2KGBC

Nmr solution of the regulatory domain cardiac f77w-troponin c in complex with the cardiac troponin i 144-163 switch peptide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
89
structure length
89
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEWLVMMVRCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein/ca binding protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title The effect of the cosolvent trifluoroethanol on a tryptophan side chain orientation in the hydrophobic core of troponin C.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kgbC00
2K61A 4PDZA 2H61C 2F3ZA 3BOWA 1SRAA 1F70A 2L2EA 1YVHA 2MJWB 5B8IB 2GGZA 1ZOTB 4MVFA 1KQMB 3LK1A 4OKHA 1TIZA 1BT6A 1CFDA 2HQ8A 1W7JB 2Y4QA 5CSIA 2HQWA 5KTYA 2BE4A 1AK8A 1B8CA 3I5GB 1CDPA 2KAXA 1AP4A 2HF5A 1SY9A 2OPOA 2KGBC 1E8AA 1PALA 2ZNDA 1HT9A 3OHMB 1UHNA 4JQ0D 1D1OA 4M2QA 2CT9A 1PSRA 2KFFA 3EK8A 1AUIB 1WRZA 2AMIA 4XYNA 1QVIZ 2JQ6A 3OB1B 2OS8B 2AUCA 1DMOA 1A75B 2K7OA 3PM8A 4D1EA 4GGFA 1CLBA 5KU1A 2WC8A 5F6TA 1F4QA 1BOCA 2MLFC 4YI9A 5DKQA 2ZFDA 4U8DA 1UHKA 4XJKB 3TS5C 1CMGA 2FOTA 1QASA 4ICBA 3JTDC 1B4CA 1J1EA 2CTNA 1CTRA 1RECA 2Y5IA 2JULA 3PALA 2LP3A 4OR9B 3ZWHA 1IQ3A 1PK0D 1S6CA 3CZTX 4HRGA 3D0YB 2KHNA 4GUKA 1GGZA 4QJ5B 1CNPA 4MN0A 1TNXA 3PSRA 4DCKA 1IKUA 4C0KA 2NCPA 1KQVA 4PHKA 1Y1UA 3EVVA 1AJ4A 1TNPA 5GQQC 2KOTA 5HKZA 1VRKA 1K94A 1H4BA 2G2BA 1SKTA 2K2FA 3O78A 1C7WA 1S5GZ 1YX8A 2B1UA 1KWOC 4NQGA 4A4CA 4YGBB 2L98A 1M63B 1NSHA 1QV0A 1NCZA 1JBAA 2LLSA 3VRPA 1XFYO 1CLLA 2BBMA 1OZSA 2JXCA 2LNKA 1LINA 3OX5A 3IF7A 2E6WA 3WXAA 1ALVA 1DJWA 3ZNIA 4ETOA 2WCFA 5ER5A 4ZCVA 3BUOB 1JFKA 5I2OA 1FI6A 2BL0B 2BKIB 2MAZA 1ZACA 3PN7B 1SL9A 1CDNA 1CFCA 1DJYA 1MHOA 2PVBA 3M0WA 4A4BA 1CM4A 1S3PA 1YRUB 2BKHB 3QRXA 5HKWA 1SR6B 2JC2A 1MUXA 2G9BA 3I5IB 2KSPA 1B8RA 2LVIA 2KQYA 2KI4B 1MF8B 1CDLA 5AERA 1CM1A 1KQMC 1UUSA 3D10A 4P2YB 4PE1A 3SG5A 4FTGA 1K8UA 1TCFA 1KCYA 3DVKA 2K7CA 1BJFA 3I5GC 3BUXB 2NCOA 1ZFSA 2P6BB 2L4HA 1V1GA 1SCVA 2NZ0A 2O60A 2ZRSA 4PALA 4PHJA 4WQ2A 4YI8A 1AHRA 4PE7A 2KAVA 1NCYA 4CFQA 3KO0A 1HQVA 3O4YA 1RROA 4F0ZB 2KBIA 2NLNA 1FF1A 4GPLB 1B7TY 3AAJA 3TDZA 1JFJA 2M1UA 2ZKMX 1UHIA 2CNPA 2JXLA 1DGVA 1SCMB 2Y1NA 2ZN9A 1NIWA 1B47A 2OS8C 2LUXA 3AKBA 4QJ4B 1S6JA 1G8IA 1RFJA 3I5HB 5CSNA 2JNXA 2SCPA 4CFRA 1G4YR 3JVTB 1XA5A 2LMVA 3BUWB 1QJTA 1YURA 5JJGA 1EG3A 1KFUL 2PMYA 3BOWB 1Y1AA 2I7AA 2QPTA 3FWBA 5D69A 1JF0A 1MR8A 1YX7A 1Y6WA 1LVCD 2KNEA 2M97A 1F55A 5HLVA 1J55A 3O2PA 1XK4A 2O5GA 1KK8B 2IS9A 2H2KA 2KI6C 3GK1A 1QLSA 5D7FA 2CXJA 1LKJA 1SL7A 4I5KA 5JOLA 2BE6A 1WDCB 3GOFA 4MZJA 2JZIA 3KPXA 1DJZA 3VROA 3SG6A 4JPZB 1GJYA 1SYMA 2LHLA 1KSOA 1OSAA 3SIBA 1R6PA 2K8MB 1R2UA 1XFZO 1KFXL 2JRFA 1Q80A 1B8LA 1EJ3A 2HPSA 3TUYB 2PALA 2ISDA 3F45A 5CSJA 1AJ5A 2MA2A 1QATA 5HYDA 2BCXA 3OX6A 4PCWA 1X02A 1U5IA 1DF0B 1K9KA 2LE9B 4USLA 5AANA 2M29A 1V1FA 4M2OA 1KFUS 2EC6B 4WQ3A 5I2QA 3DVEA 4HSZA 2BL0C 2K7DA 3O6BA 1BODA 3PN7C 3K21A 2KQ6A 2LV7A 5FYXA 3IQQA 4DRWA 2MHHA 3SG7A 2I18A 1IH0A 1Y0VH 1YR5A 1SR6C 5TNCA 1EG4A 3CR5X 3I5IC 3BUNB 2KI4C 1JF2A 2NXQA 3TZ1A 2D8NA 2LAPA 3NSIA 1YTZC 3NSKA 1DJXA 1K90D 3EK4A 1TNQA 2WORA 1FW4A 2MLEC 1J7QA 2DOQA 2EHBA 2H61A 3EKHA 4NDDA 2PSRA 3WHTB 4YBHB 1CB1A 3BQ3A 1KFXS 5HKYA 2ZNEA 4E68A 1CFPA 3FWCA 2LM5A 1WLZA 1BR4B 1BR1B 3D0YA 1EL4A 1B7TZ 2QACA 3C1VA 4WRIA 5HLOA 2LANA 4DS7A 1DT7B 3KF9A 1TRFA 4N1GA 3I5HC 1A29A 2KI6D 1MXEA 3E3RA 1PULA 3BUMB 3JVTC 1RWYA 3VRQA 1Y1XA 2Q91A 1A4PA 4TNCA 2COLB 5J3XA 4MLWA 1SMGA 4N1FA 1J7PA 1FBVA 4MZKA 2GV5A 2JWWA 3GK2A 1OZOA 4DIRA 1IJ5A 3CR4X 2MRDA 1QX5B 2F33A 1SNLA 2FCEA 2RGIA 3PFVA 4MEWA 2JPTA 1KK8C 1NX1A 2LC5A 4ORBB 5ER4X 1NP8A 5PALA 2M3WA 4M2PA 1PVBA 3BXKA 1QLKA 1DGUA 2LMTA 1XFWO 1S36A 1WDCC 5AEQA 3SG4A 4GBAA 3OP0A 1CLMA 1N0YA 1JSAA 4HRHA 3SJSA 2K0JA 1FPWA 5K89A 1S1EA 2F2OA 1XYDA 3CR2A 2F2PA 3IQOA 1JC2A 4MRXA 2WOSA 2PRUA 5BPJA 3OB2B 4Q04A 1WRLA 3HCMA 2GGMA 3HX4A 1K9PA 1AVSA 4AQIA 1F4OA 4GFTA 1XFUO 2EC6C 2PASA 4JWQA 4PHNA 3I5FB 4NDBA 1BLQA 2BCAA 3LK0A 1C7VA 1NPQA 1QTXA 4GNKB 3A4UB 1OE9B 4GGNA 4P5OE 4AQJA 4YGCB 3RLZA 2LVVA 1FI5A 1QIVA 2JTZA 3DVJA 4MZLA 4R1EA 4MRYA 1QIWA 2M0RA 1M46A 1M31A 3NXAA 2KBMA 3SIAA 4ORAB 3EK7A 2L50A 3DF0A 5DKNA 5KSZA 4NDCA 1BF5A 3DD4A 1KK7Y 1DJIA 2JT8A 1QXPA 1NYAA 2M7LA 1IG5A 1J1DA 2M8UA 1F8HA 4YGAA 1G33A 1SL8A 1N2DA 1PVAA 2KFGA 1XO5A 2JNFA 4PE0A 4YRUA 3PLFB 2OTGB 1RK9A 2LUCA 2KDHA 1U5IB 1OMRA 5CPVA 1W7IB 2TN4A 2ZRTA 4I5LB 1CDMA 3CTNA 1S6IA 3TDUA 1IGVA 1K2HA 4C0JA 1OMDA 1SPYA 2LLTA 4OCIA 1N65A 2R2IA 1TTXA 2CCMA 2LHIA 5IBWA 1J7RA 1CFFA 4HREE 1L2OB 1YVLA 2WNDA 4IL1A 5CSFA 1F54A 1DVIA 1SK6D 3KEVA 2KYFA 3LLEA 3A8RA 4PHMA 1A75A 2CBLA 2KGRA 2LVJA 3H4SE 1SW8A 1QV1A 1OQPA 1PSBA 3NSOA 1DF0A 1DJHA 4I5NB 4QJ3B 1TCOB 3TDIA 3EVRA 4ZCUA 1YUTA 2M7NA 1BMOA 1NX3A 1YUUA 2JOJA 1K9UA 2LVKA 4XJKA 1MXLC 2F8PA 1ALWA 4BY5A 1UP5A 4CPVA 2KYCA 1MQ1A 2WCBA 1JUOA 1J7OA 3VRNA 3AKAA 5G08A 1QX2A 1XVJA 2KAYA 2SASA 2EGDA 4I5JA 4MSPA 4C0LA 1RTP1 3CGAA 4PE4A 2MBXA 1SCMC 1F71A 2L4IA 3WHUB 3VGOA 3ICBA 1C07A 2E30A 3FS7A 4L9MA 1ZUZA 1TOPA 3DVMA 2K7BA 3BYAA 4OV2A 1K95A 1QVIY 2LP2A 4MBEA 4YGEB 1NX0A 1YRTB 1KSMA 1TN4A 1JWDA 1CMFA 1DTLA 4N5XA 1XFXO 1RJVA 2WCEA 1MWNA 1OOJA 1UWOA 3I5FC 1WRKA 4CLNA 2JT0A 1ODBA 3SG2A 1DJGA 1TNWA 1XK4C 3VRRA 2HETA 4CIDA 1M45A 1K93D 1QX7A 1YUSA 2I94A 1NCXA 2Y1MA 2BECA 4DUQA 1LXFC 1ZMZA 1B9AA 1WLMA 3CS1A 3TS5B 1UHHA 2F3YA 3KHEA 4GAOA 2KFHA 1XFVO 3RM1A 2JU0A 1IRJA 3JTDB 1L7ZA 1UHJA 1EXRA 1WY9A 1M39A 3LCPC 2M1KB 2V53A 1NUBA 4AOMA 1GGWA 1KK7Z 4UPGA 4YGDB 1BU3A 3FIAA 5AFPA 2L51A 3TUYC 2A4JA 3EKJA 2OTGC 1LA3A 4BY4A 1PRWA 3PATA 3EVUA 2ZN8A 3CLNA 4GGFC 1S5GY 2JTTA 5DKRA 1K96A 1LA0A 1IJ6A 1IWQA 2L5XB 2I2RE 3CWGA 2JT3A 1OMVA 1IQ5A 2K2AA 1H8BA 1BG1A 1UURA 1KWOB 2LCPA 2Q4UA 1CKKA 1EH2A 2BCBA 5I2LA 1A03A 1QS7A 2M49B 3AAKA 3SG3A 1B1GA 1NWDA 1L2OC 1A2XA 1NX2A 4FQOA 1GQMA 2FJUB 2M9GA 3GK4X 5AXIA 3LL8B 3WNXB 1S26D 4OVNF 2BBNA 5I8NA 2FCDA 4ORCB 3MSEB 3NSLA 2LLUA 1SBJA 2AAOA 2L0PA 3DF0B 2VRGA 2LMUA
chains in the Genus database with same CATH superfamily
2K61A 4PDZA 1GM0A 2H61C 3IVTA 2F3ZA 3BOWA 3R1PA 1SRAA 5D3OA 3RZSA 1F70A 2L2EA 3BFBA 1YVHA 2MJWB 5B8IB 2GGZA 1ZOTB 4MVFA 1KQMB 3LK1A 4OKHA 1TIZA 1BT6A 1CFDA 2HQ8A 1W7JB 2Y4QA 5CSIA 2HQWA 5KTYA 2BE4A 1AK8A 3B86A 1B8CA 3I5GB 1CDPA 4PT1A 2KAXA 1AP4A 2HF5A 1SY9A 2OPOA 2KGBC 1E8AA 1PALA 2ZNDA 3CZ2A 1HT9A 3B6XA 3OHMB 1UHNA 4JQ0D 3EG5B 1D1OA 4M2QA 2CT9A 1PSRA 2KFFA 3EK8A 1AUIB 1WRZA 2AMIA 4XYNA 1QVIZ 2JQ6A 3OB1B 2OS8B 2AUCA 1DMOA 1A75B 3BJHA 2K7OA 2P70A 2PQLA 3PM8A 4D1EA 4GGFA 1CLBA 5KU1A 2WC8A 5F6TA 1F4QA 1BOCA 2MLFC 4YI9A 5DKQA 2ZFDA 4U8DA 1UHKA 4XJKB 3TS5C 1CMGA 2FOTA 1QASA 4ICBA 3JTDC 4IJ7A 1B4CA 2L2CA 1J1EA 2CTNA 1CTRA 1RECA 3QMEA 2Y5IA 2JULA 3PALA 2LP3A 4OR9B 3ZWHA 2QEHA 1PK0D 1S6CA 1OOIX 3CZTX 3D0YB 2KHNA 4HRGA 4GUKA 1IQ3A 1GGZA 4QJ5B 1CNPA 4MN0A 1TNXA 3PSRA 4DCKA 1IKUA 4C0KA 2NCPA 1KQVA 4PHKA 1Y1UA 3EVVA 1AJ4A 1TNPA 5GQQC 2KLDA 2KOTA 1VRKA 1K94A 3BFHA 3DYEA 5HKZA 1H4BA 2G2BA 1SKTA 2K2FA 3O78A 1C7WA 1S5GZ 1YX8A 2B1UA 1KWOC 4NQGA 4A4CA 4YGBB 3PJIA 2L98A 1M63B 1NSHA 1QV0A 1NCZA 5FI7A 2LLSA 3VRPA 1JBAA 1XFYO 3L4LA 1CLLA 2BBMA 1OZSA 2JXCA 2LNKA 1LINA 3OX5A 3IF7A 2E6WA 2WC5A 1ALVA 1DJWA 3WXAA 3ZNIA 4ETOA 2WCFA 4KYNA 5ER5A 4ZCVA 4JKTA 3BUOB 1JFKA 2QEVA 5I2OA 1FI6A 2BL0B 2BKIB 2MAZA 1ZACA 3PN7B 1SL9A 1CDNA 1CFCA 1DJYA 1MHOA 2PVBA 3M0WA 4A4BA 1CM4A 1S3PA 1YRUB 2BKHB 3Q8IA 3QRXA 5HKWA 1SR6B 2JC2A 3L4AA 1MUXA 2G9BA 3I5IB 2KSPA 1B8RA 2LVIA 2WCHA 2KQYA 2KI4B 1MF8B 1CDLA 5AERA 1CM1A 1KQMC 1UUSA 3D10A 4P2YB 4PE1A 3SG5A 4FTGA 1K8UA 1TCFA 1TUJA 3S0BA 1KCYA 3DVKA 2K7CA 1BJFA 3I5GC 3BUXB 2NCOA 1ZFSA 2P6BB 2L4HA 1V1GA 1SCVA 2NZ0A 2O60A 2ZRSA 4PALA 4PHJA 4WQ2A 4YI8A 1AHRA 4PE7A 3DY9A 2KAVA 1NCYA 4CFQA 3KO0A 1HQVA 3O4YA 1RROA 4F0ZB 2KBIA 2NLNA 1FF1A 4GPLB 1B7TY 3AAJA 3TDZA 1JFJA 2M1UA 2ZKMX 2FJYA 1UHIA 2CNPA 2JXLA 1DGVA 1SCMB 2Y1NA 2ZN9A 1DELA 1B47A 1NIWA 2LUXA 2OS8C 3AKBA 4QJ4B 3B7AA 1S6JA 1G8IA 1RFJA 3I5HB 5CSNA 2JNXA 2SCPA 4CFRA 1G4YR 1W9ZA 1XA5A 3JVTB 2LMVA 3BUWB 1QJTA 1YURA 5JJGA 1EG3A 1KFUL 2PMYA 3BOWB 1Y1AA 2I7AA 1QWVA 2QPTA 3FWBA 5D69A 1JF0A 3S0DA 1MR8A 1YX7A 1Y6WA 1LVCD 2KNEA 2M97A 1F55A 5HLVA 1J55A 3O2PA 3L47A 1XK4A 2O5GA 1KK8B 2IS9A 2H2KA 2KI6C 3GK1A 1QLSA 5D7FA 2CXJA 1LKJA 1SL7A 3B87A 4I5KA 5JOLA 2BE6A 3NHIA 1WDCB 3GOFA 4MZJA 2JZIA 3KPXA 1DJZA 3VROA 5HL1A 1SSEB 3SG6A 4JPZB 1GJYA 1SYMA 2LHLA 1KSOA 1OSAA 3SIBA 1R6PA 2K8MB 1R2UA 1XFZO 1KFXL 2JRFA 2VRGA 1Q80A 1B8LA 1OW4A 1EJ3A 2HPSA 3TUYB 2PALA 2ISDA 3F45A 5CSJA 1AJ5A 2MA2A 1QATA 5HYDA 2BCXA 3OX6A 4PCWA 1X02A 1U5IA 1DF0B 1K9KA 2LE9B 4USLA 5AANA 2M29A 1C3ZA 1V1FA 2K60A 1KFUS 2EC6B 3B88A 4M2OA 4WQ3A 5I2QA 3DVEA 4HSZA 2BL0C 2K7DA 3O6BA 5FI2A 3PN7C 3K21A 3BFAA 2JPOA 1BODA 4FQTA 2KQ6A 2LV7A 5FYXA 3IQQA 4DRWA 2MHHA 3SG7A 2KPHA 2I18A 1IH0A 1Y0VH 1YR5A 1SR6C 1IIOA 5TNCA 1EG4A 3CR5X 3I5IC 3R1OA 3BUNB 2KI4C 1JF2A 2NXQA 3TZ1A 2D8NA 2LAPA 3NSIA 1YTZC 3NSKA 2WCLA 1DJXA 1K90D 2WCMA 1TNQA 2WORA 3EK4A 1FW4A 4INWA 2MLEC 3CDNA 1J7QA 2L5YA 2DOQA 2EHBA 2H61A 3S0FA 3EKHA 4NDDA 2PSRA 3WHTB 4YBHB 2WC6A 1CB1A 3BQ3A 1KFXS 5HKYA 2ZNEA 4E68A 1CFPA 2BAPA 3FWCA 2LM5A 1WLZA 1BR4B 1BR1B 3D0YA 1EL4A 1B7TZ 2QACA 3C1VA 4WRIA 5HLOA 2LANA 4DS7A 2BNXA 1DT7B 3KF9A 3OGNA 1TRFA 4N1GA 3I5HC 1A29A 1DQEA 1OOGA 2KI6D 1MXEA 3E3RA 1PULA 3BUMB 3JVTC 1RWYA 3VRQA 2QDIA 1Y1XA 2Q91A 1A4PA 4TNCA 2COLB 5J3XA 4MLWA 1SMGA 4N1FA 1J7PA 1FBVA 4MZKA 2GV5A 2JWWA 3GK2A 1OZOA 4DIRA 1IJ5A 3CR4X 2MRDA 1QX5B 2F33A 3R1VA 1SNLA 2FCEA 2RGIA 3PFVA 4JD9A 2QEOA 4MEWA 2JPTA 1KK8C 1NX1A 2LC5A 4ORBB 5ER4X 2WCJA 1NP8A 5PALA 2M3WA 4M2PA 1PVBA 3BXKA 1QLKA 5FI6A 1DGUA 2LMTA 1XFWO 1P28A 1S36A 1WDCC 5AEQA 3SG4A 4GBAA 3OP0A 1CLMA 1N0YA 1JSAA 3D76A 4HRHA 3SJSA 3UO9A 2K0JA 1FPWA 5K89A 1S1EA 2F2OA 1XYDA 3CR2A 3S0GA 2F2PA 3CYZA 3IQOA 3N7HA 1JC2A 3K1EA 4MRXA 2WOSA 2PRUA 3D74A 2ERBA 5BPJA 3OB2B 4Q04A 1WRLA 3HCMA 2GGMA 3HX4A 1K9PA 3DXLA 1AVSA 4OZDA 4AQIA 1LS8A 3UNWA 1F4OA 4GFTA 1XFUO 2EC6C 2PASA 4JWQA 3V2LA 4PHNA 3I5FB 4NDBA 3D73A 1BLQA 2BCAA 3LK0A 1C7VA 1NPQA 1QTXA 4GNKB 3A4UB 1OE9B 1OOHA 4GGNA 3O4XA 4P5OE 4AQJA 3NGVA 4YGCB 3RLZA 2LVVA 1FI5A 1QIVA 2JTZA 3D75A 3DVJA 2PYQA 3DZTA 1QIWA 4MRYA 4MZLA 4R1EA 2M0RA 1M46A 1M31A 3NXAA 2KBMA 2WCKA 3SIAA 4ORAB 3EK7A 2L50A 3DF0A 3SS5A 5DKNA 5KSZA 4NDCA 3S0EA 1BF5A 3DD4A 1KK7Y 1DJIA 2JT8A 1QXPA 1NYAA 2M7LA 1IG5A 1J1DA 2M8UA 3FE6A 4YGAA 1G33A 1SL8A 1TWOA 1F8HA 3NHTA 1N2DA 1PVAA 2KFGA 3PM2A 5I94A 1XO5A 2JNFA 4PE0A 4YRUA 3PLFB 2OTGB 1RK9A 2LUCA 2KDHA 3FE8A 4F7FA 1U5IB 1OMRA 5CPVA 1W7IB 2TN4A 2ZRTA 4I5LB 1CDMA 3CTNA 1S6IA 1XFRA 1IGVA 3CZ1A 3TDUA 1K2HA 4C0JA 1OMDA 1SPYA 2LLTA 3D77A 4OCIA 1N65A 2R2IA 1TTXA 2CCMA 1OOFA 2LHIA 5IBWA 1J7RA 1CFFA 4HREE 1L2OB 1YVLA 2WNDA 4IL1A 5CSFA 1F54A 1DVIA 1SK6D 3KEVA 2KYFA 3LLEA 2P71A 3A8RA 4PHMA 3SS4A 1A75A 2CBLA 2KGRA 2LVJA 3H4SE 1SW8A 1QV1A 1OQPA 1PSBA 3NSOA 1DF0A 1DJHA 4I5NB 4QJ3B 1TCOB 3TDIA 3EVRA 4ZCUA 1YUTA 2M7NA 1BMOA 1NX3A 1YUUA 2JOJA 1DEKA 1K9UA 2LVKA 4XJKA 1MXLC 2F8PA 4INXA 1ALWA 4BY5A 1UP5A 4CPVA 2KYCA 1MQ1A 2WCBA 1JUOA 1J7OA 3VRNA 3AKAA 5G08A 1QX2A 1Z4HA 1XVJA 2KAYA 2SASA 2EGDA 1T14A 4I5JA 4MSPA 4C0LA 1RTP1 3CGAA 4PE4A 2MBXA 1SCMC 1F71A 2L4IA 3WHUB 3VGOA 2GTEA 3ICBA 1C07A 2E30A 3FS7A 4L9MA 1ZUZA 1TOPA 3DVMA 2H8VA 3OBVA 2K7BA 3BYAA 4OV2A 5EL2A 1K95A 1QVIY 2LP2A 4MBEA 4YGEB 1NX0A 1YRTB 1KSMA 1TN4A 1JWDA 1CMFA 1DTLA 2YGUA 4N5XA 1XFXO 1RJVA 2KLEA 2WCEA 1MWNA 1OOJA 1UWOA 3I5FC 1WRKA 4CLNA 2JT0A 1ODBA 3SG2A 3VB1A 1DJGA 1TNWA 1XK4C 3VRRA 2HETA 4CIDA 1M45A 1K93D 1QX7A 1YUSA 2I94A 1NCXA 2Y1MA 2BECA 4DUQA 1LXFC 1ZMZA 1B9AA 1ORGA 1WLMA 3CS1A 3TS5B 1UHHA 2F3YA 3KHEA 4GAOA 2KFHA 1XFVO 3RM1A 2JU0A 1IRJA 3JTDB 1L7ZA 1UHJA 1EXRA 3CABA 1WY9A 1M39A 3LCPC 2M1KB 2QEBA 2V53A 1NUBA 5DICA 4AOMA 1GGWA 1KK7Z 4UPGA 4YGDB 1BU3A 3FIAA 5AFPA 2L51A 3TUYC 3CZ0A 2A4JA 3EKJA 2OTGC 1LA3A 4BY4A 1PRWA 3PATA 3EVUA 2ZN8A 3CLNA 4GGFC 1Z2CB 1S5GY 2JTTA 5DKRA 1K96A 1LA0A 1IJ6A 1IWQA 3FE9A 2L5XB 2I2RE 3CWGA 2JT3A 1OMVA 1IQ5A 2K2AA 1H8BA 1BG1A 1UURA 1KWOB 2LCPA 2Q4UA 3D78A 1CKKA 1EH2A 2BCBA 5I2LA 1A03A 1QS7A 2M49B 3AAKA 3R72A 3SG3A 1B1GA 1NWDA 1L2OC 3S0AA 1A2XA 1NX2A 4FQOA 1GQMA 2FJUB 2M9GA 3GK4X 5AXIA 3LL8B 3WNXB 1S26D 4OVNF 2BBNA 5I8NA 2FCDA 4ORCB 3MSEB 3NSLA 1C3YA 2LLUA 1SBJA 3SS3A 2AAOA 2L0PA 3DF0B 1DC1A 1TUZA 2LMUA
chains in the Genus database with same CATH topology
2K61A 4PDZA 2H61C 2F3ZA 3BOWA 1SRAA 1F70A 2L2EA 1YVHA 2MJWB 5B8IB 2GGZA 1ZOTB 4MVFA 1KQMB 3LK1A 4OKHA 1TIZA 1BT6A 1CFDA 2HQ8A 1W7JB 2Y4QA 5CSIA 2HQWA 5KTYA 2BE4A 1AK8A 1B8CA 3I5GB 1CDPA 2KAXA 1AP4A 2HF5A 1SY9A 2OPOA 2KGBC 1E8AA 1PALA 2ZNDA 1HT9A 3OHMB 1UHNA 4JQ0D 1D1OA 4M2QA 2CT9A 1PSRA 2KFFA 3EK8A 1AUIB 1WRZA 2AMIA 4XYNA 1QVIZ 2JQ6A 3OB1B 2OS8B 2AUCA 1DMOA 1A75B 2K7OA 3PM8A 4D1EA 4GGFA 1CLBA 5KU1A 2WC8A 5F6TA 1F4QA 1BOCA 2MLFC 4YI9A 5DKQA 2ZFDA 4U8DA 1UHKA 4XJKB 3TS5C 1CMGA 2FOTA 1QASA 4ICBA 3JTDC 1B4CA 1J1EA 2CTNA 1CTRA 1RECA 2Y5IA 2JULA 3PALA 2LP3A 4OR9B 3ZWHA 1IQ3A 1PK0D 1S6CA 3CZTX 4HRGA 3D0YB 2KHNA 4GUKA 1GGZA 4QJ5B 1CNPA 4MN0A 1TNXA 3PSRA 4DCKA 1IKUA 4C0KA 2NCPA 1KQVA 4PHKA 1Y1UA 3EVVA 1AJ4A 1TNPA 5GQQC 2KOTA 5HKZA 1VRKA 1K94A 1H4BA 2G2BA 1SKTA 2K2FA 3O78A 1C7WA 1S5GZ 1YX8A 2B1UA 1KWOC 4NQGA 4A4CA 4YGBB 2L98A 1M63B 1NSHA 1QV0A 1NCZA 1JBAA 2LLSA 3VRPA 1XFYO 1CLLA 2BBMA 1OZSA 2JXCA 2LNKA 1LINA 3OX5A 3IF7A 2E6WA 3WXAA 1ALVA 1DJWA 3ZNIA 4ETOA 2WCFA 5ER5A 4ZCVA 3BUOB 1JFKA 5I2OA 1FI6A 2BL0B 2BKIB 2MAZA 1ZACA 3PN7B 1SL9A 1CDNA 1CFCA 1DJYA 1MHOA 2PVBA 3M0WA 4A4BA 1CM4A 1S3PA 1YRUB 2BKHB 3QRXA 5HKWA 1SR6B 2JC2A 1MUXA 2G9BA 3I5IB 2KSPA 1B8RA 2LVIA 2KQYA 2KI4B 1MF8B 1CDLA 5AERA 1CM1A 1KQMC 1UUSA 3D10A 4P2YB 4PE1A 3SG5A 4FTGA 1K8UA 1TCFA 1KCYA 3DVKA 2K7CA 1BJFA 3I5GC 3BUXB 2NCOA 1ZFSA 2P6BB 2L4HA 1V1GA 1SCVA 2NZ0A 2O60A 2ZRSA 4PALA 4PHJA 4WQ2A 4YI8A 1AHRA 4PE7A 2KAVA 1NCYA 4CFQA 3KO0A 1HQVA 3O4YA 1RROA 4F0ZB 2KBIA 2NLNA 1FF1A 4GPLB 1B7TY 3AAJA 3TDZA 1JFJA 2M1UA 2ZKMX 1UHIA 2CNPA 2JXLA 1DGVA 1SCMB 2Y1NA 2ZN9A 1NIWA 1B47A 2OS8C 2LUXA 3AKBA 4QJ4B 1S6JA 1G8IA 1RFJA 3I5HB 5CSNA 2JNXA 2SCPA 4CFRA 1G4YR 3JVTB 1XA5A 2LMVA 3BUWB 1QJTA 1YURA 5JJGA 1EG3A 1KFUL 2PMYA 3BOWB 1Y1AA 2I7AA 2QPTA 3FWBA 5D69A 1JF0A 1MR8A 1YX7A 1Y6WA 1LVCD 2KNEA 2M97A 1F55A 5HLVA 1J55A 3O2PA 1XK4A 2O5GA 1KK8B 2IS9A 2H2KA 2KI6C 3GK1A 1QLSA 5D7FA 2CXJA 1LKJA 1SL7A 4I5KA 5JOLA 2BE6A 1WDCB 3GOFA 4MZJA 2JZIA 3KPXA 1DJZA 3VROA 3SG6A 4JPZB 1GJYA 1SYMA 2LHLA 1KSOA 1OSAA 3SIBA 1R6PA 2K8MB 1R2UA 1XFZO 1KFXL 2JRFA 1Q80A 1B8LA 1EJ3A 2HPSA 3TUYB 2PALA 2ISDA 3F45A 5CSJA 1AJ5A 2MA2A 1QATA 5HYDA 2BCXA 3OX6A 4PCWA 1X02A 1U5IA 1DF0B 1K9KA 2LE9B 4USLA 5AANA 2M29A 1V1FA 4M2OA 1KFUS 2EC6B 4WQ3A 5I2QA 3DVEA 4HSZA 2BL0C 2K7DA 3O6BA 1BODA 3PN7C 3K21A 2KQ6A 2LV7A 5FYXA 3IQQA 4DRWA 2MHHA 3SG7A 2I18A 1IH0A 1Y0VH 1YR5A 1SR6C 5TNCA 1EG4A 3CR5X 3I5IC 3BUNB 2KI4C 1JF2A 2NXQA 3TZ1A 2D8NA 2LAPA 3NSIA 1YTZC 3NSKA 1DJXA 1K90D 3EK4A 1TNQA 2WORA 1FW4A 2MLEC 1J7QA 2DOQA 2EHBA 2H61A 3EKHA 4NDDA 2PSRA 3WHTB 4YBHB 1CB1A 3BQ3A 1KFXS 5HKYA 2ZNEA 4E68A 1CFPA 3FWCA 2LM5A 1WLZA 1BR4B 1BR1B 3D0YA 1EL4A 1B7TZ 2QACA 3C1VA 4WRIA 5HLOA 2LANA 4DS7A 1DT7B 3KF9A 1TRFA 4N1GA 3I5HC 1A29A 2KI6D 1MXEA 3E3RA 1PULA 3BUMB 3JVTC 1RWYA 3VRQA 1Y1XA 2Q91A 1A4PA 4TNCA 2COLB 5J3XA 4MLWA 1SMGA 4N1FA 1J7PA 1FBVA 4MZKA 2GV5A 2JWWA 3GK2A 1OZOA 4DIRA 1IJ5A 3CR4X 2MRDA 1QX5B 2F33A 1SNLA 2FCEA 2RGIA 3PFVA 4MEWA 2JPTA 1KK8C 1NX1A 2LC5A 4ORBB 5ER4X 1NP8A 5PALA 2M3WA 4M2PA 1PVBA 3BXKA 1QLKA 1DGUA 2LMTA 1XFWO 1S36A 1WDCC 5AEQA 3SG4A 4GBAA 3OP0A 1CLMA 1N0YA 1JSAA 4HRHA 3SJSA 2K0JA 1FPWA 5K89A 1S1EA 2F2OA 1XYDA 3CR2A 2F2PA 3IQOA 1JC2A 4MRXA 2WOSA 2PRUA 5BPJA 3OB2B 4Q04A 1WRLA 3HCMA 2GGMA 3HX4A 1K9PA 1AVSA 4AQIA 1F4OA 4GFTA 1XFUO 2EC6C 2PASA 4JWQA 4PHNA 3I5FB 4NDBA 1BLQA 2BCAA 3LK0A 1C7VA 1NPQA 1QTXA 4GNKB 3A4UB 1OE9B 4GGNA 4P5OE 4AQJA 4YGCB 3RLZA 2LVVA 1FI5A 1QIVA 2JTZA 3DVJA 4MZLA 4R1EA 4MRYA 1QIWA 2M0RA 1M46A 1M31A 3NXAA 2KBMA 3SIAA 4ORAB 3EK7A 2L50A 3DF0A 5DKNA 5KSZA 4NDCA 1BF5A 3DD4A 1KK7Y 1DJIA 2JT8A 1QXPA 1NYAA 2M7LA 1IG5A 1J1DA 2M8UA 1F8HA 4YGAA 1G33A 1SL8A 1N2DA 1PVAA 2KFGA 1XO5A 2JNFA 4PE0A 4YRUA 3PLFB 2OTGB 1RK9A 2LUCA 2KDHA 1U5IB 1OMRA 5CPVA 1W7IB 2TN4A 2ZRTA 4I5LB 1CDMA 3CTNA 1S6IA 3TDUA 1IGVA 1K2HA 4C0JA 1OMDA 1SPYA 2LLTA 4OCIA 1N65A 2R2IA 1TTXA 2CCMA 2LHIA 5IBWA 1J7RA 1CFFA 4HREE 1L2OB 1YVLA 2WNDA 4IL1A 5CSFA 1F54A 1DVIA 1SK6D 3KEVA 2KYFA 3LLEA 3A8RA 4PHMA 1A75A 2CBLA 2KGRA 2LVJA 3H4SE 1SW8A 1QV1A 1OQPA 1PSBA 3NSOA 1DF0A 1DJHA 4I5NB 4QJ3B 1TCOB 3TDIA 3EVRA 4ZCUA 1YUTA 2M7NA 1BMOA 1NX3A 1YUUA 2JOJA 1K9UA 2LVKA 4XJKA 1MXLC 2F8PA 1ALWA 4BY5A 1UP5A 4CPVA 2KYCA 1MQ1A 2WCBA 1JUOA 1J7OA 3VRNA 3AKAA 5G08A 1QX2A 1XVJA 2KAYA 2SASA 2EGDA 4I5JA 4MSPA 4C0LA 1RTP1 3CGAA 4PE4A 2MBXA 1SCMC 1F71A 2L4IA 3WHUB 3VGOA 3ICBA 1C07A 2E30A 3FS7A 4L9MA 1ZUZA 1TOPA 3DVMA 2K7BA 3BYAA 4OV2A 1K95A 1QVIY 2LP2A 4MBEA 4YGEB 1NX0A 1YRTB 1KSMA 1TN4A 1JWDA 1CMFA 1DTLA 4N5XA 1XFXO 1RJVA 2WCEA 1MWNA 1OOJA 1UWOA 3I5FC 1WRKA 4CLNA 2JT0A 1ODBA 3SG2A 1DJGA 1TNWA 1XK4C 3VRRA 2HETA 4CIDA 1M45A 1K93D 1QX7A 1YUSA 2I94A 1NCXA 2Y1MA 2BECA 4DUQA 1LXFC 1ZMZA 1B9AA 1WLMA 3CS1A 3TS5B 1UHHA 2F3YA 3KHEA 4GAOA 2KFHA 1XFVO 3RM1A 2JU0A 1IRJA 3JTDB 1L7ZA 1UHJA 1EXRA 1WY9A 1M39A 3LCPC 2M1KB 2V53A 1NUBA 4AOMA 1GGWA 1KK7Z 4UPGA 4YGDB 1BU3A 3FIAA 5AFPA 2L51A 3TUYC 2A4JA 3EKJA 2OTGC 1LA3A 4BY4A 1PRWA 3PATA 3EVUA 2ZN8A 3CLNA 4GGFC 1S5GY 2JTTA 5DKRA 1K96A 1LA0A 1IJ6A 1IWQA 2L5XB 2I2RE 3CWGA 2JT3A 1OMVA 1IQ5A 2K2AA 1H8BA 1BG1A 1UURA 1KWOB 2LCPA 2Q4UA 1CKKA 1EH2A 2BCBA 5I2LA 1A03A 1QS7A 2M49B 3AAKA 3SG3A 1B1GA 1NWDA 1L2OC 1A2XA 1NX2A 4FQOA 1GQMA 2FJUB 2M9GA 3GK4X 5AXIA 3LL8B 3WNXB 1S26D 4OVNF 2BBNA 5I8NA 2FCDA 4ORCB 3MSEB 3NSLA 2LLUA 1SBJA 2AAOA 2L0PA 3DF0B 2VRGA 2LMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K61 A;  4PDZ A;  2H61 C;  2F3Z A;  3BOW A;  1SRA A;  1F70 A;  2L2E A;  1YVH A;  2MJW B;  5B8I B;  2GGZ A;  1ZOT B;  4MVF A;  1KQM B;  3LK1 A;  4OKH A;  1TIZ A;  1BT6 A;  1CFD A;  2HQ8 A;  1W7J B;  2Y4Q A;  5CSI A;  2HQW A;  5KTY A;  2BE4 A;  1AK8 A;  1B8C A;  3I5G B;  1CDP A;  2KAX A;  1AP4 A;  2HF5 A;  1SY9 A;  2OPO A;  2KGB C;  1E8A A;  1PAL A;  2ZND A;  1HT9 A;  3OHM B;  1UHN A;  4JQ0 D;  1D1O A;  4M2Q A;  2CT9 A;  1PSR A;  2KFF A;  3EK8 A;  1AUI B;  1WRZ A;  2AMI A;  4XYN A;  1QVI Z;  2JQ6 A;  3OB1 B;  2OS8 B;  2AUC A;  1DMO A;  1A75 B;  2K7O A;  3PM8 A;  4D1E A;  4GGF A;  1CLB A;  5KU1 A;  2WC8 A;  5F6T A;  1F4Q A;  1BOC A;  2MLF C;  4YI9 A;  5DKQ A;  2ZFD A;  4U8D A;  1UHK A;  4XJK B;  3TS5 C;  1CMG A;  2FOT A;  1QAS A;  4ICB A;  3JTD C;  1B4C A;  1J1E A;  2CTN A;  1CTR A;  1REC A;  2Y5I A;  2JUL A;  3PAL A;  2LP3 A;  4OR9 B;  3ZWH A;  1IQ3 A;  1PK0 D;  1S6C A;  3CZT X;  4HRG A;  3D0Y B;  2KHN A;  4GUK A;  1GGZ A;  4QJ5 B;  1CNP A;  4MN0 A;  1TNX A;  3PSR A;  4DCK A;  1IKU A;  4C0K A;  2NCP A;  1KQV A;  4PHK A;  1Y1U A;  3EVV A;  1AJ4 A;  1TNP A;  5GQQ C;  2KOT A;  5HKZ A;  1VRK A;  1K94 A;  1H4B A;  2G2B A;  1SKT A;  2K2F A;  3O78 A;  1C7W A;  1S5G Z;  1YX8 A;  2B1U A;  1KWO C;  4NQG A;  4A4C A;  4YGB B;  2L98 A;  1M63 B;  1NSH A;  1QV0 A;  1NCZ A;  1JBA A;  2LLS A;  3VRP A;  1XFY O;  1CLL A;  2BBM A;  1OZS A;  2JXC A;  2LNK A;  1LIN A;  3OX5 A;  3IF7 A;  2E6W A;  3WXA A;  1ALV A;  1DJW A;  3ZNI A;  4ETO A;  2WCF A;  5ER5 A;  4ZCV A;  3BUO B;  1JFK A;  5I2O A;  1FI6 A;  2BL0 B;  2BKI B;  2MAZ A;  1ZAC A;  3PN7 B;  1SL9 A;  1CDN A;  1CFC A;  1DJY A;  1MHO A;  2PVB A;  3M0W A;  4A4B A;  1CM4 A;  1S3P A;  1YRU B;  2BKH B;  3QRX A;  5HKW A;  1SR6 B;  2JC2 A;  1MUX A;  2G9B A;  3I5I B;  2KSP A;  1B8R A;  2LVI A;  2KQY A;  2KI4 B;  1MF8 B;  1CDL A;  5AER A;  1CM1 A;  1KQM C;  1UUS A;  3D10 A;  4P2Y B;  4PE1 A;  3SG5 A;  4FTG A;  1K8U A;  1TCF A;  1KCY A;  3DVK A;  2K7C A;  1BJF A;  3I5G C;  3BUX B;  2NCO A;  1ZFS A;  2P6B B;  2L4H A;  1V1G A;  1SCV A;  2NZ0 A;  2O60 A;  2ZRS A;  4PAL A;  4PHJ A;  4WQ2 A;  4YI8 A;  1AHR A;  4PE7 A;  2KAV A;  1NCY A;  4CFQ A;  3KO0 A;  1HQV A;  3O4Y A;  1RRO A;  4F0Z B;  2KBI A;  2NLN A;  1FF1 A;  4GPL B;  1B7T Y;  3AAJ A;  3TDZ A;  1JFJ A;  2M1U A;  2ZKM X;  1UHI A;  2CNP A;  2JXL A;  1DGV A;  1SCM B;  2Y1N A;  2ZN9 A;  1NIW A;  1B47 A;  2OS8 C;  2LUX A;  3AKB A;  4QJ4 B;  1S6J A;  1G8I A;  1RFJ A;  3I5H B;  5CSN A;  2JNX A;  2SCP A;  4CFR A;  1G4Y R;  3JVT B;  1XA5 A;  2LMV A;  3BUW B;  1QJT A;  1YUR A;  5JJG A;  1EG3 A;  1KFU L;  2PMY A;  3BOW B;  1Y1A A;  2I7A A;  2QPT A;  3FWB A;  5D69 A;  1JF0 A;  1MR8 A;  1YX7 A;  1Y6W A;  1LVC D;  2KNE A;  2M97 A;  1F55 A;  5HLV A;  1J55 A;  3O2P A;  1XK4 A;  2O5G A;  1KK8 B;  2IS9 A;  2H2K A;  2KI6 C;  3GK1 A;  1QLS A;  5D7F A;  2CXJ A;  1LKJ A;  1SL7 A;  4I5K A;  5JOL A;  2BE6 A;  1WDC B;  3GOF A;  4MZJ A;  2JZI A;  3KPX A;  1DJZ A;  3VRO A;  3SG6 A;  4JPZ B;  1GJY A;  1SYM A;  2LHL A;  1KSO A;  1OSA A;  3SIB A;  1R6P A;  2K8M B;  1R2U A;  1XFZ O;  1KFX L;  2JRF A;  1Q80 A;  1B8L A;  1EJ3 A;  2HPS A;  3TUY B;  2PAL A;  2ISD A;  3F45 A;  5CSJ A;  1AJ5 A;  2MA2 A;  1QAT A;  5HYD A;  2BCX A;  3OX6 A;  4PCW A;  1X02 A;  1U5I A;  1DF0 B;  1K9K A;  2LE9 B;  4USL A;  5AAN A;  2M29 A;  1V1F A;  4M2O A;  1KFU S;  2EC6 B;  4WQ3 A;  5I2Q A;  3DVE A;  4HSZ A;  2BL0 C;  2K7D A;  3O6B A;  1BOD A;  3PN7 C;  3K21 A;  2KQ6 A;  2LV7 A;  5FYX A;  3IQQ A;  4DRW A;  2MHH A;  3SG7 A;  2I18 A;  1IH0 A;  1Y0V H;  1YR5 A;  1SR6 C;  5TNC A;  1EG4 A;  3CR5 X;  3I5I C;  3BUN B;  2KI4 C;  1JF2 A;  2NXQ A;  3TZ1 A;  2D8N A;  2LAP A;  3NSI A;  1YTZ C;  3NSK A;  1DJX A;  1K90 D;  3EK4 A;  1TNQ A;  2WOR A;  1FW4 A;  2MLE C;  1J7Q A;  2DOQ A;  2EHB A;  2H61 A;  3EKH A;  4NDD A;  2PSR A;  3WHT B;  4YBH B;  1CB1 A;  3BQ3 A;  1KFX S;  5HKY A;  2ZNE A;  4E68 A;  1CFP A;  3FWC A;  2LM5 A;  1WLZ A;  1BR4 B;  1BR1 B;  3D0Y A;  1EL4 A;  1B7T Z;  2QAC A;  3C1V A;  4WRI A;  5HLO A;  2LAN A;  4DS7 A;  1DT7 B;  3KF9 A;  1TRF A;  4N1G A;  3I5H C;  1A29 A;  2KI6 D;  1MXE A;  3E3R A;  1PUL A;  3BUM B;  3JVT C;  1RWY A;  3VRQ A;  1Y1X A;  2Q91 A;  1A4P A;  4TNC A;  2COL B;  5J3X A;  4MLW A;  1SMG A;  4N1F A;  1J7P A;  1FBV A;  4MZK A;  2GV5 A;  2JWW A;  3GK2 A;  1OZO A;  4DIR A;  1IJ5 A;  3CR4 X;  2MRD A;  1QX5 B;  2F33 A;  1SNL A;  2FCE A;  2RGI A;  3PFV A;  4MEW A;  2JPT A;  1KK8 C;  1NX1 A;  2LC5 A;  4ORB B;  5ER4 X;  1NP8 A;  5PAL A;  2M3W A;  4M2P A;  1PVB A;  3BXK A;  1QLK A;  1DGU A;  2LMT A;  1XFW O;  1S36 A;  1WDC C;  5AEQ A;  3SG4 A;  4GBA A;  3OP0 A;  1CLM A;  1N0Y A;  1JSA A;  4HRH A;  3SJS A;  2K0J A;  1FPW A;  5K89 A;  1S1E A;  2F2O A;  1XYD A;  3CR2 A;  2F2P A;  3IQO A;  1JC2 A;  4MRX A;  2WOS A;  2PRU A;  5BPJ A;  3OB2 B;  4Q04 A;  1WRL A;  3HCM A;  2GGM A;  3HX4 A;  1K9P A;  1AVS A;  4AQI A;  1F4O A;  4GFT A;  1XFU O;  2EC6 C;  2PAS A;  4JWQ A;  4PHN A;  3I5F B;  4NDB A;  1BLQ A;  2BCA A;  3LK0 A;  1C7V A;  1NPQ A;  1QTX A;  4GNK B;  3A4U B;  1OE9 B;  4GGN A;  4P5O E;  4AQJ A;  4YGC B;  3RLZ A;  2LVV A;  1FI5 A;  1QIV A;  2JTZ A;  3DVJ A;  4MZL A;  4R1E A;  4MRY A;  1QIW A;  2M0R A;  1M46 A;  1M31 A;  3NXA A;  2KBM A;  3SIA A;  4ORA B;  3EK7 A;  2L50 A;  3DF0 A;  5DKN A;  5KSZ A;  4NDC A;  1BF5 A;  3DD4 A;  1KK7 Y;  1DJI A;  2JT8 A;  1QXP A;  1NYA A;  2M7L A;  1IG5 A;  1J1D A;  2M8U A;  1F8H A;  4YGA A;  1G33 A;  1SL8 A;  1N2D A;  1PVA A;  2KFG A;  1XO5 A;  2JNF A;  4PE0 A;  4YRU A;  3PLF B;  2OTG B;  1RK9 A;  2LUC A;  2KDH A;  1U5I B;  1OMR A;  5CPV A;  1W7I B;  2TN4 A;  2ZRT A;  4I5L B;  1CDM A;  3CTN A;  1S6I A;  3TDU A;  1IGV A;  1K2H A;  4C0J A;  1OMD A;  1SPY A;  2LLT A;  4OCI A;  1N65 A;  2R2I A;  1TTX A;  2CCM A;  2LHI A;  5IBW A;  1J7R A;  1CFF A;  4HRE E;  1L2O B;  1YVL A;  2WND A;  4IL1 A;  5CSF A;  1F54 A;  1DVI A;  1SK6 D;  3KEV A;  2KYF A;  3LLE A;  3A8R A;  4PHM A;  1A75 A;  2CBL A;  2KGR A;  2LVJ A;  3H4S E;  1SW8 A;  1QV1 A;  1OQP A;  1PSB A;  3NSO A;  1DF0 A;  1DJH A;  4I5N B;  4QJ3 B;  1TCO B;  3TDI A;  3EVR A;  4ZCU A;  1YUT A;  2M7N A;  1BMO A;  1NX3 A;  1YUU A;  2JOJ A;  1K9U A;  2LVK A;  4XJK A;  1MXL C;  2F8P A;  1ALW A;  4BY5 A;  1UP5 A;  4CPV A;  2KYC A;  1MQ1 A;  2WCB A;  1JUO A;  1J7O A;  3VRN A;  3AKA A;  5G08 A;  1QX2 A;  1XVJ A;  2KAY A;  2SAS A;  2EGD A;  4I5J A;  4MSP A;  4C0L A;  1RTP 1;  3CGA A;  4PE4 A;  2MBX A;  1SCM C;  1F71 A;  2L4I A;  3WHU B;  3VGO A;  3ICB A;  1C07 A;  2E30 A;  3FS7 A;  4L9M A;  1ZUZ A;  1TOP A;  3DVM A;  2K7B A;  3BYA A;  4OV2 A;  1K95 A;  1QVI Y;  2LP2 A;  4MBE A;  4YGE B;  1NX0 A;  1YRT B;  1KSM A;  1TN4 A;  1JWD A;  1CMF A;  1DTL A;  4N5X A;  1XFX O;  1RJV A;  2WCE A;  1MWN A;  1OOJ A;  1UWO A;  3I5F C;  1WRK A;  4CLN A;  2JT0 A;  1ODB A;  3SG2 A;  1DJG A;  1TNW A;  1XK4 C;  3VRR A;  2HET A;  4CID A;  1M45 A;  1K93 D;  1QX7 A;  1YUS A;  2I94 A;  1NCX A;  2Y1M A;  2BEC A;  4DUQ A;  1LXF C;  1ZMZ A;  1B9A A;  1WLM A;  3CS1 A;  3TS5 B;  1UHH A;  2F3Y A;  3KHE A;  4GAO A;  2KFH A;  1XFV O;  3RM1 A;  2JU0 A;  1IRJ A;  3JTD B;  1L7Z A;  1UHJ A;  1EXR A;  1WY9 A;  1M39 A;  3LCP C;  2M1K B;  2V53 A;  1NUB A;  4AOM A;  1GGW A;  1KK7 Z;  4UPG A;  4YGD B;  1BU3 A;  3FIA A;  5AFP A;  2L51 A;  3TUY C;  2A4J A;  3EKJ A;  2OTG C;  1LA3 A;  4BY4 A;  1PRW A;  3PAT A;  3EVU A;  2ZN8 A;  3CLN A;  4GGF C;  1S5G Y;  2JTT A;  5DKR A;  1K96 A;  1LA0 A;  1IJ6 A;  1IWQ A;  2L5X B;  2I2R E;  3CWG A;  2JT3 A;  1OMV A;  1IQ5 A;  2K2A A;  1H8B A;  1BG1 A;  1UUR A;  1KWO B;  2LCP A;  2Q4U A;  1CKK A;  1EH2 A;  2BCB A;  5I2L A;  1A03 A;  1QS7 A;  2M49 B;  3AAK A;  3SG3 A;  1B1G A;  1NWD A;  1L2O C;  1A2X A;  1NX2 A;  4FQO A;  1GQM A;  2FJU B;  2M9G A;  3GK4 X;  5AXI A;  3LL8 B;  3WNX B;  1S26 D;  4OVN F;  2BBN A;  5I8N A;  2FCD A;  4ORC B;  3MSE B;  3NSL A;  2LLU A;  1SBJ A;  2AAO A;  2L0P A;  3DF0 B;  2VRG A;  2LMU A; 
#chains in the Genus database with same CATH topology
 2K61 A;  4PDZ A;  1GM0 A;  2H61 C;  3IVT A;  2F3Z A;  3BOW A;  3R1P A;  1SRA A;  5D3O A;  3RZS A;  1F70 A;  2L2E A;  3BFB A;  1YVH A;  2MJW B;  5B8I B;  2GGZ A;  1ZOT B;  4MVF A;  1KQM B;  3LK1 A;  4OKH A;  1TIZ A;  1BT6 A;  1CFD A;  2HQ8 A;  1W7J B;  2Y4Q A;  5CSI A;  2HQW A;  5KTY A;  2BE4 A;  1AK8 A;  3B86 A;  1B8C A;  3I5G B;  1CDP A;  4PT1 A;  2KAX A;  1AP4 A;  2HF5 A;  1SY9 A;  2OPO A;  2KGB C;  1E8A A;  1PAL A;  2ZND A;  3CZ2 A;  1HT9 A;  3B6X A;  3OHM B;  1UHN A;  4JQ0 D;  3EG5 B;  1D1O A;  4M2Q A;  2CT9 A;  1PSR A;  2KFF A;  3EK8 A;  1AUI B;  1WRZ A;  2AMI A;  4XYN A;  1QVI Z;  2JQ6 A;  3OB1 B;  2OS8 B;  2AUC A;  1DMO A;  1A75 B;  3BJH A;  2K7O A;  2P70 A;  2PQL A;  3PM8 A;  4D1E A;  4GGF A;  1CLB A;  5KU1 A;  2WC8 A;  5F6T A;  1F4Q A;  1BOC A;  2MLF C;  4YI9 A;  5DKQ A;  2ZFD A;  4U8D A;  1UHK A;  4XJK B;  3TS5 C;  1CMG A;  2FOT A;  1QAS A;  4ICB A;  3JTD C;  4IJ7 A;  1B4C A;  2L2C A;  1J1E A;  2CTN A;  1CTR A;  1REC A;  3QME A;  2Y5I A;  2JUL A;  3PAL A;  2LP3 A;  4OR9 B;  3ZWH A;  2QEH A;  1PK0 D;  1S6C A;  1OOI X;  3CZT X;  3D0Y B;  2KHN A;  4HRG A;  4GUK A;  1IQ3 A;  1GGZ A;  4QJ5 B;  1CNP A;  4MN0 A;  1TNX A;  3PSR A;  4DCK A;  1IKU A;  4C0K A;  2NCP A;  1KQV A;  4PHK A;  1Y1U A;  3EVV A;  1AJ4 A;  1TNP A;  5GQQ C;  2KLD A;  2KOT A;  1VRK A;  1K94 A;  3BFH A;  3DYE A;  5HKZ A;  1H4B A;  2G2B A;  1SKT A;  2K2F A;  3O78 A;  1C7W A;  1S5G Z;  1YX8 A;  2B1U A;  1KWO C;  4NQG A;  4A4C A;  4YGB B;  3PJI A;  2L98 A;  1M63 B;  1NSH A;  1QV0 A;  1NCZ A;  5FI7 A;  2LLS A;  3VRP A;  1JBA A;  1XFY O;  3L4L A;  1CLL A;  2BBM A;  1OZS A;  2JXC A;  2LNK A;  1LIN A;  3OX5 A;  3IF7 A;  2E6W A;  2WC5 A;  1ALV A;  1DJW A;  3WXA A;  3ZNI A;  4ETO A;  2WCF A;  4KYN A;  5ER5 A;  4ZCV A;  4JKT A;  3BUO B;  1JFK A;  2QEV A;  5I2O A;  1FI6 A;  2BL0 B;  2BKI B;  2MAZ A;  1ZAC A;  3PN7 B;  1SL9 A;  1CDN A;  1CFC A;  1DJY A;  1MHO A;  2PVB A;  3M0W A;  4A4B A;  1CM4 A;  1S3P A;  1YRU B;  2BKH B;  3Q8I A;  3QRX A;  5HKW A;  1SR6 B;  2JC2 A;  3L4A A;  1MUX A;  2G9B A;  3I5I B;  2KSP A;  1B8R A;  2LVI A;  2WCH A;  2KQY A;  2KI4 B;  1MF8 B;  1CDL A;  5AER A;  1CM1 A;  1KQM C;  1UUS A;  3D10 A;  4P2Y B;  4PE1 A;  3SG5 A;  4FTG A;  1K8U A;  1TCF A;  1TUJ A;  3S0B A;  1KCY A;  3DVK A;  2K7C A;  1BJF A;  3I5G C;  3BUX B;  2NCO A;  1ZFS A;  2P6B B;  2L4H A;  1V1G A;  1SCV A;  2NZ0 A;  2O60 A;  2ZRS A;  4PAL A;  4PHJ A;  4WQ2 A;  4YI8 A;  1AHR A;  4PE7 A;  3DY9 A;  2KAV A;  1NCY A;  4CFQ A;  3KO0 A;  1HQV A;  3O4Y A;  1RRO A;  4F0Z B;  2KBI A;  2NLN A;  1FF1 A;  4GPL B;  1B7T Y;  3AAJ A;  3TDZ A;  1JFJ A;  2M1U A;  2ZKM X;  2FJY A;  1UHI A;  2CNP A;  2JXL A;  1DGV A;  1SCM B;  2Y1N A;  2ZN9 A;  1DEL A;  1B47 A;  1NIW A;  2LUX A;  2OS8 C;  3AKB A;  4QJ4 B;  3B7A A;  1S6J A;  1G8I A;  1RFJ A;  3I5H B;  5CSN A;  2JNX A;  2SCP A;  4CFR A;  1G4Y R;  1W9Z A;  1XA5 A;  3JVT B;  2LMV A;  3BUW B;  1QJT A;  1YUR A;  5JJG A;  1EG3 A;  1KFU L;  2PMY A;  3BOW B;  1Y1A A;  2I7A A;  1QWV A;  2QPT A;  3FWB A;  5D69 A;  1JF0 A;  3S0D A;  1MR8 A;  1YX7 A;  1Y6W A;  1LVC D;  2KNE A;  2M97 A;  1F55 A;  5HLV A;  1J55 A;  3O2P A;  3L47 A;  1XK4 A;  2O5G A;  1KK8 B;  2IS9 A;  2H2K A;  2KI6 C;  3GK1 A;  1QLS A;  5D7F A;  2CXJ A;  1LKJ A;  1SL7 A;  3B87 A;  4I5K A;  5JOL A;  2BE6 A;  3NHI A;  1WDC B;  3GOF A;  4MZJ A;  2JZI A;  3KPX A;  1DJZ A;  3VRO A;  5HL1 A;  1SSE B;  3SG6 A;  4JPZ B;  1GJY A;  1SYM A;  2LHL A;  1KSO A;  1OSA A;  3SIB A;  1R6P A;  2K8M B;  1R2U A;  1XFZ O;  1KFX L;  2JRF A;  2VRG A;  1Q80 A;  1B8L A;  1OW4 A;  1EJ3 A;  2HPS A;  3TUY B;  2PAL A;  2ISD A;  3F45 A;  5CSJ A;  1AJ5 A;  2MA2 A;  1QAT A;  5HYD A;  2BCX A;  3OX6 A;  4PCW A;  1X02 A;  1U5I A;  1DF0 B;  1K9K A;  2LE9 B;  4USL A;  5AAN A;  2M29 A;  1C3Z A;  1V1F A;  2K60 A;  1KFU S;  2EC6 B;  3B88 A;  4M2O A;  4WQ3 A;  5I2Q A;  3DVE A;  4HSZ A;  2BL0 C;  2K7D A;  3O6B A;  5FI2 A;  3PN7 C;  3K21 A;  3BFA A;  2JPO A;  1BOD A;  4FQT A;  2KQ6 A;  2LV7 A;  5FYX A;  3IQQ A;  4DRW A;  2MHH A;  3SG7 A;  2KPH A;  2I18 A;  1IH0 A;  1Y0V H;  1YR5 A;  1SR6 C;  1IIO A;  5TNC A;  1EG4 A;  3CR5 X;  3I5I C;  3R1O A;  3BUN B;  2KI4 C;  1JF2 A;  2NXQ A;  3TZ1 A;  2D8N A;  2LAP A;  3NSI A;  1YTZ C;  3NSK A;  2WCL A;  1DJX A;  1K90 D;  2WCM A;  1TNQ A;  2WOR A;  3EK4 A;  1FW4 A;  4INW A;  2MLE C;  3CDN A;  1J7Q A;  2L5Y A;  2DOQ A;  2EHB A;  2H61 A;  3S0F A;  3EKH A;  4NDD A;  2PSR A;  3WHT B;  4YBH B;  2WC6 A;  1CB1 A;  3BQ3 A;  1KFX S;  5HKY A;  2ZNE A;  4E68 A;  1CFP A;  2BAP A;  3FWC A;  2LM5 A;  1WLZ A;  1BR4 B;  1BR1 B;  3D0Y A;  1EL4 A;  1B7T Z;  2QAC A;  3C1V A;  4WRI A;  5HLO A;  2LAN A;  4DS7 A;  2BNX A;  1DT7 B;  3KF9 A;  3OGN A;  1TRF A;  4N1G A;  3I5H C;  1A29 A;  1DQE A;  1OOG A;  2KI6 D;  1MXE A;  3E3R A;  1PUL A;  3BUM B;  3JVT C;  1RWY A;  3VRQ A;  2QDI A;  1Y1X A;  2Q91 A;  1A4P A;  4TNC A;  2COL B;  5J3X A;  4MLW A;  1SMG A;  4N1F A;  1J7P A;  1FBV A;  4MZK A;  2GV5 A;  2JWW A;  3GK2 A;  1OZO A;  4DIR A;  1IJ5 A;  3CR4 X;  2MRD A;  1QX5 B;  2F33 A;  3R1V A;  1SNL A;  2FCE A;  2RGI A;  3PFV A;  4JD9 A;  2QEO A;  4MEW A;  2JPT A;  1KK8 C;  1NX1 A;  2LC5 A;  4ORB B;  5ER4 X;  2WCJ A;  1NP8 A;  5PAL A;  2M3W A;  4M2P A;  1PVB A;  3BXK A;  1QLK A;  5FI6 A;  1DGU A;  2LMT A;  1XFW O;  1P28 A;  1S36 A;  1WDC C;  5AEQ A;  3SG4 A;  4GBA A;  3OP0 A;  1CLM A;  1N0Y A;  1JSA A;  3D76 A;  4HRH A;  3SJS A;  3UO9 A;  2K0J A;  1FPW A;  5K89 A;  1S1E A;  2F2O A;  1XYD A;  3CR2 A;  3S0G A;  2F2P A;  3CYZ A;  3IQO A;  3N7H A;  1JC2 A;  3K1E A;  4MRX A;  2WOS A;  2PRU A;  3D74 A;  2ERB A;  5BPJ A;  3OB2 B;  4Q04 A;  1WRL A;  3HCM A;  2GGM A;  3HX4 A;  1K9P A;  3DXL A;  1AVS A;  4OZD A;  4AQI A;  1LS8 A;  3UNW A;  1F4O A;  4GFT A;  1XFU O;  2EC6 C;  2PAS A;  4JWQ A;  3V2L A;  4PHN A;  3I5F B;  4NDB A;  3D73 A;  1BLQ A;  2BCA A;  3LK0 A;  1C7V A;  1NPQ A;  1QTX A;  4GNK B;  3A4U B;  1OE9 B;  1OOH A;  4GGN A;  3O4X A;  4P5O E;  4AQJ A;  3NGV A;  4YGC B;  3RLZ A;  2LVV A;  1FI5 A;  1QIV A;  2JTZ A;  3D75 A;  3DVJ A;  2PYQ A;  3DZT A;  1QIW A;  4MRY A;  4MZL A;  4R1E A;  2M0R A;  1M46 A;  1M31 A;  3NXA A;  2KBM A;  2WCK A;  3SIA A;  4ORA B;  3EK7 A;  2L50 A;  3DF0 A;  3SS5 A;  5DKN A;  5KSZ A;  4NDC A;  3S0E A;  1BF5 A;  3DD4 A;  1KK7 Y;  1DJI A;  2JT8 A;  1QXP A;  1NYA A;  2M7L A;  1IG5 A;  1J1D A;  2M8U A;  3FE6 A;  4YGA A;  1G33 A;  1SL8 A;  1TWO A;  1F8H A;  3NHT A;  1N2D A;  1PVA A;  2KFG A;  3PM2 A;  5I94 A;  1XO5 A;  2JNF A;  4PE0 A;  4YRU A;  3PLF B;  2OTG B;  1RK9 A;  2LUC A;  2KDH A;  3FE8 A;  4F7F A;  1U5I B;  1OMR A;  5CPV A;  1W7I B;  2TN4 A;  2ZRT A;  4I5L B;  1CDM A;  3CTN A;  1S6I A;  1XFR A;  1IGV A;  3CZ1 A;  3TDU A;  1K2H A;  4C0J A;  1OMD A;  1SPY A;  2LLT A;  3D77 A;  4OCI A;  1N65 A;  2R2I A;  1TTX A;  2CCM A;  1OOF A;  2LHI A;  5IBW A;  1J7R A;  1CFF A;  4HRE E;  1L2O B;  1YVL A;  2WND A;  4IL1 A;  5CSF A;  1F54 A;  1DVI A;  1SK6 D;  3KEV A;  2KYF A;  3LLE A;  2P71 A;  3A8R A;  4PHM A;  3SS4 A;  1A75 A;  2CBL A;  2KGR A;  2LVJ A;  3H4S E;  1SW8 A;  1QV1 A;  1OQP A;  1PSB A;  3NSO A;  1DF0 A;  1DJH A;  4I5N B;  4QJ3 B;  1TCO B;  3TDI A;  3EVR A;  4ZCU A;  1YUT A;  2M7N A;  1BMO A;  1NX3 A;  1YUU A;  2JOJ A;  1DEK A;  1K9U A;  2LVK A;  4XJK A;  1MXL C;  2F8P A;  4INX A;  1ALW A;  4BY5 A;  1UP5 A;  4CPV A;  2KYC A;  1MQ1 A;  2WCB A;  1JUO A;  1J7O A;  3VRN A;  3AKA A;  5G08 A;  1QX2 A;  1Z4H A;  1XVJ A;  2KAY A;  2SAS A;  2EGD A;  1T14 A;  4I5J A;  4MSP A;  4C0L A;  1RTP 1;  3CGA A;  4PE4 A;  2MBX A;  1SCM C;  1F71 A;  2L4I A;  3WHU B;  3VGO A;  2GTE A;  3ICB A;  1C07 A;  2E30 A;  3FS7 A;  4L9M A;  1ZUZ A;  1TOP A;  3DVM A;  2H8V A;  3OBV A;  2K7B A;  3BYA A;  4OV2 A;  5EL2 A;  1K95 A;  1QVI Y;  2LP2 A;  4MBE A;  4YGE B;  1NX0 A;  1YRT B;  1KSM A;  1TN4 A;  1JWD A;  1CMF A;  1DTL A;  2YGU A;  4N5X A;  1XFX O;  1RJV A;  2KLE A;  2WCE A;  1MWN A;  1OOJ A;  1UWO A;  3I5F C;  1WRK A;  4CLN A;  2JT0 A;  1ODB A;  3SG2 A;  3VB1 A;  1DJG A;  1TNW A;  1XK4 C;  3VRR A;  2HET A;  4CID A;  1M45 A;  1K93 D;  1QX7 A;  1YUS A;  2I94 A;  1NCX A;  2Y1M A;  2BEC A;  4DUQ A;  1LXF C;  1ZMZ A;  1B9A A;  1ORG A;  1WLM A;  3CS1 A;  3TS5 B;  1UHH A;  2F3Y A;  3KHE A;  4GAO A;  2KFH A;  1XFV O;  3RM1 A;  2JU0 A;  1IRJ A;  3JTD B;  1L7Z A;  1UHJ A;  1EXR A;  3CAB A;  1WY9 A;  1M39 A;  3LCP C;  2M1K B;  2QEB A;  2V53 A;  1NUB A;  5DIC A;  4AOM A;  1GGW A;  1KK7 Z;  4UPG A;  4YGD B;  1BU3 A;  3FIA A;  5AFP A;  2L51 A;  3TUY C;  3CZ0 A;  2A4J A;  3EKJ A;  2OTG C;  1LA3 A;  4BY4 A;  1PRW A;  3PAT A;  3EVU A;  2ZN8 A;  3CLN A;  4GGF C;  1Z2C B;  1S5G Y;  2JTT A;  5DKR A;  1K96 A;  1LA0 A;  1IJ6 A;  1IWQ A;  3FE9 A;  2L5X B;  2I2R E;  3CWG A;  2JT3 A;  1OMV A;  1IQ5 A;  2K2A A;  1H8B A;  1BG1 A;  1UUR A;  1KWO B;  2LCP A;  2Q4U A;  3D78 A;  1CKK A;  1EH2 A;  2BCB A;  5I2L A;  1A03 A;  1QS7 A;  2M49 B;  3AAK A;  3R72 A;  3SG3 A;  1B1G A;  1NWD A;  1L2O C;  3S0A A;  1A2X A;  1NX2 A;  4FQO A;  1GQM A;  2FJU B;  2M9G A;  3GK4 X;  5AXI A;  3LL8 B;  3WNX B;  1S26 D;  4OVN F;  2BBN A;  5I8N A;  2FCD A;  4ORC B;  3MSE B;  3NSL A;  1C3Y A;  2LLU A;  1SBJ A;  3SS3 A;  2AAO A;  2L0P A;  3DF0 B;  1DC1 A;  1TUZ A;  2LMU A; 
#chains in the Genus database with same CATH homology
 2K61 A;  4PDZ A;  2H61 C;  2F3Z A;  3BOW A;  1SRA A;  1F70 A;  2L2E A;  1YVH A;  2MJW B;  5B8I B;  2GGZ A;  1ZOT B;  4MVF A;  1KQM B;  3LK1 A;  4OKH A;  1TIZ A;  1BT6 A;  1CFD A;  2HQ8 A;  1W7J B;  2Y4Q A;  5CSI A;  2HQW A;  5KTY A;  2BE4 A;  1AK8 A;  1B8C A;  3I5G B;  1CDP A;  2KAX A;  1AP4 A;  2HF5 A;  1SY9 A;  2OPO A;  2KGB C;  1E8A A;  1PAL A;  2ZND A;  1HT9 A;  3OHM B;  1UHN A;  4JQ0 D;  1D1O A;  4M2Q A;  2CT9 A;  1PSR A;  2KFF A;  3EK8 A;  1AUI B;  1WRZ A;  2AMI A;  4XYN A;  1QVI Z;  2JQ6 A;  3OB1 B;  2OS8 B;  2AUC A;  1DMO A;  1A75 B;  2K7O A;  3PM8 A;  4D1E A;  4GGF A;  1CLB A;  5KU1 A;  2WC8 A;  5F6T A;  1F4Q A;  1BOC A;  2MLF C;  4YI9 A;  5DKQ A;  2ZFD A;  4U8D A;  1UHK A;  4XJK B;  3TS5 C;  1CMG A;  2FOT A;  1QAS A;  4ICB A;  3JTD C;  1B4C A;  1J1E A;  2CTN A;  1CTR A;  1REC A;  2Y5I A;  2JUL A;  3PAL A;  2LP3 A;  4OR9 B;  3ZWH A;  1IQ3 A;  1PK0 D;  1S6C A;  3CZT X;  4HRG A;  3D0Y B;  2KHN A;  4GUK A;  1GGZ A;  4QJ5 B;  1CNP A;  4MN0 A;  1TNX A;  3PSR A;  4DCK A;  1IKU A;  4C0K A;  2NCP A;  1KQV A;  4PHK A;  1Y1U A;  3EVV A;  1AJ4 A;  1TNP A;  5GQQ C;  2KOT A;  5HKZ A;  1VRK A;  1K94 A;  1H4B A;  2G2B A;  1SKT A;  2K2F A;  3O78 A;  1C7W A;  1S5G Z;  1YX8 A;  2B1U A;  1KWO C;  4NQG A;  4A4C A;  4YGB B;  2L98 A;  1M63 B;  1NSH A;  1QV0 A;  1NCZ A;  1JBA A;  2LLS A;  3VRP A;  1XFY O;  1CLL A;  2BBM A;  1OZS A;  2JXC A;  2LNK A;  1LIN A;  3OX5 A;  3IF7 A;  2E6W A;  3WXA A;  1ALV A;  1DJW A;  3ZNI A;  4ETO A;  2WCF A;  5ER5 A;  4ZCV A;  3BUO B;  1JFK A;  5I2O A;  1FI6 A;  2BL0 B;  2BKI B;  2MAZ A;  1ZAC A;  3PN7 B;  1SL9 A;  1CDN A;  1CFC A;  1DJY A;  1MHO A;  2PVB A;  3M0W A;  4A4B A;  1CM4 A;  1S3P A;  1YRU B;  2BKH B;  3QRX A;  5HKW A;  1SR6 B;  2JC2 A;  1MUX A;  2G9B A;  3I5I B;  2KSP A;  1B8R A;  2LVI A;  2KQY A;  2KI4 B;  1MF8 B;  1CDL A;  5AER A;  1CM1 A;  1KQM C;  1UUS A;  3D10 A;  4P2Y B;  4PE1 A;  3SG5 A;  4FTG A;  1K8U A;  1TCF A;  1KCY A;  3DVK A;  2K7C A;  1BJF A;  3I5G C;  3BUX B;  2NCO A;  1ZFS A;  2P6B B;  2L4H A;  1V1G A;  1SCV A;  2NZ0 A;  2O60 A;  2ZRS A;  4PAL A;  4PHJ A;  4WQ2 A;  4YI8 A;  1AHR A;  4PE7 A;  2KAV A;  1NCY A;  4CFQ A;  3KO0 A;  1HQV A;  3O4Y A;  1RRO A;  4F0Z B;  2KBI A;  2NLN A;  1FF1 A;  4GPL B;  1B7T Y;  3AAJ A;  3TDZ A;  1JFJ A;  2M1U A;  2ZKM X;  1UHI A;  2CNP A;  2JXL A;  1DGV A;  1SCM B;  2Y1N A;  2ZN9 A;  1NIW A;  1B47 A;  2OS8 C;  2LUX A;  3AKB A;  4QJ4 B;  1S6J A;  1G8I A;  1RFJ A;  3I5H B;  5CSN A;  2JNX A;  2SCP A;  4CFR A;  1G4Y R;  3JVT B;  1XA5 A;  2LMV A;  3BUW B;  1QJT A;  1YUR A;  5JJG A;  1EG3 A;  1KFU L;  2PMY A;  3BOW B;  1Y1A A;  2I7A A;  2QPT A;  3FWB A;  5D69 A;  1JF0 A;  1MR8 A;  1YX7 A;  1Y6W A;  1LVC D;  2KNE A;  2M97 A;  1F55 A;  5HLV A;  1J55 A;  3O2P A;  1XK4 A;  2O5G A;  1KK8 B;  2IS9 A;  2H2K A;  2KI6 C;  3GK1 A;  1QLS A;  5D7F A;  2CXJ A;  1LKJ A;  1SL7 A;  4I5K A;  5JOL A;  2BE6 A;  1WDC B;  3GOF A;  4MZJ A;  2JZI A;  3KPX A;  1DJZ A;  3VRO A;  3SG6 A;  4JPZ B;  1GJY A;  1SYM A;  2LHL A;  1KSO A;  1OSA A;  3SIB A;  1R6P A;  2K8M B;  1R2U A;  1XFZ O;  1KFX L;  2JRF A;  1Q80 A;  1B8L A;  1EJ3 A;  2HPS A;  3TUY B;  2PAL A;  2ISD A;  3F45 A;  5CSJ A;  1AJ5 A;  2MA2 A;  1QAT A;  5HYD A;  2BCX A;  3OX6 A;  4PCW A;  1X02 A;  1U5I A;  1DF0 B;  1K9K A;  2LE9 B;  4USL A;  5AAN A;  2M29 A;  1V1F A;  4M2O A;  1KFU S;  2EC6 B;  4WQ3 A;  5I2Q A;  3DVE A;  4HSZ A;  2BL0 C;  2K7D A;  3O6B A;  1BOD A;  3PN7 C;  3K21 A;  2KQ6 A;  2LV7 A;  5FYX A;  3IQQ A;  4DRW A;  2MHH A;  3SG7 A;  2I18 A;  1IH0 A;  1Y0V H;  1YR5 A;  1SR6 C;  5TNC A;  1EG4 A;  3CR5 X;  3I5I C;  3BUN B;  2KI4 C;  1JF2 A;  2NXQ A;  3TZ1 A;  2D8N A;  2LAP A;  3NSI A;  1YTZ C;  3NSK A;  1DJX A;  1K90 D;  3EK4 A;  1TNQ A;  2WOR A;  1FW4 A;  2MLE C;  1J7Q A;  2DOQ A;  2EHB A;  2H61 A;  3EKH A;  4NDD A;  2PSR A;  3WHT B;  4YBH B;  1CB1 A;  3BQ3 A;  1KFX S;  5HKY A;  2ZNE A;  4E68 A;  1CFP A;  3FWC A;  2LM5 A;  1WLZ A;  1BR4 B;  1BR1 B;  3D0Y A;  1EL4 A;  1B7T Z;  2QAC A;  3C1V A;  4WRI A;  5HLO A;  2LAN A;  4DS7 A;  1DT7 B;  3KF9 A;  1TRF A;  4N1G A;  3I5H C;  1A29 A;  2KI6 D;  1MXE A;  3E3R A;  1PUL A;  3BUM B;  3JVT C;  1RWY A;  3VRQ A;  1Y1X A;  2Q91 A;  1A4P A;  4TNC A;  2COL B;  5J3X A;  4MLW A;  1SMG A;  4N1F A;  1J7P A;  1FBV A;  4MZK A;  2GV5 A;  2JWW A;  3GK2 A;  1OZO A;  4DIR A;  1IJ5 A;  3CR4 X;  2MRD A;  1QX5 B;  2F33 A;  1SNL A;  2FCE A;  2RGI A;  3PFV A;  4MEW A;  2JPT A;  1KK8 C;  1NX1 A;  2LC5 A;  4ORB B;  5ER4 X;  1NP8 A;  5PAL A;  2M3W A;  4M2P A;  1PVB A;  3BXK A;  1QLK A;  1DGU A;  2LMT A;  1XFW O;  1S36 A;  1WDC C;  5AEQ A;  3SG4 A;  4GBA A;  3OP0 A;  1CLM A;  1N0Y A;  1JSA A;  4HRH A;  3SJS A;  2K0J A;  1FPW A;  5K89 A;  1S1E A;  2F2O A;  1XYD A;  3CR2 A;  2F2P A;  3IQO A;  1JC2 A;  4MRX A;  2WOS A;  2PRU A;  5BPJ A;  3OB2 B;  4Q04 A;  1WRL A;  3HCM A;  2GGM A;  3HX4 A;  1K9P A;  1AVS A;  4AQI A;  1F4O A;  4GFT A;  1XFU O;  2EC6 C;  2PAS A;  4JWQ A;  4PHN A;  3I5F B;  4NDB A;  1BLQ A;  2BCA A;  3LK0 A;  1C7V A;  1NPQ A;  1QTX A;  4GNK B;  3A4U B;  1OE9 B;  4GGN A;  4P5O E;  4AQJ A;  4YGC B;  3RLZ A;  2LVV A;  1FI5 A;  1QIV A;  2JTZ A;  3DVJ A;  4MZL A;  4R1E A;  4MRY A;  1QIW A;  2M0R A;  1M46 A;  1M31 A;  3NXA A;  2KBM A;  3SIA A;  4ORA B;  3EK7 A;  2L50 A;  3DF0 A;  5DKN A;  5KSZ A;  4NDC A;  1BF5 A;  3DD4 A;  1KK7 Y;  1DJI A;  2JT8 A;  1QXP A;  1NYA A;  2M7L A;  1IG5 A;  1J1D A;  2M8U A;  1F8H A;  4YGA A;  1G33 A;  1SL8 A;  1N2D A;  1PVA A;  2KFG A;  1XO5 A;  2JNF A;  4PE0 A;  4YRU A;  3PLF B;  2OTG B;  1RK9 A;  2LUC A;  2KDH A;  1U5I B;  1OMR A;  5CPV A;  1W7I B;  2TN4 A;  2ZRT A;  4I5L B;  1CDM A;  3CTN A;  1S6I A;  3TDU A;  1IGV A;  1K2H A;  4C0J A;  1OMD A;  1SPY A;  2LLT A;  4OCI A;  1N65 A;  2R2I A;  1TTX A;  2CCM A;  2LHI A;  5IBW A;  1J7R A;  1CFF A;  4HRE E;  1L2O B;  1YVL A;  2WND A;  4IL1 A;  5CSF A;  1F54 A;  1DVI A;  1SK6 D;  3KEV A;  2KYF A;  3LLE A;  3A8R A;  4PHM A;  1A75 A;  2CBL A;  2KGR A;  2LVJ A;  3H4S E;  1SW8 A;  1QV1 A;  1OQP A;  1PSB A;  3NSO A;  1DF0 A;  1DJH A;  4I5N B;  4QJ3 B;  1TCO B;  3TDI A;  3EVR A;  4ZCU A;  1YUT A;  2M7N A;  1BMO A;  1NX3 A;  1YUU A;  2JOJ A;  1K9U A;  2LVK A;  4XJK A;  1MXL C;  2F8P A;  1ALW A;  4BY5 A;  1UP5 A;  4CPV A;  2KYC A;  1MQ1 A;  2WCB A;  1JUO A;  1J7O A;  3VRN A;  3AKA A;  5G08 A;  1QX2 A;  1XVJ A;  2KAY A;  2SAS A;  2EGD A;  4I5J A;  4MSP A;  4C0L A;  1RTP 1;  3CGA A;  4PE4 A;  2MBX A;  1SCM C;  1F71 A;  2L4I A;  3WHU B;  3VGO A;  3ICB A;  1C07 A;  2E30 A;  3FS7 A;  4L9M A;  1ZUZ A;  1TOP A;  3DVM A;  2K7B A;  3BYA A;  4OV2 A;  1K95 A;  1QVI Y;  2LP2 A;  4MBE A;  4YGE B;  1NX0 A;  1YRT B;  1KSM A;  1TN4 A;  1JWD A;  1CMF A;  1DTL A;  4N5X A;  1XFX O;  1RJV A;  2WCE A;  1MWN A;  1OOJ A;  1UWO A;  3I5F C;  1WRK A;  4CLN A;  2JT0 A;  1ODB A;  3SG2 A;  1DJG A;  1TNW A;  1XK4 C;  3VRR A;  2HET A;  4CID A;  1M45 A;  1K93 D;  1QX7 A;  1YUS A;  2I94 A;  1NCX A;  2Y1M A;  2BEC A;  4DUQ A;  1LXF C;  1ZMZ A;  1B9A A;  1WLM A;  3CS1 A;  3TS5 B;  1UHH A;  2F3Y A;  3KHE A;  4GAO A;  2KFH A;  1XFV O;  3RM1 A;  2JU0 A;  1IRJ A;  3JTD B;  1L7Z A;  1UHJ A;  1EXR A;  1WY9 A;  1M39 A;  3LCP C;  2M1K B;  2V53 A;  1NUB A;  4AOM A;  1GGW A;  1KK7 Z;  4UPG A;  4YGD B;  1BU3 A;  3FIA A;  5AFP A;  2L51 A;  3TUY C;  2A4J A;  3EKJ A;  2OTG C;  1LA3 A;  4BY4 A;  1PRW A;  3PAT A;  3EVU A;  2ZN8 A;  3CLN A;  4GGF C;  1S5G Y;  2JTT A;  5DKR A;  1K96 A;  1LA0 A;  1IJ6 A;  1IWQ A;  2L5X B;  2I2R E;  3CWG A;  2JT3 A;  1OMV A;  1IQ5 A;  2K2A A;  1H8B A;  1BG1 A;  1UUR A;  1KWO B;  2LCP A;  2Q4U A;  1CKK A;  1EH2 A;  2BCB A;  5I2L A;  1A03 A;  1QS7 A;  2M49 B;  3AAK A;  3SG3 A;  1B1G A;  1NWD A;  1L2O C;  1A2X A;  1NX2 A;  4FQO A;  1GQM A;  2FJU B;  2M9G A;  3GK4 X;  5AXI A;  3LL8 B;  3WNX B;  1S26 D;  4OVN F;  2BBN A;  5I8N A;  2FCD A;  4ORC B;  3MSE B;  3NSL A;  2LLU A;  1SBJ A;  2AAO A;  2L0P A;  3DF0 B;  2VRG A;  2LMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...