM A;  1DT7 B;  3SG6 A;  3I5F B;  3BOW B;  2F3Z A;  2EGD A;  2BCX A;  1UWO A;  2K8M B;  1SYM A;  3JVT B;  3VRP A;  4PE0 A;  1RJV A;  4MRX A;  1TTX A;  1NPQ A;  1YUS A;  1U5I A;  1OMR A;  1BR1 B;  2LMU A;  1IJ6 A;  2PAS A;  2JRF A;  2KFG A;  1GQM A;  2WCF A;  2ZRS A;  4NDB A;  1CTR A;  1MXL C;  4DUQ A;  1IJ5 A;  1CFD A;  2M0R A;  3EK8 A;  1DGU A;  1QX5 B;  1SKT A;  1YX7 A;  1L2O C;  1YX8 A;  3O2P A;  4M2O A;  1J1D A;  3BUW B;  4N1F A;  2M29 A;  4HRH A;  2CTN A;  2LMV A;  2LVK A;  1SCM C;  1XK4 A;  3PM8 A;  4QJ4 B;  1F54 A;  1LXF C;  3BQ3 A;  2E30 A;  3CR5 X;  1QS7 A;  3TS5 B;  2KI4 B;  5HKW A;  1ZFS A;  1EG4 A;  2K7D A;  1TOP A;  4OKH A;  4E68 A;  2M49 B;  2MBX A;  3CWG A;  1XVJ A;  2NZ0 A;  1KWO C;  2BEC A;  3C1V A;  4NDC A;  1K2H A;  5TNC A;  2L4H A;  1M31 A;  5CSI A;  1E8A A;  1KFU S;  4MLW A;  2KNE A;  5AER A;  3GK1 A;  2EC6 C;  2WOR A;  2BBM A;  1NCX A;  4I5K A;  2O60 A;  5J3X A;  2LHL A;  1KSO A;  5AAN A;  3IF7 A;  4NDD A;  2H61 C;  1WDC B;  4GAO A;  1UHN A;  1X02 A;  1CLM A;  2ZN9 A;  4MRY A;  2LM5 A;  3EVU A;  4YRU A;  1AHR A;  3BUM B;  1SR6 C;  2BCB A;  5FYX A;  1S1E A;  1RTP 1;  2GGZ A;  3D0Y B;  2LP3 A;  1WRK A;  1IWQ A;  1UP5 A;  1G4Y R;  2E6W A;  2KQY A;  1SW8 A;  1A2X A;  2AMI A;  4YI8 A;  3OB2 B;  2HPS A;  1K90 D;  3KF9 A;  2VRG A;  1JBA A;  1YTZ C;  1IQ3 A;  4JPZ B;  2LC5 A;  4HRE E;  4PHJ A;  1REC A;  1UHI A;  1BU3 A;  1OMV A;  1QTX A;  2LLT A;  4CID A;  3LL8 B;  1BR4 B;  3ICB A;  1DJW A;  4XJK B;  1XFV O;  2LUX A;  3BYA A;  2OTG C;  1PUL A;  2WC8 A;  4GGF C;  4R1E A;  4YGC B;  1MXE A;  3I5H B;  3PLF B;  3VRQ A;  1A4P A;  3LK0 A;  5I2O A;  1QV1 A;  2MHH A;  3KO0 A;  1JF2 A;  1EXR A;  1ZMZ A;  2L4I A;  2NCP A;  2H61 A;  1RWY A;  1KQM C;  1SRA A;  1DTL A;  2L50 A;  4C0K A;  2Y1M A;  1PSR A;  4I5N B;  1IKU A;  1RK9 A;  1NP8 A;  2F2P A;  1CMG A;  2LLU A;  3SG2 A;  1XFW O;  4YGA A;  1BT6 A;  1XFY O;  2AUC A;  3FWC A;  4HSZ A;  2K2A A;  4PAL A;  3FIA A;  1TNW A;  2G9B A;  4MZK A;  1BG1 A;  2COL B;  1K9U A;  3EK7 A;  2F3Y A;  2AAO A;  1PRW A;  3TZ1 A;  5CSN A;  4IL1 A;  1NCY A;  1A75 A;  2DOQ A;  5I2Q A;  4YGB B;  1BOC A;  2I2R E;  1PSB A;  3D10 A;  4AQJ A;  4A4C A;  3LK1 A;  2MJW B;  2ZRT A;  4GGF A;  2JXL A;  2ZKM X;  2OS8 C;  1KK8 B;  1K8U A;  1QLK A;  1YUR A;  1OOJ A;  1AJ4 A;  2G2B A;  1CB1 A;  2CNP A;  1S6C A;  1S5G Y;  3I5F C;  2F33 A;  1J7O A;  1MUX A;  1DJX A;  1QVI Y;  4N1G A;  3OB1 B;  1A03 A;  3BUN B;  3E3R A;  2MAZ A;  3HCM A;  1KCY A;  1HT9 A;  1OZO A;  1XFU O;  4GBA A;  1F70 A;  3PFV A;  4DS7 A;  5CPV A;  1B1G A;  3I5G C;  1FI6 A;  1KSM A;  2LNK A;  1SCV A;  4M2Q A;  1QAS A;  2Y1N A;  1SL7 A;  2KBM A;  2ZND A;  4D1E A;  1NYA A;  3KHE A;  4OR9 B;  2I7A A;  5D69 A;  5D7F A;  4MSP A;  1H8B A;  2F2O A;  1OMD A;  5KU1 A;  3RLZ A;  4WQ3 A;  1J1E A;  1F4Q A;  3GOF A;  3WNX B;  3AKB A;  1CMF A;  2KI4 C;  1TRF A;  2JT0 A;  3NSO A;  1S6J A;  4PHK A;  1NSH A;  1MWN A;  1YVH A;  2PVB A;  1Y1U A;  2IS9 A;  2LUC A;  4GFT A;  2V53 A;  3PAL A;  1DJI A;  1UUR A;  5JOL A;  2LLS A;  2LP2 A;  1IG5 A;  4HRG A;  1WRZ A;  2Y4Q A;  4FQO A;  2BE6 A;  3NSK A;  1FPW A;  3BOW A;  3SG7 A;  3BUO B;  4QJ3 B;  1JFK A;  3PSR A;  1BJF A;  3TUY B;  1DF0 B;  4YGD B;  1PVB A;  2BL0 B;  3AAK A;  3SG5 A;  1W7J B;  1DVI A;  3F45 A;  1C07 A;  3CLN A;  3I5I B;  2KAY A;  5B8I B;  5HLV A;  1M39 A;  1LA3 A;  2ISD A;  3ZNI A;  1L2O B;  4DRW A;  1FF1 A;  1Y6W A;  4DIR A;  4AQI A;  2GV5 A;  1ALV A;  1SCM B;  1SY9 A;  1KQV A;  1EH2 A;  3OHM B;  3OP0 A;  1IRJ A;  5K89 A;  2SAS A;  1BOD A;  4MVF A;  1WLZ A;  2MLE C;  1B8L A;  3NXA A;  2KHN A;  3VGO A;  1GJY A;  2FCE A;  3KEV A;  1SL8 A;  1MHO A;  1IH0 A;  1JWD A;  2GGM A;  3VRO A;  1B8R A;  2Q91 A;  2CCM A;  5I8N A;  2K7O A;  1LVC D;  4PHN A;  1ODB A;  3VRR A;  4F0Z B;  1SPY A;  3EVV A;  1GGW A;  1WY9 A;  2P6B B;  1Q80 A;  3ZWH A;  1CM4 A;  4P5O E;  1G8I A;  2WND A;  1CDN A;  2LAN A;  3I5H C;  4MZL A;  1Y1A A;  1QV0 A;  4MBE A;  2SCP A;  4CFQ A;  1IQ5 A;  2JXC A;  2PRU A;  1DJZ A;  2WCE A;  5KTY A;  1PAL A;  1BF5 A;  1CNP A;  5HLO A;  2K2F A;  2R2I A;  3HX4 A;  1QJT A;  2ZN8 A;  5PAL A;  2M8U A;  4BY4 A;  2I94 A;  3EVR A;  2ZFD A;  5HYD A;  1J7Q A;  1S5G Z;  1DJY A;  1C7V A;  4I5J A;  1XO5 A;  2LMT A;  1QVI Z;  3AKA A;  1JUO A;  1W7I B;  3NSI A;  3D0Y A;  2TN4 A;  1JC2 A;  1TNX A;  2M7L A;  1QIV A;  1XFX O;  3SIB A;  1JF0 A;  1TN4 A;  2CXJ A;  2KAV A;  3BUX B;  2D8N A;  2OTG B;  4ORA B;  2BKI B;  1K94 A;  1JFJ A;  1S26 D;  1F4O A;  3IQO A;  1YVL A;  1S36 A;  1S6I A;  3BXK A;  3O4Y A;  2Y5I A;  2MLF C;  5HKZ A;  1WLM A;  1AP4 A;  3A4U B;  4XJK A;  2M3W A;  4DCK A;  1QAT A;  1YUT A;  2JC2 A;  2JTZ A;  4P2Y B;  4MN0 A;  2QPT A;  2L0P A;  3CGA A;  1ALW A;  4NQG A;  1AVS A;  1KK8 C;  1CFC A;  4QJ5 B;  1EG3 A;  3H4S E;  2LVV A;  4FTG A;  2M7N A;  1YRT B;  3PAT A;  1AJ5 A;  1OZS A;  1TNP A;  2LVJ A;  3JTD B;  4GGN A;  2RGI A;  1BLQ A;  4PDZ A;  1DJH A;  1U5I B;  1B8C A;  2KGB C;  4GPL B;  4L9M A;  3DVJ A;  1WRL A;  3JVT C;  3M0W A;  1B47 A;  2NCO A;  3OX5 A;  4JQ0 D;  4JWQ A;  3SG3 A;  1K9P A;  3PN7 B;  3DVM A;  1NWD A;  3VRN A;  2JQ6 A;  1AUI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...