2KGBC

Nmr solution of the regulatory domain cardiac f77w-troponin c in complex with the cardiac troponin i 144-163 switch peptide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
89
structure length
89
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEWLVMMVRCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The effect of the cosolvent trifluoroethanol on a tryptophan side chain orientation in the hydrophobic core of troponin C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein/ca binding protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
total genus 21
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kgbC00
1LXFC 1KQVA 3O4YA 1YUSA 3IQQA 1ODBA 4GGFA 1YUUA 4JPZB 1WDCC 1KQMC 2LV7A 1C7WA 1M46A 4I5KA 5DKQA 3CGAA 1CTRA 4AOMA 5HLOA 2CXJA 2BKIB 4R1EA 1SPYA 2QPTA 1TN4A 2K7DA 4GGFC 3NXAA 3CZTX 3EKJA 2I18A 2L51A 1KQMB 2LHLA 1PVAA 2L98A 2MLEC 4NQGA 1EG4A 1K9PA 2BKHB 1SKTA 1IGVA 2MRDA 2LAPA 1Y6WA 2QACA 1WLZA 2LVIA 3O6BA 2ISDA 1A75A 3NSLA 3AAJA 1HQVA 1SL9A 4PE0A 2KAVA 2FOTA 1BMOA 5AANA 2VRGA 3SIAA 3I5HC 1KCYA 1UUSA 2H2KA 3A4UB 3AAKA 1SCMC 1DJHA 1K9KA 1KSOA 1HT9A 5CPVA 1V1GA 2G9BA 3TUYC 3TDUA 4CIDA 3O78A 3VROA 2O60A 1TNXA 1V1FA 2SASA 3IQOA 2BECA 1A03A 1N2DA 1FBVA 4PDZA 1B1GA 1K94A 4MLWA 1G33A 3PN7C 1Q80A 4WQ2A 1YRUB 1S1EA 1BT6A 1W7JB 1CFDA 3VRRA 1Y1UA 1QV1A 1BLQA 1QX2A 2KI6D 1NUBA 2K7OA 4DCKA 3D0YA 1YTZC 2LP3A 2LHIA 2LLTA 2JT0A 2OS8C 4F0ZB 3WHTB 4GBAA 2KHNA 3LK1A 4ORAB 4MEWA 4FTGA 1J7QA 3ZWHA 1K2HA 1QIVA 1JF0A 1DGVA 3E3RA 1QIWA 4YI9A 2ZRTA 3OB1B 4WQ3A 3WNXB 1XVJA 2KI4C 3GK4X 1Y0VH 2Y5IA 1BF5A 1Y1XA 3D10A 1YURA 2LLSA 4CPVA 2RGIA 1NWDA 4TNCA 2LNKA 2WC8A 1B8LA 1XFWO 1XK4C 2FCDA 2F8PA 2GGMA 4OR9B 4OVNF 1UURA 1SK6D 2NCOA 3TS5C 1TOPA 1OZSA 4FQOA 3PM8A 1PVBA 1J7PA 2KQYA 1SL8A 2NCPA 2H61C 4GPLB 2MHHA 4M2PA 1YR5A 2EC6B 3VRQA 1KK8B 2KDHA 1XFZO 4OV2A 3SG5A 4MVFA 1E8AA 4OCIA 2I94A 5CSIA 5KU1A 1SBJA 2JULA 2M1KB 3BUWB 1AHRA 3ICBA 1PRWA 3NSOA 1B7TZ 1CNPA 2JRFA 2L5XB 1SY9A 1UHIA 1RROA 2LCPA 1TNPA 1KSMA 4N5XA 2L4HA 4GGNA 3DD4A 2OTGB 2LVVA 1YVLA 1S5GZ 1LVCD 3FIAA 5I8NA 1JSAA 4YGBB 1R6PA 1NX0A 4I5JA 2M49B 1CKKA 1BOCA 4YGDB 3HCMA 2M97A 1FI5A 1DTLA 4MN0A 4CLNA 1W7IB 2BE4A 1CMGA 1H4BA 1TRFA 1CB1A 5I2OA 1SYMA 2M8UA 1JF2A 2R2IA 1SL7A 3BYAA 1U5IA 1QTXA 1S6CA 2ZN9A 3H4SE 2LP2A 1F70A 1L7ZA 1QX5B 1H8BA 3NSKA 2JWWA 3SIBA 2M1UA 1EH2A 1DJXA 3PALA 4C0LA 2A4JA 3SG2A 1OZOA 1K95A 1X02A 2EGDA 3LLEA 1NX1A 1UHJA 3DF0A 4I5LB 5TNCA 4DRWA 4PHKA 2F3YA 4C0KA 2WNDA 3AKBA 3BUOB 1YX8A 2F2PA 1OE9B 4U8DA 2F2OA 1BU3A 1KK7Y 1UHKA 1WRLA 4MRXA 4OKHA 2BCXA 5HYDA 1DMOA 3KF9A 5AEQA 4A4CA 4A4BA 1MF8B 5GQQC 2ZNEA 1EL4A 1NIWA 1UHNA 1ZUZA 2L50A 2FJUB 2JTTA 1U5IB 1FF1A 2KI6C 4XYNA 2MBXA 3I5HB 3HX4A 1LKJA 2AAOA 1PSBA 2JU0A 2KSPA 4HRHA 2ZKMX 3I5GC 4IL1A 1CMFA 5I2QA 1VRKA 2E6WA 1YUTA 5K89A 1FI6A 4N1GA 2JXCA 2F33A 3DVEA 5KTYA 1KWOB 1JBAA 1SR6C 1R2UA 1F4OA 1CFFA 1OMDA 4MZJA 2CBLA 1NP8A 1UWOA 3CR5X 3JVTC 3QRXA 1YX7A 2OPOA 1TCOB 3O2PA 4CFQA 3KO0A 4PHJA 1F71A 1WDCB 4PALA 1MWNA 1M31A 3BOWA 1TNWA 1BR1B 2NZ0A 3CLNA 1CLMA 2WCBA 1A4PA 3AKAA 3KHEA 4HREE 2JQ6A 4QJ4B 1TIZA 1M45A 2BCBA 2KBIA 1OMVA 1M63B 4YGEB 2E30A 2PASA 2OS8B 3TDZA 3SJSA 1KK8C 4YRUA 2LMUA 4DS7A 1SR6B 2CNPA 1B4CA 2HPSA 2LMVA 3LCPC 1WY9A 1ALVA 2G2BA 4NDBA 5G08A 4N1FA 4P2YB 5HKWA 3FS7A 4NDCA 1CLLA 3EKHA 2L2EA 1CFCA 5F6TA 2K61A 1Y1AA 1QLKA 3EK4A 4XJKB 3EK7A 1L2OC 3BUMB 4D1EA 4I5NB 4HSZA 2GGZA 2I2RE 1GQMA 1KFXS 1FW4A 4QJ5B 4XJKA 1XFUO 3VRNA 1UP5A 1TTXA 1WRZA 2KI4B 3OP0A 5AFPA 1NPQA 1QLSA 1QV0A 3VGOA 1K93D 1XYDA 3EVRA 1S36A 1XK4A 5PALA 2GV5A 4BY5A 1PULA 3GK2A 1A2XA 3C1VA 1UHHA 2K8MB 1J55A 2MAZA 1NSHA 4NDDA 3D0YB 1MXLC 3K21A 3WXAA 3PN7B 3GOFA 1C7VA 2D8NA 5ER5A 3OHMB 2WCFA 1CM4A 2LUCA 4AQJA 1BR4B 2JT8A 1RFJA 1S3PA 4YI8A 3LL8B 2CTNA 4MSPA 1KK7Z 3BOWB 5ER4X 1NYAA 3RLZA 1DJYA 2KQ6A 4GNKB 5AERA 5AXIA 2BBNA 2JZIA 3OX6A 1OOJA 2TN4A 4ETOA 5CSNA 1SMGA 1MUXA 4YGCB 1ZOTB 4WRIA 1PK0D 2LC5A 1SCVA 5CSFA 2Q91A 2MA2A 2HF5A 1DGUA 5FYXA 3I5FC 3KEVA 2OTGC 2KGRA 4PCWA 4JQ0D 4DIRA 1ZACA 1EG3A 2FCEA 1D1OA 3JTDB 1AJ5A 4ORCB 3CTNA 1CDMA 3SG7A 3A8RA 1QJTA 2BCAA 1KWOC 4GFTA 1B47A 1IJ6A 2ZRSA 4MZLA 3LK0A 4UPGA 2JTZA 3BXKA 1AVSA 4CFRA 1AJ4A 2M3WA 2CT9A 3JTDC 3SG3A 1C07A 3ZNIA 3I5FB 4C0JA 3IF7A 4PE4A 1NCZA 4YBHB 5I2LA 1CLBA 4L9MA 1FPWA 2WOSA 2K7CA 3PFVA 2JXLA 2KYCA 2M29A 4GUKA 1SW8A 3OX5A 2LANA 3BUXB 3TDIA 3VRPA 4MZKA 2K2FA 5DKRA 1YRTB 1TCFA 2BBMA 1MHOA 1RJVA 2KAYA 3TZ1A 1IQ5A 1B8CA 1WLMA 1A29A 1LA0A 1K9UA 2F3ZA 3BQ3A 1DT7B 3EVUA 3DF0B 1M39A 1QATA 2PMYA 2WORA 1DVIA 2BL0B 1EJ3A 2MJWB 3CS1A 2WCEA 4MRYA 3PLFB 1XO5A 2IS9A 5BPJA 1CDNA 4PE7A 3DVJA 5CSJA 3WHUB 1S26D 5IBWA 2PSRA 1K96A 1J7OA 1K8UA 2K7BA 1TNQA 2O5GA 1N0YA 5JOLA 1OMRA 2M9GA 1S6JA 1RECA 2L4IA 1PSRA 3FWCA 2KBMA 3I5GB 2NLNA 1DJIA 2JPTA 1OSAA 4ORBB 4BY4A 2B1UA 2PRUA 1B8RA 1JFKA 2KAXA 1L2OB 1BODA 2I7AA 1B9AA 2JC2A 1RTP1 1KFUL 2LLUA 1G4YR 2LM5A 2LUXA 3CR2A 2HETA 1N65A 1CM1A 4PE1A 1F55A 1RK9A 2AUCA 2JT3A 5HKZA 1QASA 4M2QA 2NXQA 4ICBA 1IKUA 1XFVO 4HRGA 2Y1NA 2AMIA 1QS7A 4GAOA 2PALA 3TUYB 2K0JA 1DF0A 1QVIZ 3KPXA 1AK8A 2KFGA 2P6BB 3GK1A 1SCMB 4ZCUA 2KOTA 1K90D 1LA3A 3PSRA 5HLVA 5JJGA 1BG1A 2DOQA 2LVKA 2PVBA 5DKNA 1OQPA 2LE9B 1IH0A 4AQIA 1B7TY 1G8IA 3M0WA 1MQ1A 1DF0B 2H61A 3I5IC 2HQWA 1JFJA 3F45A 1WRKA 4Q04A 3DVMA 5KSZA 1MR8A 1DJGA 1XFXO 2COLB 2HQ8A 3OB2B 1EXRA 2JNXA 4MBEA 1JUOA 1PALA 1S5GY 3BUNB 5D7FA 3JVTB 1QVIY 1J1EA 1GJYA 1NX3A 1F8HA 3SG4A 3FWBA 2KGBC 4QJ3B 1KFUS 1QXPA 5B8IB 4M2OA 1NX2A 2Q4UA 1KFXL 3EVVA 1XFYO 2Y1MA 1CDPA 2V53A 1LINA 4PHMA 1J7RA 2BE6A 2ZNDA 2JOJA 1AP4A 3I5IB 1IG5A 1J1DA 1CDLA 1NCXA 2K2AA 1IJ5A 2LMTA 3SG6A 4E68A 1JC2A 1AUIB 4JWQA 1DJZA 2KFHA 3DVKA 1IQ3A 1DJWA 2EC6C 5HKYA 1IRJA 4USLA 2M7NA 1XA5A 3TS5B 4YGAA 2MLFC 1SRAA 3EK8A 2JNFA 1GGWA 1BJFA 2L0PA 1F54A 1YVHA 5J3XA 4ZCVA 3MSEB 2KFFA 2KYFA 2LVJA 1NCYA 4DUQA 2KNEA 3CR4X 2BL0C 1CFPA 1QX7A 1S6IA 1ZFSA 2ZFDA 4P5OE 1MXEA 2M7LA 1ZMZA 1F4QA 2M0RA 1GGZA 5D69A 3PATA 1JWDA 4PHNA 1IWQA 2EHBA 2CCMA 2Y4QA 3CWGA 3NSIA 1RWYA 1ALWA 3RM1A 1SNLA 2SCPA 2ZN8A 1A75B
chains in the Genus database with same CATH superfamily
1LXFC 1KQVA 3O4YA 1YUSA 3IQQA 1ODBA 4GGFA 1YUUA 4JPZB 1GM0A 1WDCC 1KQMC 2LV7A 1C7WA 2WCLA 1M46A 4I5KA 5DKQA 3CGAA 1CTRA 4AOMA 5HLOA 2CXJA 2BKIB 4R1EA 1SPYA 2QPTA 1TN4A 2K7DA 4GGFC 3NXAA 3CZTX 3EKJA 1DC1A 2I18A 2L51A 1KQMB 2LHLA 1PVAA 3QMEA 2L98A 2MLEC 4NQGA 1EG4A 1K9PA 2BKHB 3BFAA 1SKTA 2KLEA 1IGVA 2MRDA 2LAPA 3PJIA 1Y6WA 2QACA 1WLZA 2LVIA 3O6BA 2ISDA 1A75A 3NSLA 3AAJA 1HQVA 1SL9A 4PE0A 3CDNA 3D77A 2KAVA 2FOTA 1BMOA 5AANA 2VRGA 1DELA 3I5HC 3SIAA 1KCYA 1UUSA 2H2KA 3A4UB 3AAKA 1SCMC 1DJHA 1K9KA 1KSOA 1HT9A 5CPVA 1V1GA 1TWOA 2G9BA 3TUYC 3TDUA 4CIDA 3O78A 3VROA 2O60A 1TNXA 1V1FA 2SASA 3BJHA 2BECA 3IQOA 1A03A 3NGVA 1N2DA 1FBVA 3PM2A 4PDZA 1K94A 4MLWA 1B1GA 1G33A 3PN7C 1Q80A 4WQ2A 3CYZA 1YRUB 1S1EA 1BT6A 1W7JB 1TUZA 1CFDA 3VRRA 1Y1UA 1QV1A 1BLQA 1QX2A 2KI6D 1NUBA 2K7OA 4DCKA 3D0YA 1YTZC 2LP3A 4JKTA 2LHIA 2LLTA 2JT0A 2OS8C 4F0ZB 3WHTB 4GBAA 2KHNA 3B7AA 3LK1A 3L4LA 4MEWA 4FTGA 4ORAB 3SS5A 1J7QA 3ZWHA 1K2HA 3S0AA 1QIVA 1JF0A 1DGVA 3E3RA 1QIWA 2JPOA 4YI9A 2ZRTA 3OB1B 4WQ3A 3WNXB 1XVJA 2KI4C 3GK4X 1Y0VH 2Y5IA 1BF5A 1Y1XA 3D10A 1YURA 2LLSA 4CPVA 5EL2A 2RGIA 1NWDA 4TNCA 2LNKA 3B88A 2WC8A 1B8LA 4INWA 1XFWO 1XK4C 2FCDA 2F8PA 2GGMA 2YGUA 4OR9B 4OVNF 1UURA 1SK6D 2NCOA 2K60A 5I94A 3TS5C 1TOPA 1OZSA 3D75A 3PM8A 1PVBA 4FQOA 1C3ZA 1J7PA 2KQYA 1SL8A 2NCPA 3B6XA 2H61C 4GPLB 2MHHA 4M2PA 1YR5A 2EC6B 3VRQA 1KK8B 2KDHA 1XFZO 4OV2A 3SG5A 3DXLA 4MVFA 1E8AA 4OCIA 2I94A 5CSIA 5KU1A 1SBJA 2JULA 2M1KB 3BUWB 1AHRA 3ICBA 1PRWA 3IVTA 3NSOA 1B7TZ 1CNPA 1OOIX 2JRFA 2L5XB 1SY9A 1UHIA 1RROA 2QEOA 2LCPA 4FQTA 3R1OA 1TNPA 1C3YA 1KSMA 4N5XA 3R72A 2L4HA 4GGNA 3DD4A 2L2CA 2OTGB 2LVVA 5D3OA 1YVLA 1S5GZ 1LVCD 3FIAA 5I8NA 1JSAA 4YGBB 1R6PA 1NX0A 4I5JA 2M49B 2PYQA 1CKKA 4YGDB 1BOCA 3HCMA 2M97A 1FI5A 1DTLA 3K1EA 4MN0A 4CLNA 1W7IB 2BE4A 1CMGA 1H4BA 1TRFA 3OGNA 5I2OA 1CB1A 1SYMA 2M8UA 1JF2A 2R2IA 1SL7A 3BYAA 1U5IA 1QTXA 3FE6A 1S6CA 2ZN9A 1DEKA 3H4SE 2LP2A 1F70A 1L7ZA 1QX5B 1H8BA 3NSKA 2JWWA 3SIBA 2M1UA 1EH2A 1DJXA 3PALA 4C0LA 2A4JA 3SG2A 1OZOA 1K95A 1DQEA 1X02A 2EGDA 1NX1A 1UHJA 3DF0A 3LLEA 4I5LB 3N7HA 4DRWA 1Z2CB 4PHKA 2F3YA 3CZ1A 4C0KA 2WNDA 3AKBA 2FJYA 3BUOB 1YX8A 5FI7A 1OE9B 2F2PA 4U8DA 2F2OA 1BU3A 1KK7Y 1UHKA 1WRLA 4MRXA 4OKHA 2BCXA 5HYDA 1DMOA 3KF9A 5AEQA 4A4CA 4A4BA 1MF8B 3O4XA 3NHIA 5GQQC 2ZNEA 1EL4A 1NIWA 1UHNA 3FE8A 1ZUZA 2L50A 2FJUB 2JTTA 1U5IB 1FF1A 2KI6C 4XYNA 2MBXA 3DZTA 3S0EA 1P28A 3I5HB 3HX4A 1LKJA 2AAOA 1PSBA 2JU0A 2KSPA 3SS4A 4HRHA 2ZKMX 3I5GC 4IL1A 1CMFA 1OW4A 5I2QA 1VRKA 2E6WA 1YUTA 5K89A 1FI6A 4N1GA 3V2LA 1IIOA 2JXCA 3S0BA 2F33A 3DVEA 5KTYA 1KWOB 1JBAA 2WCJA 1SR6C 1R2UA 1F4OA 1CFFA 1OMDA 4MZJA 2CBLA 1NP8A 1UWOA 3CR5X 3JVTC 3QRXA 5FI2A 1YX7A 3L4AA 2OPOA 1TCOB 3O2PA 4KYNA 4CFQA 3KO0A 2P70A 4PHJA 1OOHA 1F71A 1WDCB 4PALA 1MWNA 1M31A 2P71A 3BOWA 1TNWA 1BR1B 2NZ0A 3CLNA 1CLMA 2WCBA 1A4PA 3AKAA 3KHEA 4HREE 2JQ6A 4QJ4B 1TIZA 1M45A 2BCBA 2KBIA 1OMVA 1M63B 4YGEB 2E30A 2PASA 2OS8B 3TDZA 3SJSA 1KK8C 4YRUA 2LMUA 4DS7A 1SR6B 2H8VA 2CNPA 3S0FA 1B4CA 2HPSA 2LMVA 2WC6A 3LCPC 1WY9A 1ALVA 2G2BA 4NDBA 5G08A 4N1FA 4P2YB 4PT1A 5HKWA 3FS7A 4NDCA 1CLLA 3EKHA 2L2EA 1CFCA 5F6TA 2K61A 3CABA 1W9ZA 5HL1A 1Y1AA 1SSEB 1QLKA 2KPHA 3R1PA 3EK4A 4XJKB 3EK7A 1L2OC 3BUMB 4D1EA 4I5NB 4HSZA 2GGZA 2I2RE 1GQMA 1KFXS 1FW4A 4QJ5B 4XJKA 1XFUO 3VRNA 1UP5A 1TTXA 1WRZA 2PQLA 2KI4B 3FE9A 3OP0A 5AFPA 1NPQA 1QLSA 3SS3A 1QV0A 3VGOA 3B87A 3DY9A 1K93D 1XYDA 3EVRA 2WCHA 1S36A 1XK4A 4INXA 2GV5A 5PALA 4BY5A 1PULA 2BNXA 3GK2A 1A2XA 3C1VA 1UHHA 2K8MB 1J55A 2MAZA 1NSHA 3R1VA 3D0YB 4NDDA 1MXLC 3K21A 3WXAA 3PN7B 3GOFA 1C7VA 2D8NA 2ERBA 4JD9A 5ER5A 3OHMB 2WCFA 1CM4A 2LUCA 4AQJA 1BR4B 2JT8A 1RFJA 1S3PA 4YI8A 5DICA 1OOGA 2CTNA 3LL8B 4MSPA 1KK7Z 3BOWB 5ER4X 1NYAA 3RLZA 1DJYA 2KQ6A 4GNKB 5AERA 5AXIA 1ORGA 2BBNA 2JZIA 3OX6A 1OOJA 2TN4A 4ETOA 5TNCA 5CSNA 1SMGA 1MUXA 4YGCB 1ZOTB 4WRIA 1PK0D 2LC5A 1SCVA 5CSFA 2Q91A 2MA2A 2HF5A 1DGUA 2BAPA 5FYXA 2GTEA 3I5FC 3KEVA 2OTGC 2KGRA 4PCWA 4JQ0D 4DIRA 1ZACA 1EG3A 2FCEA 3OBVA 1D1OA 3JTDB 1AJ5A 4ORCB 3CTNA 1CDMA 3SG7A 3A8RA 1QJTA 2BCAA 1KWOC 4GFTA 1B47A 1IJ6A 2ZRSA 4MZLA 3VB1A 3LK0A 4UPGA 2JTZA 3BXKA 1AVSA 4CFRA 1AJ4A 2M3WA 2CT9A 3JTDC 3SG3A 1C07A 3ZNIA 3I5FB 4C0JA 1OOFA 3IF7A 1NCZA 4PE4A 4YBHB 5I2LA 4L9MA 1CLBA 2WOSA 1FPWA 3B86A 2K7CA 3PFVA 2JXLA 2KYCA 2M29A 3S0GA 4GUKA 1SW8A 1Z4HA 3OX5A 2LANA 3BUXB 3TDIA 3VRPA 4MZKA 2K2FA 5DKRA 1YRTB 1TCFA 2BBMA 1MHOA 3CZ0A 1RJVA 2KAYA 3TZ1A 1IQ5A 1B8CA 1WLMA 1A29A 3D78A 1LA0A 1K9UA 2F3ZA 3BQ3A 1DT7B 3EVUA 3DF0B 1M39A 1QATA 2PMYA 2WORA 1DVIA 2BL0B 2WCKA 1EJ3A 3L47A 2MJWB 3CS1A 2WCEA 4MRYA 3PLFB 1XO5A 2IS9A 5BPJA 1CDNA 4PE7A 3DVJA 5CSJA 3WHUB 1S26D 5IBWA 2PSRA 1K96A 1J7OA 1K8UA 2K7BA 1TNQA 2O5GA 1N0YA 5JOLA 1OMRA 2M9GA 1S6JA 1RECA 2L4IA 1PSRA 3FWCA 2KBMA 3I5GB 2NLNA 1DJIA 2JPTA 1OSAA 4ORBB 4BY4A 4F7FA 2B1UA 2PRUA 1B8RA 1JFKA 2KAXA 3RZSA 1L2OB 1BODA 2I7AA 1B9AA 2JC2A 1RTP1 1KFUL 2LLUA 1G4YR 2LM5A 2LUXA 2WCMA 3CR2A 2HETA 1N65A 1CM1A 4PE1A 1F55A 1RK9A 3D74A 2AUCA 2JT3A 5HKZA 1QASA 4M2QA 2KLDA 5FI6A 2NXQA 4ICBA 1IKUA 1XFVO 4HRGA 2Y1NA 2AMIA 1QS7A 2WC5A 4GAOA 1LS8A 2PALA 3TUYB 2K0JA 1DF0A 1QVIZ 3KPXA 3UO9A 2KFGA 1AK8A 2P6BB 3GK1A 1SCMB 4ZCUA 2KOTA 1K90D 1LA3A 3PSRA 5HLVA 5JJGA 1BG1A 2DOQA 2LVKA 2PVBA 5DKNA 1OQPA 2LE9B 3NHTA 1IH0A 4AQIA 1B7TY 1G8IA 3M0WA 1MQ1A 1DF0B 2H61A 3I5IC 2HQWA 1JFJA 3F45A 3S0DA 1WRKA 4Q04A 3DVMA 5KSZA 1MR8A 1DJGA 1XFXO 2COLB 2HQ8A 3OB2B 1EXRA 2JNXA 4MBEA 1JUOA 1TUJA 1PALA 1S5GY 3BUNB 5D7FA 3JVTB 4OZDA 1QVIY 1J1EA 2QEHA 1GJYA 1NX3A 1F8HA 3SG4A 3FWBA 3D76A 2KGBC 4QJ3B 1KFUS 1QXPA 5B8IB 4M2OA 1NX2A 2Q4UA 1KFXL 3EVVA 1XFYO 2Y1MA 1CDPA 2V53A 1LINA 3EG5B 4PHMA 3UNWA 1J7RA 2BE6A 2ZNDA 2JOJA 1AP4A 3I5IB 1IG5A 1J1DA 1XFRA 1CDLA 1NCXA 2K2AA 1IJ5A 2LMTA 3SG6A 4E68A 1JC2A 1AUIB 4JWQA 1DJZA 2KFHA 3DVKA 1IQ3A 1T14A 1DJWA 2EC6C 2QEVA 5HKYA 1IRJA 3BFHA 4USLA 2L5YA 2M7NA 1XA5A 3TS5B 4YGAA 2MLFC 1SRAA 3EK8A 3DYEA 2JNFA 3BFBA 1GGWA 1BJFA 2L0PA 1F54A 1YVHA 5J3XA 1QWVA 3Q8IA 3MSEB 2KFFA 2KYFA 4ZCVA 2LVJA 1NCYA 4DUQA 2KNEA 3CR4X 2BL0C 1CFPA 1QX7A 1S6IA 1ZFSA 2ZFDA 4P5OE 1MXEA 2M7LA 1ZMZA 1F4QA 2M0RA 1GGZA 5D69A 3CZ2A 3PATA 1JWDA 4PHNA 1IWQA 2EHBA 2QDIA 2CCMA 3D73A 2Y4QA 3CWGA 3NSIA 1RWYA 1ALWA 4IJ7A 3RM1A 2QEBA 1SNLA 2SCPA 2ZN8A 1A75B
chains in the Genus database with same CATH topology
1LXFC 1KQVA 3O4YA 1YUSA 3IQQA 1ODBA 4GGFA 1YUUA 4JPZB 1WDCC 1KQMC 2LV7A 1C7WA 1M46A 4I5KA 5DKQA 3CGAA 1CTRA 4AOMA 5HLOA 2CXJA 2BKIB 4R1EA 1SPYA 2QPTA 1TN4A 2K7DA 4GGFC 3NXAA 3CZTX 3EKJA 2I18A 2L51A 1KQMB 2LHLA 1PVAA 2L98A 2MLEC 4NQGA 1EG4A 1K9PA 2BKHB 1SKTA 1IGVA 2MRDA 2LAPA 1Y6WA 2QACA 1WLZA 2LVIA 3O6BA 2ISDA 1A75A 3NSLA 3AAJA 1HQVA 1SL9A 4PE0A 2KAVA 2FOTA 1BMOA 5AANA 2VRGA 3SIAA 3I5HC 1KCYA 1UUSA 2H2KA 3A4UB 3AAKA 1SCMC 1DJHA 1K9KA 1KSOA 1HT9A 5CPVA 1V1GA 2G9BA 3TUYC 3TDUA 4CIDA 3O78A 3VROA 2O60A 1TNXA 1V1FA 2SASA 3IQOA 2BECA 1A03A 1N2DA 1FBVA 4PDZA 1B1GA 1K94A 4MLWA 1G33A 3PN7C 1Q80A 4WQ2A 1YRUB 1S1EA 1BT6A 1W7JB 1CFDA 3VRRA 1Y1UA 1QV1A 1BLQA 1QX2A 2KI6D 1NUBA 2K7OA 4DCKA 3D0YA 1YTZC 2LP3A 2LHIA 2LLTA 2JT0A 2OS8C 4F0ZB 3WHTB 4GBAA 2KHNA 3LK1A 4ORAB 4MEWA 4FTGA 1J7QA 3ZWHA 1K2HA 1QIVA 1JF0A 1DGVA 3E3RA 1QIWA 4YI9A 2ZRTA 3OB1B 4WQ3A 3WNXB 1XVJA 2KI4C 3GK4X 1Y0VH 2Y5IA 1BF5A 1Y1XA 3D10A 1YURA 2LLSA 4CPVA 2RGIA 1NWDA 4TNCA 2LNKA 2WC8A 1B8LA 1XFWO 1XK4C 2FCDA 2F8PA 2GGMA 4OR9B 4OVNF 1UURA 1SK6D 2NCOA 3TS5C 1TOPA 1OZSA 4FQOA 3PM8A 1PVBA 1J7PA 2KQYA 1SL8A 2NCPA 2H61C 4GPLB 2MHHA 4M2PA 1YR5A 2EC6B 3VRQA 1KK8B 2KDHA 1XFZO 4OV2A 3SG5A 4MVFA 1E8AA 4OCIA 2I94A 5CSIA 5KU1A 1SBJA 2JULA 2M1KB 3BUWB 1AHRA 3ICBA 1PRWA 3NSOA 1B7TZ 1CNPA 2JRFA 2L5XB 1SY9A 1UHIA 1RROA 2LCPA 1TNPA 1KSMA 4N5XA 2L4HA 4GGNA 3DD4A 2OTGB 2LVVA 1YVLA 1S5GZ 1LVCD 3FIAA 5I8NA 1JSAA 4YGBB 1R6PA 1NX0A 4I5JA 2M49B 1CKKA 1BOCA 4YGDB 3HCMA 2M97A 1FI5A 1DTLA 4MN0A 4CLNA 1W7IB 2BE4A 1CMGA 1H4BA 1TRFA 1CB1A 5I2OA 1SYMA 2M8UA 1JF2A 2R2IA 1SL7A 3BYAA 1U5IA 1QTXA 1S6CA 2ZN9A 3H4SE 2LP2A 1F70A 1L7ZA 1QX5B 1H8BA 3NSKA 2JWWA 3SIBA 2M1UA 1EH2A 1DJXA 3PALA 4C0LA 2A4JA 3SG2A 1OZOA 1K95A 1X02A 2EGDA 3LLEA 1NX1A 1UHJA 3DF0A 4I5LB 5TNCA 4DRWA 4PHKA 2F3YA 4C0KA 2WNDA 3AKBA 3BUOB 1YX8A 2F2PA 1OE9B 4U8DA 2F2OA 1BU3A 1KK7Y 1UHKA 1WRLA 4MRXA 4OKHA 2BCXA 5HYDA 1DMOA 3KF9A 5AEQA 4A4CA 4A4BA 1MF8B 5GQQC 2ZNEA 1EL4A 1NIWA 1UHNA 1ZUZA 2L50A 2FJUB 2JTTA 1U5IB 1FF1A 2KI6C 4XYNA 2MBXA 3I5HB 3HX4A 1LKJA 2AAOA 1PSBA 2JU0A 2KSPA 4HRHA 2ZKMX 3I5GC 4IL1A 1CMFA 5I2QA 1VRKA 2E6WA 1YUTA 5K89A 1FI6A 4N1GA 2JXCA 2F33A 3DVEA 5KTYA 1KWOB 1JBAA 1SR6C 1R2UA 1F4OA 1CFFA 1OMDA 4MZJA 2CBLA 1NP8A 1UWOA 3CR5X 3JVTC 3QRXA 1YX7A 2OPOA 1TCOB 3O2PA 4CFQA 3KO0A 4PHJA 1F71A 1WDCB 4PALA 1MWNA 1M31A 3BOWA 1TNWA 1BR1B 2NZ0A 3CLNA 1CLMA 2WCBA 1A4PA 3AKAA 3KHEA 4HREE 2JQ6A 4QJ4B 1TIZA 1M45A 2BCBA 2KBIA 1OMVA 1M63B 4YGEB 2E30A 2PASA 2OS8B 3TDZA 3SJSA 1KK8C 4YRUA 2LMUA 4DS7A 1SR6B 2CNPA 1B4CA 2HPSA 2LMVA 3LCPC 1WY9A 1ALVA 2G2BA 4NDBA 5G08A 4N1FA 4P2YB 5HKWA 3FS7A 4NDCA 1CLLA 3EKHA 2L2EA 1CFCA 5F6TA 2K61A 1Y1AA 1QLKA 3EK4A 4XJKB 3EK7A 1L2OC 3BUMB 4D1EA 4I5NB 4HSZA 2GGZA 2I2RE 1GQMA 1KFXS 1FW4A 4QJ5B 4XJKA 1XFUO 3VRNA 1UP5A 1TTXA 1WRZA 2KI4B 3OP0A 5AFPA 1NPQA 1QLSA 1QV0A 3VGOA 1K93D 1XYDA 3EVRA 1S36A 1XK4A 5PALA 2GV5A 4BY5A 1PULA 3GK2A 1A2XA 3C1VA 1UHHA 2K8MB 1J55A 2MAZA 1NSHA 4NDDA 3D0YB 1MXLC 3K21A 3WXAA 3PN7B 3GOFA 1C7VA 2D8NA 5ER5A 3OHMB 2WCFA 1CM4A 2LUCA 4AQJA 1BR4B 2JT8A 1RFJA 1S3PA 4YI8A 3LL8B 2CTNA 4MSPA 1KK7Z 3BOWB 5ER4X 1NYAA 3RLZA 1DJYA 2KQ6A 4GNKB 5AERA 5AXIA 2BBNA 2JZIA 3OX6A 1OOJA 2TN4A 4ETOA 5CSNA 1SMGA 1MUXA 4YGCB 1ZOTB 4WRIA 1PK0D 2LC5A 1SCVA 5CSFA 2Q91A 2MA2A 2HF5A 1DGUA 5FYXA 3I5FC 3KEVA 2OTGC 2KGRA 4PCWA 4JQ0D 4DIRA 1ZACA 1EG3A 2FCEA 1D1OA 3JTDB 1AJ5A 4ORCB 3CTNA 1CDMA 3SG7A 3A8RA 1QJTA 2BCAA 1KWOC 4GFTA 1B47A 1IJ6A 2ZRSA 4MZLA 3LK0A 4UPGA 2JTZA 3BXKA 1AVSA 4CFRA 1AJ4A 2M3WA 2CT9A 3JTDC 3SG3A 1C07A 3ZNIA 3I5FB 4C0JA 3IF7A 4PE4A 1NCZA 4YBHB 5I2LA 1CLBA 4L9MA 1FPWA 2WOSA 2K7CA 3PFVA 2JXLA 2KYCA 2M29A 4GUKA 1SW8A 3OX5A 2LANA 3BUXB 3TDIA 3VRPA 4MZKA 2K2FA 5DKRA 1YRTB 1TCFA 2BBMA 1MHOA 1RJVA 2KAYA 3TZ1A 1IQ5A 1B8CA 1WLMA 1A29A 1LA0A 1K9UA 2F3ZA 3BQ3A 1DT7B 3EVUA 3DF0B 1M39A 1QATA 2PMYA 2WORA 1DVIA 2BL0B 1EJ3A 2MJWB 3CS1A 2WCEA 4MRYA 3PLFB 1XO5A 2IS9A 5BPJA 1CDNA 4PE7A 3DVJA 5CSJA 3WHUB 1S26D 5IBWA 2PSRA 1K96A 1J7OA 1K8UA 2K7BA 1TNQA 2O5GA 1N0YA 5JOLA 1OMRA 2M9GA 1S6JA 1RECA 2L4IA 1PSRA 3FWCA 2KBMA 3I5GB 2NLNA 1DJIA 2JPTA 1OSAA 4ORBB 4BY4A 2B1UA 2PRUA 1B8RA 1JFKA 2KAXA 1L2OB 1BODA 2I7AA 1B9AA 2JC2A 1RTP1 1KFUL 2LLUA 1G4YR 2LM5A 2LUXA 3CR2A 2HETA 1N65A 1CM1A 4PE1A 1F55A 1RK9A 2AUCA 2JT3A 5HKZA 1QASA 4M2QA 2NXQA 4ICBA 1IKUA 1XFVO 4HRGA 2Y1NA 2AMIA 1QS7A 4GAOA 2PALA 3TUYB 2K0JA 1DF0A 1QVIZ 3KPXA 1AK8A 2KFGA 2P6BB 3GK1A 1SCMB 4ZCUA 2KOTA 1K90D 1LA3A 3PSRA 5HLVA 5JJGA 1BG1A 2DOQA 2LVKA 2PVBA 5DKNA 1OQPA 2LE9B 1IH0A 4AQIA 1B7TY 1G8IA 3M0WA 1MQ1A 1DF0B 2H61A 3I5IC 2HQWA 1JFJA 3F45A 1WRKA 4Q04A 3DVMA 5KSZA 1MR8A 1DJGA 1XFXO 2COLB 2HQ8A 3OB2B 1EXRA 2JNXA 4MBEA 1JUOA 1PALA 1S5GY 3BUNB 5D7FA 3JVTB 1QVIY 1J1EA 1GJYA 1NX3A 1F8HA 3SG4A 3FWBA 2KGBC 4QJ3B 1KFUS 1QXPA 5B8IB 4M2OA 1NX2A 2Q4UA 1KFXL 3EVVA 1XFYO 2Y1MA 1CDPA 2V53A 1LINA 4PHMA 1J7RA 2BE6A 2ZNDA 2JOJA 1AP4A 3I5IB 1IG5A 1J1DA 1CDLA 1NCXA 2K2AA 1IJ5A 2LMTA 3SG6A 4E68A 1JC2A 1AUIB 4JWQA 1DJZA 2KFHA 3DVKA 1IQ3A 1DJWA 2EC6C 5HKYA 1IRJA 4USLA 2M7NA 1XA5A 3TS5B 4YGAA 2MLFC 1SRAA 3EK8A 2JNFA 1GGWA 1BJFA 2L0PA 1F54A 1YVHA 5J3XA 4ZCVA 3MSEB 2KFFA 2KYFA 2LVJA 1NCYA 4DUQA 2KNEA 3CR4X 2BL0C 1CFPA 1QX7A 1S6IA 1ZFSA 2ZFDA 4P5OE 1MXEA 2M7LA 1ZMZA 1F4QA 2M0RA 1GGZA 5D69A 3PATA 1JWDA 4PHNA 1IWQA 2EHBA 2CCMA 2Y4QA 3CWGA 3NSIA 1RWYA 1ALWA 3RM1A 1SNLA 2SCPA 2ZN8A 1A75B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LXF C;  1KQV A;  3O4Y A;  1YUS A;  3IQQ A;  1ODB A;  4GGF A;  1YUU A;  4JPZ B;  1WDC C;  1KQM C;  2LV7 A;  1C7W A;  1M46 A;  4I5K A;  5DKQ A;  3CGA A;  1CTR A;  4AOM A;  5HLO A;  2CXJ A;  2BKI B;  4R1E A;  1SPY A;  2QPT A;  1TN4 A;  2K7D A;  4GGF C;  3NXA A;  3CZT X;  3EKJ A;  2I18 A;  2L51 A;  1KQM B;  2LHL A;  1PVA A;  2L98 A;  2MLE C;  4NQG A;  1EG4 A;  1K9P A;  2BKH B;  1SKT A;  1IGV A;  2MRD A;  2LAP A;  1Y6W A;  2QAC A;  1WLZ A;  2LVI A;  3O6B A;  2ISD A;  1A75 A;  3NSL A;  3AAJ A;  1HQV A;  1SL9 A;  4PE0 A;  2KAV A;  2FOT A;  1BMO A;  5AAN A;  2VRG A;  3SIA A;  3I5H C;  1KCY A;  1UUS A;  2H2K A;  3A4U B;  3AAK A;  1SCM C;  1DJH A;  1K9K A;  1KSO A;  1HT9 A;  5CPV A;  1V1G A;  2G9B A;  3TUY C;  3TDU A;  4CID A;  3O78 A;  3VRO A;  2O60 A;  1TNX A;  1V1F A;  2SAS A;  3IQO A;  2BEC A;  1A03 A;  1N2D A;  1FBV A;  4PDZ A;  1B1G A;  1K94 A;  4MLW A;  1G33 A;  3PN7 C;  1Q80 A;  4WQ2 A;  1YRU B;  1S1E A;  1BT6 A;  1W7J B;  1CFD A;  3VRR A;  1Y1U A;  1QV1 A;  1BLQ A;  1QX2 A;  2KI6 D;  1NUB A;  2K7O A;  4DCK A;  3D0Y A;  1YTZ C;  2LP3 A;  2LHI A;  2LLT A;  2JT0 A;  2OS8 C;  4F0Z B;  3WHT B;  4GBA A;  2KHN A;  3LK1 A;  4ORA B;  4MEW A;  4FTG A;  1J7Q A;  3ZWH A;  1K2H A;  1QIV A;  1JF0 A;  1DGV A;  3E3R A;  1QIW A;  4YI9 A;  2ZRT A;  3OB1 B;  4WQ3 A;  3WNX B;  1XVJ A;  2KI4 C;  3GK4 X;  1Y0V H;  2Y5I A;  1BF5 A;  1Y1X A;  3D10 A;  1YUR A;  2LLS A;  4CPV A;  2RGI A;  1NWD A;  4TNC A;  2LNK A;  2WC8 A;  1B8L A;  1XFW O;  1XK4 C;  2FCD A;  2F8P A;  2GGM A;  4OR9 B;  4OVN F;  1UUR A;  1SK6 D;  2NCO A;  3TS5 C;  1TOP A;  1OZS A;  4FQO A;  3PM8 A;  1PVB A;  1J7P A;  2KQY A;  1SL8 A;  2NCP A;  2H61 C;  4GPL B;  2MHH A;  4M2P A;  1YR5 A;  2EC6 B;  3VRQ A;  1KK8 B;  2KDH A;  1XFZ O;  4OV2 A;  3SG5 A;  4MVF A;  1E8A A;  4OCI A;  2I94 A;  5CSI A;  5KU1 A;  1SBJ A;  2JUL A;  2M1K B;  3BUW B;  1AHR A;  3ICB A;  1PRW A;  3NSO A;  1B7T Z;  1CNP A;  2JRF A;  2L5X B;  1SY9 A;  1UHI A;  1RRO A;  2LCP A;  1TNP A;  1KSM A;  4N5X A;  2L4H A;  4GGN A;  3DD4 A;  2OTG B;  2LVV A;  1YVL A;  1S5G Z;  1LVC D;  3FIA A;  5I8N A;  1JSA A;  4YGB B;  1R6P A;  1NX0 A;  4I5J A;  2M49 B;  1CKK A;  1BOC A;  4YGD B;  3HCM A;  2M97 A;  1FI5 A;  1DTL A;  4MN0 A;  4CLN A;  1W7I B;  2BE4 A;  1CMG A;  1H4B A;  1TRF A;  1CB1 A;  5I2O A;  1SYM A;  2M8U A;  1JF2 A;  2R2I A;  1SL7 A;  3BYA A;  1U5I A;  1QTX A;  1S6C A;  2ZN9 A;  3H4S E;  2LP2 A;  1F70 A;  1L7Z A;  1QX5 B;  1H8B A;  3NSK A;  2JWW A;  3SIB A;  2M1U A;  1EH2 A;  1DJX A;  3PAL A;  4C0L A;  2A4J A;  3SG2 A;  1OZO A;  1K95 A;  1X02 A;  2EGD A;  3LLE A;  1NX1 A;  1UHJ A;  3DF0 A;  4I5L B;  5TNC A;  4DRW A;  4PHK A;  2F3Y A;  4C0K A;  2WND A;  3AKB A;  3BUO B;  1YX8 A;  2F2P A;  1OE9 B;  4U8D A;  2F2O A;  1BU3 A;  1KK7 Y;  1UHK A;  1WRL A;  4MRX A;  4OKH A;  2BCX A;  5HYD A;  1DMO A;  3KF9 A;  5AEQ A;  4A4C A;  4A4B A;  1MF8 B;  5GQQ C;  2ZNE A;  1EL4 A;  1NIW A;  1UHN A;  1ZUZ A;  2L50 A;  2FJU B;  2JTT A;  1U5I B;  1FF1 A;  2KI6 C;  4XYN A;  2MBX A;  3I5H B;  3HX4 A;  1LKJ A;  2AAO A;  1PSB A;  2JU0 A;  2KSP A;  4HRH A;  2ZKM X;  3I5G C;  4IL1 A;  1CMF A;  5I2Q A;  1VRK A;  2E6W A;  1YUT A;  5K89 A;  1FI6 A;  4N1G A;  2JXC A;  2F33 A;  3DVE A;  5KTY A;  1KWO B;  1JBA A;  1SR6 C;  1R2U A;  1F4O A;  1CFF A;  1OMD A;  4MZJ A;  2CBL A;  1NP8 A;  1UWO A;  3CR5 X;  3JVT C;  3QRX A;  1YX7 A;  2OPO A;  1TCO B;  3O2P A;  4CFQ A;  3KO0 A;  4PHJ A;  1F71 A;  1WDC B;  4PAL A;  1MWN A;  1M31 A;  3BOW A;  1TNW A;  1BR1 B;  2NZ0 A;  3CLN A;  1CLM A;  2WCB A;  1A4P A;  3AKA A;  3KHE A;  4HRE E;  2JQ6 A;  4QJ4 B;  1TIZ A;  1M45 A;  2BCB A;  2KBI A;  1OMV A;  1M63 B;  4YGE B;  2E30 A;  2PAS A;  2OS8 B;  3TDZ A;  3SJS A;  1KK8 C;  4YRU A;  2LMU A;  4DS7 A;  1SR6 B;  2CNP A;  1B4C A;  2HPS A;  2LMV A;  3LCP C;  1WY9 A;  1ALV A;  2G2B A;  4NDB A;  5G08 A;  4N1F A;  4P2Y B;  5HKW A;  3FS7 A;  4NDC A;  1CLL A;  3EKH A;  2L2E A;  1CFC A;  5F6T A;  2K61 A;  1Y1A A;  1QLK A;  3EK4 A;  4XJK B;  3EK7 A;  1L2O C;  3BUM B;  4D1E A;  4I5N B;  4HSZ A;  2GGZ A;  2I2R E;  1GQM A;  1KFX S;  1FW4 A;  4QJ5 B;  4XJK A;  1XFU O;  3VRN A;  1UP5 A;  1TTX A;  1WRZ A;  2KI4 B;  3OP0 A;  5AFP A;  1NPQ A;  1QLS A;  1QV0 A;  3VGO A;  1K93 D;  1XYD A;  3EVR A;  1S36 A;  1XK4 A;  5PAL A;  2GV5 A;  4BY5 A;  1PUL A;  3GK2 A;  1A2X A;  3C1V A;  1UHH A;  2K8M B;  1J55 A;  2MAZ A;  1NSH A;  4NDD A;  3D0Y B;  1MXL C;  3K21 A;  3WXA A;  3PN7 B;  3GOF A;  1C7V A;  2D8N A;  5ER5 A;  3OHM B;  2WCF A;  1CM4 A;  2LUC A;  4AQJ A;  1BR4 B;  2JT8 A;  1RFJ A;  1S3P A;  4YI8 A;  3LL8 B;  2CTN A;  4MSP A;  1KK7 Z;  3BOW B;  5ER4 X;  1NYA A;  3RLZ A;  1DJY A;  2KQ6 A;  4GNK B;  5AER A;  5AXI A;  2BBN A;  2JZI A;  3OX6 A;  1OOJ A;  2TN4 A;  4ETO A;  5CSN A;  1SMG A;  1MUX A;  4YGC B;  1ZOT B;  4WRI A;  1PK0 D;  2LC5 A;  1SCV A;  5CSF A;  2Q91 A;  2MA2 A;  2HF5 A;  1DGU A;  5FYX A;  3I5F C;  3KEV A;  2OTG C;  2KGR A;  4PCW A;  4JQ0 D;  4DIR A;  1ZAC A;  1EG3 A;  2FCE A;  1D1O A;  3JTD B;  1AJ5 A;  4ORC B;  3CTN A;  1CDM A;  3SG7 A;  3A8R A;  1QJT A;  2BCA A;  1KWO C;  4GFT A;  1B47 A;  1IJ6 A;  2ZRS A;  4MZL A;  3LK0 A;  4UPG A;  2JTZ A;  3BXK A;  1AVS A;  4CFR A;  1AJ4 A;  2M3W A;  2CT9 A;  3JTD C;  3SG3 A;  1C07 A;  3ZNI A;  3I5F B;  4C0J A;  3IF7 A;  4PE4 A;  1NCZ A;  4YBH B;  5I2L A;  1CLB A;  4L9M A;  1FPW A;  2WOS A;  2K7C A;  3PFV A;  2JXL A;  2KYC A;  2M29 A;  4GUK A;  1SW8 A;  3OX5 A;  2LAN A;  3BUX B;  3TDI A;  3VRP A;  4MZK A;  2K2F A;  5DKR A;  1YRT B;  1TCF A;  2BBM A;  1MHO A;  1RJV A;  2KAY A;  3TZ1 A;  1IQ5 A;  1B8C A;  1WLM A;  1A29 A;  1LA0 A;  1K9U A;  2F3Z A;  3BQ3 A;  1DT7 B;  3EVU A;  3DF0 B;  1M39 A;  1QAT A;  2PMY A;  2WOR A;  1DVI A;  2BL0 B;  1EJ3 A;  2MJW B;  3CS1 A;  2WCE A;  4MRY A;  3PLF B;  1XO5 A;  2IS9 A;  5BPJ A;  1CDN A;  4PE7 A;  3DVJ A;  5CSJ A;  3WHU B;  1S26 D;  5IBW A;  2PSR A;  1K96 A;  1J7O A;  1K8U A;  2K7B A;  1TNQ A;  2O5G A;  1N0Y A;  5JOL A;  1OMR A;  2M9G A;  1S6J A;  1REC A;  2L4I A;  1PSR A;  3FWC A;  2KBM A;  3I5G B;  2NLN A;  1DJI A;  2JPT A;  1OSA A;  4ORB B;  4BY4 A;  2B1U A;  2PRU A;  1B8R A;  1JFK A;  2KAX A;  1L2O B;  1BOD A;  2I7A A;  1B9A A;  2JC2 A;  1RTP 1;  1KFU L;  2LLU A;  1G4Y R;  2LM5 A;  2LUX A;  3CR2 A;  2HET A;  1N65 A;  1CM1 A;  4PE1 A;  1F55 A;  1RK9 A;  2AUC A;  2JT3 A;  5HKZ A;  1QAS A;  4M2Q A;  2NXQ A;  4ICB A;  1IKU A;  1XFV O;  4HRG A;  2Y1N A;  2AMI A;  1QS7 A;  4GAO A;  2PAL A;  3TUY B;  2K0J A;  1DF0 A;  1QVI Z;  3KPX A;  1AK8 A;  2KFG A;  2P6B B;  3GK1 A;  1SCM B;  4ZCU A;  2KOT A;  1K90 D;  1LA3 A;  3PSR A;  5HLV A;  5JJG A;  1BG1 A;  2DOQ A;  2LVK A;  2PVB A;  5DKN A;  1OQP A;  2LE9 B;  1IH0 A;  4AQI A;  1B7T Y;  1G8I A;  3M0W A;  1MQ1 A;  1DF0 B;  2H61 A;  3I5I C;  2HQW A;  1JFJ A;  3F45 A;  1WRK A;  4Q04 A;  3DVM A;  5KSZ A;  1MR8 A;  1DJG A;  1XFX O;  2COL B;  2HQ8 A;  3OB2 B;  1EXR A;  2JNX A;  4MBE A;  1JUO A;  1PAL A;  1S5G Y;  3BUN B;  5D7F A;  3JVT B;  1QVI Y;  1J1E A;  1GJY A;  1NX3 A;  1F8H A;  3SG4 A;  3FWB A;  2KGB C;  4QJ3 B;  1KFU S;  1QXP A;  5B8I B;  4M2O A;  1NX2 A;  2Q4U A;  1KFX L;  3EVV A;  1XFY O;  2Y1M A;  1CDP A;  2V53 A;  1LIN A;  4PHM A;  1J7R A;  2BE6 A;  2ZND A;  2JOJ A;  1AP4 A;  3I5I B;  1IG5 A;  1J1D A;  1CDL A;  1NCX A;  2K2A A;  1IJ5 A;  2LMT A;  3SG6 A;  4E68 A;  1JC2 A;  1AUI B;  4JWQ A;  1DJZ A;  2KFH A;  3DVK A;  1IQ3 A;  1DJW A;  2EC6 C;  5HKY A;  1IRJ A;  4USL A;  2M7N A;  1XA5 A;  3TS5 B;  4YGA A;  2MLF C;  1SRA A;  3EK8 A;  2JNF A;  1GGW A;  1BJF A;  2L0P A;  1F54 A;  1YVH A;  5J3X A;  4ZCV A;  3MSE B;  2KFF A;  2KYF A;  2LVJ A;  1NCY A;  4DUQ A;  2KNE A;  3CR4 X;  2BL0 C;  1CFP A;  1QX7 A;  1S6I A;  1ZFS A;  2ZFD A;  4P5O E;  1MXE A;  2M7L A;  1ZMZ A;  1F4Q A;  2M0R A;  1GGZ A;  5D69 A;  3PAT A;  1JWD A;  4PHN A;  1IWQ A;  2EHB A;  2CCM A;  2Y4Q A;  3CWG A;  3NSI A;  1RWY A;  1ALW A;  3RM1 A;  1SNL A;  2SCP A;  2ZN8 A;  1A75 B; 
#chains in the Genus database with same CATH topology
 1LXF C;  1KQV A;  3O4Y A;  1YUS A;  3IQQ A;  1ODB A;  4GGF A;  1YUU A;  4JPZ B;  1GM0 A;  1WDC C;  1KQM C;  2LV7 A;  1C7W A;  2WCL A;  1M46 A;  4I5K A;  5DKQ A;  3CGA A;  1CTR A;  4AOM A;  5HLO A;  2CXJ A;  2BKI B;  4R1E A;  1SPY A;  2QPT A;  1TN4 A;  2K7D A;  4GGF C;  3NXA A;  3CZT X;  3EKJ A;  1DC1 A;  2I18 A;  2L51 A;  1KQM B;  2LHL A;  1PVA A;  3QME A;  2L98 A;  2MLE C;  4NQG A;  1EG4 A;  1K9P A;  2BKH B;  3BFA A;  1SKT A;  2KLE A;  1IGV A;  2MRD A;  2LAP A;  3PJI A;  1Y6W A;  2QAC A;  1WLZ A;  2LVI A;  3O6B A;  2ISD A;  1A75 A;  3NSL A;  3AAJ A;  1HQV A;  1SL9 A;  4PE0 A;  3CDN A;  3D77 A;  2KAV A;  2FOT A;  1BMO A;  5AAN A;  2VRG A;  1DEL A;  3I5H C;  3SIA A;  1KCY A;  1UUS A;  2H2K A;  3A4U B;  3AAK A;  1SCM C;  1DJH A;  1K9K A;  1KSO A;  1HT9 A;  5CPV A;  1V1G A;  1TWO A;  2G9B A;  3TUY C;  3TDU A;  4CID A;  3O78 A;  3VRO A;  2O60 A;  1TNX A;  1V1F A;  2SAS A;  3BJH A;  2BEC A;  3IQO A;  1A03 A;  3NGV A;  1N2D A;  1FBV A;  3PM2 A;  4PDZ A;  1K94 A;  4MLW A;  1B1G A;  1G33 A;  3PN7 C;  1Q80 A;  4WQ2 A;  3CYZ A;  1YRU B;  1S1E A;  1BT6 A;  1W7J B;  1TUZ A;  1CFD A;  3VRR A;  1Y1U A;  1QV1 A;  1BLQ A;  1QX2 A;  2KI6 D;  1NUB A;  2K7O A;  4DCK A;  3D0Y A;  1YTZ C;  2LP3 A;  4JKT A;  2LHI A;  2LLT A;  2JT0 A;  2OS8 C;  4F0Z B;  3WHT B;  4GBA A;  2KHN A;  3B7A A;  3LK1 A;  3L4L A;  4MEW A;  4FTG A;  4ORA B;  3SS5 A;  1J7Q A;  3ZWH A;  1K2H A;  3S0A A;  1QIV A;  1JF0 A;  1DGV A;  3E3R A;  1QIW A;  2JPO A;  4YI9 A;  2ZRT A;  3OB1 B;  4WQ3 A;  3WNX B;  1XVJ A;  2KI4 C;  3GK4 X;  1Y0V H;  2Y5I A;  1BF5 A;  1Y1X A;  3D10 A;  1YUR A;  2LLS A;  4CPV A;  5EL2 A;  2RGI A;  1NWD A;  4TNC A;  2LNK A;  3B88 A;  2WC8 A;  1B8L A;  4INW A;  1XFW O;  1XK4 C;  2FCD A;  2F8P A;  2GGM A;  2YGU A;  4OR9 B;  4OVN F;  1UUR A;  1SK6 D;  2NCO A;  2K60 A;  5I94 A;  3TS5 C;  1TOP A;  1OZS A;  3D75 A;  3PM8 A;  1PVB A;  4FQO A;  1C3Z A;  1J7P A;  2KQY A;  1SL8 A;  2NCP A;  3B6X A;  2H61 C;  4GPL B;  2MHH A;  4M2P A;  1YR5 A;  2EC6 B;  3VRQ A;  1KK8 B;  2KDH A;  1XFZ O;  4OV2 A;  3SG5 A;  3DXL A;  4MVF A;  1E8A A;  4OCI A;  2I94 A;  5CSI A;  5KU1 A;  1SBJ A;  2JUL A;  2M1K B;  3BUW B;  1AHR A;  3ICB A;  1PRW A;  3IVT A;  3NSO A;  1B7T Z;  1CNP A;  1OOI X;  2JRF A;  2L5X B;  1SY9 A;  1UHI A;  1RRO A;  2QEO A;  2LCP A;  4FQT A;  3R1O A;  1TNP A;  1C3Y A;  1KSM A;  4N5X A;  3R72 A;  2L4H A;  4GGN A;  3DD4 A;  2L2C A;  2OTG B;  2LVV A;  5D3O A;  1YVL A;  1S5G Z;  1LVC D;  3FIA A;  5I8N A;  1JSA A;  4YGB B;  1R6P A;  1NX0 A;  4I5J A;  2M49 B;  2PYQ A;  1CKK A;  4YGD B;  1BOC A;  3HCM A;  2M97 A;  1FI5 A;  1DTL A;  3K1E A;  4MN0 A;  4CLN A;  1W7I B;  2BE4 A;  1CMG A;  1H4B A;  1TRF A;  3OGN A;  5I2O A;  1CB1 A;  1SYM A;  2M8U A;  1JF2 A;  2R2I A;  1SL7 A;  3BYA A;  1U5I A;  1QTX A;  3FE6 A;  1S6C A;  2ZN9 A;  1DEK A;  3H4S E;  2LP2 A;  1F70 A;  1L7Z A;  1QX5 B;  1H8B A;  3NSK A;  2JWW A;  3SIB A;  2M1U A;  1EH2 A;  1DJX A;  3PAL A;  4C0L A;  2A4J A;  3SG2 A;  1OZO A;  1K95 A;  1DQE A;  1X02 A;  2EGD A;  1NX1 A;  1UHJ A;  3DF0 A;  3LLE A;  4I5L B;  3N7H A;  4DRW A;  1Z2C B;  4PHK A;  2F3Y A;  3CZ1 A;  4C0K A;  2WND A;  3AKB A;  2FJY A;  3BUO B;  1YX8 A;  5FI7 A;  1OE9 B;  2F2P A;  4U8D A;  2F2O A;  1BU3 A;  1KK7 Y;  1UHK A;  1WRL A;  4MRX A;  4OKH A;  2BCX A;  5HYD A;  1DMO A;  3KF9 A;  5AEQ A;  4A4C A;  4A4B A;  1MF8 B;  3O4X A;  3NHI A;  5GQQ C;  2ZNE A;  1EL4 A;  1NIW A;  1UHN A;  3FE8 A;  1ZUZ A;  2L50 A;  2FJU B;  2JTT A;  1U5I B;  1FF1 A;  2KI6 C;  4XYN A;  2MBX A;  3DZT A;  3S0E A;  1P28 A;  3I5H B;  3HX4 A;  1LKJ A;  2AAO A;  1PSB A;  2JU0 A;  2KSP A;  3SS4 A;  4HRH A;  2ZKM X;  3I5G C;  4IL1 A;  1CMF A;  1OW4 A;  5I2Q A;  1VRK A;  2E6W A;  1YUT A;  5K89 A;  1FI6 A;  4N1G A;  3V2L A;  1IIO A;  2JXC A;  3S0B A;  2F33 A;  3DVE A;  5KTY A;  1KWO B;  1JBA A;  2WCJ A;  1SR6 C;  1R2U A;  1F4O A;  1CFF A;  1OMD A;  4MZJ A;  2CBL A;  1NP8 A;  1UWO A;  3CR5 X;  3JVT C;  3QRX A;  5FI2 A;  1YX7 A;  3L4A A;  2OPO A;  1TCO B;  3O2P A;  4KYN A;  4CFQ A;  3KO0 A;  2P70 A;  4PHJ A;  1OOH A;  1F71 A;  1WDC B;  4PAL A;  1MWN A;  1M31 A;  2P71 A;  3BOW A;  1TNW A;  1BR1 B;  2NZ0 A;  3CLN A;  1CLM A;  2WCB A;  1A4P A;  3AKA A;  3KHE A;  4HRE E;  2JQ6 A;  4QJ4 B;  1TIZ A;  1M45 A;  2BCB A;  2KBI A;  1OMV A;  1M63 B;  4YGE B;  2E30 A;  2PAS A;  2OS8 B;  3TDZ A;  3SJS A;  1KK8 C;  4YRU A;  2LMU A;  4DS7 A;  1SR6 B;  2H8V A;  2CNP A;  3S0F A;  1B4C A;  2HPS A;  2LMV A;  2WC6 A;  3LCP C;  1WY9 A;  1ALV A;  2G2B A;  4NDB A;  5G08 A;  4N1F A;  4P2Y B;  4PT1 A;  5HKW A;  3FS7 A;  4NDC A;  1CLL A;  3EKH A;  2L2E A;  1CFC A;  5F6T A;  2K61 A;  3CAB A;  1W9Z A;  5HL1 A;  1Y1A A;  1SSE B;  1QLK A;  2KPH A;  3R1P A;  3EK4 A;  4XJK B;  3EK7 A;  1L2O C;  3BUM B;  4D1E A;  4I5N B;  4HSZ A;  2GGZ A;  2I2R E;  1GQM A;  1KFX S;  1FW4 A;  4QJ5 B;  4XJK A;  1XFU O;  3VRN A;  1UP5 A;  1TTX A;  1WRZ A;  2PQL A;  2KI4 B;  3FE9 A;  3OP0 A;  5AFP A;  1NPQ A;  1QLS A;  3SS3 A;  1QV0 A;  3VGO A;  3B87 A;  3DY9 A;  1K93 D;  1XYD A;  3EVR A;  2WCH A;  1S36 A;  1XK4 A;  4INX A;  2GV5 A;  5PAL A;  4BY5 A;  1PUL A;  2BNX A;  3GK2 A;  1A2X A;  3C1V A;  1UHH A;  2K8M B;  1J55 A;  2MAZ A;  1NSH A;  3R1V A;  3D0Y B;  4NDD A;  1MXL C;  3K21 A;  3WXA A;  3PN7 B;  3GOF A;  1C7V A;  2D8N A;  2ERB A;  4JD9 A;  5ER5 A;  3OHM B;  2WCF A;  1CM4 A;  2LUC A;  4AQJ A;  1BR4 B;  2JT8 A;  1RFJ A;  1S3P A;  4YI8 A;  5DIC A;  1OOG A;  2CTN A;  3LL8 B;  4MSP A;  1KK7 Z;  3BOW B;  5ER4 X;  1NYA A;  3RLZ A;  1DJY A;  2KQ6 A;  4GNK B;  5AER A;  5AXI A;  1ORG A;  2BBN A;  2JZI A;  3OX6 A;  1OOJ A;  2TN4 A;  4ETO A;  5TNC A;  5CSN A;  1SMG A;  1MUX A;  4YGC B;  1ZOT B;  4WRI A;  1PK0 D;  2LC5 A;  1SCV A;  5CSF A;  2Q91 A;  2MA2 A;  2HF5 A;  1DGU A;  2BAP A;  5FYX A;  2GTE A;  3I5F C;  3KEV A;  2OTG C;  2KGR A;  4PCW A;  4JQ0 D;  4DIR A;  1ZAC A;  1EG3 A;  2FCE A;  3OBV A;  1D1O A;  3JTD B;  1AJ5 A;  4ORC B;  3CTN A;  1CDM A;  3SG7 A;  3A8R A;  1QJT A;  2BCA A;  1KWO C;  4GFT A;  1B47 A;  1IJ6 A;  2ZRS A;  4MZL A;  3VB1 A;  3LK0 A;  4UPG A;  2JTZ A;  3BXK A;  1AVS A;  4CFR A;  1AJ4 A;  2M3W A;  2CT9 A;  3JTD C;  3SG3 A;  1C07 A;  3ZNI A;  3I5F B;  4C0J A;  1OOF A;  3IF7 A;  1NCZ A;  4PE4 A;  4YBH B;  5I2L A;  4L9M A;  1CLB A;  2WOS A;  1FPW A;  3B86 A;  2K7C A;  3PFV A;  2JXL A;  2KYC A;  2M29 A;  3S0G A;  4GUK A;  1SW8 A;  1Z4H A;  3OX5 A;  2LAN A;  3BUX B;  3TDI A;  3VRP A;  4MZK A;  2K2F A;  5DKR A;  1YRT B;  1TCF A;  2BBM A;  1MHO A;  3CZ0 A;  1RJV A;  2KAY A;  3TZ1 A;  1IQ5 A;  1B8C A;  1WLM A;  1A29 A;  3D78 A;  1LA0 A;  1K9U A;  2F3Z A;  3BQ3 A;  1DT7 B;  3EVU A;  3DF0 B;  1M39 A;  1QAT A;  2PMY A;  2WOR A;  1DVI A;  2BL0 B;  2WCK A;  1EJ3 A;  3L47 A;  2MJW B;  3CS1 A;  2WCE A;  4MRY A;  3PLF B;  1XO5 A;  2IS9 A;  5BPJ A;  1CDN A;  4PE7 A;  3DVJ A;  5CSJ A;  3WHU B;  1S26 D;  5IBW A;  2PSR A;  1K96 A;  1J7O A;  1K8U A;  2K7B A;  1TNQ A;  2O5G A;  1N0Y A;  5JOL A;  1OMR A;  2M9G A;  1S6J A;  1REC A;  2L4I A;  1PSR A;  3FWC A;  2KBM A;  3I5G B;  2NLN A;  1DJI A;  2JPT A;  1OSA A;  4ORB B;  4BY4 A;  4F7F A;  2B1U A;  2PRU A;  1B8R A;  1JFK A;  2KAX A;  3RZS A;  1L2O B;  1BOD A;  2I7A A;  1B9A A;  2JC2 A;  1RTP 1;  1KFU L;  2LLU A;  1G4Y R;  2LM5 A;  2LUX A;  2WCM A;  3CR2 A;  2HET A;  1N65 A;  1CM1 A;  4PE1 A;  1F55 A;  1RK9 A;  3D74 A;  2AUC A;  2JT3 A;  5HKZ A;  1QAS A;  4M2Q A;  2KLD A;  5FI6 A;  2NXQ A;  4ICB A;  1IKU A;  1XFV O;  4HRG A;  2Y1N A;  2AMI A;  1QS7 A;  2WC5 A;  4GAO A;  1LS8 A;  2PAL A;  3TUY B;  2K0J A;  1DF0 A;  1QVI Z;  3KPX A;  3UO9 A;  2KFG A;  1AK8 A;  2P6B B;  3GK1 A;  1SCM B;  4ZCU A;  2KOT A;  1K90 D;  1LA3 A;  3PSR A;  5HLV A;  5JJG A;  1BG1 A;  2DOQ A;  2LVK A;  2PVB A;  5DKN A;  1OQP A;  2LE9 B;  3NHT A;  1IH0 A;  4AQI A;  1B7T Y;  1G8I A;  3M0W A;  1MQ1 A;  1DF0 B;  2H61 A;  3I5I C;  2HQW A;  1JFJ A;  3F45 A;  3S0D A;  1WRK A;  4Q04 A;  3DVM A;  5KSZ A;  1MR8 A;  1DJG A;  1XFX O;  2COL B;  2HQ8 A;  3OB2 B;  1EXR A;  2JNX A;  4MBE A;  1JUO A;  1TUJ A;  1PAL A;  1S5G Y;  3BUN B;  5D7F A;  3JVT B;  4OZD A;  1QVI Y;  1J1E A;  2QEH A;  1GJY A;  1NX3 A;  1F8H A;  3SG4 A;  3FWB A;  3D76 A;  2KGB C;  4QJ3 B;  1KFU S;  1QXP A;  5B8I B;  4M2O A;  1NX2 A;  2Q4U A;  1KFX L;  3EVV A;  1XFY O;  2Y1M A;  1CDP A;  2V53 A;  1LIN A;  3EG5 B;  4PHM A;  3UNW A;  1J7R A;  2BE6 A;  2ZND A;  2JOJ A;  1AP4 A;  3I5I B;  1IG5 A;  1J1D A;  1XFR A;  1CDL A;  1NCX A;  2K2A A;  1IJ5 A;  2LMT A;  3SG6 A;  4E68 A;  1JC2 A;  1AUI B;  4JWQ A;  1DJZ A;  2KFH A;  3DVK A;  1IQ3 A;  1T14 A;  1DJW A;  2EC6 C;  2QEV A;  5HKY A;  1IRJ A;  3BFH A;  4USL A;  2L5Y A;  2M7N A;  1XA5 A;  3TS5 B;  4YGA A;  2MLF C;  1SRA A;  3EK8 A;  3DYE A;  2JNF A;  3BFB A;  1GGW A;  1BJF A;  2L0P A;  1F54 A;  1YVH A;  5J3X A;  1QWV A;  3Q8I A;  3MSE B;  2KFF A;  2KYF A;  4ZCV A;  2LVJ A;  1NCY A;  4DUQ A;  2KNE A;  3CR4 X;  2BL0 C;  1CFP A;  1QX7 A;  1S6I A;  1ZFS A;  2ZFD A;  4P5O E;  1MXE A;  2M7L A;  1ZMZ A;  1F4Q A;  2M0R A;  1GGZ A;  5D69 A;  3CZ2 A;  3PAT A;  1JWD A;  4PHN A;  1IWQ A;  2EHB A;  2QDI A;  2CCM A;  3D73 A;  2Y4Q A;  3CWG A;  3NSI A;  1RWY A;  1ALW A;  4IJ7 A;  3RM1 A;  2QEB A;  1SNL A;  2SCP A;  2ZN8 A;  1A75 B; 
#chains in the Genus database with same CATH homology
 1LXF C;  1KQV A;  3O4Y A;  1YUS A;  3IQQ A;  1ODB A;  4GGF A;  1YUU A;  4JPZ B;  1WDC C;  1KQM C;  2LV7 A;  1C7W A;  1M46 A;  4I5K A;  5DKQ A;  3CGA A;  1CTR A;  4AOM A;  5HLO A;  2CXJ A;  2BKI B;  4R1E A;  1SPY A;  2QPT A;  1TN4 A;  2K7D A;  4GGF C;  3NXA A;  3CZT X;  3EKJ A;  2I18 A;  2L51 A;  1KQM B;  2LHL A;  1PVA A;  2L98 A;  2MLE C;  4NQG A;  1EG4 A;  1K9P A;  2BKH B;  1SKT A;  1IGV A;  2MRD A;  2LAP A;  1Y6W A;  2QAC A;  1WLZ A;  2LVI A;  3O6B A;  2ISD A;  1A75 A;  3NSL A;  3AAJ A;  1HQV A;  1SL9 A;  4PE0 A;  2KAV A;  2FOT A;  1BMO A;  5AAN A;  2VRG A;  3SIA A;  3I5H C;  1KCY A;  1UUS A;  2H2K A;  3A4U B;  3AAK A;  1SCM C;  1DJH A;  1K9K A;  1KSO A;  1HT9 A;  5CPV A;  1V1G A;  2G9B A;  3TUY C;  3TDU A;  4CID A;  3O78 A;  3VRO A;  2O60 A;  1TNX A;  1V1F A;  2SAS A;  3IQO A;  2BEC A;  1A03 A;  1N2D A;  1FBV A;  4PDZ A;  1B1G A;  1K94 A;  4MLW A;  1G33 A;  3PN7 C;  1Q80 A;  4WQ2 A;  1YRU B;  1S1E A;  1BT6 A;  1W7J B;  1CFD A;  3VRR A;  1Y1U A;  1QV1 A;  1BLQ A;  1QX2 A;  2KI6 D;  1NUB A;  2K7O A;  4DCK A;  3D0Y A;  1YTZ C;  2LP3 A;  2LHI A;  2LLT A;  2JT0 A;  2OS8 C;  4F0Z B;  3WHT B;  4GBA A;  2KHN A;  3LK1 A;  4ORA B;  4MEW A;  4FTG A;  1J7Q A;  3ZWH A;  1K2H A;  1QIV A;  1JF0 A;  1DGV A;  3E3R A;  1QIW A;  4YI9 A;  2ZRT A;  3OB1 B;  4WQ3 A;  3WNX B;  1XVJ A;  2KI4 C;  3GK4 X;  1Y0V H;  2Y5I A;  1BF5 A;  1Y1X A;  3D10 A;  1YUR A;  2LLS A;  4CPV A;  2RGI A;  1NWD A;  4TNC A;  2LNK A;  2WC8 A;  1B8L A;  1XFW O;  1XK4 C;  2FCD A;  2F8P A;  2GGM A;  4OR9 B;  4OVN F;  1UUR A;  1SK6 D;  2NCO A;  3TS5 C;  1TOP A;  1OZS A;  4FQO A;  3PM8 A;  1PVB A;  1J7P A;  2KQY A;  1SL8 A;  2NCP A;  2H61 C;  4GPL B;  2MHH A;  4M2P A;  1YR5 A;  2EC6 B;  3VRQ A;  1KK8 B;  2KDH A;  1XFZ O;  4OV2 A;  3SG5 A;  4MVF A;  1E8A A;  4OCI A;  2I94 A;  5CSI A;  5KU1 A;  1SBJ A;  2JUL A;  2M1K B;  3BUW B;  1AHR A;  3ICB A;  1PRW A;  3NSO A;  1B7T Z;  1CNP A;  2JRF A;  2L5X B;  1SY9 A;  1UHI A;  1RRO A;  2LCP A;  1TNP A;  1KSM A;  4N5X A;  2L4H A;  4GGN A;  3DD4 A;  2OTG B;  2LVV A;  1YVL A;  1S5G Z;  1LVC D;  3FIA A;  5I8N A;  1JSA A;  4YGB B;  1R6P A;  1NX0 A;  4I5J A;  2M49 B;  1CKK A;  1BOC A;  4YGD B;  3HCM A;  2M97 A;  1FI5 A;  1DTL A;  4MN0 A;  4CLN A;  1W7I B;  2BE4 A;  1CMG A;  1H4B A;  1TRF A;  1CB1 A;  5I2O A;  1SYM A;  2M8U A;  1JF2 A;  2R2I A;  1SL7 A;  3BYA A;  1U5I A;  1QTX A;  1S6C A;  2ZN9 A;  3H4S E;  2LP2 A;  1F70 A;  1L7Z A;  1QX5 B;  1H8B A;  3NSK A;  2JWW A;  3SIB A;  2M1U A;  1EH2 A;  1DJX A;  3PAL A;  4C0L A;  2A4J A;  3SG2 A;  1OZO A;  1K95 A;  1X02 A;  2EGD A;  3LLE A;  1NX1 A;  1UHJ A;  3DF0 A;  4I5L B;  5TNC A;  4DRW A;  4PHK A;  2F3Y A;  4C0K A;  2WND A;  3AKB A;  3BUO B;  1YX8 A;  2F2P A;  1OE9 B;  4U8D A;  2F2O A;  1BU3 A;  1KK7 Y;  1UHK A;  1WRL A;  4MRX A;  4OKH A;  2BCX A;  5HYD A;  1DMO A;  3KF9 A;  5AEQ A;  4A4C A;  4A4B A;  1MF8 B;  5GQQ C;  2ZNE A;  1EL4 A;  1NIW A;  1UHN A;  1ZUZ A;  2L50 A;  2FJU B;  2JTT A;  1U5I B;  1FF1 A;  2KI6 C;  4XYN A;  2MBX A;  3I5H B;  3HX4 A;  1LKJ A;  2AAO A;  1PSB A;  2JU0 A;  2KSP A;  4HRH A;  2ZKM X;  3I5G C;  4IL1 A;  1CMF A;  5I2Q A;  1VRK A;  2E6W A;  1YUT A;  5K89 A;  1FI6 A;  4N1G A;  2JXC A;  2F33 A;  3DVE A;  5KTY A;  1KWO B;  1JBA A;  1SR6 C;  1R2U A;  1F4O A;  1CFF A;  1OMD A;  4MZJ A;  2CBL A;  1NP8 A;  1UWO A;  3CR5 X;  3JVT C;  3QRX A;  1YX7 A;  2OPO A;  1TCO B;  3O2P A;  4CFQ A;  3KO0 A;  4PHJ A;  1F71 A;  1WDC B;  4PAL A;  1MWN A;  1M31 A;  3BOW A;  1TNW A;  1BR1 B;  2NZ0 A;  3CLN A;  1CLM A;  2WCB A;  1A4P A;  3AKA A;  3KHE A;  4HRE E;  2JQ6 A;  4QJ4 B;  1TIZ A;  1M45 A;  2BCB A;  2KBI A;  1OMV A;  1M63 B;  4YGE B;  2E30 A;  2PAS A;  2OS8 B;  3TDZ A;  3SJS A;  1KK8 C;  4YRU A;  2LMU A;  4DS7 A;  1SR6 B;  2CNP A;  1B4C A;  2HPS A;  2LMV A;  3LCP C;  1WY9 A;  1ALV A;  2G2B A;  4NDB A;  5G08 A;  4N1F A;  4P2Y B;  5HKW A;  3FS7 A;  4NDC A;  1CLL A;  3EKH A;  2L2E A;  1CFC A;  5F6T A;  2K61 A;  1Y1A A;  1QLK A;  3EK4 A;  4XJK B;  3EK7 A;  1L2O C;  3BUM B;  4D1E A;  4I5N B;  4HSZ A;  2GGZ A;  2I2R E;  1GQM A;  1KFX S;  1FW4 A;  4QJ5 B;  4XJK A;  1XFU O;  3VRN A;  1UP5 A;  1TTX A;  1WRZ A;  2KI4 B;  3OP0 A;  5AFP A;  1NPQ A;  1QLS A;  1QV0 A;  3VGO A;  1K93 D;  1XYD A;  3EVR A;  1S36 A;  1XK4 A;  5PAL A;  2GV5 A;  4BY5 A;  1PUL A;  3GK2 A;  1A2X A;  3C1V A;  1UHH A;  2K8M B;  1J55 A;  2MAZ A;  1NSH A;  4NDD A;  3D0Y B;  1MXL C;  3K21 A;  3WXA A;  3PN7 B;  3GOF A;  1C7V A;  2D8N A;  5ER5 A;  3OHM B;  2WCF A;  1CM4 A;  2LUC A;  4AQJ A;  1BR4 B;  2JT8 A;  1RFJ A;  1S3P A;  4YI8 A;  3LL8 B;  2CTN A;  4MSP A;  1KK7 Z;  3BOW B;  5ER4 X;  1NYA A;  3RLZ A;  1DJY A;  2KQ6 A;  4GNK B;  5AER A;  5AXI A;  2BBN A;  2JZI A;  3OX6 A;  1OOJ A;  2TN4 A;  4ETO A;  5CSN A;  1SMG A;  1MUX A;  4YGC B;  1ZOT B;  4WRI A;  1PK0 D;  2LC5 A;  1SCV A;  5CSF A;  2Q91 A;  2MA2 A;  2HF5 A;  1DGU A;  5FYX A;  3I5F C;  3KEV A;  2OTG C;  2KGR A;  4PCW A;  4JQ0 D;  4DIR A;  1ZAC A;  1EG3 A;  2FCE A;  1D1O A;  3JTD B;  1AJ5 A;  4ORC B;  3CTN A;  1CDM A;  3SG7 A;  3A8R A;  1QJT A;  2BCA A;  1KWO C;  4GFT A;  1B47 A;  1IJ6 A;  2ZRS A;  4MZL A;  3LK0 A;  4UPG A;  2JTZ A;  3BXK A;  1AVS A;  4CFR A;  1AJ4 A;  2M3W A;  2CT9 A;  3JTD C;  3SG3 A;  1C07 A;  3ZNI A;  3I5F B;  4C0J A;  3IF7 A;  4PE4 A;  1NCZ A;  4YBH B;  5I2L A;  1CLB A;  4L9M A;  1FPW A;  2WOS A;  2K7C A;  3PFV A;  2JXL A;  2KYC A;  2M29 A;  4GUK A;  1SW8 A;  3OX5 A;  2LAN A;  3BUX B;  3TDI A;  3VRP A;  4MZK A;  2K2F A;  5DKR A;  1YRT B;  1TCF A;  2BBM A;  1MHO A;  1RJV A;  2KAY A;  3TZ1 A;  1IQ5 A;  1B8C A;  1WLM A;  1A29 A;  1LA0 A;  1K9U A;  2F3Z A;  3BQ3 A;  1DT7 B;  3EVU A;  3DF0 B;  1M39 A;  1QAT A;  2PMY A;  2WOR A;  1DVI A;  2BL0 B;  1EJ3 A;  2MJW B;  3CS1 A;  2WCE A;  4MRY A;  3PLF B;  1XO5 A;  2IS9 A;  5BPJ A;  1CDN A;  4PE7 A;  3DVJ A;  5CSJ A;  3WHU B;  1S26 D;  5IBW A;  2PSR A;  1K96 A;  1J7O A;  1K8U A;  2K7B A;  1TNQ A;  2O5G A;  1N0Y A;  5JOL A;  1OMR A;  2M9G A;  1S6J A;  1REC A;  2L4I A;  1PSR A;  3FWC A;  2KBM A;  3I5G B;  2NLN A;  1DJI A;  2JPT A;  1OSA A;  4ORB B;  4BY4 A;  2B1U A;  2PRU A;  1B8R A;  1JFK A;  2KAX A;  1L2O B;  1BOD A;  2I7A A;  1B9A A;  2JC2 A;  1RTP 1;  1KFU L;  2LLU A;  1G4Y R;  2LM5 A;  2LUX A;  3CR2 A;  2HET A;  1N65 A;  1CM1 A;  4PE1 A;  1F55 A;  1RK9 A;  2AUC A;  2JT3 A;  5HKZ A;  1QAS A;  4M2Q A;  2NXQ A;  4ICB A;  1IKU A;  1XFV O;  4HRG A;  2Y1N A;  2AMI A;  1QS7 A;  4GAO A;  2PAL A;  3TUY B;  2K0J A;  1DF0 A;  1QVI Z;  3KPX A;  1AK8 A;  2KFG A;  2P6B B;  3GK1 A;  1SCM B;  4ZCU A;  2KOT A;  1K90 D;  1LA3 A;  3PSR A;  5HLV A;  5JJG A;  1BG1 A;  2DOQ A;  2LVK A;  2PVB A;  5DKN A;  1OQP A;  2LE9 B;  1IH0 A;  4AQI A;  1B7T Y;  1G8I A;  3M0W A;  1MQ1 A;  1DF0 B;  2H61 A;  3I5I C;  2HQW A;  1JFJ A;  3F45 A;  1WRK A;  4Q04 A;  3DVM A;  5KSZ A;  1MR8 A;  1DJG A;  1XFX O;  2COL B;  2HQ8 A;  3OB2 B;  1EXR A;  2JNX A;  4MBE A;  1JUO A;  1PAL A;  1S5G Y;  3BUN B;  5D7F A;  3JVT B;  1QVI Y;  1J1E A;  1GJY A;  1NX3 A;  1F8H A;  3SG4 A;  3FWB A;  2KGB C;  4QJ3 B;  1KFU S;  1QXP A;  5B8I B;  4M2O A;  1NX2 A;  2Q4U A;  1KFX L;  3EVV A;  1XFY O;  2Y1M A;  1CDP A;  2V53 A;  1LIN A;  4PHM A;  1J7R A;  2BE6 A;  2ZND A;  2JOJ A;  1AP4 A;  3I5I B;  1IG5 A;  1J1D A;  1CDL A;  1NCX A;  2K2A A;  1IJ5 A;  2LMT A;  3SG6 A;  4E68 A;  1JC2 A;  1AUI B;  4JWQ A;  1DJZ A;  2KFH A;  3DVK A;  1IQ3 A;  1DJW A;  2EC6 C;  5HKY A;  1IRJ A;  4USL A;  2M7N A;  1XA5 A;  3TS5 B;  4YGA A;  2MLF C;  1SRA A;  3EK8 A;  2JNF A;  1GGW A;  1BJF A;  2L0P A;  1F54 A;  1YVH A;  5J3X A;  4ZCV A;  3MSE B;  2KFF A;  2KYF A;  2LVJ A;  1NCY A;  4DUQ A;  2KNE A;  3CR4 X;  2BL0 C;  1CFP A;  1QX7 A;  1S6I A;  1ZFS A;  2ZFD A;  4P5O E;  1MXE A;  2M7L A;  1ZMZ A;  1F4Q A;  2M0R A;  1GGZ A;  5D69 A;  3PAT A;  1JWD A;  4PHN A;  1IWQ A;  2EHB A;  2CCM A;  2Y4Q A;  3CWG A;  3NSI A;  1RWY A;  1ALW A;  3RM1 A;  1SNL A;  2SCP A;  2ZN8 A;  1A75 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...