5DKRA

Crystal structure of calcium-loaded s100b bound to sbi29
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
89
structure length
89
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Small Molecule Inhibitors of Ca(2+)-S100B Reveal Two Protein Conformations.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein/inhibitor
total genus 34
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5dkrA00
1UHHA 3BUNB 1S36A 2LVIA 5D69A 1CFPA 1KFXS 1J7QA 2HF5A 4OCIA 1DVIA 1PULA 1FI5A 2AMIA 4NDCA 2Q4UA 1UP5A 4HREE 2ISDA 1PALA 1IQ3A 1SCMC 1YR5A 1B7TZ 3GOFA 3FIAA 1SPYA 1EXRA 5I2QA 1JC2A 2PSRA 1F71A 3OB2B 1IQ5A 2O5GA 3BYAA 3TS5C 1YURA 2EC6C 5CSFA 2FJUB 4C0KA 4MRXA 2IS9A 1WRZA 1NX1A 1IJ6A 2F2PA 1Y1AA 4WQ2A 2COLB 3VROA 3O6BA 2F3ZA 1DMOA 1S6CA 3PN7B 2BE4A 2KFGA 1WY9A 1OQPA 4ORCB 2LMUA 1B47A 4DS7A 3EK7A 2JU0A 2D8NA 1A75A 2Y4QA 3BOWB 1NX2A 2KBIA 1M45A 1U5IB 2KI4B 1NYAA 2LUCA 2NXQA 2PMYA 2LLTA 1B1GA 4F0ZB 1R2UA 4GFTA 2K7DA 1EH2A 5I2OA 3PSRA 4HSZA 1S6JA 1V1GA 4FTGA 1BODA 1K94A 1Y1XA 1NIWA 3IQOA 4YI8A 4YBHB 2RGIA 3EK8A 4DCKA 2JT8A 1BF5A 3M0WA 4AQJA 1FF1A 1FI6A 3I5HB 5D7FA 4CFQA 1PRWA 1RJVA 1C7WA 1DF0B 2JZIA 2KSPA 2NZ0A 2M49B 3GK1A 5DKRA 3TDZA 3NSLA 5B8IB 1AK8A 4U8DA 1TNXA 3SG7A 3SG4A 1B9AA 1WRKA 2MA2A 2BE6A 1IKUA 3NXAA 1K2HA 1J7RA 1G8IA 2GGZA 3PLFB 1CDPA 1F4QA 1CLBA 2KNEA 2K0JA 1K93D 1YX8A 1KWOB 1SKTA 1J1DA 1LXFC 2CCMA 5FYXA 1S26D 3CTNA 1TNQA 1EJ3A 2KI6D 2LC5A 2HPSA 1VRKA 1E8AA 2CTNA 2LHLA 4I5NB 4YGDB 3SIBA 2KDHA 1PVBA 2KHNA 1CFDA 1LA3A 2I2RE 1H4BA 1JUOA 4P2YB 4R1EA 2MLFC 1L2OB 1CTRA 4PE1A 3JVTB 1XK4C 2WCEA 1ODBA 1NSHA 4TNCA 2MHHA 5CSIA 2KYCA 3ZNIA 3JTDC 4MSPA 1G33A 2BKIB 1TOPA 2H61C 1TIZA 1KSMA 1XFXO 3PM8A 3H4SE 2K7CA 1N0YA 3CGAA 2M1KB 1BR1B 4YI9A 3OX6A 3KEVA 4JWQA 3TS5B 2KQ6A 2EC6B 5BPJA 3OX5A 2BBMA 1BLQA 1PSRA 1OZSA 1WDCB 1F4OA 2VRGA 4ICBA 2LNKA 3PFVA 1XFWO 1A75B 1ALVA 1Y6WA 1SYMA 2JNFA 1UHJA 5HKYA 4NDBA 1KFUL 3AAJA 3TZ1A 3NSIA 4MZLA 2L2EA 1KCYA 3EVVA 1DJHA 4UPGA 1TCFA 1JFKA 2L50A 1L7ZA 2O60A 2LE9B 1KK8C 2ZNDA 1WLZA 2OTGC 2BCBA 4PHJA 1MXLC 1R6PA 3F45A 1BJFA 4M2PA 3DD4A 3SG2A 1ZFSA 2GGMA 4PCWA 4WRIA 1JF0A 1K95A 1N65A 1B8CA 1OMVA 2WORA 3FS7A 4N1GA 1OMDA 1KFXL 4PALA 3VRQA 1UHIA 2JXCA 3DVJA 4GBAA 4BY4A 1QV1A 3I5GB 2K8MB 3LK1A 1Q80A 1TRFA 2FCEA 1EL4A 2BL0C 5TNCA 1SR6C 4GNKB 2I18A 1B8LA 4ORAB 2FCDA 3HCMA 1QJTA 4MBEA 1RROA 2WCBA 2KGRA 3BQ3A 1KQMB 1ZUZA 2L4HA 1PK0D 4M2QA 1QX5B 1QLSA 1W7JB 4YGAA 2LHIA 2K2FA 1MF8B 3CWGA 1SNLA 4P5OE 4GGFC 2MBXA 1LINA 1CB1A 1YRTB 3VRRA 5K89A 1RK9A 2LMVA 4CFRA 1D1OA 1F55A 4JPZB 2OS8B 3KO0A 1G4YR 5GQQC 2AUCA 2ZRTA 3RM1A 3RLZA 4MZKA 5AERA 4NQGA 1UHNA 2BKHB 1M31A 1XA5A 2HETA 1Y0VH 1KQVA 2WCFA 2AAOA 1GQMA 1XFYO 3BUMB 2JTZA 3OP0A 2PALA 2F3YA 2M97A 5DKNA 4I5JA 1Y1UA 1CKKA 4NDDA 1YRUB 4AOMA 1NUBA 1BMOA 1IRJA 3D0YB 1CFCA 1OE9B 2M7LA 4ZCVA 3I5IB 3TUYC 3CLNA 2A4JA 4WQ3A 1LVCD 2M7NA 2LP3A 2DOQA 2I7AA 1NX0A 4XJKA 3VGOA 2V53A 5AANA 1DJGA 2LP2A 3WHTB 1V1FA 4DUQA 4QJ4B 2ZKMX 5JJGA 3VRNA 4FQOA 2CT9A 3DVMA 2EGDA 2KAYA 5IBWA 3K21A 1CNPA 1C07A 3DVEA 2LUXA 3NSOA 1QS7A 1M39A 3OHMB 2KAXA 4DIRA 1XFZO 2LM5A 1NCZA 1UHKA 3LLEA 2LVKA 3SG3A 1QV0A 3PN7C 2M1UA 4YGCB 1IWQA 4PE4A 4N5XA 1CLMA 5KSZA 1N2DA 1SCMB 2TN4A 4N1FA 1QLKA 1DJWA 4XYNA 4DRWA 1DGUA 1BT6A 1XK4A 4PHKA 1YUSA 3DVKA 1CLLA 3BUWB 4PE7A 1CDNA 1OSAA 1IH0A 3EVRA 4BY5A 2CXJA 2KBMA 3AAKA 1YVLA 5CSNA 5ER5A 2GV5A 1F8HA 2H61A 1YTZC 1QASA 5HYDA 1UURA 1F70A 1QTXA 2MAZA 1DGVA 4ZCUA 1XO5A 2I94A 2KFHA 2JULA 2F8PA 1DJXA 2MJWB 4Q04A 2JXLA 1S6IA 2KI6C 1MWNA 2B1UA 1WRLA 2HQWA 1LKJA 1GGWA 1S5GZ 2BCXA 1JWDA 1BU3A 3A4UB 3D0YA 1PSBA 2OPOA 1HQVA 3OB1B 2L5XB 3I5HC 1TTXA 1BOCA 1CM1A 3WXAA 3IQQA 3KHEA 4I5LB 2NLNA 2QACA 1RECA 1SCVA 1NCXA 2L98A 5HKZA 4PDZA 1DJIA 2FOTA 1C7VA 1XFUO 2ZRSA 5HLVA 1KWOC 1YUTA 1NWDA 1KFUS 1QVIY 1IJ5A 1EG4A 1XFVO 1IGVA 1YVHA 4MLWA 3LK0A 4MZJA 1LA0A 5AXIA 1NP8A 2KYFA 4XJKB 1EG3A 5I8NA 1JBAA 1GGZA 4GAOA 1OZOA 1A4PA 1NCYA 4A4CA 4YRUA 2JWWA 3EVUA 3PATA 4CIDA 1HT9A 2L0PA 4D1EA 2JOJA 2F33A 4HRGA 4M2OA 2H2KA 2SCPA 1L2OC 2JNXA 2HQ8A 3JVTC 1TN4A 3O78A 1ALWA 2KFFA 3LCPC 2JC2A 1YUUA 1J1EA 1QVIZ 2E30A 4PHMA 3DF0B 2LVVA 5CPVA 1JF2A 2M3WA 1A29A 3ICBA 2LV7A 5G08A 1WLMA 1AJ4A 5PALA 4CLNA 2KAVA 3E3RA 2ZN9A 3IF7A 2JPTA 2Y1MA 1JFJA 2JT3A 2M9GA 4OKHA 3TDUA 4GGFA 4MRYA 1K9PA 1WDCC 1TNPA 1S1EA 5F6TA 4E68A 2KGBC 2CNPA 2LLSA 2ZFDA 3JTDB 1SMGA 1MR8A 2M29A 2NCOA 4AQIA 2LVJA 3CR4X 2LMTA 2LANA 4HRHA 1NPQA 4OV2A 1CMGA 1MUXA 2JTTA 3I5FC 3CZTX 2WOSA 5J3XA 1JSAA 1NX3A 2F2OA 3QRXA 1MQ1A 1K96A 2KOTA 3LL8B 1FBVA 3WNXB 3SIAA 1RWYA 1A03A 2BBNA 3AKBA 1OMRA 1AP4A 3D10A 3GK4X 2WC8A 2WNDA 3FWBA 1OOJA 1DTLA 1GJYA 1QIWA 2BECA 4USLA 4PHNA 3ZWHA 1B4CA 1KK8B 2OTGB 3I5GC 1QXPA 1DT7B 3WHUB 2K7BA 1XVJA 4A4BA 4GUKA 1A2XA 3TDIA 1RTP1 4CPVA 2CBLA 4GPLB 5HKWA 3BXKA 5I2LA 5ER4X 2ZN8A 2M0RA 2JRFA 2PRUA 3KF9A 1TCOB 2M8UA 2K61A 3DF0A 1KQMC 1YX7A 1M46A 1W7IB 1MHOA 1X02A 4IL1A 3CR5X 1ZMZA 2PASA 3KPXA 2E6WA 1S5GY 4ETOA 1BR4B 2Q91A 3NSKA 4I5KA 1SL8A 3EKHA 1F54A 2BL0B 1FW4A 1SR6B 1K9UA 1TNWA 5CSJA 3SG6A 2SASA 2ZNEA 3O2PA 2Y5IA 1K8UA 1QX7A 2MLEC 1RFJA 1AJ5A 2KI4C 3A8RA 1K9KA 2OS8C 2BCAA 1SRAA 4L9MA 1MXEA 1DJZA 4OVNF 1J55A 1SL7A 4QJ5B 4JQ0D 4C0LA 2JQ6A 2Y1NA 1CDMA 1CM4A 1UWOA 2EHBA 3EK4A 4YGEB 1ZOTB 2G9BA 3BOWA 3EKJA 1SK6D 2P6BB 1S3PA 3HX4A 1U5IA 3AKAA 1J7OA 1SY9A 4PE0A 1KK7Y 2LLUA 4ORBB 2L4IA 5KU1A 3SJSA 1CDLA 5AFPA 1B8RA 2PVBA 3PALA 1UUSA 3MSEB 1BG1A 1DJYA 1IG5A 1QIVA 3BUOB 2L51A 3C1VA 4MVFA 3I5IC 4C0JA 1AVSA 1K90D 1H8BA 1SW8A 3BUXB 5KTYA 1ZACA 5HLOA 1AHRA 2LAPA 2NCPA 2R2IA 1DF0A 4MN0A 1SBJA 2QPTA 1XYDA 5AEQA 3I5FB 2KQYA 1CFFA 1B7TY 1J7PA 1FPWA 2LCPA 1SL9A 4OR9B 1KK7Z 1KSOA 3O4YA 1AUIB 2K2AA 3CR2A 2JT0A 2G2BA 3SG5A 4QJ3B 3FWCA 1PVAA 1M63B 3TUYB 3CS1A 1QATA 1CMFA 1QX2A 2K7OA 4YGBB 5DKQA 5JOLA 4GGNA 3GK2A 2MRDA 3VRPA 4MEWA
chains in the Genus database with same CATH superfamily
1UHHA 3BUNB 1S36A 2LVIA 3DZTA 5D69A 1CFPA 1KFXS 1J7QA 2HF5A 4OCIA 1DVIA 1PULA 1FI5A 2AMIA 4NDCA 3B87A 2Q4UA 1UP5A 4HREE 2ISDA 1PALA 1IQ3A 1SCMC 1YR5A 1B7TZ 3GOFA 3FIAA 1SPYA 1EXRA 5I2QA 1JC2A 2PSRA 1F71A 3OB2B 1IQ5A 2O5GA 3BYAA 3O4XA 3TS5C 2WCMA 1YURA 2EC6C 5CSFA 2FJUB 4C0KA 1DQEA 4MRXA 2IS9A 1WRZA 1NX1A 1IJ6A 2F2PA 1Y1AA 3CYZA 2COLB 4WQ2A 3VROA 3O6BA 2F3ZA 1DMOA 1S6CA 3PN7B 2BE4A 2KFGA 1WY9A 2QEBA 1OQPA 4ORCB 2LMUA 3D75A 1B47A 2WC6A 4DS7A 3EK7A 2JU0A 2D8NA 1A75A 2Y4QA 3BOWB 1NX2A 2KBIA 1M45A 1C3YA 1U5IB 2KI4B 1NYAA 2LUCA 2NXQA 2PMYA 3CDNA 2LLTA 1B1GA 4F0ZB 3L47A 2KLDA 1R2UA 4GFTA 2K7DA 1EH2A 5I2OA 3PSRA 4HSZA 1S6JA 1V1GA 4FTGA 3EG5B 2BAPA 1BODA 2H8VA 1K94A 1Y1XA 1NIWA 3IQOA 4YI8A 4YBHB 2RGIA 3EK8A 4DCKA 2JT8A 1BF5A 3M0WA 4AQJA 1FF1A 1FI6A 3I5HB 5D7FA 4CFQA 1PRWA 1RJVA 1C7WA 1DF0B 2JZIA 2KSPA 2NZ0A 2M49B 3GK1A 5DKRA 3TDZA 3NSLA 5B8IB 1AK8A 4U8DA 1TNXA 5EL2A 3SG7A 3SG4A 1B9AA 1WRKA 1XFRA 2MA2A 2BE6A 1IKUA 3NXAA 5I94A 1K2HA 1J7RA 1G8IA 2GGZA 2PYQA 3PLFB 1CDPA 1F4QA 1CLBA 2KNEA 2K0JA 1K93D 1YX8A 1KWOB 1SKTA 1J1DA 1LXFC 2CCMA 5FYXA 1S26D 3CTNA 1TNQA 2WC5A 2PQLA 1EJ3A 2QEOA 2KI6D 2LC5A 2HPSA 1VRKA 1E8AA 1OOGA 2CTNA 1TWOA 2LHLA 4I5NB 4YGDB 3SIBA 2KDHA 1PVBA 2KHNA 1CFDA 1LA3A 2I2RE 1H4BA 1JUOA 4P2YB 4R1EA 2MLFC 1L2OB 1CTRA 4PE1A 3JVTB 1XK4C 5DICA 2WCEA 1ODBA 1NSHA 4TNCA 2MHHA 5CSIA 2KYCA 3FE8A 3ZNIA 3JTDC 4MSPA 1G33A 4OZDA 5FI6A 2BKIB 1TOPA 2H61C 1TIZA 1KSMA 1XFXO 3PM8A 3H4SE 2K7CA 1N0YA 3CGAA 2M1KB 1BR1B 4YI9A 3OX6A 3KEVA 4JWQA 3TS5B 2KQ6A 2EC6B 5BPJA 3OX5A 3CZ0A 2ERBA 2BBMA 1BLQA 1PSRA 1OZSA 1WDCB 1F4OA 2VRGA 4ICBA 2LNKA 3PFVA 1XFWO 1A75B 1ALVA 1Y6WA 3V2LA 1SYMA 2JNFA 1UHJA 3S0AA 5HKYA 2P70A 4NDBA 1KFUL 2KPHA 3AAJA 4IJ7A 3NSIA 4MZLA 2L2EA 3TZ1A 5HL1A 3EVVA 1DJHA 1KCYA 4UPGA 1TCFA 1JFKA 2L50A 1L7ZA 2O60A 2LE9B 1KK8C 2ZNDA 1WLZA 2OTGC 2BCBA 4PHJA 1MXLC 1R6PA 3F45A 1BJFA 2WCKA 4M2PA 3DD4A 3SG2A 1ZFSA 2GGMA 4PCWA 2WCLA 4WRIA 1JF0A 1K95A 1N65A 1B8CA 1OMVA 2WORA 3FS7A 4N1GA 1OMDA 1KFXL 4PALA 3K1EA 3VRQA 1UHIA 2JXCA 4INWA 3D77A 3DVJA 4GBAA 4BY4A 1QV1A 2BNXA 3I5GB 2K8MB 3LK1A 1Q80A 1TRFA 2FCEA 1EL4A 2BL0C 5TNCA 1SR6C 4GNKB 2I18A 1B8LA 2QEHA 4ORAB 2FCDA 3HCMA 1QJTA 4MBEA 1RROA 2WCBA 2KGRA 3BQ3A 3B88A 3L4AA 1DC1A 4YGEB 1KQMB 1ZUZA 2L4HA 1PK0D 4M2QA 1QX5B 1QLSA 1W7JB 4YGAA 2LHIA 3NGVA 2K2FA 1MF8B 3CWGA 1SNLA 4P5OE 4GGFC 2MBXA 1LINA 1CB1A 3B6XA 1YRTB 3VRRA 5K89A 1RK9A 2LMVA 4CFRA 1D1OA 1F55A 4FQTA 4JPZB 2OS8B 3KO0A 1G4YR 5GQQC 2AUCA 1SSEB 2ZRTA 3RM1A 3RLZA 4MZKA 5AERA 4NQGA 1UHNA 2BKHB 1M31A 1XA5A 2HETA 1Y0VH 3S0FA 1KQVA 2WCFA 2AAOA 1GQMA 1XFYO 3BUMB 2JTZA 3OP0A 3R1OA 2PALA 2F3YA 2M97A 3SS3A 5DKNA 4I5JA 1Y1UA 1CKKA 4NDDA 1YRUB 4AOMA 3SS4A 1NUBA 1BMOA 1IRJA 3D0YB 1CFCA 1OE9B 2M7LA 4ZCVA 1GM0A 3I5IB 3TUYC 3CLNA 2A4JA 4WQ3A 1LVCD 2M7NA 3NHIA 3PM2A 2LP3A 2P71A 2DOQA 2I7AA 1NX0A 2QEVA 4XJKA 3VGOA 2V53A 5AANA 3BFAA 1DJGA 2LP2A 3WHTB 1V1FA 4DUQA 4QJ4B 2ZKMX 5JJGA 3VRNA 4FQOA 2CT9A 3DVMA 1TUZA 2EGDA 2KAYA 5IBWA 3K21A 1CNPA 1C07A 3DVEA 2LUXA 3NSOA 4PT1A 3S0EA 1QS7A 1OW4A 1M39A 3OHMB 2KAXA 4DIRA 1OOHA 1XFZO 2LM5A 3VB1A 1NCZA 1UHKA 3LLEA 2LVKA 3SG3A 1QV0A 3PN7C 2M1UA 4YGCB 1IWQA 4PE4A 4N5XA 1CLMA 1T14A 2WCJA 5KSZA 1N2DA 1SCMB 2TN4A 4N1FA 1QLKA 1DJWA 4XYNA 4DRWA 1DGUA 1BT6A 1XK4A 3BJHA 4PHKA 1YUSA 3D73A 1CLLA 3BUWB 3DVKA 4PE7A 1CDNA 1OSAA 1C3ZA 3DXLA 3EVRA 1IH0A 4BY5A 2L5YA 2CXJA 2KBMA 3AAKA 1YVLA 5CSNA 5ER5A 2GV5A 1F8HA 2H61A 1YTZC 1QASA 5HYDA 1UURA 1DEKA 3BFHA 1F70A 1QTXA 2MAZA 1DGVA 4ZCUA 1XO5A 2I94A 2KFHA 2JULA 2F8PA 1DJXA 2MJWB 4Q04A 2JXLA 3DY9A 1S6IA 2KI6C 1MWNA 2B1UA 1WRLA 2HQWA 1LKJA 2GTEA 3D74A 1S5GZ 3S0GA 3UNWA 2BCXA 1GGWA 3OBVA 1JWDA 1BU3A 3A4UB 3D0YA 3CABA 1PSBA 2OPOA 1HQVA 3OB1B 2L5XB 3I5HC 1TTXA 1BOCA 1CM1A 3D76A 3S0BA 3WXAA 3IQQA 3KHEA 4I5LB 2NLNA 2QACA 5FI7A 1RECA 3L4LA 1SCVA 1NCXA 2L98A 5HKZA 4PDZA 1DJIA 2FOTA 1C7VA 1XFUO 2ZRSA 5HLVA 1KWOC 1YUTA 1NWDA 1KFUS 1QVIY 1IJ5A 1EG4A 1XFVO 1IGVA 1YVHA 2L2CA 3LK0A 4MLWA 1LA0A 1OOIX 1NP8A 2KYFA 4MZJA 4XJKB 5AXIA 4F7FA 1EG3A 5I8NA 1JBAA 1GGZA 4GAOA 1OZOA 1A4PA 1NCYA 4A4CA 4YRUA 1Z2CB 2JWWA 3EVUA 3NHTA 1HT9A 3PATA 4CIDA 2L0PA 4D1EA 2JOJA 2F33A 4HRGA 4M2OA 2H2KA 2SCPA 1L2OC 2JNXA 2HQ8A 3JVTC 1TN4A 3O78A 1ALWA 2KFFA 3LCPC 2JC2A 3UO9A 1YUUA 1J1EA 1QVIZ 2E30A 3BFBA 3DF0B 4PHMA 2JPOA 2LVVA 5CPVA 2QDIA 1JF2A 2M3WA 1A29A 3ICBA 2LV7A 5G08A 1WLMA 1AJ4A 5PALA 4CLNA 2KAVA 3E3RA 2ZN9A 3IF7A 2JPTA 2Y1MA 1JFJA 2JT3A 4INXA 2M9GA 3QMEA 4OKHA 3TDUA 4GGFA 4MRYA 3IVTA 1K9PA 3CZ1A 1WDCC 1TNPA 1S1EA 5F6TA 4E68A 2KGBC 2CNPA 2LLSA 2ZFDA 3JTDB 1SMGA 1MR8A 2M29A 2NCOA 4AQIA 2LVJA 3CR4X 2LMTA 3Q8IA 2LANA 4HRHA 1NPQA 4OV2A 1CMGA 5FI2A 1OOFA 1MUXA 2JTTA 3I5FC 3CZTX 3SS5A 2WOSA 5J3XA 2K60A 1JSAA 1NX3A 2F2OA 3QRXA 4KYNA 1MQ1A 1K96A 2KOTA 3LL8B 1FBVA 3WNXB 3SIAA 1RWYA 3RZSA 1A03A 2BBNA 3AKBA 1OMRA 1AP4A 3OGNA 3D10A 3GK4X 2WC8A 2WNDA 3FWBA 1OOJA 1DTLA 1GJYA 2FJYA 1QIWA 2BECA 4USLA 4PHNA 3ZWHA 1B4CA 1KK8B 2OTGB 3I5GC 1QXPA 1DT7B 3WHUB 2K7BA 1Z4HA 1XVJA 4A4BA 4GUKA 3CZ2A 1A2XA 3TDIA 1RTP1 4CPVA 2CBLA 4GPLB 5HKWA 3BXKA 5I2LA 5ER4X 2ZN8A 3D78A 2M0RA 3R1VA 2KLEA 2JRFA 2PRUA 3KF9A 1TCOB 2M8UA 5D3OA 2K61A 3DF0A 1J7OA 1KQMC 1YX7A 3PJIA 1M46A 1W7IB 1MHOA 1X02A 4IL1A 3CR5X 1ZMZA 2PASA 3KPXA 2E6WA 1S5GY 4ETOA 1BR4B 2Q91A 3NSKA 4I5KA 1SL8A 4JKTA 3EKHA 1F54A 2BL0B 3DYEA 1FW4A 1SR6B 1K9UA 1TNWA 5CSJA 3FE9A 1W9ZA 3SG6A 2SASA 2ZNEA 3O2PA 2Y5IA 1K8UA 1QX7A 2MLEC 1ORGA 1RFJA 1AJ5A 2KI4C 3A8RA 1DELA 1K9KA 1SRAA 2BCAA 2OS8C 4L9MA 1MXEA 1DJZA 4OVNF 1J55A 1SL7A 4QJ5B 4JQ0D 4C0LA 2JQ6A 2Y1NA 3FE6A 1LS8A 3B7AA 1CDMA 1CM4A 1UWOA 1TUJA 2EHBA 3EK4A 1ZOTB 2G9BA 3BOWA 3EKJA 1SK6D 2P6BB 1S3PA 3HX4A 1U5IA 3AKAA 3S0DA 1SY9A 4PE0A 1KK7Y 2LLUA 4ORBB 2L4IA 3R72A 4JD9A 3SJSA 5KU1A 1P28A 1CDLA 5AFPA 1B8RA 3N7HA 2PVBA 3PALA 1UUSA 1QWVA 3MSEB 1BG1A 1DJYA 1IG5A 1QIVA 3BUOB 2L51A 3C1VA 3R1PA 4MVFA 3I5IC 4C0JA 1AVSA 1K90D 1H8BA 1SW8A 3BUXB 5KTYA 1ZACA 5HLOA 1AHRA 2LAPA 2NCPA 2R2IA 1DF0A 4MN0A 1SBJA 2WCHA 2QPTA 1XYDA 5AEQA 3I5FB 2KQYA 1CFFA 1B7TY 1J7PA 1FPWA 2LCPA 1SL9A 4OR9B 1KK7Z 1KSOA 3O4YA 1AUIB 2K2AA 3CR2A 2JT0A 2G2BA 3B86A 2YGUA 3SG5A 4QJ3B 3FWCA 1PVAA 1M63B 3TUYB 3CS1A 1QATA 1CMFA 1QX2A 2K7OA 4YGBB 5DKQA 5JOLA 4GGNA 3GK2A 1IIOA 2MRDA 3VRPA 4MEWA
chains in the Genus database with same CATH topology
1UHHA 3BUNB 1S36A 2LVIA 5D69A 1CFPA 1KFXS 1J7QA 2HF5A 4OCIA 1DVIA 1PULA 1FI5A 2AMIA 4NDCA 2Q4UA 1UP5A 4HREE 2ISDA 1PALA 1IQ3A 1SCMC 1YR5A 1B7TZ 3GOFA 3FIAA 1SPYA 1EXRA 5I2QA 1JC2A 2PSRA 1F71A 3OB2B 1IQ5A 2O5GA 3BYAA 3TS5C 1YURA 2EC6C 5CSFA 2FJUB 4C0KA 4MRXA 2IS9A 1WRZA 1NX1A 1IJ6A 2F2PA 1Y1AA 4WQ2A 2COLB 3VROA 3O6BA 2F3ZA 1DMOA 1S6CA 3PN7B 2BE4A 2KFGA 1WY9A 1OQPA 4ORCB 2LMUA 1B47A 4DS7A 3EK7A 2JU0A 2D8NA 1A75A 2Y4QA 3BOWB 1NX2A 2KBIA 1M45A 1U5IB 2KI4B 1NYAA 2LUCA 2NXQA 2PMYA 2LLTA 1B1GA 4F0ZB 1R2UA 4GFTA 2K7DA 1EH2A 5I2OA 3PSRA 4HSZA 1S6JA 1V1GA 4FTGA 1BODA 1K94A 1Y1XA 1NIWA 3IQOA 4YI8A 4YBHB 2RGIA 3EK8A 4DCKA 2JT8A 1BF5A 3M0WA 4AQJA 1FF1A 1FI6A 3I5HB 5D7FA 4CFQA 1PRWA 1RJVA 1C7WA 1DF0B 2JZIA 2KSPA 2NZ0A 2M49B 3GK1A 5DKRA 3TDZA 3NSLA 5B8IB 1AK8A 4U8DA 1TNXA 3SG7A 3SG4A 1B9AA 1WRKA 2MA2A 2BE6A 1IKUA 3NXAA 1K2HA 1J7RA 1G8IA 2GGZA 3PLFB 1CDPA 1F4QA 1CLBA 2KNEA 2K0JA 1K93D 1YX8A 1KWOB 1SKTA 1J1DA 1LXFC 2CCMA 5FYXA 1S26D 3CTNA 1TNQA 1EJ3A 2KI6D 2LC5A 2HPSA 1VRKA 1E8AA 2CTNA 2LHLA 4I5NB 4YGDB 3SIBA 2KDHA 1PVBA 2KHNA 1CFDA 1LA3A 2I2RE 1H4BA 1JUOA 4P2YB 4R1EA 2MLFC 1L2OB 1CTRA 4PE1A 3JVTB 1XK4C 2WCEA 1ODBA 1NSHA 4TNCA 2MHHA 5CSIA 2KYCA 3ZNIA 3JTDC 4MSPA 1G33A 2BKIB 1TOPA 2H61C 1TIZA 1KSMA 1XFXO 3PM8A 3H4SE 2K7CA 1N0YA 3CGAA 2M1KB 1BR1B 4YI9A 3OX6A 3KEVA 4JWQA 3TS5B 2KQ6A 2EC6B 5BPJA 3OX5A 2BBMA 1BLQA 1PSRA 1OZSA 1WDCB 1F4OA 2VRGA 4ICBA 2LNKA 3PFVA 1XFWO 1A75B 1ALVA 1Y6WA 1SYMA 2JNFA 1UHJA 5HKYA 4NDBA 1KFUL 3AAJA 3TZ1A 3NSIA 4MZLA 2L2EA 1KCYA 3EVVA 1DJHA 4UPGA 1TCFA 1JFKA 2L50A 1L7ZA 2O60A 2LE9B 1KK8C 2ZNDA 1WLZA 2OTGC 2BCBA 4PHJA 1MXLC 1R6PA 3F45A 1BJFA 4M2PA 3DD4A 3SG2A 1ZFSA 2GGMA 4PCWA 4WRIA 1JF0A 1K95A 1N65A 1B8CA 1OMVA 2WORA 3FS7A 4N1GA 1OMDA 1KFXL 4PALA 3VRQA 1UHIA 2JXCA 3DVJA 4GBAA 4BY4A 1QV1A 3I5GB 2K8MB 3LK1A 1Q80A 1TRFA 2FCEA 1EL4A 2BL0C 5TNCA 1SR6C 4GNKB 2I18A 1B8LA 4ORAB 2FCDA 3HCMA 1QJTA 4MBEA 1RROA 2WCBA 2KGRA 3BQ3A 1KQMB 1ZUZA 2L4HA 1PK0D 4M2QA 1QX5B 1QLSA 1W7JB 4YGAA 2LHIA 2K2FA 1MF8B 3CWGA 1SNLA 4P5OE 4GGFC 2MBXA 1LINA 1CB1A 1YRTB 3VRRA 5K89A 1RK9A 2LMVA 4CFRA 1D1OA 1F55A 4JPZB 2OS8B 3KO0A 1G4YR 5GQQC 2AUCA 2ZRTA 3RM1A 3RLZA 4MZKA 5AERA 4NQGA 1UHNA 2BKHB 1M31A 1XA5A 2HETA 1Y0VH 1KQVA 2WCFA 2AAOA 1GQMA 1XFYO 3BUMB 2JTZA 3OP0A 2PALA 2F3YA 2M97A 5DKNA 4I5JA 1Y1UA 1CKKA 4NDDA 1YRUB 4AOMA 1NUBA 1BMOA 1IRJA 3D0YB 1CFCA 1OE9B 2M7LA 4ZCVA 3I5IB 3TUYC 3CLNA 2A4JA 4WQ3A 1LVCD 2M7NA 2LP3A 2DOQA 2I7AA 1NX0A 4XJKA 3VGOA 2V53A 5AANA 1DJGA 2LP2A 3WHTB 1V1FA 4DUQA 4QJ4B 2ZKMX 5JJGA 3VRNA 4FQOA 2CT9A 3DVMA 2EGDA 2KAYA 5IBWA 3K21A 1CNPA 1C07A 3DVEA 2LUXA 3NSOA 1QS7A 1M39A 3OHMB 2KAXA 4DIRA 1XFZO 2LM5A 1NCZA 1UHKA 3LLEA 2LVKA 3SG3A 1QV0A 3PN7C 2M1UA 4YGCB 1IWQA 4PE4A 4N5XA 1CLMA 5KSZA 1N2DA 1SCMB 2TN4A 4N1FA 1QLKA 1DJWA 4XYNA 4DRWA 1DGUA 1BT6A 1XK4A 4PHKA 1YUSA 3DVKA 1CLLA 3BUWB 4PE7A 1CDNA 1OSAA 1IH0A 3EVRA 4BY5A 2CXJA 2KBMA 3AAKA 1YVLA 5CSNA 5ER5A 2GV5A 1F8HA 2H61A 1YTZC 1QASA 5HYDA 1UURA 1F70A 1QTXA 2MAZA 1DGVA 4ZCUA 1XO5A 2I94A 2KFHA 2JULA 2F8PA 1DJXA 2MJWB 4Q04A 2JXLA 1S6IA 2KI6C 1MWNA 2B1UA 1WRLA 2HQWA 1LKJA 1GGWA 1S5GZ 2BCXA 1JWDA 1BU3A 3A4UB 3D0YA 1PSBA 2OPOA 1HQVA 3OB1B 2L5XB 3I5HC 1TTXA 1BOCA 1CM1A 3WXAA 3IQQA 3KHEA 4I5LB 2NLNA 2QACA 1RECA 1SCVA 1NCXA 2L98A 5HKZA 4PDZA 1DJIA 2FOTA 1C7VA 1XFUO 2ZRSA 5HLVA 1KWOC 1YUTA 1NWDA 1KFUS 1QVIY 1IJ5A 1EG4A 1XFVO 1IGVA 1YVHA 4MLWA 3LK0A 4MZJA 1LA0A 5AXIA 1NP8A 2KYFA 4XJKB 1EG3A 5I8NA 1JBAA 1GGZA 4GAOA 1OZOA 1A4PA 1NCYA 4A4CA 4YRUA 2JWWA 3EVUA 3PATA 4CIDA 1HT9A 2L0PA 4D1EA 2JOJA 2F33A 4HRGA 4M2OA 2H2KA 2SCPA 1L2OC 2JNXA 2HQ8A 3JVTC 1TN4A 3O78A 1ALWA 2KFFA 3LCPC 2JC2A 1YUUA 1J1EA 1QVIZ 2E30A 4PHMA 3DF0B 2LVVA 5CPVA 1JF2A 2M3WA 1A29A 3ICBA 2LV7A 5G08A 1WLMA 1AJ4A 5PALA 4CLNA 2KAVA 3E3RA 2ZN9A 3IF7A 2JPTA 2Y1MA 1JFJA 2JT3A 2M9GA 4OKHA 3TDUA 4GGFA 4MRYA 1K9PA 1WDCC 1TNPA 1S1EA 5F6TA 4E68A 2KGBC 2CNPA 2LLSA 2ZFDA 3JTDB 1SMGA 1MR8A 2M29A 2NCOA 4AQIA 2LVJA 3CR4X 2LMTA 2LANA 4HRHA 1NPQA 4OV2A 1CMGA 1MUXA 2JTTA 3I5FC 3CZTX 2WOSA 5J3XA 1JSAA 1NX3A 2F2OA 3QRXA 1MQ1A 1K96A 2KOTA 3LL8B 1FBVA 3WNXB 3SIAA 1RWYA 1A03A 2BBNA 3AKBA 1OMRA 1AP4A 3D10A 3GK4X 2WC8A 2WNDA 3FWBA 1OOJA 1DTLA 1GJYA 1QIWA 2BECA 4USLA 4PHNA 3ZWHA 1B4CA 1KK8B 2OTGB 3I5GC 1QXPA 1DT7B 3WHUB 2K7BA 1XVJA 4A4BA 4GUKA 1A2XA 3TDIA 1RTP1 4CPVA 2CBLA 4GPLB 5HKWA 3BXKA 5I2LA 5ER4X 2ZN8A 2M0RA 2JRFA 2PRUA 3KF9A 1TCOB 2M8UA 2K61A 3DF0A 1KQMC 1YX7A 1M46A 1W7IB 1MHOA 1X02A 4IL1A 3CR5X 1ZMZA 2PASA 3KPXA 2E6WA 1S5GY 4ETOA 1BR4B 2Q91A 3NSKA 4I5KA 1SL8A 3EKHA 1F54A 2BL0B 1FW4A 1SR6B 1K9UA 1TNWA 5CSJA 3SG6A 2SASA 2ZNEA 3O2PA 2Y5IA 1K8UA 1QX7A 2MLEC 1RFJA 1AJ5A 2KI4C 3A8RA 1K9KA 2OS8C 2BCAA 1SRAA 4L9MA 1MXEA 1DJZA 4OVNF 1J55A 1SL7A 4QJ5B 4JQ0D 4C0LA 2JQ6A 2Y1NA 1CDMA 1CM4A 1UWOA 2EHBA 3EK4A 4YGEB 1ZOTB 2G9BA 3BOWA 3EKJA 1SK6D 2P6BB 1S3PA 3HX4A 1U5IA 3AKAA 1J7OA 1SY9A 4PE0A 1KK7Y 2LLUA 4ORBB 2L4IA 5KU1A 3SJSA 1CDLA 5AFPA 1B8RA 2PVBA 3PALA 1UUSA 3MSEB 1BG1A 1DJYA 1IG5A 1QIVA 3BUOB 2L51A 3C1VA 4MVFA 3I5IC 4C0JA 1AVSA 1K90D 1H8BA 1SW8A 3BUXB 5KTYA 1ZACA 5HLOA 1AHRA 2LAPA 2NCPA 2R2IA 1DF0A 4MN0A 1SBJA 2QPTA 1XYDA 5AEQA 3I5FB 2KQYA 1CFFA 1B7TY 1J7PA 1FPWA 2LCPA 1SL9A 4OR9B 1KK7Z 1KSOA 3O4YA 1AUIB 2K2AA 3CR2A 2JT0A 2G2BA 3SG5A 4QJ3B 3FWCA 1PVAA 1M63B 3TUYB 3CS1A 1QATA 1CMFA 1QX2A 2K7OA 4YGBB 5DKQA 5JOLA 4GGNA 3GK2A 2MRDA 3VRPA 4MEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHH A;  3BUN B;  1S36 A;  2LVI A;  5D69 A;  1CFP A;  1KFX S;  1J7Q A;  2HF5 A;  4OCI A;  1DVI A;  1PUL A;  1FI5 A;  2AMI A;  4NDC A;  2Q4U A;  1UP5 A;  4HRE E;  2ISD A;  1PAL A;  1IQ3 A;  1SCM C;  1YR5 A;  1B7T Z;  3GOF A;  3FIA A;  1SPY A;  1EXR A;  5I2Q A;  1JC2 A;  2PSR A;  1F71 A;  3OB2 B;  1IQ5 A;  2O5G A;  3BYA A;  3TS5 C;  1YUR A;  2EC6 C;  5CSF A;  2FJU B;  4C0K A;  4MRX A;  2IS9 A;  1WRZ A;  1NX1 A;  1IJ6 A;  2F2P A;  1Y1A A;  4WQ2 A;  2COL B;  3VRO A;  3O6B A;  2F3Z A;  1DMO A;  1S6C A;  3PN7 B;  2BE4 A;  2KFG A;  1WY9 A;  1OQP A;  4ORC B;  2LMU A;  1B47 A;  4DS7 A;  3EK7 A;  2JU0 A;  2D8N A;  1A75 A;  2Y4Q A;  3BOW B;  1NX2 A;  2KBI A;  1M45 A;  1U5I B;  2KI4 B;  1NYA A;  2LUC A;  2NXQ A;  2PMY A;  2LLT A;  1B1G A;  4F0Z B;  1R2U A;  4GFT A;  2K7D A;  1EH2 A;  5I2O A;  3PSR A;  4HSZ A;  1S6J A;  1V1G A;  4FTG A;  1BOD A;  1K94 A;  1Y1X A;  1NIW A;  3IQO A;  4YI8 A;  4YBH B;  2RGI A;  3EK8 A;  4DCK A;  2JT8 A;  1BF5 A;  3M0W A;  4AQJ A;  1FF1 A;  1FI6 A;  3I5H B;  5D7F A;  4CFQ A;  1PRW A;  1RJV A;  1C7W A;  1DF0 B;  2JZI A;  2KSP A;  2NZ0 A;  2M49 B;  3GK1 A;  5DKR A;  3TDZ A;  3NSL A;  5B8I B;  1AK8 A;  4U8D A;  1TNX A;  3SG7 A;  3SG4 A;  1B9A A;  1WRK A;  2MA2 A;  2BE6 A;  1IKU A;  3NXA A;  1K2H A;  1J7R A;  1G8I A;  2GGZ A;  3PLF B;  1CDP A;  1F4Q A;  1CLB A;  2KNE A;  2K0J A;  1K93 D;  1YX8 A;  1KWO B;  1SKT A;  1J1D A;  1LXF C;  2CCM A;  5FYX A;  1S26 D;  3CTN A;  1TNQ A;  1EJ3 A;  2KI6 D;  2LC5 A;  2HPS A;  1VRK A;  1E8A A;  2CTN A;  2LHL A;  4I5N B;  4YGD B;  3SIB A;  2KDH A;  1PVB A;  2KHN A;  1CFD A;  1LA3 A;  2I2R E;  1H4B A;  1JUO A;  4P2Y B;  4R1E A;  2MLF C;  1L2O B;  1CTR A;  4PE1 A;  3JVT B;  1XK4 C;  2WCE A;  1ODB A;  1NSH A;  4TNC A;  2MHH A;  5CSI A;  2KYC A;  3ZNI A;  3JTD C;  4MSP A;  1G33 A;  2BKI B;  1TOP A;  2H61 C;  1TIZ A;  1KSM A;  1XFX O;  3PM8 A;  3H4S E;  2K7C A;  1N0Y A;  3CGA A;  2M1K B;  1BR1 B;  4YI9 A;  3OX6 A;  3KEV A;  4JWQ A;  3TS5 B;  2KQ6 A;  2EC6 B;  5BPJ A;  3OX5 A;  2BBM A;  1BLQ A;  1PSR A;  1OZS A;  1WDC B;  1F4O A;  2VRG A;  4ICB A;  2LNK A;  3PFV A;  1XFW O;  1A75 B;  1ALV A;  1Y6W A;  1SYM A;  2JNF A;  1UHJ A;  5HKY A;  4NDB A;  1KFU L;  3AAJ A;  3TZ1 A;  3NSI A;  4MZL A;  2L2E A;  1KCY A;  3EVV A;  1DJH A;  4UPG A;  1TCF A;  1JFK A;  2L50 A;  1L7Z A;  2O60 A;  2LE9 B;  1KK8 C;  2ZND A;  1WLZ A;  2OTG C;  2BCB A;  4PHJ A;  1MXL C;  1R6P A;  3F45 A;  1BJF A;  4M2P A;  3DD4 A;  3SG2 A;  1ZFS A;  2GGM A;  4PCW A;  4WRI A;  1JF0 A;  1K95 A;  1N65 A;  1B8C A;  1OMV A;  2WOR A;  3FS7 A;  4N1G A;  1OMD A;  1KFX L;  4PAL A;  3VRQ A;  1UHI A;  2JXC A;  3DVJ A;  4GBA A;  4BY4 A;  1QV1 A;  3I5G B;  2K8M B;  3LK1 A;  1Q80 A;  1TRF A;  2FCE A;  1EL4 A;  2BL0 C;  5TNC A;  1SR6 C;  4GNK B;  2I18 A;  1B8L A;  4ORA B;  2FCD A;  3HCM A;  1QJT A;  4MBE A;  1RRO A;  2WCB A;  2KGR A;  3BQ3 A;  1KQM B;  1ZUZ A;  2L4H A;  1PK0 D;  4M2Q A;  1QX5 B;  1QLS A;  1W7J B;  4YGA A;  2LHI A;  2K2F A;  1MF8 B;  3CWG A;  1SNL A;  4P5O E;  4GGF C;  2MBX A;  1LIN A;  1CB1 A;  1YRT B;  3VRR A;  5K89 A;  1RK9 A;  2LMV A;  4CFR A;  1D1O A;  1F55 A;  4JPZ B;  2OS8 B;  3KO0 A;  1G4Y R;  5GQQ C;  2AUC A;  2ZRT A;  3RM1 A;  3RLZ A;  4MZK A;  5AER A;  4NQG A;  1UHN A;  2BKH B;  1M31 A;  1XA5 A;  2HET A;  1Y0V H;  1KQV A;  2WCF A;  2AAO A;  1GQM A;  1XFY O;  3BUM B;  2JTZ A;  3OP0 A;  2PAL A;  2F3Y A;  2M97 A;  5DKN A;  4I5J A;  1Y1U A;  1CKK A;  4NDD A;  1YRU B;  4AOM A;  1NUB A;  1BMO A;  1IRJ A;  3D0Y B;  1CFC A;  1OE9 B;  2M7L A;  4ZCV A;  3I5I B;  3TUY C;  3CLN A;  2A4J A;  4WQ3 A;  1LVC D;  2M7N A;  2LP3 A;  2DOQ A;  2I7A A;  1NX0 A;  4XJK A;  3VGO A;  2V53 A;  5AAN A;  1DJG A;  2LP2 A;  3WHT B;  1V1F A;  4DUQ A;  4QJ4 B;  2ZKM X;  5JJG A;  3VRN A;  4FQO A;  2CT9 A;  3DVM A;  2EGD A;  2KAY A;  5IBW A;  3K21 A;  1CNP A;  1C07 A;  3DVE A;  2LUX A;  3NSO A;  1QS7 A;  1M39 A;  3OHM B;  2KAX A;  4DIR A;  1XFZ O;  2LM5 A;  1NCZ A;  1UHK A;  3LLE A;  2LVK A;  3SG3 A;  1QV0 A;  3PN7 C;  2M1U A;  4YGC B;  1IWQ A;  4PE4 A;  4N5X A;  1CLM A;  5KSZ A;  1N2D A;  1SCM B;  2TN4 A;  4N1F A;  1QLK A;  1DJW A;  4XYN A;  4DRW A;  1DGU A;  1BT6 A;  1XK4 A;  4PHK A;  1YUS A;  3DVK A;  1CLL A;  3BUW B;  4PE7 A;  1CDN A;  1OSA A;  1IH0 A;  3EVR A;  4BY5 A;  2CXJ A;  2KBM A;  3AAK A;  1YVL A;  5CSN A;  5ER5 A;  2GV5 A;  1F8H A;  2H61 A;  1YTZ C;  1QAS A;  5HYD A;  1UUR A;  1F70 A;  1QTX A;  2MAZ A;  1DGV A;  4ZCU A;  1XO5 A;  2I94 A;  2KFH A;  2JUL A;  2F8P A;  1DJX A;  2MJW B;  4Q04 A;  2JXL A;  1S6I A;  2KI6 C;  1MWN A;  2B1U A;  1WRL A;  2HQW A;  1LKJ A;  1GGW A;  1S5G Z;  2BCX A;  1JWD A;  1BU3 A;  3A4U B;  3D0Y A;  1PSB A;  2OPO A;  1HQV A;  3OB1 B;  2L5X B;  3I5H C;  1TTX A;  1BOC A;  1CM1 A;  3WXA A;  3IQQ A;  3KHE A;  4I5L B;  2NLN A;  2QAC A;  1REC A;  1SCV A;  1NCX A;  2L98 A;  5HKZ A;  4PDZ A;  1DJI A;  2FOT A;  1C7V A;  1XFU O;  2ZRS A;  5HLV A;  1KWO C;  1YUT A;  1NWD A;  1KFU S;  1QVI Y;  1IJ5 A;  1EG4 A;  1XFV O;  1IGV A;  1YVH A;  4MLW A;  3LK0 A;  4MZJ A;  1LA0 A;  5AXI A;  1NP8 A;  2KYF A;  4XJK B;  1EG3 A;  5I8N A;  1JBA A;  1GGZ A;  4GAO A;  1OZO A;  1A4P A;  1NCY A;  4A4C A;  4YRU A;  2JWW A;  3EVU A;  3PAT A;  4CID A;  1HT9 A;  2L0P A;  4D1E A;  2JOJ A;  2F33 A;  4HRG A;  4M2O A;  2H2K A;  2SCP A;  1L2O C;  2JNX A;  2HQ8 A;  3JVT C;  1TN4 A;  3O78 A;  1ALW A;  2KFF A;  3LCP C;  2JC2 A;  1YUU A;  1J1E A;  1QVI Z;  2E30 A;  4PHM A;  3DF0 B;  2LVV A;  5CPV A;  1JF2 A;  2M3W A;  1A29 A;  3ICB A;  2LV7 A;  5G08 A;  1WLM A;  1AJ4 A;  5PAL A;  4CLN A;  2KAV A;  3E3R A;  2ZN9 A;  3IF7 A;  2JPT A;  2Y1M A;  1JFJ A;  2JT3 A;  2M9G A;  4OKH A;  3TDU A;  4GGF A;  4MRY A;  1K9P A;  1WDC C;  1TNP A;  1S1E A;  5F6T A;  4E68 A;  2KGB C;  2CNP A;  2LLS A;  2ZFD A;  3JTD B;  1SMG A;  1MR8 A;  2M29 A;  2NCO A;  4AQI A;  2LVJ A;  3CR4 X;  2LMT A;  2LAN A;  4HRH A;  1NPQ A;  4OV2 A;  1CMG A;  1MUX A;  2JTT A;  3I5F C;  3CZT X;  2WOS A;  5J3X A;  1JSA A;  1NX3 A;  2F2O A;  3QRX A;  1MQ1 A;  1K96 A;  2KOT A;  3LL8 B;  1FBV A;  3WNX B;  3SIA A;  1RWY A;  1A03 A;  2BBN A;  3AKB A;  1OMR A;  1AP4 A;  3D10 A;  3GK4 X;  2WC8 A;  2WND A;  3FWB A;  1OOJ A;  1DTL A;  1GJY A;  1QIW A;  2BEC A;  4USL A;  4PHN A;  3ZWH A;  1B4C A;  1KK8 B;  2OTG B;  3I5G C;  1QXP A;  1DT7 B;  3WHU B;  2K7B A;  1XVJ A;  4A4B A;  4GUK A;  1A2X A;  3TDI A;  1RTP 1;  4CPV A;  2CBL A;  4GPL B;  5HKW A;  3BXK A;  5I2L A;  5ER4 X;  2ZN8 A;  2M0R A;  2JRF A;  2PRU A;  3KF9 A;  1TCO B;  2M8U A;  2K61 A;  3DF0 A;  1KQM C;  1YX7 A;  1M46 A;  1W7I B;  1MHO A;  1X02 A;  4IL1 A;  3CR5 X;  1ZMZ A;  2PAS A;  3KPX A;  2E6W A;  1S5G Y;  4ETO A;  1BR4 B;  2Q91 A;  3NSK A;  4I5K A;  1SL8 A;  3EKH A;  1F54 A;  2BL0 B;  1FW4 A;  1SR6 B;  1K9U A;  1TNW A;  5CSJ A;  3SG6 A;  2SAS A;  2ZNE A;  3O2P A;  2Y5I A;  1K8U A;  1QX7 A;  2MLE C;  1RFJ A;  1AJ5 A;  2KI4 C;  3A8R A;  1K9K A;  2OS8 C;  2BCA A;  1SRA A;  4L9M A;  1MXE A;  1DJZ A;  4OVN F;  1J55 A;  1SL7 A;  4QJ5 B;  4JQ0 D;  4C0L A;  2JQ6 A;  2Y1N A;  1CDM A;  1CM4 A;  1UWO A;  2EHB A;  3EK4 A;  4YGE B;  1ZOT B;  2G9B A;  3BOW A;  3EKJ A;  1SK6 D;  2P6B B;  1S3P A;  3HX4 A;  1U5I A;  3AKA A;  1J7O A;  1SY9 A;  4PE0 A;  1KK7 Y;  2LLU A;  4ORB B;  2L4I A;  5KU1 A;  3SJS A;  1CDL A;  5AFP A;  1B8R A;  2PVB A;  3PAL A;  1UUS A;  3MSE B;  1BG1 A;  1DJY A;  1IG5 A;  1QIV A;  3BUO B;  2L51 A;  3C1V A;  4MVF A;  3I5I C;  4C0J A;  1AVS A;  1K90 D;  1H8B A;  1SW8 A;  3BUX B;  5KTY A;  1ZAC A;  5HLO A;  1AHR A;  2LAP A;  2NCP A;  2R2I A;  1DF0 A;  4MN0 A;  1SBJ A;  2QPT A;  1XYD A;  5AEQ A;  3I5F B;  2KQY A;  1CFF A;  1B7T Y;  1J7P A;  1FPW A;  2LCP A;  1SL9 A;  4OR9 B;  1KK7 Z;  1KSO A;  3O4Y A;  1AUI B;  2K2A A;  3CR2 A;  2JT0 A;  2G2B A;  3SG5 A;  4QJ3 B;  3FWC A;  1PVA A;  1M63 B;  3TUY B;  3CS1 A;  1QAT A;  1CMF A;  1QX2 A;  2K7O A;  4YGB B;  5DKQ A;  5JOL A;  4GGN A;  3GK2 A;  2MRD A;  3VRP A;  4MEW A; 
#chains in the Genus database with same CATH topology
 1UHH A;  3BUN B;  1S36 A;  2LVI A;  3DZT A;  5D69 A;  1CFP A;  1KFX S;  1J7Q A;  2HF5 A;  4OCI A;  1DVI A;  1PUL A;  1FI5 A;  2AMI A;  4NDC A;  3B87 A;  2Q4U A;  1UP5 A;  4HRE E;  2ISD A;  1PAL A;  1IQ3 A;  1SCM C;  1YR5 A;  1B7T Z;  3GOF A;  3FIA A;  1SPY A;  1EXR A;  5I2Q A;  1JC2 A;  2PSR A;  1F71 A;  3OB2 B;  1IQ5 A;  2O5G A;  3BYA A;  3O4X A;  3TS5 C;  2WCM A;  1YUR A;  2EC6 C;  5CSF A;  2FJU B;  4C0K A;  1DQE A;  4MRX A;  2IS9 A;  1WRZ A;  1NX1 A;  1IJ6 A;  2F2P A;  1Y1A A;  3CYZ A;  2COL B;  4WQ2 A;  3VRO A;  3O6B A;  2F3Z A;  1DMO A;  1S6C A;  3PN7 B;  2BE4 A;  2KFG A;  1WY9 A;  2QEB A;  1OQP A;  4ORC B;  2LMU A;  3D75 A;  1B47 A;  2WC6 A;  4DS7 A;  3EK7 A;  2JU0 A;  2D8N A;  1A75 A;  2Y4Q A;  3BOW B;  1NX2 A;  2KBI A;  1M45 A;  1C3Y A;  1U5I B;  2KI4 B;  1NYA A;  2LUC A;  2NXQ A;  2PMY A;  3CDN A;  2LLT A;  1B1G A;  4F0Z B;  3L47 A;  2KLD A;  1R2U A;  4GFT A;  2K7D A;  1EH2 A;  5I2O A;  3PSR A;  4HSZ A;  1S6J A;  1V1G A;  4FTG A;  3EG5 B;  2BAP A;  1BOD A;  2H8V A;  1K94 A;  1Y1X A;  1NIW A;  3IQO A;  4YI8 A;  4YBH B;  2RGI A;  3EK8 A;  4DCK A;  2JT8 A;  1BF5 A;  3M0W A;  4AQJ A;  1FF1 A;  1FI6 A;  3I5H B;  5D7F A;  4CFQ A;  1PRW A;  1RJV A;  1C7W A;  1DF0 B;  2JZI A;  2KSP A;  2NZ0 A;  2M49 B;  3GK1 A;  5DKR A;  3TDZ A;  3NSL A;  5B8I B;  1AK8 A;  4U8D A;  1TNX A;  5EL2 A;  3SG7 A;  3SG4 A;  1B9A A;  1WRK A;  1XFR A;  2MA2 A;  2BE6 A;  1IKU A;  3NXA A;  5I94 A;  1K2H A;  1J7R A;  1G8I A;  2GGZ A;  2PYQ A;  3PLF B;  1CDP A;  1F4Q A;  1CLB A;  2KNE A;  2K0J A;  1K93 D;  1YX8 A;  1KWO B;  1SKT A;  1J1D A;  1LXF C;  2CCM A;  5FYX A;  1S26 D;  3CTN A;  1TNQ A;  2WC5 A;  2PQL A;  1EJ3 A;  2QEO A;  2KI6 D;  2LC5 A;  2HPS A;  1VRK A;  1E8A A;  1OOG A;  2CTN A;  1TWO A;  2LHL A;  4I5N B;  4YGD B;  3SIB A;  2KDH A;  1PVB A;  2KHN A;  1CFD A;  1LA3 A;  2I2R E;  1H4B A;  1JUO A;  4P2Y B;  4R1E A;  2MLF C;  1L2O B;  1CTR A;  4PE1 A;  3JVT B;  1XK4 C;  5DIC A;  2WCE A;  1ODB A;  1NSH A;  4TNC A;  2MHH A;  5CSI A;  2KYC A;  3FE8 A;  3ZNI A;  3JTD C;  4MSP A;  1G33 A;  4OZD A;  5FI6 A;  2BKI B;  1TOP A;  2H61 C;  1TIZ A;  1KSM A;  1XFX O;  3PM8 A;  3H4S E;  2K7C A;  1N0Y A;  3CGA A;  2M1K B;  1BR1 B;  4YI9 A;  3OX6 A;  3KEV A;  4JWQ A;  3TS5 B;  2KQ6 A;  2EC6 B;  5BPJ A;  3OX5 A;  3CZ0 A;  2ERB A;  2BBM A;  1BLQ A;  1PSR A;  1OZS A;  1WDC B;  1F4O A;  2VRG A;  4ICB A;  2LNK A;  3PFV A;  1XFW O;  1A75 B;  1ALV A;  1Y6W A;  3V2L A;  1SYM A;  2JNF A;  1UHJ A;  3S0A A;  5HKY A;  2P70 A;  4NDB A;  1KFU L;  2KPH A;  3AAJ A;  4IJ7 A;  3NSI A;  4MZL A;  2L2E A;  3TZ1 A;  5HL1 A;  3EVV A;  1DJH A;  1KCY A;  4UPG A;  1TCF A;  1JFK A;  2L50 A;  1L7Z A;  2O60 A;  2LE9 B;  1KK8 C;  2ZND A;  1WLZ A;  2OTG C;  2BCB A;  4PHJ A;  1MXL C;  1R6P A;  3F45 A;  1BJF A;  2WCK A;  4M2P A;  3DD4 A;  3SG2 A;  1ZFS A;  2GGM A;  4PCW A;  2WCL A;  4WRI A;  1JF0 A;  1K95 A;  1N65 A;  1B8C A;  1OMV A;  2WOR A;  3FS7 A;  4N1G A;  1OMD A;  1KFX L;  4PAL A;  3K1E A;  3VRQ A;  1UHI A;  2JXC A;  4INW A;  3D77 A;  3DVJ A;  4GBA A;  4BY4 A;  1QV1 A;  2BNX A;  3I5G B;  2K8M B;  3LK1 A;  1Q80 A;  1TRF A;  2FCE A;  1EL4 A;  2BL0 C;  5TNC A;  1SR6 C;  4GNK B;  2I18 A;  1B8L A;  2QEH A;  4ORA B;  2FCD A;  3HCM A;  1QJT A;  4MBE A;  1RRO A;  2WCB A;  2KGR A;  3BQ3 A;  3B88 A;  3L4A A;  1DC1 A;  4YGE B;  1KQM B;  1ZUZ A;  2L4H A;  1PK0 D;  4M2Q A;  1QX5 B;  1QLS A;  1W7J B;  4YGA A;  2LHI A;  3NGV A;  2K2F A;  1MF8 B;  3CWG A;  1SNL A;  4P5O E;  4GGF C;  2MBX A;  1LIN A;  1CB1 A;  3B6X A;  1YRT B;  3VRR A;  5K89 A;  1RK9 A;  2LMV A;  4CFR A;  1D1O A;  1F55 A;  4FQT A;  4JPZ B;  2OS8 B;  3KO0 A;  1G4Y R;  5GQQ C;  2AUC A;  1SSE B;  2ZRT A;  3RM1 A;  3RLZ A;  4MZK A;  5AER A;  4NQG A;  1UHN A;  2BKH B;  1M31 A;  1XA5 A;  2HET A;  1Y0V H;  3S0F A;  1KQV A;  2WCF A;  2AAO A;  1GQM A;  1XFY O;  3BUM B;  2JTZ A;  3OP0 A;  3R1O A;  2PAL A;  2F3Y A;  2M97 A;  3SS3 A;  5DKN A;  4I5J A;  1Y1U A;  1CKK A;  4NDD A;  1YRU B;  4AOM A;  3SS4 A;  1NUB A;  1BMO A;  1IRJ A;  3D0Y B;  1CFC A;  1OE9 B;  2M7L A;  4ZCV A;  1GM0 A;  3I5I B;  3TUY C;  3CLN A;  2A4J A;  4WQ3 A;  1LVC D;  2M7N A;  3NHI A;  3PM2 A;  2LP3 A;  2P71 A;  2DOQ A;  2I7A A;  1NX0 A;  2QEV A;  4XJK A;  3VGO A;  2V53 A;  5AAN A;  3BFA A;  1DJG A;  2LP2 A;  3WHT B;  1V1F A;  4DUQ A;  4QJ4 B;  2ZKM X;  5JJG A;  3VRN A;  4FQO A;  2CT9 A;  3DVM A;  1TUZ A;  2EGD A;  2KAY A;  5IBW A;  3K21 A;  1CNP A;  1C07 A;  3DVE A;  2LUX A;  3NSO A;  4PT1 A;  3S0E A;  1QS7 A;  1OW4 A;  1M39 A;  3OHM B;  2KAX A;  4DIR A;  1OOH A;  1XFZ O;  2LM5 A;  3VB1 A;  1NCZ A;  1UHK A;  3LLE A;  2LVK A;  3SG3 A;  1QV0 A;  3PN7 C;  2M1U A;  4YGC B;  1IWQ A;  4PE4 A;  4N5X A;  1CLM A;  1T14 A;  2WCJ A;  5KSZ A;  1N2D A;  1SCM B;  2TN4 A;  4N1F A;  1QLK A;  1DJW A;  4XYN A;  4DRW A;  1DGU A;  1BT6 A;  1XK4 A;  3BJH A;  4PHK A;  1YUS A;  3D73 A;  1CLL A;  3BUW B;  3DVK A;  4PE7 A;  1CDN A;  1OSA A;  1C3Z A;  3DXL A;  3EVR A;  1IH0 A;  4BY5 A;  2L5Y A;  2CXJ A;  2KBM A;  3AAK A;  1YVL A;  5CSN A;  5ER5 A;  2GV5 A;  1F8H A;  2H61 A;  1YTZ C;  1QAS A;  5HYD A;  1UUR A;  1DEK A;  3BFH A;  1F70 A;  1QTX A;  2MAZ A;  1DGV A;  4ZCU A;  1XO5 A;  2I94 A;  2KFH A;  2JUL A;  2F8P A;  1DJX A;  2MJW B;  4Q04 A;  2JXL A;  3DY9 A;  1S6I A;  2KI6 C;  1MWN A;  2B1U A;  1WRL A;  2HQW A;  1LKJ A;  2GTE A;  3D74 A;  1S5G Z;  3S0G A;  3UNW A;  2BCX A;  1GGW A;  3OBV A;  1JWD A;  1BU3 A;  3A4U B;  3D0Y A;  3CAB A;  1PSB A;  2OPO A;  1HQV A;  3OB1 B;  2L5X B;  3I5H C;  1TTX A;  1BOC A;  1CM1 A;  3D76 A;  3S0B A;  3WXA A;  3IQQ A;  3KHE A;  4I5L B;  2NLN A;  2QAC A;  5FI7 A;  1REC A;  3L4L A;  1SCV A;  1NCX A;  2L98 A;  5HKZ A;  4PDZ A;  1DJI A;  2FOT A;  1C7V A;  1XFU O;  2ZRS A;  5HLV A;  1KWO C;  1YUT A;  1NWD A;  1KFU S;  1QVI Y;  1IJ5 A;  1EG4 A;  1XFV O;  1IGV A;  1YVH A;  2L2C A;  3LK0 A;  4MLW A;  1LA0 A;  1OOI X;  1NP8 A;  2KYF A;  4MZJ A;  4XJK B;  5AXI A;  4F7F A;  1EG3 A;  5I8N A;  1JBA A;  1GGZ A;  4GAO A;  1OZO A;  1A4P A;  1NCY A;  4A4C A;  4YRU A;  1Z2C B;  2JWW A;  3EVU A;  3NHT A;  1HT9 A;  3PAT A;  4CID A;  2L0P A;  4D1E A;  2JOJ A;  2F33 A;  4HRG A;  4M2O A;  2H2K A;  2SCP A;  1L2O C;  2JNX A;  2HQ8 A;  3JVT C;  1TN4 A;  3O78 A;  1ALW A;  2KFF A;  3LCP C;  2JC2 A;  3UO9 A;  1YUU A;  1J1E A;  1QVI Z;  2E30 A;  3BFB A;  3DF0 B;  4PHM A;  2JPO A;  2LVV A;  5CPV A;  2QDI A;  1JF2 A;  2M3W A;  1A29 A;  3ICB A;  2LV7 A;  5G08 A;  1WLM A;  1AJ4 A;  5PAL A;  4CLN A;  2KAV A;  3E3R A;  2ZN9 A;  3IF7 A;  2JPT A;  2Y1M A;  1JFJ A;  2JT3 A;  4INX A;  2M9G A;  3QME A;  4OKH A;  3TDU A;  4GGF A;  4MRY A;  3IVT A;  1K9P A;  3CZ1 A;  1WDC C;  1TNP A;  1S1E A;  5F6T A;  4E68 A;  2KGB C;  2CNP A;  2LLS A;  2ZFD A;  3JTD B;  1SMG A;  1MR8 A;  2M29 A;  2NCO A;  4AQI A;  2LVJ A;  3CR4 X;  2LMT A;  3Q8I A;  2LAN A;  4HRH A;  1NPQ A;  4OV2 A;  1CMG A;  5FI2 A;  1OOF A;  1MUX A;  2JTT A;  3I5F C;  3CZT X;  3SS5 A;  2WOS A;  5J3X A;  2K60 A;  1JSA A;  1NX3 A;  2F2O A;  3QRX A;  4KYN A;  1MQ1 A;  1K96 A;  2KOT A;  3LL8 B;  1FBV A;  3WNX B;  3SIA A;  1RWY A;  3RZS A;  1A03 A;  2BBN A;  3AKB A;  1OMR A;  1AP4 A;  3OGN A;  3D10 A;  3GK4 X;  2WC8 A;  2WND A;  3FWB A;  1OOJ A;  1DTL A;  1GJY A;  2FJY A;  1QIW A;  2BEC A;  4USL A;  4PHN A;  3ZWH A;  1B4C A;  1KK8 B;  2OTG B;  3I5G C;  1QXP A;  1DT7 B;  3WHU B;  2K7B A;  1Z4H A;  1XVJ A;  4A4B A;  4GUK A;  3CZ2 A;  1A2X A;  3TDI A;  1RTP 1;  4CPV A;  2CBL A;  4GPL B;  5HKW A;  3BXK A;  5I2L A;  5ER4 X;  2ZN8 A;  3D78 A;  2M0R A;  3R1V A;  2KLE A;  2JRF A;  2PRU A;  3KF9 A;  1TCO B;  2M8U A;  5D3O A;  2K61 A;  3DF0 A;  1J7O A;  1KQM C;  1YX7 A;  3PJI A;  1M46 A;  1W7I B;  1MHO A;  1X02 A;  4IL1 A;  3CR5 X;  1ZMZ A;  2PAS A;  3KPX A;  2E6W A;  1S5G Y;  4ETO A;  1BR4 B;  2Q91 A;  3NSK A;  4I5K A;  1SL8 A;  4JKT A;  3EKH A;  1F54 A;  2BL0 B;  3DYE A;  1FW4 A;  1SR6 B;  1K9U A;  1TNW A;  5CSJ A;  3FE9 A;  1W9Z A;  3SG6 A;  2SAS A;  2ZNE A;  3O2P A;  2Y5I A;  1K8U A;  1QX7 A;  2MLE C;  1ORG A;  1RFJ A;  1AJ5 A;  2KI4 C;  3A8R A;  1DEL A;  1K9K A;  1SRA A;  2BCA A;  2OS8 C;  4L9M A;  1MXE A;  1DJZ A;  4OVN F;  1J55 A;  1SL7 A;  4QJ5 B;  4JQ0 D;  4C0L A;  2JQ6 A;  2Y1N A;  3FE6 A;  1LS8 A;  3B7A A;  1CDM A;  1CM4 A;  1UWO A;  1TUJ A;  2EHB A;  3EK4 A;  1ZOT B;  2G9B A;  3BOW A;  3EKJ A;  1SK6 D;  2P6B B;  1S3P A;  3HX4 A;  1U5I A;  3AKA A;  3S0D A;  1SY9 A;  4PE0 A;  1KK7 Y;  2LLU A;  4ORB B;  2L4I A;  3R72 A;  4JD9 A;  3SJS A;  5KU1 A;  1P28 A;  1CDL A;  5AFP A;  1B8R A;  3N7H A;  2PVB A;  3PAL A;  1UUS A;  1QWV A;  3MSE B;  1BG1 A;  1DJY A;  1IG5 A;  1QIV A;  3BUO B;  2L51 A;  3C1V A;  3R1P A;  4MVF A;  3I5I C;  4C0J A;  1AVS A;  1K90 D;  1H8B A;  1SW8 A;  3BUX B;  5KTY A;  1ZAC A;  5HLO A;  1AHR A;  2LAP A;  2NCP A;  2R2I A;  1DF0 A;  4MN0 A;  1SBJ A;  2WCH A;  2QPT A;  1XYD A;  5AEQ A;  3I5F B;  2KQY A;  1CFF A;  1B7T Y;  1J7P A;  1FPW A;  2LCP A;  1SL9 A;  4OR9 B;  1KK7 Z;  1KSO A;  3O4Y A;  1AUI B;  2K2A A;  3CR2 A;  2JT0 A;  2G2B A;  3B86 A;  2YGU A;  3SG5 A;  4QJ3 B;  3FWC A;  1PVA A;  1M63 B;  3TUY B;  3CS1 A;  1QAT A;  1CMF A;  1QX2 A;  2K7O A;  4YGB B;  5DKQ A;  5JOL A;  4GGN A;  3GK2 A;  1IIO A;  2MRD A;  3VRP A;  4MEW A; 
#chains in the Genus database with same CATH homology
 1UHH A;  3BUN B;  1S36 A;  2LVI A;  5D69 A;  1CFP A;  1KFX S;  1J7Q A;  2HF5 A;  4OCI A;  1DVI A;  1PUL A;  1FI5 A;  2AMI A;  4NDC A;  2Q4U A;  1UP5 A;  4HRE E;  2ISD A;  1PAL A;  1IQ3 A;  1SCM C;  1YR5 A;  1B7T Z;  3GOF A;  3FIA A;  1SPY A;  1EXR A;  5I2Q A;  1JC2 A;  2PSR A;  1F71 A;  3OB2 B;  1IQ5 A;  2O5G A;  3BYA A;  3TS5 C;  1YUR A;  2EC6 C;  5CSF A;  2FJU B;  4C0K A;  4MRX A;  2IS9 A;  1WRZ A;  1NX1 A;  1IJ6 A;  2F2P A;  1Y1A A;  4WQ2 A;  2COL B;  3VRO A;  3O6B A;  2F3Z A;  1DMO A;  1S6C A;  3PN7 B;  2BE4 A;  2KFG A;  1WY9 A;  1OQP A;  4ORC B;  2LMU A;  1B47 A;  4DS7 A;  3EK7 A;  2JU0 A;  2D8N A;  1A75 A;  2Y4Q A;  3BOW B;  1NX2 A;  2KBI A;  1M45 A;  1U5I B;  2KI4 B;  1NYA A;  2LUC A;  2NXQ A;  2PMY A;  2LLT A;  1B1G A;  4F0Z B;  1R2U A;  4GFT A;  2K7D A;  1EH2 A;  5I2O A;  3PSR A;  4HSZ A;  1S6J A;  1V1G A;  4FTG A;  1BOD A;  1K94 A;  1Y1X A;  1NIW A;  3IQO A;  4YI8 A;  4YBH B;  2RGI A;  3EK8 A;  4DCK A;  2JT8 A;  1BF5 A;  3M0W A;  4AQJ A;  1FF1 A;  1FI6 A;  3I5H B;  5D7F A;  4CFQ A;  1PRW A;  1RJV A;  1C7W A;  1DF0 B;  2JZI A;  2KSP A;  2NZ0 A;  2M49 B;  3GK1 A;  5DKR A;  3TDZ A;  3NSL A;  5B8I B;  1AK8 A;  4U8D A;  1TNX A;  3SG7 A;  3SG4 A;  1B9A A;  1WRK A;  2MA2 A;  2BE6 A;  1IKU A;  3NXA A;  1K2H A;  1J7R A;  1G8I A;  2GGZ A;  3PLF B;  1CDP A;  1F4Q A;  1CLB A;  2KNE A;  2K0J A;  1K93 D;  1YX8 A;  1KWO B;  1SKT A;  1J1D A;  1LXF C;  2CCM A;  5FYX A;  1S26 D;  3CTN A;  1TNQ A;  1EJ3 A;  2KI6 D;  2LC5 A;  2HPS A;  1VRK A;  1E8A A;  2CTN A;  2LHL A;  4I5N B;  4YGD B;  3SIB A;  2KDH A;  1PVB A;  2KHN A;  1CFD A;  1LA3 A;  2I2R E;  1H4B A;  1JUO A;  4P2Y B;  4R1E A;  2MLF C;  1L2O B;  1CTR A;  4PE1 A;  3JVT B;  1XK4 C;  2WCE A;  1ODB A;  1NSH A;  4TNC A;  2MHH A;  5CSI A;  2KYC A;  3ZNI A;  3JTD C;  4MSP A;  1G33 A;  2BKI B;  1TOP A;  2H61 C;  1TIZ A;  1KSM A;  1XFX O;  3PM8 A;  3H4S E;  2K7C A;  1N0Y A;  3CGA A;  2M1K B;  1BR1 B;  4YI9 A;  3OX6 A;  3KEV A;  4JWQ A;  3TS5 B;  2KQ6 A;  2EC6 B;  5BPJ A;  3OX5 A;  2BBM A;  1BLQ A;  1PSR A;  1OZS A;  1WDC B;  1F4O A;  2VRG A;  4ICB A;  2LNK A;  3PFV A;  1XFW O;  1A75 B;  1ALV A;  1Y6W A;  1SYM A;  2JNF A;  1UHJ A;  5HKY A;  4NDB A;  1KFU L;  3AAJ A;  3TZ1 A;  3NSI A;  4MZL A;  2L2E A;  1KCY A;  3EVV A;  1DJH A;  4UPG A;  1TCF A;  1JFK A;  2L50 A;  1L7Z A;  2O60 A;  2LE9 B;  1KK8 C;  2ZND A;  1WLZ A;  2OTG C;  2BCB A;  4PHJ A;  1MXL C;  1R6P A;  3F45 A;  1BJF A;  4M2P A;  3DD4 A;  3SG2 A;  1ZFS A;  2GGM A;  4PCW A;  4WRI A;  1JF0 A;  1K95 A;  1N65 A;  1B8C A;  1OMV A;  2WOR A;  3FS7 A;  4N1G A;  1OMD A;  1KFX L;  4PAL A;  3VRQ A;  1UHI A;  2JXC A;  3DVJ A;  4GBA A;  4BY4 A;  1QV1 A;  3I5G B;  2K8M B;  3LK1 A;  1Q80 A;  1TRF A;  2FCE A;  1EL4 A;  2BL0 C;  5TNC A;  1SR6 C;  4GNK B;  2I18 A;  1B8L A;  4ORA B;  2FCD A;  3HCM A;  1QJT A;  4MBE A;  1RRO A;  2WCB A;  2KGR A;  3BQ3 A;  1KQM B;  1ZUZ A;  2L4H A;  1PK0 D;  4M2Q A;  1QX5 B;  1QLS A;  1W7J B;  4YGA A;  2LHI A;  2K2F A;  1MF8 B;  3CWG A;  1SNL A;  4P5O E;  4GGF C;  2MBX A;  1LIN A;  1CB1 A;  1YRT B;  3VRR A;  5K89 A;  1RK9 A;  2LMV A;  4CFR A;  1D1O A;  1F55 A;  4JPZ B;  2OS8 B;  3KO0 A;  1G4Y R;  5GQQ C;  2AUC A;  2ZRT A;  3RM1 A;  3RLZ A;  4MZK A;  5AER A;  4NQG A;  1UHN A;  2BKH B;  1M31 A;  1XA5 A;  2HET A;  1Y0V H;  1KQV A;  2WCF A;  2AAO A;  1GQM A;  1XFY O;  3BUM B;  2JTZ A;  3OP0 A;  2PAL A;  2F3Y A;  2M97 A;  5DKN A;  4I5J A;  1Y1U A;  1CKK A;  4NDD A;  1YRU B;  4AOM A;  1NUB A;  1BMO A;  1IRJ A;  3D0Y B;  1CFC A;  1OE9 B;  2M7L A;  4ZCV A;  3I5I B;  3TUY C;  3CLN A;  2A4J A;  4WQ3 A;  1LVC D;  2M7N A;  2LP3 A;  2DOQ A;  2I7A A;  1NX0 A;  4XJK A;  3VGO A;  2V53 A;  5AAN A;  1DJG A;  2LP2 A;  3WHT B;  1V1F A;  4DUQ A;  4QJ4 B;  2ZKM X;  5JJG A;  3VRN A;  4FQO A;  2CT9 A;  3DVM A;  2EGD A;  2KAY A;  5IBW A;  3K21 A;  1CNP A;  1C07 A;  3DVE A;  2LUX A;  3NSO A;  1QS7 A;  1M39 A;  3OHM B;  2KAX A;  4DIR A;  1XFZ O;  2LM5 A;  1NCZ A;  1UHK A;  3LLE A;  2LVK A;  3SG3 A;  1QV0 A;  3PN7 C;  2M1U A;  4YGC B;  1IWQ A;  4PE4 A;  4N5X A;  1CLM A;  5KSZ A;  1N2D A;  1SCM B;  2TN4 A;  4N1F A;  1QLK A;  1DJW A;  4XYN A;  4DRW A;  1DGU A;  1BT6 A;  1XK4 A;  4PHK A;  1YUS A;  3DVK A;  1CLL A;  3BUW B;  4PE7 A;  1CDN A;  1OSA A;  1IH0 A;  3EVR A;  4BY5 A;  2CXJ A;  2KBM A;  3AAK A;  1YVL A;  5CSN A;  5ER5 A;  2GV5 A;  1F8H A;  2H61 A;  1YTZ C;  1QAS A;  5HYD A;  1UUR A;  1F70 A;  1QTX A;  2MAZ A;  1DGV A;  4ZCU A;  1XO5 A;  2I94 A;  2KFH A;  2JUL A;  2F8P A;  1DJX A;  2MJW B;  4Q04 A;  2JXL A;  1S6I A;  2KI6 C;  1MWN A;  2B1U A;  1WRL A;  2HQW A;  1LKJ A;  1GGW A;  1S5G Z;  2BCX A;  1JWD A;  1BU3 A;  3A4U B;  3D0Y A;  1PSB A;  2OPO A;  1HQV A;  3OB1 B;  2L5X B;  3I5H C;  1TTX A;  1BOC A;  1CM1 A;  3WXA A;  3IQQ A;  3KHE A;  4I5L B;  2NLN A;  2QAC A;  1REC A;  1SCV A;  1NCX A;  2L98 A;  5HKZ A;  4PDZ A;  1DJI A;  2FOT A;  1C7V A;  1XFU O;  2ZRS A;  5HLV A;  1KWO C;  1YUT A;  1NWD A;  1KFU S;  1QVI Y;  1IJ5 A;  1EG4 A;  1XFV O;  1IGV A;  1YVH A;  4MLW A;  3LK0 A;  4MZJ A;  1LA0 A;  5AXI A;  1NP8 A;  2KYF A;  4XJK B;  1EG3 A;  5I8N A;  1JBA A;  1GGZ A;  4GAO A;  1OZO A;  1A4P A;  1NCY A;  4A4C A;  4YRU A;  2JWW A;  3EVU A;  3PAT A;  4CID A;  1HT9 A;  2L0P A;  4D1E A;  2JOJ A;  2F33 A;  4HRG A;  4M2O A;  2H2K A;  2SCP A;  1L2O C;  2JNX A;  2HQ8 A;  3JVT C;  1TN4 A;  3O78 A;  1ALW A;  2KFF A;  3LCP C;  2JC2 A;  1YUU A;  1J1E A;  1QVI Z;  2E30 A;  4PHM A;  3DF0 B;  2LVV A;  5CPV A;  1JF2 A;  2M3W A;  1A29 A;  3ICB A;  2LV7 A;  5G08 A;  1WLM A;  1AJ4 A;  5PAL A;  4CLN A;  2KAV A;  3E3R A;  2ZN9 A;  3IF7 A;  2JPT A;  2Y1M A;  1JFJ A;  2JT3 A;  2M9G A;  4OKH A;  3TDU A;  4GGF A;  4MRY A;  1K9P A;  1WDC C;  1TNP A;  1S1E A;  5F6T A;  4E68 A;  2KGB C;  2CNP A;  2LLS A;  2ZFD A;  3JTD B;  1SMG A;  1MR8 A;  2M29 A;  2NCO A;  4AQI A;  2LVJ A;  3CR4 X;  2LMT A;  2LAN A;  4HRH A;  1NPQ A;  4OV2 A;  1CMG A;  1MUX A;  2JTT A;  3I5F C;  3CZT X;  2WOS A;  5J3X A;  1JSA A;  1NX3 A;  2F2O A;  3QRX A;  1MQ1 A;  1K96 A;  2KOT A;  3LL8 B;  1FBV A;  3WNX B;  3SIA A;  1RWY A;  1A03 A;  2BBN A;  3AKB A;  1OMR A;  1AP4 A;  3D10 A;  3GK4 X;  2WC8 A;  2WND A;  3FWB A;  1OOJ A;  1DTL A;  1GJY A;  1QIW A;  2BEC A;  4USL A;  4PHN A;  3ZWH A;  1B4C A;  1KK8 B;  2OTG B;  3I5G C;  1QXP A;  1DT7 B;  3WHU B;  2K7B A;  1XVJ A;  4A4B A;  4GUK A;  1A2X A;  3TDI A;  1RTP 1;  4CPV A;  2CBL A;  4GPL B;  5HKW A;  3BXK A;  5I2L A;  5ER4 X;  2ZN8 A;  2M0R A;  2JRF A;  2PRU A;  3KF9 A;  1TCO B;  2M8U A;  2K61 A;  3DF0 A;  1KQM C;  1YX7 A;  1M46 A;  1W7I B;  1MHO A;  1X02 A;  4IL1 A;  3CR5 X;  1ZMZ A;  2PAS A;  3KPX A;  2E6W A;  1S5G Y;  4ETO A;  1BR4 B;  2Q91 A;  3NSK A;  4I5K A;  1SL8 A;  3EKH A;  1F54 A;  2BL0 B;  1FW4 A;  1SR6 B;  1K9U A;  1TNW A;  5CSJ A;  3SG6 A;  2SAS A;  2ZNE A;  3O2P A;  2Y5I A;  1K8U A;  1QX7 A;  2MLE C;  1RFJ A;  1AJ5 A;  2KI4 C;  3A8R A;  1K9K A;  2OS8 C;  2BCA A;  1SRA A;  4L9M A;  1MXE A;  1DJZ A;  4OVN F;  1J55 A;  1SL7 A;  4QJ5 B;  4JQ0 D;  4C0L A;  2JQ6 A;  2Y1N A;  1CDM A;  1CM4 A;  1UWO A;  2EHB A;  3EK4 A;  4YGE B;  1ZOT B;  2G9B A;  3BOW A;  3EKJ A;  1SK6 D;  2P6B B;  1S3P A;  3HX4 A;  1U5I A;  3AKA A;  1J7O A;  1SY9 A;  4PE0 A;  1KK7 Y;  2LLU A;  4ORB B;  2L4I A;  5KU1 A;  3SJS A;  1CDL A;  5AFP A;  1B8R A;  2PVB A;  3PAL A;  1UUS A;  3MSE B;  1BG1 A;  1DJY A;  1IG5 A;  1QIV A;  3BUO B;  2L51 A;  3C1V A;  4MVF A;  3I5I C;  4C0J A;  1AVS A;  1K90 D;  1H8B A;  1SW8 A;  3BUX B;  5KTY A;  1ZAC A;  5HLO A;  1AHR A;  2LAP A;  2NCP A;  2R2I A;  1DF0 A;  4MN0 A;  1SBJ A;  2QPT A;  1XYD A;  5AEQ A;  3I5F B;  2KQY A;  1CFF A;  1B7T Y;  1J7P A;  1FPW A;  2LCP A;  1SL9 A;  4OR9 B;  1KK7 Z;  1KSO A;  3O4Y A;  1AUI B;  2K2A A;  3CR2 A;  2JT0 A;  2G2B A;  3SG5 A;  4QJ3 B;  3FWC A;  1PVA A;  1M63 B;  3TUY B;  3CS1 A;  1QAT A;  1CMF A;  1QX2 A;  2K7O A;  4YGB B;  5DKQ A;  5JOL A;  4GGN A;  3GK2 A;  2MRD A;  3VRP A;  4MEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...