3CZ2A

Dimeric crystal structure of a pheromone binding protein from apis mellifera at ph 7.0
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
118
structure length
118
Chain Sequence
b'PDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 38
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3cz2A00
3FE6A 1LS8A 2L2CA 3D78A 1TWOA 3R1VA 4OZDA 3B86A 3R72A 1OW4A 3BFHA 3D75A 3R1PA 3CZ0A 3D73A 3NGVA 3N7HA 3B88A 1OOFA 4INXA 4JD9A 3S0DA 1C3ZA 3K1EA 1C3YA 2H8VA 2WC5A 5EL2A 2P70A 1QWVA 2WCHA 3BJHA 3DY9A 5DICA 2WC6A 2WCKA 3QMEA 2QEVA 3D76A 2ERBA 3NHTA 2PQLA 1OOHA 3VB1A 3RZSA 3DYEA 3D74A 1OOGA 3V2LA 3DZTA 3S0GA 3FE9A 3NHIA 3S0AA 3Q8IA 3CZ2A 2QEHA 3CZ1A 1GM0A 3PJIA 2QEOA 1T14A 3D77A 2P71A 2QDIA 2WCLA 4INWA 3L47A 3DXLA 2QEBA 1DQEA 1TUJA 3OGNA 2WCJA 1XFRA 4PT1A 3S0EA 1OOIX 3B7AA 1P28A 3FE8A 3B87A 3B6XA 2KPHA 2GTEA 3S0BA 3L4LA 3CYZA 3L4AA 4F7FA 3S0FA 3R1OA 1ORGA 3BFBA 2FJYA 3BFAA 2JPOA 2WCMA 4FQTA 3CDNA 3CABA
chains in the Genus database with same CATH superfamily
2JXCA 2KQYA 1V1FA 2COLB 1KWOC 3D78A 1YRUB 3AKBA 5ER5A 1YVHA 1CFPA 2KGRA 1M45A 5AEQA 3B86A 3E3RA 3TUYC 3JTDB 1GQMA 1KSMA 2LMTA 3CLNA 3FIAA 2BBMA 2ZN8A 3KO0A 1DJZA 2OTGB 5KTYA 1J7RA 1CTRA 2KFFA 3KF9A 1WLMA 3EVVA 1OZOA 3EVUA 1PRWA 2I18A 2MLEC 2L5XB 3JVTC 1EG4A 4PALA 2K61A 2LE9B 1NX2A 2LP3A 2B1UA 1NYAA 1SCMB 3IQOA 4C0JA 3SS3A 1SW8A 3CR2A 4GNKB 1AJ5A 2JPTA 2BKHB 2FCDA 1B8RA 1PSRA 2I7AA 2H8VA 2WOSA 3IVTA 3OX6A 4YGCB 5EL2A 5HKYA 1C3YA 4OKHA 2M7LA 3EG5B 4WQ2A 2V53A 4L9MA 4ETOA 2L98A 2WCHA 3FS7A 4AOMA 2ZKMX 2G9BA 1LINA 3BUOB 5G08A 1QLKA 1XA5A 2CT9A 1IIOA 1RWYA 3DY9A 3KPXA 1AJ4A 5DICA 1AUIB 1SKTA 3SG3A 3NSOA 5HYDA 2AUCA 1IRJA 2QEVA 1TOPA 3D76A 1L7ZA 2ERBA 2L2EA 1WRZA 2LLSA 2PQLA 4CPVA 1IQ5A 2LHLA 1TUZA 2MRDA 1KK7Z 3RZSA 2KI6D 1K9UA 1HT9A 2A4JA 3BUWB 3K21A 2FOTA 1TN4A 2NLNA 1B8CA 2JOJA 2P6BB 4ZCUA 2JQ6A 3V2LA 2BE6A 1KQMC 2JC2A 4MVFA 4I5JA 1CKKA 1S5GY 1A4PA 2QACA 1S6CA 2AAOA 3I5IC 4YI8A 1DJYA 2MBXA 1BODA 2JZIA 2KBMA 2GV5A 5DKRA 1ODBA 1SYMA 3PALA 5CSJA 2BKIB 1B7TY 2KLEA 1LKJA 1WRKA 1F71A 2M7NA 2MAZA 4XJKB 3VRRA 1WRLA 1WDCB 1UHHA 1BR1B 4PDZA 3SS4A 1DJWA 2QDIA 2WCLA 1DVIA 1H4BA 3AAKA 1B8LA 1IQ3A 2K2AA 1SL9A 1UHKA 4IL1A 2CTNA 4Q04A 3L47A 1CFCA 1XFXO 2R2IA 4ZCVA 1F70A 1Y1AA 1IG5A 2KGBC 1KK8C 2K8MB 3OB2B 2Y4QA 1ZFSA 2PALA 1QV1A 1A03A 1XYDA 2ZRSA 2LUCA 3TDIA 5HLVA 3LK0A 2NXQA 1S36A 2ZFDA 2KPHA 3OBVA 1BMOA 1Y6WA 4YGAA 3CYZA 5B8IB 1MQ1A 4OCIA 1ORGA 1S6IA 3A8RA 3VROA 3O4YA 2HPSA 1KFUS 1TNPA 5CSFA 2EC6C 2FJYA 2H61A 2KFHA 3BFAA 3BUXB 4AQIA 1OOJA 1CDMA 1RROA 2HQWA 1U5IA 2WCMA 3EKHA 3O4XA 4DS7A 2KAYA 1XO5A 2LNKA 1XFWO 3PN7C 1QV0A 1FI5A 3TDZA 5KU1A 4GGFA 2L2CA 3AKAA 2KOTA 4UPGA 1SY9A 2D8NA 1F4QA 2PASA 2LV7A 3BOWA 3D0YB 4PCWA 2OTGC 1W7JB 4OZDA 1DF0B 5DKQA 1X02A 1XK4A 2JNFA 3SIAA 1S5GZ 2WCBA 1XFYO 1QASA 2ZNDA 4QJ3B 1NIWA 1OW4A 2KLDA 2L0PA 3BFHA 1DJXA 3R1PA 3JTDC 4MN0A 2BECA 3C1VA 3O2PA 1DJHA 1B7TZ 1KK7Y 2LMVA 4CFRA 1CLMA 2K7BA 4A4CA 1FI6A 2MA2A 3B88A 1K9PA 1OOFA 2EHBA 3GOFA 5CSNA 1M46A 2KQ6A 4M2OA 3HCMA 1SCMC 4MSPA 3FWBA 1EH2A 4WQ3A 1OMVA 2SASA 1K9KA 2VRGA 1UWOA 5I2LA 3NXAA 2K60A 3BUNB 1PVAA 4NDBA 3NSIA 2M3WA 4U8DA 2JU0A 4PE1A 1FPWA 1QS7A 4BY4A 1ALVA 1B1GA 2LP2A 3HX4A 2Y1NA 1UURA 3SG4A 3CR4X 1CFFA 1BOCA 1JC2A 5I8NA 1RK9A 4YBHB 1LA3A 1G8IA 2KI4B 4QJ4B 2Y5IA 3NHTA 1OOHA 3IQQA 5PALA 2FJUB 2L5YA 1WLZA 4YGEB 1NX0A 3SS5A 2LVKA 4D1EA 1C07A 4HRGA 1F4OA 1TNQA 1OOGA 2Y1MA 2WCEA 4YRUA 3WHTB 1SBJA 1DELA 2F2PA 3DZTA 1CDNA 2NCOA 1M39A 1SPYA 4GAOA 2KBIA 2JT0A 3FE9A 4N5XA 1TNWA 1Q80A 1TTXA 1NPQA 1M31A 1N2DA 1UUSA 3EKJA 3EVRA 1YRTB 1NWDA 3CZ2A 3I5GB 3KEVA 3LCPC 1PVBA 3SG6A 1G33A 4M2QA 1GM0A 3PJIA 1C7WA 3BUMB 1CDLA 1J7QA 1A2XA 1R2UA 5BPJA 1MUXA 2BCAA 3NSLA 1F55A 1EJ3A 2P71A 1JSAA 3SIBA 2HF5A 3CR5X 1QIWA 5I2OA 3TZ1A 1RECA 1WDCC 1FBVA 2QEBA 2JWWA 1PALA 3A4UB 1W9ZA 1WY9A 1QX2A 4GUKA 1A29A 1MR8A 2WCJA 4DUQA 2WCFA 1W7IB 4I5LB 4JQ0D 3UNWA 1B9AA 1XFUO 3CDNA 3I5FB 2WORA 3B7AA 5D69A 1P28A 1DEKA 4MRYA 1AK8A 1QXPA 1PSBA 4P2YB 1TCOB 1SSEB 3DD4A 1GGZA 2GTEA 1NX3A 4DIRA 3VGOA 3S0FA 1C7VA 2M9GA 2O5GA 1NCXA 1JFJA 1YR5A 2DOQA 3CS1A 1KFXL 5IBWA 2MJWB 2OS8B 2JPOA 2PMYA 4C0KA 1NSHA 2F2OA 1JF0A 1TRFA 3CABA 4P5OE 1YTZC 4GBAA 2JT3A 5K89A 1A75A 4TNCA 1TIZA 1DF0A 1DMOA 3SG7A 3R1VA 1VRKA 1SRAA 3GK2A 3I5HC 5GQQC 1YUSA 1NCZA 5I2QA 1CMFA 2O60A 2KFGA 3DF0A 4JWQA 1ZACA 4PHKA 1SL7A 1CNPA 4CLNA 3BYAA 3D73A 2E30A 2BE4A 2LUXA 2OPOA 4PE0A 1XVJA 3RM1A 3VRQA 2JTTA 1S1EA 2ZN9A 2SCPA 1OQPA 3WHUB 4OR9B 4JD9A 1ZOTB 2IS9A 5AFPA 1C3ZA 3K1EA 3ZNIA 3O78A 2EGDA 4JKTA 4FTGA 2KSPA 3ZWHA 3I5HB 4C0LA 2Q91A 4KYNA 1K8UA 3LK1A 4USLA 5TNCA 1CB1A 1NX1A 1QTXA 1XFZO 3BJHA 1V1GA 2WC8A 2ZNEA 1XFVO 3GK1A 5FI6A 2WC6A 5HKZA 3GK4X 1DJGA 3QMEA 1MHOA 1OMRA 2K0JA 1YX7A 4FQOA 1OSAA 2LAPA 1NCYA 2KNEA 1B47A 1OE9B 1F54A 2AMIA 1SK6D 4I5NB 2KI4C 4ICBA 1K93D 4GGNA 3D74A 1QX5B 4YGBB 1BR4B 5FI7A 1IH0A 3PATA 1KCYA 1ZUZA 4ORAB 3EK7A 4MEWA 1H8BA 5AERA 1CM4A 2CXJA 1JUOA 1QIVA 5KSZA 1DGVA 4M2PA 2F33A 5FYXA 1J1DA 4CFQA 2CNPA 2NCPA 4CIDA 2M97A 2JRFA 4ORBB 3Q8IA 3KHEA 4OVNF 1Z2CB 1JFKA 2QEHA 1MWNA 4NDDA 2M0RA 5AANA 1QATA 1CFDA 4ORCB 1IWQA 3H4SE 3I5GC 1Y0VH 2ISDA 3D77A 1DGUA 1JBAA 1L2OB 1BJFA 1YUTA 1R6PA 2H2KA 1SCVA 3MSEB 1EL4A 1SMGA 1SNLA 3PLFB 3DXLA 1Z4HA 3PM2A 3M0WA 4PE4A 1QX7A 1XFRA 4MBEA 4NQGA 5F6TA 2MLFC 2JTZA 1M63B 2K2FA 2LHIA 3BOWB 3ICBA 4PT1A 3S0EA 4AQJA 2BAPA 1OOIX 1K96A 5I94A 1SR6B 3BXKA 5ER4X 4GPLB 3F45A 2I2RE 1TNXA 4I5KA 3B87A 3I5FC 3TS5B 4DCKA 1DC1A 3B6XA 2K7OA 2JXLA 3S0BA 4NDCA 3DVKA 3R1OA 1DTLA 4XJKA 1J7OA 2KAXA 1DT7B 1KFUL 3LL8B 1QVIZ 2K7CA 2KAVA 1FF1A 2ZRTA 1DJIA 1EXRA 1KWOB 1S26D 1Y1XA 2M1UA 2M29A 4FQTA 1NUBA 3TDUA 4QJ5B 3D10A 2BBNA 3FE6A 1IJ6A 1LS8A 2OS8C 3TUYB 2KYCA 2BNXA 1TWOA 2LC5A 3OP0A 1BT6A 4PE7A 5JJGA 3R72A 5HLOA 2LVIA 3JVTB 4IJ7A 1RTP1 2LVJA 1ALWA 1YURA 3BQ3A 2Q4UA 3CZ0A 1G4YR 2L4HA 3D75A 1CLLA 3EK4A 5D7FA 3PM8A 3NGVA 5AXIA 3N7HA 2K7DA 1AP4A 4XYNA 1FW4A 1SL8A 3RLZA 1RJVA 1K95A 1OMDA 3DVJA 4R1EA 3PFVA 4BY5A 4INXA 4MLWA 3CZTX 3S0DA 1YX8A 1AHRA 1Y1UA 4GFTA 4PHJA 1UHJA 1J7PA 2E6WA 3SG5A 5FI2A 2WC5A 1CLBA 3O6BA 2LCPA 3WNXB 2M8UA 2P70A 1QWVA 3D0YA 1GGWA 1QJTA 1QLSA 3SJSA 1E8AA 1BLQA 2PRUA 1K94A 1N65A 2LLUA 4PHMA 4PHNA 1TCFA 4MZJA 2BCXA 2M1KB 5CPVA 2G2BA 2WCKA 1LA0A 4A4BA 2KDHA 3OHMB 2F3YA 1UP5A 3VRPA 1S6JA 2LMUA 3FWCA 3VB1A 2BL0C 1IJ5A 5JOLA 2GGZA 3DYEA 3VRNA 3OX5A 2FCEA 1JF2A 2KI6C 2PSRA 1KQMB 3WXAA 1D1OA 1F8HA 4HRHA 2L50A 3I5IB 3PSRA 3DVMA 2CCMA 1K90D 4F0ZB 1YUUA 4YGDB 1PK0D 4JPZB 3S0GA 3EK8A 2GGMA 2LANA 1CDPA 2WNDA 3NHIA 3S0AA 4E68A 4MRXA 1LVCD 1UHNA 1GJYA 3UO9A 3CWGA 2LLTA 1KQVA 4N1GA 1CM1A 3DVEA 2KHNA 3CZ1A 2I94A 1J1EA 2PVBA 3AAJA 3QRXA 2QEOA 1T14A 4OV2A 2BL0B 1BG1A 3OB1B 1QVIY 4N1FA 1J55A 4INWA 1IGVA 5J3XA 4MZKA 1MF8B 1KSOA 4MZLA 2MHHA 1RFJA 1ZMZA 2HQ8A 2JULA 1CMGA 4HREE 1KK8B 1DQEA 1L2OC 1TUJA 2KYFA 1MXEA 1MXLC 2F8PA 2H61C 3CGAA 3OGNA 1NP8A 1YVLA 4HSZA 2M49B 2RGIA 5HL1A 4DRWA 2JT8A 1S3PA 1A75B 1LXFC 1PULA 2YGUA 2NZ0A 1HQVA 1IKUA 1UHIA 4WRIA 4GGFC 2F3ZA 5CSIA 1OZSA 3FE8A 2JNXA 3DF0B 2TN4A 1XK4C 1SR6C 1AVSA 3IF7A 3L4LA 2BCBA 4YI9A 3L4AA 5HKWA 2CBLA 4F7FA 2EC6B 3LLEA 2QPTA 2L51A 3TS5C 3SG2A 2L4IA 5D3OA 2HETA 1KFXS 3PN7B 3BFBA 5DKNA 1B4CA 1EG3A 1N0YA 1JWDA 1BU3A 3NSKA 1BF5A 3CTNA 2LM5A 1U5IB 2PYQA 1K2HA 2LVVA
chains in the Genus database with same CATH topology
3FE6A 1LS8A 2L2CA 3D78A 1TWOA 3R1VA 4OZDA 3B86A 3R72A 1OW4A 3BFHA 3D75A 3R1PA 3CZ0A 3D73A 3NGVA 3N7HA 3B88A 1OOFA 4INXA 4JD9A 3S0DA 1C3ZA 3K1EA 1C3YA 2H8VA 2WC5A 5EL2A 2P70A 1QWVA 2WCHA 3BJHA 3DY9A 5DICA 2WC6A 2WCKA 3QMEA 2QEVA 3D76A 2ERBA 3NHTA 2PQLA 1OOHA 3VB1A 3RZSA 3DYEA 3D74A 1OOGA 3V2LA 3DZTA 3S0GA 3FE9A 3NHIA 3S0AA 3Q8IA 3CZ2A 2QEHA 3CZ1A 1GM0A 3PJIA 2QEOA 1T14A 3D77A 2P71A 2QDIA 2WCLA 4INWA 3L47A 3DXLA 2QEBA 1DQEA 1TUJA 3OGNA 2WCJA 1XFRA 4PT1A 3S0EA 1OOIX 3B7AA 1P28A 3FE8A 3B87A 3B6XA 2KPHA 2GTEA 3S0BA 3L4LA 3CYZA 3L4AA 4F7FA 3S0FA 3R1OA 1ORGA 3BFBA 2FJYA 3BFAA 2JPOA 2WCMA 4FQTA 3CDNA 3CABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FE6 A;  1LS8 A;  2L2C A;  3D78 A;  1TWO A;  3R1V A;  4OZD A;  3B86 A;  3R72 A;  1OW4 A;  3BFH A;  3D75 A;  3R1P A;  3CZ0 A;  3D73 A;  3NGV A;  3N7H A;  3B88 A;  1OOF A;  4INX A;  4JD9 A;  3S0D A;  1C3Z A;  3K1E A;  1C3Y A;  2H8V A;  2WC5 A;  5EL2 A;  2P70 A;  1QWV A;  2WCH A;  3BJH A;  3DY9 A;  5DIC A;  2WC6 A;  2WCK A;  3QME A;  2QEV A;  3D76 A;  2ERB A;  3NHT A;  2PQL A;  1OOH A;  3VB1 A;  3RZS A;  3DYE A;  3D74 A;  1OOG A;  3V2L A;  3DZT A;  3S0G A;  3FE9 A;  3NHI A;  3S0A A;  3Q8I A;  3CZ2 A;  2QEH A;  3CZ1 A;  1GM0 A;  3PJI A;  2QEO A;  1T14 A;  3D77 A;  2P71 A;  2QDI A;  2WCL A;  4INW A;  3L47 A;  3DXL A;  2QEB A;  1DQE A;  1TUJ A;  3OGN A;  2WCJ A;  1XFR A;  4PT1 A;  3S0E A;  1OOI X;  3B7A A;  1P28 A;  3FE8 A;  3B87 A;  3B6X A;  2KPH A;  2GTE A;  3S0B A;  3L4L A;  3CYZ A;  3L4A A;  4F7F A;  3S0F A;  3R1O A;  1ORG A;  3BFB A;  2FJY A;  3BFA A;  2JPO A;  2WCM A;  4FQT A;  3CDN A;  3CAB A; 
#chains in the Genus database with same CATH topology
 2JXC A;  2KQY A;  1V1F A;  2COL B;  1KWO C;  3D78 A;  1YRU B;  3AKB A;  5ER5 A;  1YVH A;  1CFP A;  2KGR A;  1M45 A;  5AEQ A;  3B86 A;  3E3R A;  3TUY C;  3JTD B;  1GQM A;  1KSM A;  2LMT A;  3CLN A;  3FIA A;  2BBM A;  2ZN8 A;  3KO0 A;  1DJZ A;  2OTG B;  5KTY A;  1J7R A;  1CTR A;  2KFF A;  3KF9 A;  1WLM A;  3EVV A;  1OZO A;  3EVU A;  1PRW A;  2I18 A;  2MLE C;  2L5X B;  3JVT C;  1EG4 A;  4PAL A;  2K61 A;  2LE9 B;  1NX2 A;  2LP3 A;  2B1U A;  1NYA A;  1SCM B;  3IQO A;  4C0J A;  3SS3 A;  1SW8 A;  3CR2 A;  4GNK B;  1AJ5 A;  2JPT A;  2BKH B;  2FCD A;  1B8R A;  1PSR A;  2I7A A;  2H8V A;  2WOS A;  3IVT A;  3OX6 A;  4YGC B;  5EL2 A;  5HKY A;  1C3Y A;  4OKH A;  2M7L A;  3EG5 B;  4WQ2 A;  2V53 A;  4L9M A;  4ETO A;  2L98 A;  2WCH A;  3FS7 A;  4AOM A;  2ZKM X;  2G9B A;  1LIN A;  3BUO B;  5G08 A;  1QLK A;  1XA5 A;  2CT9 A;  1IIO A;  1RWY A;  3DY9 A;  3KPX A;  1AJ4 A;  5DIC A;  1AUI B;  1SKT A;  3SG3 A;  3NSO A;  5HYD A;  2AUC A;  1IRJ A;  2QEV A;  1TOP A;  3D76 A;  1L7Z A;  2ERB A;  2L2E A;  1WRZ A;  2LLS A;  2PQL A;  4CPV A;  1IQ5 A;  2LHL A;  1TUZ A;  2MRD A;  1KK7 Z;  3RZS A;  2KI6 D;  1K9U A;  1HT9 A;  2A4J A;  3BUW B;  3K21 A;  2FOT A;  1TN4 A;  2NLN A;  1B8C A;  2JOJ A;  2P6B B;  4ZCU A;  2JQ6 A;  3V2L A;  2BE6 A;  1KQM C;  2JC2 A;  4MVF A;  4I5J A;  1CKK A;  1S5G Y;  1A4P A;  2QAC A;  1S6C A;  2AAO A;  3I5I C;  4YI8 A;  1DJY A;  2MBX A;  1BOD A;  2JZI A;  2KBM A;  2GV5 A;  5DKR A;  1ODB A;  1SYM A;  3PAL A;  5CSJ A;  2BKI B;  1B7T Y;  2KLE A;  1LKJ A;  1WRK A;  1F71 A;  2M7N A;  2MAZ A;  4XJK B;  3VRR A;  1WRL A;  1WDC B;  1UHH A;  1BR1 B;  4PDZ A;  3SS4 A;  1DJW A;  2QDI A;  2WCL A;  1DVI A;  1H4B A;  3AAK A;  1B8L A;  1IQ3 A;  2K2A A;  1SL9 A;  1UHK A;  4IL1 A;  2CTN A;  4Q04 A;  3L47 A;  1CFC A;  1XFX O;  2R2I A;  4ZCV A;  1F70 A;  1Y1A A;  1IG5 A;  2KGB C;  1KK8 C;  2K8M B;  3OB2 B;  2Y4Q A;  1ZFS A;  2PAL A;  1QV1 A;  1A03 A;  1XYD A;  2ZRS A;  2LUC A;  3TDI A;  5HLV A;  3LK0 A;  2NXQ A;  1S36 A;  2ZFD A;  2KPH A;  3OBV A;  1BMO A;  1Y6W A;  4YGA A;  3CYZ A;  5B8I B;  1MQ1 A;  4OCI A;  1ORG A;  1S6I A;  3A8R A;  3VRO A;  3O4Y A;  2HPS A;  1KFU S;  1TNP A;  5CSF A;  2EC6 C;  2FJY A;  2H61 A;  2KFH A;  3BFA A;  3BUX B;  4AQI A;  1OOJ A;  1CDM A;  1RRO A;  2HQW A;  1U5I A;  2WCM A;  3EKH A;  3O4X A;  4DS7 A;  2KAY A;  1XO5 A;  2LNK A;  1XFW O;  3PN7 C;  1QV0 A;  1FI5 A;  3TDZ A;  5KU1 A;  4GGF A;  2L2C A;  3AKA A;  2KOT A;  4UPG A;  1SY9 A;  2D8N A;  1F4Q A;  2PAS A;  2LV7 A;  3BOW A;  3D0Y B;  4PCW A;  2OTG C;  1W7J B;  4OZD A;  1DF0 B;  5DKQ A;  1X02 A;  1XK4 A;  2JNF A;  3SIA A;  1S5G Z;  2WCB A;  1XFY O;  1QAS A;  2ZND A;  4QJ3 B;  1NIW A;  1OW4 A;  2KLD A;  2L0P A;  3BFH A;  1DJX A;  3R1P A;  3JTD C;  4MN0 A;  2BEC A;  3C1V A;  3O2P A;  1DJH A;  1B7T Z;  1KK7 Y;  2LMV A;  4CFR A;  1CLM A;  2K7B A;  4A4C A;  1FI6 A;  2MA2 A;  3B88 A;  1K9P A;  1OOF A;  2EHB A;  3GOF A;  5CSN A;  1M46 A;  2KQ6 A;  4M2O A;  3HCM A;  1SCM C;  4MSP A;  3FWB A;  1EH2 A;  4WQ3 A;  1OMV A;  2SAS A;  1K9K A;  2VRG A;  1UWO A;  5I2L A;  3NXA A;  2K60 A;  3BUN B;  1PVA A;  4NDB A;  3NSI A;  2M3W A;  4U8D A;  2JU0 A;  4PE1 A;  1FPW A;  1QS7 A;  4BY4 A;  1ALV A;  1B1G A;  2LP2 A;  3HX4 A;  2Y1N A;  1UUR A;  3SG4 A;  3CR4 X;  1CFF A;  1BOC A;  1JC2 A;  5I8N A;  1RK9 A;  4YBH B;  1LA3 A;  1G8I A;  2KI4 B;  4QJ4 B;  2Y5I A;  3NHT A;  1OOH A;  3IQQ A;  5PAL A;  2FJU B;  2L5Y A;  1WLZ A;  4YGE B;  1NX0 A;  3SS5 A;  2LVK A;  4D1E A;  1C07 A;  4HRG A;  1F4O A;  1TNQ A;  1OOG A;  2Y1M A;  2WCE A;  4YRU A;  3WHT B;  1SBJ A;  1DEL A;  2F2P A;  3DZT A;  1CDN A;  2NCO A;  1M39 A;  1SPY A;  4GAO A;  2KBI A;  2JT0 A;  3FE9 A;  4N5X A;  1TNW A;  1Q80 A;  1TTX A;  1NPQ A;  1M31 A;  1N2D A;  1UUS A;  3EKJ A;  3EVR A;  1YRT B;  1NWD A;  3CZ2 A;  3I5G B;  3KEV A;  3LCP C;  1PVB A;  3SG6 A;  1G33 A;  4M2Q A;  1GM0 A;  3PJI A;  1C7W A;  3BUM B;  1CDL A;  1J7Q A;  1A2X A;  1R2U A;  5BPJ A;  1MUX A;  2BCA A;  3NSL A;  1F55 A;  1EJ3 A;  2P71 A;  1JSA A;  3SIB A;  2HF5 A;  3CR5 X;  1QIW A;  5I2O A;  3TZ1 A;  1REC A;  1WDC C;  1FBV A;  2QEB A;  2JWW A;  1PAL A;  3A4U B;  1W9Z A;  1WY9 A;  1QX2 A;  4GUK A;  1A29 A;  1MR8 A;  2WCJ A;  4DUQ A;  2WCF A;  1W7I B;  4I5L B;  4JQ0 D;  3UNW A;  1B9A A;  1XFU O;  3CDN A;  3I5F B;  2WOR A;  3B7A A;  5D69 A;  1P28 A;  1DEK A;  4MRY A;  1AK8 A;  1QXP A;  1PSB A;  4P2Y B;  1TCO B;  1SSE B;  3DD4 A;  1GGZ A;  2GTE A;  1NX3 A;  4DIR A;  3VGO A;  3S0F A;  1C7V A;  2M9G A;  2O5G A;  1NCX A;  1JFJ A;  1YR5 A;  2DOQ A;  3CS1 A;  1KFX L;  5IBW A;  2MJW B;  2OS8 B;  2JPO A;  2PMY A;  4C0K A;  1NSH A;  2F2O A;  1JF0 A;  1TRF A;  3CAB A;  4P5O E;  1YTZ C;  4GBA A;  2JT3 A;  5K89 A;  1A75 A;  4TNC A;  1TIZ A;  1DF0 A;  1DMO A;  3SG7 A;  3R1V A;  1VRK A;  1SRA A;  3GK2 A;  3I5H C;  5GQQ C;  1YUS A;  1NCZ A;  5I2Q A;  1CMF A;  2O60 A;  2KFG A;  3DF0 A;  4JWQ A;  1ZAC A;  4PHK A;  1SL7 A;  1CNP A;  4CLN A;  3BYA A;  3D73 A;  2E30 A;  2BE4 A;  2LUX A;  2OPO A;  4PE0 A;  1XVJ A;  3RM1 A;  3VRQ A;  2JTT A;  1S1E A;  2ZN9 A;  2SCP A;  1OQP A;  3WHU B;  4OR9 B;  4JD9 A;  1ZOT B;  2IS9 A;  5AFP A;  1C3Z A;  3K1E A;  3ZNI A;  3O78 A;  2EGD A;  4JKT A;  4FTG A;  2KSP A;  3ZWH A;  3I5H B;  4C0L A;  2Q91 A;  4KYN A;  1K8U A;  3LK1 A;  4USL A;  5TNC A;  1CB1 A;  1NX1 A;  1QTX A;  1XFZ O;  3BJH A;  1V1G A;  2WC8 A;  2ZNE A;  1XFV O;  3GK1 A;  5FI6 A;  2WC6 A;  5HKZ A;  3GK4 X;  1DJG A;  3QME A;  1MHO A;  1OMR A;  2K0J A;  1YX7 A;  4FQO A;  1OSA A;  2LAP A;  1NCY A;  2KNE A;  1B47 A;  1OE9 B;  1F54 A;  2AMI A;  1SK6 D;  4I5N B;  2KI4 C;  4ICB A;  1K93 D;  4GGN A;  3D74 A;  1QX5 B;  4YGB B;  1BR4 B;  5FI7 A;  1IH0 A;  3PAT A;  1KCY A;  1ZUZ A;  4ORA B;  3EK7 A;  4MEW A;  1H8B A;  5AER A;  1CM4 A;  2CXJ A;  1JUO A;  1QIV A;  5KSZ A;  1DGV A;  4M2P A;  2F33 A;  5FYX A;  1J1D A;  4CFQ A;  2CNP A;  2NCP A;  4CID A;  2M97 A;  2JRF A;  4ORB B;  3Q8I A;  3KHE A;  4OVN F;  1Z2C B;  1JFK A;  2QEH A;  1MWN A;  4NDD A;  2M0R A;  5AAN A;  1QAT A;  1CFD A;  4ORC B;  1IWQ A;  3H4S E;  3I5G C;  1Y0V H;  2ISD A;  3D77 A;  1DGU A;  1JBA A;  1L2O B;  1BJF A;  1YUT A;  1R6P A;  2H2K A;  1SCV A;  3MSE B;  1EL4 A;  1SMG A;  1SNL A;  3PLF B;  3DXL A;  1Z4H A;  3PM2 A;  3M0W A;  4PE4 A;  1QX7 A;  1XFR A;  4MBE A;  4NQG A;  5F6T A;  2MLF C;  2JTZ A;  1M63 B;  2K2F A;  2LHI A;  3BOW B;  3ICB A;  4PT1 A;  3S0E A;  4AQJ A;  2BAP A;  1OOI X;  1K96 A;  5I94 A;  1SR6 B;  3BXK A;  5ER4 X;  4GPL B;  3F45 A;  2I2R E;  1TNX A;  4I5K A;  3B87 A;  3I5F C;  3TS5 B;  4DCK A;  1DC1 A;  3B6X A;  2K7O A;  2JXL A;  3S0B A;  4NDC A;  3DVK A;  3R1O A;  1DTL A;  4XJK A;  1J7O A;  2KAX A;  1DT7 B;  1KFU L;  3LL8 B;  1QVI Z;  2K7C A;  2KAV A;  1FF1 A;  2ZRT A;  1DJI A;  1EXR A;  1KWO B;  1S26 D;  1Y1X A;  2M1U A;  2M29 A;  4FQT A;  1NUB A;  3TDU A;  4QJ5 B;  3D10 A;  2BBN A;  3FE6 A;  1IJ6 A;  1LS8 A;  2OS8 C;  3TUY B;  2KYC A;  2BNX A;  1TWO A;  2LC5 A;  3OP0 A;  1BT6 A;  4PE7 A;  5JJG A;  3R72 A;  5HLO A;  2LVI A;  3JVT B;  4IJ7 A;  1RTP 1;  2LVJ A;  1ALW A;  1YUR A;  3BQ3 A;  2Q4U A;  3CZ0 A;  1G4Y R;  2L4H A;  3D75 A;  1CLL A;  3EK4 A;  5D7F A;  3PM8 A;  3NGV A;  5AXI A;  3N7H A;  2K7D A;  1AP4 A;  4XYN A;  1FW4 A;  1SL8 A;  3RLZ A;  1RJV A;  1K95 A;  1OMD A;  3DVJ A;  4R1E A;  3PFV A;  4BY5 A;  4INX A;  4MLW A;  3CZT X;  3S0D A;  1YX8 A;  1AHR A;  1Y1U A;  4GFT A;  4PHJ A;  1UHJ A;  1J7P A;  2E6W A;  3SG5 A;  5FI2 A;  2WC5 A;  1CLB A;  3O6B A;  2LCP A;  3WNX B;  2M8U A;  2P70 A;  1QWV A;  3D0Y A;  1GGW A;  1QJT A;  1QLS A;  3SJS A;  1E8A A;  1BLQ A;  2PRU A;  1K94 A;  1N65 A;  2LLU A;  4PHM A;  4PHN A;  1TCF A;  4MZJ A;  2BCX A;  2M1K B;  5CPV A;  2G2B A;  2WCK A;  1LA0 A;  4A4B A;  2KDH A;  3OHM B;  2F3Y A;  1UP5 A;  3VRP A;  1S6J A;  2LMU A;  3FWC A;  3VB1 A;  2BL0 C;  1IJ5 A;  5JOL A;  2GGZ A;  3DYE A;  3VRN A;  3OX5 A;  2FCE A;  1JF2 A;  2KI6 C;  2PSR A;  1KQM B;  3WXA A;  1D1O A;  1F8H A;  4HRH A;  2L50 A;  3I5I B;  3PSR A;  3DVM A;  2CCM A;  1K90 D;  4F0Z B;  1YUU A;  4YGD B;  1PK0 D;  4JPZ B;  3S0G A;  3EK8 A;  2GGM A;  2LAN A;  1CDP A;  2WND A;  3NHI A;  3S0A A;  4E68 A;  4MRX A;  1LVC D;  1UHN A;  1GJY A;  3UO9 A;  3CWG A;  2LLT A;  1KQV A;  4N1G A;  1CM1 A;  3DVE A;  2KHN A;  3CZ1 A;  2I94 A;  1J1E A;  2PVB A;  3AAJ A;  3QRX A;  2QEO A;  1T14 A;  4OV2 A;  2BL0 B;  1BG1 A;  3OB1 B;  1QVI Y;  4N1F A;  1J55 A;  4INW A;  1IGV A;  5J3X A;  4MZK A;  1MF8 B;  1KSO A;  4MZL A;  2MHH A;  1RFJ A;  1ZMZ A;  2HQ8 A;  2JUL A;  1CMG A;  4HRE E;  1KK8 B;  1DQE A;  1L2O C;  1TUJ A;  2KYF A;  1MXE A;  1MXL C;  2F8P A;  2H61 C;  3CGA A;  3OGN A;  1NP8 A;  1YVL A;  4HSZ A;  2M49 B;  2RGI A;  5HL1 A;  4DRW A;  2JT8 A;  1S3P A;  1A75 B;  1LXF C;  1PUL A;  2YGU A;  2NZ0 A;  1HQV A;  1IKU A;  1UHI A;  4WRI A;  4GGF C;  2F3Z A;  5CSI A;  1OZS A;  3FE8 A;  2JNX A;  3DF0 B;  2TN4 A;  1XK4 C;  1SR6 C;  1AVS A;  3IF7 A;  3L4L A;  2BCB A;  4YI9 A;  3L4A A;  5HKW A;  2CBL A;  4F7F A;  2EC6 B;  3LLE A;  2QPT A;  2L51 A;  3TS5 C;  3SG2 A;  2L4I A;  5D3O A;  2HET A;  1KFX S;  3PN7 B;  3BFB A;  5DKN A;  1B4C A;  1EG3 A;  1N0Y A;  1JWD A;  1BU3 A;  3NSK A;  1BF5 A;  3CTN A;  2LM5 A;  1U5I B;  2PYQ A;  1K2H A;  2LVV A; 
#chains in the Genus database with same CATH homology
 3FE6 A;  1LS8 A;  2L2C A;  3D78 A;  1TWO A;  3R1V A;  4OZD A;  3B86 A;  3R72 A;  1OW4 A;  3BFH A;  3D75 A;  3R1P A;  3CZ0 A;  3D73 A;  3NGV A;  3N7H A;  3B88 A;  1OOF A;  4INX A;  4JD9 A;  3S0D A;  1C3Z A;  3K1E A;  1C3Y A;  2H8V A;  2WC5 A;  5EL2 A;  2P70 A;  1QWV A;  2WCH A;  3BJH A;  3DY9 A;  5DIC A;  2WC6 A;  2WCK A;  3QME A;  2QEV A;  3D76 A;  2ERB A;  3NHT A;  2PQL A;  1OOH A;  3VB1 A;  3RZS A;  3DYE A;  3D74 A;  1OOG A;  3V2L A;  3DZT A;  3S0G A;  3FE9 A;  3NHI A;  3S0A A;  3Q8I A;  3CZ2 A;  2QEH A;  3CZ1 A;  1GM0 A;  3PJI A;  2QEO A;  1T14 A;  3D77 A;  2P71 A;  2QDI A;  2WCL A;  4INW A;  3L47 A;  3DXL A;  2QEB A;  1DQE A;  1TUJ A;  3OGN A;  2WCJ A;  1XFR A;  4PT1 A;  3S0E A;  1OOI X;  3B7A A;  1P28 A;  3FE8 A;  3B87 A;  3B6X A;  2KPH A;  2GTE A;  3S0B A;  3L4L A;  3CYZ A;  3L4A A;  4F7F A;  3S0F A;  3R1O A;  1ORG A;  3BFB A;  2FJY A;  3BFA A;  2JPO A;  2WCM A;  4FQT A;  3CDN A;  3CAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...