3CZ2A

Dimeric crystal structure of a pheromone binding protein from apis mellifera at ph 7.0
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
118
structure length
118
Chain Sequence
PDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 38
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3cz2A00
2ERBA 3B87A 2GTEA 3D74A 3D73A 3R72A 4OZDA 3NGVA 3BFBA 4F7FA 3BFAA 1GM0A 4JD9A 3FE9A 3B88A 5DICA 3S0BA 3S0EA 3QMEA 1OOIX 1ORGA 3DYEA 3N7HA 2QDIA 2WC6A 2KPHA 2QEOA 3B7AA 3OGNA 2QEVA 3S0AA 3D77A 3FE8A 3D75A 3BJHA 3S0FA 3K1EA 2QEBA 3CZ1A 3NHIA 3S0DA 3BFHA 5EL2A 1P28A 3CZ0A 3RZSA 3R1VA 3D76A 4FQTA 1OOGA 3Q8IA 3VB1A 1XFRA 1OW4A 1DQEA 3L4LA 1OOFA 1C3ZA 4INXA 2L2CA 2H8VA 3CDNA 3NHTA 3CABA 2P70A 3B6XA 1TWOA 1T14A 2JPOA 3R1PA 1C3YA 2WCJA 3CYZA 2PQLA 3V2LA 2WCKA 3DZTA 4INWA 3D78A 2FJYA 3CZ2A 2P71A 2QEHA 3DXLA 2WCLA 3PJIA 1OOHA 4PT1A 1LS8A 3R1OA 3FE6A 1TUJA 3DY9A 3S0GA 3L47A 1QWVA 2WC5A 3B86A 2WCMA 3L4AA 2WCHA
chains in the Genus database with same CATH superfamily
4MZJA 4N5XA 3SS3A 5JJGA 2ERBA 1B8LA 3D0YB 1F55A 1V1GA 3EKHA 3D73A 3CGAA 2KQ6A 2H2KA 3NGVA 2R2IA 3I5HB 3SJSA 4KYNA 2JWWA 1JSAA 1KK8C 3TDIA 1J55A 2LANA 1C07A 1TUZA 1RWYA 4JD9A 3QRXA 1A4PA 5F6TA 1GQMA 4JKTA 1J7QA 3I5IC 1K96A 1QIVA 3MSEB 1TNXA 2OS8C 1EH2A 3FIAA 4MN0A 1RROA 1SCMB 3N7HA 2L51A 1BG1A 1R2UA 2NXQA 1PULA 4QJ4B 2K7CA 4GAOA 4M2QA 3PLFB 1Y1AA 1DTLA 3EVVA 1K9UA 1A03A 4BY5A 2KPHA 1BR1B 1YX8A 2HQWA 1PK0D 2L4IA 3D77A 1KFUS 2VRGA 5D7FA 1NCZA 3S0FA 1FF1A 1UWOA 4ZCVA 1SR6C 2F2PA 2WORA 2BE6A 2Y1NA 2I18A 3FWBA 1UP5A 1TNPA 4AQIA 1M63B 4I5KA 1DJXA 4PE4A 1P28A 2G2BA 3CZ0A 1K2HA 2KI4C 1Z4HA 4QJ5B 1S6JA 1J1EA 4C0JA 5KU1A 2L50A 2LMUA 4NDDA 1TNQA 3DF0A 5AXIA 3GK1A 1JFJA 2KI6D 2IS9A 4Q04A 4PHNA 4R1EA 1OW4A 4CPVA 5DKNA 2KBMA 1F71A 1JFKA 2K2FA 1K94A 2KGRA 4MZKA 1OOFA 2WCMA 3SG2A 3CS1A 2LC5A 3SG6A 1LKJA 2L2CA 1J7RA 1KK7Y 2H8VA 3CDNA 4FTGA 1CFCA 2NLNA 3ZWHA 4NDCA 3CABA 1SPYA 2WCBA 3CR4X 1S36A 1C7WA 2BCAA 2M7NA 1CFFA 1S1EA 1T14A 1UHNA 4GBAA 3SIAA 1EG4A 1E8AA 5AANA 3V2LA 2WCKA 1QX7A 1TCFA 1BT6A 1KWOC 3ZNIA 2PVBA 1S6CA 2AAOA 2M3WA 3D78A 4MBEA 4ORAB 1MQ1A 2LV7A 4PALA 2M1KB 5AEQA 1IKUA 3BUOB 2MLEC 3UO9A 3VGOA 2KBIA 1JUOA 2M1UA 3OHMB 1XA5A 1SCMC 1S26D 2KYCA 1RTP1 2MHHA 5HYDA 1K93D 1UHKA 3E3RA 2BL0B 4PT1A 3K21A 1NYAA 1MHOA 2JOJA 2LLTA 1M45A 2F3YA 1NP8A 4CIDA 2L98A 1TIZA 3WHTB 3BUNB 1HQVA 3I5GB 3KO0A 1EXRA 5FI6A 3L4AA 2G9BA 2QDIA 1CFPA 4OVNF 2KFHA 2JULA 3TUYB 1DMOA 3JVTC 2F3ZA 2GTEA 2I7AA 2LE9B 1BOCA 1J7OA 2K60A 2KSPA 3BOWB 4N1FA 2JTTA 1F70A 3R72A 1N65A 4OZDA 1H4BA 1ODBA 4YRUA 5I8NA 5CPVA 1YUTA 2LM5A 4F7FA 4GFTA 2H61A 2O60A 1NWDA 3LLEA 5K89A 1PSBA 1MUXA 1N2DA 1WDCB 2MLFC 2GGZA 3DF0B 3LK1A 1X02A 1CM1A 1XFWO 1QTXA 3IF7A 1KSMA 1K9PA 2ZFDA 4UPGA 1OE9B 3B88A 2RGIA 5DICA 1QV0A 3DVEA 3S0EA 2PMYA 4ZCUA 5HKYA 1EL4A 1SY9A 5HL1A 1NCXA 1QX5B 2KQYA 1RK9A 2KFFA 1K9KA 1S5GY 2JTZA 3H4SE 1DT7B 1BLQA 4GGFA 3PSRA 3RM1A 2LMTA 3SS4A 3AAKA 4AOMA 1YRTB 1VRKA 1Y1XA 2LCPA 1UHHA 1W7JB 1L2OC 1QLSA 3OGNA 4CFRA 3LK0A 1K90D 3CZTX 2CT9A 2QEVA 1YVLA 1YX7A 1OMVA 4JQ0D 1IQ3A 3K1EA 2FCEA 2HPSA 1LXFC 2LUXA 2QEBA 3KEVA 4HRHA 5I2QA 3PN7B 1BMOA 1R6PA 4MVFA 2KGBC 2EC6B 4I5NB 4YBHB 4FQOA 4XJKA 1NUBA 2K7OA 2PSRA 3RZSA 1U5IA 3CTNA 1W7IB 2NCPA 5ER4X 3TDZA 3DD4A 2Q4UA 2ZNEA 5DKQA 3EK8A 3EKJA 1TOPA 1IG5A 3BUWB 1JBAA 2M0RA 1KFXL 4MLWA 1TNWA 3JTDC 3VB1A 1BODA 1CLLA 1XFRA 3WNXB 1DQEA 5CSFA 2LAPA 1KQVA 1PVBA 2MAZA 1RFJA 1Y0VH 1WLZA 1ZOTB 1CDNA 1K95A 1NCYA 2KHNA 5G08A 3IVTA 2FJUB 3TUYC 2BKHB 1GGZA 5JOLA 1QJTA 2KAVA 3NHTA 1XVJA 3SG3A 4C0LA 3NXAA 2QPTA 5HLOA 1WRZA 1TWOA 2F8PA 1C3YA 5AERA 1BF5A 1LVCD 2WCJA 3CYZA 2PQLA 4MEWA 2BNXA 1F4QA 1KK7Z 4PE1A 5KTYA 2WCEA 3DZTA 1WRKA 1M31A 2ZN9A 2FJYA 2LP2A 1CDLA 1QS7A 2D8NA 3KPXA 1C7VA 1KQMB 1XFUO 1KFXS 2KYFA 2OTGB 2WC8A 1G8IA 3DXLA 2Y1MA 1ZMZA 1NIWA 1RECA 3OB2B 3PJIA 2V53A 4JWQA 3SG7A 1ZUZA 1XFXO 2JT3A 4NQGA 2WNDA 4AQJA 2SCPA 1OMDA 3KF9A 3FE6A 2M29A 1CMFA 2BCXA 3AKAA 1SK6D 5J3XA 1F8HA 1OOJA 2GV5A 1LA0A 3PALA 3L47A 1OZOA 3PATA 3I5HC 1XFVO 5FI2A 3S0GA 1TRFA 1QWVA 3WXAA 1H8BA 1DELA 5I94A 3HX4A 1M46A 3BQ3A 1B47A 3B87A 2EC6C 4OR9B 3D74A 1AJ5A 4YGCB 1JWDA 3BUMB 2K7DA 1V1FA 3EK7A 1WLMA 2BECA 5CSJA 1TN4A 4XJKB 1AP4A 3IQOA 1XO5A 3BFAA 4YGEB 2Q91A 3TZ1A 1MWNA 2KAXA 1FW4A 1DF0A 1DJGA 2PRUA 2M49B 1LINA 2LUCA 2K61A 4IJ7A 4WQ2A 2L0PA 2HQ8A 1DJYA 1NX0A 1SRAA 4JPZB 1Q80A 1KK8B 3QMEA 1OOIX 4YI9A 2JPTA 4P2YB 1ALVA 1FPWA 3GK2A 3OP0A 4GGNA 3AKBA 3NSOA 2JNFA 4CLNA 2JT8A 2NCOA 2JRFA 3NSIA 4M2PA 4OCIA 2PYQA 3I5IB 2BBNA 2BCBA 3O4XA 2OS8B 3SIBA 3S0AA 1XFYO 4WQ3A 4CFQA 3D75A 3BJHA 2LLUA 2KAYA 1S5GZ 1NPQA 3CZ1A 3FWCA 3NHIA 4A4CA 3GOFA 3A8RA 1CKKA 3DVKA 3IQQA 3BFHA 1YUSA 2LMVA 4MRYA 4A4BA 1ALWA 1KQMC 2KLDA 2ISDA 1XK4C 2OTGC 2ZKMX 4FQTA 3TS5B 1OOGA 2F2OA 1CMGA 1YURA 2DOQA 3D10A 3Q8IA 1SR6B 3TDUA 3M0WA 1CM4A 1NSHA 2BAPA 3O4YA 4GUKA 3O6BA 1HT9A 1QV1A 3A4UB 3O2PA 1IJ6A 4I5JA 2LVIA 4I5LB 1CB1A 1L7ZA 1DGVA 5ER5A 4DIRA 2I2RE 1YVHA 2FOTA 3AAJA 4F0ZB 1G33A 4INXA 1SW8A 3C1VA 1JF2A 4DUQA 1WY9A 1AHRA 1QATA 4GPLB 3SS5A 1JF0A 1MXEA 4PE7A 1J7PA 4P5OE 2BE4A 2P70A 4E68A 1B7TZ 2QACA 2M9GA 3B6XA 4YGAA 2KNEA 1DC1A 3R1PA 2JPOA 1CFDA 4USLA 1W9ZA 3VRPA 1DJZA 1BJFA 1AVSA 2JU0A 2LHIA 3WHUB 2ZN8A 1Y1UA 3DVJA 3OX5A 3PM2A 2K7BA 4INWA 1YTZC 1KFUL 1B9AA 2BL0C 1S3PA 4YI8A 1D1OA 1F4OA 1DF0B 1SL9A 1UHIA 2L2EA 5TNCA 1OSAA 1QASA 1SMGA 2FCDA 1MR8A 2F33A 1B7TY 2AUCA 2MJWB 2QEHA 2ZRSA 3F45A 3HCMA 2BBMA 2PALA 3OX6A 1B8RA 2K2AA 2L5YA 1KWOB 3I5GC 2E6WA 4PHJA 2PASA 2JC2A 2LLSA 2OPOA 2M8UA 4PCWA 3SG5A 2KDHA 2LVKA 3R1OA 2K8MB 5D69A 2LVVA 1DGUA 2JNXA 2B1UA 1EJ3A 2WCFA 3FS7A 4OKHA 1GJYA 2L4HA 1SNLA 1B4CA 2WCHA 1WDCC 4MZLA 1OZSA 4QJ3B 3LL8B 1A75A 5FI7A 4NDBA 5KSZA 1OQPA 1QXPA 1UURA 1CDMA 3VRQA 3I5FB 1SSEB 2JXCA 3TS5C 3BFBA 1NX2A 1PRWA 1DEKA 2CBLA 2P6BB 3BOWA 2M7LA 1GM0A 2LHLA 3JVTB 1CNPA 1G4YR 3FE9A 5GQQC 1QX2A 1AK8A 2COLB 5B8IB 1GGWA 2JQ6A 2CNPA 3VRNA 1XFZO 1OMRA 4ORBB 4L9MA 1UHJA 4TNCA 3S0BA 1ORGA 3DYEA 2LNKA 5D3OA 1Z2CB 1SL8A 1AUIB 1LA3A 3BUXB 4PE0A 3PN7C 2BKIB 5HKZA 2CXJA 2WC6A 4MSPA 4PHMA 1YR5A 5CSNA 4HREE 3B7AA 1CTRA 1SKTA 2QEOA 3PM8A 4MRXA 3UNWA 2ZNDA 1PALA 1CDPA 1FI5A 3BYAA 1PSRA 3FE8A 2I94A 4GNKB 4ORCB 1BU3A 5DKRA 2E30A 1U5IB 3D0YA 1IH0A 1IQ5A 3S0DA 4YGDB 1SL7A 4DCKA 4ICBA 2GGMA 4PDZA 1ZACA 5EL2A 1SBJA 4PHKA 1L2OB 1EG3A 3CLNA 3R1VA 4D1EA 2CTNA 3PFVA 3KHEA 3D76A 4OV2A 2Y4QA 3O78A 2SASA 3RLZA 5PALA 1PVAA 1B1GA 1FI6A 3LCPC 4YGBB 5FYXA 2EHBA 1IGVA 2AMIA 3SG4A 2KOTA 3BXKA 1S6IA 1Y6WA 1A2XA 1DJWA 2LVJA 3L4LA 2KFGA 2HETA 4WRIA 2CCMA 3CR5X 1FBVA 5HLVA 4DRWA 5HKWA 2KLEA 1C3ZA 2JT0A 3DVMA 5I2OA 2A4JA 1NX3A 1JC2A 1QVIZ 2NZ0A 2YGUA 3JTDB 4IL1A 4U8DA 5BPJA 2MRDA 1MXLC 3CWGA 1M39A 1SYMA 2MA2A 1IJ5A 1KSOA 1QIWA 1WRLA 2H61C 1XYDA 1RJVA 4HRGA 3EVRA 1CLBA 3I5FC 2M97A 3OBVA 1A75B 5I2LA 1N0YA 1IIOA 1IRJA 1BR4B 2KI6C 3EVUA 1IWQA 4BY4A 3EG5B 2K0JA 2HF5A 3NSKA 1QVIY 1AJ4A 2Y5IA 1UUSA 2P71A 2ZRTA 3CZ2A 1DJIA 3NSLA 1QLKA 2O5GA 1B8CA 4GGFC 2KI4B 3CR2A 4ETOA 4N1GA 3VRRA 4HSZA 3OB1B 1KCYA 5IBWA 2WCLA 1MF8B 1CLMA 1TCOB 3EK4A 1OOHA 4M2OA 3VROA 1J1DA 4XYNA 2L5XB 1TTXA 1LS8A 1NX1A 3ICBA 1XK4A 2MBXA 1F54A 1ZFSA 2JXLA 4DS7A 2WOSA 1YUUA 5CSIA 1TUJA 2TN4A 2EGDA 1K8UA 3DY9A 4C0KA 1DVIA 1DJHA 3B86A 2JZIA 1YRUB 2WC5A 5AFPA 1SCVA 1A29A 3GK4X 2LP3A
chains in the Genus database with same CATH topology
2ERBA 3B87A 2GTEA 3D74A 3D73A 3R72A 4OZDA 3NGVA 3BFBA 4F7FA 3BFAA 1GM0A 4JD9A 3FE9A 3B88A 5DICA 3S0BA 3S0EA 3QMEA 1OOIX 1ORGA 3DYEA 3N7HA 2QDIA 2WC6A 2KPHA 2QEOA 3B7AA 3OGNA 2QEVA 3S0AA 3D77A 3FE8A 3D75A 3BJHA 3S0FA 3K1EA 2QEBA 3CZ1A 3NHIA 3S0DA 3BFHA 5EL2A 1P28A 3CZ0A 3RZSA 3R1VA 3D76A 4FQTA 1OOGA 3Q8IA 3VB1A 1XFRA 1OW4A 1DQEA 3L4LA 1OOFA 1C3ZA 4INXA 2L2CA 2H8VA 3CDNA 3NHTA 3CABA 2P70A 3B6XA 1TWOA 1T14A 2JPOA 3R1PA 1C3YA 2WCJA 3CYZA 2PQLA 3V2LA 2WCKA 3DZTA 4INWA 3D78A 2FJYA 3CZ2A 2P71A 2QEHA 3DXLA 2WCLA 3PJIA 1OOHA 4PT1A 1LS8A 3R1OA 3FE6A 1TUJA 3DY9A 3S0GA 3L47A 1QWVA 2WC5A 3B86A 2WCMA 3L4AA 2WCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERB A;  3B87 A;  2GTE A;  3D74 A;  3D73 A;  3R72 A;  4OZD A;  3NGV A;  3BFB A;  4F7F A;  3BFA A;  1GM0 A;  4JD9 A;  3FE9 A;  3B88 A;  5DIC A;  3S0B A;  3S0E A;  3QME A;  1OOI X;  1ORG A;  3DYE A;  3N7H A;  2QDI A;  2WC6 A;  2KPH A;  2QEO A;  3B7A A;  3OGN A;  2QEV A;  3S0A A;  3D77 A;  3FE8 A;  3D75 A;  3BJH A;  3S0F A;  3K1E A;  2QEB A;  3CZ1 A;  3NHI A;  3S0D A;  3BFH A;  5EL2 A;  1P28 A;  3CZ0 A;  3RZS A;  3R1V A;  3D76 A;  4FQT A;  1OOG A;  3Q8I A;  3VB1 A;  1XFR A;  1OW4 A;  1DQE A;  3L4L A;  1OOF A;  1C3Z A;  4INX A;  2L2C A;  2H8V A;  3CDN A;  3NHT A;  3CAB A;  2P70 A;  3B6X A;  1TWO A;  1T14 A;  2JPO A;  3R1P A;  1C3Y A;  2WCJ A;  3CYZ A;  2PQL A;  3V2L A;  2WCK A;  3DZT A;  4INW A;  3D78 A;  2FJY A;  3CZ2 A;  2P71 A;  2QEH A;  3DXL A;  2WCL A;  3PJI A;  1OOH A;  4PT1 A;  1LS8 A;  3R1O A;  3FE6 A;  1TUJ A;  3DY9 A;  3S0G A;  3L47 A;  1QWV A;  2WC5 A;  3B86 A;  2WCM A;  3L4A A;  2WCH A; 
#chains in the Genus database with same CATH topology
 4MZJ A;  4N5X A;  3SS3 A;  5JJG A;  2ERB A;  1B8L A;  3D0Y B;  1F55 A;  1V1G A;  3EKH A;  3D73 A;  3CGA A;  2KQ6 A;  2H2K A;  3NGV A;  2R2I A;  3I5H B;  3SJS A;  4KYN A;  2JWW A;  1JSA A;  1KK8 C;  3TDI A;  1J55 A;  2LAN A;  1C07 A;  1TUZ A;  1RWY A;  4JD9 A;  3QRX A;  1A4P A;  5F6T A;  1GQM A;  4JKT A;  1J7Q A;  3I5I C;  1K96 A;  1QIV A;  3MSE B;  1TNX A;  2OS8 C;  1EH2 A;  3FIA A;  4MN0 A;  1RRO A;  1SCM B;  3N7H A;  2L51 A;  1BG1 A;  1R2U A;  2NXQ A;  1PUL A;  4QJ4 B;  2K7C A;  4GAO A;  4M2Q A;  3PLF B;  1Y1A A;  1DTL A;  3EVV A;  1K9U A;  1A03 A;  4BY5 A;  2KPH A;  1BR1 B;  1YX8 A;  2HQW A;  1PK0 D;  2L4I A;  3D77 A;  1KFU S;  2VRG A;  5D7F A;  1NCZ A;  3S0F A;  1FF1 A;  1UWO A;  4ZCV A;  1SR6 C;  2F2P A;  2WOR A;  2BE6 A;  2Y1N A;  2I18 A;  3FWB A;  1UP5 A;  1TNP A;  4AQI A;  1M63 B;  4I5K A;  1DJX A;  4PE4 A;  1P28 A;  2G2B A;  3CZ0 A;  1K2H A;  2KI4 C;  1Z4H A;  4QJ5 B;  1S6J A;  1J1E A;  4C0J A;  5KU1 A;  2L50 A;  2LMU A;  4NDD A;  1TNQ A;  3DF0 A;  5AXI A;  3GK1 A;  1JFJ A;  2KI6 D;  2IS9 A;  4Q04 A;  4PHN A;  4R1E A;  1OW4 A;  4CPV A;  5DKN A;  2KBM A;  1F71 A;  1JFK A;  2K2F A;  1K94 A;  2KGR A;  4MZK A;  1OOF A;  2WCM A;  3SG2 A;  3CS1 A;  2LC5 A;  3SG6 A;  1LKJ A;  2L2C A;  1J7R A;  1KK7 Y;  2H8V A;  3CDN A;  4FTG A;  1CFC A;  2NLN A;  3ZWH A;  4NDC A;  3CAB A;  1SPY A;  2WCB A;  3CR4 X;  1S36 A;  1C7W A;  2BCA A;  2M7N A;  1CFF A;  1S1E A;  1T14 A;  1UHN A;  4GBA A;  3SIA A;  1EG4 A;  1E8A A;  5AAN A;  3V2L A;  2WCK A;  1QX7 A;  1TCF A;  1BT6 A;  1KWO C;  3ZNI A;  2PVB A;  1S6C A;  2AAO A;  2M3W A;  3D78 A;  4MBE A;  4ORA B;  1MQ1 A;  2LV7 A;  4PAL A;  2M1K B;  5AEQ A;  1IKU A;  3BUO B;  2MLE C;  3UO9 A;  3VGO A;  2KBI A;  1JUO A;  2M1U A;  3OHM B;  1XA5 A;  1SCM C;  1S26 D;  2KYC A;  1RTP 1;  2MHH A;  5HYD A;  1K93 D;  1UHK A;  3E3R A;  2BL0 B;  4PT1 A;  3K21 A;  1NYA A;  1MHO A;  2JOJ A;  2LLT A;  1M45 A;  2F3Y A;  1NP8 A;  4CID A;  2L98 A;  1TIZ A;  3WHT B;  3BUN B;  1HQV A;  3I5G B;  3KO0 A;  1EXR A;  5FI6 A;  3L4A A;  2G9B A;  2QDI A;  1CFP A;  4OVN F;  2KFH A;  2JUL A;  3TUY B;  1DMO A;  3JVT C;  2F3Z A;  2GTE A;  2I7A A;  2LE9 B;  1BOC A;  1J7O A;  2K60 A;  2KSP A;  3BOW B;  4N1F A;  2JTT A;  1F70 A;  3R72 A;  1N65 A;  4OZD A;  1H4B A;  1ODB A;  4YRU A;  5I8N A;  5CPV A;  1YUT A;  2LM5 A;  4F7F A;  4GFT A;  2H61 A;  2O60 A;  1NWD A;  3LLE A;  5K89 A;  1PSB A;  1MUX A;  1N2D A;  1WDC B;  2MLF C;  2GGZ A;  3DF0 B;  3LK1 A;  1X02 A;  1CM1 A;  1XFW O;  1QTX A;  3IF7 A;  1KSM A;  1K9P A;  2ZFD A;  4UPG A;  1OE9 B;  3B88 A;  2RGI A;  5DIC A;  1QV0 A;  3DVE A;  3S0E A;  2PMY A;  4ZCU A;  5HKY A;  1EL4 A;  1SY9 A;  5HL1 A;  1NCX A;  1QX5 B;  2KQY A;  1RK9 A;  2KFF A;  1K9K A;  1S5G Y;  2JTZ A;  3H4S E;  1DT7 B;  1BLQ A;  4GGF A;  3PSR A;  3RM1 A;  2LMT A;  3SS4 A;  3AAK A;  4AOM A;  1YRT B;  1VRK A;  1Y1X A;  2LCP A;  1UHH A;  1W7J B;  1L2O C;  1QLS A;  3OGN A;  4CFR A;  3LK0 A;  1K90 D;  3CZT X;  2CT9 A;  2QEV A;  1YVL A;  1YX7 A;  1OMV A;  4JQ0 D;  1IQ3 A;  3K1E A;  2FCE A;  2HPS A;  1LXF C;  2LUX A;  2QEB A;  3KEV A;  4HRH A;  5I2Q A;  3PN7 B;  1BMO A;  1R6P A;  4MVF A;  2KGB C;  2EC6 B;  4I5N B;  4YBH B;  4FQO A;  4XJK A;  1NUB A;  2K7O A;  2PSR A;  3RZS A;  1U5I A;  3CTN A;  1W7I B;  2NCP A;  5ER4 X;  3TDZ A;  3DD4 A;  2Q4U A;  2ZNE A;  5DKQ A;  3EK8 A;  3EKJ A;  1TOP A;  1IG5 A;  3BUW B;  1JBA A;  2M0R A;  1KFX L;  4MLW A;  1TNW A;  3JTD C;  3VB1 A;  1BOD A;  1CLL A;  1XFR A;  3WNX B;  1DQE A;  5CSF A;  2LAP A;  1KQV A;  1PVB A;  2MAZ A;  1RFJ A;  1Y0V H;  1WLZ A;  1ZOT B;  1CDN A;  1K95 A;  1NCY A;  2KHN A;  5G08 A;  3IVT A;  2FJU B;  3TUY C;  2BKH B;  1GGZ A;  5JOL A;  1QJT A;  2KAV A;  3NHT A;  1XVJ A;  3SG3 A;  4C0L A;  3NXA A;  2QPT A;  5HLO A;  1WRZ A;  1TWO A;  2F8P A;  1C3Y A;  5AER A;  1BF5 A;  1LVC D;  2WCJ A;  3CYZ A;  2PQL A;  4MEW A;  2BNX A;  1F4Q A;  1KK7 Z;  4PE1 A;  5KTY A;  2WCE A;  3DZT A;  1WRK A;  1M31 A;  2ZN9 A;  2FJY A;  2LP2 A;  1CDL A;  1QS7 A;  2D8N A;  3KPX A;  1C7V A;  1KQM B;  1XFU O;  1KFX S;  2KYF A;  2OTG B;  2WC8 A;  1G8I A;  3DXL A;  2Y1M A;  1ZMZ A;  1NIW A;  1REC A;  3OB2 B;  3PJI A;  2V53 A;  4JWQ A;  3SG7 A;  1ZUZ A;  1XFX O;  2JT3 A;  4NQG A;  2WND A;  4AQJ A;  2SCP A;  1OMD A;  3KF9 A;  3FE6 A;  2M29 A;  1CMF A;  2BCX A;  3AKA A;  1SK6 D;  5J3X A;  1F8H A;  1OOJ A;  2GV5 A;  1LA0 A;  3PAL A;  3L47 A;  1OZO A;  3PAT A;  3I5H C;  1XFV O;  5FI2 A;  3S0G A;  1TRF A;  1QWV A;  3WXA A;  1H8B A;  1DEL A;  5I94 A;  3HX4 A;  1M46 A;  3BQ3 A;  1B47 A;  3B87 A;  2EC6 C;  4OR9 B;  3D74 A;  1AJ5 A;  4YGC B;  1JWD A;  3BUM B;  2K7D A;  1V1F A;  3EK7 A;  1WLM A;  2BEC A;  5CSJ A;  1TN4 A;  4XJK B;  1AP4 A;  3IQO A;  1XO5 A;  3BFA A;  4YGE B;  2Q91 A;  3TZ1 A;  1MWN A;  2KAX A;  1FW4 A;  1DF0 A;  1DJG A;  2PRU A;  2M49 B;  1LIN A;  2LUC A;  2K61 A;  4IJ7 A;  4WQ2 A;  2L0P A;  2HQ8 A;  1DJY A;  1NX0 A;  1SRA A;  4JPZ B;  1Q80 A;  1KK8 B;  3QME A;  1OOI X;  4YI9 A;  2JPT A;  4P2Y B;  1ALV A;  1FPW A;  3GK2 A;  3OP0 A;  4GGN A;  3AKB A;  3NSO A;  2JNF A;  4CLN A;  2JT8 A;  2NCO A;  2JRF A;  3NSI A;  4M2P A;  4OCI A;  2PYQ A;  3I5I B;  2BBN A;  2BCB A;  3O4X A;  2OS8 B;  3SIB A;  3S0A A;  1XFY O;  4WQ3 A;  4CFQ A;  3D75 A;  3BJH A;  2LLU A;  2KAY A;  1S5G Z;  1NPQ A;  3CZ1 A;  3FWC A;  3NHI A;  4A4C A;  3GOF A;  3A8R A;  1CKK A;  3DVK A;  3IQQ A;  3BFH A;  1YUS A;  2LMV A;  4MRY A;  4A4B A;  1ALW A;  1KQM C;  2KLD A;  2ISD A;  1XK4 C;  2OTG C;  2ZKM X;  4FQT A;  3TS5 B;  1OOG A;  2F2O A;  1CMG A;  1YUR A;  2DOQ A;  3D10 A;  3Q8I A;  1SR6 B;  3TDU A;  3M0W A;  1CM4 A;  1NSH A;  2BAP A;  3O4Y A;  4GUK A;  3O6B A;  1HT9 A;  1QV1 A;  3A4U B;  3O2P A;  1IJ6 A;  4I5J A;  2LVI A;  4I5L B;  1CB1 A;  1L7Z A;  1DGV A;  5ER5 A;  4DIR A;  2I2R E;  1YVH A;  2FOT A;  3AAJ A;  4F0Z B;  1G33 A;  4INX A;  1SW8 A;  3C1V A;  1JF2 A;  4DUQ A;  1WY9 A;  1AHR A;  1QAT A;  4GPL B;  3SS5 A;  1JF0 A;  1MXE A;  4PE7 A;  1J7P A;  4P5O E;  2BE4 A;  2P70 A;  4E68 A;  1B7T Z;  2QAC A;  2M9G A;  3B6X A;  4YGA A;  2KNE A;  1DC1 A;  3R1P A;  2JPO A;  1CFD A;  4USL A;  1W9Z A;  3VRP A;  1DJZ A;  1BJF A;  1AVS A;  2JU0 A;  2LHI A;  3WHU B;  2ZN8 A;  1Y1U A;  3DVJ A;  3OX5 A;  3PM2 A;  2K7B A;  4INW A;  1YTZ C;  1KFU L;  1B9A A;  2BL0 C;  1S3P A;  4YI8 A;  1D1O A;  1F4O A;  1DF0 B;  1SL9 A;  1UHI A;  2L2E A;  5TNC A;  1OSA A;  1QAS A;  1SMG A;  2FCD A;  1MR8 A;  2F33 A;  1B7T Y;  2AUC A;  2MJW B;  2QEH A;  2ZRS A;  3F45 A;  3HCM A;  2BBM A;  2PAL A;  3OX6 A;  1B8R A;  2K2A A;  2L5Y A;  1KWO B;  3I5G C;  2E6W A;  4PHJ A;  2PAS A;  2JC2 A;  2LLS A;  2OPO A;  2M8U A;  4PCW A;  3SG5 A;  2KDH A;  2LVK A;  3R1O A;  2K8M B;  5D69 A;  2LVV A;  1DGU A;  2JNX A;  2B1U A;  1EJ3 A;  2WCF A;  3FS7 A;  4OKH A;  1GJY A;  2L4H A;  1SNL A;  1B4C A;  2WCH A;  1WDC C;  4MZL A;  1OZS A;  4QJ3 B;  3LL8 B;  1A75 A;  5FI7 A;  4NDB A;  5KSZ A;  1OQP A;  1QXP A;  1UUR A;  1CDM A;  3VRQ A;  3I5F B;  1SSE B;  2JXC A;  3TS5 C;  3BFB A;  1NX2 A;  1PRW A;  1DEK A;  2CBL A;  2P6B B;  3BOW A;  2M7L A;  1GM0 A;  2LHL A;  3JVT B;  1CNP A;  1G4Y R;  3FE9 A;  5GQQ C;  1QX2 A;  1AK8 A;  2COL B;  5B8I B;  1GGW A;  2JQ6 A;  2CNP A;  3VRN A;  1XFZ O;  1OMR A;  4ORB B;  4L9M A;  1UHJ A;  4TNC A;  3S0B A;  1ORG A;  3DYE A;  2LNK A;  5D3O A;  1Z2C B;  1SL8 A;  1AUI B;  1LA3 A;  3BUX B;  4PE0 A;  3PN7 C;  2BKI B;  5HKZ A;  2CXJ A;  2WC6 A;  4MSP A;  4PHM A;  1YR5 A;  5CSN A;  4HRE E;  3B7A A;  1CTR A;  1SKT A;  2QEO A;  3PM8 A;  4MRX A;  3UNW A;  2ZND A;  1PAL A;  1CDP A;  1FI5 A;  3BYA A;  1PSR A;  3FE8 A;  2I94 A;  4GNK B;  4ORC B;  1BU3 A;  5DKR A;  2E30 A;  1U5I B;  3D0Y A;  1IH0 A;  1IQ5 A;  3S0D A;  4YGD B;  1SL7 A;  4DCK A;  4ICB A;  2GGM A;  4PDZ A;  1ZAC A;  5EL2 A;  1SBJ A;  4PHK A;  1L2O B;  1EG3 A;  3CLN A;  3R1V A;  4D1E A;  2CTN A;  3PFV A;  3KHE A;  3D76 A;  4OV2 A;  2Y4Q A;  3O78 A;  2SAS A;  3RLZ A;  5PAL A;  1PVA A;  1B1G A;  1FI6 A;  3LCP C;  4YGB B;  5FYX A;  2EHB A;  1IGV A;  2AMI A;  3SG4 A;  2KOT A;  3BXK A;  1S6I A;  1Y6W A;  1A2X A;  1DJW A;  2LVJ A;  3L4L A;  2KFG A;  2HET A;  4WRI A;  2CCM A;  3CR5 X;  1FBV A;  5HLV A;  4DRW A;  5HKW A;  2KLE A;  1C3Z A;  2JT0 A;  3DVM A;  5I2O A;  2A4J A;  1NX3 A;  1JC2 A;  1QVI Z;  2NZ0 A;  2YGU A;  3JTD B;  4IL1 A;  4U8D A;  5BPJ A;  2MRD A;  1MXL C;  3CWG A;  1M39 A;  1SYM A;  2MA2 A;  1IJ5 A;  1KSO A;  1QIW A;  1WRL A;  2H61 C;  1XYD A;  1RJV A;  4HRG A;  3EVR A;  1CLB A;  3I5F C;  2M97 A;  3OBV A;  1A75 B;  5I2L A;  1N0Y A;  1IIO A;  1IRJ A;  1BR4 B;  2KI6 C;  3EVU A;  1IWQ A;  4BY4 A;  3EG5 B;  2K0J A;  2HF5 A;  3NSK A;  1QVI Y;  1AJ4 A;  2Y5I A;  1UUS A;  2P71 A;  2ZRT A;  3CZ2 A;  1DJI A;  3NSL A;  1QLK A;  2O5G A;  1B8C A;  4GGF C;  2KI4 B;  3CR2 A;  4ETO A;  4N1G A;  3VRR A;  4HSZ A;  3OB1 B;  1KCY A;  5IBW A;  2WCL A;  1MF8 B;  1CLM A;  1TCO B;  3EK4 A;  1OOH A;  4M2O A;  3VRO A;  1J1D A;  4XYN A;  2L5X B;  1TTX A;  1LS8 A;  1NX1 A;  3ICB A;  1XK4 A;  2MBX A;  1F54 A;  1ZFS A;  2JXL A;  4DS7 A;  2WOS A;  1YUU A;  5CSI A;  1TUJ A;  2TN4 A;  2EGD A;  1K8U A;  3DY9 A;  4C0K A;  1DVI A;  1DJH A;  3B86 A;  2JZI A;  1YRU B;  2WC5 A;  5AFP A;  1SCV A;  1A29 A;  3GK4 X;  2LP3 A; 
#chains in the Genus database with same CATH homology
 2ERB A;  3B87 A;  2GTE A;  3D74 A;  3D73 A;  3R72 A;  4OZD A;  3NGV A;  3BFB A;  4F7F A;  3BFA A;  1GM0 A;  4JD9 A;  3FE9 A;  3B88 A;  5DIC A;  3S0B A;  3S0E A;  3QME A;  1OOI X;  1ORG A;  3DYE A;  3N7H A;  2QDI A;  2WC6 A;  2KPH A;  2QEO A;  3B7A A;  3OGN A;  2QEV A;  3S0A A;  3D77 A;  3FE8 A;  3D75 A;  3BJH A;  3S0F A;  3K1E A;  2QEB A;  3CZ1 A;  3NHI A;  3S0D A;  3BFH A;  5EL2 A;  1P28 A;  3CZ0 A;  3RZS A;  3R1V A;  3D76 A;  4FQT A;  1OOG A;  3Q8I A;  3VB1 A;  1XFR A;  1OW4 A;  1DQE A;  3L4L A;  1OOF A;  1C3Z A;  4INX A;  2L2C A;  2H8V A;  3CDN A;  3NHT A;  3CAB A;  2P70 A;  3B6X A;  1TWO A;  1T14 A;  2JPO A;  3R1P A;  1C3Y A;  2WCJ A;  3CYZ A;  2PQL A;  3V2L A;  2WCK A;  3DZT A;  4INW A;  3D78 A;  2FJY A;  3CZ2 A;  2P71 A;  2QEH A;  3DXL A;  2WCL A;  3PJI A;  1OOH A;  4PT1 A;  1LS8 A;  3R1O A;  3FE6 A;  1TUJ A;  3DY9 A;  3S0G A;  3L47 A;  1QWV A;  2WC5 A;  3B86 A;  2WCM A;  3L4A A;  2WCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...