1LA0A

Solution structure of calcium saturated cardiac troponin c in the troponin c-troponin i complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
161
structure length
161
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Solution Structure of Calcium-Saturated Cardiac Troponin C bound to cardiac Troponin I.
pubmed doi rcsb
source organism Gallus gallus
total genus 25
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2002-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1la0A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1la0A02
2FCDA 1YR5A 1JUOA 1N0YA 2JOJA 3ZWHA 1QJTA 1SCMB 2ZN8A 3SG6A 3EVUA 4M2PA 1LKJA 2L0PA 1FPWA 3AKAA 1B8RA 1SYMA 2KI6D 3LL8B 2V53A 2WCFA 1MXLC 4BY4A 2L51A 1YURA 1RK9A 1NX1A 2LP2A 1Y0VH 1ALVA 4GNKB 2KNEA 2L2EA 1TRFA 1SCMC 1WLZA 3TDUA 1CMGA 2DOQA 4HRGA 1B7TY 4DIRA 1SNLA 2WC8A 3CLNA 1DJWA 2JC2A 4PALA 1JF2A 1C7WA 1A29A 1PSRA 2H61C 1A03A 1EJ3A 1WLMA 5KTYA 2GGMA 1BMOA 3DVMA 3OB2B 5PALA 3EKHA 3SG2A 3E3RA 2ZN9A 2COLB 2LM5A 1RROA 3TZ1A 1ZFSA 3BYAA 4CFRA 1SL8A 1OMRA 5G08A 3AAKA 1V1FA 2PSRA 1SK6D 3VRQA 1Q80A 1F4QA 1S5GY 1NPQA 1NSHA 3NSLA 2O5GA 2I2RE 1YTZC 4M2OA 4PE4A 2P6BB 4PDZA 2HETA 1C7VA 3VRRA 1M46A 5JJGA 1DT7B 3BUNB 1N65A 2JQ6A 2WCBA 1SMGA 2LANA 1UHKA 2M1UA 3BOWA 3I5IB 4N1FA 1BODA 1JBAA 1KK8B 1FI5A 1BJFA 2JNFA 1NUBA 2LVJA 2LNKA 2WCEA 1MUXA 1MQ1A 3BUOB 1SKTA 2FCEA 2LMTA 1J7PA 1BF5A 3WXAA 2LE9B 2BE4A 1WRZA 2OTGC 4R1EA 5ER5A 2JNXA 3ICBA 2LUXA 1YUSA 1DGUA 1JFKA 2KYCA 2EC6B 3I5IC 1PALA 1UHJA 3A8RA 3DVEA 1F71A 1KK8C 2F3YA 2JPTA 4F0ZB 3DVKA 1UUSA 2M3WA 4WRIA 3SG4A 1B8LA 1GQMA 1QX7A 3EVVA 1TN4A 4HRHA 5CSJA 5HYDA 1J7OA 4NDDA 1AP4A 1DMOA 3PSRA 1TNPA 1OQPA 3CS1A 4MZKA 2TN4A 3WHTB 1KFXS 1J55A 1TIZA 1OOJA 1S6JA 2KFFA 2OPOA 1G8IA 1BT6A 1IWQA 2EC6C 3NSOA 2I7AA 1QIWA 1CDNA 1K9PA 5AEQA 4YGDB 2LVVA 3JVTC 4PCWA 4YGEB 4YGAA 4UPGA 4GUKA 2MRDA 3BOWB 2K61A 1KFUS 1N2DA 3HX4A 2JT0A 5KU1A 2B1UA 2LP3A 1CMFA 2KFGA 4PHMA 2LLSA 2MBXA 1JSAA 4L9MA 3PFVA 1XO5A 1KSMA 3O6BA 2I94A 1LXFC 1PULA 3EK8A 4DCKA 1DGVA 4A4BA 1TCFA 4MLWA 3OHMB 1KK7Y 1UHHA 2FJUB 1JFJA 4YRUA 4QJ5B 1V1GA 4I5KA 5D69A 2KHNA 2JRFA 3LK1A 3I5HB 2K7DA 2KAVA 1IH0A 2D8NA 2CTNA 1DTLA 1KCYA 1KQMB 2Q4UA 1BG1A 2BBNA 2KI4B 2Y1MA 2JZIA 3BUWB 3GK2A 4I5LB 2K7OA 5AXIA 1YX8A 1H8BA 4MVFA 1TNWA 1CDMA 4XJKB 4GFTA 1PK0D 3EK4A 2O60A 3PM8A 5CSIA 1CFCA 4MN0A 3BUXB 3GOFA 1YUUA 2K7BA 3ZNIA 3I5HC 3PATA 1QS7A 4OCIA 4YI9A 3TDZA 5HKZA 1KQMC 2H2KA 1AHRA 1YX7A 2EGDA 2KI4C 1K2HA 4ORBB 1B1GA 5HKWA 2KFHA 2M1KB 2CCMA 1CB1A 3OB1B 1IJ6A 3I5GB 2K2AA 4WQ3A 2KI6C 1XVJA 2KAXA 2BECA 2LC5A 1NX0A 1XYDA 1TTXA 2JTZA 1DJHA 2LLUA 1F70A 1DVIA 1TNXA 3FS7A 4I5NB 3SG5A 3IQOA 2JXCA 1A75A 4TNCA 1KFXL 3LLEA 1F8HA 2OS8B 3KF9A 2BCXA 3NXAA 3I5GC 1ODBA 1NCZA 1XFWO 1RFJA 1H4BA 1IJ5A 3H4SE 4JQ0D 3GK1A 1R2UA 2SASA 3EKJA 4HSZA 1JC2A 3NSIA 1MR8A 4ORAB 1PVBA 2L4IA 2AAOA 1IQ3A 1XFVO 1KFUL 2M8UA 4JWQA 2OS8C 2OTGB 1QX5B 2ZRSA 2L5XB 4A4CA 4MSPA 1A4PA 1QV0A 2ZKMX 1SL7A 1UWOA 1J7RA 2LLTA 3DF0A 5D7FA 5KSZA 1G33A 1NCXA 2KYFA 2QPTA 3SG7A 1S36A 1UURA 1IRJA 2MA2A 4QJ4B 1UP5A 1K9KA 2Q91A 4ZCUA 1QVIY 2KGBC 1XFUO 1CNPA 1CFFA 3VRNA 2HQ8A 4C0LA 1A75B 1L7ZA 3JVTB 3O78A 4D1EA 1BR1B 4WQ2A 3TDIA 1EG4A 1YRUB 1KQVA 2K0JA 5FYXA 1SW8A 4P2YB 1S26D 2NXQA 3LCPC 1TNQA 1S6IA 1XFYO 1AJ5A 2GGZA 3JTDB 2NCPA 3KHEA 4XYNA 5DKRA 1B7TZ 2K8MB 4YBHB 1CFDA 3RLZA 2MLEC 4N1GA 2KGRA 2CNPA 2LMUA 2KQYA 3KPXA 1SBJA 2LUCA 4NQGA 2NZ0A 1HQVA 1RJVA 1WDCC 3VRPA 1YVLA 2L4HA 4PHNA 1SL9A 3JTDC 2NCOA 1K94A 2L98A 1AK8A 4Q04A 4OV2A 1OSAA 5CSNA 1UHNA 3D10A 2BL0B 1K93D 1S5GZ 2G9BA 2PRUA 3MSEB 1YRTB 2F3ZA 2WNDA 2M7LA 1PRWA 1WY9A 2LVIA 2SCPA 1R6PA 2K7CA 5CSFA 2CBLA 2M9GA 2F33A 3IF7A 1L2OB 2QACA 2PALA 1K90D 3VROA 1EG3A 1B4CA 1QLKA 3PALA 1GGZA 2JU0A 3VGOA 1XA5A 2BL0C 2M0RA 1CDLA 4QJ3B 5CPVA 2RGIA 4JPZB 2BBMA 5BPJA 3DD4A 5HKYA 2E30A 1KSOA 2ZNEA 2ISDA 1BU3A 2KQ6A 1BR4B 2BCAA 1DJGA 2A4JA 2NLNA 1ALWA 3EK7A 3IQQA 1L2OC 4FTGA 4MRYA 1U5IA 5JOLA 1G4YR 1Y1UA 3D0YA 1SCVA 4GGFC 4PE0A 2HF5A 1LINA 1FF1A 4MZLA 2M49B 1MXEA 2GV5A 4ZCVA 4OKHA 2G2BA 2F2PA 1MWNA 2M97A 4P5OE 3WNXB 1F54A 1WRLA 2KBIA 4GBAA 1OMVA 2WORA 3KEVA 2I18A 1CFPA 1ZUZA 2JT3A 1B8CA 3CTNA 4HREE 4CLNA 4ICBA 4AQJA 3BUMB 2VRGA 2HPSA 3KO0A 1S1EA 1DJXA 4DS7A 4PHKA 5ER4X 1ZACA 2MAZA 2ZFDA 2Y1NA 3CR4X 2R2IA 1NYAA 3CZTX 5B8IB 1K96A 5I8NA 1BOCA 1SRAA 1J1EA 2PVBA 4GAOA 1K95A 3FIAA 3GK4X 3SJSA 1XFZO 4MBEA 4YGCB 3HCMA 1IG5A 1C07A 1GGWA 1CTRA 3CGAA 4DUQA 3PN7B 1XK4A 4OR9B 2JWWA 1U5IB 3O2PA 1KWOB 1RECA 3D0YB 1QV1A 3TUYB 1J7QA 5DKNA 1Y6WA 1NIWA 1KK7Z 2LV7A 2KDHA 2BKIB 3CR2A 3EVRA 3C1VA 1AUIB 1J1DA 3SIBA 2Y5IA 2KAYA 3PN7C 5HLVA 1QIVA 1QTXA 4ORCB 3SIAA 1DF0A 2IS9A 1KWOC 2M29A 2KSPA 3CR5X 1F55A 1QLSA 1LA0A 3TUYC 3OX5A 1LA3A 4PHJA 2L50A 5TNCA 1MHOA 1DJIA 2M7NA 2ZRTA 1DJZA 2EHBA 1EXRA 1B9AA 2BKHB 1EH2A 5F6TA 4AQIA 1TCOB 1NX2A 3NSKA 4C0KA 1HT9A 4GGFA 3OX6A 1D1OA 4PE1A 3SG3A 1WDCB 3TS5B 1LVCD 1GJYA 1YVHA 1QX2A 1M45A 1NX3A 2FOTA 1OE9B 2ZNDA 2LHLA 4OVNF 1FI6A 2JTTA 2AMIA 1JF0A 1CM4A 1QASA 2MHHA 1CLLA 4E68A 1X02A 1UHIA 5HLOA 3RM1A 1CLMA 2Y4QA 1SR6B 3WHUB 1CDPA 3A4UB 5IBWA 1BLQA 1CKKA 1PVAA 1W7IB 2BE6A 4AOMA 2KBMA 3TS5C 1OZOA 1XK4C 3F45A 1Y1XA 1IGVA 1DF0B 4NDBA 2MJWB 2F8PA 1B47A 2E6WA 3FWBA 4C0JA 5I2QA 1ZOTB 3DF0B 1NWDA 3O4YA 1AJ4A 2KOTA 5J3XA 1RWYA 4BY5A 3DVJA 2LVKA 5I2LA 1SR6C 4GPLB 1M39A 1E8AA 5DKQA 1EL4A 1OMDA 1OZSA 3LK0A 2HQWA 3CWGA 2LHIA 2CT9A 2MLFC 3QRXA 1TOPA 4NDCA 4YI8A 5I2OA 1W7JB 4USLA 4XJKA 4CFQA 1JWDA 3K21A 2LAPA 3BQ3A 2F2OA 3BXKA 2BCBA 3I5FB 5AFPA 1SY9A 1S6CA 2K2FA 4PE7A 4YGBB 1VRKA 3AAJA 4I5JA 1RTP1 1IKUA 1K9UA 5GQQC 2H61A 4DRWA 5K89A 2LCPA 5AANA 3M0WA 1CM1A 4FQOA 4M2QA 1AVSA 2JULA 4CIDA 1M31A 1S3PA 1FBVA 3OP0A 4IL1A 1F4OA 1QVIZ 1A2XA 1K8UA 1YUTA 5AERA 3I5FC 4N5XA 4GGNA 4U8DA 1CLBA 1QXPA 1NCYA 1M63B 2PASA 1DJYA 3FWCA 1PSBA 1QATA 2CXJA 3AKBA 1FW4A 1ZMZA 4MEWA 4CPVA 1Y1AA 4MRXA 4MZJA 4ETOA 1NP8A 2PMYA 1MF8B 2WOSA 2JXLA 2AUCA 1XFXO 3PLFB 1IQ5A 1WRKA 2JT8A 1SPYA 2LMVA
chains in the Genus database with same CATH superfamily
2KLDA 2FCDA 1YR5A 2ERBA 1JUOA 1N0YA 2JOJA 3ZWHA 1QJTA 1SCMB 2ZN8A 3SG6A 1OOIX 3EVUA 4M2PA 1LKJA 2L0PA 1FPWA 3AKAA 1B8RA 1SYMA 2KI6D 3LL8B 2V53A 2WCFA 1MXLC 4BY4A 2L51A 1YURA 1Z2CB 1RK9A 1NX1A 2LP2A 4KYNA 1Y0VH 1ALVA 4GNKB 2KNEA 3NHIA 2L2EA 3Q8IA 1TRFA 3D78A 1SCMC 1WLZA 3TDUA 2QEVA 1SSEB 1CMGA 3R72A 2DOQA 4HRGA 1B7TY 4DIRA 1SNLA 5FI6A 2WC8A 3B88A 3CLNA 1DJWA 2JC2A 4PALA 1JF2A 1C7WA 1A29A 1PSRA 2H61C 1A03A 1EJ3A 1WLMA 5KTYA 2GGMA 1BMOA 3DVMA 3OB2B 5PALA 3EKHA 3SG2A 1TWOA 3E3RA 2FJYA 2ZN9A 2COLB 1C3YA 2LM5A 1RROA 3TZ1A 1ZFSA 3BYAA 4CFRA 1SL8A 1OMRA 5G08A 3AAKA 1V1FA 2PSRA 1SK6D 3VRQA 1Q80A 1F4QA 1S5GY 4IJ7A 1NPQA 3OBVA 1NSHA 3NSLA 2O5GA 2I2RE 3N7HA 1YTZC 4M2OA 4PE4A 2P6BB 4PDZA 2HETA 1C7VA 3VRRA 1M46A 5JJGA 1DT7B 3BUNB 1N65A 2JQ6A 2WCBA 1SMGA 2LANA 1UHKA 2M1UA 3BOWA 3I5IB 4N1FA 3S0EA 1BODA 1KK8B 3L4AA 1FI5A 1BJFA 2JNFA 1NUBA 2LVJA 2LNKA 4INXA 2WCEA 1MUXA 1MQ1A 3BUOB 1SKTA 2FCEA 4F7FA 2LMTA 1J7PA 1BF5A 3WXAA 2LE9B 2BE4A 1WRZA 2OTGC 4R1EA 5ER5A 2JNXA 3ICBA 2LUXA 1YUSA 1DGUA 1JFKA 2KYCA 2EC6B 3I5IC 1PALA 1UHJA 3A8RA 3DVEA 1F71A 1KK8C 2F3YA 2JPTA 4F0ZB 3DVKA 1UUSA 2M3WA 4WRIA 3SG4A 3SS3A 1B8LA 1GQMA 1QX7A 3EVVA 1TN4A 4HRHA 5CSJA 5HYDA 3B6XA 1J7OA 4NDDA 1AP4A 1DMOA 3PSRA 1TNPA 1OQPA 3CS1A 4MZKA 2TN4A 3WHTB 1KFXS 2QEBA 1J55A 3S0FA 1TIZA 1OOJA 1S6JA 2KFFA 2OPOA 3RZSA 2BNXA 1G8IA 1BT6A 1IWQA 2EC6C 3NSOA 2I7AA 1QIWA 1CDNA 1K9PA 5AEQA 4YGDB 2LVVA 3EG5B 3JVTC 3R1OA 4PCWA 4YGEB 4YGAA 4UPGA 3NHTA 1OW4A 4GUKA 2MRDA 3B86A 2ZNDA 3BOWB 2K61A 1KFUS 1N2DA 3HX4A 2JT0A 5KU1A 2B1UA 1T14A 2LP3A 1CMFA 2KFGA 4PHMA 3BFHA 2LLSA 2MBXA 1JSAA 4L9MA 3PFVA 1XO5A 2QEOA 1DELA 1KSMA 3K1EA 3O6BA 3S0DA 2I94A 1LXFC 1PULA 3EK8A 4DCKA 2YGUA 1DGVA 4A4BA 1TCFA 4MLWA 3DXLA 5I94A 3OHMB 1KK7Y 4JD9A 1UHHA 3S0BA 2FJUB 1JFJA 4YRUA 4QJ5B 1V1GA 4I5KA 5D69A 3VB1A 2KHNA 2JRFA 3LK1A 3PJIA 3UNWA 3I5HB 2K7DA 2KAVA 1IH0A 2D8NA 3DY9A 2CTNA 1DTLA 5D3OA 1KCYA 1KQMB 2Q4UA 1BG1A 2BBNA 2KI4B 2Y1MA 2JZIA 3BUWB 3GK2A 4I5LB 2K7OA 5AXIA 1YX8A 1H8BA 4MVFA 1TNWA 1CDMA 4XJKB 4GFTA 1PK0D 1P28A 3EK4A 2O60A 3PM8A 3SS5A 5CSIA 1CFCA 4MN0A 3BUXB 3GOFA 1YUUA 3D74A 2K7BA 3ZNIA 3I5HC 1Z4HA 3PATA 2QDIA 1QS7A 4OCIA 2L5YA 4YI9A 3TDZA 5HKZA 1KQMC 3DYEA 2H2KA 1AHRA 1YX7A 2EGDA 2KI4C 1IIOA 1K2HA 4ORBB 1B1GA 5HKWA 2KFHA 3S0AA 2M1KB 2CCMA 3QMEA 1CB1A 2K60A 3OB1B 1IJ6A 3I5GB 2K2AA 3DZTA 4WQ3A 2KI6C 1XVJA 2KAXA 2BECA 2LC5A 1NX0A 1XYDA 1TTXA 2JTZA 2WC6A 1DJHA 2LLUA 1F70A 3CZ1A 1DVIA 1TNXA 3FS7A 4I5NB 3SG5A 3IQOA 3D75A 2JXCA 1A75A 4TNCA 1KFXL 3LLEA 1F8HA 2OS8B 3KF9A 2BCXA 3NXAA 3I5GC 3S0GA 2WCJA 1ODBA 1NCZA 1XFWO 1RFJA 1H4BA 1IJ5A 3H4SE 4JQ0D 3GK1A 1OOFA 1R2UA 2SASA 3EKJA 4HSZA 1JC2A 3NSIA 1MR8A 4ORAB 1PVBA 2L4IA 2AAOA 1IQ3A 1XFVO 1KFUL 1OOHA 2M8UA 3FE9A 3CZ2A 1TUZA 2OS8C 2OTGB 1QX5B 4JWQA 2ZRSA 2L5XB 4A4CA 4MSPA 1A4PA 1QV0A 3L4LA 2ZKMX 1SL7A 5JOLA 1UWOA 1J7RA 1DC1A 2LLTA 1XFRA 3DF0A 5D7FA 5KSZA 1G33A 1NCXA 2KYFA 2QPTA 3SG7A 1LS8A 1S36A 1UURA 1IRJA 2MA2A 4FQTA 4QJ4B 1UP5A 1K9KA 2Q91A 4ZCUA 1QVIY 2KGBC 1XFUO 1CNPA 1CFFA 3VRNA 2HQ8A 4C0LA 1A75B 1L7ZA 3JVTB 3O78A 4D1EA 1DQEA 1BR1B 4WQ2A 3TDIA 1EG4A 1YRUB 1KQVA 2BAPA 2K0JA 5FYXA 1SW8A 4P2YB 1S26D 2NXQA 3BFAA 3LCPC 1TNQA 1S6IA 1XFYO 1AJ5A 2GGZA 3JTDB 2NCPA 3KHEA 4XYNA 5DKRA 1B7TZ 2K8MB 4YBHB 1CFDA 3RLZA 2MLEC 4N1GA 2KGRA 2CNPA 2LMUA 2KQYA 3KPXA 1SBJA 2LUCA 4NQGA 2NZ0A 1HQVA 1RJVA 1WDCC 3VRPA 1YVLA 2L4HA 4PHNA 1SL9A 3JTDC 2NCOA 1K94A 2L98A 1AK8A 4Q04A 4OV2A 1OSAA 1DEKA 5CSNA 1UHNA 3D10A 2BL0B 1K93D 1S5GZ 2G9BA 2PRUA 3MSEB 1YRTB 2F3ZA 2WNDA 2WCKA 2M7LA 1PRWA 1WY9A 2LVIA 3FE8A 1GM0A 2SCPA 1R6PA 2K7CA 5CSFA 2CBLA 2M9GA 2F33A 3O4XA 3IF7A 3B87A 1L2OB 4INWA 2QACA 2PALA 1K90D 3CDNA 3VROA 1EG3A 1B4CA 1QLKA 3PALA 1GGZA 2JU0A 3VGOA 1XA5A 2BL0C 2M0RA 1CDLA 4QJ3B 5HL1A 3FE6A 5CPVA 2RGIA 4JPZB 2BBMA 5BPJA 1ORGA 3DD4A 5FI2A 5AERA 5HKYA 2E30A 1KSOA 2ZNEA 2ISDA 1BU3A 2KQ6A 1BR4B 1DJGA 2BCAA 2A4JA 2NLNA 1ALWA 3EK7A 3IQQA 1L2OC 4FTGA 4MRYA 1U5IA 5FI7A 1G4YR 1Y1UA 3D0YA 1SCVA 4GGFC 4PE0A 2HF5A 3OGNA 1LINA 2KPHA 4MZLA 1FF1A 2M49B 1MXEA 2GV5A 4ZCVA 4OKHA 2G2BA 2F2PA 1MWNA 2M97A 4P5OE 3WNXB 1F54A 1WRLA 2KBIA 4GBAA 1OMVA 2WORA 2PYQA 3KEVA 2I18A 2PQLA 1CFPA 1ZUZA 2JT3A 1B8CA 3CTNA 4HREE 4CLNA 4ICBA 4AQJA 3BUMB 2VRGA 2HPSA 3KO0A 1S1EA 1DJXA 4DS7A 1JBAA 4OZDA 4PHKA 5ER4X 1ZACA 2MAZA 2ZFDA 2Y1NA 3CR4X 2R2IA 1NYAA 3CZTX 5B8IB 1K96A 5I8NA 1BOCA 1SRAA 3SS4A 1J1EA 2PVBA 3CABA 4GAOA 1K95A 3FIAA 3GK4X 2L2CA 3IVTA 3SJSA 1XFZO 4MBEA 4YGCB 2WCHA 1IG5A 3HCMA 1C07A 1GGWA 1CTRA 3CGAA 4DUQA 3PN7B 1XK4A 4JKTA 4OR9B 2JWWA 1U5IB 2P70A 1KWOB 1RECA 3B7AA 3O2PA 3D0YB 3R1PA 1QV1A 3TUYB 1J7QA 5DKNA 1Y6WA 3D73A 1NIWA 1KK7Z 2LV7A 2KDHA 2BKIB 3CR2A 3EVRA 3C1VA 3D76A 1AUIB 1J1DA 3SIBA 2Y5IA 2KAYA 2WC5A 3PN7C 1QIVA 1QTXA 4ORCB 5HLVA 1DF0A 2IS9A 3SIAA 3L47A 1KWOC 2M29A 2KSPA 3CR5X 1F55A 1QLSA 1LA0A 3TUYC 3OX5A 1LA3A 4PHJA 2L50A 5TNCA 1MHOA 1DJIA 2M7NA 4PT1A 2ZRTA 1DJZA 2EHBA 1EXRA 1TUJA 5DICA 1B9AA 2BKHB 1EH2A 5F6TA 4AQIA 1TCOB 1NX2A 3NSKA 4C0KA 3UO9A 1HT9A 3R1VA 3OX6A 4GGFA 1D1OA 3NGVA 4PE1A 3SG3A 1WDCB 3TS5B 1LVCD 1GJYA 1YVHA 1QX2A 1M45A 1NX3A 1W9ZA 1OE9B 2FOTA 2LHLA 2QEHA 4OVNF 2JTTA 2AMIA 1FI6A 1JF0A 2JPOA 1CM4A 1QASA 2MHHA 1CLLA 4E68A 1X02A 1UHIA 5HLOA 3RM1A 1CLMA 2Y4QA 1SR6B 3V2LA 1CDPA 3A4UB 3WHUB 5IBWA 1BLQA 1CKKA 1PVAA 1W7IB 2BE6A 4AOMA 2KBMA 3TS5C 1OZOA 1XK4C 3F45A 1Y1XA 1IGVA 1DF0B 4NDBA 2WCMA 2MJWB 2F8PA 1B47A 2E6WA 3FWBA 4C0JA 5I2QA 3PM2A 5EL2A 1ZOTB 3DF0B 1NWDA 3O4YA 1AJ4A 2KOTA 5J3XA 1RWYA 4BY5A 3DVJA 2LVKA 5I2LA 1SR6C 4GPLB 1M39A 1E8AA 5DKQA 1EL4A 1OMDA 1OZSA 3LK0A 2HQWA 3CWGA 2LHIA 2CT9A 2MLFC 3QRXA 1TOPA 4NDCA 3BJHA 4YI8A 1W7JB 4USLA 5I2OA 4XJKA 4CFQA 1JWDA 3K21A 2LAPA 3BQ3A 2F2OA 3BXKA 2BCBA 2WCLA 3I5FB 5AFPA 1SY9A 1S6CA 2K2FA 4PE7A 4YGBB 1VRKA 3AAJA 4I5JA 1RTP1 1IKUA 1K9UA 5GQQC 2H61A 4DRWA 5K89A 2LCPA 5AANA 3M0WA 1CM1A 1OOGA 4FQOA 3CZ0A 4M2QA 3BFBA 1AVSA 2JULA 4CIDA 1M31A 2KLEA 1S3PA 1C3ZA 1FBVA 2GTEA 3OP0A 4IL1A 1F4OA 1QVIZ 1A2XA 1K8UA 1YUTA 2H8VA 2P71A 3I5FC 4N5XA 4GGNA 3D77A 4U8DA 1CLBA 1QXPA 1NCYA 1M63B 2PASA 1DJYA 3FWCA 1PSBA 1QWVA 1QATA 2CXJA 3AKBA 1FW4A 1ZMZA 4MEWA 4CPVA 1Y1AA 4MRXA 4MZJA 4ETOA 1NP8A 2PMYA 3CYZA 1MF8B 2WOSA 2JXLA 2AUCA 1XFXO 3PLFB 1IQ5A 1WRKA 2JT8A 1SPYA 2LMVA
chains in the Genus database with same CATH topology
2FCDA 1YR5A 1JUOA 1N0YA 2JOJA 3ZWHA 1QJTA 1SCMB 2ZN8A 3SG6A 3EVUA 4M2PA 1LKJA 2L0PA 1FPWA 3AKAA 1B8RA 1SYMA 2KI6D 3LL8B 2V53A 2WCFA 1MXLC 4BY4A 2L51A 1YURA 1RK9A 1NX1A 2LP2A 1Y0VH 1ALVA 4GNKB 2KNEA 2L2EA 1TRFA 1SCMC 1WLZA 3TDUA 1CMGA 2DOQA 4HRGA 1B7TY 4DIRA 1SNLA 2WC8A 3CLNA 1DJWA 2JC2A 4PALA 1JF2A 1C7WA 1A29A 1PSRA 2H61C 1A03A 1EJ3A 1WLMA 5KTYA 2GGMA 1BMOA 3DVMA 3OB2B 5PALA 3EKHA 3SG2A 3E3RA 2ZN9A 2COLB 2LM5A 1RROA 3TZ1A 1ZFSA 3BYAA 4CFRA 1SL8A 1OMRA 5G08A 3AAKA 1V1FA 2PSRA 1SK6D 3VRQA 1Q80A 1F4QA 1S5GY 1NPQA 1NSHA 3NSLA 2O5GA 2I2RE 1YTZC 4M2OA 4PE4A 2P6BB 4PDZA 2HETA 1C7VA 3VRRA 1M46A 5JJGA 1DT7B 3BUNB 1N65A 2JQ6A 2WCBA 1SMGA 2LANA 1UHKA 2M1UA 3BOWA 3I5IB 4N1FA 1BODA 1JBAA 1KK8B 1FI5A 1BJFA 2JNFA 1NUBA 2LVJA 2LNKA 2WCEA 1MUXA 1MQ1A 3BUOB 1SKTA 2FCEA 2LMTA 1J7PA 1BF5A 3WXAA 2LE9B 2BE4A 1WRZA 2OTGC 4R1EA 5ER5A 2JNXA 3ICBA 2LUXA 1YUSA 1DGUA 1JFKA 2KYCA 2EC6B 3I5IC 1PALA 1UHJA 3A8RA 3DVEA 1F71A 1KK8C 2F3YA 2JPTA 4F0ZB 3DVKA 1UUSA 2M3WA 4WRIA 3SG4A 1B8LA 1GQMA 1QX7A 3EVVA 1TN4A 4HRHA 5CSJA 5HYDA 1J7OA 4NDDA 1AP4A 1DMOA 3PSRA 1TNPA 1OQPA 3CS1A 4MZKA 2TN4A 3WHTB 1KFXS 1J55A 1TIZA 1OOJA 1S6JA 2KFFA 2OPOA 1G8IA 1BT6A 1IWQA 2EC6C 3NSOA 2I7AA 1QIWA 1CDNA 1K9PA 5AEQA 4YGDB 2LVVA 3JVTC 4PCWA 4YGEB 4YGAA 4UPGA 4GUKA 2MRDA 3BOWB 2K61A 1KFUS 1N2DA 3HX4A 2JT0A 5KU1A 2B1UA 2LP3A 1CMFA 2KFGA 4PHMA 2LLSA 2MBXA 1JSAA 4L9MA 3PFVA 1XO5A 1KSMA 3O6BA 2I94A 1LXFC 1PULA 3EK8A 4DCKA 1DGVA 4A4BA 1TCFA 4MLWA 3OHMB 1KK7Y 1UHHA 2FJUB 1JFJA 4YRUA 4QJ5B 1V1GA 4I5KA 5D69A 2KHNA 2JRFA 3LK1A 3I5HB 2K7DA 2KAVA 1IH0A 2D8NA 2CTNA 1DTLA 1KCYA 1KQMB 2Q4UA 1BG1A 2BBNA 2KI4B 2Y1MA 2JZIA 3BUWB 3GK2A 4I5LB 2K7OA 5AXIA 1YX8A 1H8BA 4MVFA 1TNWA 1CDMA 4XJKB 4GFTA 1PK0D 3EK4A 2O60A 3PM8A 5CSIA 1CFCA 4MN0A 3BUXB 3GOFA 1YUUA 2K7BA 3ZNIA 3I5HC 3PATA 1QS7A 4OCIA 4YI9A 3TDZA 5HKZA 1KQMC 2H2KA 1AHRA 1YX7A 2EGDA 2KI4C 1K2HA 4ORBB 1B1GA 5HKWA 2KFHA 2M1KB 2CCMA 1CB1A 3OB1B 1IJ6A 3I5GB 2K2AA 4WQ3A 2KI6C 1XVJA 2KAXA 2BECA 2LC5A 1NX0A 1XYDA 1TTXA 2JTZA 1DJHA 2LLUA 1F70A 1DVIA 1TNXA 3FS7A 4I5NB 3SG5A 3IQOA 2JXCA 1A75A 4TNCA 1KFXL 3LLEA 1F8HA 2OS8B 3KF9A 2BCXA 3NXAA 3I5GC 1ODBA 1NCZA 1XFWO 1RFJA 1H4BA 1IJ5A 3H4SE 4JQ0D 3GK1A 1R2UA 2SASA 3EKJA 4HSZA 1JC2A 3NSIA 1MR8A 4ORAB 1PVBA 2L4IA 2AAOA 1IQ3A 1XFVO 1KFUL 2M8UA 4JWQA 2OS8C 2OTGB 1QX5B 2ZRSA 2L5XB 4A4CA 4MSPA 1A4PA 1QV0A 2ZKMX 1SL7A 1UWOA 1J7RA 2LLTA 3DF0A 5D7FA 5KSZA 1G33A 1NCXA 2KYFA 2QPTA 3SG7A 1S36A 1UURA 1IRJA 2MA2A 4QJ4B 1UP5A 1K9KA 2Q91A 4ZCUA 1QVIY 2KGBC 1XFUO 1CNPA 1CFFA 3VRNA 2HQ8A 4C0LA 1A75B 1L7ZA 3JVTB 3O78A 4D1EA 1BR1B 4WQ2A 3TDIA 1EG4A 1YRUB 1KQVA 2K0JA 5FYXA 1SW8A 4P2YB 1S26D 2NXQA 3LCPC 1TNQA 1S6IA 1XFYO 1AJ5A 2GGZA 3JTDB 2NCPA 3KHEA 4XYNA 5DKRA 1B7TZ 2K8MB 4YBHB 1CFDA 3RLZA 2MLEC 4N1GA 2KGRA 2CNPA 2LMUA 2KQYA 3KPXA 1SBJA 2LUCA 4NQGA 2NZ0A 1HQVA 1RJVA 1WDCC 3VRPA 1YVLA 2L4HA 4PHNA 1SL9A 3JTDC 2NCOA 1K94A 2L98A 1AK8A 4Q04A 4OV2A 1OSAA 5CSNA 1UHNA 3D10A 2BL0B 1K93D 1S5GZ 2G9BA 2PRUA 3MSEB 1YRTB 2F3ZA 2WNDA 2M7LA 1PRWA 1WY9A 2LVIA 2SCPA 1R6PA 2K7CA 5CSFA 2CBLA 2M9GA 2F33A 3IF7A 1L2OB 2QACA 2PALA 1K90D 3VROA 1EG3A 1B4CA 1QLKA 3PALA 1GGZA 2JU0A 3VGOA 1XA5A 2BL0C 2M0RA 1CDLA 4QJ3B 5CPVA 2RGIA 4JPZB 2BBMA 5BPJA 3DD4A 5HKYA 2E30A 1KSOA 2ZNEA 2ISDA 1BU3A 2KQ6A 1BR4B 2BCAA 1DJGA 2A4JA 2NLNA 1ALWA 3EK7A 3IQQA 1L2OC 4FTGA 4MRYA 1U5IA 5JOLA 1G4YR 1Y1UA 3D0YA 1SCVA 4GGFC 4PE0A 2HF5A 1LINA 1FF1A 4MZLA 2M49B 1MXEA 2GV5A 4ZCVA 4OKHA 2G2BA 2F2PA 1MWNA 2M97A 4P5OE 3WNXB 1F54A 1WRLA 2KBIA 4GBAA 1OMVA 2WORA 3KEVA 2I18A 1CFPA 1ZUZA 2JT3A 1B8CA 3CTNA 4HREE 4CLNA 4ICBA 4AQJA 3BUMB 2VRGA 2HPSA 3KO0A 1S1EA 1DJXA 4DS7A 4PHKA 5ER4X 1ZACA 2MAZA 2ZFDA 2Y1NA 3CR4X 2R2IA 1NYAA 3CZTX 5B8IB 1K96A 5I8NA 1BOCA 1SRAA 1J1EA 2PVBA 4GAOA 1K95A 3FIAA 3GK4X 3SJSA 1XFZO 4MBEA 4YGCB 3HCMA 1IG5A 1C07A 1GGWA 1CTRA 3CGAA 4DUQA 3PN7B 1XK4A 4OR9B 2JWWA 1U5IB 3O2PA 1KWOB 1RECA 3D0YB 1QV1A 3TUYB 1J7QA 5DKNA 1Y6WA 1NIWA 1KK7Z 2LV7A 2KDHA 2BKIB 3CR2A 3EVRA 3C1VA 1AUIB 1J1DA 3SIBA 2Y5IA 2KAYA 3PN7C 5HLVA 1QIVA 1QTXA 4ORCB 3SIAA 1DF0A 2IS9A 1KWOC 2M29A 2KSPA 3CR5X 1F55A 1QLSA 1LA0A 3TUYC 3OX5A 1LA3A 4PHJA 2L50A 5TNCA 1MHOA 1DJIA 2M7NA 2ZRTA 1DJZA 2EHBA 1EXRA 1B9AA 2BKHB 1EH2A 5F6TA 4AQIA 1TCOB 1NX2A 3NSKA 4C0KA 1HT9A 4GGFA 3OX6A 1D1OA 4PE1A 3SG3A 1WDCB 3TS5B 1LVCD 1GJYA 1YVHA 1QX2A 1M45A 1NX3A 2FOTA 1OE9B 2ZNDA 2LHLA 4OVNF 1FI6A 2JTTA 2AMIA 1JF0A 1CM4A 1QASA 2MHHA 1CLLA 4E68A 1X02A 1UHIA 5HLOA 3RM1A 1CLMA 2Y4QA 1SR6B 3WHUB 1CDPA 3A4UB 5IBWA 1BLQA 1CKKA 1PVAA 1W7IB 2BE6A 4AOMA 2KBMA 3TS5C 1OZOA 1XK4C 3F45A 1Y1XA 1IGVA 1DF0B 4NDBA 2MJWB 2F8PA 1B47A 2E6WA 3FWBA 4C0JA 5I2QA 1ZOTB 3DF0B 1NWDA 3O4YA 1AJ4A 2KOTA 5J3XA 1RWYA 4BY5A 3DVJA 2LVKA 5I2LA 1SR6C 4GPLB 1M39A 1E8AA 5DKQA 1EL4A 1OMDA 1OZSA 3LK0A 2HQWA 3CWGA 2LHIA 2CT9A 2MLFC 3QRXA 1TOPA 4NDCA 4YI8A 5I2OA 1W7JB 4USLA 4XJKA 4CFQA 1JWDA 3K21A 2LAPA 3BQ3A 2F2OA 3BXKA 2BCBA 3I5FB 5AFPA 1SY9A 1S6CA 2K2FA 4PE7A 4YGBB 1VRKA 3AAJA 4I5JA 1RTP1 1IKUA 1K9UA 5GQQC 2H61A 4DRWA 5K89A 2LCPA 5AANA 3M0WA 1CM1A 4FQOA 4M2QA 1AVSA 2JULA 4CIDA 1M31A 1S3PA 1FBVA 3OP0A 4IL1A 1F4OA 1QVIZ 1A2XA 1K8UA 1YUTA 5AERA 3I5FC 4N5XA 4GGNA 4U8DA 1CLBA 1QXPA 1NCYA 1M63B 2PASA 1DJYA 3FWCA 1PSBA 1QATA 2CXJA 3AKBA 1FW4A 1ZMZA 4MEWA 4CPVA 1Y1AA 4MRXA 4MZJA 4ETOA 1NP8A 2PMYA 1MF8B 2WOSA 2JXLA 2AUCA 1XFXO 3PLFB 1IQ5A 1WRKA 2JT8A 1SPYA 2LMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCD A;  1YR5 A;  1JUO A;  1N0Y A;  2JOJ A;  3ZWH A;  1QJT A;  1SCM B;  2ZN8 A;  3SG6 A;  3EVU A;  4M2P A;  1LKJ A;  2L0P A;  1FPW A;  3AKA A;  1B8R A;  1SYM A;  2KI6 D;  3LL8 B;  2V53 A;  2WCF A;  1MXL C;  4BY4 A;  2L51 A;  1YUR A;  1RK9 A;  1NX1 A;  2LP2 A;  1Y0V H;  1ALV A;  4GNK B;  2KNE A;  2L2E A;  1TRF A;  1SCM C;  1WLZ A;  3TDU A;  1CMG A;  2DOQ A;  4HRG A;  1B7T Y;  4DIR A;  1SNL A;  2WC8 A;  3CLN A;  1DJW A;  2JC2 A;  4PAL A;  1JF2 A;  1C7W A;  1A29 A;  1PSR A;  2H61 C;  1A03 A;  1EJ3 A;  1WLM A;  5KTY A;  2GGM A;  1BMO A;  3DVM A;  3OB2 B;  5PAL A;  3EKH A;  3SG2 A;  3E3R A;  2ZN9 A;  2COL B;  2LM5 A;  1RRO A;  3TZ1 A;  1ZFS A;  3BYA A;  4CFR A;  1SL8 A;  1OMR A;  5G08 A;  3AAK A;  1V1F A;  2PSR A;  1SK6 D;  3VRQ A;  1Q80 A;  1F4Q A;  1S5G Y;  1NPQ A;  1NSH A;  3NSL A;  2O5G A;  2I2R E;  1YTZ C;  4M2O A;  4PE4 A;  2P6B B;  4PDZ A;  2HET A;  1C7V A;  3VRR A;  1M46 A;  5JJG A;  1DT7 B;  3BUN B;  1N65 A;  2JQ6 A;  2WCB A;  1SMG A;  2LAN A;  1UHK A;  2M1U A;  3BOW A;  3I5I B;  4N1F A;  1BOD A;  1JBA A;  1KK8 B;  1FI5 A;  1BJF A;  2JNF A;  1NUB A;  2LVJ A;  2LNK A;  2WCE A;  1MUX A;  1MQ1 A;  3BUO B;  1SKT A;  2FCE A;  2LMT A;  1J7P A;  1BF5 A;  3WXA A;  2LE9 B;  2BE4 A;  1WRZ A;  2OTG C;  4R1E A;  5ER5 A;  2JNX A;  3ICB A;  2LUX A;  1YUS A;  1DGU A;  1JFK A;  2KYC A;  2EC6 B;  3I5I C;  1PAL A;  1UHJ A;  3A8R A;  3DVE A;  1F71 A;  1KK8 C;  2F3Y A;  2JPT A;  4F0Z B;  3DVK A;  1UUS A;  2M3W A;  4WRI A;  3SG4 A;  1B8L A;  1GQM A;  1QX7 A;  3EVV A;  1TN4 A;  4HRH A;  5CSJ A;  5HYD A;  1J7O A;  4NDD A;  1AP4 A;  1DMO A;  3PSR A;  1TNP A;  1OQP A;  3CS1 A;  4MZK A;  2TN4 A;  3WHT B;  1KFX S;  1J55 A;  1TIZ A;  1OOJ A;  1S6J A;  2KFF A;  2OPO A;  1G8I A;  1BT6 A;  1IWQ A;  2EC6 C;  3NSO A;  2I7A A;  1QIW A;  1CDN A;  1K9P A;  5AEQ A;  4YGD B;  2LVV A;  3JVT C;  4PCW A;  4YGE B;  4YGA A;  4UPG A;  4GUK A;  2MRD A;  3BOW B;  2K61 A;  1KFU S;  1N2D A;  3HX4 A;  2JT0 A;  5KU1 A;  2B1U A;  2LP3 A;  1CMF A;  2KFG A;  4PHM A;  2LLS A;  2MBX A;  1JSA A;  4L9M A;  3PFV A;  1XO5 A;  1KSM A;  3O6B A;  2I94 A;  1LXF C;  1PUL A;  3EK8 A;  4DCK A;  1DGV A;  4A4B A;  1TCF A;  4MLW A;  3OHM B;  1KK7 Y;  1UHH A;  2FJU B;  1JFJ A;  4YRU A;  4QJ5 B;  1V1G A;  4I5K A;  5D69 A;  2KHN A;  2JRF A;  3LK1 A;  3I5H B;  2K7D A;  2KAV A;  1IH0 A;  2D8N A;  2CTN A;  1DTL A;  1KCY A;  1KQM B;  2Q4U A;  1BG1 A;  2BBN A;  2KI4 B;  2Y1M A;  2JZI A;  3BUW B;  3GK2 A;  4I5L B;  2K7O A;  5AXI A;  1YX8 A;  1H8B A;  4MVF A;  1TNW A;  1CDM A;  4XJK B;  4GFT A;  1PK0 D;  3EK4 A;  2O60 A;  3PM8 A;  5CSI A;  1CFC A;  4MN0 A;  3BUX B;  3GOF A;  1YUU A;  2K7B A;  3ZNI A;  3I5H C;  3PAT A;  1QS7 A;  4OCI A;  4YI9 A;  3TDZ A;  5HKZ A;  1KQM C;  2H2K A;  1AHR A;  1YX7 A;  2EGD A;  2KI4 C;  1K2H A;  4ORB B;  1B1G A;  5HKW A;  2KFH A;  2M1K B;  2CCM A;  1CB1 A;  3OB1 B;  1IJ6 A;  3I5G B;  2K2A A;  4WQ3 A;  2KI6 C;  1XVJ A;  2KAX A;  2BEC A;  2LC5 A;  1NX0 A;  1XYD A;  1TTX A;  2JTZ A;  1DJH A;  2LLU A;  1F70 A;  1DVI A;  1TNX A;  3FS7 A;  4I5N B;  3SG5 A;  3IQO A;  2JXC A;  1A75 A;  4TNC A;  1KFX L;  3LLE A;  1F8H A;  2OS8 B;  3KF9 A;  2BCX A;  3NXA A;  3I5G C;  1ODB A;  1NCZ A;  1XFW O;  1RFJ A;  1H4B A;  1IJ5 A;  3H4S E;  4JQ0 D;  3GK1 A;  1R2U A;  2SAS A;  3EKJ A;  4HSZ A;  1JC2 A;  3NSI A;  1MR8 A;  4ORA B;  1PVB A;  2L4I A;  2AAO A;  1IQ3 A;  1XFV O;  1KFU L;  2M8U A;  4JWQ A;  2OS8 C;  2OTG B;  1QX5 B;  2ZRS A;  2L5X B;  4A4C A;  4MSP A;  1A4P A;  1QV0 A;  2ZKM X;  1SL7 A;  1UWO A;  1J7R A;  2LLT A;  3DF0 A;  5D7F A;  5KSZ A;  1G33 A;  1NCX A;  2KYF A;  2QPT A;  3SG7 A;  1S36 A;  1UUR A;  1IRJ A;  2MA2 A;  4QJ4 B;  1UP5 A;  1K9K A;  2Q91 A;  4ZCU A;  1QVI Y;  2KGB C;  1XFU O;  1CNP A;  1CFF A;  3VRN A;  2HQ8 A;  4C0L A;  1A75 B;  1L7Z A;  3JVT B;  3O78 A;  4D1E A;  1BR1 B;  4WQ2 A;  3TDI A;  1EG4 A;  1YRU B;  1KQV A;  2K0J A;  5FYX A;  1SW8 A;  4P2Y B;  1S26 D;  2NXQ A;  3LCP C;  1TNQ A;  1S6I A;  1XFY O;  1AJ5 A;  2GGZ A;  3JTD B;  2NCP A;  3KHE A;  4XYN A;  5DKR A;  1B7T Z;  2K8M B;  4YBH B;  1CFD A;  3RLZ A;  2MLE C;  4N1G A;  2KGR A;  2CNP A;  2LMU A;  2KQY A;  3KPX A;  1SBJ A;  2LUC A;  4NQG A;  2NZ0 A;  1HQV A;  1RJV A;  1WDC C;  3VRP A;  1YVL A;  2L4H A;  4PHN A;  1SL9 A;  3JTD C;  2NCO A;  1K94 A;  2L98 A;  1AK8 A;  4Q04 A;  4OV2 A;  1OSA A;  5CSN A;  1UHN A;  3D10 A;  2BL0 B;  1K93 D;  1S5G Z;  2G9B A;  2PRU A;  3MSE B;  1YRT B;  2F3Z A;  2WND A;  2M7L A;  1PRW A;  1WY9 A;  2LVI A;  2SCP A;  1R6P A;  2K7C A;  5CSF A;  2CBL A;  2M9G A;  2F33 A;  3IF7 A;  1L2O B;  2QAC A;  2PAL A;  1K90 D;  3VRO A;  1EG3 A;  1B4C A;  1QLK A;  3PAL A;  1GGZ A;  2JU0 A;  3VGO A;  1XA5 A;  2BL0 C;  2M0R A;  1CDL A;  4QJ3 B;  5CPV A;  2RGI A;  4JPZ B;  2BBM A;  5BPJ A;  3DD4 A;  5HKY A;  2E30 A;  1KSO A;  2ZNE A;  2ISD A;  1BU3 A;  2KQ6 A;  1BR4 B;  2BCA A;  1DJG A;  2A4J A;  2NLN A;  1ALW A;  3EK7 A;  3IQQ A;  1L2O C;  4FTG A;  4MRY A;  1U5I A;  5JOL A;  1G4Y R;  1Y1U A;  3D0Y A;  1SCV A;  4GGF C;  4PE0 A;  2HF5 A;  1LIN A;  1FF1 A;  4MZL A;  2M49 B;  1MXE A;  2GV5 A;  4ZCV A;  4OKH A;  2G2B A;  2F2P A;  1MWN A;  2M97 A;  4P5O E;  3WNX B;  1F54 A;  1WRL A;  2KBI A;  4GBA A;  1OMV A;  2WOR A;  3KEV A;  2I18 A;  1CFP A;  1ZUZ A;  2JT3 A;  1B8C A;  3CTN A;  4HRE E;  4CLN A;  4ICB A;  4AQJ A;  3BUM B;  2VRG A;  2HPS A;  3KO0 A;  1S1E A;  1DJX A;  4DS7 A;  4PHK A;  5ER4 X;  1ZAC A;  2MAZ A;  2ZFD A;  2Y1N A;  3CR4 X;  2R2I A;  1NYA A;  3CZT X;  5B8I B;  1K96 A;  5I8N A;  1BOC A;  1SRA A;  1J1E A;  2PVB A;  4GAO A;  1K95 A;  3FIA A;  3GK4 X;  3SJS A;  1XFZ O;  4MBE A;  4YGC B;  3HCM A;  1IG5 A;  1C07 A;  1GGW A;  1CTR A;  3CGA A;  4DUQ A;  3PN7 B;  1XK4 A;  4OR9 B;  2JWW A;  1U5I B;  3O2P A;  1KWO B;  1REC A;  3D0Y B;  1QV1 A;  3TUY B;  1J7Q A;  5DKN A;  1Y6W A;  1NIW A;  1KK7 Z;  2LV7 A;  2KDH A;  2BKI B;  3CR2 A;  3EVR A;  3C1V A;  1AUI B;  1J1D A;  3SIB A;  2Y5I A;  2KAY A;  3PN7 C;  5HLV A;  1QIV A;  1QTX A;  4ORC B;  3SIA A;  1DF0 A;  2IS9 A;  1KWO C;  2M29 A;  2KSP A;  3CR5 X;  1F55 A;  1QLS A;  1LA0 A;  3TUY C;  3OX5 A;  1LA3 A;  4PHJ A;  2L50 A;  5TNC A;  1MHO A;  1DJI A;  2M7N A;  2ZRT A;  1DJZ A;  2EHB A;  1EXR A;  1B9A A;  2BKH B;  1EH2 A;  5F6T A;  4AQI A;  1TCO B;  1NX2 A;  3NSK A;  4C0K A;  1HT9 A;  4GGF A;  3OX6 A;  1D1O A;  4PE1 A;  3SG3 A;  1WDC B;  3TS5 B;  1LVC D;  1GJY A;  1YVH A;  1QX2 A;  1M45 A;  1NX3 A;  2FOT A;  1OE9 B;  2ZND A;  2LHL A;  4OVN F;  1FI6 A;  2JTT A;  2AMI A;  1JF0 A;  1CM4 A;  1QAS A;  2MHH A;  1CLL A;  4E68 A;  1X02 A;  1UHI A;  5HLO A;  3RM1 A;  1CLM A;  2Y4Q A;  1SR6 B;  3WHU B;  1CDP A;  3A4U B;  5IBW A;  1BLQ A;  1CKK A;  1PVA A;  1W7I B;  2BE6 A;  4AOM A;  2KBM A;  3TS5 C;  1OZO A;  1XK4 C;  3F45 A;  1Y1X A;  1IGV A;  1DF0 B;  4NDB A;  2MJW B;  2F8P A;  1B47 A;  2E6W A;  3FWB A;  4C0J A;  5I2Q A;  1ZOT B;  3DF0 B;  1NWD A;  3O4Y A;  1AJ4 A;  2KOT A;  5J3X A;  1RWY A;  4BY5 A;  3DVJ A;  2LVK A;  5I2L A;  1SR6 C;  4GPL B;  1M39 A;  1E8A A;  5DKQ A;  1EL4 A;  1OMD A;  1OZS A;  3LK0 A;  2HQW A;  3CWG A;  2LHI A;  2CT9 A;  2MLF C;  3QRX A;  1TOP A;  4NDC A;  4YI8 A;  5I2O A;  1W7J B;  4USL A;  4XJK A;  4CFQ A;  1JWD A;  3K21 A;  2LAP A;  3BQ3 A;  2F2O A;  3BXK A;  2BCB A;  3I5F B;  5AFP A;  1SY9 A;  1S6C A;  2K2F A;  4PE7 A;  4YGB B;  1VRK A;  3AAJ A;  4I5J A;  1RTP 1;  1IKU A;  1K9U A;  5GQQ C;  2H61 A;  4DRW A;  5K89 A;  2LCP A;  5AAN A;  3M0W A;  1CM1 A;  4FQO A;  4M2Q A;  1AVS A;  2JUL A;  4CID A;  1M31 A;  1S3P A;  1FBV A;  3OP0 A;  4IL1 A;  1F4O A;  1QVI Z;  1A2X A;  1K8U A;  1YUT A;  5AER A;  3I5F C;  4N5X A;  4GGN A;  4U8D A;  1CLB A;  1QXP A;  1NCY A;  1M63 B;  2PAS A;  1DJY A;  3FWC A;  1PSB A;  1QAT A;  2CXJ A;  3AKB A;  1FW4 A;  1ZMZ A;  4MEW A;  4CPV A;  1Y1A A;  4MRX A;  4MZJ A;  4ETO A;  1NP8 A;  2PMY A;  1MF8 B;  2WOS A;  2JXL A;  2AUC A;  1XFX O;  3PLF B;  1IQ5 A;  1WRK A;  2JT8 A;  1SPY A;  2LMV A; 
#chains in the Genus database with same CATH topology
 2KLD A;  2FCD A;  1YR5 A;  2ERB A;  1JUO A;  1N0Y A;  2JOJ A;  3ZWH A;  1QJT A;  1SCM B;  2ZN8 A;  3SG6 A;  1OOI X;  3EVU A;  4M2P A;  1LKJ A;  2L0P A;  1FPW A;  3AKA A;  1B8R A;  1SYM A;  2KI6 D;  3LL8 B;  2V53 A;  2WCF A;  1MXL C;  4BY4 A;  2L51 A;  1YUR A;  1Z2C B;  1RK9 A;  1NX1 A;  2LP2 A;  4KYN A;  1Y0V H;  1ALV A;  4GNK B;  2KNE A;  3NHI A;  2L2E A;  3Q8I A;  1TRF A;  3D78 A;  1SCM C;  1WLZ A;  3TDU A;  2QEV A;  1SSE B;  1CMG A;  3R72 A;  2DOQ A;  4HRG A;  1B7T Y;  4DIR A;  1SNL A;  5FI6 A;  2WC8 A;  3B88 A;  3CLN A;  1DJW A;  2JC2 A;  4PAL A;  1JF2 A;  1C7W A;  1A29 A;  1PSR A;  2H61 C;  1A03 A;  1EJ3 A;  1WLM A;  5KTY A;  2GGM A;  1BMO A;  3DVM A;  3OB2 B;  5PAL A;  3EKH A;  3SG2 A;  1TWO A;  3E3R A;  2FJY A;  2ZN9 A;  2COL B;  1C3Y A;  2LM5 A;  1RRO A;  3TZ1 A;  1ZFS A;  3BYA A;  4CFR A;  1SL8 A;  1OMR A;  5G08 A;  3AAK A;  1V1F A;  2PSR A;  1SK6 D;  3VRQ A;  1Q80 A;  1F4Q A;  1S5G Y;  4IJ7 A;  1NPQ A;  3OBV A;  1NSH A;  3NSL A;  2O5G A;  2I2R E;  3N7H A;  1YTZ C;  4M2O A;  4PE4 A;  2P6B B;  4PDZ A;  2HET A;  1C7V A;  3VRR A;  1M46 A;  5JJG A;  1DT7 B;  3BUN B;  1N65 A;  2JQ6 A;  2WCB A;  1SMG A;  2LAN A;  1UHK A;  2M1U A;  3BOW A;  3I5I B;  4N1F A;  3S0E A;  1BOD A;  1KK8 B;  3L4A A;  1FI5 A;  1BJF A;  2JNF A;  1NUB A;  2LVJ A;  2LNK A;  4INX A;  2WCE A;  1MUX A;  1MQ1 A;  3BUO B;  1SKT A;  2FCE A;  4F7F A;  2LMT A;  1J7P A;  1BF5 A;  3WXA A;  2LE9 B;  2BE4 A;  1WRZ A;  2OTG C;  4R1E A;  5ER5 A;  2JNX A;  3ICB A;  2LUX A;  1YUS A;  1DGU A;  1JFK A;  2KYC A;  2EC6 B;  3I5I C;  1PAL A;  1UHJ A;  3A8R A;  3DVE A;  1F71 A;  1KK8 C;  2F3Y A;  2JPT A;  4F0Z B;  3DVK A;  1UUS A;  2M3W A;  4WRI A;  3SG4 A;  3SS3 A;  1B8L A;  1GQM A;  1QX7 A;  3EVV A;  1TN4 A;  4HRH A;  5CSJ A;  5HYD A;  3B6X A;  1J7O A;  4NDD A;  1AP4 A;  1DMO A;  3PSR A;  1TNP A;  1OQP A;  3CS1 A;  4MZK A;  2TN4 A;  3WHT B;  1KFX S;  2QEB A;  1J55 A;  3S0F A;  1TIZ A;  1OOJ A;  1S6J A;  2KFF A;  2OPO A;  3RZS A;  2BNX A;  1G8I A;  1BT6 A;  1IWQ A;  2EC6 C;  3NSO A;  2I7A A;  1QIW A;  1CDN A;  1K9P A;  5AEQ A;  4YGD B;  2LVV A;  3EG5 B;  3JVT C;  3R1O A;  4PCW A;  4YGE B;  4YGA A;  4UPG A;  3NHT A;  1OW4 A;  4GUK A;  2MRD A;  3B86 A;  2ZND A;  3BOW B;  2K61 A;  1KFU S;  1N2D A;  3HX4 A;  2JT0 A;  5KU1 A;  2B1U A;  1T14 A;  2LP3 A;  1CMF A;  2KFG A;  4PHM A;  3BFH A;  2LLS A;  2MBX A;  1JSA A;  4L9M A;  3PFV A;  1XO5 A;  2QEO A;  1DEL A;  1KSM A;  3K1E A;  3O6B A;  3S0D A;  2I94 A;  1LXF C;  1PUL A;  3EK8 A;  4DCK A;  2YGU A;  1DGV A;  4A4B A;  1TCF A;  4MLW A;  3DXL A;  5I94 A;  3OHM B;  1KK7 Y;  4JD9 A;  1UHH A;  3S0B A;  2FJU B;  1JFJ A;  4YRU A;  4QJ5 B;  1V1G A;  4I5K A;  5D69 A;  3VB1 A;  2KHN A;  2JRF A;  3LK1 A;  3PJI A;  3UNW A;  3I5H B;  2K7D A;  2KAV A;  1IH0 A;  2D8N A;  3DY9 A;  2CTN A;  1DTL A;  5D3O A;  1KCY A;  1KQM B;  2Q4U A;  1BG1 A;  2BBN A;  2KI4 B;  2Y1M A;  2JZI A;  3BUW B;  3GK2 A;  4I5L B;  2K7O A;  5AXI A;  1YX8 A;  1H8B A;  4MVF A;  1TNW A;  1CDM A;  4XJK B;  4GFT A;  1PK0 D;  1P28 A;  3EK4 A;  2O60 A;  3PM8 A;  3SS5 A;  5CSI A;  1CFC A;  4MN0 A;  3BUX B;  3GOF A;  1YUU A;  3D74 A;  2K7B A;  3ZNI A;  3I5H C;  1Z4H A;  3PAT A;  2QDI A;  1QS7 A;  4OCI A;  2L5Y A;  4YI9 A;  3TDZ A;  5HKZ A;  1KQM C;  3DYE A;  2H2K A;  1AHR A;  1YX7 A;  2EGD A;  2KI4 C;  1IIO A;  1K2H A;  4ORB B;  1B1G A;  5HKW A;  2KFH A;  3S0A A;  2M1K B;  2CCM A;  3QME A;  1CB1 A;  2K60 A;  3OB1 B;  1IJ6 A;  3I5G B;  2K2A A;  3DZT A;  4WQ3 A;  2KI6 C;  1XVJ A;  2KAX A;  2BEC A;  2LC5 A;  1NX0 A;  1XYD A;  1TTX A;  2JTZ A;  2WC6 A;  1DJH A;  2LLU A;  1F70 A;  3CZ1 A;  1DVI A;  1TNX A;  3FS7 A;  4I5N B;  3SG5 A;  3IQO A;  3D75 A;  2JXC A;  1A75 A;  4TNC A;  1KFX L;  3LLE A;  1F8H A;  2OS8 B;  3KF9 A;  2BCX A;  3NXA A;  3I5G C;  3S0G A;  2WCJ A;  1ODB A;  1NCZ A;  1XFW O;  1RFJ A;  1H4B A;  1IJ5 A;  3H4S E;  4JQ0 D;  3GK1 A;  1OOF A;  1R2U A;  2SAS A;  3EKJ A;  4HSZ A;  1JC2 A;  3NSI A;  1MR8 A;  4ORA B;  1PVB A;  2L4I A;  2AAO A;  1IQ3 A;  1XFV O;  1KFU L;  1OOH A;  2M8U A;  3FE9 A;  3CZ2 A;  1TUZ A;  2OS8 C;  2OTG B;  1QX5 B;  4JWQ A;  2ZRS A;  2L5X B;  4A4C A;  4MSP A;  1A4P A;  1QV0 A;  3L4L A;  2ZKM X;  1SL7 A;  5JOL A;  1UWO A;  1J7R A;  1DC1 A;  2LLT A;  1XFR A;  3DF0 A;  5D7F A;  5KSZ A;  1G33 A;  1NCX A;  2KYF A;  2QPT A;  3SG7 A;  1LS8 A;  1S36 A;  1UUR A;  1IRJ A;  2MA2 A;  4FQT A;  4QJ4 B;  1UP5 A;  1K9K A;  2Q91 A;  4ZCU A;  1QVI Y;  2KGB C;  1XFU O;  1CNP A;  1CFF A;  3VRN A;  2HQ8 A;  4C0L A;  1A75 B;  1L7Z A;  3JVT B;  3O78 A;  4D1E A;  1DQE A;  1BR1 B;  4WQ2 A;  3TDI A;  1EG4 A;  1YRU B;  1KQV A;  2BAP A;  2K0J A;  5FYX A;  1SW8 A;  4P2Y B;  1S26 D;  2NXQ A;  3BFA A;  3LCP C;  1TNQ A;  1S6I A;  1XFY O;  1AJ5 A;  2GGZ A;  3JTD B;  2NCP A;  3KHE A;  4XYN A;  5DKR A;  1B7T Z;  2K8M B;  4YBH B;  1CFD A;  3RLZ A;  2MLE C;  4N1G A;  2KGR A;  2CNP A;  2LMU A;  2KQY A;  3KPX A;  1SBJ A;  2LUC A;  4NQG A;  2NZ0 A;  1HQV A;  1RJV A;  1WDC C;  3VRP A;  1YVL A;  2L4H A;  4PHN A;  1SL9 A;  3JTD C;  2NCO A;  1K94 A;  2L98 A;  1AK8 A;  4Q04 A;  4OV2 A;  1OSA A;  1DEK A;  5CSN A;  1UHN A;  3D10 A;  2BL0 B;  1K93 D;  1S5G Z;  2G9B A;  2PRU A;  3MSE B;  1YRT B;  2F3Z A;  2WND A;  2WCK A;  2M7L A;  1PRW A;  1WY9 A;  2LVI A;  3FE8 A;  1GM0 A;  2SCP A;  1R6P A;  2K7C A;  5CSF A;  2CBL A;  2M9G A;  2F33 A;  3O4X A;  3IF7 A;  3B87 A;  1L2O B;  4INW A;  2QAC A;  2PAL A;  1K90 D;  3CDN A;  3VRO A;  1EG3 A;  1B4C A;  1QLK A;  3PAL A;  1GGZ A;  2JU0 A;  3VGO A;  1XA5 A;  2BL0 C;  2M0R A;  1CDL A;  4QJ3 B;  5HL1 A;  3FE6 A;  5CPV A;  2RGI A;  4JPZ B;  2BBM A;  5BPJ A;  1ORG A;  3DD4 A;  5FI2 A;  5AER A;  5HKY A;  2E30 A;  1KSO A;  2ZNE A;  2ISD A;  1BU3 A;  2KQ6 A;  1BR4 B;  1DJG A;  2BCA A;  2A4J A;  2NLN A;  1ALW A;  3EK7 A;  3IQQ A;  1L2O C;  4FTG A;  4MRY A;  1U5I A;  5FI7 A;  1G4Y R;  1Y1U A;  3D0Y A;  1SCV A;  4GGF C;  4PE0 A;  2HF5 A;  3OGN A;  1LIN A;  2KPH A;  4MZL A;  1FF1 A;  2M49 B;  1MXE A;  2GV5 A;  4ZCV A;  4OKH A;  2G2B A;  2F2P A;  1MWN A;  2M97 A;  4P5O E;  3WNX B;  1F54 A;  1WRL A;  2KBI A;  4GBA A;  1OMV A;  2WOR A;  2PYQ A;  3KEV A;  2I18 A;  2PQL A;  1CFP A;  1ZUZ A;  2JT3 A;  1B8C A;  3CTN A;  4HRE E;  4CLN A;  4ICB A;  4AQJ A;  3BUM B;  2VRG A;  2HPS A;  3KO0 A;  1S1E A;  1DJX A;  4DS7 A;  1JBA A;  4OZD A;  4PHK A;  5ER4 X;  1ZAC A;  2MAZ A;  2ZFD A;  2Y1N A;  3CR4 X;  2R2I A;  1NYA A;  3CZT X;  5B8I B;  1K96 A;  5I8N A;  1BOC A;  1SRA A;  3SS4 A;  1J1E A;  2PVB A;  3CAB A;  4GAO A;  1K95 A;  3FIA A;  3GK4 X;  2L2C A;  3IVT A;  3SJS A;  1XFZ O;  4MBE A;  4YGC B;  2WCH A;  1IG5 A;  3HCM A;  1C07 A;  1GGW A;  1CTR A;  3CGA A;  4DUQ A;  3PN7 B;  1XK4 A;  4JKT A;  4OR9 B;  2JWW A;  1U5I B;  2P70 A;  1KWO B;  1REC A;  3B7A A;  3O2P A;  3D0Y B;  3R1P A;  1QV1 A;  3TUY B;  1J7Q A;  5DKN A;  1Y6W A;  3D73 A;  1NIW A;  1KK7 Z;  2LV7 A;  2KDH A;  2BKI B;  3CR2 A;  3EVR A;  3C1V A;  3D76 A;  1AUI B;  1J1D A;  3SIB A;  2Y5I A;  2KAY A;  2WC5 A;  3PN7 C;  1QIV A;  1QTX A;  4ORC B;  5HLV A;  1DF0 A;  2IS9 A;  3SIA A;  3L47 A;  1KWO C;  2M29 A;  2KSP A;  3CR5 X;  1F55 A;  1QLS A;  1LA0 A;  3TUY C;  3OX5 A;  1LA3 A;  4PHJ A;  2L50 A;  5TNC A;  1MHO A;  1DJI A;  2M7N A;  4PT1 A;  2ZRT A;  1DJZ A;  2EHB A;  1EXR A;  1TUJ A;  5DIC A;  1B9A A;  2BKH B;  1EH2 A;  5F6T A;  4AQI A;  1TCO B;  1NX2 A;  3NSK A;  4C0K A;  3UO9 A;  1HT9 A;  3R1V A;  3OX6 A;  4GGF A;  1D1O A;  3NGV A;  4PE1 A;  3SG3 A;  1WDC B;  3TS5 B;  1LVC D;  1GJY A;  1YVH A;  1QX2 A;  1M45 A;  1NX3 A;  1W9Z A;  1OE9 B;  2FOT A;  2LHL A;  2QEH A;  4OVN F;  2JTT A;  2AMI A;  1FI6 A;  1JF0 A;  2JPO A;  1CM4 A;  1QAS A;  2MHH A;  1CLL A;  4E68 A;  1X02 A;  1UHI A;  5HLO A;  3RM1 A;  1CLM A;  2Y4Q A;  1SR6 B;  3V2L A;  1CDP A;  3A4U B;  3WHU B;  5IBW A;  1BLQ A;  1CKK A;  1PVA A;  1W7I B;  2BE6 A;  4AOM A;  2KBM A;  3TS5 C;  1OZO A;  1XK4 C;  3F45 A;  1Y1X A;  1IGV A;  1DF0 B;  4NDB A;  2WCM A;  2MJW B;  2F8P A;  1B47 A;  2E6W A;  3FWB A;  4C0J A;  5I2Q A;  3PM2 A;  5EL2 A;  1ZOT B;  3DF0 B;  1NWD A;  3O4Y A;  1AJ4 A;  2KOT A;  5J3X A;  1RWY A;  4BY5 A;  3DVJ A;  2LVK A;  5I2L A;  1SR6 C;  4GPL B;  1M39 A;  1E8A A;  5DKQ A;  1EL4 A;  1OMD A;  1OZS A;  3LK0 A;  2HQW A;  3CWG A;  2LHI A;  2CT9 A;  2MLF C;  3QRX A;  1TOP A;  4NDC A;  3BJH A;  4YI8 A;  1W7J B;  4USL A;  5I2O A;  4XJK A;  4CFQ A;  1JWD A;  3K21 A;  2LAP A;  3BQ3 A;  2F2O A;  3BXK A;  2BCB A;  2WCL A;  3I5F B;  5AFP A;  1SY9 A;  1S6C A;  2K2F A;  4PE7 A;  4YGB B;  1VRK A;  3AAJ A;  4I5J A;  1RTP 1;  1IKU A;  1K9U A;  5GQQ C;  2H61 A;  4DRW A;  5K89 A;  2LCP A;  5AAN A;  3M0W A;  1CM1 A;  1OOG A;  4FQO A;  3CZ0 A;  4M2Q A;  3BFB A;  1AVS A;  2JUL A;  4CID A;  1M31 A;  2KLE A;  1S3P A;  1C3Z A;  1FBV A;  2GTE A;  3OP0 A;  4IL1 A;  1F4O A;  1QVI Z;  1A2X A;  1K8U A;  1YUT A;  2H8V A;  2P71 A;  3I5F C;  4N5X A;  4GGN A;  3D77 A;  4U8D A;  1CLB A;  1QXP A;  1NCY A;  1M63 B;  2PAS A;  1DJY A;  3FWC A;  1PSB A;  1QWV A;  1QAT A;  2CXJ A;  3AKB A;  1FW4 A;  1ZMZ A;  4MEW A;  4CPV A;  1Y1A A;  4MRX A;  4MZJ A;  4ETO A;  1NP8 A;  2PMY A;  3CYZ A;  1MF8 B;  2WOS A;  2JXL A;  2AUC A;  1XFX O;  3PLF B;  1IQ5 A;  1WRK A;  2JT8 A;  1SPY A;  2LMV A; 
#chains in the Genus database with same CATH homology
 2FCD A;  1YR5 A;  1JUO A;  1N0Y A;  2JOJ A;  3ZWH A;  1QJT A;  1SCM B;  2ZN8 A;  3SG6 A;  3EVU A;  4M2P A;  1LKJ A;  2L0P A;  1FPW A;  3AKA A;  1B8R A;  1SYM A;  2KI6 D;  3LL8 B;  2V53 A;  2WCF A;  1MXL C;  4BY4 A;  2L51 A;  1YUR A;  1RK9 A;  1NX1 A;  2LP2 A;  1Y0V H;  1ALV A;  4GNK B;  2KNE A;  2L2E A;  1TRF A;  1SCM C;  1WLZ A;  3TDU A;  1CMG A;  2DOQ A;  4HRG A;  1B7T Y;  4DIR A;  1SNL A;  2WC8 A;  3CLN A;  1DJW A;  2JC2 A;  4PAL A;  1JF2 A;  1C7W A;  1A29 A;  1PSR A;  2H61 C;  1A03 A;  1EJ3 A;  1WLM A;  5KTY A;  2GGM A;  1BMO A;  3DVM A;  3OB2 B;  5PAL A;  3EKH A;  3SG2 A;  3E3R A;  2ZN9 A;  2COL B;  2LM5 A;  1RRO A;  3TZ1 A;  1ZFS A;  3BYA A;  4CFR A;  1SL8 A;  1OMR A;  5G08 A;  3AAK A;  1V1F A;  2PSR A;  1SK6 D;  3VRQ A;  1Q80 A;  1F4Q A;  1S5G Y;  1NPQ A;  1NSH A;  3NSL A;  2O5G A;  2I2R E;  1YTZ C;  4M2O A;  4PE4 A;  2P6B B;  4PDZ A;  2HET A;  1C7V A;  3VRR A;  1M46 A;  5JJG A;  1DT7 B;  3BUN B;  1N65 A;  2JQ6 A;  2WCB A;  1SMG A;  2LAN A;  1UHK A;  2M1U A;  3BOW A;  3I5I B;  4N1F A;  1BOD A;  1JBA A;  1KK8 B;  1FI5 A;  1BJF A;  2JNF A;  1NUB A;  2LVJ A;  2LNK A;  2WCE A;  1MUX A;  1MQ1 A;  3BUO B;  1SKT A;  2FCE A;  2LMT A;  1J7P A;  1BF5 A;  3WXA A;  2LE9 B;  2BE4 A;  1WRZ A;  2OTG C;  4R1E A;  5ER5 A;  2JNX A;  3ICB A;  2LUX A;  1YUS A;  1DGU A;  1JFK A;  2KYC A;  2EC6 B;  3I5I C;  1PAL A;  1UHJ A;  3A8R A;  3DVE A;  1F71 A;  1KK8 C;  2F3Y A;  2JPT A;  4F0Z B;  3DVK A;  1UUS A;  2M3W A;  4WRI A;  3SG4 A;  1B8L A;  1GQM A;  1QX7 A;  3EVV A;  1TN4 A;  4HRH A;  5CSJ A;  5HYD A;  1J7O A;  4NDD A;  1AP4 A;  1DMO A;  3PSR A;  1TNP A;  1OQP A;  3CS1 A;  4MZK A;  2TN4 A;  3WHT B;  1KFX S;  1J55 A;  1TIZ A;  1OOJ A;  1S6J A;  2KFF A;  2OPO A;  1G8I A;  1BT6 A;  1IWQ A;  2EC6 C;  3NSO A;  2I7A A;  1QIW A;  1CDN A;  1K9P A;  5AEQ A;  4YGD B;  2LVV A;  3JVT C;  4PCW A;  4YGE B;  4YGA A;  4UPG A;  4GUK A;  2MRD A;  3BOW B;  2K61 A;  1KFU S;  1N2D A;  3HX4 A;  2JT0 A;  5KU1 A;  2B1U A;  2LP3 A;  1CMF A;  2KFG A;  4PHM A;  2LLS A;  2MBX A;  1JSA A;  4L9M A;  3PFV A;  1XO5 A;  1KSM A;  3O6B A;  2I94 A;  1LXF C;  1PUL A;  3EK8 A;  4DCK A;  1DGV A;  4A4B A;  1TCF A;  4MLW A;  3OHM B;  1KK7 Y;  1UHH A;  2FJU B;  1JFJ A;  4YRU A;  4QJ5 B;  1V1G A;  4I5K A;  5D69 A;  2KHN A;  2JRF A;  3LK1 A;  3I5H B;  2K7D A;  2KAV A;  1IH0 A;  2D8N A;  2CTN A;  1DTL A;  1KCY A;  1KQM B;  2Q4U A;  1BG1 A;  2BBN A;  2KI4 B;  2Y1M A;  2JZI A;  3BUW B;  3GK2 A;  4I5L B;  2K7O A;  5AXI A;  1YX8 A;  1H8B A;  4MVF A;  1TNW A;  1CDM A;  4XJK B;  4GFT A;  1PK0 D;  3EK4 A;  2O60 A;  3PM8 A;  5CSI A;  1CFC A;  4MN0 A;  3BUX B;  3GOF A;  1YUU A;  2K7B A;  3ZNI A;  3I5H C;  3PAT A;  1QS7 A;  4OCI A;  4YI9 A;  3TDZ A;  5HKZ A;  1KQM C;  2H2K A;  1AHR A;  1YX7 A;  2EGD A;  2KI4 C;  1K2H A;  4ORB B;  1B1G A;  5HKW A;  2KFH A;  2M1K B;  2CCM A;  1CB1 A;  3OB1 B;  1IJ6 A;  3I5G B;  2K2A A;  4WQ3 A;  2KI6 C;  1XVJ A;  2KAX A;  2BEC A;  2LC5 A;  1NX0 A;  1XYD A;  1TTX A;  2JTZ A;  1DJH A;  2LLU A;  1F70 A;  1DVI A;  1TNX A;  3FS7 A;  4I5N B;  3SG5 A;  3IQO A;  2JXC A;  1A75 A;  4TNC A;  1KFX L;  3LLE A;  1F8H A;  2OS8 B;  3KF9 A;  2BCX A;  3NXA A;  3I5G C;  1ODB A;  1NCZ A;  1XFW O;  1RFJ A;  1H4B A;  1IJ5 A;  3H4S E;  4JQ0 D;  3GK1 A;  1R2U A;  2SAS A;  3EKJ A;  4HSZ A;  1JC2 A;  3NSI A;  1MR8 A;  4ORA B;  1PVB A;  2L4I A;  2AAO A;  1IQ3 A;  1XFV O;  1KFU L;  2M8U A;  4JWQ A;  2OS8 C;  2OTG B;  1QX5 B;  2ZRS A;  2L5X B;  4A4C A;  4MSP A;  1A4P A;  1QV0 A;  2ZKM X;  1SL7 A;  1UWO A;  1J7R A;  2LLT A;  3DF0 A;  5D7F A;  5KSZ A;  1G33 A;  1NCX A;  2KYF A;  2QPT A;  3SG7 A;  1S36 A;  1UUR A;  1IRJ A;  2MA2 A;  4QJ4 B;  1UP5 A;  1K9K A;  2Q91 A;  4ZCU A;  1QVI Y;  2KGB C;  1XFU O;  1CNP A;  1CFF A;  3VRN A;  2HQ8 A;  4C0L A;  1A75 B;  1L7Z A;  3JVT B;  3O78 A;  4D1E A;  1BR1 B;  4WQ2 A;  3TDI A;  1EG4 A;  1YRU B;  1KQV A;  2K0J A;  5FYX A;  1SW8 A;  4P2Y B;  1S26 D;  2NXQ A;  3LCP C;  1TNQ A;  1S6I A;  1XFY O;  1AJ5 A;  2GGZ A;  3JTD B;  2NCP A;  3KHE A;  4XYN A;  5DKR A;  1B7T Z;  2K8M B;  4YBH B;  1CFD A;  3RLZ A;  2MLE C;  4N1G A;  2KGR A;  2CNP A;  2LMU A;  2KQY A;  3KPX A;  1SBJ A;  2LUC A;  4NQG A;  2NZ0 A;  1HQV A;  1RJV A;  1WDC C;  3VRP A;  1YVL A;  2L4H A;  4PHN A;  1SL9 A;  3JTD C;  2NCO A;  1K94 A;  2L98 A;  1AK8 A;  4Q04 A;  4OV2 A;  1OSA A;  5CSN A;  1UHN A;  3D10 A;  2BL0 B;  1K93 D;  1S5G Z;  2G9B A;  2PRU A;  3MSE B;  1YRT B;  2F3Z A;  2WND A;  2M7L A;  1PRW A;  1WY9 A;  2LVI A;  2SCP A;  1R6P A;  2K7C A;  5CSF A;  2CBL A;  2M9G A;  2F33 A;  3IF7 A;  1L2O B;  2QAC A;  2PAL A;  1K90 D;  3VRO A;  1EG3 A;  1B4C A;  1QLK A;  3PAL A;  1GGZ A;  2JU0 A;  3VGO A;  1XA5 A;  2BL0 C;  2M0R A;  1CDL A;  4QJ3 B;  5CPV A;  2RGI A;  4JPZ B;  2BBM A;  5BPJ A;  3DD4 A;  5HKY A;  2E30 A;  1KSO A;  2ZNE A;  2ISD A;  1BU3 A;  2KQ6 A;  1BR4 B;  2BCA A;  1DJG A;  2A4J A;  2NLN A;  1ALW A;  3EK7 A;  3IQQ A;  1L2O C;  4FTG A;  4MRY A;  1U5I A;  5JOL A;  1G4Y R;  1Y1U A;  3D0Y A;  1SCV A;  4GGF C;  4PE0 A;  2HF5 A;  1LIN A;  1FF1 A;  4MZL A;  2M49 B;  1MXE A;  2GV5 A;  4ZCV A;  4OKH A;  2G2B A;  2F2P A;  1MWN A;  2M97 A;  4P5O E;  3WNX B;  1F54 A;  1WRL A;  2KBI A;  4GBA A;  1OMV A;  2WOR A;  3KEV A;  2I18 A;  1CFP A;  1ZUZ A;  2JT3 A;  1B8C A;  3CTN A;  4HRE E;  4CLN A;  4ICB A;  4AQJ A;  3BUM B;  2VRG A;  2HPS A;  3KO0 A;  1S1E A;  1DJX A;  4DS7 A;  4PHK A;  5ER4 X;  1ZAC A;  2MAZ A;  2ZFD A;  2Y1N A;  3CR4 X;  2R2I A;  1NYA A;  3CZT X;  5B8I B;  1K96 A;  5I8N A;  1BOC A;  1SRA A;  1J1E A;  2PVB A;  4GAO A;  1K95 A;  3FIA A;  3GK4 X;  3SJS A;  1XFZ O;  4MBE A;  4YGC B;  3HCM A;  1IG5 A;  1C07 A;  1GGW A;  1CTR A;  3CGA A;  4DUQ A;  3PN7 B;  1XK4 A;  4OR9 B;  2JWW A;  1U5I B;  3O2P A;  1KWO B;  1REC A;  3D0Y B;  1QV1 A;  3TUY B;  1J7Q A;  5DKN A;  1Y6W A;  1NIW A;  1KK7 Z;  2LV7 A;  2KDH A;  2BKI B;  3CR2 A;  3EVR A;  3C1V A;  1AUI B;  1J1D A;  3SIB A;  2Y5I A;  2KAY A;  3PN7 C;  5HLV A;  1QIV A;  1QTX A;  4ORC B;  3SIA A;  1DF0 A;  2IS9 A;  1KWO C;  2M29 A;  2KSP A;  3CR5 X;  1F55 A;  1QLS A;  1LA0 A;  3TUY C;  3OX5 A;  1LA3 A;  4PHJ A;  2L50 A;  5TNC A;  1MHO A;  1DJI A;  2M7N A;  2ZRT A;  1DJZ A;  2EHB A;  1EXR A;  1B9A A;  2BKH B;  1EH2 A;  5F6T A;  4AQI A;  1TCO B;  1NX2 A;  3NSK A;  4C0K A;  1HT9 A;  4GGF A;  3OX6 A;  1D1O A;  4PE1 A;  3SG3 A;  1WDC B;  3TS5 B;  1LVC D;  1GJY A;  1YVH A;  1QX2 A;  1M45 A;  1NX3 A;  2FOT A;  1OE9 B;  2ZND A;  2LHL A;  4OVN F;  1FI6 A;  2JTT A;  2AMI A;  1JF0 A;  1CM4 A;  1QAS A;  2MHH A;  1CLL A;  4E68 A;  1X02 A;  1UHI A;  5HLO A;  3RM1 A;  1CLM A;  2Y4Q A;  1SR6 B;  3WHU B;  1CDP A;  3A4U B;  5IBW A;  1BLQ A;  1CKK A;  1PVA A;  1W7I B;  2BE6 A;  4AOM A;  2KBM A;  3TS5 C;  1OZO A;  1XK4 C;  3F45 A;  1Y1X A;  1IGV A;  1DF0 B;  4NDB A;  2MJW B;  2F8P A;  1B47 A;  2E6W A;  3FWB A;  4C0J A;  5I2Q A;  1ZOT B;  3DF0 B;  1NWD A;  3O4Y A;  1AJ4 A;  2KOT A;  5J3X A;  1RWY A;  4BY5 A;  3DVJ A;  2LVK A;  5I2L A;  1SR6 C;  4GPL B;  1M39 A;  1E8A A;  5DKQ A;  1EL4 A;  1OMD A;  1OZS A;  3LK0 A;  2HQW A;  3CWG A;  2LHI A;  2CT9 A;  2MLF C;  3QRX A;  1TOP A;  4NDC A;  4YI8 A;  5I2O A;  1W7J B;  4USL A;  4XJK A;  4CFQ A;  1JWD A;  3K21 A;  2LAP A;  3BQ3 A;  2F2O A;  3BXK A;  2BCB A;  3I5F B;  5AFP A;  1SY9 A;  1S6C A;  2K2F A;  4PE7 A;  4YGB B;  1VRK A;  3AAJ A;  4I5J A;  1RTP 1;  1IKU A;  1K9U A;  5GQQ C;  2H61 A;  4DRW A;  5K89 A;  2LCP A;  5AAN A;  3M0W A;  1CM1 A;  4FQO A;  4M2Q A;  1AVS A;  2JUL A;  4CID A;  1M31 A;  1S3P A;  1FBV A;  3OP0 A;  4IL1 A;  1F4O A;  1QVI Z;  1A2X A;  1K8U A;  1YUT A;  5AER A;  3I5F C;  4N5X A;  4GGN A;  4U8D A;  1CLB A;  1QXP A;  1NCY A;  1M63 B;  2PAS A;  1DJY A;  3FWC A;  1PSB A;  1QAT A;  2CXJ A;  3AKB A;  1FW4 A;  1ZMZ A;  4MEW A;  4CPV A;  1Y1A A;  4MRX A;  4MZJ A;  4ETO A;  1NP8 A;  2PMY A;  1MF8 B;  2WOS A;  2JXL A;  2AUC A;  1XFX O;  3PLF B;  1IQ5 A;  1WRK A;  2JT8 A;  1SPY A;  2LMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...