5DKRA

Crystal structure of calcium-loaded s100b bound to sbi29
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
89
structure length
89
Chain Sequence
b'MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Small Molecule Inhibitors of Ca(2+)-S100B Reveal Two Protein Conformations.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein/inhibitor
total genus 34
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5dkrA00
2LUXA 5HYDA 3DF0B 5I8NA 1A75B 1YRTB 5AEQA 1QIWA 1C7WA 5TNCA 2K2AA 1N2DA 2PALA 4GUKA 4JWQA 2SASA 4D1EA 3BXKA 1QX5B 2JRFA 4GBAA 4JQ0D 2M29A 4I5NB 2HQ8A 2KFFA 4MZLA 3EK7A 4QJ5B 4CFRA 4E68A 1K96A 1SYMA 2TN4A 2JU0A 5HLVA 1R6PA 1MQ1A 1QASA 1XO5A 3AKBA 3I5IC 4AQIA 2JT0A 1PVBA 1SL8A 2O60A 1BLQA 2EC6C 1SK6D 2KHNA 2Y4QA 4OCIA 4AOMA 2LLTA 4PE0A 2L98A 2KI6C 2JXLA 1GGZA 1SMGA 2OS8B 1B47A 4GGNA 4M2PA 1NYAA 1CDNA 1ZFSA 2M49B 4N1FA 1J7OA 1XK4C 3WHUB 1Q80A 1GJYA 1UHKA 1Y1AA 3AAKA 3BUMB 1PSRA 4ETOA 1B8LA 2P6BB 1J7QA 2K0JA 1ALWA 2KYFA 3D0YA 4I5JA 5AANA 1JF2A 3NSIA 1EG4A 4MVFA 1DJHA 3LCPC 5D7FA 2WORA 4PE1A 4XJKA 1LA3A 2F8PA 1KCYA 1BR1B 1H4BA 3ZWHA 1W7JB 1NCZA 2GV5A 1XA5A 2LLUA 3I5FB 4N5XA 2F3ZA 1X02A 2LVKA 1FI5A 1S6IA 2JNFA 3BUNB 2M1UA 4YI9A 2PMYA 2H61A 3I5FC 1SCMB 3ICBA 5CSIA 1M31A 4HSZA 1PRWA 1CFPA 1J1DA 2K7CA 1QS7A 1H8BA 1TOPA 4YI8A 1WY9A 2M0RA 1KFUS 3PLFB 2BBMA 3EVUA 1YX8A 2MHHA 3GK4X 1M39A 1SKTA 1AVSA 2CBLA 2DOQA 2KOTA 2M97A 5CSJA 1F55A 1YR5A 1FPWA 2Y5IA 3FWBA 1WLZA 3EK8A 2LMTA 3TDIA 3AAJA 3TUYC 3TS5C 1MHOA 1CDMA 1UHJA 2Y1NA 2LHIA 2I18A 1A4PA 4WRIA 1KQVA 3LK0A 5DKQA 3CLNA 1KK7Z 5ER5A 2ZKMX 3DVKA 1LVCD 2FOTA 1CNPA 3IF7A 5GQQC 2OTGB 2BKIB 2IS9A 4M2OA 2KYCA 2KFHA 3KO0A 3PN7C 2LP2A 1JFJA 1A2XA 2KGBC 3EKHA 2L0PA 1HQVA 5KU1A 3I5HC 1CM1A 2LHLA 5CPVA 2L51A 5PALA 1KFXL 2BE6A 4UPGA 1MXLC 2OPOA 1QATA 1YTZC 1SR6C 2LM5A 3IQOA 1MWNA 1FF1A 1CTRA 2FCDA 1QV0A 5CSNA 1QJTA 4ORBB 3BUXB 2CXJA 1KWOB 1CFCA 1SBJA 1BT6A 4HREE 1F8HA 2NLNA 2BL0B 1XYDA 3H4SE 5FYXA 2KDHA 1Y0VH 1KWOC 1SCVA 1A03A 5B8IB 1PK0D 5HKZA 1KK8B 1WRZA 3NSKA 1ZACA 4OV2A 1YVLA 3SG3A 5DKNA 2CNPA 1V1FA 2CTNA 2QPTA 2MLFC 2LMVA 3FWCA 4M2QA 1KQMB 3LK1A 4YGAA 1F70A 1SL9A 4CFQA 1OOJA 1K9KA 1IKUA 3VRNA 1K8UA 4QJ3B 1KQMC 4YBHB 2JTTA 4BY5A 5DKRA 1DF0B 2B1UA 4AQJA 3KHEA 3GOFA 1J55A 1CMFA 2WNDA 1YRUB 1JFKA 2KAXA 4OVNF 3MSEB 2PASA 3WHTB 2I2RE 4Q04A 2JT3A 4BY4A 1WDCB 4L9MA 2ZRTA 1Y1XA 1GQMA 2Y1MA 3AKAA 4PHKA 1YX7A 2BCBA 1IRJA 1SY9A 1K94A 1E8AA 1QLSA 1TCOB 4NDDA 1CLBA 1DTLA 1RROA 1L7ZA 1PSBA 1OZOA 3OHMB 4CPVA 1BU3A 4PALA 4FQOA 3CR2A 5G08A 3TDZA 1AJ5A 2LC5A 3F45A 3VRRA 2D8NA 4MLWA 1MF8B 3WNXB 3CGAA 1C07A 2KGRA 3GK2A 5F6TA 1CB1A 5AFPA 1SW8A 4OKHA 1WLMA 1N0YA 4P2YB 2M1KB 1B7TY 2E30A 2KI4B 3CTNA 2PSRA 1SL7A 2NCPA 2OS8C 3EK4A 1M45A 2A4JA 1YUSA 1EJ3A 1GGWA 2KI4C 1OSAA 1S36A 2HETA 2LVJA 2LV7A 1MXEA 5HLOA 4HRHA 1FW4A 1KSMA 4MEWA 4OR9B 1K90D 3EVRA 1F54A 2KFGA 1K93D 1Y6WA 1Y1UA 3D0YB 2GGMA 1MR8A 2CT9A 1IWQA 1KFXS 1SPYA 1IJ6A 1EL4A 2RGIA 4DRWA 2ZN8A 4HRGA 3O2PA 4MZJA 4PCWA 3SJSA 4XJKB 1TTXA 3I5GB 1ALVA 2F2OA 1XVJA 4YGEB 3FIAA 1NCYA 1OQPA 1XFUO 4XYNA 1OE9B 4F0ZB 1NIWA 1PALA 2MAZA 3I5GC 4ICBA 1SCMC 2F33A 3QRXA 1W7IB 3ZNIA 1XFXO 3RLZA 1D1OA 1AUIB 1UHHA 2KBIA 2ZNEA 2JXCA 2MA2A 3KEVA 4ZCVA 1JUOA 3EVVA 3FS7A 1JBAA 5KTYA 3RM1A 1QX7A 1QTXA 5JJGA 1OZSA 1JF0A 1NPQA 1BOCA 1UP5A 4GPLB 1SRAA 1UUSA 2JPTA 4C0JA 1G8IA 2MJWB 2AMIA 4YRUA 1L2OB 3VRPA 2JTZA 1NSHA 2L5XB 4I5KA 2M3WA 1QX2A 1IQ3A 4WQ3A 5IBWA 3DVMA 3PATA 2Q4UA 2BE4A 3SG5A 2OTGC 4USLA 4C0LA 2GGZA 2JOJA 2BCXA 4DCKA 3SG4A 2L4HA 1QIVA 5J3XA 1YUTA 2BBNA 3CS1A 1NUBA 2LP3A 5ER4X 2KQYA 2K7OA 2BKHB 2K8MB 2MRDA 4PHJA 1KK7Y 1M46A 2K7BA 4PHMA 5CSFA 4YGBB 3D10A 4QJ4B 1IH0A 3SG7A 2BL0C 4I5LB 2I7AA 1EXRA 4NDCA 2JULA 1QVIZ 1TNPA 4CIDA 1RWYA 3BOWA 1TIZA 1RTP1 4MBEA 1YVHA 1U5IA 1KK8C 1S5GZ 2JNXA 2K2FA 1K2HA 2K7DA 3LL8B 2ZNDA 4GNKB 1OMVA 1TNWA 1QLKA 2BCAA 3O78A 3LLEA 2G2BA 3BYAA 1UHIA 2ISDA 4MRYA 1NWDA 3PSRA 1BJFA 2JT8A 1S3PA 2FCEA 1B1GA 3CWGA 2QACA 2F3YA 3VGOA 2JWWA 1NX1A 4GGFC 4R1EA 2G9BA 3SIAA 1TCFA 2PRUA 1AHRA 3M0WA 2L2EA 1WDCC 1BG1A 2M8UA 1JC2A 2LE9B 2SCPA 2I94A 1G33A 1DJXA 1S26D 2Q91A 3DF0A 1A75A 1LINA 2BECA 2JZIA 3A8RA 4ZCUA 3NSLA 4MSPA 2JC2A 4FTGA 2LCPA 1B7TZ 4DUQA 1ZUZA 4PE7A 4GAOA 1AK8A 5JOLA 3OB1B 1TNQA 3C1VA 1CFDA 2ZN9A 3O4YA 1EH2A 1UURA 4C0KA 1DJGA 1F71A 1IGVA 3I5IB 1DVIA 1TNXA 4A4CA 3CR5X 1TN4A 3OX5A 4MZKA 2EGDA 2KBMA 1OMRA 2KNEA 2EC6B 2ZRSA 1XK4A 1PULA 1OMDA 2HPSA 3VRQA 3VROA 2WOSA 1BMOA 3KPXA 5D69A 2KAYA 1XFWO 3DVJA 3SG6A 1DJIA 1ZMZA 1DJYA 1ODBA 3OX6A 3OP0A 5I2LA 1G4YR 2LAPA 2WC8A 1FI6A 2EHBA 5I2QA 1PVAA 3BQ3A 2LNKA 1K95A 1BR4B 4NQGA 1DT7B 1ZOTB 1NP8A 5HKWA 1C7VA 1F4OA 3DVEA 1NCXA 1DGUA 3HCMA 1CDLA 3CR4X 2H61C 2LUCA 1RK9A 1BF5A 1R2UA 4PHNA 1RFJA 1K9PA 1DMOA 2O5GA 4CLNA 1V1GA 1J7PA 3SG2A 1RJVA 3O6BA 1AP4A 2HQWA 1S1EA 3HX4A 1XFVO 1RECA 4YGDB 3TDUA 1CKKA 1B8RA 1BODA 2COLB 2LANA 1JWDA 2AUCA 4MRXA 2WCFA 1SNLA 2M7NA 4DS7A 1B8CA 1S6JA 3PFVA 1L2OC 1DGVA 1NX2A 1HT9A 1CMGA 2FJUB 1LKJA 2CCMA 1LXFC 4U8DA 1XFYO 1TRFA 3TUYB 1S6CA 5BPJA 3TS5B 4WQ2A 2L50A 2MLEC 4ORCB 2E6WA 1B9AA 2PVBA 2HF5A 3OB2B 1DJZA 3JTDB 2H2KA 1CLMA 1N65A 3DD4A 1VRKA 1CLLA 2M9GA 1A29A 2WCBA 1J1EA 1J7RA 1EG3A 2KSPA 2KAVA 4PDZA 1F4QA 3JTDC 1IG5A 2LMUA 2LVVA 4NDBA 1YURA 5AERA 3PN7B 1IJ5A 3JVTB 5K89A 2JQ6A 3BUOB 1CFFA 3I5HB 1WRLA 2V53A 4P5OE 2NXQA 1QXPA 4IL1A 2L4IA 2NCOA 4N1GA 2ZFDA 3JVTC 4YGCB 1YUUA 3A4UB 5KSZA 2NZ0A 1B4CA 1SR6B 1XFZO 3SIBA 3IQQA 3BUWB 1WRKA 1LA0A 1UHNA 1DJWA 3BOWB 3NXAA 2KQ6A 3PALA 1U5IB 4TNCA 5HKYA 1IQ5A 2K61A 3PM8A 4A4BA 1QV1A 5AXIA 2AAOA 4ORAB 3CZTX 2LLSA 1KFUL 1AJ4A 1NX3A 2F2PA 2KI6D 3K21A 4PE4A 4DIRA 1NX0A 2LVIA 2R2IA 1DF0A 1MUXA 2VRGA 2M7LA 1CM4A 1QVIY 4GGFA 1CDPA 4GFTA 3KF9A 1FBVA 1KSOA 1S5GY 3NSOA 4JPZB 2WCEA 3TZ1A 3E3RA 1K9UA 4MN0A 3GK1A 1JSAA 3WXAA 1M63B 5I2OA 2MBXA 3EKJA 1UWOA
chains in the Genus database with same CATH superfamily
2LUXA 5HYDA 3DF0B 5I8NA 1A75B 1TUJA 1YRTB 5AEQA 1QIWA 3SS3A 1C7WA 5TNCA 2FJYA 1N2DA 2K2AA 2PALA 4GUKA 2SASA 4JWQA 4D1EA 3BXKA 2ERBA 1QX5B 2JRFA 4GBAA 4JQ0D 2M29A 4I5NB 2HQ8A 2KFFA 3BFAA 4MZLA 4F7FA 3EK7A 4QJ5B 4CFRA 4E68A 1K96A 1SYMA 2TN4A 2JU0A 5HLVA 3D75A 1R6PA 2WC6A 1MQ1A 1QASA 1XO5A 3AKBA 3I5IC 4AQIA 2JT0A 1PVBA 1SL8A 2O60A 1BLQA 2EC6C 1SK6D 2KHNA 2Y4QA 4OCIA 4AOMA 2LLTA 4PE0A 2L98A 2KI6C 4KYNA 2JXLA 1GGZA 1SMGA 2OS8B 1B47A 4GGNA 4M2PA 1NYAA 1CDNA 1ZFSA 2M49B 4N1FA 1J7OA 1XK4C 3WHUB 4PT1A 1Q80A 1GJYA 1UHKA 1Y1AA 3AAKA 3BUMB 1PSRA 4ETOA 1B8LA 2P6BB 1J7QA 2K0JA 1ALWA 2KYFA 3D0YA 4I5JA 5AANA 1JF2A 3NSIA 1EG4A 4MVFA 1DJHA 3LCPC 3NHTA 2QDIA 3B86A 5D7FA 2WORA 4PE1A 4XJKA 1T14A 1LA3A 2F8PA 1KCYA 1BR1B 1H4BA 3ZWHA 1W7JB 1NCZA 2GV5A 1XA5A 2LLUA 3I5FB 4N5XA 2F3ZA 1X02A 2LVKA 1FI5A 1S6IA 2JNFA 3BUNB 2M1UA 4YI9A 2PMYA 2H61A 3I5FC 1SCMB 3D78A 3ICBA 5CSIA 1M31A 2PYQA 1PRWA 4HSZA 1CFPA 1J1DA 2K7CA 1QS7A 5I94A 1H8BA 1TOPA 4YI8A 1WY9A 2M0RA 1KFUS 3PLFB 2QEHA 2BBMA 3EVUA 1YX8A 2MHHA 1W9ZA 3B87A 3GK4X 1M39A 1SKTA 1AVSA 3DXLA 2CBLA 2DOQA 2KOTA 2YGUA 2M97A 5CSJA 1F55A 1YR5A 2WCHA 1FPWA 2Y5IA 3FWBA 1WLZA 3EK8A 2LMTA 3TDIA 3AAJA 2QEBA 5EL2A 3S0DA 1MHOA 3TS5C 3TUYC 1CDMA 1UHJA 2Y1NA 2LHIA 2I18A 1A4PA 4WRIA 3NGVA 1KQVA 3LK0A 5FI6A 5DKQA 3CLNA 1KK7Z 5ER5A 2ZKMX 3DVKA 1LVCD 2FOTA 2H8VA 1CNPA 3IF7A 5GQQC 2OTGB 2BKIB 2IS9A 4M2OA 2KYCA 2KFHA 3CABA 3KO0A 3PN7C 2LP2A 1JFJA 1A2XA 2KGBC 3EKHA 2L0PA 1HQVA 5HL1A 5KU1A 3I5HC 1CM1A 2LHLA 5CPVA 2L51A 5PALA 1KFXL 2BE6A 4UPGA 1MXLC 2OPOA 1QATA 1YTZC 1SR6C 2LM5A 3EG5B 3IQOA 1MWNA 1FF1A 1CTRA 2FCDA 1QV0A 5CSNA 1QJTA 4ORBB 3BUXB 2CXJA 1KWOB 4JKTA 3B88A 3OBVA 1SBJA 1BT6A 4HREE 5DICA 1CFCA 1F8HA 2NLNA 2L2CA 2BL0B 1XYDA 3H4SE 5FYXA 2KDHA 1Y0VH 1KWOC 1SCVA 1TWOA 1A03A 5B8IB 1PK0D 5HKZA 1KK8B 1WRZA 3NSKA 1ZACA 4OV2A 1YVLA 1ORGA 3SG3A 5DKNA 1SSEB 2CNPA 1V1FA 2GTEA 2CTNA 2QPTA 2MLFC 2LMVA 3FWCA 4M2QA 1KQMB 3CDNA 3LK1A 4YGAA 1P28A 1SL9A 1F70A 4CFQA 1OOJA 1K9KA 1IKUA 3VRNA 1K8UA 4QJ3B 1KQMC 4YBHB 2JTTA 4BY5A 5DKRA 1DF0B 2B1UA 4AQJA 3KHEA 3GOFA 1J55A 1LS8A 1CMFA 2WNDA 3FE6A 1YRUB 1JFKA 2KAXA 4OVNF 3D74A 2PASA 3MSEB 3WHTB 2I2RE 4Q04A 2JT3A 3QMEA 4BY4A 1WDCB 4L9MA 2ZRTA 3CYZA 1Y1XA 1GQMA 3S0AA 1GM0A 1DQEA 2Y1MA 3AKAA 4PHKA 1YX7A 1SY9A 1IRJA 2BCBA 1K94A 1E8AA 1QLSA 1TCOB 4NDDA 1CLBA 3BJHA 1DTLA 1RROA 3CZ2A 3R1OA 1L7ZA 1PSBA 5FI2A 1OZOA 3SS5A 3OHMB 4CPVA 1BU3A 4PALA 2JPOA 4FQOA 3CR2A 5G08A 3TDZA 3R1PA 1AJ5A 3Q8IA 2LC5A 3F45A 3VRRA 2D8NA 4MLWA 1MF8B 3WNXB 3CGAA 1C07A 2KGRA 3GK2A 3IVTA 3PJIA 5F6TA 1SW8A 4OKHA 5AFPA 1WLMA 1CB1A 1N0YA 4P2YB 2M1KB 1B7TY 2E30A 2KI4B 3CTNA 2PSRA 1SL7A 3D73A 2NCPA 2OS8C 3EK4A 1M45A 2A4JA 1YUSA 1EJ3A 1GGWA 2KI4C 1OSAA 1S36A 2HETA 2LVJA 2LV7A 1MXEA 5HLOA 4HRHA 1FW4A 1KSMA 4MEWA 4OR9B 1K90D 3EVRA 1F54A 2KFGA 1K93D 1Y6WA 1Y1UA 3D0YB 2GGMA 1MR8A 2CT9A 1IWQA 1KFXS 1SPYA 3V2LA 1IJ6A 2QEVA 1EL4A 2WCMA 2RGIA 4DRWA 2ZN8A 2PQLA 4HRGA 3O2PA 4MZJA 4PCWA 3SJSA 4XJKB 5D3OA 1TTXA 3I5GB 1ALVA 2F2OA 1XVJA 4YGEB 3FIAA 1NCYA 1OQPA 1XFUO 3N7HA 4XYNA 1OE9B 4F0ZB 1NIWA 1PALA 2MAZA 3I5GC 4ICBA 1SCMC 2F33A 3QRXA 1F71A 1W7IB 3ZNIA 1XFXO 3RLZA 1D1OA 1AUIB 1UHHA 2KBIA 2ZNEA 2JXCA 2MA2A 3KEVA 4ZCVA 1JUOA 3EVVA 3FS7A 1JBAA 5KTYA 3RM1A 1QX7A 1QTXA 5JJGA 1OZSA 1JF0A 1NPQA 1BOCA 4INXA 1UP5A 4GPLB 1SRAA 3DY9A 3EKJA 1UUSA 1DEKA 3S0BA 2JPTA 4C0JA 1G8IA 2MJWB 2KPHA 2AMIA 4YRUA 1L2OB 3VRPA 2JTZA 1NSHA 2L5XB 4I5KA 4INWA 2M3WA 1XFRA 1QX2A 1IQ3A 4WQ3A 5IBWA 3DVMA 3PATA 2Q4UA 2BE4A 3SG5A 3NHIA 2OTGC 4USLA 4C0LA 2GGZA 2JOJA 2BCXA 3BFBA 2QEOA 4DCKA 3SG4A 2K60A 2L4HA 1QIVA 3D77A 5J3XA 1YUTA 2BBNA 3CS1A 1NUBA 2LP3A 5ER4X 2KQYA 2K7OA 2BKHB 2K8MB 5FI7A 2MRDA 2P70A 4PHJA 1KK7Y 1M46A 1OW4A 2K7BA 4PHMA 5CSFA 4YGBB 3D10A 4QJ4B 1IH0A 3SG7A 2BL0C 4I5LB 2I7AA 1EXRA 4NDCA 2JULA 1QVIZ 1TNPA 3DYEA 1RWYA 3BOWA 4CIDA 1TIZA 1RTP1 4MBEA 1YVHA 1U5IA 1KK8C 1S5GZ 2JNXA 2K2FA 3B7AA 1IIOA 3D76A 1K2HA 2K7DA 3LL8B 2ZNDA 4GNKB 1OMVA 1TNWA 1QLKA 2BCAA 3O78A 3LLEA 2G2BA 3BYAA 1UHIA 3OGNA 4MRYA 1NWDA 2ISDA 3PSRA 1BJFA 3FE8A 2JT8A 1S3PA 2KLEA 2FCEA 1B1GA 3CWGA 2QACA 2F3YA 3L47A 2JWWA 1NX1A 3VGOA 4GGFC 4R1EA 2G9BA 3SIAA 1TCFA 3BFHA 1OOFA 2PRUA 3R1VA 1AHRA 3M0WA 2L2EA 1WDCC 3SS4A 1BG1A 2M8UA 1JC2A 2LE9B 2SCPA 2I94A 1G33A 1DJXA 1S26D 2Q91A 3DF0A 1A75A 1LINA 2BECA 3S0EA 2JZIA 3A8RA 4ZCUA 3NSLA 4MSPA 2JC2A 4FTGA 2LCPA 1B7TZ 4DUQA 1ZUZA 3S0GA 4PE7A 4GAOA 1AK8A 5JOLA 3OB1B 1TNQA 3C1VA 1CFDA 2ZN9A 3O4YA 1EH2A 3VB1A 1UURA 1TUZA 1DJGA 4JD9A 1IGVA 4OZDA 3I5IB 1DVIA 4C0KA 1TNXA 2L5YA 4A4CA 3CR5X 1TN4A 1C3YA 3PM2A 3OX5A 4MZKA 2EGDA 2KBMA 1OMRA 2KNEA 2EC6B 2ZRSA 1XK4A 1PULA 1OMDA 2HPSA 3VRQA 3VROA 2WOSA 1BMOA 3K1EA 3KPXA 5D69A 2KAYA 2WC5A 1XFWO 3DVJA 3SG6A 1DJIA 1QWVA 1ZMZA 1DJYA 1ODBA 2P71A 3L4AA 3OP0A 3OX6A 5I2LA 1G4YR 2LAPA 2WC8A 1FI6A 2EHBA 5I2QA 1PVAA 3BQ3A 2LNKA 1K95A 1BR4B 4NQGA 1DT7B 1ZOTB 1C3ZA 1NP8A 2KLDA 5HKWA 1C7VA 1F4OA 3DVEA 1NCXA 1DGUA 1OOIX 3HCMA 1CDLA 3CR4X 2H61C 2LUCA 1RK9A 1BF5A 1R2UA 4PHNA 1RFJA 1K9PA 1DMOA 2O5GA 4CLNA 1V1GA 1J7PA 3SG2A 1RJVA 3O6BA 4IJ7A 1AP4A 2HQWA 1S1EA 3HX4A 1XFVO 1RECA 4YGDB 3TDUA 1CKKA 1B8RA 1BODA 2COLB 3S0FA 2LANA 1JWDA 2AUCA 4MRXA 2WCFA 1SNLA 3R72A 2M7NA 4DS7A 1B8CA 1S6JA 3PFVA 1L2OC 1DGVA 1NX2A 1HT9A 1CMGA 2FJUB 1LKJA 1LXFC 2CCMA 2WCLA 4U8DA 1XFYO 1TRFA 3TUYB 1S6CA 5BPJA 3TS5B 4WQ2A 2L50A 2MLEC 4ORCB 2E6WA 1B9AA 2PVBA 2HF5A 3OB2B 1DJZA 3JTDB 2H2KA 1CLMA 1N65A 3DD4A 1VRKA 3UO9A 1CLLA 2M9GA 1A29A 2WCBA 1J1EA 1J7RA 1EG3A 2KSPA 2KAVA 4PDZA 1F4QA 3JTDC 1IG5A 2LMUA 1OOGA 2LVVA 1YURA 4NDBA 5AERA 3PN7B 2WCJA 1IJ5A 3JVTB 5K89A 2JQ6A 3BUOB 1CFFA 3I5HB 1WRLA 2V53A 4P5OE 2NXQA 1QXPA 4IL1A 2L4IA 2NCOA 4N1GA 2ZFDA 3JVTC 4YGCB 1YUUA 3A4UB 3FE9A 3RZSA 5KSZA 2NZ0A 1B4CA 1SR6B 1XFZO 1Z4HA 3CZ1A 3SIBA 2WCKA 3IQQA 3BUWB 3B6XA 1WRKA 1LA0A 2BAPA 3UNWA 1UHNA 1DJWA 3BOWB 3NXAA 2KQ6A 1OOHA 3O4XA 1U5IB 3PALA 4TNCA 5HKYA 1IQ5A 2K61A 3PM8A 4A4BA 1QV1A 5AXIA 2AAOA 4ORAB 1DC1A 3CZTX 2LLSA 2BNXA 1KFUL 1AJ4A 1NX3A 4FQTA 2F2PA 2KI6D 3DZTA 3K21A 4PE4A 4DIRA 3L4LA 1NX0A 2LVIA 2R2IA 1DF0A 1MUXA 2VRGA 2M7LA 1CM4A 1QVIY 3CZ0A 1CDPA 4GGFA 4GFTA 3KF9A 1FBVA 1KSOA 1S5GY 1Z2CB 3NSOA 4JPZB 2WCEA 3TZ1A 3E3RA 1K9UA 4MN0A 3GK1A 1JSAA 3WXAA 1M63B 5I2OA 2MBXA 1DELA 1UWOA
chains in the Genus database with same CATH topology
2LUXA 5HYDA 3DF0B 5I8NA 1A75B 1YRTB 5AEQA 1QIWA 1C7WA 5TNCA 2K2AA 1N2DA 2PALA 4GUKA 4JWQA 2SASA 4D1EA 3BXKA 1QX5B 2JRFA 4GBAA 4JQ0D 2M29A 4I5NB 2HQ8A 2KFFA 4MZLA 3EK7A 4QJ5B 4CFRA 4E68A 1K96A 1SYMA 2TN4A 2JU0A 5HLVA 1R6PA 1MQ1A 1QASA 1XO5A 3AKBA 3I5IC 4AQIA 2JT0A 1PVBA 1SL8A 2O60A 1BLQA 2EC6C 1SK6D 2KHNA 2Y4QA 4OCIA 4AOMA 2LLTA 4PE0A 2L98A 2KI6C 2JXLA 1GGZA 1SMGA 2OS8B 1B47A 4GGNA 4M2PA 1NYAA 1CDNA 1ZFSA 2M49B 4N1FA 1J7OA 1XK4C 3WHUB 1Q80A 1GJYA 1UHKA 1Y1AA 3AAKA 3BUMB 1PSRA 4ETOA 1B8LA 2P6BB 1J7QA 2K0JA 1ALWA 2KYFA 3D0YA 4I5JA 5AANA 1JF2A 3NSIA 1EG4A 4MVFA 1DJHA 3LCPC 5D7FA 2WORA 4PE1A 4XJKA 1LA3A 2F8PA 1KCYA 1BR1B 1H4BA 3ZWHA 1W7JB 1NCZA 2GV5A 1XA5A 2LLUA 3I5FB 4N5XA 2F3ZA 1X02A 2LVKA 1FI5A 1S6IA 2JNFA 3BUNB 2M1UA 4YI9A 2PMYA 2H61A 3I5FC 1SCMB 3ICBA 5CSIA 1M31A 4HSZA 1PRWA 1CFPA 1J1DA 2K7CA 1QS7A 1H8BA 1TOPA 4YI8A 1WY9A 2M0RA 1KFUS 3PLFB 2BBMA 3EVUA 1YX8A 2MHHA 3GK4X 1M39A 1SKTA 1AVSA 2CBLA 2DOQA 2KOTA 2M97A 5CSJA 1F55A 1YR5A 1FPWA 2Y5IA 3FWBA 1WLZA 3EK8A 2LMTA 3TDIA 3AAJA 3TUYC 3TS5C 1MHOA 1CDMA 1UHJA 2Y1NA 2LHIA 2I18A 1A4PA 4WRIA 1KQVA 3LK0A 5DKQA 3CLNA 1KK7Z 5ER5A 2ZKMX 3DVKA 1LVCD 2FOTA 1CNPA 3IF7A 5GQQC 2OTGB 2BKIB 2IS9A 4M2OA 2KYCA 2KFHA 3KO0A 3PN7C 2LP2A 1JFJA 1A2XA 2KGBC 3EKHA 2L0PA 1HQVA 5KU1A 3I5HC 1CM1A 2LHLA 5CPVA 2L51A 5PALA 1KFXL 2BE6A 4UPGA 1MXLC 2OPOA 1QATA 1YTZC 1SR6C 2LM5A 3IQOA 1MWNA 1FF1A 1CTRA 2FCDA 1QV0A 5CSNA 1QJTA 4ORBB 3BUXB 2CXJA 1KWOB 1CFCA 1SBJA 1BT6A 4HREE 1F8HA 2NLNA 2BL0B 1XYDA 3H4SE 5FYXA 2KDHA 1Y0VH 1KWOC 1SCVA 1A03A 5B8IB 1PK0D 5HKZA 1KK8B 1WRZA 3NSKA 1ZACA 4OV2A 1YVLA 3SG3A 5DKNA 2CNPA 1V1FA 2CTNA 2QPTA 2MLFC 2LMVA 3FWCA 4M2QA 1KQMB 3LK1A 4YGAA 1F70A 1SL9A 4CFQA 1OOJA 1K9KA 1IKUA 3VRNA 1K8UA 4QJ3B 1KQMC 4YBHB 2JTTA 4BY5A 5DKRA 1DF0B 2B1UA 4AQJA 3KHEA 3GOFA 1J55A 1CMFA 2WNDA 1YRUB 1JFKA 2KAXA 4OVNF 3MSEB 2PASA 3WHTB 2I2RE 4Q04A 2JT3A 4BY4A 1WDCB 4L9MA 2ZRTA 1Y1XA 1GQMA 2Y1MA 3AKAA 4PHKA 1YX7A 2BCBA 1IRJA 1SY9A 1K94A 1E8AA 1QLSA 1TCOB 4NDDA 1CLBA 1DTLA 1RROA 1L7ZA 1PSBA 1OZOA 3OHMB 4CPVA 1BU3A 4PALA 4FQOA 3CR2A 5G08A 3TDZA 1AJ5A 2LC5A 3F45A 3VRRA 2D8NA 4MLWA 1MF8B 3WNXB 3CGAA 1C07A 2KGRA 3GK2A 5F6TA 1CB1A 5AFPA 1SW8A 4OKHA 1WLMA 1N0YA 4P2YB 2M1KB 1B7TY 2E30A 2KI4B 3CTNA 2PSRA 1SL7A 2NCPA 2OS8C 3EK4A 1M45A 2A4JA 1YUSA 1EJ3A 1GGWA 2KI4C 1OSAA 1S36A 2HETA 2LVJA 2LV7A 1MXEA 5HLOA 4HRHA 1FW4A 1KSMA 4MEWA 4OR9B 1K90D 3EVRA 1F54A 2KFGA 1K93D 1Y6WA 1Y1UA 3D0YB 2GGMA 1MR8A 2CT9A 1IWQA 1KFXS 1SPYA 1IJ6A 1EL4A 2RGIA 4DRWA 2ZN8A 4HRGA 3O2PA 4MZJA 4PCWA 3SJSA 4XJKB 1TTXA 3I5GB 1ALVA 2F2OA 1XVJA 4YGEB 3FIAA 1NCYA 1OQPA 1XFUO 4XYNA 1OE9B 4F0ZB 1NIWA 1PALA 2MAZA 3I5GC 4ICBA 1SCMC 2F33A 3QRXA 1W7IB 3ZNIA 1XFXO 3RLZA 1D1OA 1AUIB 1UHHA 2KBIA 2ZNEA 2JXCA 2MA2A 3KEVA 4ZCVA 1JUOA 3EVVA 3FS7A 1JBAA 5KTYA 3RM1A 1QX7A 1QTXA 5JJGA 1OZSA 1JF0A 1NPQA 1BOCA 1UP5A 4GPLB 1SRAA 1UUSA 2JPTA 4C0JA 1G8IA 2MJWB 2AMIA 4YRUA 1L2OB 3VRPA 2JTZA 1NSHA 2L5XB 4I5KA 2M3WA 1QX2A 1IQ3A 4WQ3A 5IBWA 3DVMA 3PATA 2Q4UA 2BE4A 3SG5A 2OTGC 4USLA 4C0LA 2GGZA 2JOJA 2BCXA 4DCKA 3SG4A 2L4HA 1QIVA 5J3XA 1YUTA 2BBNA 3CS1A 1NUBA 2LP3A 5ER4X 2KQYA 2K7OA 2BKHB 2K8MB 2MRDA 4PHJA 1KK7Y 1M46A 2K7BA 4PHMA 5CSFA 4YGBB 3D10A 4QJ4B 1IH0A 3SG7A 2BL0C 4I5LB 2I7AA 1EXRA 4NDCA 2JULA 1QVIZ 1TNPA 4CIDA 1RWYA 3BOWA 1TIZA 1RTP1 4MBEA 1YVHA 1U5IA 1KK8C 1S5GZ 2JNXA 2K2FA 1K2HA 2K7DA 3LL8B 2ZNDA 4GNKB 1OMVA 1TNWA 1QLKA 2BCAA 3O78A 3LLEA 2G2BA 3BYAA 1UHIA 2ISDA 4MRYA 1NWDA 3PSRA 1BJFA 2JT8A 1S3PA 2FCEA 1B1GA 3CWGA 2QACA 2F3YA 3VGOA 2JWWA 1NX1A 4GGFC 4R1EA 2G9BA 3SIAA 1TCFA 2PRUA 1AHRA 3M0WA 2L2EA 1WDCC 1BG1A 2M8UA 1JC2A 2LE9B 2SCPA 2I94A 1G33A 1DJXA 1S26D 2Q91A 3DF0A 1A75A 1LINA 2BECA 2JZIA 3A8RA 4ZCUA 3NSLA 4MSPA 2JC2A 4FTGA 2LCPA 1B7TZ 4DUQA 1ZUZA 4PE7A 4GAOA 1AK8A 5JOLA 3OB1B 1TNQA 3C1VA 1CFDA 2ZN9A 3O4YA 1EH2A 1UURA 4C0KA 1DJGA 1F71A 1IGVA 3I5IB 1DVIA 1TNXA 4A4CA 3CR5X 1TN4A 3OX5A 4MZKA 2EGDA 2KBMA 1OMRA 2KNEA 2EC6B 2ZRSA 1XK4A 1PULA 1OMDA 2HPSA 3VRQA 3VROA 2WOSA 1BMOA 3KPXA 5D69A 2KAYA 1XFWO 3DVJA 3SG6A 1DJIA 1ZMZA 1DJYA 1ODBA 3OX6A 3OP0A 5I2LA 1G4YR 2LAPA 2WC8A 1FI6A 2EHBA 5I2QA 1PVAA 3BQ3A 2LNKA 1K95A 1BR4B 4NQGA 1DT7B 1ZOTB 1NP8A 5HKWA 1C7VA 1F4OA 3DVEA 1NCXA 1DGUA 3HCMA 1CDLA 3CR4X 2H61C 2LUCA 1RK9A 1BF5A 1R2UA 4PHNA 1RFJA 1K9PA 1DMOA 2O5GA 4CLNA 1V1GA 1J7PA 3SG2A 1RJVA 3O6BA 1AP4A 2HQWA 1S1EA 3HX4A 1XFVO 1RECA 4YGDB 3TDUA 1CKKA 1B8RA 1BODA 2COLB 2LANA 1JWDA 2AUCA 4MRXA 2WCFA 1SNLA 2M7NA 4DS7A 1B8CA 1S6JA 3PFVA 1L2OC 1DGVA 1NX2A 1HT9A 1CMGA 2FJUB 1LKJA 2CCMA 1LXFC 4U8DA 1XFYO 1TRFA 3TUYB 1S6CA 5BPJA 3TS5B 4WQ2A 2L50A 2MLEC 4ORCB 2E6WA 1B9AA 2PVBA 2HF5A 3OB2B 1DJZA 3JTDB 2H2KA 1CLMA 1N65A 3DD4A 1VRKA 1CLLA 2M9GA 1A29A 2WCBA 1J1EA 1J7RA 1EG3A 2KSPA 2KAVA 4PDZA 1F4QA 3JTDC 1IG5A 2LMUA 2LVVA 4NDBA 1YURA 5AERA 3PN7B 1IJ5A 3JVTB 5K89A 2JQ6A 3BUOB 1CFFA 3I5HB 1WRLA 2V53A 4P5OE 2NXQA 1QXPA 4IL1A 2L4IA 2NCOA 4N1GA 2ZFDA 3JVTC 4YGCB 1YUUA 3A4UB 5KSZA 2NZ0A 1B4CA 1SR6B 1XFZO 3SIBA 3IQQA 3BUWB 1WRKA 1LA0A 1UHNA 1DJWA 3BOWB 3NXAA 2KQ6A 3PALA 1U5IB 4TNCA 5HKYA 1IQ5A 2K61A 3PM8A 4A4BA 1QV1A 5AXIA 2AAOA 4ORAB 3CZTX 2LLSA 1KFUL 1AJ4A 1NX3A 2F2PA 2KI6D 3K21A 4PE4A 4DIRA 1NX0A 2LVIA 2R2IA 1DF0A 1MUXA 2VRGA 2M7LA 1CM4A 1QVIY 4GGFA 1CDPA 4GFTA 3KF9A 1FBVA 1KSOA 1S5GY 3NSOA 4JPZB 2WCEA 3TZ1A 3E3RA 1K9UA 4MN0A 3GK1A 1JSAA 3WXAA 1M63B 5I2OA 2MBXA 3EKJA 1UWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUX A;  5HYD A;  3DF0 B;  5I8N A;  1A75 B;  1YRT B;  5AEQ A;  1QIW A;  1C7W A;  5TNC A;  2K2A A;  1N2D A;  2PAL A;  4GUK A;  4JWQ A;  2SAS A;  4D1E A;  3BXK A;  1QX5 B;  2JRF A;  4GBA A;  4JQ0 D;  2M29 A;  4I5N B;  2HQ8 A;  2KFF A;  4MZL A;  3EK7 A;  4QJ5 B;  4CFR A;  4E68 A;  1K96 A;  1SYM A;  2TN4 A;  2JU0 A;  5HLV A;  1R6P A;  1MQ1 A;  1QAS A;  1XO5 A;  3AKB A;  3I5I C;  4AQI A;  2JT0 A;  1PVB A;  1SL8 A;  2O60 A;  1BLQ A;  2EC6 C;  1SK6 D;  2KHN A;  2Y4Q A;  4OCI A;  4AOM A;  2LLT A;  4PE0 A;  2L98 A;  2KI6 C;  2JXL A;  1GGZ A;  1SMG A;  2OS8 B;  1B47 A;  4GGN A;  4M2P A;  1NYA A;  1CDN A;  1ZFS A;  2M49 B;  4N1F A;  1J7O A;  1XK4 C;  3WHU B;  1Q80 A;  1GJY A;  1UHK A;  1Y1A A;  3AAK A;  3BUM B;  1PSR A;  4ETO A;  1B8L A;  2P6B B;  1J7Q A;  2K0J A;  1ALW A;  2KYF A;  3D0Y A;  4I5J A;  5AAN A;  1JF2 A;  3NSI A;  1EG4 A;  4MVF A;  1DJH A;  3LCP C;  5D7F A;  2WOR A;  4PE1 A;  4XJK A;  1LA3 A;  2F8P A;  1KCY A;  1BR1 B;  1H4B A;  3ZWH A;  1W7J B;  1NCZ A;  2GV5 A;  1XA5 A;  2LLU A;  3I5F B;  4N5X A;  2F3Z A;  1X02 A;  2LVK A;  1FI5 A;  1S6I A;  2JNF A;  3BUN B;  2M1U A;  4YI9 A;  2PMY A;  2H61 A;  3I5F C;  1SCM B;  3ICB A;  5CSI A;  1M31 A;  4HSZ A;  1PRW A;  1CFP A;  1J1D A;  2K7C A;  1QS7 A;  1H8B A;  1TOP A;  4YI8 A;  1WY9 A;  2M0R A;  1KFU S;  3PLF B;  2BBM A;  3EVU A;  1YX8 A;  2MHH A;  3GK4 X;  1M39 A;  1SKT A;  1AVS A;  2CBL A;  2DOQ A;  2KOT A;  2M97 A;  5CSJ A;  1F55 A;  1YR5 A;  1FPW A;  2Y5I A;  3FWB A;  1WLZ A;  3EK8 A;  2LMT A;  3TDI A;  3AAJ A;  3TUY C;  3TS5 C;  1MHO A;  1CDM A;  1UHJ A;  2Y1N A;  2LHI A;  2I18 A;  1A4P A;  4WRI A;  1KQV A;  3LK0 A;  5DKQ A;  3CLN A;  1KK7 Z;  5ER5 A;  2ZKM X;  3DVK A;  1LVC D;  2FOT A;  1CNP A;  3IF7 A;  5GQQ C;  2OTG B;  2BKI B;  2IS9 A;  4M2O A;  2KYC A;  2KFH A;  3KO0 A;  3PN7 C;  2LP2 A;  1JFJ A;  1A2X A;  2KGB C;  3EKH A;  2L0P A;  1HQV A;  5KU1 A;  3I5H C;  1CM1 A;  2LHL A;  5CPV A;  2L51 A;  5PAL A;  1KFX L;  2BE6 A;  4UPG A;  1MXL C;  2OPO A;  1QAT A;  1YTZ C;  1SR6 C;  2LM5 A;  3IQO A;  1MWN A;  1FF1 A;  1CTR A;  2FCD A;  1QV0 A;  5CSN A;  1QJT A;  4ORB B;  3BUX B;  2CXJ A;  1KWO B;  1CFC A;  1SBJ A;  1BT6 A;  4HRE E;  1F8H A;  2NLN A;  2BL0 B;  1XYD A;  3H4S E;  5FYX A;  2KDH A;  1Y0V H;  1KWO C;  1SCV A;  1A03 A;  5B8I B;  1PK0 D;  5HKZ A;  1KK8 B;  1WRZ A;  3NSK A;  1ZAC A;  4OV2 A;  1YVL A;  3SG3 A;  5DKN A;  2CNP A;  1V1F A;  2CTN A;  2QPT A;  2MLF C;  2LMV A;  3FWC A;  4M2Q A;  1KQM B;  3LK1 A;  4YGA A;  1F70 A;  1SL9 A;  4CFQ A;  1OOJ A;  1K9K A;  1IKU A;  3VRN A;  1K8U A;  4QJ3 B;  1KQM C;  4YBH B;  2JTT A;  4BY5 A;  5DKR A;  1DF0 B;  2B1U A;  4AQJ A;  3KHE A;  3GOF A;  1J55 A;  1CMF A;  2WND A;  1YRU B;  1JFK A;  2KAX A;  4OVN F;  3MSE B;  2PAS A;  3WHT B;  2I2R E;  4Q04 A;  2JT3 A;  4BY4 A;  1WDC B;  4L9M A;  2ZRT A;  1Y1X A;  1GQM A;  2Y1M A;  3AKA A;  4PHK A;  1YX7 A;  2BCB A;  1IRJ A;  1SY9 A;  1K94 A;  1E8A A;  1QLS A;  1TCO B;  4NDD A;  1CLB A;  1DTL A;  1RRO A;  1L7Z A;  1PSB A;  1OZO A;  3OHM B;  4CPV A;  1BU3 A;  4PAL A;  4FQO A;  3CR2 A;  5G08 A;  3TDZ A;  1AJ5 A;  2LC5 A;  3F45 A;  3VRR A;  2D8N A;  4MLW A;  1MF8 B;  3WNX B;  3CGA A;  1C07 A;  2KGR A;  3GK2 A;  5F6T A;  1CB1 A;  5AFP A;  1SW8 A;  4OKH A;  1WLM A;  1N0Y A;  4P2Y B;  2M1K B;  1B7T Y;  2E30 A;  2KI4 B;  3CTN A;  2PSR A;  1SL7 A;  2NCP A;  2OS8 C;  3EK4 A;  1M45 A;  2A4J A;  1YUS A;  1EJ3 A;  1GGW A;  2KI4 C;  1OSA A;  1S36 A;  2HET A;  2LVJ A;  2LV7 A;  1MXE A;  5HLO A;  4HRH A;  1FW4 A;  1KSM A;  4MEW A;  4OR9 B;  1K90 D;  3EVR A;  1F54 A;  2KFG A;  1K93 D;  1Y6W A;  1Y1U A;  3D0Y B;  2GGM A;  1MR8 A;  2CT9 A;  1IWQ A;  1KFX S;  1SPY A;  1IJ6 A;  1EL4 A;  2RGI A;  4DRW A;  2ZN8 A;  4HRG A;  3O2P A;  4MZJ A;  4PCW A;  3SJS A;  4XJK B;  1TTX A;  3I5G B;  1ALV A;  2F2O A;  1XVJ A;  4YGE B;  3FIA A;  1NCY A;  1OQP A;  1XFU O;  4XYN A;  1OE9 B;  4F0Z B;  1NIW A;  1PAL A;  2MAZ A;  3I5G C;  4ICB A;  1SCM C;  2F33 A;  3QRX A;  1W7I B;  3ZNI A;  1XFX O;  3RLZ A;  1D1O A;  1AUI B;  1UHH A;  2KBI A;  2ZNE A;  2JXC A;  2MA2 A;  3KEV A;  4ZCV A;  1JUO A;  3EVV A;  3FS7 A;  1JBA A;  5KTY A;  3RM1 A;  1QX7 A;  1QTX A;  5JJG A;  1OZS A;  1JF0 A;  1NPQ A;  1BOC A;  1UP5 A;  4GPL B;  1SRA A;  1UUS A;  2JPT A;  4C0J A;  1G8I A;  2MJW B;  2AMI A;  4YRU A;  1L2O B;  3VRP A;  2JTZ A;  1NSH A;  2L5X B;  4I5K A;  2M3W A;  1QX2 A;  1IQ3 A;  4WQ3 A;  5IBW A;  3DVM A;  3PAT A;  2Q4U A;  2BE4 A;  3SG5 A;  2OTG C;  4USL A;  4C0L A;  2GGZ A;  2JOJ A;  2BCX A;  4DCK A;  3SG4 A;  2L4H A;  1QIV A;  5J3X A;  1YUT A;  2BBN A;  3CS1 A;  1NUB A;  2LP3 A;  5ER4 X;  2KQY A;  2K7O A;  2BKH B;  2K8M B;  2MRD A;  4PHJ A;  1KK7 Y;  1M46 A;  2K7B A;  4PHM A;  5CSF A;  4YGB B;  3D10 A;  4QJ4 B;  1IH0 A;  3SG7 A;  2BL0 C;  4I5L B;  2I7A A;  1EXR A;  4NDC A;  2JUL A;  1QVI Z;  1TNP A;  4CID A;  1RWY A;  3BOW A;  1TIZ A;  1RTP 1;  4MBE A;  1YVH A;  1U5I A;  1KK8 C;  1S5G Z;  2JNX A;  2K2F A;  1K2H A;  2K7D A;  3LL8 B;  2ZND A;  4GNK B;  1OMV A;  1TNW A;  1QLK A;  2BCA A;  3O78 A;  3LLE A;  2G2B A;  3BYA A;  1UHI A;  2ISD A;  4MRY A;  1NWD A;  3PSR A;  1BJF A;  2JT8 A;  1S3P A;  2FCE A;  1B1G A;  3CWG A;  2QAC A;  2F3Y A;  3VGO A;  2JWW A;  1NX1 A;  4GGF C;  4R1E A;  2G9B A;  3SIA A;  1TCF A;  2PRU A;  1AHR A;  3M0W A;  2L2E A;  1WDC C;  1BG1 A;  2M8U A;  1JC2 A;  2LE9 B;  2SCP A;  2I94 A;  1G33 A;  1DJX A;  1S26 D;  2Q91 A;  3DF0 A;  1A75 A;  1LIN A;  2BEC A;  2JZI A;  3A8R A;  4ZCU A;  3NSL A;  4MSP A;  2JC2 A;  4FTG A;  2LCP A;  1B7T Z;  4DUQ A;  1ZUZ A;  4PE7 A;  4GAO A;  1AK8 A;  5JOL A;  3OB1 B;  1TNQ A;  3C1V A;  1CFD A;  2ZN9 A;  3O4Y A;  1EH2 A;  1UUR A;  4C0K A;  1DJG A;  1F71 A;  1IGV A;  3I5I B;  1DVI A;  1TNX A;  4A4C A;  3CR5 X;  1TN4 A;  3OX5 A;  4MZK A;  2EGD A;  2KBM A;  1OMR A;  2KNE A;  2EC6 B;  2ZRS A;  1XK4 A;  1PUL A;  1OMD A;  2HPS A;  3VRQ A;  3VRO A;  2WOS A;  1BMO A;  3KPX A;  5D69 A;  2KAY A;  1XFW O;  3DVJ A;  3SG6 A;  1DJI A;  1ZMZ A;  1DJY A;  1ODB A;  3OX6 A;  3OP0 A;  5I2L A;  1G4Y R;  2LAP A;  2WC8 A;  1FI6 A;  2EHB A;  5I2Q A;  1PVA A;  3BQ3 A;  2LNK A;  1K95 A;  1BR4 B;  4NQG A;  1DT7 B;  1ZOT B;  1NP8 A;  5HKW A;  1C7V A;  1F4O A;  3DVE A;  1NCX A;  1DGU A;  3HCM A;  1CDL A;  3CR4 X;  2H61 C;  2LUC A;  1RK9 A;  1BF5 A;  1R2U A;  4PHN A;  1RFJ A;  1K9P A;  1DMO A;  2O5G A;  4CLN A;  1V1G A;  1J7P A;  3SG2 A;  1RJV A;  3O6B A;  1AP4 A;  2HQW A;  1S1E A;  3HX4 A;  1XFV O;  1REC A;  4YGD B;  3TDU A;  1CKK A;  1B8R A;  1BOD A;  2COL B;  2LAN A;  1JWD A;  2AUC A;  4MRX A;  2WCF A;  1SNL A;  2M7N A;  4DS7 A;  1B8C A;  1S6J A;  3PFV A;  1L2O C;  1DGV A;  1NX2 A;  1HT9 A;  1CMG A;  2FJU B;  1LKJ A;  2CCM A;  1LXF C;  4U8D A;  1XFY O;  1TRF A;  3TUY B;  1S6C A;  5BPJ A;  3TS5 B;  4WQ2 A;  2L50 A;  2MLE C;  4ORC B;  2E6W A;  1B9A A;  2PVB A;  2HF5 A;  3OB2 B;  1DJZ A;  3JTD B;  2H2K A;  1CLM A;  1N65 A;  3DD4 A;  1VRK A;  1CLL A;  2M9G A;  1A29 A;  2WCB A;  1J1E A;  1J7R A;  1EG3 A;  2KSP A;  2KAV A;  4PDZ A;  1F4Q A;  3JTD C;  1IG5 A;  2LMU A;  2LVV A;  4NDB A;  1YUR A;  5AER A;  3PN7 B;  1IJ5 A;  3JVT B;  5K89 A;  2JQ6 A;  3BUO B;  1CFF A;  3I5H B;  1WRL A;  2V53 A;  4P5O E;  2NXQ A;  1QXP A;  4IL1 A;  2L4I A;  2NCO A;  4N1G A;  2ZFD A;  3JVT C;  4YGC B;  1YUU A;  3A4U B;  5KSZ A;  2NZ0 A;  1B4C A;  1SR6 B;  1XFZ O;  3SIB A;  3IQQ A;  3BUW B;  1WRK A;  1LA0 A;  1UHN A;  1DJW A;  3BOW B;  3NXA A;  2KQ6 A;  3PAL A;  1U5I B;  4TNC A;  5HKY A;  1IQ5 A;  2K61 A;  3PM8 A;  4A4B A;  1QV1 A;  5AXI A;  2AAO A;  4ORA B;  3CZT X;  2LLS A;  1KFU L;  1AJ4 A;  1NX3 A;  2F2P A;  2KI6 D;  3K21 A;  4PE4 A;  4DIR A;  1NX0 A;  2LVI A;  2R2I A;  1DF0 A;  1MUX A;  2VRG A;  2M7L A;  1CM4 A;  1QVI Y;  4GGF A;  1CDP A;  4GFT A;  3KF9 A;  1FBV A;  1KSO A;  1S5G Y;  3NSO A;  4JPZ B;  2WCE A;  3TZ1 A;  3E3R A;  1K9U A;  4MN0 A;  3GK1 A;  1JSA A;  3WXA A;  1M63 B;  5I2O A;  2MBX A;  3EKJ A;  1UWO A; 
#chains in the Genus database with same CATH topology
 2LUX A;  5HYD A;  3DF0 B;  5I8N A;  1A75 B;  1TUJ A;  1YRT B;  5AEQ A;  1QIW A;  3SS3 A;  1C7W A;  5TNC A;  2FJY A;  1N2D A;  2K2A A;  2PAL A;  4GUK A;  2SAS A;  4JWQ A;  4D1E A;  3BXK A;  2ERB A;  1QX5 B;  2JRF A;  4GBA A;  4JQ0 D;  2M29 A;  4I5N B;  2HQ8 A;  2KFF A;  3BFA A;  4MZL A;  4F7F A;  3EK7 A;  4QJ5 B;  4CFR A;  4E68 A;  1K96 A;  1SYM A;  2TN4 A;  2JU0 A;  5HLV A;  3D75 A;  1R6P A;  2WC6 A;  1MQ1 A;  1QAS A;  1XO5 A;  3AKB A;  3I5I C;  4AQI A;  2JT0 A;  1PVB A;  1SL8 A;  2O60 A;  1BLQ A;  2EC6 C;  1SK6 D;  2KHN A;  2Y4Q A;  4OCI A;  4AOM A;  2LLT A;  4PE0 A;  2L98 A;  2KI6 C;  4KYN A;  2JXL A;  1GGZ A;  1SMG A;  2OS8 B;  1B47 A;  4GGN A;  4M2P A;  1NYA A;  1CDN A;  1ZFS A;  2M49 B;  4N1F A;  1J7O A;  1XK4 C;  3WHU B;  4PT1 A;  1Q80 A;  1GJY A;  1UHK A;  1Y1A A;  3AAK A;  3BUM B;  1PSR A;  4ETO A;  1B8L A;  2P6B B;  1J7Q A;  2K0J A;  1ALW A;  2KYF A;  3D0Y A;  4I5J A;  5AAN A;  1JF2 A;  3NSI A;  1EG4 A;  4MVF A;  1DJH A;  3LCP C;  3NHT A;  2QDI A;  3B86 A;  5D7F A;  2WOR A;  4PE1 A;  4XJK A;  1T14 A;  1LA3 A;  2F8P A;  1KCY A;  1BR1 B;  1H4B A;  3ZWH A;  1W7J B;  1NCZ A;  2GV5 A;  1XA5 A;  2LLU A;  3I5F B;  4N5X A;  2F3Z A;  1X02 A;  2LVK A;  1FI5 A;  1S6I A;  2JNF A;  3BUN B;  2M1U A;  4YI9 A;  2PMY A;  2H61 A;  3I5F C;  1SCM B;  3D78 A;  3ICB A;  5CSI A;  1M31 A;  2PYQ A;  1PRW A;  4HSZ A;  1CFP A;  1J1D A;  2K7C A;  1QS7 A;  5I94 A;  1H8B A;  1TOP A;  4YI8 A;  1WY9 A;  2M0R A;  1KFU S;  3PLF B;  2QEH A;  2BBM A;  3EVU A;  1YX8 A;  2MHH A;  1W9Z A;  3B87 A;  3GK4 X;  1M39 A;  1SKT A;  1AVS A;  3DXL A;  2CBL A;  2DOQ A;  2KOT A;  2YGU A;  2M97 A;  5CSJ A;  1F55 A;  1YR5 A;  2WCH A;  1FPW A;  2Y5I A;  3FWB A;  1WLZ A;  3EK8 A;  2LMT A;  3TDI A;  3AAJ A;  2QEB A;  5EL2 A;  3S0D A;  1MHO A;  3TS5 C;  3TUY C;  1CDM A;  1UHJ A;  2Y1N A;  2LHI A;  2I18 A;  1A4P A;  4WRI A;  3NGV A;  1KQV A;  3LK0 A;  5FI6 A;  5DKQ A;  3CLN A;  1KK7 Z;  5ER5 A;  2ZKM X;  3DVK A;  1LVC D;  2FOT A;  2H8V A;  1CNP A;  3IF7 A;  5GQQ C;  2OTG B;  2BKI B;  2IS9 A;  4M2O A;  2KYC A;  2KFH A;  3CAB A;  3KO0 A;  3PN7 C;  2LP2 A;  1JFJ A;  1A2X A;  2KGB C;  3EKH A;  2L0P A;  1HQV A;  5HL1 A;  5KU1 A;  3I5H C;  1CM1 A;  2LHL A;  5CPV A;  2L51 A;  5PAL A;  1KFX L;  2BE6 A;  4UPG A;  1MXL C;  2OPO A;  1QAT A;  1YTZ C;  1SR6 C;  2LM5 A;  3EG5 B;  3IQO A;  1MWN A;  1FF1 A;  1CTR A;  2FCD A;  1QV0 A;  5CSN A;  1QJT A;  4ORB B;  3BUX B;  2CXJ A;  1KWO B;  4JKT A;  3B88 A;  3OBV A;  1SBJ A;  1BT6 A;  4HRE E;  5DIC A;  1CFC A;  1F8H A;  2NLN A;  2L2C A;  2BL0 B;  1XYD A;  3H4S E;  5FYX A;  2KDH A;  1Y0V H;  1KWO C;  1SCV A;  1TWO A;  1A03 A;  5B8I B;  1PK0 D;  5HKZ A;  1KK8 B;  1WRZ A;  3NSK A;  1ZAC A;  4OV2 A;  1YVL A;  1ORG A;  3SG3 A;  5DKN A;  1SSE B;  2CNP A;  1V1F A;  2GTE A;  2CTN A;  2QPT A;  2MLF C;  2LMV A;  3FWC A;  4M2Q A;  1KQM B;  3CDN A;  3LK1 A;  4YGA A;  1P28 A;  1SL9 A;  1F70 A;  4CFQ A;  1OOJ A;  1K9K A;  1IKU A;  3VRN A;  1K8U A;  4QJ3 B;  1KQM C;  4YBH B;  2JTT A;  4BY5 A;  5DKR A;  1DF0 B;  2B1U A;  4AQJ A;  3KHE A;  3GOF A;  1J55 A;  1LS8 A;  1CMF A;  2WND A;  3FE6 A;  1YRU B;  1JFK A;  2KAX A;  4OVN F;  3D74 A;  2PAS A;  3MSE B;  3WHT B;  2I2R E;  4Q04 A;  2JT3 A;  3QME A;  4BY4 A;  1WDC B;  4L9M A;  2ZRT A;  3CYZ A;  1Y1X A;  1GQM A;  3S0A A;  1GM0 A;  1DQE A;  2Y1M A;  3AKA A;  4PHK A;  1YX7 A;  1SY9 A;  1IRJ A;  2BCB A;  1K94 A;  1E8A A;  1QLS A;  1TCO B;  4NDD A;  1CLB A;  3BJH A;  1DTL A;  1RRO A;  3CZ2 A;  3R1O A;  1L7Z A;  1PSB A;  5FI2 A;  1OZO A;  3SS5 A;  3OHM B;  4CPV A;  1BU3 A;  4PAL A;  2JPO A;  4FQO A;  3CR2 A;  5G08 A;  3TDZ A;  3R1P A;  1AJ5 A;  3Q8I A;  2LC5 A;  3F45 A;  3VRR A;  2D8N A;  4MLW A;  1MF8 B;  3WNX B;  3CGA A;  1C07 A;  2KGR A;  3GK2 A;  3IVT A;  3PJI A;  5F6T A;  1SW8 A;  4OKH A;  5AFP A;  1WLM A;  1CB1 A;  1N0Y A;  4P2Y B;  2M1K B;  1B7T Y;  2E30 A;  2KI4 B;  3CTN A;  2PSR A;  1SL7 A;  3D73 A;  2NCP A;  2OS8 C;  3EK4 A;  1M45 A;  2A4J A;  1YUS A;  1EJ3 A;  1GGW A;  2KI4 C;  1OSA A;  1S36 A;  2HET A;  2LVJ A;  2LV7 A;  1MXE A;  5HLO A;  4HRH A;  1FW4 A;  1KSM A;  4MEW A;  4OR9 B;  1K90 D;  3EVR A;  1F54 A;  2KFG A;  1K93 D;  1Y6W A;  1Y1U A;  3D0Y B;  2GGM A;  1MR8 A;  2CT9 A;  1IWQ A;  1KFX S;  1SPY A;  3V2L A;  1IJ6 A;  2QEV A;  1EL4 A;  2WCM A;  2RGI A;  4DRW A;  2ZN8 A;  2PQL A;  4HRG A;  3O2P A;  4MZJ A;  4PCW A;  3SJS A;  4XJK B;  5D3O A;  1TTX A;  3I5G B;  1ALV A;  2F2O A;  1XVJ A;  4YGE B;  3FIA A;  1NCY A;  1OQP A;  1XFU O;  3N7H A;  4XYN A;  1OE9 B;  4F0Z B;  1NIW A;  1PAL A;  2MAZ A;  3I5G C;  4ICB A;  1SCM C;  2F33 A;  3QRX A;  1F71 A;  1W7I B;  3ZNI A;  1XFX O;  3RLZ A;  1D1O A;  1AUI B;  1UHH A;  2KBI A;  2ZNE A;  2JXC A;  2MA2 A;  3KEV A;  4ZCV A;  1JUO A;  3EVV A;  3FS7 A;  1JBA A;  5KTY A;  3RM1 A;  1QX7 A;  1QTX A;  5JJG A;  1OZS A;  1JF0 A;  1NPQ A;  1BOC A;  4INX A;  1UP5 A;  4GPL B;  1SRA A;  3DY9 A;  3EKJ A;  1UUS A;  1DEK A;  3S0B A;  2JPT A;  4C0J A;  1G8I A;  2MJW B;  2KPH A;  2AMI A;  4YRU A;  1L2O B;  3VRP A;  2JTZ A;  1NSH A;  2L5X B;  4I5K A;  4INW A;  2M3W A;  1XFR A;  1QX2 A;  1IQ3 A;  4WQ3 A;  5IBW A;  3DVM A;  3PAT A;  2Q4U A;  2BE4 A;  3SG5 A;  3NHI A;  2OTG C;  4USL A;  4C0L A;  2GGZ A;  2JOJ A;  2BCX A;  3BFB A;  2QEO A;  4DCK A;  3SG4 A;  2K60 A;  2L4H A;  1QIV A;  3D77 A;  5J3X A;  1YUT A;  2BBN A;  3CS1 A;  1NUB A;  2LP3 A;  5ER4 X;  2KQY A;  2K7O A;  2BKH B;  2K8M B;  5FI7 A;  2MRD A;  2P70 A;  4PHJ A;  1KK7 Y;  1M46 A;  1OW4 A;  2K7B A;  4PHM A;  5CSF A;  4YGB B;  3D10 A;  4QJ4 B;  1IH0 A;  3SG7 A;  2BL0 C;  4I5L B;  2I7A A;  1EXR A;  4NDC A;  2JUL A;  1QVI Z;  1TNP A;  3DYE A;  1RWY A;  3BOW A;  4CID A;  1TIZ A;  1RTP 1;  4MBE A;  1YVH A;  1U5I A;  1KK8 C;  1S5G Z;  2JNX A;  2K2F A;  3B7A A;  1IIO A;  3D76 A;  1K2H A;  2K7D A;  3LL8 B;  2ZND A;  4GNK B;  1OMV A;  1TNW A;  1QLK A;  2BCA A;  3O78 A;  3LLE A;  2G2B A;  3BYA A;  1UHI A;  3OGN A;  4MRY A;  1NWD A;  2ISD A;  3PSR A;  1BJF A;  3FE8 A;  2JT8 A;  1S3P A;  2KLE A;  2FCE A;  1B1G A;  3CWG A;  2QAC A;  2F3Y A;  3L47 A;  2JWW A;  1NX1 A;  3VGO A;  4GGF C;  4R1E A;  2G9B A;  3SIA A;  1TCF A;  3BFH A;  1OOF A;  2PRU A;  3R1V A;  1AHR A;  3M0W A;  2L2E A;  1WDC C;  3SS4 A;  1BG1 A;  2M8U A;  1JC2 A;  2LE9 B;  2SCP A;  2I94 A;  1G33 A;  1DJX A;  1S26 D;  2Q91 A;  3DF0 A;  1A75 A;  1LIN A;  2BEC A;  3S0E A;  2JZI A;  3A8R A;  4ZCU A;  3NSL A;  4MSP A;  2JC2 A;  4FTG A;  2LCP A;  1B7T Z;  4DUQ A;  1ZUZ A;  3S0G A;  4PE7 A;  4GAO A;  1AK8 A;  5JOL A;  3OB1 B;  1TNQ A;  3C1V A;  1CFD A;  2ZN9 A;  3O4Y A;  1EH2 A;  3VB1 A;  1UUR A;  1TUZ A;  1DJG A;  4JD9 A;  1IGV A;  4OZD A;  3I5I B;  1DVI A;  4C0K A;  1TNX A;  2L5Y A;  4A4C A;  3CR5 X;  1TN4 A;  1C3Y A;  3PM2 A;  3OX5 A;  4MZK A;  2EGD A;  2KBM A;  1OMR A;  2KNE A;  2EC6 B;  2ZRS A;  1XK4 A;  1PUL A;  1OMD A;  2HPS A;  3VRQ A;  3VRO A;  2WOS A;  1BMO A;  3K1E A;  3KPX A;  5D69 A;  2KAY A;  2WC5 A;  1XFW O;  3DVJ A;  3SG6 A;  1DJI A;  1QWV A;  1ZMZ A;  1DJY A;  1ODB A;  2P71 A;  3L4A A;  3OP0 A;  3OX6 A;  5I2L A;  1G4Y R;  2LAP A;  2WC8 A;  1FI6 A;  2EHB A;  5I2Q A;  1PVA A;  3BQ3 A;  2LNK A;  1K95 A;  1BR4 B;  4NQG A;  1DT7 B;  1ZOT B;  1C3Z A;  1NP8 A;  2KLD A;  5HKW A;  1C7V A;  1F4O A;  3DVE A;  1NCX A;  1DGU A;  1OOI X;  3HCM A;  1CDL A;  3CR4 X;  2H61 C;  2LUC A;  1RK9 A;  1BF5 A;  1R2U A;  4PHN A;  1RFJ A;  1K9P A;  1DMO A;  2O5G A;  4CLN A;  1V1G A;  1J7P A;  3SG2 A;  1RJV A;  3O6B A;  4IJ7 A;  1AP4 A;  2HQW A;  1S1E A;  3HX4 A;  1XFV O;  1REC A;  4YGD B;  3TDU A;  1CKK A;  1B8R A;  1BOD A;  2COL B;  3S0F A;  2LAN A;  1JWD A;  2AUC A;  4MRX A;  2WCF A;  1SNL A;  3R72 A;  2M7N A;  4DS7 A;  1B8C A;  1S6J A;  3PFV A;  1L2O C;  1DGV A;  1NX2 A;  1HT9 A;  1CMG A;  2FJU B;  1LKJ A;  1LXF C;  2CCM A;  2WCL A;  4U8D A;  1XFY O;  1TRF A;  3TUY B;  1S6C A;  5BPJ A;  3TS5 B;  4WQ2 A;  2L50 A;  2MLE C;  4ORC B;  2E6W A;  1B9A A;  2PVB A;  2HF5 A;  3OB2 B;  1DJZ A;  3JTD B;  2H2K A;  1CLM A;  1N65 A;  3DD4 A;  1VRK A;  3UO9 A;  1CLL A;  2M9G A;  1A29 A;  2WCB A;  1J1E A;  1J7R A;  1EG3 A;  2KSP A;  2KAV A;  4PDZ A;  1F4Q A;  3JTD C;  1IG5 A;  2LMU A;  1OOG A;  2LVV A;  1YUR A;  4NDB A;  5AER A;  3PN7 B;  2WCJ A;  1IJ5 A;  3JVT B;  5K89 A;  2JQ6 A;  3BUO B;  1CFF A;  3I5H B;  1WRL A;  2V53 A;  4P5O E;  2NXQ A;  1QXP A;  4IL1 A;  2L4I A;  2NCO A;  4N1G A;  2ZFD A;  3JVT C;  4YGC B;  1YUU A;  3A4U B;  3FE9 A;  3RZS A;  5KSZ A;  2NZ0 A;  1B4C A;  1SR6 B;  1XFZ O;  1Z4H A;  3CZ1 A;  3SIB A;  2WCK A;  3IQQ A;  3BUW B;  3B6X A;  1WRK A;  1LA0 A;  2BAP A;  3UNW A;  1UHN A;  1DJW A;  3BOW B;  3NXA A;  2KQ6 A;  1OOH A;  3O4X A;  1U5I B;  3PAL A;  4TNC A;  5HKY A;  1IQ5 A;  2K61 A;  3PM8 A;  4A4B A;  1QV1 A;  5AXI A;  2AAO A;  4ORA B;  1DC1 A;  3CZT X;  2LLS A;  2BNX A;  1KFU L;  1AJ4 A;  1NX3 A;  4FQT A;  2F2P A;  2KI6 D;  3DZT A;  3K21 A;  4PE4 A;  4DIR A;  3L4L A;  1NX0 A;  2LVI A;  2R2I A;  1DF0 A;  1MUX A;  2VRG A;  2M7L A;  1CM4 A;  1QVI Y;  3CZ0 A;  1CDP A;  4GGF A;  4GFT A;  3KF9 A;  1FBV A;  1KSO A;  1S5G Y;  1Z2C B;  3NSO A;  4JPZ B;  2WCE A;  3TZ1 A;  3E3R A;  1K9U A;  4MN0 A;  3GK1 A;  1JSA A;  3WXA A;  1M63 B;  5I2O A;  2MBX A;  1DEL A;  1UWO A; 
#chains in the Genus database with same CATH homology
 2LUX A;  5HYD A;  3DF0 B;  5I8N A;  1A75 B;  1YRT B;  5AEQ A;  1QIW A;  1C7W A;  5TNC A;  2K2A A;  1N2D A;  2PAL A;  4GUK A;  4JWQ A;  2SAS A;  4D1E A;  3BXK A;  1QX5 B;  2JRF A;  4GBA A;  4JQ0 D;  2M29 A;  4I5N B;  2HQ8 A;  2KFF A;  4MZL A;  3EK7 A;  4QJ5 B;  4CFR A;  4E68 A;  1K96 A;  1SYM A;  2TN4 A;  2JU0 A;  5HLV A;  1R6P A;  1MQ1 A;  1QAS A;  1XO5 A;  3AKB A;  3I5I C;  4AQI A;  2JT0 A;  1PVB A;  1SL8 A;  2O60 A;  1BLQ A;  2EC6 C;  1SK6 D;  2KHN A;  2Y4Q A;  4OCI A;  4AOM A;  2LLT A;  4PE0 A;  2L98 A;  2KI6 C;  2JXL A;  1GGZ A;  1SMG A;  2OS8 B;  1B47 A;  4GGN A;  4M2P A;  1NYA A;  1CDN A;  1ZFS A;  2M49 B;  4N1F A;  1J7O A;  1XK4 C;  3WHU B;  1Q80 A;  1GJY A;  1UHK A;  1Y1A A;  3AAK A;  3BUM B;  1PSR A;  4ETO A;  1B8L A;  2P6B B;  1J7Q A;  2K0J A;  1ALW A;  2KYF A;  3D0Y A;  4I5J A;  5AAN A;  1JF2 A;  3NSI A;  1EG4 A;  4MVF A;  1DJH A;  3LCP C;  5D7F A;  2WOR A;  4PE1 A;  4XJK A;  1LA3 A;  2F8P A;  1KCY A;  1BR1 B;  1H4B A;  3ZWH A;  1W7J B;  1NCZ A;  2GV5 A;  1XA5 A;  2LLU A;  3I5F B;  4N5X A;  2F3Z A;  1X02 A;  2LVK A;  1FI5 A;  1S6I A;  2JNF A;  3BUN B;  2M1U A;  4YI9 A;  2PMY A;  2H61 A;  3I5F C;  1SCM B;  3ICB A;  5CSI A;  1M31 A;  4HSZ A;  1PRW A;  1CFP A;  1J1D A;  2K7C A;  1QS7 A;  1H8B A;  1TOP A;  4YI8 A;  1WY9 A;  2M0R A;  1KFU S;  3PLF B;  2BBM A;  3EVU A;  1YX8 A;  2MHH A;  3GK4 X;  1M39 A;  1SKT A;  1AVS A;  2CBL A;  2DOQ A;  2KOT A;  2M97 A;  5CSJ A;  1F55 A;  1YR5 A;  1FPW A;  2Y5I A;  3FWB A;  1WLZ A;  3EK8 A;  2LMT A;  3TDI A;  3AAJ A;  3TUY C;  3TS5 C;  1MHO A;  1CDM A;  1UHJ A;  2Y1N A;  2LHI A;  2I18 A;  1A4P A;  4WRI A;  1KQV A;  3LK0 A;  5DKQ A;  3CLN A;  1KK7 Z;  5ER5 A;  2ZKM X;  3DVK A;  1LVC D;  2FOT A;  1CNP A;  3IF7 A;  5GQQ C;  2OTG B;  2BKI B;  2IS9 A;  4M2O A;  2KYC A;  2KFH A;  3KO0 A;  3PN7 C;  2LP2 A;  1JFJ A;  1A2X A;  2KGB C;  3EKH A;  2L0P A;  1HQV A;  5KU1 A;  3I5H C;  1CM1 A;  2LHL A;  5CPV A;  2L51 A;  5PAL A;  1KFX L;  2BE6 A;  4UPG A;  1MXL C;  2OPO A;  1QAT A;  1YTZ C;  1SR6 C;  2LM5 A;  3IQO A;  1MWN A;  1FF1 A;  1CTR A;  2FCD A;  1QV0 A;  5CSN A;  1QJT A;  4ORB B;  3BUX B;  2CXJ A;  1KWO B;  1CFC A;  1SBJ A;  1BT6 A;  4HRE E;  1F8H A;  2NLN A;  2BL0 B;  1XYD A;  3H4S E;  5FYX A;  2KDH A;  1Y0V H;  1KWO C;  1SCV A;  1A03 A;  5B8I B;  1PK0 D;  5HKZ A;  1KK8 B;  1WRZ A;  3NSK A;  1ZAC A;  4OV2 A;  1YVL A;  3SG3 A;  5DKN A;  2CNP A;  1V1F A;  2CTN A;  2QPT A;  2MLF C;  2LMV A;  3FWC A;  4M2Q A;  1KQM B;  3LK1 A;  4YGA A;  1F70 A;  1SL9 A;  4CFQ A;  1OOJ A;  1K9K A;  1IKU A;  3VRN A;  1K8U A;  4QJ3 B;  1KQM C;  4YBH B;  2JTT A;  4BY5 A;  5DKR A;  1DF0 B;  2B1U A;  4AQJ A;  3KHE A;  3GOF A;  1J55 A;  1CMF A;  2WND A;  1YRU B;  1JFK A;  2KAX A;  4OVN F;  3MSE B;  2PAS A;  3WHT B;  2I2R E;  4Q04 A;  2JT3 A;  4BY4 A;  1WDC B;  4L9M A;  2ZRT A;  1Y1X A;  1GQM A;  2Y1M A;  3AKA A;  4PHK A;  1YX7 A;  2BCB A;  1IRJ A;  1SY9 A;  1K94 A;  1E8A A;  1QLS A;  1TCO B;  4NDD A;  1CLB A;  1DTL A;  1RRO A;  1L7Z A;  1PSB A;  1OZO A;  3OHM B;  4CPV A;  1BU3 A;  4PAL A;  4FQO A;  3CR2 A;  5G08 A;  3TDZ A;  1AJ5 A;  2LC5 A;  3F45 A;  3VRR A;  2D8N A;  4MLW A;  1MF8 B;  3WNX B;  3CGA A;  1C07 A;  2KGR A;  3GK2 A;  5F6T A;  1CB1 A;  5AFP A;  1SW8 A;  4OKH A;  1WLM A;  1N0Y A;  4P2Y B;  2M1K B;  1B7T Y;  2E30 A;  2KI4 B;  3CTN A;  2PSR A;  1SL7 A;  2NCP A;  2OS8 C;  3EK4 A;  1M45 A;  2A4J A;  1YUS A;  1EJ3 A;  1GGW A;  2KI4 C;  1OSA A;  1S36 A;  2HET A;  2LVJ A;  2LV7 A;  1MXE A;  5HLO A;  4HRH A;  1FW4 A;  1KSM A;  4MEW A;  4OR9 B;  1K90 D;  3EVR A;  1F54 A;  2KFG A;  1K93 D;  1Y6W A;  1Y1U A;  3D0Y B;  2GGM A;  1MR8 A;  2CT9 A;  1IWQ A;  1KFX S;  1SPY A;  1IJ6 A;  1EL4 A;  2RGI A;  4DRW A;  2ZN8 A;  4HRG A;  3O2P A;  4MZJ A;  4PCW A;  3SJS A;  4XJK B;  1TTX A;  3I5G B;  1ALV A;  2F2O A;  1XVJ A;  4YGE B;  3FIA A;  1NCY A;  1OQP A;  1XFU O;  4XYN A;  1OE9 B;  4F0Z B;  1NIW A;  1PAL A;  2MAZ A;  3I5G C;  4ICB A;  1SCM C;  2F33 A;  3QRX A;  1W7I B;  3ZNI A;  1XFX O;  3RLZ A;  1D1O A;  1AUI B;  1UHH A;  2KBI A;  2ZNE A;  2JXC A;  2MA2 A;  3KEV A;  4ZCV A;  1JUO A;  3EVV A;  3FS7 A;  1JBA A;  5KTY A;  3RM1 A;  1QX7 A;  1QTX A;  5JJG A;  1OZS A;  1JF0 A;  1NPQ A;  1BOC A;  1UP5 A;  4GPL B;  1SRA A;  1UUS A;  2JPT A;  4C0J A;  1G8I A;  2MJW B;  2AMI A;  4YRU A;  1L2O B;  3VRP A;  2JTZ A;  1NSH A;  2L5X B;  4I5K A;  2M3W A;  1QX2 A;  1IQ3 A;  4WQ3 A;  5IBW A;  3DVM A;  3PAT A;  2Q4U A;  2BE4 A;  3SG5 A;  2OTG C;  4USL A;  4C0L A;  2GGZ A;  2JOJ A;  2BCX A;  4DCK A;  3SG4 A;  2L4H A;  1QIV A;  5J3X A;  1YUT A;  2BBN A;  3CS1 A;  1NUB A;  2LP3 A;  5ER4 X;  2KQY A;  2K7O A;  2BKH B;  2K8M B;  2MRD A;  4PHJ A;  1KK7 Y;  1M46 A;  2K7B A;  4PHM A;  5CSF A;  4YGB B;  3D10 A;  4QJ4 B;  1IH0 A;  3SG7 A;  2BL0 C;  4I5L B;  2I7A A;  1EXR A;  4NDC A;  2JUL A;  1QVI Z;  1TNP A;  4CID A;  1RWY A;  3BOW A;  1TIZ A;  1RTP 1;  4MBE A;  1YVH A;  1U5I A;  1KK8 C;  1S5G Z;  2JNX A;  2K2F A;  1K2H A;  2K7D A;  3LL8 B;  2ZND A;  4GNK B;  1OMV A;  1TNW A;  1QLK A;  2BCA A;  3O78 A;  3LLE A;  2G2B A;  3BYA A;  1UHI A;  2ISD A;  4MRY A;  1NWD A;  3PSR A;  1BJF A;  2JT8 A;  1S3P A;  2FCE A;  1B1G A;  3CWG A;  2QAC A;  2F3Y A;  3VGO A;  2JWW A;  1NX1 A;  4GGF C;  4R1E A;  2G9B A;  3SIA A;  1TCF A;  2PRU A;  1AHR A;  3M0W A;  2L2E A;  1WDC C;  1BG1 A;  2M8U A;  1JC2 A;  2LE9 B;  2SCP A;  2I94 A;  1G33 A;  1DJX A;  1S26 D;  2Q91 A;  3DF0 A;  1A75 A;  1LIN A;  2BEC A;  2JZI A;  3A8R A;  4ZCU A;  3NSL A;  4MSP A;  2JC2 A;  4FTG A;  2LCP A;  1B7T Z;  4DUQ A;  1ZUZ A;  4PE7 A;  4GAO A;  1AK8 A;  5JOL A;  3OB1 B;  1TNQ A;  3C1V A;  1CFD A;  2ZN9 A;  3O4Y A;  1EH2 A;  1UUR A;  4C0K A;  1DJG A;  1F71 A;  1IGV A;  3I5I B;  1DVI A;  1TNX A;  4A4C A;  3CR5 X;  1TN4 A;  3OX5 A;  4MZK A;  2EGD A;  2KBM A;  1OMR A;  2KNE A;  2EC6 B;  2ZRS A;  1XK4 A;  1PUL A;  1OMD A;  2HPS A;  3VRQ A;  3VRO A;  2WOS A;  1BMO A;  3KPX A;  5D69 A;  2KAY A;  1XFW O;  3DVJ A;  3SG6 A;  1DJI A;  1ZMZ A;  1DJY A;  1ODB A;  3OX6 A;  3OP0 A;  5I2L A;  1G4Y R;  2LAP A;  2WC8 A;  1FI6 A;  2EHB A;  5I2Q A;  1PVA A;  3BQ3 A;  2LNK A;  1K95 A;  1BR4 B;  4NQG A;  1DT7 B;  1ZOT B;  1NP8 A;  5HKW A;  1C7V A;  1F4O A;  3DVE A;  1NCX A;  1DGU A;  3HCM A;  1CDL A;  3CR4 X;  2H61 C;  2LUC A;  1RK9 A;  1BF5 A;  1R2U A;  4PHN A;  1RFJ A;  1K9P A;  1DMO A;  2O5G A;  4CLN A;  1V1G A;  1J7P A;  3SG2 A;  1RJV A;  3O6B A;  1AP4 A;  2HQW A;  1S1E A;  3HX4 A;  1XFV O;  1REC A;  4YGD B;  3TDU A;  1CKK A;  1B8R A;  1BOD A;  2COL B;  2LAN A;  1JWD A;  2AUC A;  4MRX A;  2WCF A;  1SNL A;  2M7N A;  4DS7 A;  1B8C A;  1S6J A;  3PFV A;  1L2O C;  1DGV A;  1NX2 A;  1HT9 A;  1CMG A;  2FJU B;  1LKJ A;  2CCM A;  1LXF C;  4U8D A;  1XFY O;  1TRF A;  3TUY B;  1S6C A;  5BPJ A;  3TS5 B;  4WQ2 A;  2L50 A;  2MLE C;  4ORC B;  2E6W A;  1B9A A;  2PVB A;  2HF5 A;  3OB2 B;  1DJZ A;  3JTD B;  2H2K A;  1CLM A;  1N65 A;  3DD4 A;  1VRK A;  1CLL A;  2M9G A;  1A29 A;  2WCB A;  1J1E A;  1J7R A;  1EG3 A;  2KSP A;  2KAV A;  4PDZ A;  1F4Q A;  3JTD C;  1IG5 A;  2LMU A;  2LVV A;  4NDB A;  1YUR A;  5AER A;  3PN7 B;  1IJ5 A;  3JVT B;  5K89 A;  2JQ6 A;  3BUO B;  1CFF A;  3I5H B;  1WRL A;  2V53 A;  4P5O E;  2NXQ A;  1QXP A;  4IL1 A;  2L4I A;  2NCO A;  4N1G A;  2ZFD A;  3JVT C;  4YGC B;  1YUU A;  3A4U B;  5KSZ A;  2NZ0 A;  1B4C A;  1SR6 B;  1XFZ O;  3SIB A;  3IQQ A;  3BUW B;  1WRK A;  1LA0 A;  1UHN A;  1DJW A;  3BOW B;  3NXA A;  2KQ6 A;  3PAL A;  1U5I B;  4TNC A;  5HKY A;  1IQ5 A;  2K61 A;  3PM8 A;  4A4B A;  1QV1 A;  5AXI A;  2AAO A;  4ORA B;  3CZT X;  2LLS A;  1KFU L;  1AJ4 A;  1NX3 A;  2F2P A;  2KI6 D;  3K21 A;  4PE4 A;  4DIR A;  1NX0 A;  2LVI A;  2R2I A;  1DF0 A;  1MUX A;  2VRG A;  2M7L A;  1CM4 A;  1QVI Y;  4GGF A;  1CDP A;  4GFT A;  3KF9 A;  1FBV A;  1KSO A;  1S5G Y;  3NSO A;  4JPZ B;  2WCE A;  3TZ1 A;  3E3R A;  1K9U A;  4MN0 A;  3GK1 A;  1JSA A;  3WXA A;  1M63 B;  5I2O A;  2MBX A;  3EKJ A;  1UWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...