5DKRA

Crystal structure of calcium-loaded s100b bound to sbi29
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
89
structure length
89
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/inhibitor
molecule keywords Protein S100-B
publication title Small Molecule Inhibitors of Ca(2+)-S100B Reveal Two Protein Conformations.
pubmed doi rcsb
source organism Bos taurus
total genus 34
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5dkrA00
2BE6A 5KTYA 4PHKA 4P5OE 2MLFC 2R2IA 2WNDA 3DVEA 3DVMA 5FYXA 1PRWA 2LLTA 2LP2A 1Y6WA 2NXQA 4MRXA 2L4IA 2K7CA 2PMYA 2KBIA 2JNFA 5I2QA 4A4BA 1IRJA 3DF0B 3LL8B 2RGIA 1ZOTB 5CSNA 1B1GA 2BKHB 4N1GA 3FS7A 1TNPA 3VRNA 1UURA 2LCPA 2LMTA 1F71A 1TN4A 3IQOA 2M97A 1BMOA 2GGMA 1C07A 1NIWA 1NCXA 5AANA 1MXLC 1CLBA 2K7BA 1KQMB 1F55A 1XFXO 4HREE 2K8MB 1RWYA 3D10A 4N5XA 1WLMA 3LLEA 2BBNA 1B7TY 4IL1A 2WORA 2PRUA 1DMOA 1YX7A 5HKYA 1DJWA 3RM1A 1AUIB 3I5GC 4M2QA 4NDBA 4UPGA 3AKAA 1J1DA 2E30A 5HLOA 3VRRA 1K93D 3KHEA 5TNCA 1B8LA 1OZSA 3KF9A 5DKQA 3LK0A 1S3PA 1YURA 2KFGA 1SBJA 3SJSA 1SCMC 3PLFB 2LVJA 3ZNIA 3PN7C 1WRLA 3EKJA 3CWGA 1ALVA 1OMVA 3BXKA 3D0YA 1AVSA 1RJVA 1KWOC 1SRAA 1TIZA 2LC5A 1K94A 1SK6D 2M49B 2WCBA 1JSAA 1FW4A 1YUSA 2IS9A 1CMFA 2O60A 3JTDB 2M1KB 1YRTB 4XYNA 5ER4X 2LVVA 2LUXA 4OKHA 1R2UA 2JTZA 4YGAA 1FPWA 1YUTA 1UHNA 1KK7Y 2BL0B 1B8RA 5PALA 1UP5A 2PALA 1BU3A 1RECA 1CDNA 1MQ1A 3TUYB 1ALWA 2KGBC 1B7TZ 4DCKA 1K9KA 1NCZA 2KI6D 4CFQA 4ZCUA 2F2OA 2JRFA 3NXAA 1TTXA 2WCEA 4M2OA 2MJWB 3OP0A 2LANA 4TNCA 1U5IB 1BT6A 2F8PA 4WQ3A 2WOSA 4C0JA 1S6IA 1YR5A 2MRDA 2L2EA 1AK8A 1DTLA 3VRQA 2B1UA 5K89A 1KFXS 3OHMB 2Q4UA 4PCWA 1SL9A 3GOFA 3TDUA 1JWDA 1QV1A 3SIBA 2JT8A 2K7DA 3FIAA 3VRPA 1LINA 1SR6B 4YI9A 1DF0A 4PDZA 4YRUA 2LVIA 1KFXL 3RLZA 1TCFA 2MLEC 3JVTC 4OV2A 4ZCVA 1WDCC 3C1VA 1C7VA 1KK7Z 1EH2A 1V1GA 4E68A 3GK1A 4MVFA 1CMGA 1CFPA 3TS5B 4NDCA 2BCBA 2KYFA 2OS8C 1NYAA 1QIVA 1YRUB 4PE4A 4PHMA 1CM4A 4Q04A 1AP4A 1JF0A 1B9AA 4YBHB 1UWOA 1QX2A 2K0JA 2EC6B 3I5IB 1IKUA 4ORCB 1QS7A 2LHLA 4N1FA 1FI5A 1G4YR 2ZNEA 1WRZA 1Y0VH 1NSHA 1QXPA 1JBAA 3VGOA 1OQPA 3HCMA 1XK4A 5DKNA 2MAZA 5CPVA 2KAXA 1JFKA 3BUNB 1NPQA 2JQ6A 2Y4QA 4AQJA 1GJYA 4PHNA 1MHOA 2NZ0A 1QJTA 4YGCB 2O5GA 1XFZO 2KBMA 3E3RA 1BR1B 1MWNA 2CCMA 1J7RA 2M0RA 5AERA 3F45A 1UHHA 1EL4A 1K95A 3FWCA 4OR9B 2JWWA 1N0YA 1S6JA 4OVNF 1MR8A 1PSRA 2M9GA 1J7OA 1CM1A 1M45A 1XYDA 3OX5A 1E8AA 2KDHA 1J7QA 3BOWB 2I7AA 2PSRA 3OX6A 1A4PA 3GK4X 2GV5A 4ICBA 1PULA 1DJZA 1A29A 2Y5IA 1L2OB 1N65A 1S26D 4I5JA 4MRYA 1HQVA 2MBXA 4XJKA 2LUCA 2JC2A 5GQQC 2F3ZA 2LAPA 2Y1NA 1TNWA 1A2XA 1QV0A 2JTTA 2JXCA 1TOPA 3EVRA 4GNKB 2BBMA 1PALA 1XFWO 4MBEA 3CS1A 2CXJA 4QJ3B 1NX3A 1K9UA 4MSPA 3BQ3A 1EG3A 2ZN9A 1QX7A 3PFVA 1DJHA 5AXIA 1XVJA 3I5GB 5B8IB 1Q80A 1H4BA 4QJ4B 1OMRA 1F54A 1LKJA 1CDLA 1CTRA 1NP8A 4U8DA 2ZKMX 3EKHA 1DJIA 1GGZA 2WC8A 4CLNA 1DJGA 3DF0A 2HQWA 2PASA 1J55A 3CR5X 1WY9A 3WHTB 2F2PA 3PN7B 3SG5A 1B4CA 1SYMA 1B47A 4GBAA 1BODA 2LMVA 1DGVA 1KWOB 3AAKA 3BUMB 4USLA 2LVKA 5JOLA 3TZ1A 3PM8A 1WLZA 5HYDA 1G8IA 1SMGA 2CTNA 2ZRTA 4ORBB 3WHUB 2KSPA 1YVLA 4YGDB 2M7NA 1TNXA 1CDPA 4QJ5B 2JU0A 1A75B 3JTDC 3NSLA 1SNLA 1IH0A 1S36A 3A4UB 1DJYA 1ZACA 4HSZA 1NCYA 3CR2A 4GPLB 1YTZC 5CSIA 2KQYA 2LE9B 2BL0C 1QX5B 1QTXA 2JT0A 1RFJA 5AFPA 1OMDA 3BUOB 1GGWA 1LXFC 1MXEA 1M39A 2BCAA 4NQGA 1TNQA 4MN0A 3BYAA 1NX2A 3CTNA 1S6CA 1XFVO 2KNEA 1XFYO 2KAVA 3I5HC 2LM5A 3K21A 1MUXA 4NDDA 1K2HA 4R1EA 1BJFA 1ZMZA 4C0KA 1XK4C 1BOCA 2KAYA 1AJ4A 3TDZA 1IQ3A 2LV7A 4M2PA 2HQ8A 1NUBA 3NSIA 4PE7A 3DVKA 1JF2A 1K8UA 2OTGC 3JVTB 5J3XA 1A03A 2LLSA 2L4HA 5IBWA 5I2OA 2CNPA 2G9BA 4AQIA 2M8UA 3SG4A 1WRKA 2OS8B 2ZRSA 1PK0D 1BF5A 2LHIA 1U5IA 2GGZA 1UHKA 3SG3A 4WQ2A 4A4CA 5BPJA 3TS5C 1BLQA 4MZLA 2MHHA 4JWQA 3OB2B 2KI4B 1N2DA 1RROA 2M1UA 4MZKA 3I5IC 1SCVA 2VRGA 3I5FC 1VRKA 2G2BA 4JQ0D 1KK8B 2ZNDA 5D7FA 4BY4A 1FF1A 5HLVA 4HRHA 2DOQA 1J1EA 4PHJA 2FCEA 5AEQA 1UHJA 4AOMA 3PATA 1BR4B 3DVJA 3LK1A 1DGUA 4GGNA 4CIDA 2BE4A 2I2RE 3KO0A 4GFTA 3SG6A 1KFUL 2L50A 4CPVA 4P2YB 1XFUO 2EGDA 3EVVA 3PALA 1X02A 1C7WA 1D1OA 2HETA 1F70A 5CSJA 1W7IB 1RK9A 1TCOB 3O2PA 4I5KA 5I8NA 1KQVA 3A8RA 1JUOA 1L2OC 1ZFSA 2KFFA 3M0WA 4C0LA 1PVBA 1H8BA 1OE9B 4MLWA 1DVIA 1JFJA 1TRFA 2FOTA 2SCPA 1M31A 1UHIA 1BG1A 1CNPA 3LCPC 1S5GY 1QIWA 4I5LB 3D0YB 1Y1XA 4GAOA 2K2AA 3IQQA 3DD4A 2L51A 1KQMC 4ORAB 2WCFA 2M3WA 1IJ6A 1Y1AA 4GUKA 1OZOA 1QATA 2KI6C 2I94A 2H61A 3BUWB 1M46A 1MF8B 1SPYA 3IF7A 4L9MA 5DKRA 3BOWA 1NX0A 3OB1B 2KGRA 4HRGA 2JXLA 1F8HA 1SCMB 1W7JB 1JC2A 3QRXA 3CR4X 2Q91A 1CLLA 4DUQA 1G33A 1CFDA 1QLSA 2D8NA 1DT7B 4MEWA 3HX4A 2NCPA 2HPSA 2V53A 2KYCA 4F0ZB 2CBLA 2LNKA 2LP3A 1LA3A 1S1EA 3EVUA 2KQ6A 1YUUA 4DRWA 1B8CA 4PE1A 1GQMA 1SY9A 1IGVA 5I2LA 3BUXB 1XA5A 2CT9A 2SASA 1UUSA 4JPZB 2BCXA 1PSBA 3O6BA 1S5GZ 4PE0A 1CLMA 3CLNA 1SW8A 3O4YA 1PVAA 2KOTA 1EJ3A 1OOJA 4FQOA 3CGAA 3NSKA 2TN4A 3NSOA 3SG2A 1ODBA 5KSZA 1AHRA 3KPXA 1DF0B 1KSOA 4CFRA 1K90D 2QACA 2JPTA 1EG4A 1M63B 5G08A 1IG5A 2BKIB 3TUYC 2NLNA 1YVHA 3EK7A 3MSEB 1KSMA 1V1FA 1EXRA 3TDIA 1K9PA 3EK8A 1FBVA 2JT3A 3FWBA 3WNXB 1Y1UA 2E6WA 2ISDA 4BY5A 2LMUA 2H2KA 2Y1MA 5CSFA 2P6BB 2COLB 1IQ5A 2AUCA 2PVBA 4DS7A 2F3YA 2L0PA 2OPOA 5D69A 1R6PA 3I5HB 4YI8A 2KFHA 1CFCA 3AKBA 3PSRA 1WDCB 2AMIA 3CZTX 2K2FA 1QLKA 1A75A 1SR6C 2M7LA 4GGFC 1QVIY 2L98A 2ZN8A 3VROA 2OTGB 3ZWHA 2K7OA 1QASA 1XO5A 5HKZA 1CFFA 2K61A 1RTP1 2NCOA 5ER5A 1F4OA 2AAOA 2A4JA 1CDMA 2JZIA 2JNXA 5JJGA 2F33A 4YGBB 1AJ5A 3GK2A 4PALA 1CKKA 2L5XB 2FCDA 1SL8A 4I5NB 1DJXA 1YX8A 2EC6C 3H4SE 1F4QA 4GGFA 2ZFDA 2FJUB 3ICBA 3EK4A 1L7ZA 2MA2A 1LVCD 5HKWA 5KU1A 4XJKB 3SG7A 2QPTA 3I5FB 2JOJA 1KCYA 1KFUS 2KI4C 3AAJA 1SKTA 1CB1A 1K96A 2LLUA 5F6TA 1IJ5A 1IWQA 1NX1A 1SL7A 1LA0A 3KEVA 4OCIA 1KK8C 1J7PA 2JULA 1QVIZ 2KHNA 4ETOA 2BECA 3O78A 3WXAA 4MZJA 1HT9A 4YGEB 1NWDA 2M29A 4FTGA 4WRIA 1FI6A 2EHBA 2I18A 4DIRA 1ZUZA 4D1EA 2H61C 3SIAA 1OSAA 2HF5A
chains in the Genus database with same CATH superfamily
2BE6A 5KTYA 3B88A 4PHKA 4P5OE 2MLFC 2R2IA 2WNDA 3DVEA 3DVMA 5FYXA 1PRWA 2LLTA 2LP2A 1Y6WA 2NXQA 4MRXA 2L4IA 3S0DA 2K7CA 2PMYA 2KBIA 2JNFA 5I2QA 4A4BA 1IRJA 3DF0B 3LL8B 2RGIA 1ZOTB 5CSNA 1B1GA 2BKHB 4N1GA 3FS7A 1TNPA 3VRNA 1UURA 2LCPA 2LMTA 3D74A 1TN4A 3IQOA 2M97A 1F71A 1BMOA 2GGMA 1C07A 1NIWA 1NCXA 5AANA 1MXLC 1CLBA 2K7BA 1KQMB 1F55A 1XFXO 2GTEA 4HREE 2K8MB 1RWYA 3D10A 4N5XA 1WLMA 3LLEA 2BBNA 1B7TY 4IL1A 2WORA 2PRUA 1DMOA 1YX7A 5HKYA 1DJWA 3RM1A 1AUIB 3I5GC 4M2QA 4NDBA 4UPGA 3AKAA 1J1DA 2E30A 5HLOA 3VRRA 1K93D 3KHEA 4FQTA 5TNCA 1B8LA 1OZSA 3KF9A 3RZSA 5DKQA 3LK0A 1S3PA 1YURA 2KFGA 2QDIA 1SBJA 1DQEA 3B7AA 3SJSA 1SCMC 3PLFB 2LVJA 3ZNIA 3PN7C 1WRLA 3EKJA 3CWGA 1ALVA 1OMVA 3BXKA 3FE8A 3D0YA 1OOIX 1AVSA 1RJVA 1KWOC 1SRAA 1TIZA 2LC5A 1K94A 1SK6D 2M49B 2WCBA 5DICA 1FW4A 1YUSA 2IS9A 1JSAA 1CMFA 2O60A 3JTDB 2M1KB 1YRTB 4XYNA 5ER4X 2LVVA 2LUXA 4OKHA 1R2UA 2JTZA 4YGAA 1FPWA 1YUTA 1UHNA 1KK7Y 2BL0B 1B8RA 3FE9A 1UP5A 5PALA 2PALA 1BU3A 3PJIA 1RECA 1CDNA 1MQ1A 3TUYB 1ALWA 2KGBC 1B7TZ 5EL2A 4DCKA 1K9KA 1NCZA 2KI6D 4CFQA 4KYNA 4ZCUA 2F2OA 2JRFA 4IJ7A 3NXAA 1TTXA 2WCEA 4M2OA 2MJWB 3OP0A 2LANA 4TNCA 1U5IB 1BT6A 3NGVA 2F8PA 4WQ3A 2WOSA 4C0JA 1S6IA 1YR5A 2MRDA 2L2EA 1AK8A 1DTLA 3VRQA 2B1UA 2KLEA 5K89A 1KFXS 3OHMB 2Q4UA 4PCWA 1SL9A 3GOFA 3R1PA 3TDUA 1JWDA 1QV1A 3IVTA 3SIBA 2JT8A 2K7DA 3FIAA 3VRPA 3S0AA 1LINA 1SR6B 4YI9A 1DF0A 4PDZA 4YRUA 2LVIA 1KFXL 3RLZA 1TCFA 2MLEC 3JVTC 4OV2A 4ZCVA 1WDCC 3C1VA 1C7VA 1KK7Z 1EH2A 1V1GA 3BJHA 4E68A 3GK1A 4MVFA 1CMGA 1CFPA 3TS5B 4NDCA 2BCBA 2KYFA 3CZ0A 2OS8C 1NYAA 1QIVA 4F7FA 1YRUB 4PE4A 4PHMA 1CM4A 4Q04A 1AP4A 1JF0A 1B9AA 4YBHB 1UWOA 1QX2A 2K0JA 2EC6B 3I5IB 1IKUA 4ORCB 1QS7A 2LHLA 4N1FA 1FI5A 1G4YR 2ZNEA 3R72A 1WRZA 1Y0VH 1NSHA 1QXPA 1JBAA 3VGOA 1OQPA 3HCMA 1XK4A 5DKNA 2MAZA 5CPVA 1DELA 2KAXA 1JFKA 3BUNB 1NPQA 2JQ6A 2Y4QA 3R1VA 1GJYA 4AQJA 4PHNA 1MHOA 2NZ0A 3SS5A 1QJTA 4YGCB 2O5GA 3D77A 1XFZO 2KBMA 3E3RA 1BR1B 1MWNA 2CCMA 1J7RA 2M0RA 5AERA 3F45A 2PQLA 1UHHA 1EL4A 1K95A 3FWCA 4OR9B 2JWWA 2WCHA 1N0YA 1S6JA 3B87A 1MR8A 1PSRA 2M9GA 4OVNF 1CM1A 1J7OA 1GM0A 1M45A 1XYDA 3OX5A 1E8AA 2KDHA 1J7QA 3BOWB 2I7AA 2PSRA 3OX6A 1A4PA 3GK4X 2GV5A 4ICBA 1PULA 1DJZA 3SS3A 1A29A 2Y5IA 1L2OB 1N65A 1S26D 4I5JA 4MRYA 1HQVA 2ERBA 2MBXA 4INXA 4XJKA 3CZ2A 2L2CA 2LUCA 2JC2A 5GQQC 2F3ZA 2LAPA 2Y1NA 1TNWA 1A2XA 3R1OA 2WC6A 1QV0A 2JTTA 3D76A 2JXCA 1TOPA 3EVRA 4GNKB 2BBMA 1PALA 1XFWO 3B86A 4MBEA 3CS1A 2CXJA 4QJ3B 1NX3A 1K9UA 1OOGA 4MSPA 3BQ3A 1EG3A 2FJYA 2ZN9A 1QX7A 1LS8A 2P71A 3PFVA 1DJHA 3D78A 1XVJA 5AXIA 3I5GB 5B8IB 1Q80A 1H4BA 4QJ4B 1OMRA 1F54A 1LKJA 1CDLA 1CTRA 1OOFA 1NP8A 4U8DA 2ZKMX 3EKHA 1DJIA 1GGZA 1W9ZA 2WC8A 3S0GA 4CLNA 1DJGA 3DF0A 2HQWA 2PASA 3DY9A 3DYEA 1J55A 3CR5X 1WY9A 3WHTB 2F2PA 3PN7B 3SG5A 1B4CA 1SYMA 1B47A 4GBAA 3D75A 1BODA 2LMVA 3D73A 1DGVA 1KWOB 3AAKA 3BUMB 4USLA 2LVKA 5JOLA 3TZ1A 3PM8A 1WLZA 5HYDA 1G8IA 2QEOA 1SMGA 2CTNA 2ZRTA 4ORBB 2BAPA 3WHUB 2KSPA 1YVLA 4YGDB 2M7NA 1TNXA 1CDPA 4QJ5B 2JU0A 1A75B 3JTDC 3NSLA 1SNLA 1IH0A 1S36A 3A4UB 1DJYA 1ZACA 4HSZA 1NCYA 3CR2A 4GPLB 1YTZC 5CSIA 2KLDA 2KQYA 2LE9B 2BL0C 1QX5B 1QTXA 2JT0A 1RFJA 5AFPA 1OMDA 3BUOB 3PM2A 1GGWA 1LXFC 1MXEA 1M39A 2BCAA 4INWA 4NQGA 1TNQA 4MN0A 3BYAA 1NX2A 3CTNA 1S6CA 1XFVO 2P70A 2KNEA 1XFYO 2WC5A 2KAVA 3I5HC 3K1EA 2LM5A 3K21A 1MUXA 3VB1A 4NDDA 1K2HA 4R1EA 1BJFA 1ZMZA 4C0KA 3OGNA 1XK4C 1BOCA 2KAYA 1AJ4A 3TDZA 1IQ3A 2LV7A 1C3ZA 2HQ8A 1NUBA 4M2PA 3NSIA 4PE7A 3DVKA 1JF2A 1K8UA 2OTGC 3JVTB 5J3XA 1A03A 2LLSA 2L4HA 5IBWA 5I2OA 2CNPA 3BFHA 5D3OA 2G9BA 4AQIA 2K60A 3L4AA 1ORGA 2M8UA 3SG4A 1WRKA 2OS8B 2ZRSA 1PK0D 1BF5A 2LHIA 1U5IA 2GGZA 2KPHA 1UHKA 3SG3A 4WQ2A 4A4CA 1TUJA 3TS5C 5BPJA 1BLQA 4MZLA 2MHHA 5FI7A 4JWQA 3OB2B 2KI4B 1Z4HA 3CYZA 1N2DA 1RROA 2M1UA 4MZKA 3I5IC 1SCVA 2VRGA 3I5FC 1VRKA 2G2BA 2WCKA 1KK8B 2ZNDA 4JQ0D 5D7FA 4BY4A 3EG5B 4JD9A 1FF1A 5HLVA 4HRHA 2DOQA 1J1EA 1XFRA 2YGUA 2H8VA 3QMEA 4PHJA 2FCEA 5AEQA 1UHJA 4AOMA 3PATA 1BR4B 3DVJA 3LK1A 1DGUA 4GGNA 5HL1A 3S0BA 4CIDA 2BE4A 3V2LA 2I2RE 3KO0A 4GFTA 3SG6A 1KFUL 2L50A 4CPVA 4P2YB 1XFUO 2EGDA 1SSEB 3EVVA 3PALA 1X02A 1C7WA 1D1OA 2HETA 1F70A 5CSJA 1W7IB 1RK9A 1TCOB 2QEHA 3CDNA 3O2PA 4I5KA 3O4XA 5I8NA 3UNWA 1KQVA 3A8RA 1JUOA 1L2OC 1ZFSA 2KFFA 3M0WA 4C0LA 1PVBA 1H8BA 1OE9B 4MLWA 1DVIA 1JFJA 1TRFA 2FOTA 2SCPA 1M31A 1UHIA 1BG1A 1CNPA 3LCPC 1S5GY 1DC1A 1QIWA 4I5LB 5FI6A 3D0YB 1Y1XA 4GAOA 2K2AA 3IQQA 3DD4A 2L51A 1KQMC 4ORAB 2WCFA 2M3WA 1IJ6A 1Y1AA 4GUKA 1OZOA 1QATA 2KI6C 2I94A 2H61A 3BUWB 1M46A 1MF8B 1SPYA 3IF7A 4L9MA 5DKRA 3BOWA 1IIOA 3OBVA 1NX0A 3OB1B 2KGRA 4HRGA 2JXLA 3DXLA 1F8HA 1SCMB 1W7JB 1JC2A 1TWOA 3QRXA 3CR4X 2Q91A 1CLLA 4DUQA 1G33A 1CFDA 1QLSA 2D8NA 3SS4A 3UO9A 1DT7B 4MEWA 3HX4A 3N7HA 2WCMA 2NCPA 2BNXA 2HPSA 2V53A 2WCJA 2KYCA 4F0ZB 2CBLA 2LNKA 2LP3A 3B6XA 1LA3A 1S1EA 3EVUA 2KQ6A 1YUUA 4DRWA 1B8CA 4PE1A 1GQMA 1SY9A 1IGVA 5I2LA 3BUXB 1XA5A 2CT9A 2SASA 1UUSA 3Q8IA 2BCXA 4JPZB 1DEKA 1PSBA 3O6BA 1S5GZ 4PE0A 1CLMA 3CLNA 1P28A 1SW8A 2L5YA 1PVAA 2KOTA 1EJ3A 1OOJA 3O4YA 4FQOA 3CGAA 3NSKA 2TN4A 3NSOA 3SG2A 1ODBA 5KSZA 1AHRA 3KPXA 1DF0B 1KSOA 4CFRA 1K90D 2QACA 2JPTA 1EG4A 1M63B 5G08A 1IG5A 2BKIB 3TUYC 2NLNA 1YVHA 2QEVA 3EK7A 3MSEB 1KSMA 1V1FA 1EXRA 3TDIA 1K9PA 3EK8A 1FBVA 3DZTA 2JT3A 3FWBA 3WNXB 2JPOA 5FI2A 1Y1UA 2E6WA 2ISDA 4BY5A 5I94A 2LMUA 2H2KA 2Y1MA 5CSFA 2P6BB 1T14A 2COLB 1IQ5A 2AUCA 2PVBA 4DS7A 2F3YA 2L0PA 2OPOA 5D69A 1R6PA 3I5HB 4YI8A 2KFHA 1TUZA 1CFCA 3AKBA 3PSRA 1WDCB 2AMIA 3CZTX 2K2FA 1QLKA 1A75A 1SR6C 2M7LA 4GGFC 1QVIY 2L98A 3NHIA 2ZN8A 3VROA 2OTGB 3ZWHA 2QEBA 4JKTA 2K7OA 1QASA 1XO5A 5HKZA 1CFFA 2K61A 1RTP1 2NCOA 3BFAA 5ER5A 1F4OA 2AAOA 2A4JA 1Z2CB 1CDMA 2JZIA 2JNXA 5JJGA 2F33A 4YGBB 1AJ5A 2PYQA 3GK2A 4PALA 1CKKA 2L5XB 3L4LA 2FCDA 1SL8A 4I5NB 1C3YA 1DJXA 1YX8A 2EC6C 3H4SE 1F4QA 4GGFA 2ZFDA 2FJUB 4PT1A 3ICBA 3EK4A 1L7ZA 2MA2A 1LVCD 3L47A 3S0FA 5HKWA 5KU1A 4XJKB 3SG7A 2QPTA 3I5FB 2JOJA 1KCYA 1KFUS 2KI4C 2WCLA 3AAJA 1SKTA 1CB1A 1K96A 3S0EA 2LLUA 4OZDA 1OOHA 5F6TA 3CABA 1IJ5A 1QWVA 1IWQA 1NX1A 1SL7A 1LA0A 3KEVA 4OCIA 1KK8C 1J7PA 2JULA 1QVIZ 2KHNA 3NHTA 4ETOA 2BECA 3O78A 3FE6A 3WXAA 4MZJA 1HT9A 4YGEB 1NWDA 2M29A 4FTGA 3BFBA 3CZ1A 1OW4A 4WRIA 1FI6A 2EHBA 2I18A 4DIRA 1ZUZA 4D1EA 2H61C 3SIAA 1OSAA 2HF5A
chains in the Genus database with same CATH topology
2BE6A 5KTYA 4PHKA 4P5OE 2MLFC 2R2IA 2WNDA 3DVEA 3DVMA 5FYXA 1PRWA 2LLTA 2LP2A 1Y6WA 2NXQA 4MRXA 2L4IA 2K7CA 2PMYA 2KBIA 2JNFA 5I2QA 4A4BA 1IRJA 3DF0B 3LL8B 2RGIA 1ZOTB 5CSNA 1B1GA 2BKHB 4N1GA 3FS7A 1TNPA 3VRNA 1UURA 2LCPA 2LMTA 1F71A 1TN4A 3IQOA 2M97A 1BMOA 2GGMA 1C07A 1NIWA 1NCXA 5AANA 1MXLC 1CLBA 2K7BA 1KQMB 1F55A 1XFXO 4HREE 2K8MB 1RWYA 3D10A 4N5XA 1WLMA 3LLEA 2BBNA 1B7TY 4IL1A 2WORA 2PRUA 1DMOA 1YX7A 5HKYA 1DJWA 3RM1A 1AUIB 3I5GC 4M2QA 4NDBA 4UPGA 3AKAA 1J1DA 2E30A 5HLOA 3VRRA 1K93D 3KHEA 5TNCA 1B8LA 1OZSA 3KF9A 5DKQA 3LK0A 1S3PA 1YURA 2KFGA 1SBJA 3SJSA 1SCMC 3PLFB 2LVJA 3ZNIA 3PN7C 1WRLA 3EKJA 3CWGA 1ALVA 1OMVA 3BXKA 3D0YA 1AVSA 1RJVA 1KWOC 1SRAA 1TIZA 2LC5A 1K94A 1SK6D 2M49B 2WCBA 1JSAA 1FW4A 1YUSA 2IS9A 1CMFA 2O60A 3JTDB 2M1KB 1YRTB 4XYNA 5ER4X 2LVVA 2LUXA 4OKHA 1R2UA 2JTZA 4YGAA 1FPWA 1YUTA 1UHNA 1KK7Y 2BL0B 1B8RA 5PALA 1UP5A 2PALA 1BU3A 1RECA 1CDNA 1MQ1A 3TUYB 1ALWA 2KGBC 1B7TZ 4DCKA 1K9KA 1NCZA 2KI6D 4CFQA 4ZCUA 2F2OA 2JRFA 3NXAA 1TTXA 2WCEA 4M2OA 2MJWB 3OP0A 2LANA 4TNCA 1U5IB 1BT6A 2F8PA 4WQ3A 2WOSA 4C0JA 1S6IA 1YR5A 2MRDA 2L2EA 1AK8A 1DTLA 3VRQA 2B1UA 5K89A 1KFXS 3OHMB 2Q4UA 4PCWA 1SL9A 3GOFA 3TDUA 1JWDA 1QV1A 3SIBA 2JT8A 2K7DA 3FIAA 3VRPA 1LINA 1SR6B 4YI9A 1DF0A 4PDZA 4YRUA 2LVIA 1KFXL 3RLZA 1TCFA 2MLEC 3JVTC 4OV2A 4ZCVA 1WDCC 3C1VA 1C7VA 1KK7Z 1EH2A 1V1GA 4E68A 3GK1A 4MVFA 1CMGA 1CFPA 3TS5B 4NDCA 2BCBA 2KYFA 2OS8C 1NYAA 1QIVA 1YRUB 4PE4A 4PHMA 1CM4A 4Q04A 1AP4A 1JF0A 1B9AA 4YBHB 1UWOA 1QX2A 2K0JA 2EC6B 3I5IB 1IKUA 4ORCB 1QS7A 2LHLA 4N1FA 1FI5A 1G4YR 2ZNEA 1WRZA 1Y0VH 1NSHA 1QXPA 1JBAA 3VGOA 1OQPA 3HCMA 1XK4A 5DKNA 2MAZA 5CPVA 2KAXA 1JFKA 3BUNB 1NPQA 2JQ6A 2Y4QA 4AQJA 1GJYA 4PHNA 1MHOA 2NZ0A 1QJTA 4YGCB 2O5GA 1XFZO 2KBMA 3E3RA 1BR1B 1MWNA 2CCMA 1J7RA 2M0RA 5AERA 3F45A 1UHHA 1EL4A 1K95A 3FWCA 4OR9B 2JWWA 1N0YA 1S6JA 4OVNF 1MR8A 1PSRA 2M9GA 1J7OA 1CM1A 1M45A 1XYDA 3OX5A 1E8AA 2KDHA 1J7QA 3BOWB 2I7AA 2PSRA 3OX6A 1A4PA 3GK4X 2GV5A 4ICBA 1PULA 1DJZA 1A29A 2Y5IA 1L2OB 1N65A 1S26D 4I5JA 4MRYA 1HQVA 2MBXA 4XJKA 2LUCA 2JC2A 5GQQC 2F3ZA 2LAPA 2Y1NA 1TNWA 1A2XA 1QV0A 2JTTA 2JXCA 1TOPA 3EVRA 4GNKB 2BBMA 1PALA 1XFWO 4MBEA 3CS1A 2CXJA 4QJ3B 1NX3A 1K9UA 4MSPA 3BQ3A 1EG3A 2ZN9A 1QX7A 3PFVA 1DJHA 5AXIA 1XVJA 3I5GB 5B8IB 1Q80A 1H4BA 4QJ4B 1OMRA 1F54A 1LKJA 1CDLA 1CTRA 1NP8A 4U8DA 2ZKMX 3EKHA 1DJIA 1GGZA 2WC8A 4CLNA 1DJGA 3DF0A 2HQWA 2PASA 1J55A 3CR5X 1WY9A 3WHTB 2F2PA 3PN7B 3SG5A 1B4CA 1SYMA 1B47A 4GBAA 1BODA 2LMVA 1DGVA 1KWOB 3AAKA 3BUMB 4USLA 2LVKA 5JOLA 3TZ1A 3PM8A 1WLZA 5HYDA 1G8IA 1SMGA 2CTNA 2ZRTA 4ORBB 3WHUB 2KSPA 1YVLA 4YGDB 2M7NA 1TNXA 1CDPA 4QJ5B 2JU0A 1A75B 3JTDC 3NSLA 1SNLA 1IH0A 1S36A 3A4UB 1DJYA 1ZACA 4HSZA 1NCYA 3CR2A 4GPLB 1YTZC 5CSIA 2KQYA 2LE9B 2BL0C 1QX5B 1QTXA 2JT0A 1RFJA 5AFPA 1OMDA 3BUOB 1GGWA 1LXFC 1MXEA 1M39A 2BCAA 4NQGA 1TNQA 4MN0A 3BYAA 1NX2A 3CTNA 1S6CA 1XFVO 2KNEA 1XFYO 2KAVA 3I5HC 2LM5A 3K21A 1MUXA 4NDDA 1K2HA 4R1EA 1BJFA 1ZMZA 4C0KA 1XK4C 1BOCA 2KAYA 1AJ4A 3TDZA 1IQ3A 2LV7A 4M2PA 2HQ8A 1NUBA 3NSIA 4PE7A 3DVKA 1JF2A 1K8UA 2OTGC 3JVTB 5J3XA 1A03A 2LLSA 2L4HA 5IBWA 5I2OA 2CNPA 2G9BA 4AQIA 2M8UA 3SG4A 1WRKA 2OS8B 2ZRSA 1PK0D 1BF5A 2LHIA 1U5IA 2GGZA 1UHKA 3SG3A 4WQ2A 4A4CA 5BPJA 3TS5C 1BLQA 4MZLA 2MHHA 4JWQA 3OB2B 2KI4B 1N2DA 1RROA 2M1UA 4MZKA 3I5IC 1SCVA 2VRGA 3I5FC 1VRKA 2G2BA 4JQ0D 1KK8B 2ZNDA 5D7FA 4BY4A 1FF1A 5HLVA 4HRHA 2DOQA 1J1EA 4PHJA 2FCEA 5AEQA 1UHJA 4AOMA 3PATA 1BR4B 3DVJA 3LK1A 1DGUA 4GGNA 4CIDA 2BE4A 2I2RE 3KO0A 4GFTA 3SG6A 1KFUL 2L50A 4CPVA 4P2YB 1XFUO 2EGDA 3EVVA 3PALA 1X02A 1C7WA 1D1OA 2HETA 1F70A 5CSJA 1W7IB 1RK9A 1TCOB 3O2PA 4I5KA 5I8NA 1KQVA 3A8RA 1JUOA 1L2OC 1ZFSA 2KFFA 3M0WA 4C0LA 1PVBA 1H8BA 1OE9B 4MLWA 1DVIA 1JFJA 1TRFA 2FOTA 2SCPA 1M31A 1UHIA 1BG1A 1CNPA 3LCPC 1S5GY 1QIWA 4I5LB 3D0YB 1Y1XA 4GAOA 2K2AA 3IQQA 3DD4A 2L51A 1KQMC 4ORAB 2WCFA 2M3WA 1IJ6A 1Y1AA 4GUKA 1OZOA 1QATA 2KI6C 2I94A 2H61A 3BUWB 1M46A 1MF8B 1SPYA 3IF7A 4L9MA 5DKRA 3BOWA 1NX0A 3OB1B 2KGRA 4HRGA 2JXLA 1F8HA 1SCMB 1W7JB 1JC2A 3QRXA 3CR4X 2Q91A 1CLLA 4DUQA 1G33A 1CFDA 1QLSA 2D8NA 1DT7B 4MEWA 3HX4A 2NCPA 2HPSA 2V53A 2KYCA 4F0ZB 2CBLA 2LNKA 2LP3A 1LA3A 1S1EA 3EVUA 2KQ6A 1YUUA 4DRWA 1B8CA 4PE1A 1GQMA 1SY9A 1IGVA 5I2LA 3BUXB 1XA5A 2CT9A 2SASA 1UUSA 4JPZB 2BCXA 1PSBA 3O6BA 1S5GZ 4PE0A 1CLMA 3CLNA 1SW8A 3O4YA 1PVAA 2KOTA 1EJ3A 1OOJA 4FQOA 3CGAA 3NSKA 2TN4A 3NSOA 3SG2A 1ODBA 5KSZA 1AHRA 3KPXA 1DF0B 1KSOA 4CFRA 1K90D 2QACA 2JPTA 1EG4A 1M63B 5G08A 1IG5A 2BKIB 3TUYC 2NLNA 1YVHA 3EK7A 3MSEB 1KSMA 1V1FA 1EXRA 3TDIA 1K9PA 3EK8A 1FBVA 2JT3A 3FWBA 3WNXB 1Y1UA 2E6WA 2ISDA 4BY5A 2LMUA 2H2KA 2Y1MA 5CSFA 2P6BB 2COLB 1IQ5A 2AUCA 2PVBA 4DS7A 2F3YA 2L0PA 2OPOA 5D69A 1R6PA 3I5HB 4YI8A 2KFHA 1CFCA 3AKBA 3PSRA 1WDCB 2AMIA 3CZTX 2K2FA 1QLKA 1A75A 1SR6C 2M7LA 4GGFC 1QVIY 2L98A 2ZN8A 3VROA 2OTGB 3ZWHA 2K7OA 1QASA 1XO5A 5HKZA 1CFFA 2K61A 1RTP1 2NCOA 5ER5A 1F4OA 2AAOA 2A4JA 1CDMA 2JZIA 2JNXA 5JJGA 2F33A 4YGBB 1AJ5A 3GK2A 4PALA 1CKKA 2L5XB 2FCDA 1SL8A 4I5NB 1DJXA 1YX8A 2EC6C 3H4SE 1F4QA 4GGFA 2ZFDA 2FJUB 3ICBA 3EK4A 1L7ZA 2MA2A 1LVCD 5HKWA 5KU1A 4XJKB 3SG7A 2QPTA 3I5FB 2JOJA 1KCYA 1KFUS 2KI4C 3AAJA 1SKTA 1CB1A 1K96A 2LLUA 5F6TA 1IJ5A 1IWQA 1NX1A 1SL7A 1LA0A 3KEVA 4OCIA 1KK8C 1J7PA 2JULA 1QVIZ 2KHNA 4ETOA 2BECA 3O78A 3WXAA 4MZJA 1HT9A 4YGEB 1NWDA 2M29A 4FTGA 4WRIA 1FI6A 2EHBA 2I18A 4DIRA 1ZUZA 4D1EA 2H61C 3SIAA 1OSAA 2HF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BE6 A;  5KTY A;  4PHK A;  4P5O E;  2MLF C;  2R2I A;  2WND A;  3DVE A;  3DVM A;  5FYX A;  1PRW A;  2LLT A;  2LP2 A;  1Y6W A;  2NXQ A;  4MRX A;  2L4I A;  2K7C A;  2PMY A;  2KBI A;  2JNF A;  5I2Q A;  4A4B A;  1IRJ A;  3DF0 B;  3LL8 B;  2RGI A;  1ZOT B;  5CSN A;  1B1G A;  2BKH B;  4N1G A;  3FS7 A;  1TNP A;  3VRN A;  1UUR A;  2LCP A;  2LMT A;  1F71 A;  1TN4 A;  3IQO A;  2M97 A;  1BMO A;  2GGM A;  1C07 A;  1NIW A;  1NCX A;  5AAN A;  1MXL C;  1CLB A;  2K7B A;  1KQM B;  1F55 A;  1XFX O;  4HRE E;  2K8M B;  1RWY A;  3D10 A;  4N5X A;  1WLM A;  3LLE A;  2BBN A;  1B7T Y;  4IL1 A;  2WOR A;  2PRU A;  1DMO A;  1YX7 A;  5HKY A;  1DJW A;  3RM1 A;  1AUI B;  3I5G C;  4M2Q A;  4NDB A;  4UPG A;  3AKA A;  1J1D A;  2E30 A;  5HLO A;  3VRR A;  1K93 D;  3KHE A;  5TNC A;  1B8L A;  1OZS A;  3KF9 A;  5DKQ A;  3LK0 A;  1S3P A;  1YUR A;  2KFG A;  1SBJ A;  3SJS A;  1SCM C;  3PLF B;  2LVJ A;  3ZNI A;  3PN7 C;  1WRL A;  3EKJ A;  3CWG A;  1ALV A;  1OMV A;  3BXK A;  3D0Y A;  1AVS A;  1RJV A;  1KWO C;  1SRA A;  1TIZ A;  2LC5 A;  1K94 A;  1SK6 D;  2M49 B;  2WCB A;  1JSA A;  1FW4 A;  1YUS A;  2IS9 A;  1CMF A;  2O60 A;  3JTD B;  2M1K B;  1YRT B;  4XYN A;  5ER4 X;  2LVV A;  2LUX A;  4OKH A;  1R2U A;  2JTZ A;  4YGA A;  1FPW A;  1YUT A;  1UHN A;  1KK7 Y;  2BL0 B;  1B8R A;  5PAL A;  1UP5 A;  2PAL A;  1BU3 A;  1REC A;  1CDN A;  1MQ1 A;  3TUY B;  1ALW A;  2KGB C;  1B7T Z;  4DCK A;  1K9K A;  1NCZ A;  2KI6 D;  4CFQ A;  4ZCU A;  2F2O A;  2JRF A;  3NXA A;  1TTX A;  2WCE A;  4M2O A;  2MJW B;  3OP0 A;  2LAN A;  4TNC A;  1U5I B;  1BT6 A;  2F8P A;  4WQ3 A;  2WOS A;  4C0J A;  1S6I A;  1YR5 A;  2MRD A;  2L2E A;  1AK8 A;  1DTL A;  3VRQ A;  2B1U A;  5K89 A;  1KFX S;  3OHM B;  2Q4U A;  4PCW A;  1SL9 A;  3GOF A;  3TDU A;  1JWD A;  1QV1 A;  3SIB A;  2JT8 A;  2K7D A;  3FIA A;  3VRP A;  1LIN A;  1SR6 B;  4YI9 A;  1DF0 A;  4PDZ A;  4YRU A;  2LVI A;  1KFX L;  3RLZ A;  1TCF A;  2MLE C;  3JVT C;  4OV2 A;  4ZCV A;  1WDC C;  3C1V A;  1C7V A;  1KK7 Z;  1EH2 A;  1V1G A;  4E68 A;  3GK1 A;  4MVF A;  1CMG A;  1CFP A;  3TS5 B;  4NDC A;  2BCB A;  2KYF A;  2OS8 C;  1NYA A;  1QIV A;  1YRU B;  4PE4 A;  4PHM A;  1CM4 A;  4Q04 A;  1AP4 A;  1JF0 A;  1B9A A;  4YBH B;  1UWO A;  1QX2 A;  2K0J A;  2EC6 B;  3I5I B;  1IKU A;  4ORC B;  1QS7 A;  2LHL A;  4N1F A;  1FI5 A;  1G4Y R;  2ZNE A;  1WRZ A;  1Y0V H;  1NSH A;  1QXP A;  1JBA A;  3VGO A;  1OQP A;  3HCM A;  1XK4 A;  5DKN A;  2MAZ A;  5CPV A;  2KAX A;  1JFK A;  3BUN B;  1NPQ A;  2JQ6 A;  2Y4Q A;  4AQJ A;  1GJY A;  4PHN A;  1MHO A;  2NZ0 A;  1QJT A;  4YGC B;  2O5G A;  1XFZ O;  2KBM A;  3E3R A;  1BR1 B;  1MWN A;  2CCM A;  1J7R A;  2M0R A;  5AER A;  3F45 A;  1UHH A;  1EL4 A;  1K95 A;  3FWC A;  4OR9 B;  2JWW A;  1N0Y A;  1S6J A;  4OVN F;  1MR8 A;  1PSR A;  2M9G A;  1J7O A;  1CM1 A;  1M45 A;  1XYD A;  3OX5 A;  1E8A A;  2KDH A;  1J7Q A;  3BOW B;  2I7A A;  2PSR A;  3OX6 A;  1A4P A;  3GK4 X;  2GV5 A;  4ICB A;  1PUL A;  1DJZ A;  1A29 A;  2Y5I A;  1L2O B;  1N65 A;  1S26 D;  4I5J A;  4MRY A;  1HQV A;  2MBX A;  4XJK A;  2LUC A;  2JC2 A;  5GQQ C;  2F3Z A;  2LAP A;  2Y1N A;  1TNW A;  1A2X A;  1QV0 A;  2JTT A;  2JXC A;  1TOP A;  3EVR A;  4GNK B;  2BBM A;  1PAL A;  1XFW O;  4MBE A;  3CS1 A;  2CXJ A;  4QJ3 B;  1NX3 A;  1K9U A;  4MSP A;  3BQ3 A;  1EG3 A;  2ZN9 A;  1QX7 A;  3PFV A;  1DJH A;  5AXI A;  1XVJ A;  3I5G B;  5B8I B;  1Q80 A;  1H4B A;  4QJ4 B;  1OMR A;  1F54 A;  1LKJ A;  1CDL A;  1CTR A;  1NP8 A;  4U8D A;  2ZKM X;  3EKH A;  1DJI A;  1GGZ A;  2WC8 A;  4CLN A;  1DJG A;  3DF0 A;  2HQW A;  2PAS A;  1J55 A;  3CR5 X;  1WY9 A;  3WHT B;  2F2P A;  3PN7 B;  3SG5 A;  1B4C A;  1SYM A;  1B47 A;  4GBA A;  1BOD A;  2LMV A;  1DGV A;  1KWO B;  3AAK A;  3BUM B;  4USL A;  2LVK A;  5JOL A;  3TZ1 A;  3PM8 A;  1WLZ A;  5HYD A;  1G8I A;  1SMG A;  2CTN A;  2ZRT A;  4ORB B;  3WHU B;  2KSP A;  1YVL A;  4YGD B;  2M7N A;  1TNX A;  1CDP A;  4QJ5 B;  2JU0 A;  1A75 B;  3JTD C;  3NSL A;  1SNL A;  1IH0 A;  1S36 A;  3A4U B;  1DJY A;  1ZAC A;  4HSZ A;  1NCY A;  3CR2 A;  4GPL B;  1YTZ C;  5CSI A;  2KQY A;  2LE9 B;  2BL0 C;  1QX5 B;  1QTX A;  2JT0 A;  1RFJ A;  5AFP A;  1OMD A;  3BUO B;  1GGW A;  1LXF C;  1MXE A;  1M39 A;  2BCA A;  4NQG A;  1TNQ A;  4MN0 A;  3BYA A;  1NX2 A;  3CTN A;  1S6C A;  1XFV O;  2KNE A;  1XFY O;  2KAV A;  3I5H C;  2LM5 A;  3K21 A;  1MUX A;  4NDD A;  1K2H A;  4R1E A;  1BJF A;  1ZMZ A;  4C0K A;  1XK4 C;  1BOC A;  2KAY A;  1AJ4 A;  3TDZ A;  1IQ3 A;  2LV7 A;  4M2P A;  2HQ8 A;  1NUB A;  3NSI A;  4PE7 A;  3DVK A;  1JF2 A;  1K8U A;  2OTG C;  3JVT B;  5J3X A;  1A03 A;  2LLS A;  2L4H A;  5IBW A;  5I2O A;  2CNP A;  2G9B A;  4AQI A;  2M8U A;  3SG4 A;  1WRK A;  2OS8 B;  2ZRS A;  1PK0 D;  1BF5 A;  2LHI A;  1U5I A;  2GGZ A;  1UHK A;  3SG3 A;  4WQ2 A;  4A4C A;  5BPJ A;  3TS5 C;  1BLQ A;  4MZL A;  2MHH A;  4JWQ A;  3OB2 B;  2KI4 B;  1N2D A;  1RRO A;  2M1U A;  4MZK A;  3I5I C;  1SCV A;  2VRG A;  3I5F C;  1VRK A;  2G2B A;  4JQ0 D;  1KK8 B;  2ZND A;  5D7F A;  4BY4 A;  1FF1 A;  5HLV A;  4HRH A;  2DOQ A;  1J1E A;  4PHJ A;  2FCE A;  5AEQ A;  1UHJ A;  4AOM A;  3PAT A;  1BR4 B;  3DVJ A;  3LK1 A;  1DGU A;  4GGN A;  4CID A;  2BE4 A;  2I2R E;  3KO0 A;  4GFT A;  3SG6 A;  1KFU L;  2L50 A;  4CPV A;  4P2Y B;  1XFU O;  2EGD A;  3EVV A;  3PAL A;  1X02 A;  1C7W A;  1D1O A;  2HET A;  1F70 A;  5CSJ A;  1W7I B;  1RK9 A;  1TCO B;  3O2P A;  4I5K A;  5I8N A;  1KQV A;  3A8R A;  1JUO A;  1L2O C;  1ZFS A;  2KFF A;  3M0W A;  4C0L A;  1PVB A;  1H8B A;  1OE9 B;  4MLW A;  1DVI A;  1JFJ A;  1TRF A;  2FOT A;  2SCP A;  1M31 A;  1UHI A;  1BG1 A;  1CNP A;  3LCP C;  1S5G Y;  1QIW A;  4I5L B;  3D0Y B;  1Y1X A;  4GAO A;  2K2A A;  3IQQ A;  3DD4 A;  2L51 A;  1KQM C;  4ORA B;  2WCF A;  2M3W A;  1IJ6 A;  1Y1A A;  4GUK A;  1OZO A;  1QAT A;  2KI6 C;  2I94 A;  2H61 A;  3BUW B;  1M46 A;  1MF8 B;  1SPY A;  3IF7 A;  4L9M A;  5DKR A;  3BOW A;  1NX0 A;  3OB1 B;  2KGR A;  4HRG A;  2JXL A;  1F8H A;  1SCM B;  1W7J B;  1JC2 A;  3QRX A;  3CR4 X;  2Q91 A;  1CLL A;  4DUQ A;  1G33 A;  1CFD A;  1QLS A;  2D8N A;  1DT7 B;  4MEW A;  3HX4 A;  2NCP A;  2HPS A;  2V53 A;  2KYC A;  4F0Z B;  2CBL A;  2LNK A;  2LP3 A;  1LA3 A;  1S1E A;  3EVU A;  2KQ6 A;  1YUU A;  4DRW A;  1B8C A;  4PE1 A;  1GQM A;  1SY9 A;  1IGV A;  5I2L A;  3BUX B;  1XA5 A;  2CT9 A;  2SAS A;  1UUS A;  4JPZ B;  2BCX A;  1PSB A;  3O6B A;  1S5G Z;  4PE0 A;  1CLM A;  3CLN A;  1SW8 A;  3O4Y A;  1PVA A;  2KOT A;  1EJ3 A;  1OOJ A;  4FQO A;  3CGA A;  3NSK A;  2TN4 A;  3NSO A;  3SG2 A;  1ODB A;  5KSZ A;  1AHR A;  3KPX A;  1DF0 B;  1KSO A;  4CFR A;  1K90 D;  2QAC A;  2JPT A;  1EG4 A;  1M63 B;  5G08 A;  1IG5 A;  2BKI B;  3TUY C;  2NLN A;  1YVH A;  3EK7 A;  3MSE B;  1KSM A;  1V1F A;  1EXR A;  3TDI A;  1K9P A;  3EK8 A;  1FBV A;  2JT3 A;  3FWB A;  3WNX B;  1Y1U A;  2E6W A;  2ISD A;  4BY5 A;  2LMU A;  2H2K A;  2Y1M A;  5CSF A;  2P6B B;  2COL B;  1IQ5 A;  2AUC A;  2PVB A;  4DS7 A;  2F3Y A;  2L0P A;  2OPO A;  5D69 A;  1R6P A;  3I5H B;  4YI8 A;  2KFH A;  1CFC A;  3AKB A;  3PSR A;  1WDC B;  2AMI A;  3CZT X;  2K2F A;  1QLK A;  1A75 A;  1SR6 C;  2M7L A;  4GGF C;  1QVI Y;  2L98 A;  2ZN8 A;  3VRO A;  2OTG B;  3ZWH A;  2K7O A;  1QAS A;  1XO5 A;  5HKZ A;  1CFF A;  2K61 A;  1RTP 1;  2NCO A;  5ER5 A;  1F4O A;  2AAO A;  2A4J A;  1CDM A;  2JZI A;  2JNX A;  5JJG A;  2F33 A;  4YGB B;  1AJ5 A;  3GK2 A;  4PAL A;  1CKK A;  2L5X B;  2FCD A;  1SL8 A;  4I5N B;  1DJX A;  1YX8 A;  2EC6 C;  3H4S E;  1F4Q A;  4GGF A;  2ZFD A;  2FJU B;  3ICB A;  3EK4 A;  1L7Z A;  2MA2 A;  1LVC D;  5HKW A;  5KU1 A;  4XJK B;  3SG7 A;  2QPT A;  3I5F B;  2JOJ A;  1KCY A;  1KFU S;  2KI4 C;  3AAJ A;  1SKT A;  1CB1 A;  1K96 A;  2LLU A;  5F6T A;  1IJ5 A;  1IWQ A;  1NX1 A;  1SL7 A;  1LA0 A;  3KEV A;  4OCI A;  1KK8 C;  1J7P A;  2JUL A;  1QVI Z;  2KHN A;  4ETO A;  2BEC A;  3O78 A;  3WXA A;  4MZJ A;  1HT9 A;  4YGE B;  1NWD A;  2M29 A;  4FTG A;  4WRI A;  1FI6 A;  2EHB A;  2I18 A;  4DIR A;  1ZUZ A;  4D1E A;  2H61 C;  3SIA A;  1OSA A;  2HF5 A; 
#chains in the Genus database with same CATH topology
 2BE6 A;  5KTY A;  3B88 A;  4PHK A;  4P5O E;  2MLF C;  2R2I A;  2WND A;  3DVE A;  3DVM A;  5FYX A;  1PRW A;  2LLT A;  2LP2 A;  1Y6W A;  2NXQ A;  4MRX A;  2L4I A;  3S0D A;  2K7C A;  2PMY A;  2KBI A;  2JNF A;  5I2Q A;  4A4B A;  1IRJ A;  3DF0 B;  3LL8 B;  2RGI A;  1ZOT B;  5CSN A;  1B1G A;  2BKH B;  4N1G A;  3FS7 A;  1TNP A;  3VRN A;  1UUR A;  2LCP A;  2LMT A;  3D74 A;  1TN4 A;  3IQO A;  2M97 A;  1F71 A;  1BMO A;  2GGM A;  1C07 A;  1NIW A;  1NCX A;  5AAN A;  1MXL C;  1CLB A;  2K7B A;  1KQM B;  1F55 A;  1XFX O;  2GTE A;  4HRE E;  2K8M B;  1RWY A;  3D10 A;  4N5X A;  1WLM A;  3LLE A;  2BBN A;  1B7T Y;  4IL1 A;  2WOR A;  2PRU A;  1DMO A;  1YX7 A;  5HKY A;  1DJW A;  3RM1 A;  1AUI B;  3I5G C;  4M2Q A;  4NDB A;  4UPG A;  3AKA A;  1J1D A;  2E30 A;  5HLO A;  3VRR A;  1K93 D;  3KHE A;  4FQT A;  5TNC A;  1B8L A;  1OZS A;  3KF9 A;  3RZS A;  5DKQ A;  3LK0 A;  1S3P A;  1YUR A;  2KFG A;  2QDI A;  1SBJ A;  1DQE A;  3B7A A;  3SJS A;  1SCM C;  3PLF B;  2LVJ A;  3ZNI A;  3PN7 C;  1WRL A;  3EKJ A;  3CWG A;  1ALV A;  1OMV A;  3BXK A;  3FE8 A;  3D0Y A;  1OOI X;  1AVS A;  1RJV A;  1KWO C;  1SRA A;  1TIZ A;  2LC5 A;  1K94 A;  1SK6 D;  2M49 B;  2WCB A;  5DIC A;  1FW4 A;  1YUS A;  2IS9 A;  1JSA A;  1CMF A;  2O60 A;  3JTD B;  2M1K B;  1YRT B;  4XYN A;  5ER4 X;  2LVV A;  2LUX A;  4OKH A;  1R2U A;  2JTZ A;  4YGA A;  1FPW A;  1YUT A;  1UHN A;  1KK7 Y;  2BL0 B;  1B8R A;  3FE9 A;  1UP5 A;  5PAL A;  2PAL A;  1BU3 A;  3PJI A;  1REC A;  1CDN A;  1MQ1 A;  3TUY B;  1ALW A;  2KGB C;  1B7T Z;  5EL2 A;  4DCK A;  1K9K A;  1NCZ A;  2KI6 D;  4CFQ A;  4KYN A;  4ZCU A;  2F2O A;  2JRF A;  4IJ7 A;  3NXA A;  1TTX A;  2WCE A;  4M2O A;  2MJW B;  3OP0 A;  2LAN A;  4TNC A;  1U5I B;  1BT6 A;  3NGV A;  2F8P A;  4WQ3 A;  2WOS A;  4C0J A;  1S6I A;  1YR5 A;  2MRD A;  2L2E A;  1AK8 A;  1DTL A;  3VRQ A;  2B1U A;  2KLE A;  5K89 A;  1KFX S;  3OHM B;  2Q4U A;  4PCW A;  1SL9 A;  3GOF A;  3R1P A;  3TDU A;  1JWD A;  1QV1 A;  3IVT A;  3SIB A;  2JT8 A;  2K7D A;  3FIA A;  3VRP A;  3S0A A;  1LIN A;  1SR6 B;  4YI9 A;  1DF0 A;  4PDZ A;  4YRU A;  2LVI A;  1KFX L;  3RLZ A;  1TCF A;  2MLE C;  3JVT C;  4OV2 A;  4ZCV A;  1WDC C;  3C1V A;  1C7V A;  1KK7 Z;  1EH2 A;  1V1G A;  3BJH A;  4E68 A;  3GK1 A;  4MVF A;  1CMG A;  1CFP A;  3TS5 B;  4NDC A;  2BCB A;  2KYF A;  3CZ0 A;  2OS8 C;  1NYA A;  1QIV A;  4F7F A;  1YRU B;  4PE4 A;  4PHM A;  1CM4 A;  4Q04 A;  1AP4 A;  1JF0 A;  1B9A A;  4YBH B;  1UWO A;  1QX2 A;  2K0J A;  2EC6 B;  3I5I B;  1IKU A;  4ORC B;  1QS7 A;  2LHL A;  4N1F A;  1FI5 A;  1G4Y R;  2ZNE A;  3R72 A;  1WRZ A;  1Y0V H;  1NSH A;  1QXP A;  1JBA A;  3VGO A;  1OQP A;  3HCM A;  1XK4 A;  5DKN A;  2MAZ A;  5CPV A;  1DEL A;  2KAX A;  1JFK A;  3BUN B;  1NPQ A;  2JQ6 A;  2Y4Q A;  3R1V A;  1GJY A;  4AQJ A;  4PHN A;  1MHO A;  2NZ0 A;  3SS5 A;  1QJT A;  4YGC B;  2O5G A;  3D77 A;  1XFZ O;  2KBM A;  3E3R A;  1BR1 B;  1MWN A;  2CCM A;  1J7R A;  2M0R A;  5AER A;  3F45 A;  2PQL A;  1UHH A;  1EL4 A;  1K95 A;  3FWC A;  4OR9 B;  2JWW A;  2WCH A;  1N0Y A;  1S6J A;  3B87 A;  1MR8 A;  1PSR A;  2M9G A;  4OVN F;  1CM1 A;  1J7O A;  1GM0 A;  1M45 A;  1XYD A;  3OX5 A;  1E8A A;  2KDH A;  1J7Q A;  3BOW B;  2I7A A;  2PSR A;  3OX6 A;  1A4P A;  3GK4 X;  2GV5 A;  4ICB A;  1PUL A;  1DJZ A;  3SS3 A;  1A29 A;  2Y5I A;  1L2O B;  1N65 A;  1S26 D;  4I5J A;  4MRY A;  1HQV A;  2ERB A;  2MBX A;  4INX A;  4XJK A;  3CZ2 A;  2L2C A;  2LUC A;  2JC2 A;  5GQQ C;  2F3Z A;  2LAP A;  2Y1N A;  1TNW A;  1A2X A;  3R1O A;  2WC6 A;  1QV0 A;  2JTT A;  3D76 A;  2JXC A;  1TOP A;  3EVR A;  4GNK B;  2BBM A;  1PAL A;  1XFW O;  3B86 A;  4MBE A;  3CS1 A;  2CXJ A;  4QJ3 B;  1NX3 A;  1K9U A;  1OOG A;  4MSP A;  3BQ3 A;  1EG3 A;  2FJY A;  2ZN9 A;  1QX7 A;  1LS8 A;  2P71 A;  3PFV A;  1DJH A;  3D78 A;  1XVJ A;  5AXI A;  3I5G B;  5B8I B;  1Q80 A;  1H4B A;  4QJ4 B;  1OMR A;  1F54 A;  1LKJ A;  1CDL A;  1CTR A;  1OOF A;  1NP8 A;  4U8D A;  2ZKM X;  3EKH A;  1DJI A;  1GGZ A;  1W9Z A;  2WC8 A;  3S0G A;  4CLN A;  1DJG A;  3DF0 A;  2HQW A;  2PAS A;  3DY9 A;  3DYE A;  1J55 A;  3CR5 X;  1WY9 A;  3WHT B;  2F2P A;  3PN7 B;  3SG5 A;  1B4C A;  1SYM A;  1B47 A;  4GBA A;  3D75 A;  1BOD A;  2LMV A;  3D73 A;  1DGV A;  1KWO B;  3AAK A;  3BUM B;  4USL A;  2LVK A;  5JOL A;  3TZ1 A;  3PM8 A;  1WLZ A;  5HYD A;  1G8I A;  2QEO A;  1SMG A;  2CTN A;  2ZRT A;  4ORB B;  2BAP A;  3WHU B;  2KSP A;  1YVL A;  4YGD B;  2M7N A;  1TNX A;  1CDP A;  4QJ5 B;  2JU0 A;  1A75 B;  3JTD C;  3NSL A;  1SNL A;  1IH0 A;  1S36 A;  3A4U B;  1DJY A;  1ZAC A;  4HSZ A;  1NCY A;  3CR2 A;  4GPL B;  1YTZ C;  5CSI A;  2KLD A;  2KQY A;  2LE9 B;  2BL0 C;  1QX5 B;  1QTX A;  2JT0 A;  1RFJ A;  5AFP A;  1OMD A;  3BUO B;  3PM2 A;  1GGW A;  1LXF C;  1MXE A;  1M39 A;  2BCA A;  4INW A;  4NQG A;  1TNQ A;  4MN0 A;  3BYA A;  1NX2 A;  3CTN A;  1S6C A;  1XFV O;  2P70 A;  2KNE A;  1XFY O;  2WC5 A;  2KAV A;  3I5H C;  3K1E A;  2LM5 A;  3K21 A;  1MUX A;  3VB1 A;  4NDD A;  1K2H A;  4R1E A;  1BJF A;  1ZMZ A;  4C0K A;  3OGN A;  1XK4 C;  1BOC A;  2KAY A;  1AJ4 A;  3TDZ A;  1IQ3 A;  2LV7 A;  1C3Z A;  2HQ8 A;  1NUB A;  4M2P A;  3NSI A;  4PE7 A;  3DVK A;  1JF2 A;  1K8U A;  2OTG C;  3JVT B;  5J3X A;  1A03 A;  2LLS A;  2L4H A;  5IBW A;  5I2O A;  2CNP A;  3BFH A;  5D3O A;  2G9B A;  4AQI A;  2K60 A;  3L4A A;  1ORG A;  2M8U A;  3SG4 A;  1WRK A;  2OS8 B;  2ZRS A;  1PK0 D;  1BF5 A;  2LHI A;  1U5I A;  2GGZ A;  2KPH A;  1UHK A;  3SG3 A;  4WQ2 A;  4A4C A;  1TUJ A;  3TS5 C;  5BPJ A;  1BLQ A;  4MZL A;  2MHH A;  5FI7 A;  4JWQ A;  3OB2 B;  2KI4 B;  1Z4H A;  3CYZ A;  1N2D A;  1RRO A;  2M1U A;  4MZK A;  3I5I C;  1SCV A;  2VRG A;  3I5F C;  1VRK A;  2G2B A;  2WCK A;  1KK8 B;  2ZND A;  4JQ0 D;  5D7F A;  4BY4 A;  3EG5 B;  4JD9 A;  1FF1 A;  5HLV A;  4HRH A;  2DOQ A;  1J1E A;  1XFR A;  2YGU A;  2H8V A;  3QME A;  4PHJ A;  2FCE A;  5AEQ A;  1UHJ A;  4AOM A;  3PAT A;  1BR4 B;  3DVJ A;  3LK1 A;  1DGU A;  4GGN A;  5HL1 A;  3S0B A;  4CID A;  2BE4 A;  3V2L A;  2I2R E;  3KO0 A;  4GFT A;  3SG6 A;  1KFU L;  2L50 A;  4CPV A;  4P2Y B;  1XFU O;  2EGD A;  1SSE B;  3EVV A;  3PAL A;  1X02 A;  1C7W A;  1D1O A;  2HET A;  1F70 A;  5CSJ A;  1W7I B;  1RK9 A;  1TCO B;  2QEH A;  3CDN A;  3O2P A;  4I5K A;  3O4X A;  5I8N A;  3UNW A;  1KQV A;  3A8R A;  1JUO A;  1L2O C;  1ZFS A;  2KFF A;  3M0W A;  4C0L A;  1PVB A;  1H8B A;  1OE9 B;  4MLW A;  1DVI A;  1JFJ A;  1TRF A;  2FOT A;  2SCP A;  1M31 A;  1UHI A;  1BG1 A;  1CNP A;  3LCP C;  1S5G Y;  1DC1 A;  1QIW A;  4I5L B;  5FI6 A;  3D0Y B;  1Y1X A;  4GAO A;  2K2A A;  3IQQ A;  3DD4 A;  2L51 A;  1KQM C;  4ORA B;  2WCF A;  2M3W A;  1IJ6 A;  1Y1A A;  4GUK A;  1OZO A;  1QAT A;  2KI6 C;  2I94 A;  2H61 A;  3BUW B;  1M46 A;  1MF8 B;  1SPY A;  3IF7 A;  4L9M A;  5DKR A;  3BOW A;  1IIO A;  3OBV A;  1NX0 A;  3OB1 B;  2KGR A;  4HRG A;  2JXL A;  3DXL A;  1F8H A;  1SCM B;  1W7J B;  1JC2 A;  1TWO A;  3QRX A;  3CR4 X;  2Q91 A;  1CLL A;  4DUQ A;  1G33 A;  1CFD A;  1QLS A;  2D8N A;  3SS4 A;  3UO9 A;  1DT7 B;  4MEW A;  3HX4 A;  3N7H A;  2WCM A;  2NCP A;  2BNX A;  2HPS A;  2V53 A;  2WCJ A;  2KYC A;  4F0Z B;  2CBL A;  2LNK A;  2LP3 A;  3B6X A;  1LA3 A;  1S1E A;  3EVU A;  2KQ6 A;  1YUU A;  4DRW A;  1B8C A;  4PE1 A;  1GQM A;  1SY9 A;  1IGV A;  5I2L A;  3BUX B;  1XA5 A;  2CT9 A;  2SAS A;  1UUS A;  3Q8I A;  2BCX A;  4JPZ B;  1DEK A;  1PSB A;  3O6B A;  1S5G Z;  4PE0 A;  1CLM A;  3CLN A;  1P28 A;  1SW8 A;  2L5Y A;  1PVA A;  2KOT A;  1EJ3 A;  1OOJ A;  3O4Y A;  4FQO A;  3CGA A;  3NSK A;  2TN4 A;  3NSO A;  3SG2 A;  1ODB A;  5KSZ A;  1AHR A;  3KPX A;  1DF0 B;  1KSO A;  4CFR A;  1K90 D;  2QAC A;  2JPT A;  1EG4 A;  1M63 B;  5G08 A;  1IG5 A;  2BKI B;  3TUY C;  2NLN A;  1YVH A;  2QEV A;  3EK7 A;  3MSE B;  1KSM A;  1V1F A;  1EXR A;  3TDI A;  1K9P A;  3EK8 A;  1FBV A;  3DZT A;  2JT3 A;  3FWB A;  3WNX B;  2JPO A;  5FI2 A;  1Y1U A;  2E6W A;  2ISD A;  4BY5 A;  5I94 A;  2LMU A;  2H2K A;  2Y1M A;  5CSF A;  2P6B B;  1T14 A;  2COL B;  1IQ5 A;  2AUC A;  2PVB A;  4DS7 A;  2F3Y A;  2L0P A;  2OPO A;  5D69 A;  1R6P A;  3I5H B;  4YI8 A;  2KFH A;  1TUZ A;  1CFC A;  3AKB A;  3PSR A;  1WDC B;  2AMI A;  3CZT X;  2K2F A;  1QLK A;  1A75 A;  1SR6 C;  2M7L A;  4GGF C;  1QVI Y;  2L98 A;  3NHI A;  2ZN8 A;  3VRO A;  2OTG B;  3ZWH A;  2QEB A;  4JKT A;  2K7O A;  1QAS A;  1XO5 A;  5HKZ A;  1CFF A;  2K61 A;  1RTP 1;  2NCO A;  3BFA A;  5ER5 A;  1F4O A;  2AAO A;  2A4J A;  1Z2C B;  1CDM A;  2JZI A;  2JNX A;  5JJG A;  2F33 A;  4YGB B;  1AJ5 A;  2PYQ A;  3GK2 A;  4PAL A;  1CKK A;  2L5X B;  3L4L A;  2FCD A;  1SL8 A;  4I5N B;  1C3Y A;  1DJX A;  1YX8 A;  2EC6 C;  3H4S E;  1F4Q A;  4GGF A;  2ZFD A;  2FJU B;  4PT1 A;  3ICB A;  3EK4 A;  1L7Z A;  2MA2 A;  1LVC D;  3L47 A;  3S0F A;  5HKW A;  5KU1 A;  4XJK B;  3SG7 A;  2QPT A;  3I5F B;  2JOJ A;  1KCY A;  1KFU S;  2KI4 C;  2WCL A;  3AAJ A;  1SKT A;  1CB1 A;  1K96 A;  3S0E A;  2LLU A;  4OZD A;  1OOH A;  5F6T A;  3CAB A;  1IJ5 A;  1QWV A;  1IWQ A;  1NX1 A;  1SL7 A;  1LA0 A;  3KEV A;  4OCI A;  1KK8 C;  1J7P A;  2JUL A;  1QVI Z;  2KHN A;  3NHT A;  4ETO A;  2BEC A;  3O78 A;  3FE6 A;  3WXA A;  4MZJ A;  1HT9 A;  4YGE B;  1NWD A;  2M29 A;  4FTG A;  3BFB A;  3CZ1 A;  1OW4 A;  4WRI A;  1FI6 A;  2EHB A;  2I18 A;  4DIR A;  1ZUZ A;  4D1E A;  2H61 C;  3SIA A;  1OSA A;  2HF5 A; 
#chains in the Genus database with same CATH homology
 2BE6 A;  5KTY A;  4PHK A;  4P5O E;  2MLF C;  2R2I A;  2WND A;  3DVE A;  3DVM A;  5FYX A;  1PRW A;  2LLT A;  2LP2 A;  1Y6W A;  2NXQ A;  4MRX A;  2L4I A;  2K7C A;  2PMY A;  2KBI A;  2JNF A;  5I2Q A;  4A4B A;  1IRJ A;  3DF0 B;  3LL8 B;  2RGI A;  1ZOT B;  5CSN A;  1B1G A;  2BKH B;  4N1G A;  3FS7 A;  1TNP A;  3VRN A;  1UUR A;  2LCP A;  2LMT A;  1F71 A;  1TN4 A;  3IQO A;  2M97 A;  1BMO A;  2GGM A;  1C07 A;  1NIW A;  1NCX A;  5AAN A;  1MXL C;  1CLB A;  2K7B A;  1KQM B;  1F55 A;  1XFX O;  4HRE E;  2K8M B;  1RWY A;  3D10 A;  4N5X A;  1WLM A;  3LLE A;  2BBN A;  1B7T Y;  4IL1 A;  2WOR A;  2PRU A;  1DMO A;  1YX7 A;  5HKY A;  1DJW A;  3RM1 A;  1AUI B;  3I5G C;  4M2Q A;  4NDB A;  4UPG A;  3AKA A;  1J1D A;  2E30 A;  5HLO A;  3VRR A;  1K93 D;  3KHE A;  5TNC A;  1B8L A;  1OZS A;  3KF9 A;  5DKQ A;  3LK0 A;  1S3P A;  1YUR A;  2KFG A;  1SBJ A;  3SJS A;  1SCM C;  3PLF B;  2LVJ A;  3ZNI A;  3PN7 C;  1WRL A;  3EKJ A;  3CWG A;  1ALV A;  1OMV A;  3BXK A;  3D0Y A;  1AVS A;  1RJV A;  1KWO C;  1SRA A;  1TIZ A;  2LC5 A;  1K94 A;  1SK6 D;  2M49 B;  2WCB A;  1JSA A;  1FW4 A;  1YUS A;  2IS9 A;  1CMF A;  2O60 A;  3JTD B;  2M1K B;  1YRT B;  4XYN A;  5ER4 X;  2LVV A;  2LUX A;  4OKH A;  1R2U A;  2JTZ A;  4YGA A;  1FPW A;  1YUT A;  1UHN A;  1KK7 Y;  2BL0 B;  1B8R A;  5PAL A;  1UP5 A;  2PAL A;  1BU3 A;  1REC A;  1CDN A;  1MQ1 A;  3TUY B;  1ALW A;  2KGB C;  1B7T Z;  4DCK A;  1K9K A;  1NCZ A;  2KI6 D;  4CFQ A;  4ZCU A;  2F2O A;  2JRF A;  3NXA A;  1TTX A;  2WCE A;  4M2O A;  2MJW B;  3OP0 A;  2LAN A;  4TNC A;  1U5I B;  1BT6 A;  2F8P A;  4WQ3 A;  2WOS A;  4C0J A;  1S6I A;  1YR5 A;  2MRD A;  2L2E A;  1AK8 A;  1DTL A;  3VRQ A;  2B1U A;  5K89 A;  1KFX S;  3OHM B;  2Q4U A;  4PCW A;  1SL9 A;  3GOF A;  3TDU A;  1JWD A;  1QV1 A;  3SIB A;  2JT8 A;  2K7D A;  3FIA A;  3VRP A;  1LIN A;  1SR6 B;  4YI9 A;  1DF0 A;  4PDZ A;  4YRU A;  2LVI A;  1KFX L;  3RLZ A;  1TCF A;  2MLE C;  3JVT C;  4OV2 A;  4ZCV A;  1WDC C;  3C1V A;  1C7V A;  1KK7 Z;  1EH2 A;  1V1G A;  4E68 A;  3GK1 A;  4MVF A;  1CMG A;  1CFP A;  3TS5 B;  4NDC A;  2BCB A;  2KYF A;  2OS8 C;  1NYA A;  1QIV A;  1YRU B;  4PE4 A;  4PHM A;  1CM4 A;  4Q04 A;  1AP4 A;  1JF0 A;  1B9A A;  4YBH B;  1UWO A;  1QX2 A;  2K0J A;  2EC6 B;  3I5I B;  1IKU A;  4ORC B;  1QS7 A;  2LHL A;  4N1F A;  1FI5 A;  1G4Y R;  2ZNE A;  1WRZ A;  1Y0V H;  1NSH A;  1QXP A;  1JBA A;  3VGO A;  1OQP A;  3HCM A;  1XK4 A;  5DKN A;  2MAZ A;  5CPV A;  2KAX A;  1JFK A;  3BUN B;  1NPQ A;  2JQ6 A;  2Y4Q A;  4AQJ A;  1GJY A;  4PHN A;  1MHO A;  2NZ0 A;  1QJT A;  4YGC B;  2O5G A;  1XFZ O;  2KBM A;  3E3R A;  1BR1 B;  1MWN A;  2CCM A;  1J7R A;  2M0R A;  5AER A;  3F45 A;  1UHH A;  1EL4 A;  1K95 A;  3FWC A;  4OR9 B;  2JWW A;  1N0Y A;  1S6J A;  4OVN F;  1MR8 A;  1PSR A;  2M9G A;  1J7O A;  1CM1 A;  1M45 A;  1XYD A;  3OX5 A;  1E8A A;  2KDH A;  1J7Q A;  3BOW B;  2I7A A;  2PSR A;  3OX6 A;  1A4P A;  3GK4 X;  2GV5 A;  4ICB A;  1PUL A;  1DJZ A;  1A29 A;  2Y5I A;  1L2O B;  1N65 A;  1S26 D;  4I5J A;  4MRY A;  1HQV A;  2MBX A;  4XJK A;  2LUC A;  2JC2 A;  5GQQ C;  2F3Z A;  2LAP A;  2Y1N A;  1TNW A;  1A2X A;  1QV0 A;  2JTT A;  2JXC A;  1TOP A;  3EVR A;  4GNK B;  2BBM A;  1PAL A;  1XFW O;  4MBE A;  3CS1 A;  2CXJ A;  4QJ3 B;  1NX3 A;  1K9U A;  4MSP A;  3BQ3 A;  1EG3 A;  2ZN9 A;  1QX7 A;  3PFV A;  1DJH A;  5AXI A;  1XVJ A;  3I5G B;  5B8I B;  1Q80 A;  1H4B A;  4QJ4 B;  1OMR A;  1F54 A;  1LKJ A;  1CDL A;  1CTR A;  1NP8 A;  4U8D A;  2ZKM X;  3EKH A;  1DJI A;  1GGZ A;  2WC8 A;  4CLN A;  1DJG A;  3DF0 A;  2HQW A;  2PAS A;  1J55 A;  3CR5 X;  1WY9 A;  3WHT B;  2F2P A;  3PN7 B;  3SG5 A;  1B4C A;  1SYM A;  1B47 A;  4GBA A;  1BOD A;  2LMV A;  1DGV A;  1KWO B;  3AAK A;  3BUM B;  4USL A;  2LVK A;  5JOL A;  3TZ1 A;  3PM8 A;  1WLZ A;  5HYD A;  1G8I A;  1SMG A;  2CTN A;  2ZRT A;  4ORB B;  3WHU B;  2KSP A;  1YVL A;  4YGD B;  2M7N A;  1TNX A;  1CDP A;  4QJ5 B;  2JU0 A;  1A75 B;  3JTD C;  3NSL A;  1SNL A;  1IH0 A;  1S36 A;  3A4U B;  1DJY A;  1ZAC A;  4HSZ A;  1NCY A;  3CR2 A;  4GPL B;  1YTZ C;  5CSI A;  2KQY A;  2LE9 B;  2BL0 C;  1QX5 B;  1QTX A;  2JT0 A;  1RFJ A;  5AFP A;  1OMD A;  3BUO B;  1GGW A;  1LXF C;  1MXE A;  1M39 A;  2BCA A;  4NQG A;  1TNQ A;  4MN0 A;  3BYA A;  1NX2 A;  3CTN A;  1S6C A;  1XFV O;  2KNE A;  1XFY O;  2KAV A;  3I5H C;  2LM5 A;  3K21 A;  1MUX A;  4NDD A;  1K2H A;  4R1E A;  1BJF A;  1ZMZ A;  4C0K A;  1XK4 C;  1BOC A;  2KAY A;  1AJ4 A;  3TDZ A;  1IQ3 A;  2LV7 A;  4M2P A;  2HQ8 A;  1NUB A;  3NSI A;  4PE7 A;  3DVK A;  1JF2 A;  1K8U A;  2OTG C;  3JVT B;  5J3X A;  1A03 A;  2LLS A;  2L4H A;  5IBW A;  5I2O A;  2CNP A;  2G9B A;  4AQI A;  2M8U A;  3SG4 A;  1WRK A;  2OS8 B;  2ZRS A;  1PK0 D;  1BF5 A;  2LHI A;  1U5I A;  2GGZ A;  1UHK A;  3SG3 A;  4WQ2 A;  4A4C A;  5BPJ A;  3TS5 C;  1BLQ A;  4MZL A;  2MHH A;  4JWQ A;  3OB2 B;  2KI4 B;  1N2D A;  1RRO A;  2M1U A;  4MZK A;  3I5I C;  1SCV A;  2VRG A;  3I5F C;  1VRK A;  2G2B A;  4JQ0 D;  1KK8 B;  2ZND A;  5D7F A;  4BY4 A;  1FF1 A;  5HLV A;  4HRH A;  2DOQ A;  1J1E A;  4PHJ A;  2FCE A;  5AEQ A;  1UHJ A;  4AOM A;  3PAT A;  1BR4 B;  3DVJ A;  3LK1 A;  1DGU A;  4GGN A;  4CID A;  2BE4 A;  2I2R E;  3KO0 A;  4GFT A;  3SG6 A;  1KFU L;  2L50 A;  4CPV A;  4P2Y B;  1XFU O;  2EGD A;  3EVV A;  3PAL A;  1X02 A;  1C7W A;  1D1O A;  2HET A;  1F70 A;  5CSJ A;  1W7I B;  1RK9 A;  1TCO B;  3O2P A;  4I5K A;  5I8N A;  1KQV A;  3A8R A;  1JUO A;  1L2O C;  1ZFS A;  2KFF A;  3M0W A;  4C0L A;  1PVB A;  1H8B A;  1OE9 B;  4MLW A;  1DVI A;  1JFJ A;  1TRF A;  2FOT A;  2SCP A;  1M31 A;  1UHI A;  1BG1 A;  1CNP A;  3LCP C;  1S5G Y;  1QIW A;  4I5L B;  3D0Y B;  1Y1X A;  4GAO A;  2K2A A;  3IQQ A;  3DD4 A;  2L51 A;  1KQM C;  4ORA B;  2WCF A;  2M3W A;  1IJ6 A;  1Y1A A;  4GUK A;  1OZO A;  1QAT A;  2KI6 C;  2I94 A;  2H61 A;  3BUW B;  1M46 A;  1MF8 B;  1SPY A;  3IF7 A;  4L9M A;  5DKR A;  3BOW A;  1NX0 A;  3OB1 B;  2KGR A;  4HRG A;  2JXL A;  1F8H A;  1SCM B;  1W7J B;  1JC2 A;  3QRX A;  3CR4 X;  2Q91 A;  1CLL A;  4DUQ A;  1G33 A;  1CFD A;  1QLS A;  2D8N A;  1DT7 B;  4MEW A;  3HX4 A;  2NCP A;  2HPS A;  2V53 A;  2KYC A;  4F0Z B;  2CBL A;  2LNK A;  2LP3 A;  1LA3 A;  1S1E A;  3EVU A;  2KQ6 A;  1YUU A;  4DRW A;  1B8C A;  4PE1 A;  1GQM A;  1SY9 A;  1IGV A;  5I2L A;  3BUX B;  1XA5 A;  2CT9 A;  2SAS A;  1UUS A;  4JPZ B;  2BCX A;  1PSB A;  3O6B A;  1S5G Z;  4PE0 A;  1CLM A;  3CLN A;  1SW8 A;  3O4Y A;  1PVA A;  2KOT A;  1EJ3 A;  1OOJ A;  4FQO A;  3CGA A;  3NSK A;  2TN4 A;  3NSO A;  3SG2 A;  1ODB A;  5KSZ A;  1AHR A;  3KPX A;  1DF0 B;  1KSO A;  4CFR A;  1K90 D;  2QAC A;  2JPT A;  1EG4 A;  1M63 B;  5G08 A;  1IG5 A;  2BKI B;  3TUY C;  2NLN A;  1YVH A;  3EK7 A;  3MSE B;  1KSM A;  1V1F A;  1EXR A;  3TDI A;  1K9P A;  3EK8 A;  1FBV A;  2JT3 A;  3FWB A;  3WNX B;  1Y1U A;  2E6W A;  2ISD A;  4BY5 A;  2LMU A;  2H2K A;  2Y1M A;  5CSF A;  2P6B B;  2COL B;  1IQ5 A;  2AUC A;  2PVB A;  4DS7 A;  2F3Y A;  2L0P A;  2OPO A;  5D69 A;  1R6P A;  3I5H B;  4YI8 A;  2KFH A;  1CFC A;  3AKB A;  3PSR A;  1WDC B;  2AMI A;  3CZT X;  2K2F A;  1QLK A;  1A75 A;  1SR6 C;  2M7L A;  4GGF C;  1QVI Y;  2L98 A;  2ZN8 A;  3VRO A;  2OTG B;  3ZWH A;  2K7O A;  1QAS A;  1XO5 A;  5HKZ A;  1CFF A;  2K61 A;  1RTP 1;  2NCO A;  5ER5 A;  1F4O A;  2AAO A;  2A4J A;  1CDM A;  2JZI A;  2JNX A;  5JJG A;  2F33 A;  4YGB B;  1AJ5 A;  3GK2 A;  4PAL A;  1CKK A;  2L5X B;  2FCD A;  1SL8 A;  4I5N B;  1DJX A;  1YX8 A;  2EC6 C;  3H4S E;  1F4Q A;  4GGF A;  2ZFD A;  2FJU B;  3ICB A;  3EK4 A;  1L7Z A;  2MA2 A;  1LVC D;  5HKW A;  5KU1 A;  4XJK B;  3SG7 A;  2QPT A;  3I5F B;  2JOJ A;  1KCY A;  1KFU S;  2KI4 C;  3AAJ A;  1SKT A;  1CB1 A;  1K96 A;  2LLU A;  5F6T A;  1IJ5 A;  1IWQ A;  1NX1 A;  1SL7 A;  1LA0 A;  3KEV A;  4OCI A;  1KK8 C;  1J7P A;  2JUL A;  1QVI Z;  2KHN A;  4ETO A;  2BEC A;  3O78 A;  3WXA A;  4MZJ A;  1HT9 A;  4YGE B;  1NWD A;  2M29 A;  4FTG A;  4WRI A;  1FI6 A;  2EHB A;  2I18 A;  4DIR A;  1ZUZ A;  4D1E A;  2H61 C;  3SIA A;  1OSA A;  2HF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...