3CZ2A

Dimeric crystal structure of a pheromone binding protein from apis mellifera at ph 7.0
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
118
structure length
118
Chain Sequence
PDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pheromone binding protein
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
total genus 38
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3cz2A00
2ERBA 3D74A 2QEVA 2WC5A 3S0EA 1QWVA 3D78A 2GTEA 3S0DA 1OOFA 2KPHA 3R1OA 3DY9A 3V2LA 1TUJA 2QEOA 1XFRA 3B6XA 2QDIA 3D73A 3BFHA 3BFBA 2L2CA 3RZSA 3Q8IA 4OZDA 4PT1A 3FE9A 3CZ1A 3K1EA 1GM0A 2QEBA 2P70A 2H8VA 3D77A 3B87A 3L47A 3CZ2A 4FQTA 1OW4A 2JPOA 1C3YA 5EL2A 1T14A 3L4LA 1OOIX 3DZTA 2QEHA 3NHIA 1OOHA 3VB1A 1DQEA 2WCMA 3CDNA 1OOGA 3R1VA 4F7FA 5DICA 3FE6A 3CYZA 2P71A 3DYEA 4INXA 2FJYA 3NGVA 1P28A 1TWOA 2PQLA 3B88A 3BJHA 3D76A 3BFAA 3DXLA 3D75A 3B86A 3CZ0A 4JD9A 3FE8A 3PJIA 2WCJA 1C3ZA 3OGNA 3QMEA 3S0GA 3NHTA 3L4AA 3CABA 3R1PA 4INWA 3N7HA 2WCKA 2WC6A 1ORGA 3S0AA 3B7AA 2WCLA 1LS8A 3S0BA 3S0FA 2WCHA 3R72A
chains in the Genus database with same CATH superfamily
2ERBA 3D74A 4N1FA 1MR8A 2Q4UA 2WC5A 3OP0A 3S0EA 3CR4X 1XFYO 1QWVA 1L7ZA 1V1GA 2M8UA 3O4XA 2FJUB 1Y6WA 2BE4A 4M2QA 3ZWHA 4P5OE 1FI6A 4YGCB 2F8PA 2NLNA 4GUKA 1XO5A 3TS5B 4E68A 1F54A 1SKTA 1BJFA 3AKAA 2PVBA 1B1GA 1JF0A 2B1UA 2HETA 4N5XA 4MZJA 2MJWB 3TS5C 1RWYA 1Y1AA 2KAVA 2LVJA 3LK0A 1DF0B 1S6JA 1B8LA 3FWCA 4CFQA 1AJ4A 1BODA 2NXQA 1G4YR 1GQMA 1XFRA 3HX4A 2O60A 1TCFA 2CBLA 4ETOA 1KK8B 2PSRA 1C7VA 2EGDA 3BFHA 4KYNA 1WLMA 4XJKB 1SY9A 3DVKA 2JQ6A 2BL0C 3F45A 2ZNEA 4OZDA 3ZNIA 1KQMB 4PT1A 1ODBA 1QLKA 1FF1A 1KK8C 1IKUA 1S6IA 2KFFA 1Y0VH 3WHUB 2DOQA 2QEBA 4TNCA 2P70A 1KQMC 2KBMA 3KEVA 4JWQA 3L47A 5CPVA 3WXAA 1OW4A 1XK4A 2MA2A 1Z4HA 1XFXO 1A2XA 2LANA 2Y5IA 3O6BA 5IBWA 4PDZA 1CLMA 2O5GA 1Y1UA 1DELA 2M9GA 2KGRA 3DVJA 4YGEB 3DF0A 3FIAA 5ER4X 4C0KA 3FWBA 1CDNA 2KAYA 4DIRA 3I5FB 5EL2A 1QS7A 1OZSA 2M7NA 1NX2A 1OOIX 2LVIA 3IF7A 2L5YA 2JXCA 1NCYA 3LK1A 4C0LA 1DEKA 3I5FC 4M2OA 1OOHA 3I5HB 1DJGA 2F33A 2BKIB 1MQ1A 1DQEA 1BF5A 1OOGA 2BECA 1DGVA 2LLTA 4GGFA 2M1KB 3OX5A 3OB2B 3OHMB 4MZKA 3TDIA 1HT9A 1N65A 1G8IA 4MRXA 3NGVA 2H61C 2LMTA 1YRTB 1EH2A 1IJ5A 1OSAA 2GGMA 1UHNA 2JRFA 1OMDA 1IQ5A 2JTZA 2AUCA 2KI4B 5I94A 3D76A 1TOPA 3BXKA 1ZMZA 3K21A 4XYNA 1YURA 2JT3A 1F55A 1SSEB 1QX7A 4HSZA 3B86A 3EKJA 4DRWA 2K7OA 4WQ3A 3CR2A 1CLBA 4JD9A 4AOMA 4AQIA 1KFXS 5DKNA 3TZ1A 2LMVA 1B8RA 1BG1A 1QVIZ 1AUIB 2SCPA 1DVIA 3FE8A 4P2YB 4PHMA 1Q80A 5BPJA 1DMOA 2LHIA 2HPSA 2KSPA 1NP8A 1MF8B 1A03A 1XFUO 3CABA 1LA0A 4YI9A 5KSZA 1GJYA 1SRAA 1XVJA 4CPVA 2JOJA 1J7RA 4HRHA 1YR5A 1AP4A 1RTP1 1F70A 1XFVO 1SL8A 2CXJA 2M29A 2WCKA 3HCMA 3KO0A 4PHJA 2KYCA 2K0JA 2LAPA 3PM8A 3CWGA 1TTXA 1S36A 5HKYA 1LKJA 1QVIY 3CR5X 2CT9A 4L9MA 4MEWA 3KHEA 2QPTA 4DUQA 3TUYB 2LM5A 1F8HA 2KBIA 1EJ3A 2WORA 1C07A 3OBVA 3D0YA 1CMGA 1YUTA 2F3YA 3JTDB 1QJTA 1IWQA 2I2RE 3TUYC 1B47A 4WQ2A 1IIOA 3BUWB 3GK2A 4PHKA 1BOCA 1K9KA 3PALA 3JTDC 1TNQA 1MUXA 1TNXA 2GTEA 2L2EA 1UWOA 2K7CA 2MLFC 1DGUA 2BKHB 3H4SE 2KPHA 3EG5B 1K94A 3O4YA 3CLNA 3PSRA 5AEQA 3R1OA 4QJ5B 1ZUZA 1DTLA 5I2OA 5KU1A 1D1OA 2LLSA 3B6XA 1NX3A 1S5GZ 1W7JB 2TN4A 5D3OA 2L0PA 5I2QA 4MN0A 1YRUB 3BFBA 1WY9A 2QACA 1H8BA 3DF0B 1M46A 1OE9B 3I5GB 3Q8IA 2HF5A 2LVVA 1YVLA 4CLNA 4CIDA 3GK4X 4WRIA 4YRUA 1TN4A 3K1EA 2WNDA 1SCMC 3NSLA 1CTRA 1RK9A 2LCPA 3EK8A 3I5GC 4MBEA 1K90D 2CTNA 1KWOC 1NCXA 2H8VA 3B87A 2L50A 2KQYA 2JPOA 1CFDA 1KSMA 2JT8A 1SR6B 1PULA 1S5GY 2WCBA 1R2UA 1XA5A 1SNLA 5JJGA 1MXEA 2H2KA 1SR6C 5HKZA 1C3YA 2PYQA 1LA3A 1KFXL 4GGFC 1ZFSA 5GQQC 1NCZA 1NYAA 1T14A 4IJ7A 1SL7A 1CB1A 2BL0B 5K89A 3EK4A 1OMRA 1NX1A 4PE7A 3DZTA 2ZN9A 4PCWA 4JQ0D 3NHIA 4YBHB 3MSEB 2LE9B 4C0JA 1QX5B 2JULA 4YI8A 1WRZA 3VB1A 1K9PA 4ZCVA 1A29A 4F7FA 3D10A 1YVHA 2Y1NA 5DICA 1CKKA 3CYZA 4DS7A 5KTYA 1DT7B 3DYEA 1JUOA 5JOLA 4A4BA 5I2LA 3IQQA 5ER5A 4BY5A 5AERA 3EVVA 1TWOA 1CNPA 5B8IB 3B88A 1CDPA 1KK7Z 1KFUL 1DJIA 1S3PA 5CSFA 2JT0A 3AAJA 2P6BB 2IS9A 3BJHA 1CFPA 3RM1A 3D75A 3PN7B 1DC1A 3CZ0A 1CM4A 3BQ3A 2KLEA 3CTNA 2KGBC 2ZFDA 2LP2A 3PN7C 4I5LB 2E6WA 5I8NA 3SS3A 2WCEA 3VGOA 4R1EA 2GV5A 2FCDA 3BOWA 1L2OC 3PLFB 1KK7Y 1RECA 4QJ4B 1U5IB 1B8CA 3R1PA 3LL8B 2KFGA 4OCIA 1WDCB 1UHJA 4MSPA 4NDDA 4FQOA 4INWA 1B7TZ 2HQ8A 4BY4A 1TCOB 1WDCC 3N7HA 1H4BA 2KFHA 3DD4A 2BAPA 1ORGA 2WC6A 1F4OA 3A8RA 5CSJA 3PM2A 3SJSA 1LINA 2WCLA 1J1EA 2KOTA 3S0BA 1EXRA 1LVCD 2I7AA 5AFPA 3C1VA 1J55A 1UHIA 1Y1XA 2MBXA 1S1EA 2M3WA 2JNFA 4OKHA 1OOJA 4GFTA 5HLOA 3PATA 1ZACA 1DF0A 2WC8A 1AJ5A 1B7TY 2AAOA 2LHLA 2OS8B 1IGVA 1TRFA 3CS1A 1M31A 2YGUA 4HREE 5HL1A 1AK8A 1IH0A 2FOTA 2L5XB 1OOFA 3EVUA 2OS8C 4XJKA 1TIZA 1PVBA 1PRWA 2KAXA 3WNXB 1NPQA 5TNCA 4PE1A 2NCPA 3GOFA 2LV7A 1HQVA 1X02A 4ORBB 1CM1A 4U8DA 1QV1A 3M0WA 3I5IC 3D73A 4NDBA 2F2PA 3RZSA 2JXLA 2JZIA 2ZKMX 3VRRA 1XYDA 2K7BA 4GNKB 4I5JA 1A75A 1YX8A 1KSOA 1RFJA 1JFJA 1UUSA 2M1UA 2KI6D 3FE9A 3NSOA 2K8MB 1G33A 1EL4A 1TNWA 2E30A 2NCOA 2R2IA 2JU0A 4GPLB 1XFWO 2D8NA 4F0ZB 1W7IB 1YUSA 2JC2A 2L98A 3D77A 3CZ2A 4FQTA 1OZOA 3TDUA 1K96A 3TDZA 5HYDA 1SMGA 1YX7A 1M39A 1M63B 2Q91A 2KYFA 2SASA 3BUXB 3BUNB 3LCPC 3EKHA 1AVSA 1FW4A 1NUBA 1SPYA 2NZ0A 1B9AA 3L4LA 1RROA 3DVMA 2QEHA 4PHNA 1DJXA 1PVAA 2Y1MA 1FPWA 1SCMB 2KLDA 1SW8A 3NSIA 2KQ6A 2I18A 1K2HA 1BMOA 1KWOB 2WCMA 2LLUA 3CDNA 3KF9A 3R1VA 1QASA 3VRPA 1SCVA 3FE6A 1SYMA 4ORAB 1A4PA 2LMUA 2MAZA 2P71A 1JFKA 1UHKA 1KQVA 1FBVA 2FJYA 1MXLC 2WCFA 1DJZA 2K61A 5FI6A 4YGBB 1R6PA 1J7QA 3CGAA 4MVFA 3UNWA 3EK7A 1NWDA 5PALA 3BOWB 3SG5A 5HLVA 1LXFC 1S6CA 1CDLA 2KI6C 3KPXA 1IRJA 2L51A 5CSIA 4GGNA 3VRNA 2AMIA 3DXLA 3AAKA 4JPZB 4PE4A 1JWDA 1SL9A 3JVTB 5AANA 1YUUA 2JPTA 4YGAA 1QIVA 3PJIA 1DJHA 2WCJA 1C3ZA 1V1FA 3JVTC 3QMEA 3WHTB 3NHTA 3CZTX 2K60A 4ORCB 3ICBA 3L4AA 2ZRSA 2LUXA 1GGWA 1CDMA 1OQPA 3GK1A 1PALA 5FI2A 5DKQA 2K2AA 1MHOA 2JTTA 1C7WA 4D1EA 1M45A 2L4IA 2M49B 1N0YA 2G2BA 1UHHA 3SG7A 3OB1B 3S0AA 3B7AA 5FI7A 2L4HA 2K7DA 3SG6A 1LS8A 2M0RA 3DVEA 5F6TA 1ZOTB 4ICBA 3S0FA 4PALA 2F2OA 2WCHA 1XFZO 1K95A 1UP5A 2BCAA 3NSKA 2BBNA 3R72A 2PALA 4MZLA 1OMVA 2EHBA 2QEVA 1F71A 2ISDA 1L2OB 3SS4A 1Z2CB 1VRKA 2VRGA 1BU3A 2CNPA 2GGZA 3D78A 3IQOA 4HRGA 1SK6D 3SIAA 1TNPA 1NIWA 2ZNDA 1A75B 5G08A 4UPGA 4GAOA 3S0DA 4MLWA 1J1DA 1N2DA 2M97A 3BUMB 3D0YB 2JNXA 4QJ3B 3BUOB 3O2PA 3DY9A 3V2LA 1GGZA 1TUJA 4ZCUA 2QEOA 1CLLA 2QDIA 1IG5A 1MWNA 3A4UB 3AKBA 4FTGA 1ALVA 2L2CA 2COLB 4CFRA 2M7LA 3FS7A 1EG4A 1K9UA 2OPOA 1QLSA 3CZ1A 1IQ3A 3SS5A 3O78A 4OR9B 1F4QA 1SBJA 4PE0A 4Q04A 1GM0A 3I5HC 2MLEC 1JC2A 2V53A 1DJWA 5D7FA 1QATA 4OV2A 2CCMA 1WRLA 1YTZC 5D69A 3SG2A 1NSHA 2BCBA 4IL1A 4A4CA 4I5NB 1WRKA 2PMYA 2LC5A 2ZRTA 1UURA 1IJ6A 1KCYA 1W9ZA 4N1GA 5FYXA 4DCKA 3I5IB 1NX0A 2OTGB 2WOSA 1CFFA 1BR4B 2KI4C 2LNKA 1AHRA 1DJYA 5DKRA 2Y4QA 2EC6B 3PFVA 3UO9A 2BE6A 2MHHA 2RGIA 3RLZA 2OTGC 3VROA 3SG4A 1EG3A 1B4CA 2EC6C 2BCXA 1QXPA 3BYAA 2KHNA 4AQJA 3QRXA 2F3ZA 2K2FA 4GBAA 4INXA 4I5KA 2KDHA 2JWWA 1P28A 2HQWA 2PQLA 2ZN8A 1QTXA 2G9BA 1JBAA 2LP3A 1RJVA 1J7OA 2LVKA 1JSAA 3E3RA 1PSRA 1KFUS 4YGDB 3BFAA 2A4JA 3IVTA 2H61A 1U5IA 1E8AA 3LLEA 1WLZA 5HKWA 3VRQA 4JKTA 1J7PA 2MRDA 3OX6A 4M2PA 1QV0A 1TUZA 3OGNA 3S0GA 4NQGA 2FCEA 1JF2A 3NXAA 1S26D 3SG3A 1ALWA 1K8UA 1PK0D 2BNXA 3EVRA 3SIBA 2BBMA 1QIWA 4USLA 5CSNA 5J3XA 4MRYA 1BR1B 1CFCA 1PSBA 4NDCA 2KNEA 2I94A 1CMFA 4OVNF 1FI5A 2LUCA 5AXIA 1BT6A 2PASA 1XK4C 1K93D 2PRUA 1BLQA 1QX2A
chains in the Genus database with same CATH topology
2ERBA 3D74A 2QEVA 2WC5A 3S0EA 1QWVA 3D78A 2GTEA 3S0DA 1OOFA 2KPHA 3R1OA 3DY9A 3V2LA 1TUJA 2QEOA 1XFRA 3B6XA 2QDIA 3D73A 3BFHA 3BFBA 2L2CA 3RZSA 3Q8IA 4OZDA 4PT1A 3FE9A 3CZ1A 3K1EA 1GM0A 2QEBA 2P70A 2H8VA 3D77A 3B87A 3L47A 3CZ2A 4FQTA 1OW4A 2JPOA 1C3YA 5EL2A 1T14A 3L4LA 1OOIX 3DZTA 2QEHA 3NHIA 1OOHA 3VB1A 1DQEA 2WCMA 3CDNA 1OOGA 3R1VA 4F7FA 5DICA 3FE6A 3CYZA 2P71A 3DYEA 4INXA 2FJYA 3NGVA 1P28A 1TWOA 2PQLA 3B88A 3BJHA 3D76A 3BFAA 3DXLA 3D75A 3B86A 3CZ0A 4JD9A 3FE8A 3PJIA 2WCJA 1C3ZA 3OGNA 3QMEA 3S0GA 3NHTA 3L4AA 3CABA 3R1PA 4INWA 3N7HA 2WCKA 2WC6A 1ORGA 3S0AA 3B7AA 2WCLA 1LS8A 3S0BA 3S0FA 2WCHA 3R72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERB A;  3D74 A;  2QEV A;  2WC5 A;  3S0E A;  1QWV A;  3D78 A;  2GTE A;  3S0D A;  1OOF A;  2KPH A;  3R1O A;  3DY9 A;  3V2L A;  1TUJ A;  2QEO A;  1XFR A;  3B6X A;  2QDI A;  3D73 A;  3BFH A;  3BFB A;  2L2C A;  3RZS A;  3Q8I A;  4OZD A;  4PT1 A;  3FE9 A;  3CZ1 A;  3K1E A;  1GM0 A;  2QEB A;  2P70 A;  2H8V A;  3D77 A;  3B87 A;  3L47 A;  3CZ2 A;  4FQT A;  1OW4 A;  2JPO A;  1C3Y A;  5EL2 A;  1T14 A;  3L4L A;  1OOI X;  3DZT A;  2QEH A;  3NHI A;  1OOH A;  3VB1 A;  1DQE A;  2WCM A;  3CDN A;  1OOG A;  3R1V A;  4F7F A;  5DIC A;  3FE6 A;  3CYZ A;  2P71 A;  3DYE A;  4INX A;  2FJY A;  3NGV A;  1P28 A;  1TWO A;  2PQL A;  3B88 A;  3BJH A;  3D76 A;  3BFA A;  3DXL A;  3D75 A;  3B86 A;  3CZ0 A;  4JD9 A;  3FE8 A;  3PJI A;  2WCJ A;  1C3Z A;  3OGN A;  3QME A;  3S0G A;  3NHT A;  3L4A A;  3CAB A;  3R1P A;  4INW A;  3N7H A;  2WCK A;  2WC6 A;  1ORG A;  3S0A A;  3B7A A;  2WCL A;  1LS8 A;  3S0B A;  3S0F A;  2WCH A;  3R72 A; 
#chains in the Genus database with same CATH topology
 2ERB A;  3D74 A;  4N1F A;  1MR8 A;  2Q4U A;  2WC5 A;  3OP0 A;  3S0E A;  3CR4 X;  1XFY O;  1QWV A;  1L7Z A;  1V1G A;  2M8U A;  3O4X A;  2FJU B;  1Y6W A;  2BE4 A;  4M2Q A;  3ZWH A;  4P5O E;  1FI6 A;  4YGC B;  2F8P A;  2NLN A;  4GUK A;  1XO5 A;  3TS5 B;  4E68 A;  1F54 A;  1SKT A;  1BJF A;  3AKA A;  2PVB A;  1B1G A;  1JF0 A;  2B1U A;  2HET A;  4N5X A;  4MZJ A;  2MJW B;  3TS5 C;  1RWY A;  1Y1A A;  2KAV A;  2LVJ A;  3LK0 A;  1DF0 B;  1S6J A;  1B8L A;  3FWC A;  4CFQ A;  1AJ4 A;  1BOD A;  2NXQ A;  1G4Y R;  1GQM A;  1XFR A;  3HX4 A;  2O60 A;  1TCF A;  2CBL A;  4ETO A;  1KK8 B;  2PSR A;  1C7V A;  2EGD A;  3BFH A;  4KYN A;  1WLM A;  4XJK B;  1SY9 A;  3DVK A;  2JQ6 A;  2BL0 C;  3F45 A;  2ZNE A;  4OZD A;  3ZNI A;  1KQM B;  4PT1 A;  1ODB A;  1QLK A;  1FF1 A;  1KK8 C;  1IKU A;  1S6I A;  2KFF A;  1Y0V H;  3WHU B;  2DOQ A;  2QEB A;  4TNC A;  2P70 A;  1KQM C;  2KBM A;  3KEV A;  4JWQ A;  3L47 A;  5CPV A;  3WXA A;  1OW4 A;  1XK4 A;  2MA2 A;  1Z4H A;  1XFX O;  1A2X A;  2LAN A;  2Y5I A;  3O6B A;  5IBW A;  4PDZ A;  1CLM A;  2O5G A;  1Y1U A;  1DEL A;  2M9G A;  2KGR A;  3DVJ A;  4YGE B;  3DF0 A;  3FIA A;  5ER4 X;  4C0K A;  3FWB A;  1CDN A;  2KAY A;  4DIR A;  3I5F B;  5EL2 A;  1QS7 A;  1OZS A;  2M7N A;  1NX2 A;  1OOI X;  2LVI A;  3IF7 A;  2L5Y A;  2JXC A;  1NCY A;  3LK1 A;  4C0L A;  1DEK A;  3I5F C;  4M2O A;  1OOH A;  3I5H B;  1DJG A;  2F33 A;  2BKI B;  1MQ1 A;  1DQE A;  1BF5 A;  1OOG A;  2BEC A;  1DGV A;  2LLT A;  4GGF A;  2M1K B;  3OX5 A;  3OB2 B;  3OHM B;  4MZK A;  3TDI A;  1HT9 A;  1N65 A;  1G8I A;  4MRX A;  3NGV A;  2H61 C;  2LMT A;  1YRT B;  1EH2 A;  1IJ5 A;  1OSA A;  2GGM A;  1UHN A;  2JRF A;  1OMD A;  1IQ5 A;  2JTZ A;  2AUC A;  2KI4 B;  5I94 A;  3D76 A;  1TOP A;  3BXK A;  1ZMZ A;  3K21 A;  4XYN A;  1YUR A;  2JT3 A;  1F55 A;  1SSE B;  1QX7 A;  4HSZ A;  3B86 A;  3EKJ A;  4DRW A;  2K7O A;  4WQ3 A;  3CR2 A;  1CLB A;  4JD9 A;  4AOM A;  4AQI A;  1KFX S;  5DKN A;  3TZ1 A;  2LMV A;  1B8R A;  1BG1 A;  1QVI Z;  1AUI B;  2SCP A;  1DVI A;  3FE8 A;  4P2Y B;  4PHM A;  1Q80 A;  5BPJ A;  1DMO A;  2LHI A;  2HPS A;  2KSP A;  1NP8 A;  1MF8 B;  1A03 A;  1XFU O;  3CAB A;  1LA0 A;  4YI9 A;  5KSZ A;  1GJY A;  1SRA A;  1XVJ A;  4CPV A;  2JOJ A;  1J7R A;  4HRH A;  1YR5 A;  1AP4 A;  1RTP 1;  1F70 A;  1XFV O;  1SL8 A;  2CXJ A;  2M29 A;  2WCK A;  3HCM A;  3KO0 A;  4PHJ A;  2KYC A;  2K0J A;  2LAP A;  3PM8 A;  3CWG A;  1TTX A;  1S36 A;  5HKY A;  1LKJ A;  1QVI Y;  3CR5 X;  2CT9 A;  4L9M A;  4MEW A;  3KHE A;  2QPT A;  4DUQ A;  3TUY B;  2LM5 A;  1F8H A;  2KBI A;  1EJ3 A;  2WOR A;  1C07 A;  3OBV A;  3D0Y A;  1CMG A;  1YUT A;  2F3Y A;  3JTD B;  1QJT A;  1IWQ A;  2I2R E;  3TUY C;  1B47 A;  4WQ2 A;  1IIO A;  3BUW B;  3GK2 A;  4PHK A;  1BOC A;  1K9K A;  3PAL A;  3JTD C;  1TNQ A;  1MUX A;  1TNX A;  2GTE A;  2L2E A;  1UWO A;  2K7C A;  2MLF C;  1DGU A;  2BKH B;  3H4S E;  2KPH A;  3EG5 B;  1K94 A;  3O4Y A;  3CLN A;  3PSR A;  5AEQ A;  3R1O A;  4QJ5 B;  1ZUZ A;  1DTL A;  5I2O A;  5KU1 A;  1D1O A;  2LLS A;  3B6X A;  1NX3 A;  1S5G Z;  1W7J B;  2TN4 A;  5D3O A;  2L0P A;  5I2Q A;  4MN0 A;  1YRU B;  3BFB A;  1WY9 A;  2QAC A;  1H8B A;  3DF0 B;  1M46 A;  1OE9 B;  3I5G B;  3Q8I A;  2HF5 A;  2LVV A;  1YVL A;  4CLN A;  4CID A;  3GK4 X;  4WRI A;  4YRU A;  1TN4 A;  3K1E A;  2WND A;  1SCM C;  3NSL A;  1CTR A;  1RK9 A;  2LCP A;  3EK8 A;  3I5G C;  4MBE A;  1K90 D;  2CTN A;  1KWO C;  1NCX A;  2H8V A;  3B87 A;  2L50 A;  2KQY A;  2JPO A;  1CFD A;  1KSM A;  2JT8 A;  1SR6 B;  1PUL A;  1S5G Y;  2WCB A;  1R2U A;  1XA5 A;  1SNL A;  5JJG A;  1MXE A;  2H2K A;  1SR6 C;  5HKZ A;  1C3Y A;  2PYQ A;  1LA3 A;  1KFX L;  4GGF C;  1ZFS A;  5GQQ C;  1NCZ A;  1NYA A;  1T14 A;  4IJ7 A;  1SL7 A;  1CB1 A;  2BL0 B;  5K89 A;  3EK4 A;  1OMR A;  1NX1 A;  4PE7 A;  3DZT A;  2ZN9 A;  4PCW A;  4JQ0 D;  3NHI A;  4YBH B;  3MSE B;  2LE9 B;  4C0J A;  1QX5 B;  2JUL A;  4YI8 A;  1WRZ A;  3VB1 A;  1K9P A;  4ZCV A;  1A29 A;  4F7F A;  3D10 A;  1YVH A;  2Y1N A;  5DIC A;  1CKK A;  3CYZ A;  4DS7 A;  5KTY A;  1DT7 B;  3DYE A;  1JUO A;  5JOL A;  4A4B A;  5I2L A;  3IQQ A;  5ER5 A;  4BY5 A;  5AER A;  3EVV A;  1TWO A;  1CNP A;  5B8I B;  3B88 A;  1CDP A;  1KK7 Z;  1KFU L;  1DJI A;  1S3P A;  5CSF A;  2JT0 A;  3AAJ A;  2P6B B;  2IS9 A;  3BJH A;  1CFP A;  3RM1 A;  3D75 A;  3PN7 B;  1DC1 A;  3CZ0 A;  1CM4 A;  3BQ3 A;  2KLE A;  3CTN A;  2KGB C;  2ZFD A;  2LP2 A;  3PN7 C;  4I5L B;  2E6W A;  5I8N A;  3SS3 A;  2WCE A;  3VGO A;  4R1E A;  2GV5 A;  2FCD A;  3BOW A;  1L2O C;  3PLF B;  1KK7 Y;  1REC A;  4QJ4 B;  1U5I B;  1B8C A;  3R1P A;  3LL8 B;  2KFG A;  4OCI A;  1WDC B;  1UHJ A;  4MSP A;  4NDD A;  4FQO A;  4INW A;  1B7T Z;  2HQ8 A;  4BY4 A;  1TCO B;  1WDC C;  3N7H A;  1H4B A;  2KFH A;  3DD4 A;  2BAP A;  1ORG A;  2WC6 A;  1F4O A;  3A8R A;  5CSJ A;  3PM2 A;  3SJS A;  1LIN A;  2WCL A;  1J1E A;  2KOT A;  3S0B A;  1EXR A;  1LVC D;  2I7A A;  5AFP A;  3C1V A;  1J55 A;  1UHI A;  1Y1X A;  2MBX A;  1S1E A;  2M3W A;  2JNF A;  4OKH A;  1OOJ A;  4GFT A;  5HLO A;  3PAT A;  1ZAC A;  1DF0 A;  2WC8 A;  1AJ5 A;  1B7T Y;  2AAO A;  2LHL A;  2OS8 B;  1IGV A;  1TRF A;  3CS1 A;  1M31 A;  2YGU A;  4HRE E;  5HL1 A;  1AK8 A;  1IH0 A;  2FOT A;  2L5X B;  1OOF A;  3EVU A;  2OS8 C;  4XJK A;  1TIZ A;  1PVB A;  1PRW A;  2KAX A;  3WNX B;  1NPQ A;  5TNC A;  4PE1 A;  2NCP A;  3GOF A;  2LV7 A;  1HQV A;  1X02 A;  4ORB B;  1CM1 A;  4U8D A;  1QV1 A;  3M0W A;  3I5I C;  3D73 A;  4NDB A;  2F2P A;  3RZS A;  2JXL A;  2JZI A;  2ZKM X;  3VRR A;  1XYD A;  2K7B A;  4GNK B;  4I5J A;  1A75 A;  1YX8 A;  1KSO A;  1RFJ A;  1JFJ A;  1UUS A;  2M1U A;  2KI6 D;  3FE9 A;  3NSO A;  2K8M B;  1G33 A;  1EL4 A;  1TNW A;  2E30 A;  2NCO A;  2R2I A;  2JU0 A;  4GPL B;  1XFW O;  2D8N A;  4F0Z B;  1W7I B;  1YUS A;  2JC2 A;  2L98 A;  3D77 A;  3CZ2 A;  4FQT A;  1OZO A;  3TDU A;  1K96 A;  3TDZ A;  5HYD A;  1SMG A;  1YX7 A;  1M39 A;  1M63 B;  2Q91 A;  2KYF A;  2SAS A;  3BUX B;  3BUN B;  3LCP C;  3EKH A;  1AVS A;  1FW4 A;  1NUB A;  1SPY A;  2NZ0 A;  1B9A A;  3L4L A;  1RRO A;  3DVM A;  2QEH A;  4PHN A;  1DJX A;  1PVA A;  2Y1M A;  1FPW A;  1SCM B;  2KLD A;  1SW8 A;  3NSI A;  2KQ6 A;  2I18 A;  1K2H A;  1BMO A;  1KWO B;  2WCM A;  2LLU A;  3CDN A;  3KF9 A;  3R1V A;  1QAS A;  3VRP A;  1SCV A;  3FE6 A;  1SYM A;  4ORA B;  1A4P A;  2LMU A;  2MAZ A;  2P71 A;  1JFK A;  1UHK A;  1KQV A;  1FBV A;  2FJY A;  1MXL C;  2WCF A;  1DJZ A;  2K61 A;  5FI6 A;  4YGB B;  1R6P A;  1J7Q A;  3CGA A;  4MVF A;  3UNW A;  3EK7 A;  1NWD A;  5PAL A;  3BOW B;  3SG5 A;  5HLV A;  1LXF C;  1S6C A;  1CDL A;  2KI6 C;  3KPX A;  1IRJ A;  2L51 A;  5CSI A;  4GGN A;  3VRN A;  2AMI A;  3DXL A;  3AAK A;  4JPZ B;  4PE4 A;  1JWD A;  1SL9 A;  3JVT B;  5AAN A;  1YUU A;  2JPT A;  4YGA A;  1QIV A;  3PJI A;  1DJH A;  2WCJ A;  1C3Z A;  1V1F A;  3JVT C;  3QME A;  3WHT B;  3NHT A;  3CZT X;  2K60 A;  4ORC B;  3ICB A;  3L4A A;  2ZRS A;  2LUX A;  1GGW A;  1CDM A;  1OQP A;  3GK1 A;  1PAL A;  5FI2 A;  5DKQ A;  2K2A A;  1MHO A;  2JTT A;  1C7W A;  4D1E A;  1M45 A;  2L4I A;  2M49 B;  1N0Y A;  2G2B A;  1UHH A;  3SG7 A;  3OB1 B;  3S0A A;  3B7A A;  5FI7 A;  2L4H A;  2K7D A;  3SG6 A;  1LS8 A;  2M0R A;  3DVE A;  5F6T A;  1ZOT B;  4ICB A;  3S0F A;  4PAL A;  2F2O A;  2WCH A;  1XFZ O;  1K95 A;  1UP5 A;  2BCA A;  3NSK A;  2BBN A;  3R72 A;  2PAL A;  4MZL A;  1OMV A;  2EHB A;  2QEV A;  1F71 A;  2ISD A;  1L2O B;  3SS4 A;  1Z2C B;  1VRK A;  2VRG A;  1BU3 A;  2CNP A;  2GGZ A;  3D78 A;  3IQO A;  4HRG A;  1SK6 D;  3SIA A;  1TNP A;  1NIW A;  2ZND A;  1A75 B;  5G08 A;  4UPG A;  4GAO A;  3S0D A;  4MLW A;  1J1D A;  1N2D A;  2M97 A;  3BUM B;  3D0Y B;  2JNX A;  4QJ3 B;  3BUO B;  3O2P A;  3DY9 A;  3V2L A;  1GGZ A;  1TUJ A;  4ZCU A;  2QEO A;  1CLL A;  2QDI A;  1IG5 A;  1MWN A;  3A4U B;  3AKB A;  4FTG A;  1ALV A;  2L2C A;  2COL B;  4CFR A;  2M7L A;  3FS7 A;  1EG4 A;  1K9U A;  2OPO A;  1QLS A;  3CZ1 A;  1IQ3 A;  3SS5 A;  3O78 A;  4OR9 B;  1F4Q A;  1SBJ A;  4PE0 A;  4Q04 A;  1GM0 A;  3I5H C;  2MLE C;  1JC2 A;  2V53 A;  1DJW A;  5D7F A;  1QAT A;  4OV2 A;  2CCM A;  1WRL A;  1YTZ C;  5D69 A;  3SG2 A;  1NSH A;  2BCB A;  4IL1 A;  4A4C A;  4I5N B;  1WRK A;  2PMY A;  2LC5 A;  2ZRT A;  1UUR A;  1IJ6 A;  1KCY A;  1W9Z A;  4N1G A;  5FYX A;  4DCK A;  3I5I B;  1NX0 A;  2OTG B;  2WOS A;  1CFF A;  1BR4 B;  2KI4 C;  2LNK A;  1AHR A;  1DJY A;  5DKR A;  2Y4Q A;  2EC6 B;  3PFV A;  3UO9 A;  2BE6 A;  2MHH A;  2RGI A;  3RLZ A;  2OTG C;  3VRO A;  3SG4 A;  1EG3 A;  1B4C A;  2EC6 C;  2BCX A;  1QXP A;  3BYA A;  2KHN A;  4AQJ A;  3QRX A;  2F3Z A;  2K2F A;  4GBA A;  4INX A;  4I5K A;  2KDH A;  2JWW A;  1P28 A;  2HQW A;  2PQL A;  2ZN8 A;  1QTX A;  2G9B A;  1JBA A;  2LP3 A;  1RJV A;  1J7O A;  2LVK A;  1JSA A;  3E3R A;  1PSR A;  1KFU S;  4YGD B;  3BFA A;  2A4J A;  3IVT A;  2H61 A;  1U5I A;  1E8A A;  3LLE A;  1WLZ A;  5HKW A;  3VRQ A;  4JKT A;  1J7P A;  2MRD A;  3OX6 A;  4M2P A;  1QV0 A;  1TUZ A;  3OGN A;  3S0G A;  4NQG A;  2FCE A;  1JF2 A;  3NXA A;  1S26 D;  3SG3 A;  1ALW A;  1K8U A;  1PK0 D;  2BNX A;  3EVR A;  3SIB A;  2BBM A;  1QIW A;  4USL A;  5CSN A;  5J3X A;  4MRY A;  1BR1 B;  1CFC A;  1PSB A;  4NDC A;  2KNE A;  2I94 A;  1CMF A;  4OVN F;  1FI5 A;  2LUC A;  5AXI A;  1BT6 A;  2PAS A;  1XK4 C;  1K93 D;  2PRU A;  1BLQ A;  1QX2 A; 
#chains in the Genus database with same CATH homology
 2ERB A;  3D74 A;  2QEV A;  2WC5 A;  3S0E A;  1QWV A;  3D78 A;  2GTE A;  3S0D A;  1OOF A;  2KPH A;  3R1O A;  3DY9 A;  3V2L A;  1TUJ A;  2QEO A;  1XFR A;  3B6X A;  2QDI A;  3D73 A;  3BFH A;  3BFB A;  2L2C A;  3RZS A;  3Q8I A;  4OZD A;  4PT1 A;  3FE9 A;  3CZ1 A;  3K1E A;  1GM0 A;  2QEB A;  2P70 A;  2H8V A;  3D77 A;  3B87 A;  3L47 A;  3CZ2 A;  4FQT A;  1OW4 A;  2JPO A;  1C3Y A;  5EL2 A;  1T14 A;  3L4L A;  1OOI X;  3DZT A;  2QEH A;  3NHI A;  1OOH A;  3VB1 A;  1DQE A;  2WCM A;  3CDN A;  1OOG A;  3R1V A;  4F7F A;  5DIC A;  3FE6 A;  3CYZ A;  2P71 A;  3DYE A;  4INX A;  2FJY A;  3NGV A;  1P28 A;  1TWO A;  2PQL A;  3B88 A;  3BJH A;  3D76 A;  3BFA A;  3DXL A;  3D75 A;  3B86 A;  3CZ0 A;  4JD9 A;  3FE8 A;  3PJI A;  2WCJ A;  1C3Z A;  3OGN A;  3QME A;  3S0G A;  3NHT A;  3L4A A;  3CAB A;  3R1P A;  4INW A;  3N7H A;  2WCK A;  2WC6 A;  1ORG A;  3S0A A;  3B7A A;  2WCL A;  1LS8 A;  3S0B A;  3S0F A;  2WCH A;  3R72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...