2KGBC

Nmr solution of the regulatory domain cardiac f77w-troponin c in complex with the cardiac troponin i 144-163 switch peptide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
89
structure length
89
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEWLVMMVRCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title The effect of the cosolvent trifluoroethanol on a tryptophan side chain orientation in the hydrophobic core of troponin C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein/ca binding protein
total genus 21
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kgbC00
1EL4A 4DUQA 3CLNA 1QATA 2KGRA 2TN4A 3ZNIA 1R6PA 1MXLC 1JUOA 2JTZA 2PALA 5ER4X 2K7CA 2ZRTA 1CM4A 2ISDA 4M2PA 1XO5A 1CLMA 2WNDA 4PHKA 1VRKA 5PALA 1F70A 2E6WA 2LCPA 3JTDC 1XFWO 2I18A 3DVMA 1BG1A 1M63B 1ZUZA 3FWBA 2RGIA 2ZRSA 2CXJA 2MBXA 3PN7C 2KFHA 2MLFC 4IL1A 4PE0A 1H4BA 2F3ZA 1CFCA 1JFKA 1FF1A 1NX3A 3ICBA 1EG4A 4OR9B 5B8IB 1JFJA 5DKRA 4CLNA 2K7BA 1Y0VH 3AKAA 1AK8A 1CFFA 1JBAA 3KO0A 1S6IA 2H2KA 1A29A 1TNWA 2EGDA 3I5IB 1F4OA 2E30A 1BMOA 3SG2A 2KI6C 4E68A 1BOCA 2LANA 5HKZA 1SY9A 1K90D 4ICBA 4AQJA 3H4SE 3JVTC 4GAOA 1F54A 2NXQA 1HQVA 1Y6WA 3SIAA 2M7NA 2JT3A 4MEWA 3CR4X 3RM1A 4QJ4B 2JU0A 4FTGA 3DF0A 2ZFDA 1KSMA 3CTNA 2P6BB 1Y1AA 2OPOA 2R2IA 4MZJA 1EJ3A 1B7TZ 2KAYA 1LA3A 1PRWA 2WOSA 1JWDA 1K95A 1CDMA 5I2QA 1G4YR 2M8UA 2LVIA 1N2DA 1DGUA 3IQOA 1IQ5A 1SRAA 1WDCB 1YVHA 1YVLA 1RROA 3DD4A 4PE4A 1J7QA 3OX6A 3SG6A 2AMIA 2K2AA 5HKWA 5CSFA 2IS9A 2KQYA 2WORA 1B47A 3BUOB 1CLLA 2KI4B 2M1KB 1SBJA 3NSLA 4XYNA 1MF8B 5AANA 1AHRA 1C7VA 1WLMA 4MBEA 2F2PA 1XFZO 1WRLA 1J7RA 1QLSA 3VRPA 1SK6D 1CDPA 3TZ1A 1JF0A 1IQ3A 2LV7A 2BKHB 1J7PA 4OCIA 2JOJA 2DOQA 3BUNB 4MZKA 3C1VA 2ZKMX 3A4UB 2KBIA 2JTTA 4R1EA 1TN4A 1IJ6A 1J55A 2BBMA 1XVJA 2L50A 2HPSA 2CBLA 3KHEA 3TUYB 3WNXB 2V53A 4I5KA 5GQQC 2L2EA 1KQMC 5ER5A 2NLNA 3PFVA 4TNCA 2KFGA 2Y5IA 2KI6D 1DF0B 3TDUA 3O6BA 4NDBA 1QJTA 1WDCC 1YR5A 1XK4A 1PULA 5CSIA 2Y4QA 1K93D 1M45A 2BE4A 2BCXA 1S5GY 2LP3A 3OHMB 4BY4A 3FS7A 2KFFA 2FJUB 4OKHA 1XFUO 1G8IA 1S1EA 4CPVA 1GJYA 1DMOA 1CMFA 3EVVA 1OE9B 4YI8A 1OMRA 3DVKA 1U5IB 5JOLA 3BQ3A 3SG4A 4GGFA 1TCOB 2LM5A 2G9BA 3PLFB 1K2HA 3NXAA 3VROA 2K8MB 2WCFA 1MXEA 1AP4A 4MZLA 1ALVA 2MJWB 3ZWHA 5J3XA 2Y1NA 2BE6A 2LVJA 1UURA 3OB2B 3BUWB 1SNLA 3K21A 3EVUA 1OOJA 2JXLA 4ORAB 1KK7Z 1B4CA 1J1DA 1S6JA 3TDIA 3TUYC 1JSAA 3RLZA 3EK8A 4YGDB 2CTNA 1A2XA 5JJGA 3JVTB 3SJSA 1NX1A 2JXCA 2NCOA 2SASA 3BXKA 1A75A 2GV5A 2CCMA 1DT7B 2LMTA 5AXIA 1LKJA 2ZN9A 4HREE 4YGEB 2LMUA 1LA0A 3PALA 1B8LA 1SL8A 1LXFC 1SW8A 3TS5C 1OZSA 2QACA 2NCPA 2CNPA 3D10A 2K2FA 1CLBA 2Y1MA 1C07A 4GBAA 2NZ0A 2HQ8A 2BL0B 1Q80A 1U5IA 4P5OE 1K94A 1B9AA 1PALA 1SR6B 2JZIA 2M97A 5IBWA 2ZNDA 3FWCA 3GK2A 2M0RA 1NCXA 1K9UA 2LVKA 5CSJA 1BLQA 1W7JB 2WC8A 2GGZA 4DCKA 1PSRA 1IRJA 3LCPC 3HX4A 1OSAA 2ZNEA 4ZCVA 2LLUA 1F4QA 2SCPA 1D1OA 2F2OA 4FQOA 3IQQA 2LE9B 3PM8A 1SKTA 1F8HA 4C0LA 1QX7A 2Q91A 1N0YA 1V1FA 2KQ6A 3OB1B 2LLSA 2H61C 1KFXS 1PK0D 2F8PA 2MA2A 1NCZA 1UP5A 1C7WA 3D0YB 2EC6C 1QIWA 2LNKA 1V1GA 1NWDA 3MSEB 1UHHA 1YRUB 3CZTX 1RECA 2BCAA 4P2YB 1F71A 1BODA 1BF5A 4YI9A 5AERA 3HCMA 1RFJA 3LLEA 4NDDA 4PCWA 5TNCA 1CFDA 1KQMB 1TCFA 2HETA 1IH0A 4OV2A 1DJIA 3PATA 2LHLA 2BL0C 2KSPA 1OMDA 1SR6C 2LUXA 1M46A 1BR1B 2K61A 1NX2A 1AVSA 2OS8B 2M7LA 4GUKA 1YX7A 2L5XB 3I5HC 4NDCA 4PE1A 4HRHA 1XYDA 2K0JA 4N1GA 4YRUA 1NIWA 3FIAA 2L98A 2PASA 1CDNA 3OP0A 5AEQA 5I2OA 1YURA 1B7TY 1OMVA 1QX2A 3AAJA 2M9GA 2PMYA 3LL8B 1FI6A 3I5GB 1DGVA 4JWQA 3EVRA 1YX8A 1TRFA 2KBMA 3DVJA 4PHJA 1WY9A 2F3YA 1SCMC 1MHOA 1TNXA 5KSZA 3O2PA 5G08A 1X02A 4GPLB 1KCYA 1ZFSA 3NSOA 1KFXL 3KEVA 4YGCB 3GK1A 1GGWA 5I2LA 1YUTA 1DJGA 2AUCA 1UWOA 3DVEA 1DJHA 4MVFA 1ALWA 1EH2A 1TNPA 2L51A 2EHBA 2QPTA 1YUSA 2LHIA 2PRUA 2AAOA 4PALA 2MAZA 2K7DA 3SG3A 2MLEC 2LLTA 1M31A 1YTZC 1SL9A 4I5JA 4NQGA 1KWOC 4AOMA 5D7FA 2L0PA 2OS8C 3E3RA 4M2OA 3PSRA 3TS5B 1MR8A 2M49B 1WLZA 1MUXA 2L4HA 4ORBB 4A4CA 1HT9A 4BY5A 3BUMB 3EKJA 5HYDA 3WXAA 1TIZA 1OQPA 1QASA 1TOPA 4C0JA 2O60A 4U8DA 1NYAA 1E8AA 2O5GA 3CS1A 3CWGA 3KF9A 5HKYA 4I5LB 1IG5A 1DJXA 3I5GC 1KFUS 3BYAA 1UHIA 2LUCA 3EK4A 2FOTA 3SG5A 2WCBA 1YRTB 1JC2A 4WRIA 1J1EA 4PHNA 4HRGA 4AQIA 4JQ0D 2BECA 2JNXA 1KK8B 1UHKA 1QXPA 2LAPA 1G33A 3NSIA 1B8CA 3IF7A 2KNEA 2FCEA 1DJYA 4MRYA 1L7ZA 4GGFC 2I2RE 3KPXA 1DF0A 2EC6B 2I94A 2HF5A 2MRDA 1W7IB 1CKKA 5KTYA 1B8RA 1UHJA 1NCYA 3SG7A 1H8BA 4F0ZB 1QVIY 2JQ6A 4DRWA 1DJZA 4WQ2A 1S6CA 4WQ3A 4D1EA 2BKIB 1KK7Y 4USLA 2PSRA 2I7AA 1S3PA 1FW4A 1NP8A 2K7OA 1IJ5A 2JT0A 1SPYA 3VRNA 5HLVA 1RK9A 2JT8A 4GNKB 3CGAA 3I5HB 4A4BA 1MQ1A 2OTGB 1WRZA 3DF0B 3GOFA 4MLWA 1FPWA 1QTXA 1KFUL 3BUXB 3VRRA 3EKHA 2HQWA 4M2QA 2JRFA 3VGOA 1BJFA 1K96A 1EXRA 1KK8C 1RTP1 1WRKA 1RWYA 1K9PA 4N1FA 5CPVA 1QV1A 5F6TA 1EG3A 4PHMA 2H61A 2LMVA 5BPJA 5AFPA 1PVAA 1A03A 2JNFA 1SCMB 2COLB 3I5FC 4GGNA 1YUUA 1XFVO 3LK1A 4DIRA 1PVBA 2G2BA 1TNQA 2KDHA 1AUIB 2KYFA 1S36A 1RJVA 4N5XA 1L2OC 1DJWA 4L9MA 3TDZA 2B1UA 3BOWB 1BT6A 1GGZA 4CFQA 1CTRA 4ETOA 1KWOB 1CNPA 4YBHB 2BCBA 3AKBA 2BBNA 2KGBC 2OTGC 4CFRA 1XA5A 4I5NB 4CIDA 3WHUB 1AJ5A 1BR4B 1NSHA 1QV0A 1IGVA 3CR5X 1SMGA 2M3WA 3O4YA 4QJ5B 1F55A 4DS7A 1SYMA 4OVNF 3CR2A 2M29A 1CM1A 1Y1XA 1SL7A 2JWWA 3D0YA 1BU3A 4XJKB 4PE7A 3A8RA 4Q04A 1ZACA 2PVBA 5CSNA 1XFXO 1QLKA 3WHTB 1JF2A 1ZOTB 2CT9A 4YGBB 1IKUA 1UUSA 4PDZA 3NSKA 3I5IC 3BOWA 1CB1A 1FI5A 2ZN8A 2F33A 5I8NA 1KSOA 1ZMZA 2JULA 5DKQA 3GK4X 1Y1UA 1CMGA 1S5GZ 2KAXA 1N65A 1PSBA 2LVVA 2D8NA 2FCDA 1GQMA 1LINA 3M0WA 2LP2A 4ORCB 3VRQA 2GGMA 1OZOA 5FYXA 1ODBA 1K8UA 2LC5A 1A4PA 1MWNA 1DTLA 1QX5B 1FBVA 4ZCUA 2M1UA 5D69A 1CFPA 1M39A 2MHHA 1KQVA 1K9KA 5KU1A 4XJKA 1A75B 4UPGA 2A4JA 1DVIA 3JTDB 3QRXA 4YGAA 1XK4C 4GFTA 5DKNA 3AAKA 3O78A 4HSZA 3OX5A 5K89A 1IWQA 4QJ3B 1NUBA 1UHNA 2JPTA 1SCVA 1TTXA 3LK0A 1AJ4A 3PN7B 2KI4C 1J7OA 4MRXA 1QS7A 2JC2A 1S26D 3I5FB 4C0KA 2KYCA 3F45A 3EK7A 2KOTA 3SIBA 2WCEA 2L4IA 1NPQA 2KAVA 1XFYO 2KHNA 4JPZB 2Q4UA 1QIVA 1CDLA 1L2OB 1LVCD 1QVIZ 5HLOA 4MSPA 1R2UA 2VRGA 1NX0A 1B1GA 4MN0A
chains in the Genus database with same CATH superfamily
1EL4A 4DUQA 3CLNA 1QATA 3SS4A 2KGRA 2TN4A 3ZNIA 1R6PA 1MXLC 1JUOA 2JTZA 2PALA 5ER4X 2K7CA 2ZRTA 1CM4A 2ISDA 3S0AA 4M2PA 1XO5A 1CLMA 1OOFA 2WNDA 4PHKA 1VRKA 5PALA 1F70A 2E6WA 2LCPA 3JTDC 1XFWO 2I18A 3DVMA 1Z4HA 1BG1A 1M63B 3CDNA 1ZUZA 3FWBA 2RGIA 2ZRSA 2CXJA 2MBXA 3PN7C 2KFHA 2MLFC 4IL1A 4PE0A 1H4BA 2F3ZA 1CFCA 1JFKA 1FF1A 1NX3A 3ICBA 1EG4A 4OR9B 5B8IB 1JFJA 5DKRA 4CLNA 2K7BA 1Y0VH 3AKAA 1AK8A 1CFFA 1JBAA 3KO0A 1S6IA 2H2KA 1A29A 1TNWA 2QEVA 2EGDA 3S0DA 3I5IB 1F4OA 2E30A 1BMOA 3SG2A 2KI6C 4E68A 1BOCA 2LANA 3CYZA 5HKZA 1SY9A 3BFAA 1K90D 4ICBA 4AQJA 3H4SE 3JVTC 4GAOA 1F54A 2NXQA 1HQVA 1Y6WA 3SIAA 2M7NA 2JT3A 4MEWA 3CR4X 3RM1A 4QJ4B 2JU0A 4FTGA 3DF0A 2ZFDA 1KSMA 3CTNA 2P6BB 1Y1AA 2OPOA 2R2IA 2WCKA 4PT1A 4INXA 4MZJA 1EJ3A 1B7TZ 2KAYA 1LA3A 3BFBA 1PRWA 2WOSA 2P71A 4INWA 1K95A 1JWDA 1CDMA 5I2QA 1G4YR 2M8UA 2P70A 2LVIA 1N2DA 1DGUA 3IQOA 1IQ5A 1SRAA 1WDCB 1YVHA 1YVLA 3CZ0A 1RROA 3D74A 3DD4A 4PE4A 1J7QA 3OX6A 3SG6A 2AMIA 2K2AA 5HKWA 2L2CA 5CSFA 2IS9A 2KQYA 2WORA 1B47A 3D77A 3BUOB 2WC5A 1CLLA 2KI4B 2M1KB 3R72A 1SBJA 3NSLA 4XYNA 1MF8B 5AANA 1AHRA 1C7VA 1WLMA 5DICA 3B7AA 4MBEA 2F2PA 1XFZO 1WRLA 1ORGA 1J7RA 1QLSA 1SK6D 1CDPA 3D75A 1JF0A 3TZ1A 2LV7A 3DYEA 2BKHB 1IQ3A 1J7PA 4OCIA 2JOJA 2DOQA 3BUNB 4MZKA 3C1VA 1DQEA 2ZKMX 3A4UB 2KBIA 3V2LA 2JTTA 4R1EA 1TN4A 1IJ6A 1J55A 2BBMA 1XVJA 2L50A 2HPSA 2CBLA 3KHEA 3TUYB 3WNXB 2V53A 4I5KA 5GQQC 2L2EA 1KQMC 5ER5A 2NLNA 3SS5A 3PFVA 4TNCA 3S0BA 2KFGA 2Y5IA 2KI6D 1DF0B 3TDUA 3O6BA 4NDBA 1QJTA 1WDCC 1YR5A 1XK4A 1PULA 5CSIA 2Y4QA 1K93D 1M45A 2BE4A 2BCXA 1S5GY 2LP3A 3CABA 3B87A 3OHMB 4BY4A 3FS7A 2KFFA 2FJUB 4OKHA 1XFUO 1G8IA 1S1EA 4CPVA 1GJYA 1DMOA 1CMFA 3EVVA 1OE9B 3UNWA 4YI8A 1OMRA 3DVKA 1U5IB 5JOLA 3BQ3A 3SG4A 4GGFA 1TCOB 2LM5A 2G9BA 3EG5B 3PLFB 1K2HA 3NXAA 3VROA 2K8MB 2WCFA 1MXEA 1AP4A 4MZLA 1ALVA 2MJWB 3ZWHA 5J3XA 2Y1NA 2BE6A 2LVJA 1UURA 3OB2B 3BUWB 1SNLA 3K21A 3EVUA 4JKTA 1OOJA 2JXLA 4ORAB 1KK7Z 1B4CA 1J1DA 1S6JA 3TDIA 3TUYC 1JSAA 2KLDA 3RLZA 3EK8A 3R1PA 4YGDB 2CTNA 1A2XA 5JJGA 3JVTB 3SJSA 1TUZA 1NX1A 2JXCA 2NCOA 2SASA 3BXKA 1A75A 2GV5A 2CCMA 1DT7B 2LMTA 5AXIA 1LKJA 2ZN9A 4HREE 4YGEB 2LMUA 1LA0A 3PALA 1B8LA 1SL8A 1LXFC 1SW8A 3TS5C 3DY9A 5FI6A 1OZSA 2QACA 2NCPA 2CNPA 2PYQA 2K2FA 3D10A 2Y1MA 1C07A 1CLBA 4GBAA 2NZ0A 2HQ8A 2BL0B 1Q80A 1U5IA 4P5OE 1K94A 1B9AA 1PALA 1SR6B 2JZIA 2M97A 5IBWA 2ZNDA 3FWCA 3GK2A 2M0RA 1NCXA 1K9UA 2LVKA 5CSJA 1BLQA 1W7JB 2WC8A 2GGZA 4DCKA 1PSRA 1IRJA 3LCPC 3HX4A 1OSAA 1OOHA 2ZNEA 2LLUA 4ZCVA 3NGVA 1F4QA 5I94A 2SCPA 1D1OA 2F2OA 4FQOA 3FE8A 3IQQA 2LE9B 3PM8A 3S0GA 1SKTA 1F8HA 4C0LA 1T14A 1QX7A 2Q91A 1N0YA 1V1FA 2KQ6A 3OB1B 2LLSA 2H61C 1KFXS 1PK0D 2F8PA 2MA2A 1NCZA 1UP5A 1C7WA 2BAPA 3D0YB 2EC6C 1QIWA 2LNKA 1V1GA 1NWDA 3MSEB 1UHHA 1YRUB 3CZTX 1RECA 2BCAA 4P2YB 1F71A 1BODA 1BF5A 3OGNA 4YI9A 5AERA 1Z2CB 1RFJA 3HCMA 3LLEA 4NDDA 4PCWA 5TNCA 1CFDA 1KQMB 1TCFA 2KLEA 2HETA 1TWOA 1IH0A 4OV2A 1DJIA 2L5YA 2LHLA 2BL0C 3B88A 2KSPA 3PATA 4OZDA 1OMDA 3S0EA 1SR6C 3VB1A 2LUXA 1M46A 1BR1B 1IIOA 2K61A 1NX2A 1AVSA 2OS8B 2M7LA 4GUKA 1YX7A 2JPOA 2L5XB 3I5HC 4NDCA 4PE1A 4HRHA 1XYDA 2K0JA 4N1GA 3DZTA 4YRUA 1NIWA 3FIAA 2L98A 2PASA 1CDNA 3VRPA 3OP0A 5AEQA 5I2OA 1YURA 1B7TY 1OMVA 1QX2A 3AAJA 2M9GA 2PMYA 3LL8B 1FI6A 3I5GB 1SSEB 2GTEA 1DGVA 3D78A 1W9ZA 4JWQA 4F7FA 3EVRA 1YX8A 1TRFA 2KBMA 3DVJA 4PHJA 1WY9A 2F3YA 5D3OA 1SCMC 1MHOA 1TNXA 5KSZA 3D73A 3O2PA 5G08A 1X02A 3NHTA 4GPLB 1KCYA 1ZFSA 3NSOA 1KFXL 3KEVA 4YGCB 3GK1A 1GGWA 5I2LA 1YUTA 1DJGA 2AUCA 1UWOA 3B6XA 1DJHA 3DVEA 3B86A 4MVFA 1ALWA 1C3ZA 1TNPA 2WCHA 1EH2A 2L51A 1OOGA 2EHBA 2QPTA 1XFRA 1YUSA 2LHIA 2PRUA 2AAOA 4PALA 2MAZA 2K7DA 3SG3A 2MLEC 1GM0A 2LLTA 1M31A 1YTZC 1SL9A 1P28A 4I5JA 4NQGA 1KWOC 4AOMA 5D7FA 2L0PA 2OS8C 3E3RA 3PJIA 4M2OA 3PSRA 3TS5B 4IJ7A 1MR8A 2M49B 1WLZA 1MUXA 2L4HA 4ORBB 3SS3A 1HT9A 4A4CA 4BY5A 3BUMB 3EKJA 5HYDA 3WXAA 1TIZA 1OQPA 1QASA 1TOPA 4C0JA 2O60A 4U8DA 1NYAA 1E8AA 2O5GA 3CS1A 3CWGA 3KF9A 5HKYA 4I5LB 1IG5A 1DJXA 2BNXA 3I5GC 3OBVA 1DELA 1KFUS 3BYAA 3RZSA 1UHIA 2LUCA 3EK4A 3S0FA 2FOTA 3SG5A 1OOIX 3BFHA 2WCBA 1YRTB 5EL2A 1JC2A 4WRIA 1J1EA 4PHNA 4HRGA 4AQIA 4JQ0D 2BECA 2JNXA 2WCLA 1KK8B 2K60A 1UHKA 1QXPA 1DC1A 2LAPA 1G33A 3NSIA 1B8CA 3IF7A 2KNEA 2FCEA 1DJYA 4MRYA 1L7ZA 3UO9A 4GGFC 2I2RE 3KPXA 3CZ1A 1DF0A 2EC6B 2I94A 2HF5A 2MRDA 1W7IB 1CKKA 5KTYA 1B8RA 3R1VA 1UHJA 3FE9A 1NCYA 3SG7A 1H8BA 4F0ZB 1QVIY 2JQ6A 4DRWA 1DJZA 4WQ2A 1S6CA 4WQ3A 4D1EA 2BKIB 3BJHA 1KK7Y 3L4LA 3QMEA 4USLA 2PSRA 2I7AA 1S3PA 1FW4A 1NP8A 2K7OA 1IJ5A 2JT0A 1SPYA 3VRNA 5HLVA 1RK9A 2JT8A 4GNKB 3CGAA 3I5HB 4A4BA 1MQ1A 2OTGB 1WRZA 3DF0B 3GOFA 4MLWA 1FPWA 1QTXA 1KFUL 3BUXB 2YGUA 3VRRA 2KPHA 3EKHA 2HQWA 4M2QA 2PQLA 2JRFA 3L47A 2WC6A 3VGOA 1BJFA 1K96A 1EXRA 1KK8C 1RTP1 1WRKA 1RWYA 1K9PA 4N1FA 5CPVA 1QV1A 5F6TA 1EG3A 4PHMA 2H61A 3D76A 2LMVA 5BPJA 5AFPA 1PVAA 1A03A 2JNFA 1SCMB 2COLB 1QWVA 2QDIA 3I5FC 4GGNA 1YUUA 1XFVO 3LK1A 4DIRA 1PVBA 2G2BA 1TNQA 2KDHA 1AUIB 2KYFA 1S36A 1RJVA 4N5XA 1L2OC 3PM2A 2WCMA 1DJWA 4L9MA 3TDZA 2B1UA 3BOWB 2QEBA 1BT6A 1GGZA 4CFQA 1CTRA 4ETOA 1KWOB 1CNPA 4YBHB 2BCBA 5HL1A 3AKBA 3CZ2A 2BBNA 2KGBC 2OTGC 4CFRA 1OW4A 1XA5A 2QEHA 4I5NB 1C3YA 4CIDA 2ERBA 3WHUB 2H8VA 1AJ5A 1BR4B 1NSHA 1QV0A 1IGVA 3CR5X 1SMGA 1TUJA 2M3WA 3O4YA 4QJ5B 1F55A 4DS7A 1SYMA 4OVNF 3CR2A 2M29A 1CM1A 1Y1XA 1SL7A 2JWWA 3D0YA 1BU3A 4XJKB 4PE7A 3A8RA 4Q04A 1ZACA 1LS8A 2PVBA 3K1EA 5CSNA 1XFXO 1QLKA 5FI2A 3WHTB 3FE6A 1JF2A 1ZOTB 2CT9A 2FJYA 2QEOA 3DXLA 4YGBB 1IKUA 1UUSA 4PDZA 3NSKA 3I5IC 3BOWA 3O4XA 1DEKA 1CB1A 1FI5A 2ZN8A 2F33A 5I8NA 1KSOA 1ZMZA 2JULA 5DKQA 3GK4X 1Y1UA 5FI7A 1CMGA 4JD9A 1S5GZ 2KAXA 1N65A 1PSBA 4KYNA 2LVVA 2D8NA 2FCDA 1GQMA 1LINA 3M0WA 2LP2A 4FQTA 4ORCB 3VRQA 2GGMA 1OZOA 5FYXA 1ODBA 1K8UA 2LC5A 3NHIA 1A4PA 1MWNA 1DTLA 1QX5B 1FBVA 4ZCUA 2M1UA 5D69A 3IVTA 1CFPA 1M39A 2MHHA 1KQVA 1K9KA 5KU1A 4XJKA 1A75B 4UPGA 1DVIA 2A4JA 3JTDB 3QRXA 4YGAA 1XK4C 4GFTA 5DKNA 3AAKA 3O78A 3R1OA 4HSZA 3OX5A 5K89A 1IWQA 4QJ3B 1NUBA 1UHNA 2JPTA 1SCVA 1TTXA 3LK0A 1AJ4A 3PN7B 2KI4C 3L4AA 1J7OA 4MRXA 1QS7A 2JC2A 1S26D 3I5FB 4C0KA 2KYCA 3F45A 3EK7A 2KOTA 2WCJA 3SIBA 2WCEA 2L4IA 1NPQA 2KAVA 1XFYO 2KHNA 4JPZB 3N7HA 2Q4UA 1QIVA 1CDLA 1L2OB 1LVCD 1QVIZ 3Q8IA 4MSPA 5HLOA 1R2UA 2VRGA 1NX0A 1B1GA 4MN0A
chains in the Genus database with same CATH topology
1EL4A 4DUQA 3CLNA 1QATA 2KGRA 2TN4A 3ZNIA 1R6PA 1MXLC 1JUOA 2JTZA 2PALA 5ER4X 2K7CA 2ZRTA 1CM4A 2ISDA 4M2PA 1XO5A 1CLMA 2WNDA 4PHKA 1VRKA 5PALA 1F70A 2E6WA 2LCPA 3JTDC 1XFWO 2I18A 3DVMA 1BG1A 1M63B 1ZUZA 3FWBA 2RGIA 2ZRSA 2CXJA 2MBXA 3PN7C 2KFHA 2MLFC 4IL1A 4PE0A 1H4BA 2F3ZA 1CFCA 1JFKA 1FF1A 1NX3A 3ICBA 1EG4A 4OR9B 5B8IB 1JFJA 5DKRA 4CLNA 2K7BA 1Y0VH 3AKAA 1AK8A 1CFFA 1JBAA 3KO0A 1S6IA 2H2KA 1A29A 1TNWA 2EGDA 3I5IB 1F4OA 2E30A 1BMOA 3SG2A 2KI6C 4E68A 1BOCA 2LANA 5HKZA 1SY9A 1K90D 4ICBA 4AQJA 3H4SE 3JVTC 4GAOA 1F54A 2NXQA 1HQVA 1Y6WA 3SIAA 2M7NA 2JT3A 4MEWA 3CR4X 3RM1A 4QJ4B 2JU0A 4FTGA 3DF0A 2ZFDA 1KSMA 3CTNA 2P6BB 1Y1AA 2OPOA 2R2IA 4MZJA 1EJ3A 1B7TZ 2KAYA 1LA3A 1PRWA 2WOSA 1JWDA 1K95A 1CDMA 5I2QA 1G4YR 2M8UA 2LVIA 1N2DA 1DGUA 3IQOA 1IQ5A 1SRAA 1WDCB 1YVHA 1YVLA 1RROA 3DD4A 4PE4A 1J7QA 3OX6A 3SG6A 2AMIA 2K2AA 5HKWA 5CSFA 2IS9A 2KQYA 2WORA 1B47A 3BUOB 1CLLA 2KI4B 2M1KB 1SBJA 3NSLA 4XYNA 1MF8B 5AANA 1AHRA 1C7VA 1WLMA 4MBEA 2F2PA 1XFZO 1WRLA 1J7RA 1QLSA 3VRPA 1SK6D 1CDPA 3TZ1A 1JF0A 1IQ3A 2LV7A 2BKHB 1J7PA 4OCIA 2JOJA 2DOQA 3BUNB 4MZKA 3C1VA 2ZKMX 3A4UB 2KBIA 2JTTA 4R1EA 1TN4A 1IJ6A 1J55A 2BBMA 1XVJA 2L50A 2HPSA 2CBLA 3KHEA 3TUYB 3WNXB 2V53A 4I5KA 5GQQC 2L2EA 1KQMC 5ER5A 2NLNA 3PFVA 4TNCA 2KFGA 2Y5IA 2KI6D 1DF0B 3TDUA 3O6BA 4NDBA 1QJTA 1WDCC 1YR5A 1XK4A 1PULA 5CSIA 2Y4QA 1K93D 1M45A 2BE4A 2BCXA 1S5GY 2LP3A 3OHMB 4BY4A 3FS7A 2KFFA 2FJUB 4OKHA 1XFUO 1G8IA 1S1EA 4CPVA 1GJYA 1DMOA 1CMFA 3EVVA 1OE9B 4YI8A 1OMRA 3DVKA 1U5IB 5JOLA 3BQ3A 3SG4A 4GGFA 1TCOB 2LM5A 2G9BA 3PLFB 1K2HA 3NXAA 3VROA 2K8MB 2WCFA 1MXEA 1AP4A 4MZLA 1ALVA 2MJWB 3ZWHA 5J3XA 2Y1NA 2BE6A 2LVJA 1UURA 3OB2B 3BUWB 1SNLA 3K21A 3EVUA 1OOJA 2JXLA 4ORAB 1KK7Z 1B4CA 1J1DA 1S6JA 3TDIA 3TUYC 1JSAA 3RLZA 3EK8A 4YGDB 2CTNA 1A2XA 5JJGA 3JVTB 3SJSA 1NX1A 2JXCA 2NCOA 2SASA 3BXKA 1A75A 2GV5A 2CCMA 1DT7B 2LMTA 5AXIA 1LKJA 2ZN9A 4HREE 4YGEB 2LMUA 1LA0A 3PALA 1B8LA 1SL8A 1LXFC 1SW8A 3TS5C 1OZSA 2QACA 2NCPA 2CNPA 3D10A 2K2FA 1CLBA 2Y1MA 1C07A 4GBAA 2NZ0A 2HQ8A 2BL0B 1Q80A 1U5IA 4P5OE 1K94A 1B9AA 1PALA 1SR6B 2JZIA 2M97A 5IBWA 2ZNDA 3FWCA 3GK2A 2M0RA 1NCXA 1K9UA 2LVKA 5CSJA 1BLQA 1W7JB 2WC8A 2GGZA 4DCKA 1PSRA 1IRJA 3LCPC 3HX4A 1OSAA 2ZNEA 4ZCVA 2LLUA 1F4QA 2SCPA 1D1OA 2F2OA 4FQOA 3IQQA 2LE9B 3PM8A 1SKTA 1F8HA 4C0LA 1QX7A 2Q91A 1N0YA 1V1FA 2KQ6A 3OB1B 2LLSA 2H61C 1KFXS 1PK0D 2F8PA 2MA2A 1NCZA 1UP5A 1C7WA 3D0YB 2EC6C 1QIWA 2LNKA 1V1GA 1NWDA 3MSEB 1UHHA 1YRUB 3CZTX 1RECA 2BCAA 4P2YB 1F71A 1BODA 1BF5A 4YI9A 5AERA 3HCMA 1RFJA 3LLEA 4NDDA 4PCWA 5TNCA 1CFDA 1KQMB 1TCFA 2HETA 1IH0A 4OV2A 1DJIA 3PATA 2LHLA 2BL0C 2KSPA 1OMDA 1SR6C 2LUXA 1M46A 1BR1B 2K61A 1NX2A 1AVSA 2OS8B 2M7LA 4GUKA 1YX7A 2L5XB 3I5HC 4NDCA 4PE1A 4HRHA 1XYDA 2K0JA 4N1GA 4YRUA 1NIWA 3FIAA 2L98A 2PASA 1CDNA 3OP0A 5AEQA 5I2OA 1YURA 1B7TY 1OMVA 1QX2A 3AAJA 2M9GA 2PMYA 3LL8B 1FI6A 3I5GB 1DGVA 4JWQA 3EVRA 1YX8A 1TRFA 2KBMA 3DVJA 4PHJA 1WY9A 2F3YA 1SCMC 1MHOA 1TNXA 5KSZA 3O2PA 5G08A 1X02A 4GPLB 1KCYA 1ZFSA 3NSOA 1KFXL 3KEVA 4YGCB 3GK1A 1GGWA 5I2LA 1YUTA 1DJGA 2AUCA 1UWOA 3DVEA 1DJHA 4MVFA 1ALWA 1EH2A 1TNPA 2L51A 2EHBA 2QPTA 1YUSA 2LHIA 2PRUA 2AAOA 4PALA 2MAZA 2K7DA 3SG3A 2MLEC 2LLTA 1M31A 1YTZC 1SL9A 4I5JA 4NQGA 1KWOC 4AOMA 5D7FA 2L0PA 2OS8C 3E3RA 4M2OA 3PSRA 3TS5B 1MR8A 2M49B 1WLZA 1MUXA 2L4HA 4ORBB 4A4CA 1HT9A 4BY5A 3BUMB 3EKJA 5HYDA 3WXAA 1TIZA 1OQPA 1QASA 1TOPA 4C0JA 2O60A 4U8DA 1NYAA 1E8AA 2O5GA 3CS1A 3CWGA 3KF9A 5HKYA 4I5LB 1IG5A 1DJXA 3I5GC 1KFUS 3BYAA 1UHIA 2LUCA 3EK4A 2FOTA 3SG5A 2WCBA 1YRTB 1JC2A 4WRIA 1J1EA 4PHNA 4HRGA 4AQIA 4JQ0D 2BECA 2JNXA 1KK8B 1UHKA 1QXPA 2LAPA 1G33A 3NSIA 1B8CA 3IF7A 2KNEA 2FCEA 1DJYA 4MRYA 1L7ZA 4GGFC 2I2RE 3KPXA 1DF0A 2EC6B 2I94A 2HF5A 2MRDA 1W7IB 1CKKA 5KTYA 1B8RA 1UHJA 1NCYA 3SG7A 1H8BA 4F0ZB 1QVIY 2JQ6A 4DRWA 1DJZA 4WQ2A 1S6CA 4WQ3A 4D1EA 2BKIB 1KK7Y 4USLA 2PSRA 2I7AA 1S3PA 1FW4A 1NP8A 2K7OA 1IJ5A 2JT0A 1SPYA 3VRNA 5HLVA 1RK9A 2JT8A 4GNKB 3CGAA 3I5HB 4A4BA 1MQ1A 2OTGB 1WRZA 3DF0B 3GOFA 4MLWA 1FPWA 1QTXA 1KFUL 3BUXB 3VRRA 3EKHA 2HQWA 4M2QA 2JRFA 3VGOA 1BJFA 1K96A 1EXRA 1KK8C 1RTP1 1WRKA 1RWYA 1K9PA 4N1FA 5CPVA 1QV1A 5F6TA 1EG3A 4PHMA 2H61A 2LMVA 5BPJA 5AFPA 1PVAA 1A03A 2JNFA 1SCMB 2COLB 3I5FC 4GGNA 1YUUA 1XFVO 3LK1A 4DIRA 1PVBA 2G2BA 1TNQA 2KDHA 1AUIB 2KYFA 1S36A 1RJVA 4N5XA 1L2OC 1DJWA 4L9MA 3TDZA 2B1UA 3BOWB 1BT6A 1GGZA 4CFQA 1CTRA 4ETOA 1KWOB 1CNPA 4YBHB 2BCBA 3AKBA 2BBNA 2KGBC 2OTGC 4CFRA 1XA5A 4I5NB 4CIDA 3WHUB 1AJ5A 1BR4B 1NSHA 1QV0A 1IGVA 3CR5X 1SMGA 2M3WA 3O4YA 4QJ5B 1F55A 4DS7A 1SYMA 4OVNF 3CR2A 2M29A 1CM1A 1Y1XA 1SL7A 2JWWA 3D0YA 1BU3A 4XJKB 4PE7A 3A8RA 4Q04A 1ZACA 2PVBA 5CSNA 1XFXO 1QLKA 3WHTB 1JF2A 1ZOTB 2CT9A 4YGBB 1IKUA 1UUSA 4PDZA 3NSKA 3I5IC 3BOWA 1CB1A 1FI5A 2ZN8A 2F33A 5I8NA 1KSOA 1ZMZA 2JULA 5DKQA 3GK4X 1Y1UA 1CMGA 1S5GZ 2KAXA 1N65A 1PSBA 2LVVA 2D8NA 2FCDA 1GQMA 1LINA 3M0WA 2LP2A 4ORCB 3VRQA 2GGMA 1OZOA 5FYXA 1ODBA 1K8UA 2LC5A 1A4PA 1MWNA 1DTLA 1QX5B 1FBVA 4ZCUA 2M1UA 5D69A 1CFPA 1M39A 2MHHA 1KQVA 1K9KA 5KU1A 4XJKA 1A75B 4UPGA 2A4JA 1DVIA 3JTDB 3QRXA 4YGAA 1XK4C 4GFTA 5DKNA 3AAKA 3O78A 4HSZA 3OX5A 5K89A 1IWQA 4QJ3B 1NUBA 1UHNA 2JPTA 1SCVA 1TTXA 3LK0A 1AJ4A 3PN7B 2KI4C 1J7OA 4MRXA 1QS7A 2JC2A 1S26D 3I5FB 4C0KA 2KYCA 3F45A 3EK7A 2KOTA 3SIBA 2WCEA 2L4IA 1NPQA 2KAVA 1XFYO 2KHNA 4JPZB 2Q4UA 1QIVA 1CDLA 1L2OB 1LVCD 1QVIZ 5HLOA 4MSPA 1R2UA 2VRGA 1NX0A 1B1GA 4MN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EL4 A;  4DUQ A;  3CLN A;  1QAT A;  2KGR A;  2TN4 A;  3ZNI A;  1R6P A;  1MXL C;  1JUO A;  2JTZ A;  2PAL A;  5ER4 X;  2K7C A;  2ZRT A;  1CM4 A;  2ISD A;  4M2P A;  1XO5 A;  1CLM A;  2WND A;  4PHK A;  1VRK A;  5PAL A;  1F70 A;  2E6W A;  2LCP A;  3JTD C;  1XFW O;  2I18 A;  3DVM A;  1BG1 A;  1M63 B;  1ZUZ A;  3FWB A;  2RGI A;  2ZRS A;  2CXJ A;  2MBX A;  3PN7 C;  2KFH A;  2MLF C;  4IL1 A;  4PE0 A;  1H4B A;  2F3Z A;  1CFC A;  1JFK A;  1FF1 A;  1NX3 A;  3ICB A;  1EG4 A;  4OR9 B;  5B8I B;  1JFJ A;  5DKR A;  4CLN A;  2K7B A;  1Y0V H;  3AKA A;  1AK8 A;  1CFF A;  1JBA A;  3KO0 A;  1S6I A;  2H2K A;  1A29 A;  1TNW A;  2EGD A;  3I5I B;  1F4O A;  2E30 A;  1BMO A;  3SG2 A;  2KI6 C;  4E68 A;  1BOC A;  2LAN A;  5HKZ A;  1SY9 A;  1K90 D;  4ICB A;  4AQJ A;  3H4S E;  3JVT C;  4GAO A;  1F54 A;  2NXQ A;  1HQV A;  1Y6W A;  3SIA A;  2M7N A;  2JT3 A;  4MEW A;  3CR4 X;  3RM1 A;  4QJ4 B;  2JU0 A;  4FTG A;  3DF0 A;  2ZFD A;  1KSM A;  3CTN A;  2P6B B;  1Y1A A;  2OPO A;  2R2I A;  4MZJ A;  1EJ3 A;  1B7T Z;  2KAY A;  1LA3 A;  1PRW A;  2WOS A;  1JWD A;  1K95 A;  1CDM A;  5I2Q A;  1G4Y R;  2M8U A;  2LVI A;  1N2D A;  1DGU A;  3IQO A;  1IQ5 A;  1SRA A;  1WDC B;  1YVH A;  1YVL A;  1RRO A;  3DD4 A;  4PE4 A;  1J7Q A;  3OX6 A;  3SG6 A;  2AMI A;  2K2A A;  5HKW A;  5CSF A;  2IS9 A;  2KQY A;  2WOR A;  1B47 A;  3BUO B;  1CLL A;  2KI4 B;  2M1K B;  1SBJ A;  3NSL A;  4XYN A;  1MF8 B;  5AAN A;  1AHR A;  1C7V A;  1WLM A;  4MBE A;  2F2P A;  1XFZ O;  1WRL A;  1J7R A;  1QLS A;  3VRP A;  1SK6 D;  1CDP A;  3TZ1 A;  1JF0 A;  1IQ3 A;  2LV7 A;  2BKH B;  1J7P A;  4OCI A;  2JOJ A;  2DOQ A;  3BUN B;  4MZK A;  3C1V A;  2ZKM X;  3A4U B;  2KBI A;  2JTT A;  4R1E A;  1TN4 A;  1IJ6 A;  1J55 A;  2BBM A;  1XVJ A;  2L50 A;  2HPS A;  2CBL A;  3KHE A;  3TUY B;  3WNX B;  2V53 A;  4I5K A;  5GQQ C;  2L2E A;  1KQM C;  5ER5 A;  2NLN A;  3PFV A;  4TNC A;  2KFG A;  2Y5I A;  2KI6 D;  1DF0 B;  3TDU A;  3O6B A;  4NDB A;  1QJT A;  1WDC C;  1YR5 A;  1XK4 A;  1PUL A;  5CSI A;  2Y4Q A;  1K93 D;  1M45 A;  2BE4 A;  2BCX A;  1S5G Y;  2LP3 A;  3OHM B;  4BY4 A;  3FS7 A;  2KFF A;  2FJU B;  4OKH A;  1XFU O;  1G8I A;  1S1E A;  4CPV A;  1GJY A;  1DMO A;  1CMF A;  3EVV A;  1OE9 B;  4YI8 A;  1OMR A;  3DVK A;  1U5I B;  5JOL A;  3BQ3 A;  3SG4 A;  4GGF A;  1TCO B;  2LM5 A;  2G9B A;  3PLF B;  1K2H A;  3NXA A;  3VRO A;  2K8M B;  2WCF A;  1MXE A;  1AP4 A;  4MZL A;  1ALV A;  2MJW B;  3ZWH A;  5J3X A;  2Y1N A;  2BE6 A;  2LVJ A;  1UUR A;  3OB2 B;  3BUW B;  1SNL A;  3K21 A;  3EVU A;  1OOJ A;  2JXL A;  4ORA B;  1KK7 Z;  1B4C A;  1J1D A;  1S6J A;  3TDI A;  3TUY C;  1JSA A;  3RLZ A;  3EK8 A;  4YGD B;  2CTN A;  1A2X A;  5JJG A;  3JVT B;  3SJS A;  1NX1 A;  2JXC A;  2NCO A;  2SAS A;  3BXK A;  1A75 A;  2GV5 A;  2CCM A;  1DT7 B;  2LMT A;  5AXI A;  1LKJ A;  2ZN9 A;  4HRE E;  4YGE B;  2LMU A;  1LA0 A;  3PAL A;  1B8L A;  1SL8 A;  1LXF C;  1SW8 A;  3TS5 C;  1OZS A;  2QAC A;  2NCP A;  2CNP A;  3D10 A;  2K2F A;  1CLB A;  2Y1M A;  1C07 A;  4GBA A;  2NZ0 A;  2HQ8 A;  2BL0 B;  1Q80 A;  1U5I A;  4P5O E;  1K94 A;  1B9A A;  1PAL A;  1SR6 B;  2JZI A;  2M97 A;  5IBW A;  2ZND A;  3FWC A;  3GK2 A;  2M0R A;  1NCX A;  1K9U A;  2LVK A;  5CSJ A;  1BLQ A;  1W7J B;  2WC8 A;  2GGZ A;  4DCK A;  1PSR A;  1IRJ A;  3LCP C;  3HX4 A;  1OSA A;  2ZNE A;  4ZCV A;  2LLU A;  1F4Q A;  2SCP A;  1D1O A;  2F2O A;  4FQO A;  3IQQ A;  2LE9 B;  3PM8 A;  1SKT A;  1F8H A;  4C0L A;  1QX7 A;  2Q91 A;  1N0Y A;  1V1F A;  2KQ6 A;  3OB1 B;  2LLS A;  2H61 C;  1KFX S;  1PK0 D;  2F8P A;  2MA2 A;  1NCZ A;  1UP5 A;  1C7W A;  3D0Y B;  2EC6 C;  1QIW A;  2LNK A;  1V1G A;  1NWD A;  3MSE B;  1UHH A;  1YRU B;  3CZT X;  1REC A;  2BCA A;  4P2Y B;  1F71 A;  1BOD A;  1BF5 A;  4YI9 A;  5AER A;  3HCM A;  1RFJ A;  3LLE A;  4NDD A;  4PCW A;  5TNC A;  1CFD A;  1KQM B;  1TCF A;  2HET A;  1IH0 A;  4OV2 A;  1DJI A;  3PAT A;  2LHL A;  2BL0 C;  2KSP A;  1OMD A;  1SR6 C;  2LUX A;  1M46 A;  1BR1 B;  2K61 A;  1NX2 A;  1AVS A;  2OS8 B;  2M7L A;  4GUK A;  1YX7 A;  2L5X B;  3I5H C;  4NDC A;  4PE1 A;  4HRH A;  1XYD A;  2K0J A;  4N1G A;  4YRU A;  1NIW A;  3FIA A;  2L98 A;  2PAS A;  1CDN A;  3OP0 A;  5AEQ A;  5I2O A;  1YUR A;  1B7T Y;  1OMV A;  1QX2 A;  3AAJ A;  2M9G A;  2PMY A;  3LL8 B;  1FI6 A;  3I5G B;  1DGV A;  4JWQ A;  3EVR A;  1YX8 A;  1TRF A;  2KBM A;  3DVJ A;  4PHJ A;  1WY9 A;  2F3Y A;  1SCM C;  1MHO A;  1TNX A;  5KSZ A;  3O2P A;  5G08 A;  1X02 A;  4GPL B;  1KCY A;  1ZFS A;  3NSO A;  1KFX L;  3KEV A;  4YGC B;  3GK1 A;  1GGW A;  5I2L A;  1YUT A;  1DJG A;  2AUC A;  1UWO A;  3DVE A;  1DJH A;  4MVF A;  1ALW A;  1EH2 A;  1TNP A;  2L51 A;  2EHB A;  2QPT A;  1YUS A;  2LHI A;  2PRU A;  2AAO A;  4PAL A;  2MAZ A;  2K7D A;  3SG3 A;  2MLE C;  2LLT A;  1M31 A;  1YTZ C;  1SL9 A;  4I5J A;  4NQG A;  1KWO C;  4AOM A;  5D7F A;  2L0P A;  2OS8 C;  3E3R A;  4M2O A;  3PSR A;  3TS5 B;  1MR8 A;  2M49 B;  1WLZ A;  1MUX A;  2L4H A;  4ORB B;  4A4C A;  1HT9 A;  4BY5 A;  3BUM B;  3EKJ A;  5HYD A;  3WXA A;  1TIZ A;  1OQP A;  1QAS A;  1TOP A;  4C0J A;  2O60 A;  4U8D A;  1NYA A;  1E8A A;  2O5G A;  3CS1 A;  3CWG A;  3KF9 A;  5HKY A;  4I5L B;  1IG5 A;  1DJX A;  3I5G C;  1KFU S;  3BYA A;  1UHI A;  2LUC A;  3EK4 A;  2FOT A;  3SG5 A;  2WCB A;  1YRT B;  1JC2 A;  4WRI A;  1J1E A;  4PHN A;  4HRG A;  4AQI A;  4JQ0 D;  2BEC A;  2JNX A;  1KK8 B;  1UHK A;  1QXP A;  2LAP A;  1G33 A;  3NSI A;  1B8C A;  3IF7 A;  2KNE A;  2FCE A;  1DJY A;  4MRY A;  1L7Z A;  4GGF C;  2I2R E;  3KPX A;  1DF0 A;  2EC6 B;  2I94 A;  2HF5 A;  2MRD A;  1W7I B;  1CKK A;  5KTY A;  1B8R A;  1UHJ A;  1NCY A;  3SG7 A;  1H8B A;  4F0Z B;  1QVI Y;  2JQ6 A;  4DRW A;  1DJZ A;  4WQ2 A;  1S6C A;  4WQ3 A;  4D1E A;  2BKI B;  1KK7 Y;  4USL A;  2PSR A;  2I7A A;  1S3P A;  1FW4 A;  1NP8 A;  2K7O A;  1IJ5 A;  2JT0 A;  1SPY A;  3VRN A;  5HLV A;  1RK9 A;  2JT8 A;  4GNK B;  3CGA A;  3I5H B;  4A4B A;  1MQ1 A;  2OTG B;  1WRZ A;  3DF0 B;  3GOF A;  4MLW A;  1FPW A;  1QTX A;  1KFU L;  3BUX B;  3VRR A;  3EKH A;  2HQW A;  4M2Q A;  2JRF A;  3VGO A;  1BJF A;  1K96 A;  1EXR A;  1KK8 C;  1RTP 1;  1WRK A;  1RWY A;  1K9P A;  4N1F A;  5CPV A;  1QV1 A;  5F6T A;  1EG3 A;  4PHM A;  2H61 A;  2LMV A;  5BPJ A;  5AFP A;  1PVA A;  1A03 A;  2JNF A;  1SCM B;  2COL B;  3I5F C;  4GGN A;  1YUU A;  1XFV O;  3LK1 A;  4DIR A;  1PVB A;  2G2B A;  1TNQ A;  2KDH A;  1AUI B;  2KYF A;  1S36 A;  1RJV A;  4N5X A;  1L2O C;  1DJW A;  4L9M A;  3TDZ A;  2B1U A;  3BOW B;  1BT6 A;  1GGZ A;  4CFQ A;  1CTR A;  4ETO A;  1KWO B;  1CNP A;  4YBH B;  2BCB A;  3AKB A;  2BBN A;  2KGB C;  2OTG C;  4CFR A;  1XA5 A;  4I5N B;  4CID A;  3WHU B;  1AJ5 A;  1BR4 B;  1NSH A;  1QV0 A;  1IGV A;  3CR5 X;  1SMG A;  2M3W A;  3O4Y A;  4QJ5 B;  1F55 A;  4DS7 A;  1SYM A;  4OVN F;  3CR2 A;  2M29 A;  1CM1 A;  1Y1X A;  1SL7 A;  2JWW A;  3D0Y A;  1BU3 A;  4XJK B;  4PE7 A;  3A8R A;  4Q04 A;  1ZAC A;  2PVB A;  5CSN A;  1XFX O;  1QLK A;  3WHT B;  1JF2 A;  1ZOT B;  2CT9 A;  4YGB B;  1IKU A;  1UUS A;  4PDZ A;  3NSK A;  3I5I C;  3BOW A;  1CB1 A;  1FI5 A;  2ZN8 A;  2F33 A;  5I8N A;  1KSO A;  1ZMZ A;  2JUL A;  5DKQ A;  3GK4 X;  1Y1U A;  1CMG A;  1S5G Z;  2KAX A;  1N65 A;  1PSB A;  2LVV A;  2D8N A;  2FCD A;  1GQM A;  1LIN A;  3M0W A;  2LP2 A;  4ORC B;  3VRQ A;  2GGM A;  1OZO A;  5FYX A;  1ODB A;  1K8U A;  2LC5 A;  1A4P A;  1MWN A;  1DTL A;  1QX5 B;  1FBV A;  4ZCU A;  2M1U A;  5D69 A;  1CFP A;  1M39 A;  2MHH A;  1KQV A;  1K9K A;  5KU1 A;  4XJK A;  1A75 B;  4UPG A;  2A4J A;  1DVI A;  3JTD B;  3QRX A;  4YGA A;  1XK4 C;  4GFT A;  5DKN A;  3AAK A;  3O78 A;  4HSZ A;  3OX5 A;  5K89 A;  1IWQ A;  4QJ3 B;  1NUB A;  1UHN A;  2JPT A;  1SCV A;  1TTX A;  3LK0 A;  1AJ4 A;  3PN7 B;  2KI4 C;  1J7O A;  4MRX A;  1QS7 A;  2JC2 A;  1S26 D;  3I5F B;  4C0K A;  2KYC A;  3F45 A;  3EK7 A;  2KOT A;  3SIB A;  2WCE A;  2L4I A;  1NPQ A;  2KAV A;  1XFY O;  2KHN A;  4JPZ B;  2Q4U A;  1QIV A;  1CDL A;  1L2O B;  1LVC D;  1QVI Z;  5HLO A;  4MSP A;  1R2U A;  2VRG A;  1NX0 A;  1B1G A;  4MN0 A; 
#chains in the Genus database with same CATH topology
 1EL4 A;  4DUQ A;  3CLN A;  1QAT A;  3SS4 A;  2KGR A;  2TN4 A;  3ZNI A;  1R6P A;  1MXL C;  1JUO A;  2JTZ A;  2PAL A;  5ER4 X;  2K7C A;  2ZRT A;  1CM4 A;  2ISD A;  3S0A A;  4M2P A;  1XO5 A;  1CLM A;  1OOF A;  2WND A;  4PHK A;  1VRK A;  5PAL A;  1F70 A;  2E6W A;  2LCP A;  3JTD C;  1XFW O;  2I18 A;  3DVM A;  1Z4H A;  1BG1 A;  1M63 B;  3CDN A;  1ZUZ A;  3FWB A;  2RGI A;  2ZRS A;  2CXJ A;  2MBX A;  3PN7 C;  2KFH A;  2MLF C;  4IL1 A;  4PE0 A;  1H4B A;  2F3Z A;  1CFC A;  1JFK A;  1FF1 A;  1NX3 A;  3ICB A;  1EG4 A;  4OR9 B;  5B8I B;  1JFJ A;  5DKR A;  4CLN A;  2K7B A;  1Y0V H;  3AKA A;  1AK8 A;  1CFF A;  1JBA A;  3KO0 A;  1S6I A;  2H2K A;  1A29 A;  1TNW A;  2QEV A;  2EGD A;  3S0D A;  3I5I B;  1F4O A;  2E30 A;  1BMO A;  3SG2 A;  2KI6 C;  4E68 A;  1BOC A;  2LAN A;  3CYZ A;  5HKZ A;  1SY9 A;  3BFA A;  1K90 D;  4ICB A;  4AQJ A;  3H4S E;  3JVT C;  4GAO A;  1F54 A;  2NXQ A;  1HQV A;  1Y6W A;  3SIA A;  2M7N A;  2JT3 A;  4MEW A;  3CR4 X;  3RM1 A;  4QJ4 B;  2JU0 A;  4FTG A;  3DF0 A;  2ZFD A;  1KSM A;  3CTN A;  2P6B B;  1Y1A A;  2OPO A;  2R2I A;  2WCK A;  4PT1 A;  4INX A;  4MZJ A;  1EJ3 A;  1B7T Z;  2KAY A;  1LA3 A;  3BFB A;  1PRW A;  2WOS A;  2P71 A;  4INW A;  1K95 A;  1JWD A;  1CDM A;  5I2Q A;  1G4Y R;  2M8U A;  2P70 A;  2LVI A;  1N2D A;  1DGU A;  3IQO A;  1IQ5 A;  1SRA A;  1WDC B;  1YVH A;  1YVL A;  3CZ0 A;  1RRO A;  3D74 A;  3DD4 A;  4PE4 A;  1J7Q A;  3OX6 A;  3SG6 A;  2AMI A;  2K2A A;  5HKW A;  2L2C A;  5CSF A;  2IS9 A;  2KQY A;  2WOR A;  1B47 A;  3D77 A;  3BUO B;  2WC5 A;  1CLL A;  2KI4 B;  2M1K B;  3R72 A;  1SBJ A;  3NSL A;  4XYN A;  1MF8 B;  5AAN A;  1AHR A;  1C7V A;  1WLM A;  5DIC A;  3B7A A;  4MBE A;  2F2P A;  1XFZ O;  1WRL A;  1ORG A;  1J7R A;  1QLS A;  1SK6 D;  1CDP A;  3D75 A;  1JF0 A;  3TZ1 A;  2LV7 A;  3DYE A;  2BKH B;  1IQ3 A;  1J7P A;  4OCI A;  2JOJ A;  2DOQ A;  3BUN B;  4MZK A;  3C1V A;  1DQE A;  2ZKM X;  3A4U B;  2KBI A;  3V2L A;  2JTT A;  4R1E A;  1TN4 A;  1IJ6 A;  1J55 A;  2BBM A;  1XVJ A;  2L50 A;  2HPS A;  2CBL A;  3KHE A;  3TUY B;  3WNX B;  2V53 A;  4I5K A;  5GQQ C;  2L2E A;  1KQM C;  5ER5 A;  2NLN A;  3SS5 A;  3PFV A;  4TNC A;  3S0B A;  2KFG A;  2Y5I A;  2KI6 D;  1DF0 B;  3TDU A;  3O6B A;  4NDB A;  1QJT A;  1WDC C;  1YR5 A;  1XK4 A;  1PUL A;  5CSI A;  2Y4Q A;  1K93 D;  1M45 A;  2BE4 A;  2BCX A;  1S5G Y;  2LP3 A;  3CAB A;  3B87 A;  3OHM B;  4BY4 A;  3FS7 A;  2KFF A;  2FJU B;  4OKH A;  1XFU O;  1G8I A;  1S1E A;  4CPV A;  1GJY A;  1DMO A;  1CMF A;  3EVV A;  1OE9 B;  3UNW A;  4YI8 A;  1OMR A;  3DVK A;  1U5I B;  5JOL A;  3BQ3 A;  3SG4 A;  4GGF A;  1TCO B;  2LM5 A;  2G9B A;  3EG5 B;  3PLF B;  1K2H A;  3NXA A;  3VRO A;  2K8M B;  2WCF A;  1MXE A;  1AP4 A;  4MZL A;  1ALV A;  2MJW B;  3ZWH A;  5J3X A;  2Y1N A;  2BE6 A;  2LVJ A;  1UUR A;  3OB2 B;  3BUW B;  1SNL A;  3K21 A;  3EVU A;  4JKT A;  1OOJ A;  2JXL A;  4ORA B;  1KK7 Z;  1B4C A;  1J1D A;  1S6J A;  3TDI A;  3TUY C;  1JSA A;  2KLD A;  3RLZ A;  3EK8 A;  3R1P A;  4YGD B;  2CTN A;  1A2X A;  5JJG A;  3JVT B;  3SJS A;  1TUZ A;  1NX1 A;  2JXC A;  2NCO A;  2SAS A;  3BXK A;  1A75 A;  2GV5 A;  2CCM A;  1DT7 B;  2LMT A;  5AXI A;  1LKJ A;  2ZN9 A;  4HRE E;  4YGE B;  2LMU A;  1LA0 A;  3PAL A;  1B8L A;  1SL8 A;  1LXF C;  1SW8 A;  3TS5 C;  3DY9 A;  5FI6 A;  1OZS A;  2QAC A;  2NCP A;  2CNP A;  2PYQ A;  2K2F A;  3D10 A;  2Y1M A;  1C07 A;  1CLB A;  4GBA A;  2NZ0 A;  2HQ8 A;  2BL0 B;  1Q80 A;  1U5I A;  4P5O E;  1K94 A;  1B9A A;  1PAL A;  1SR6 B;  2JZI A;  2M97 A;  5IBW A;  2ZND A;  3FWC A;  3GK2 A;  2M0R A;  1NCX A;  1K9U A;  2LVK A;  5CSJ A;  1BLQ A;  1W7J B;  2WC8 A;  2GGZ A;  4DCK A;  1PSR A;  1IRJ A;  3LCP C;  3HX4 A;  1OSA A;  1OOH A;  2ZNE A;  2LLU A;  4ZCV A;  3NGV A;  1F4Q A;  5I94 A;  2SCP A;  1D1O A;  2F2O A;  4FQO A;  3FE8 A;  3IQQ A;  2LE9 B;  3PM8 A;  3S0G A;  1SKT A;  1F8H A;  4C0L A;  1T14 A;  1QX7 A;  2Q91 A;  1N0Y A;  1V1F A;  2KQ6 A;  3OB1 B;  2LLS A;  2H61 C;  1KFX S;  1PK0 D;  2F8P A;  2MA2 A;  1NCZ A;  1UP5 A;  1C7W A;  2BAP A;  3D0Y B;  2EC6 C;  1QIW A;  2LNK A;  1V1G A;  1NWD A;  3MSE B;  1UHH A;  1YRU B;  3CZT X;  1REC A;  2BCA A;  4P2Y B;  1F71 A;  1BOD A;  1BF5 A;  3OGN A;  4YI9 A;  5AER A;  1Z2C B;  1RFJ A;  3HCM A;  3LLE A;  4NDD A;  4PCW A;  5TNC A;  1CFD A;  1KQM B;  1TCF A;  2KLE A;  2HET A;  1TWO A;  1IH0 A;  4OV2 A;  1DJI A;  2L5Y A;  2LHL A;  2BL0 C;  3B88 A;  2KSP A;  3PAT A;  4OZD A;  1OMD A;  3S0E A;  1SR6 C;  3VB1 A;  2LUX A;  1M46 A;  1BR1 B;  1IIO A;  2K61 A;  1NX2 A;  1AVS A;  2OS8 B;  2M7L A;  4GUK A;  1YX7 A;  2JPO A;  2L5X B;  3I5H C;  4NDC A;  4PE1 A;  4HRH A;  1XYD A;  2K0J A;  4N1G A;  3DZT A;  4YRU A;  1NIW A;  3FIA A;  2L98 A;  2PAS A;  1CDN A;  3VRP A;  3OP0 A;  5AEQ A;  5I2O A;  1YUR A;  1B7T Y;  1OMV A;  1QX2 A;  3AAJ A;  2M9G A;  2PMY A;  3LL8 B;  1FI6 A;  3I5G B;  1SSE B;  2GTE A;  1DGV A;  3D78 A;  1W9Z A;  4JWQ A;  4F7F A;  3EVR A;  1YX8 A;  1TRF A;  2KBM A;  3DVJ A;  4PHJ A;  1WY9 A;  2F3Y A;  5D3O A;  1SCM C;  1MHO A;  1TNX A;  5KSZ A;  3D73 A;  3O2P A;  5G08 A;  1X02 A;  3NHT A;  4GPL B;  1KCY A;  1ZFS A;  3NSO A;  1KFX L;  3KEV A;  4YGC B;  3GK1 A;  1GGW A;  5I2L A;  1YUT A;  1DJG A;  2AUC A;  1UWO A;  3B6X A;  1DJH A;  3DVE A;  3B86 A;  4MVF A;  1ALW A;  1C3Z A;  1TNP A;  2WCH A;  1EH2 A;  2L51 A;  1OOG A;  2EHB A;  2QPT A;  1XFR A;  1YUS A;  2LHI A;  2PRU A;  2AAO A;  4PAL A;  2MAZ A;  2K7D A;  3SG3 A;  2MLE C;  1GM0 A;  2LLT A;  1M31 A;  1YTZ C;  1SL9 A;  1P28 A;  4I5J A;  4NQG A;  1KWO C;  4AOM A;  5D7F A;  2L0P A;  2OS8 C;  3E3R A;  3PJI A;  4M2O A;  3PSR A;  3TS5 B;  4IJ7 A;  1MR8 A;  2M49 B;  1WLZ A;  1MUX A;  2L4H A;  4ORB B;  3SS3 A;  1HT9 A;  4A4C A;  4BY5 A;  3BUM B;  3EKJ A;  5HYD A;  3WXA A;  1TIZ A;  1OQP A;  1QAS A;  1TOP A;  4C0J A;  2O60 A;  4U8D A;  1NYA A;  1E8A A;  2O5G A;  3CS1 A;  3CWG A;  3KF9 A;  5HKY A;  4I5L B;  1IG5 A;  1DJX A;  2BNX A;  3I5G C;  3OBV A;  1DEL A;  1KFU S;  3BYA A;  3RZS A;  1UHI A;  2LUC A;  3EK4 A;  3S0F A;  2FOT A;  3SG5 A;  1OOI X;  3BFH A;  2WCB A;  1YRT B;  5EL2 A;  1JC2 A;  4WRI A;  1J1E A;  4PHN A;  4HRG A;  4AQI A;  4JQ0 D;  2BEC A;  2JNX A;  2WCL A;  1KK8 B;  2K60 A;  1UHK A;  1QXP A;  1DC1 A;  2LAP A;  1G33 A;  3NSI A;  1B8C A;  3IF7 A;  2KNE A;  2FCE A;  1DJY A;  4MRY A;  1L7Z A;  3UO9 A;  4GGF C;  2I2R E;  3KPX A;  3CZ1 A;  1DF0 A;  2EC6 B;  2I94 A;  2HF5 A;  2MRD A;  1W7I B;  1CKK A;  5KTY A;  1B8R A;  3R1V A;  1UHJ A;  3FE9 A;  1NCY A;  3SG7 A;  1H8B A;  4F0Z B;  1QVI Y;  2JQ6 A;  4DRW A;  1DJZ A;  4WQ2 A;  1S6C A;  4WQ3 A;  4D1E A;  2BKI B;  3BJH A;  1KK7 Y;  3L4L A;  3QME A;  4USL A;  2PSR A;  2I7A A;  1S3P A;  1FW4 A;  1NP8 A;  2K7O A;  1IJ5 A;  2JT0 A;  1SPY A;  3VRN A;  5HLV A;  1RK9 A;  2JT8 A;  4GNK B;  3CGA A;  3I5H B;  4A4B A;  1MQ1 A;  2OTG B;  1WRZ A;  3DF0 B;  3GOF A;  4MLW A;  1FPW A;  1QTX A;  1KFU L;  3BUX B;  2YGU A;  3VRR A;  2KPH A;  3EKH A;  2HQW A;  4M2Q A;  2PQL A;  2JRF A;  3L47 A;  2WC6 A;  3VGO A;  1BJF A;  1K96 A;  1EXR A;  1KK8 C;  1RTP 1;  1WRK A;  1RWY A;  1K9P A;  4N1F A;  5CPV A;  1QV1 A;  5F6T A;  1EG3 A;  4PHM A;  2H61 A;  3D76 A;  2LMV A;  5BPJ A;  5AFP A;  1PVA A;  1A03 A;  2JNF A;  1SCM B;  2COL B;  1QWV A;  2QDI A;  3I5F C;  4GGN A;  1YUU A;  1XFV O;  3LK1 A;  4DIR A;  1PVB A;  2G2B A;  1TNQ A;  2KDH A;  1AUI B;  2KYF A;  1S36 A;  1RJV A;  4N5X A;  1L2O C;  3PM2 A;  2WCM A;  1DJW A;  4L9M A;  3TDZ A;  2B1U A;  3BOW B;  2QEB A;  1BT6 A;  1GGZ A;  4CFQ A;  1CTR A;  4ETO A;  1KWO B;  1CNP A;  4YBH B;  2BCB A;  5HL1 A;  3AKB A;  3CZ2 A;  2BBN A;  2KGB C;  2OTG C;  4CFR A;  1OW4 A;  1XA5 A;  2QEH A;  4I5N B;  1C3Y A;  4CID A;  2ERB A;  3WHU B;  2H8V A;  1AJ5 A;  1BR4 B;  1NSH A;  1QV0 A;  1IGV A;  3CR5 X;  1SMG A;  1TUJ A;  2M3W A;  3O4Y A;  4QJ5 B;  1F55 A;  4DS7 A;  1SYM A;  4OVN F;  3CR2 A;  2M29 A;  1CM1 A;  1Y1X A;  1SL7 A;  2JWW A;  3D0Y A;  1BU3 A;  4XJK B;  4PE7 A;  3A8R A;  4Q04 A;  1ZAC A;  1LS8 A;  2PVB A;  3K1E A;  5CSN A;  1XFX O;  1QLK A;  5FI2 A;  3WHT B;  3FE6 A;  1JF2 A;  1ZOT B;  2CT9 A;  2FJY A;  2QEO A;  3DXL A;  4YGB B;  1IKU A;  1UUS A;  4PDZ A;  3NSK A;  3I5I C;  3BOW A;  3O4X A;  1DEK A;  1CB1 A;  1FI5 A;  2ZN8 A;  2F33 A;  5I8N A;  1KSO A;  1ZMZ A;  2JUL A;  5DKQ A;  3GK4 X;  1Y1U A;  5FI7 A;  1CMG A;  4JD9 A;  1S5G Z;  2KAX A;  1N65 A;  1PSB A;  4KYN A;  2LVV A;  2D8N A;  2FCD A;  1GQM A;  1LIN A;  3M0W A;  2LP2 A;  4FQT A;  4ORC B;  3VRQ A;  2GGM A;  1OZO A;  5FYX A;  1ODB A;  1K8U A;  2LC5 A;  3NHI A;  1A4P A;  1MWN A;  1DTL A;  1QX5 B;  1FBV A;  4ZCU A;  2M1U A;  5D69 A;  3IVT A;  1CFP A;  1M39 A;  2MHH A;  1KQV A;  1K9K A;  5KU1 A;  4XJK A;  1A75 B;  4UPG A;  1DVI A;  2A4J A;  3JTD B;  3QRX A;  4YGA A;  1XK4 C;  4GFT A;  5DKN A;  3AAK A;  3O78 A;  3R1O A;  4HSZ A;  3OX5 A;  5K89 A;  1IWQ A;  4QJ3 B;  1NUB A;  1UHN A;  2JPT A;  1SCV A;  1TTX A;  3LK0 A;  1AJ4 A;  3PN7 B;  2KI4 C;  3L4A A;  1J7O A;  4MRX A;  1QS7 A;  2JC2 A;  1S26 D;  3I5F B;  4C0K A;  2KYC A;  3F45 A;  3EK7 A;  2KOT A;  2WCJ A;  3SIB A;  2WCE A;  2L4I A;  1NPQ A;  2KAV A;  1XFY O;  2KHN A;  4JPZ B;  3N7H A;  2Q4U A;  1QIV A;  1CDL A;  1L2O B;  1LVC D;  1QVI Z;  3Q8I A;  4MSP A;  5HLO A;  1R2U A;  2VRG A;  1NX0 A;  1B1G A;  4MN0 A; 
#chains in the Genus database with same CATH homology
 1EL4 A;  4DUQ A;  3CLN A;  1QAT A;  2KGR A;  2TN4 A;  3ZNI A;  1R6P A;  1MXL C;  1JUO A;  2JTZ A;  2PAL A;  5ER4 X;  2K7C A;  2ZRT A;  1CM4 A;  2ISD A;  4M2P A;  1XO5 A;  1CLM A;  2WND A;  4PHK A;  1VRK A;  5PAL A;  1F70 A;  2E6W A;  2LCP A;  3JTD C;  1XFW O;  2I18 A;  3DVM A;  1BG1 A;  1M63 B;  1ZUZ A;  3FWB A;  2RGI A;  2ZRS A;  2CXJ A;  2MBX A;  3PN7 C;  2KFH A;  2MLF C;  4IL1 A;  4PE0 A;  1H4B A;  2F3Z A;  1CFC A;  1JFK A;  1FF1 A;  1NX3 A;  3ICB A;  1EG4 A;  4OR9 B;  5B8I B;  1JFJ A;  5DKR A;  4CLN A;  2K7B A;  1Y0V H;  3AKA A;  1AK8 A;  1CFF A;  1JBA A;  3KO0 A;  1S6I A;  2H2K A;  1A29 A;  1TNW A;  2EGD A;  3I5I B;  1F4O A;  2E30 A;  1BMO A;  3SG2 A;  2KI6 C;  4E68 A;  1BOC A;  2LAN A;  5HKZ A;  1SY9 A;  1K90 D;  4ICB A;  4AQJ A;  3H4S E;  3JVT C;  4GAO A;  1F54 A;  2NXQ A;  1HQV A;  1Y6W A;  3SIA A;  2M7N A;  2JT3 A;  4MEW A;  3CR4 X;  3RM1 A;  4QJ4 B;  2JU0 A;  4FTG A;  3DF0 A;  2ZFD A;  1KSM A;  3CTN A;  2P6B B;  1Y1A A;  2OPO A;  2R2I A;  4MZJ A;  1EJ3 A;  1B7T Z;  2KAY A;  1LA3 A;  1PRW A;  2WOS A;  1JWD A;  1K95 A;  1CDM A;  5I2Q A;  1G4Y R;  2M8U A;  2LVI A;  1N2D A;  1DGU A;  3IQO A;  1IQ5 A;  1SRA A;  1WDC B;  1YVH A;  1YVL A;  1RRO A;  3DD4 A;  4PE4 A;  1J7Q A;  3OX6 A;  3SG6 A;  2AMI A;  2K2A A;  5HKW A;  5CSF A;  2IS9 A;  2KQY A;  2WOR A;  1B47 A;  3BUO B;  1CLL A;  2KI4 B;  2M1K B;  1SBJ A;  3NSL A;  4XYN A;  1MF8 B;  5AAN A;  1AHR A;  1C7V A;  1WLM A;  4MBE A;  2F2P A;  1XFZ O;  1WRL A;  1J7R A;  1QLS A;  3VRP A;  1SK6 D;  1CDP A;  3TZ1 A;  1JF0 A;  1IQ3 A;  2LV7 A;  2BKH B;  1J7P A;  4OCI A;  2JOJ A;  2DOQ A;  3BUN B;  4MZK A;  3C1V A;  2ZKM X;  3A4U B;  2KBI A;  2JTT A;  4R1E A;  1TN4 A;  1IJ6 A;  1J55 A;  2BBM A;  1XVJ A;  2L50 A;  2HPS A;  2CBL A;  3KHE A;  3TUY B;  3WNX B;  2V53 A;  4I5K A;  5GQQ C;  2L2E A;  1KQM C;  5ER5 A;  2NLN A;  3PFV A;  4TNC A;  2KFG A;  2Y5I A;  2KI6 D;  1DF0 B;  3TDU A;  3O6B A;  4NDB A;  1QJT A;  1WDC C;  1YR5 A;  1XK4 A;  1PUL A;  5CSI A;  2Y4Q A;  1K93 D;  1M45 A;  2BE4 A;  2BCX A;  1S5G Y;  2LP3 A;  3OHM B;  4BY4 A;  3FS7 A;  2KFF A;  2FJU B;  4OKH A;  1XFU O;  1G8I A;  1S1E A;  4CPV A;  1GJY A;  1DMO A;  1CMF A;  3EVV A;  1OE9 B;  4YI8 A;  1OMR A;  3DVK A;  1U5I B;  5JOL A;  3BQ3 A;  3SG4 A;  4GGF A;  1TCO B;  2LM5 A;  2G9B A;  3PLF B;  1K2H A;  3NXA A;  3VRO A;  2K8M B;  2WCF A;  1MXE A;  1AP4 A;  4MZL A;  1ALV A;  2MJW B;  3ZWH A;  5J3X A;  2Y1N A;  2BE6 A;  2LVJ A;  1UUR A;  3OB2 B;  3BUW B;  1SNL A;  3K21 A;  3EVU A;  1OOJ A;  2JXL A;  4ORA B;  1KK7 Z;  1B4C A;  1J1D A;  1S6J A;  3TDI A;  3TUY C;  1JSA A;  3RLZ A;  3EK8 A;  4YGD B;  2CTN A;  1A2X A;  5JJG A;  3JVT B;  3SJS A;  1NX1 A;  2JXC A;  2NCO A;  2SAS A;  3BXK A;  1A75 A;  2GV5 A;  2CCM A;  1DT7 B;  2LMT A;  5AXI A;  1LKJ A;  2ZN9 A;  4HRE E;  4YGE B;  2LMU A;  1LA0 A;  3PAL A;  1B8L A;  1SL8 A;  1LXF C;  1SW8 A;  3TS5 C;  1OZS A;  2QAC A;  2NCP A;  2CNP A;  3D10 A;  2K2F A;  1CLB A;  2Y1M A;  1C07 A;  4GBA A;  2NZ0 A;  2HQ8 A;  2BL0 B;  1Q80 A;  1U5I A;  4P5O E;  1K94 A;  1B9A A;  1PAL A;  1SR6 B;  2JZI A;  2M97 A;  5IBW A;  2ZND A;  3FWC A;  3GK2 A;  2M0R A;  1NCX A;  1K9U A;  2LVK A;  5CSJ A;  1BLQ A;  1W7J B;  2WC8 A;  2GGZ A;  4DCK A;  1PSR A;  1IRJ A;  3LCP C;  3HX4 A;  1OSA A;  2ZNE A;  4ZCV A;  2LLU A;  1F4Q A;  2SCP A;  1D1O A;  2F2O A;  4FQO A;  3IQQ A;  2LE9 B;  3PM8 A;  1SKT A;  1F8H A;  4C0L A;  1QX7 A;  2Q91 A;  1N0Y A;  1V1F A;  2KQ6 A;  3OB1 B;  2LLS A;  2H61 C;  1KFX S;  1PK0 D;  2F8P A;  2MA2 A;  1NCZ A;  1UP5 A;  1C7W A;  3D0Y B;  2EC6 C;  1QIW A;  2LNK A;  1V1G A;  1NWD A;  3MSE B;  1UHH A;  1YRU B;  3CZT X;  1REC A;  2BCA A;  4P2Y B;  1F71 A;  1BOD A;  1BF5 A;  4YI9 A;  5AER A;  3HCM A;  1RFJ A;  3LLE A;  4NDD A;  4PCW A;  5TNC A;  1CFD A;  1KQM B;  1TCF A;  2HET A;  1IH0 A;  4OV2 A;  1DJI A;  3PAT A;  2LHL A;  2BL0 C;  2KSP A;  1OMD A;  1SR6 C;  2LUX A;  1M46 A;  1BR1 B;  2K61 A;  1NX2 A;  1AVS A;  2OS8 B;  2M7L A;  4GUK A;  1YX7 A;  2L5X B;  3I5H C;  4NDC A;  4PE1 A;  4HRH A;  1XYD A;  2K0J A;  4N1G A;  4YRU A;  1NIW A;  3FIA A;  2L98 A;  2PAS A;  1CDN A;  3OP0 A;  5AEQ A;  5I2O A;  1YUR A;  1B7T Y;  1OMV A;  1QX2 A;  3AAJ A;  2M9G A;  2PMY A;  3LL8 B;  1FI6 A;  3I5G B;  1DGV A;  4JWQ A;  3EVR A;  1YX8 A;  1TRF A;  2KBM A;  3DVJ A;  4PHJ A;  1WY9 A;  2F3Y A;  1SCM C;  1MHO A;  1TNX A;  5KSZ A;  3O2P A;  5G08 A;  1X02 A;  4GPL B;  1KCY A;  1ZFS A;  3NSO A;  1KFX L;  3KEV A;  4YGC B;  3GK1 A;  1GGW A;  5I2L A;  1YUT A;  1DJG A;  2AUC A;  1UWO A;  3DVE A;  1DJH A;  4MVF A;  1ALW A;  1EH2 A;  1TNP A;  2L51 A;  2EHB A;  2QPT A;  1YUS A;  2LHI A;  2PRU A;  2AAO A;  4PAL A;  2MAZ A;  2K7D A;  3SG3 A;  2MLE C;  2LLT A;  1M31 A;  1YTZ C;  1SL9 A;  4I5J A;  4NQG A;  1KWO C;  4AOM A;  5D7F A;  2L0P A;  2OS8 C;  3E3R A;  4M2O A;  3PSR A;  3TS5 B;  1MR8 A;  2M49 B;  1WLZ A;  1MUX A;  2L4H A;  4ORB B;  4A4C A;  1HT9 A;  4BY5 A;  3BUM B;  3EKJ A;  5HYD A;  3WXA A;  1TIZ A;  1OQP A;  1QAS A;  1TOP A;  4C0J A;  2O60 A;  4U8D A;  1NYA A;  1E8A A;  2O5G A;  3CS1 A;  3CWG A;  3KF9 A;  5HKY A;  4I5L B;  1IG5 A;  1DJX A;  3I5G C;  1KFU S;  3BYA A;  1UHI A;  2LUC A;  3EK4 A;  2FOT A;  3SG5 A;  2WCB A;  1YRT B;  1JC2 A;  4WRI A;  1J1E A;  4PHN A;  4HRG A;  4AQI A;  4JQ0 D;  2BEC A;  2JNX A;  1KK8 B;  1UHK A;  1QXP A;  2LAP A;  1G33 A;  3NSI A;  1B8C A;  3IF7 A;  2KNE A;  2FCE A;  1DJY A;  4MRY A;  1L7Z A;  4GGF C;  2I2R E;  3KPX A;  1DF0 A;  2EC6 B;  2I94 A;  2HF5 A;  2MRD A;  1W7I B;  1CKK A;  5KTY A;  1B8R A;  1UHJ A;  1NCY A;  3SG7 A;  1H8B A;  4F0Z B;  1QVI Y;  2JQ6 A;  4DRW A;  1DJZ A;  4WQ2 A;  1S6C A;  4WQ3 A;  4D1E A;  2BKI B;  1KK7 Y;  4USL A;  2PSR A;  2I7A A;  1S3P A;  1FW4 A;  1NP8 A;  2K7O A;  1IJ5 A;  2JT0 A;  1SPY A;  3VRN A;  5HLV A;  1RK9 A;  2JT8 A;  4GNK B;  3CGA A;  3I5H B;  4A4B A;  1MQ1 A;  2OTG B;  1WRZ A;  3DF0 B;  3GOF A;  4MLW A;  1FPW A;  1QTX A;  1KFU L;  3BUX B;  3VRR A;  3EKH A;  2HQW A;  4M2Q A;  2JRF A;  3VGO A;  1BJF A;  1K96 A;  1EXR A;  1KK8 C;  1RTP 1;  1WRK A;  1RWY A;  1K9P A;  4N1F A;  5CPV A;  1QV1 A;  5F6T A;  1EG3 A;  4PHM A;  2H61 A;  2LMV A;  5BPJ A;  5AFP A;  1PVA A;  1A03 A;  2JNF A;  1SCM B;  2COL B;  3I5F C;  4GGN A;  1YUU A;  1XFV O;  3LK1 A;  4DIR A;  1PVB A;  2G2B A;  1TNQ A;  2KDH A;  1AUI B;  2KYF A;  1S36 A;  1RJV A;  4N5X A;  1L2O C;  1DJW A;  4L9M A;  3TDZ A;  2B1U A;  3BOW B;  1BT6 A;  1GGZ A;  4CFQ A;  1CTR A;  4ETO A;  1KWO B;  1CNP A;  4YBH B;  2BCB A;  3AKB A;  2BBN A;  2KGB C;  2OTG C;  4CFR A;  1XA5 A;  4I5N B;  4CID A;  3WHU B;  1AJ5 A;  1BR4 B;  1NSH A;  1QV0 A;  1IGV A;  3CR5 X;  1SMG A;  2M3W A;  3O4Y A;  4QJ5 B;  1F55 A;  4DS7 A;  1SYM A;  4OVN F;  3CR2 A;  2M29 A;  1CM1 A;  1Y1X A;  1SL7 A;  2JWW A;  3D0Y A;  1BU3 A;  4XJK B;  4PE7 A;  3A8R A;  4Q04 A;  1ZAC A;  2PVB A;  5CSN A;  1XFX O;  1QLK A;  3WHT B;  1JF2 A;  1ZOT B;  2CT9 A;  4YGB B;  1IKU A;  1UUS A;  4PDZ A;  3NSK A;  3I5I C;  3BOW A;  1CB1 A;  1FI5 A;  2ZN8 A;  2F33 A;  5I8N A;  1KSO A;  1ZMZ A;  2JUL A;  5DKQ A;  3GK4 X;  1Y1U A;  1CMG A;  1S5G Z;  2KAX A;  1N65 A;  1PSB A;  2LVV A;  2D8N A;  2FCD A;  1GQM A;  1LIN A;  3M0W A;  2LP2 A;  4ORC B;  3VRQ A;  2GGM A;  1OZO A;  5FYX A;  1ODB A;  1K8U A;  2LC5 A;  1A4P A;  1MWN A;  1DTL A;  1QX5 B;  1FBV A;  4ZCU A;  2M1U A;  5D69 A;  1CFP A;  1M39 A;  2MHH A;  1KQV A;  1K9K A;  5KU1 A;  4XJK A;  1A75 B;  4UPG A;  2A4J A;  1DVI A;  3JTD B;  3QRX A;  4YGA A;  1XK4 C;  4GFT A;  5DKN A;  3AAK A;  3O78 A;  4HSZ A;  3OX5 A;  5K89 A;  1IWQ A;  4QJ3 B;  1NUB A;  1UHN A;  2JPT A;  1SCV A;  1TTX A;  3LK0 A;  1AJ4 A;  3PN7 B;  2KI4 C;  1J7O A;  4MRX A;  1QS7 A;  2JC2 A;  1S26 D;  3I5F B;  4C0K A;  2KYC A;  3F45 A;  3EK7 A;  2KOT A;  3SIB A;  2WCE A;  2L4I A;  1NPQ A;  2KAV A;  1XFY O;  2KHN A;  4JPZ B;  2Q4U A;  1QIV A;  1CDL A;  1L2O B;  1LVC D;  1QVI Z;  5HLO A;  4MSP A;  1R2U A;  2VRG A;  1NX0 A;  1B1G A;  4MN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...