3ICBA

The refined structure of vitamin d-dependent calcium-binding protein from bovine intestine. molecular details, ion binding, and implications for the structure of other calcium-binding proteins
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALCIUM-BINDING PROTEIN
publication title The refined structure of vitamin D-dependent calcium-binding protein from bovine intestine. Molecular details, ion binding, and implications for the structure of other calcium-binding proteins.
pubmed rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 18
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1986-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3icbA00
5CSNA 3WHUB 1UP5A 2LHLA 3EKHA 2LC5A 3I5HC 2LANA 1TIZA 4A4BA 4DIRA 3IF7A 1FI5A 2LMVA 3VRRA 4YGDB 2BECA 1BR1B 1AJ4A 2L5XB 1BODA 3FS7A 2M1UA 1A75A 2KAYA 2E6WA 4QJ5B 2AAOA 1XFWO 1YX7A 1A4PA 1SY9A 5KTYA 3SIAA 3JTDB 4OKHA 3TS5C 3I5FC 1SRAA 4MLWA 1AK8A 1CB1A 3OB1B 1CM1A 2IS9A 4PE4A 4FTGA 1KWOC 1K9UA 2WCFA 1S5GY 2B1UA 4I5KA 4MZKA 4PALA 2LVVA 4N1GA 3PLFB 2PVBA 3EVUA 4XJKA 3TDIA 1CDLA 3HCMA 3LK0A 5CSIA 4QJ3B 2KI4C 4PDZA 2BE4A 3LK1A 1Y1AA 4CFQA 2JT3A 1C7VA 5HKWA 1QX5B 3DVMA 4GBAA 1S6IA 2Y1NA 1KSOA 3EKJA 1AP4A 4ETOA 1S36A 2MLFC 1QASA 2SCPA 4N5XA 1KSMA 1QLSA 3LLEA 2LUXA 2AMIA 1DJIA 1XK4A 4M2OA 1QIWA 1IRJA 2QACA 5AXIA 1NCXA 2M0RA 1LA0A 1DJYA 5HYDA 2KFFA 1CKKA 1BR4B 1IWQA 1RTP1 3QRXA 1YRUB 1TN4A 3WXAA 4P2YB 2PRUA 3D0YA 4DCKA 1OZOA 1B8LA 3SIBA 1NCYA 1ZFSA 2F3ZA 1XK4C 4FQOA 1MXLC 1SNLA 1J1EA 3NSLA 2KQ6A 5G08A 3ZNIA 2K7DA 2MJWB 1F55A 4ORCB 2M49B 1QXPA 3JVTC 3EK4A 3O4YA 2KI6D 2L50A 1OE9B 3PN7B 1QIVA 1K90D 4HSZA 3NXAA 1RFJA 3TUYB 4BY5A 1DTLA 1PSRA 3DF0B 1S3PA 1SL7A 1B9AA 2O5GA 2HETA 2LM5A 2EC6C 4JWQA 1F8HA 1XO5A 1CM4A 1RECA 1S6CA 5HKYA 1NUBA 1IKUA 4MZLA 2GGMA 1ODBA 2Y5IA 2LCPA 1N0YA 2JWWA 1JUOA 2KFHA 2ZNEA 3VGOA 1CMFA 1SCMB 1TNXA 1B7TY 2LP2A 1EXRA 1X02A 3ICBA 4ORAB 1V1GA 5HLOA 2OS8C 2AUCA 1EG3A 1JBAA 1QVIZ 3MSEB 4I5NB 2BBNA 3PALA 1WDCC 3TZ1A 2JPTA 1CFDA 2BCXA 2JOJA 4GGFA 1MR8A 1BOCA 4JPZB 2KYFA 1KK8C 2L4HA 1YURA 1FBVA 2ZNDA 1S6JA 2K61A 1F4QA 5CPVA 4TNCA 2LV7A 1DJHA 3CZTX 4JQ0D 4M2QA 4ICBA 1CTRA 1CLMA 1NX2A 1GJYA 1B4CA 2PSRA 4E68A 3BUXB 3WHTB 4YBHB 3BOWA 2WCEA 2KFGA 1HQVA 1QV1A 4WQ2A 5AANA 2NXQA 4GGFC 4AOMA 3I5IC 3BQ3A 2CBLA 3IQOA 4PE0A 1WRLA 4MRXA 2M1KB 1G33A 3SG3A 2M7LA 1ZMZA 1A03A 1UHJA 1A29A 2BL0C 2L0PA 1AHRA 3LCPC 3I5HB 1BMOA 2LHIA 2WNDA 2HF5A 2MRDA 1R6PA 2L98A 1LVCD 5J3XA 3GK2A 4GAOA 2KOTA 4OV2A 4PE1A 1CDNA 1IG5A 2ISDA 3CR4X 3HX4A 1W7JB 4QJ4B 3DD4A 5B8IB 1UHIA 2LVKA 1VRKA 1NYAA 1FI6A 2HQWA 4GPLB 3CGAA 3I5GC 4MN0A 5I2OA 1KK7Y 4CLNA 1DMOA 1XFYO 5ER4X 4MRYA 1UHKA 2H61A 1PK0D 2I18A 2KNEA 2ZN8A 3D10A 1JSAA 1NCZA 2I2RE 1K94A 4BY4A 1LINA 4MVFA 1FPWA 1FF1A 1OZSA 1DJXA 1PULA 3KHEA 5PALA 1WY9A 2JNFA 4GUKA 1D1OA 1UUSA 2K8MB 3FWBA 5AEQA 2LNKA 2GGZA 2G2BA 1G8IA 2ZRTA 1SR6B 1JC2A 2OPOA 1TCOB 4MZJA 1SCVA 4MSPA 1BT6A 4PHKA 2H61C 2KBIA 1ALWA 1K8UA 3CWGA 1V1FA 2F3YA 4U8DA 3JTDC 2O60A 4YI8A 1TNQA 2KHNA 5JOLA 1OSAA 3BUNB 1KQMB 2JTZA 3O6BA 2CTNA 3KO0A 1OMVA 2F8PA 2SASA 1L2OB 1OOJA 1A2XA 1B8CA 1YR5A 3PM8A 1J7QA 4OR9B 2KGBC 1UHNA 1M63B 1KCYA 3KPXA 2CT9A 2ZFDA 2LAPA 1CFPA 1M45A 1UHHA 3EVVA 1BF5A 3OB2B 1B47A 3BUWB 5DKRA 1K93D 3AAJA 5DKQA 1OQPA 1TTXA 4AQJA 3F45A 1WRZA 1NX0A 1NX3A 3A8RA 4GGNA 4WRIA 1BLQA 2K7BA 2F33A 5I2QA 1AJ5A 1YX8A 1TNPA 1IJ6A 3SG5A 5K89A 1IGVA 1CFFA 2JC2A 1DF0B 1TNWA 2OTGB 2BE6A 3K21A 2K2AA 1YTZC 3EVRA 3TDUA 5AERA 3NSKA 2V53A 2LLUA 1J7RA 2JXLA 1H4BA 2MA2A 5CSFA 2MHHA 2LP3A 1NPQA 1GQMA 1PRWA 1R2UA 2M97A 1XYDA 1TCFA 3NSOA 1QV0A 4HRGA 1IH0A 3DF0A 2M8UA 3GOFA 1F4OA 1KFXL 2CXJA 1ZUZA 3RLZA 1TRFA 2TN4A 2PMYA 1FW4A 1DJWA 1U5IB 5KSZA 1SMGA 1DJGA 2JQ6A 1F70A 1CDMA 2BKIB 4C0LA 1JWDA 2Y1MA 3H4SE 3KEVA 4F0ZB 1B8RA 1ALVA 2LE9B 4R1EA 2Q4UA 5BPJA 3TUYC 2G9BA 1B7TZ 1PVAA 2LVIA 3AKBA 1K95A 1QX7A 1NP8A 4PHJA 1NWDA 3VRQA 2LUCA 3OX6A 4GNKB 3SG2A 3DVJA 1QX2A 1Y0VH 3VROA 1PALA 3ZWHA 2EGDA 4DUQA 2FOTA 2HQ8A 1MWNA 2KDHA 3BUMB 4NDDA 2FJUB 2NZ0A 4DRWA 1IJ5A 2RGIA 3KF9A 1XFXO 5GQQC 4HREE 4CPVA 1QLKA 1CLLA 1RK9A 4HRHA 1NSHA 1F54A 1Y1UA 4YGEB 1JF2A 3CTNA 1CFCA 2P6BB 3WNXB 2MBXA 1QJTA 2BCBA 4PE7A 3FIAA 2JT0A 3E3RA 2WC8A 1EG4A 2WCBA 3SG6A 3NSIA 2ZN9A 5F6TA 1NIWA 1E8AA 3GK1A 5ER5A 5I2LA 1SBJA 2E30A 2PASA 1UWOA 1JFJA 2L51A 1K2HA 4NQGA 1MXEA 1J7OA 1H8BA 2GV5A 2WORA 1N65A 1KFUL 2M9GA 3O78A 1J7PA 2FCEA 1RROA 3SG7A 2M7NA 1Y6WA 2LVJA 3A4UB 3TS5B 3CLNA 2LMUA 2JULA 3I5FB 4N1FA 4USLA 1SKTA 4YGBB 1CMGA 1KWOB 2A4JA 1ZOTB 1TOPA 1YUTA 1K9PA 1RJVA 3BYAA 2QPTA 2KQYA 4M2PA 4YGAA 2KYCA 1QS7A 1S5GZ 1A75B 2KI4B 1DJZA 1SYMA 2BBMA 4Q04A 2BKHB 1KFXS 2JT8A 3OX5A 4ORBB 2KI6C 2BCAA 1J55A 1L7ZA 1XFUO 4IL1A 1B1GA 1S26D 2KSPA 1IQ3A 2COLB 3PATA 1LKJA 1OMRA 3CS1A 2Q91A 1PVBA 2JXCA 1XFZO 2LMTA 4C0KA 2I7AA 4XJKB 4I5LB 3M0WA 1CDPA 1YVHA 2ZRSA 1YUUA 1SR6C 1W7IB 2KGRA 2MLEC 2LLTA 4MEWA 1BU3A 1GGWA 2R2IA 1YUSA 1KQVA 1M39A 1DVIA 2JNXA 4NDCA 2KBMA 1AVSA 2CCMA 3OHMB 1NX1A 2D8NA 2MAZA 1KQMC 3EK7A 5IBWA 1DGUA 5FYXA 1YRTB 1ZACA 1L2OC 3RM1A 1MF8B 1EJ3A 3JVTB 1K9KA 3C1VA 1DF0A 2M29A 1LXFC 1J1DA 1BJFA 4CIDA 5AFPA 3D0YB 1EL4A 3AAKA 1IQ5A 2EHBA 1Y1XA 2NCOA 2EC6B 3CR2A 2I94A 4DS7A 1CNPA 4AQIA 3FWCA 4YI9A 4ZCVA 2JU0A 5DKNA 1N2DA 1U5IA 3EK8A 4I5JA 4PHNA 5I8NA 2DOQA 3AKAA 1KFUS 1HT9A 2OTGC 2VRGA 2K2FA 5HKZA 1MQ1A 2K7CA 3DVKA 3PN7C 2Y4QA 1XA5A 1AUIB 2OS8B 3TDZA 4OCIA 1DGVA 1S1EA 1WDCB 1Q80A 2JTTA 1DT7B 1SL8A 1GGZA 2CNPA 2JZIA 2WOSA 3VRPA 1KK8B 1MHOA 5HLVA 4PHMA 1PSBA 3O2PA 3OP0A 4C0JA 4D1EA 2KAXA 1BG1A 3SJSA 1G4YR 1F71A 1C7WA 1JF0A 1UURA 1C07A 4A4CA 1JFKA 3GK4X 3CR5X 5D69A 1SCMC 5TNCA 1QVIY 1SPYA 1CLBA 1YVLA 3PFVA 4YRUA 1RWYA 3LL8B 1OMDA 1EH2A 2HPSA 3I5IB 2PALA 4XYNA 1SL9A 2ZKMX 1SK6D 2F2PA 2F2OA 3PSRA 1WLMA 4L9MA 4ZCUA 4UPGA 2L2EA 1SW8A 2K0JA 2LLSA 5JJGA 1QATA 2BL0B 2K7OA 4CFRA 4OVNF 3SG4A 1WLZA 2FCDA 4P5OE 4WQ3A 1MUXA 3BXKA 5CSJA 1QTXA 3DVEA 1LA3A 5D7FA 4GFTA 3BUOB 4YGCB 2M3WA 2NCPA 3BOWB 4MBEA 2JRFA 4NDBA 2H2KA 1M46A 3IQQA 2L4IA 1K96A 3I5GB 5KU1A 4PCWA 1XVJA 3VRNA 1WRKA 2KAVA 2NLNA 1XFVO 1KK7Z 1M31A
chains in the Genus database with same CATH superfamily
5CSNA 3WHUB 1UP5A 2LHLA 3EKHA 2LC5A 3I5HC 2LANA 1TIZA 3R1OA 3UNWA 3IF7A 4A4BA 2LMVA 3VRRA 4YGDB 2BECA 1FI5A 1BR1B 1AJ4A 2L5XB 1BODA 3FS7A 2M1UA 1A75A 2KAYA 2E6WA 4QJ5B 2AAOA 1XFWO 1YX7A 1A4PA 1SY9A 5KTYA 3SIAA 3D75A 3JTDB 4OKHA 3TS5C 3I5FC 1SRAA 4MLWA 1AK8A 1CB1A 3OB1B 1CM1A 2IS9A 4PE4A 4FTGA 1KWOC 1K9UA 2WCKA 2WCFA 1S5GY 2B1UA 4I5KA 4MZKA 4PALA 3K1EA 2LVVA 4N1GA 3PLFB 2PVBA 3EVUA 3R1VA 4XJKA 2BAPA 3TDIA 1CDLA 3HCMA 2WCLA 3LK0A 4QJ3B 5CSIA 2KI4C 4PDZA 2BE4A 3LK1A 1Y1AA 4CFQA 3S0BA 2JT3A 1C7VA 5HKWA 1QX5B 3DVMA 4GBAA 1S6IA 2Y1NA 1KSOA 4OZDA 3EKJA 1AP4A 4ETOA 1S36A 2MLFC 1QASA 2SCPA 4N5XA 1KSMA 1QLSA 3LLEA 2LUXA 2AMIA 1DJIA 1XK4A 4M2OA 1QIWA 2QDIA 4PT1A 1IRJA 2QACA 5AXIA 1NCXA 2M0RA 1DQEA 1LA0A 1DJYA 2PQLA 3CYZA 5HYDA 2KFFA 1CKKA 1BR4B 1IWQA 1RTP1 3QRXA 3S0FA 1YRUB 1TN4A 3WXAA 4P2YB 1XFRA 2PRUA 3D0YA 4DCKA 3OGNA 1OZOA 1B8LA 3SIBA 1NCYA 1ZFSA 2F3ZA 1XK4C 4FQOA 1MXLC 1SNLA 1J1EA 3NSLA 2KQ6A 3B6XA 5G08A 3Q8IA 3ZNIA 2K7DA 2MJWB 1F55A 4ORCB 2M49B 1QXPA 3JVTC 3EK4A 3L4AA 3O4YA 5FI6A 2KI6D 2L50A 1OE9B 3PN7B 1QIVA 1K90D 4HSZA 3NXAA 1RFJA 3TUYB 4BY5A 1DTLA 1PSRA 3DF0B 3DXLA 1S3PA 1SL7A 1B9AA 2O5GA 2HETA 2L2CA 2LM5A 2EC6C 4JWQA 1F8HA 1XO5A 1CM4A 1RECA 1S6CA 3BFAA 3QMEA 5HKYA 1NUBA 1IKUA 4MZLA 2GGMA 1ODBA 2Y5IA 2LCPA 1N0YA 5EL2A 2JWWA 1JUOA 2KFHA 2ZNEA 3VGOA 1CMFA 1SCMB 1TNXA 3NHIA 1B7TY 2LP2A 1EXRA 1X02A 3ICBA 4ORAB 1V1GA 5HLOA 2OS8C 1TWOA 3S0EA 2AUCA 1EG3A 1JBAA 1QVIZ 3MSEB 4I5NB 2BBNA 3PALA 1WDCC 3TZ1A 2JPTA 1CFDA 2BCXA 2JOJA 4GGFA 1MR8A 1BOCA 3CZ1A 4JPZB 2KYFA 1KK8C 2L4HA 3S0GA 1YURA 1FBVA 2ZNDA 2ERBA 1S6JA 2K61A 1F4QA 5CPVA 4TNCA 2LV7A 1DJHA 3CZTX 3D74A 4JQ0D 4M2QA 4ICBA 1CTRA 1CLMA 1NX2A 1GJYA 1B4CA 2PSRA 4E68A 2FJYA 3BUXB 3WHTB 4YBHB 3BOWA 2WCEA 2KFGA 1HQVA 1QV1A 4WQ2A 5AANA 2NXQA 4GGFC 1LS8A 4AOMA 3I5IC 3BQ3A 2CBLA 3IQOA 4PE0A 1WRLA 2YGUA 4MRXA 1DC1A 3B88A 2M1KB 1G33A 3SG3A 2M7LA 3S0DA 1ZMZA 1A03A 1UHJA 1A29A 1DEKA 2BL0C 1AHRA 2L0PA 3LCPC 3I5HB 1BMOA 2L5YA 2LHIA 2WNDA 2HF5A 2MRDA 1R6PA 1W9ZA 3IVTA 2L98A 1LVCD 5J3XA 3GK2A 4GAOA 2KOTA 4OV2A 4PE1A 1CDNA 1IG5A 2ISDA 3CR4X 3HX4A 1W7JB 4QJ4B 3DD4A 5B8IB 1UHIA 2LVKA 1T14A 1VRKA 1NYAA 1FI6A 2HQWA 4GPLB 3CGAA 3DYEA 3I5GC 4MN0A 5I2OA 1KK7Y 3DY9A 4CLNA 1XFYO 5ER4X 3B7AA 4MRYA 1DMOA 1UHKA 2H61A 1PK0D 2I18A 2KNEA 2ZN8A 1ORGA 3CDNA 1NCZA 2I2RE 1K94A 2GTEA 3D10A 4BY4A 1LINA 4MVFA 1FPWA 1FF1A 1OZSA 1DJXA 1PULA 3KHEA 5PALA 1WY9A 2JNFA 4GUKA 1D1OA 1UUSA 2K8MB 3N7HA 4F7FA 3FWBA 5AEQA 2K60A 2LNKA 2GGZA 3FE8A 2G2BA 1G8IA 2QEOA 1OOGA 2P71A 1SR6B 2ZRTA 1JC2A 3NHTA 2OPOA 1TCOB 4MZJA 1SCVA 4MSPA 1BT6A 4PHKA 2QEVA 2H61C 2KBIA 1ALWA 1K8UA 3CWGA 1V1FA 2F3YA 4U8DA 3JTDC 2O60A 4YI8A 1TNQA 2KHNA 5JOLA 5D3OA 1OSAA 3BUNB 1OOFA 1KQMB 2JTZA 3O6BA 2CTNA 3KO0A 3VB1A 1OMVA 2F8PA 2SASA 3EG5B 1L2OB 1OOJA 1A2XA 1B8CA 1OOHA 1YR5A 3PM8A 1J7QA 4OR9B 2KGBC 1UHNA 1M63B 1KCYA 3KPXA 2CT9A 2ZFDA 2LAPA 1CFPA 1M45A 1UHHA 3EVVA 4INWA 1BF5A 3OB2B 4FQTA 1B47A 3BUWB 5DKRA 1K93D 3AAJA 5DKQA 1OQPA 1TTXA 4AQJA 3F45A 1WRZA 1NX0A 1NX3A 3A8RA 4GGNA 4WRIA 1BLQA 2K7BA 2F33A 5I2QA 1AJ5A 3CZ2A 1YX8A 1TNPA 1IJ6A 3SG5A 5K89A 1IGVA 1CFFA 2JC2A 1DF0B 1TNWA 2OTGB 2BE6A 3K21A 2K2AA 1YTZC 3EVRA 3TDUA 5AERA 3NSKA 2V53A 2LLUA 1J7RA 2JXLA 1H4BA 2MA2A 5CSFA 2MHHA 2LP3A 1NPQA 1GQMA 1PRWA 1R2UA 2M97A 1XYDA 1TCFA 3NSOA 1QV0A 2KPHA 4HRGA 1IH0A 3DF0A 2M8UA 3GOFA 1F4OA 1KFXL 2CXJA 1ZUZA 3RLZA 1TRFA 2TN4A 2PMYA 1FW4A 1DJWA 1U5IB 5KSZA 1SMGA 1DJGA 2JQ6A 1F70A 1CDMA 2WCMA 4JKTA 2BKIB 5DICA 4C0LA 1JWDA 2Y1MA 3CZ0A 3H4SE 3KEVA 1B8RA 1ALVA 2LE9B 3NGVA 4R1EA 2Q4UA 1SSEB 4F0ZB 5BPJA 3CABA 3TUYC 2G9BA 1B7TZ 1PVAA 2LVIA 3AKBA 1K95A 1QX7A 1NP8A 4PHJA 1QWVA 1NWDA 3VRQA 5HL1A 2LUCA 3OX6A 4GNKB 3SG2A 3DVJA 1QX2A 1Y0VH 3VROA 1PALA 3ZWHA 2EGDA 4DUQA 2FOTA 2HQ8A 1MWNA 2KDHA 3BUMB 4NDDA 3S0AA 2FJUB 2NZ0A 4DRWA 1C3YA 1IJ5A 2RGIA 3KF9A 1XFXO 5GQQC 4HREE 4CPVA 1QLKA 1CLLA 1RK9A 4HRHA 1IIOA 1NSHA 1F54A 1Y1UA 3DZTA 4YGEB 3SS3A 1JF2A 3CTNA 1CFCA 2P6BB 3FE9A 3WNXB 2MBXA 1TUZA 1QJTA 2BCBA 4PE7A 3FIAA 2JT0A 1OW4A 3D76A 3E3RA 2WC8A 1EG4A 2WCBA 3SG6A 3NSIA 2ZN9A 5F6TA 1NIWA 1E8AA 3GK1A 5ER5A 5I2LA 3V2LA 1SBJA 2E30A 5I94A 2PASA 1UWOA 1JFJA 2L51A 1K2HA 1DELA 4NQGA 1MXEA 1J7OA 1H8BA 2GV5A 2WORA 1N65A 1KFUL 2M9GA 3O78A 1J7PA 2FCEA 1RROA 3SG7A 2M7NA 1Y6WA 2LVJA 3A4UB 3TS5B 3CLNA 2LMUA 2JULA 3I5FB 4N1FA 4USLA 1SKTA 4YGBB 3SS4A 1CMGA 1KWOB 2BNXA 2A4JA 1ZOTB 1TOPA 3FE6A 1YUTA 1K9PA 1RJVA 2PYQA 2QPTA 3BYAA 1Z4HA 2KQYA 4M2PA 2KYCA 4YGAA 1QS7A 1S5GZ 1A75B 2KI4B 1DJZA 1SYMA 2BBMA 4Q04A 2BKHB 1KFXS 2JT8A 3UO9A 3OX5A 4ORBB 2KI6C 2BCAA 1J55A 1L7ZA 1XFUO 4IL1A 1B1GA 3BFBA 1S26D 2KSPA 1IQ3A 2COLB 3PATA 1LKJA 1OMRA 3CS1A 2Q91A 1PVBA 2JXCA 1XFZO 2LMTA 4C0KA 2I7AA 4XJKB 3B87A 3M0WA 4I5LB 1CDPA 3R1PA 1YVHA 4JD9A 2ZRSA 1YUUA 1SR6C 1W7IB 2KLEA 2KGRA 2MLEC 2LLTA 4MEWA 1BU3A 1GGWA 2R2IA 1YUSA 1KQVA 1M39A 3PM2A 1DVIA 2JNXA 3D77A 3R72A 4NDCA 2KBMA 2WCJA 1AVSA 2CCMA 3OHMB 1NX1A 2D8NA 2MAZA 1KQMC 3EK7A 5IBWA 1DGUA 5FYXA 3D78A 1YRTB 1ZACA 1L2OC 3RM1A 3BFHA 1MF8B 1EJ3A 2WCHA 3JVTB 1K9KA 3C1VA 1DF0A 2M29A 1LXFC 5FI7A 1J1DA 1BJFA 4CIDA 5AFPA 3D0YB 1EL4A 3AAKA 1IQ5A 2EHBA 1Y1XA 2NCOA 2EC6B 3CR2A 2I94A 4DS7A 3O4XA 1CNPA 4AQIA 3FWCA 2QEBA 2WC5A 4YI9A 4ZCVA 3BJHA 2JU0A 5DKNA 1N2DA 1U5IA 3EK8A 3RZSA 4I5JA 2WC6A 4INXA 4PHNA 5I8NA 2DOQA 3AKAA 1KFUS 1HT9A 2OTGC 2QEHA 2VRGA 2K2FA 5HKZA 1MQ1A 2K7CA 3DVKA 3PN7C 2Y4QA 3L47A 3L4LA 1XA5A 1AUIB 2OS8B 3TDZA 4OCIA 1DGVA 1S1EA 1WDCB 1Q80A 2JTTA 3B86A 1DT7B 1SL8A 1GGZA 2CNPA 2JZIA 2WOSA 3VRPA 1KK8B 1MHOA 5HLVA 4PHMA 1PSBA 1OOIX 3O2PA 3OP0A 4C0JA 4D1EA 2KAXA 4IJ7A 1BG1A 3SJSA 1G4YR 1F71A 1C7WA 2JPOA 1JF0A 1UURA 1C07A 1Z2CB 4A4CA 1JFKA 3SS5A 1P28A 3GK4X 3CR5X 5D69A 4DIRA 1SCMC 5TNCA 1QVIY 1SPYA 1CLBA 1YVLA 3PFVA 4YRUA 1RWYA 3LL8B 1OMDA 1EH2A 2HPSA 1TUJA 3I5IB 2PALA 4XYNA 1SL9A 2ZKMX 1SK6D 2F2PA 2F2OA 3PSRA 1WLMA 2H8VA 4L9MA 4ZCUA 4UPGA 2L2EA 3OBVA 1SW8A 2K0JA 2LLSA 5JJGA 3D73A 1QATA 2BL0B 2K7OA 4CFRA 4OVNF 3SG4A 1WLZA 2FCDA 2P70A 4P5OE 4WQ3A 1MUXA 3BXKA 5CSJA 1QTXA 3DVEA 1LA3A 5D7FA 4GFTA 3BUOB 4YGCB 2M3WA 2NCPA 3BOWB 1GM0A 4MBEA 2JRFA 4NDBA 2H2KA 1M46A 3PJIA 3IQQA 1JSAA 2L4IA 1K96A 3I5GB 1C3ZA 5KU1A 4PCWA 1XVJA 4KYNA 3VRNA 1WRKA 2KAVA 5FI2A 2NLNA 2KLDA 1XFVO 1KK7Z 1M31A
chains in the Genus database with same CATH topology
5CSNA 3WHUB 1UP5A 2LHLA 3EKHA 2LC5A 3I5HC 2LANA 1TIZA 4A4BA 4DIRA 3IF7A 1FI5A 2LMVA 3VRRA 4YGDB 2BECA 1BR1B 1AJ4A 2L5XB 1BODA 3FS7A 2M1UA 1A75A 2KAYA 2E6WA 4QJ5B 2AAOA 1XFWO 1YX7A 1A4PA 1SY9A 5KTYA 3SIAA 3JTDB 4OKHA 3TS5C 3I5FC 1SRAA 4MLWA 1AK8A 1CB1A 3OB1B 1CM1A 2IS9A 4PE4A 4FTGA 1KWOC 1K9UA 2WCFA 1S5GY 2B1UA 4I5KA 4MZKA 4PALA 2LVVA 4N1GA 3PLFB 2PVBA 3EVUA 4XJKA 3TDIA 1CDLA 3HCMA 3LK0A 5CSIA 4QJ3B 2KI4C 4PDZA 2BE4A 3LK1A 1Y1AA 4CFQA 2JT3A 1C7VA 5HKWA 1QX5B 3DVMA 4GBAA 1S6IA 2Y1NA 1KSOA 3EKJA 1AP4A 4ETOA 1S36A 2MLFC 1QASA 2SCPA 4N5XA 1KSMA 1QLSA 3LLEA 2LUXA 2AMIA 1DJIA 1XK4A 4M2OA 1QIWA 1IRJA 2QACA 5AXIA 1NCXA 2M0RA 1LA0A 1DJYA 5HYDA 2KFFA 1CKKA 1BR4B 1IWQA 1RTP1 3QRXA 1YRUB 1TN4A 3WXAA 4P2YB 2PRUA 3D0YA 4DCKA 1OZOA 1B8LA 3SIBA 1NCYA 1ZFSA 2F3ZA 1XK4C 4FQOA 1MXLC 1SNLA 1J1EA 3NSLA 2KQ6A 5G08A 3ZNIA 2K7DA 2MJWB 1F55A 4ORCB 2M49B 1QXPA 3JVTC 3EK4A 3O4YA 2KI6D 2L50A 1OE9B 3PN7B 1QIVA 1K90D 4HSZA 3NXAA 1RFJA 3TUYB 4BY5A 1DTLA 1PSRA 3DF0B 1S3PA 1SL7A 1B9AA 2O5GA 2HETA 2LM5A 2EC6C 4JWQA 1F8HA 1XO5A 1CM4A 1RECA 1S6CA 5HKYA 1NUBA 1IKUA 4MZLA 2GGMA 1ODBA 2Y5IA 2LCPA 1N0YA 2JWWA 1JUOA 2KFHA 2ZNEA 3VGOA 1CMFA 1SCMB 1TNXA 1B7TY 2LP2A 1EXRA 1X02A 3ICBA 4ORAB 1V1GA 5HLOA 2OS8C 2AUCA 1EG3A 1JBAA 1QVIZ 3MSEB 4I5NB 2BBNA 3PALA 1WDCC 3TZ1A 2JPTA 1CFDA 2BCXA 2JOJA 4GGFA 1MR8A 1BOCA 4JPZB 2KYFA 1KK8C 2L4HA 1YURA 1FBVA 2ZNDA 1S6JA 2K61A 1F4QA 5CPVA 4TNCA 2LV7A 1DJHA 3CZTX 4JQ0D 4M2QA 4ICBA 1CTRA 1CLMA 1NX2A 1GJYA 1B4CA 2PSRA 4E68A 3BUXB 3WHTB 4YBHB 3BOWA 2WCEA 2KFGA 1HQVA 1QV1A 4WQ2A 5AANA 2NXQA 4GGFC 4AOMA 3I5IC 3BQ3A 2CBLA 3IQOA 4PE0A 1WRLA 4MRXA 2M1KB 1G33A 3SG3A 2M7LA 1ZMZA 1A03A 1UHJA 1A29A 2BL0C 2L0PA 1AHRA 3LCPC 3I5HB 1BMOA 2LHIA 2WNDA 2HF5A 2MRDA 1R6PA 2L98A 1LVCD 5J3XA 3GK2A 4GAOA 2KOTA 4OV2A 4PE1A 1CDNA 1IG5A 2ISDA 3CR4X 3HX4A 1W7JB 4QJ4B 3DD4A 5B8IB 1UHIA 2LVKA 1VRKA 1NYAA 1FI6A 2HQWA 4GPLB 3CGAA 3I5GC 4MN0A 5I2OA 1KK7Y 4CLNA 1DMOA 1XFYO 5ER4X 4MRYA 1UHKA 2H61A 1PK0D 2I18A 2KNEA 2ZN8A 3D10A 1JSAA 1NCZA 2I2RE 1K94A 4BY4A 1LINA 4MVFA 1FPWA 1FF1A 1OZSA 1DJXA 1PULA 3KHEA 5PALA 1WY9A 2JNFA 4GUKA 1D1OA 1UUSA 2K8MB 3FWBA 5AEQA 2LNKA 2GGZA 2G2BA 1G8IA 2ZRTA 1SR6B 1JC2A 2OPOA 1TCOB 4MZJA 1SCVA 4MSPA 1BT6A 4PHKA 2H61C 2KBIA 1ALWA 1K8UA 3CWGA 1V1FA 2F3YA 4U8DA 3JTDC 2O60A 4YI8A 1TNQA 2KHNA 5JOLA 1OSAA 3BUNB 1KQMB 2JTZA 3O6BA 2CTNA 3KO0A 1OMVA 2F8PA 2SASA 1L2OB 1OOJA 1A2XA 1B8CA 1YR5A 3PM8A 1J7QA 4OR9B 2KGBC 1UHNA 1M63B 1KCYA 3KPXA 2CT9A 2ZFDA 2LAPA 1CFPA 1M45A 1UHHA 3EVVA 1BF5A 3OB2B 1B47A 3BUWB 5DKRA 1K93D 3AAJA 5DKQA 1OQPA 1TTXA 4AQJA 3F45A 1WRZA 1NX0A 1NX3A 3A8RA 4GGNA 4WRIA 1BLQA 2K7BA 2F33A 5I2QA 1AJ5A 1YX8A 1TNPA 1IJ6A 3SG5A 5K89A 1IGVA 1CFFA 2JC2A 1DF0B 1TNWA 2OTGB 2BE6A 3K21A 2K2AA 1YTZC 3EVRA 3TDUA 5AERA 3NSKA 2V53A 2LLUA 1J7RA 2JXLA 1H4BA 2MA2A 5CSFA 2MHHA 2LP3A 1NPQA 1GQMA 1PRWA 1R2UA 2M97A 1XYDA 1TCFA 3NSOA 1QV0A 4HRGA 1IH0A 3DF0A 2M8UA 3GOFA 1F4OA 1KFXL 2CXJA 1ZUZA 3RLZA 1TRFA 2TN4A 2PMYA 1FW4A 1DJWA 1U5IB 5KSZA 1SMGA 1DJGA 2JQ6A 1F70A 1CDMA 2BKIB 4C0LA 1JWDA 2Y1MA 3H4SE 3KEVA 4F0ZB 1B8RA 1ALVA 2LE9B 4R1EA 2Q4UA 5BPJA 3TUYC 2G9BA 1B7TZ 1PVAA 2LVIA 3AKBA 1K95A 1QX7A 1NP8A 4PHJA 1NWDA 3VRQA 2LUCA 3OX6A 4GNKB 3SG2A 3DVJA 1QX2A 1Y0VH 3VROA 1PALA 3ZWHA 2EGDA 4DUQA 2FOTA 2HQ8A 1MWNA 2KDHA 3BUMB 4NDDA 2FJUB 2NZ0A 4DRWA 1IJ5A 2RGIA 3KF9A 1XFXO 5GQQC 4HREE 4CPVA 1QLKA 1CLLA 1RK9A 4HRHA 1NSHA 1F54A 1Y1UA 4YGEB 1JF2A 3CTNA 1CFCA 2P6BB 3WNXB 2MBXA 1QJTA 2BCBA 4PE7A 3FIAA 2JT0A 3E3RA 2WC8A 1EG4A 2WCBA 3SG6A 3NSIA 2ZN9A 5F6TA 1NIWA 1E8AA 3GK1A 5ER5A 5I2LA 1SBJA 2E30A 2PASA 1UWOA 1JFJA 2L51A 1K2HA 4NQGA 1MXEA 1J7OA 1H8BA 2GV5A 2WORA 1N65A 1KFUL 2M9GA 3O78A 1J7PA 2FCEA 1RROA 3SG7A 2M7NA 1Y6WA 2LVJA 3A4UB 3TS5B 3CLNA 2LMUA 2JULA 3I5FB 4N1FA 4USLA 1SKTA 4YGBB 1CMGA 1KWOB 2A4JA 1ZOTB 1TOPA 1YUTA 1K9PA 1RJVA 3BYAA 2QPTA 2KQYA 4M2PA 4YGAA 2KYCA 1QS7A 1S5GZ 1A75B 2KI4B 1DJZA 1SYMA 2BBMA 4Q04A 2BKHB 1KFXS 2JT8A 3OX5A 4ORBB 2KI6C 2BCAA 1J55A 1L7ZA 1XFUO 4IL1A 1B1GA 1S26D 2KSPA 1IQ3A 2COLB 3PATA 1LKJA 1OMRA 3CS1A 2Q91A 1PVBA 2JXCA 1XFZO 2LMTA 4C0KA 2I7AA 4XJKB 4I5LB 3M0WA 1CDPA 1YVHA 2ZRSA 1YUUA 1SR6C 1W7IB 2KGRA 2MLEC 2LLTA 4MEWA 1BU3A 1GGWA 2R2IA 1YUSA 1KQVA 1M39A 1DVIA 2JNXA 4NDCA 2KBMA 1AVSA 2CCMA 3OHMB 1NX1A 2D8NA 2MAZA 1KQMC 3EK7A 5IBWA 1DGUA 5FYXA 1YRTB 1ZACA 1L2OC 3RM1A 1MF8B 1EJ3A 3JVTB 1K9KA 3C1VA 1DF0A 2M29A 1LXFC 1J1DA 1BJFA 4CIDA 5AFPA 3D0YB 1EL4A 3AAKA 1IQ5A 2EHBA 1Y1XA 2NCOA 2EC6B 3CR2A 2I94A 4DS7A 1CNPA 4AQIA 3FWCA 4YI9A 4ZCVA 2JU0A 5DKNA 1N2DA 1U5IA 3EK8A 4I5JA 4PHNA 5I8NA 2DOQA 3AKAA 1KFUS 1HT9A 2OTGC 2VRGA 2K2FA 5HKZA 1MQ1A 2K7CA 3DVKA 3PN7C 2Y4QA 1XA5A 1AUIB 2OS8B 3TDZA 4OCIA 1DGVA 1S1EA 1WDCB 1Q80A 2JTTA 1DT7B 1SL8A 1GGZA 2CNPA 2JZIA 2WOSA 3VRPA 1KK8B 1MHOA 5HLVA 4PHMA 1PSBA 3O2PA 3OP0A 4C0JA 4D1EA 2KAXA 1BG1A 3SJSA 1G4YR 1F71A 1C7WA 1JF0A 1UURA 1C07A 4A4CA 1JFKA 3GK4X 3CR5X 5D69A 1SCMC 5TNCA 1QVIY 1SPYA 1CLBA 1YVLA 3PFVA 4YRUA 1RWYA 3LL8B 1OMDA 1EH2A 2HPSA 3I5IB 2PALA 4XYNA 1SL9A 2ZKMX 1SK6D 2F2PA 2F2OA 3PSRA 1WLMA 4L9MA 4ZCUA 4UPGA 2L2EA 1SW8A 2K0JA 2LLSA 5JJGA 1QATA 2BL0B 2K7OA 4CFRA 4OVNF 3SG4A 1WLZA 2FCDA 4P5OE 4WQ3A 1MUXA 3BXKA 5CSJA 1QTXA 3DVEA 1LA3A 5D7FA 4GFTA 3BUOB 4YGCB 2M3WA 2NCPA 3BOWB 4MBEA 2JRFA 4NDBA 2H2KA 1M46A 3IQQA 2L4IA 1K96A 3I5GB 5KU1A 4PCWA 1XVJA 3VRNA 1WRKA 2KAVA 2NLNA 1XFVO 1KK7Z 1M31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CSN A;  3WHU B;  1UP5 A;  2LHL A;  3EKH A;  2LC5 A;  3I5H C;  2LAN A;  1TIZ A;  4A4B A;  4DIR A;  3IF7 A;  1FI5 A;  2LMV A;  3VRR A;  4YGD B;  2BEC A;  1BR1 B;  1AJ4 A;  2L5X B;  1BOD A;  3FS7 A;  2M1U A;  1A75 A;  2KAY A;  2E6W A;  4QJ5 B;  2AAO A;  1XFW O;  1YX7 A;  1A4P A;  1SY9 A;  5KTY A;  3SIA A;  3JTD B;  4OKH A;  3TS5 C;  3I5F C;  1SRA A;  4MLW A;  1AK8 A;  1CB1 A;  3OB1 B;  1CM1 A;  2IS9 A;  4PE4 A;  4FTG A;  1KWO C;  1K9U A;  2WCF A;  1S5G Y;  2B1U A;  4I5K A;  4MZK A;  4PAL A;  2LVV A;  4N1G A;  3PLF B;  2PVB A;  3EVU A;  4XJK A;  3TDI A;  1CDL A;  3HCM A;  3LK0 A;  5CSI A;  4QJ3 B;  2KI4 C;  4PDZ A;  2BE4 A;  3LK1 A;  1Y1A A;  4CFQ A;  2JT3 A;  1C7V A;  5HKW A;  1QX5 B;  3DVM A;  4GBA A;  1S6I A;  2Y1N A;  1KSO A;  3EKJ A;  1AP4 A;  4ETO A;  1S36 A;  2MLF C;  1QAS A;  2SCP A;  4N5X A;  1KSM A;  1QLS A;  3LLE A;  2LUX A;  2AMI A;  1DJI A;  1XK4 A;  4M2O A;  1QIW A;  1IRJ A;  2QAC A;  5AXI A;  1NCX A;  2M0R A;  1LA0 A;  1DJY A;  5HYD A;  2KFF A;  1CKK A;  1BR4 B;  1IWQ A;  1RTP 1;  3QRX A;  1YRU B;  1TN4 A;  3WXA A;  4P2Y B;  2PRU A;  3D0Y A;  4DCK A;  1OZO A;  1B8L A;  3SIB A;  1NCY A;  1ZFS A;  2F3Z A;  1XK4 C;  4FQO A;  1MXL C;  1SNL A;  1J1E A;  3NSL A;  2KQ6 A;  5G08 A;  3ZNI A;  2K7D A;  2MJW B;  1F55 A;  4ORC B;  2M49 B;  1QXP A;  3JVT C;  3EK4 A;  3O4Y A;  2KI6 D;  2L50 A;  1OE9 B;  3PN7 B;  1QIV A;  1K90 D;  4HSZ A;  3NXA A;  1RFJ A;  3TUY B;  4BY5 A;  1DTL A;  1PSR A;  3DF0 B;  1S3P A;  1SL7 A;  1B9A A;  2O5G A;  2HET A;  2LM5 A;  2EC6 C;  4JWQ A;  1F8H A;  1XO5 A;  1CM4 A;  1REC A;  1S6C A;  5HKY A;  1NUB A;  1IKU A;  4MZL A;  2GGM A;  1ODB A;  2Y5I A;  2LCP A;  1N0Y A;  2JWW A;  1JUO A;  2KFH A;  2ZNE A;  3VGO A;  1CMF A;  1SCM B;  1TNX A;  1B7T Y;  2LP2 A;  1EXR A;  1X02 A;  3ICB A;  4ORA B;  1V1G A;  5HLO A;  2OS8 C;  2AUC A;  1EG3 A;  1JBA A;  1QVI Z;  3MSE B;  4I5N B;  2BBN A;  3PAL A;  1WDC C;  3TZ1 A;  2JPT A;  1CFD A;  2BCX A;  2JOJ A;  4GGF A;  1MR8 A;  1BOC A;  4JPZ B;  2KYF A;  1KK8 C;  2L4H A;  1YUR A;  1FBV A;  2ZND A;  1S6J A;  2K61 A;  1F4Q A;  5CPV A;  4TNC A;  2LV7 A;  1DJH A;  3CZT X;  4JQ0 D;  4M2Q A;  4ICB A;  1CTR A;  1CLM A;  1NX2 A;  1GJY A;  1B4C A;  2PSR A;  4E68 A;  3BUX B;  3WHT B;  4YBH B;  3BOW A;  2WCE A;  2KFG A;  1HQV A;  1QV1 A;  4WQ2 A;  5AAN A;  2NXQ A;  4GGF C;  4AOM A;  3I5I C;  3BQ3 A;  2CBL A;  3IQO A;  4PE0 A;  1WRL A;  4MRX A;  2M1K B;  1G33 A;  3SG3 A;  2M7L A;  1ZMZ A;  1A03 A;  1UHJ A;  1A29 A;  2BL0 C;  2L0P A;  1AHR A;  3LCP C;  3I5H B;  1BMO A;  2LHI A;  2WND A;  2HF5 A;  2MRD A;  1R6P A;  2L98 A;  1LVC D;  5J3X A;  3GK2 A;  4GAO A;  2KOT A;  4OV2 A;  4PE1 A;  1CDN A;  1IG5 A;  2ISD A;  3CR4 X;  3HX4 A;  1W7J B;  4QJ4 B;  3DD4 A;  5B8I B;  1UHI A;  2LVK A;  1VRK A;  1NYA A;  1FI6 A;  2HQW A;  4GPL B;  3CGA A;  3I5G C;  4MN0 A;  5I2O A;  1KK7 Y;  4CLN A;  1DMO A;  1XFY O;  5ER4 X;  4MRY A;  1UHK A;  2H61 A;  1PK0 D;  2I18 A;  2KNE A;  2ZN8 A;  3D10 A;  1JSA A;  1NCZ A;  2I2R E;  1K94 A;  4BY4 A;  1LIN A;  4MVF A;  1FPW A;  1FF1 A;  1OZS A;  1DJX A;  1PUL A;  3KHE A;  5PAL A;  1WY9 A;  2JNF A;  4GUK A;  1D1O A;  1UUS A;  2K8M B;  3FWB A;  5AEQ A;  2LNK A;  2GGZ A;  2G2B A;  1G8I A;  2ZRT A;  1SR6 B;  1JC2 A;  2OPO A;  1TCO B;  4MZJ A;  1SCV A;  4MSP A;  1BT6 A;  4PHK A;  2H61 C;  2KBI A;  1ALW A;  1K8U A;  3CWG A;  1V1F A;  2F3Y A;  4U8D A;  3JTD C;  2O60 A;  4YI8 A;  1TNQ A;  2KHN A;  5JOL A;  1OSA A;  3BUN B;  1KQM B;  2JTZ A;  3O6B A;  2CTN A;  3KO0 A;  1OMV A;  2F8P A;  2SAS A;  1L2O B;  1OOJ A;  1A2X A;  1B8C A;  1YR5 A;  3PM8 A;  1J7Q A;  4OR9 B;  2KGB C;  1UHN A;  1M63 B;  1KCY A;  3KPX A;  2CT9 A;  2ZFD A;  2LAP A;  1CFP A;  1M45 A;  1UHH A;  3EVV A;  1BF5 A;  3OB2 B;  1B47 A;  3BUW B;  5DKR A;  1K93 D;  3AAJ A;  5DKQ A;  1OQP A;  1TTX A;  4AQJ A;  3F45 A;  1WRZ A;  1NX0 A;  1NX3 A;  3A8R A;  4GGN A;  4WRI A;  1BLQ A;  2K7B A;  2F33 A;  5I2Q A;  1AJ5 A;  1YX8 A;  1TNP A;  1IJ6 A;  3SG5 A;  5K89 A;  1IGV A;  1CFF A;  2JC2 A;  1DF0 B;  1TNW A;  2OTG B;  2BE6 A;  3K21 A;  2K2A A;  1YTZ C;  3EVR A;  3TDU A;  5AER A;  3NSK A;  2V53 A;  2LLU A;  1J7R A;  2JXL A;  1H4B A;  2MA2 A;  5CSF A;  2MHH A;  2LP3 A;  1NPQ A;  1GQM A;  1PRW A;  1R2U A;  2M97 A;  1XYD A;  1TCF A;  3NSO A;  1QV0 A;  4HRG A;  1IH0 A;  3DF0 A;  2M8U A;  3GOF A;  1F4O A;  1KFX L;  2CXJ A;  1ZUZ A;  3RLZ A;  1TRF A;  2TN4 A;  2PMY A;  1FW4 A;  1DJW A;  1U5I B;  5KSZ A;  1SMG A;  1DJG A;  2JQ6 A;  1F70 A;  1CDM A;  2BKI B;  4C0L A;  1JWD A;  2Y1M A;  3H4S E;  3KEV A;  4F0Z B;  1B8R A;  1ALV A;  2LE9 B;  4R1E A;  2Q4U A;  5BPJ A;  3TUY C;  2G9B A;  1B7T Z;  1PVA A;  2LVI A;  3AKB A;  1K95 A;  1QX7 A;  1NP8 A;  4PHJ A;  1NWD A;  3VRQ A;  2LUC A;  3OX6 A;  4GNK B;  3SG2 A;  3DVJ A;  1QX2 A;  1Y0V H;  3VRO A;  1PAL A;  3ZWH A;  2EGD A;  4DUQ A;  2FOT A;  2HQ8 A;  1MWN A;  2KDH A;  3BUM B;  4NDD A;  2FJU B;  2NZ0 A;  4DRW A;  1IJ5 A;  2RGI A;  3KF9 A;  1XFX O;  5GQQ C;  4HRE E;  4CPV A;  1QLK A;  1CLL A;  1RK9 A;  4HRH A;  1NSH A;  1F54 A;  1Y1U A;  4YGE B;  1JF2 A;  3CTN A;  1CFC A;  2P6B B;  3WNX B;  2MBX A;  1QJT A;  2BCB A;  4PE7 A;  3FIA A;  2JT0 A;  3E3R A;  2WC8 A;  1EG4 A;  2WCB A;  3SG6 A;  3NSI A;  2ZN9 A;  5F6T A;  1NIW A;  1E8A A;  3GK1 A;  5ER5 A;  5I2L A;  1SBJ A;  2E30 A;  2PAS A;  1UWO A;  1JFJ A;  2L51 A;  1K2H A;  4NQG A;  1MXE A;  1J7O A;  1H8B A;  2GV5 A;  2WOR A;  1N65 A;  1KFU L;  2M9G A;  3O78 A;  1J7P A;  2FCE A;  1RRO A;  3SG7 A;  2M7N A;  1Y6W A;  2LVJ A;  3A4U B;  3TS5 B;  3CLN A;  2LMU A;  2JUL A;  3I5F B;  4N1F A;  4USL A;  1SKT A;  4YGB B;  1CMG A;  1KWO B;  2A4J A;  1ZOT B;  1TOP A;  1YUT A;  1K9P A;  1RJV A;  3BYA A;  2QPT A;  2KQY A;  4M2P A;  4YGA A;  2KYC A;  1QS7 A;  1S5G Z;  1A75 B;  2KI4 B;  1DJZ A;  1SYM A;  2BBM A;  4Q04 A;  2BKH B;  1KFX S;  2JT8 A;  3OX5 A;  4ORB B;  2KI6 C;  2BCA A;  1J55 A;  1L7Z A;  1XFU O;  4IL1 A;  1B1G A;  1S26 D;  2KSP A;  1IQ3 A;  2COL B;  3PAT A;  1LKJ A;  1OMR A;  3CS1 A;  2Q91 A;  1PVB A;  2JXC A;  1XFZ O;  2LMT A;  4C0K A;  2I7A A;  4XJK B;  4I5L B;  3M0W A;  1CDP A;  1YVH A;  2ZRS A;  1YUU A;  1SR6 C;  1W7I B;  2KGR A;  2MLE C;  2LLT A;  4MEW A;  1BU3 A;  1GGW A;  2R2I A;  1YUS A;  1KQV A;  1M39 A;  1DVI A;  2JNX A;  4NDC A;  2KBM A;  1AVS A;  2CCM A;  3OHM B;  1NX1 A;  2D8N A;  2MAZ A;  1KQM C;  3EK7 A;  5IBW A;  1DGU A;  5FYX A;  1YRT B;  1ZAC A;  1L2O C;  3RM1 A;  1MF8 B;  1EJ3 A;  3JVT B;  1K9K A;  3C1V A;  1DF0 A;  2M29 A;  1LXF C;  1J1D A;  1BJF A;  4CID A;  5AFP A;  3D0Y B;  1EL4 A;  3AAK A;  1IQ5 A;  2EHB A;  1Y1X A;  2NCO A;  2EC6 B;  3CR2 A;  2I94 A;  4DS7 A;  1CNP A;  4AQI A;  3FWC A;  4YI9 A;  4ZCV A;  2JU0 A;  5DKN A;  1N2D A;  1U5I A;  3EK8 A;  4I5J A;  4PHN A;  5I8N A;  2DOQ A;  3AKA A;  1KFU S;  1HT9 A;  2OTG C;  2VRG A;  2K2F A;  5HKZ A;  1MQ1 A;  2K7C A;  3DVK A;  3PN7 C;  2Y4Q A;  1XA5 A;  1AUI B;  2OS8 B;  3TDZ A;  4OCI A;  1DGV A;  1S1E A;  1WDC B;  1Q80 A;  2JTT A;  1DT7 B;  1SL8 A;  1GGZ A;  2CNP A;  2JZI A;  2WOS A;  3VRP A;  1KK8 B;  1MHO A;  5HLV A;  4PHM A;  1PSB A;  3O2P A;  3OP0 A;  4C0J A;  4D1E A;  2KAX A;  1BG1 A;  3SJS A;  1G4Y R;  1F71 A;  1C7W A;  1JF0 A;  1UUR A;  1C07 A;  4A4C A;  1JFK A;  3GK4 X;  3CR5 X;  5D69 A;  1SCM C;  5TNC A;  1QVI Y;  1SPY A;  1CLB A;  1YVL A;  3PFV A;  4YRU A;  1RWY A;  3LL8 B;  1OMD A;  1EH2 A;  2HPS A;  3I5I B;  2PAL A;  4XYN A;  1SL9 A;  2ZKM X;  1SK6 D;  2F2P A;  2F2O A;  3PSR A;  1WLM A;  4L9M A;  4ZCU A;  4UPG A;  2L2E A;  1SW8 A;  2K0J A;  2LLS A;  5JJG A;  1QAT A;  2BL0 B;  2K7O A;  4CFR A;  4OVN F;  3SG4 A;  1WLZ A;  2FCD A;  4P5O E;  4WQ3 A;  1MUX A;  3BXK A;  5CSJ A;  1QTX A;  3DVE A;  1LA3 A;  5D7F A;  4GFT A;  3BUO B;  4YGC B;  2M3W A;  2NCP A;  3BOW B;  4MBE A;  2JRF A;  4NDB A;  2H2K A;  1M46 A;  3IQQ A;  2L4I A;  1K96 A;  3I5G B;  5KU1 A;  4PCW A;  1XVJ A;  3VRN A;  1WRK A;  2KAV A;  2NLN A;  1XFV O;  1KK7 Z;  1M31 A; 
#chains in the Genus database with same CATH topology
 5CSN A;  3WHU B;  1UP5 A;  2LHL A;  3EKH A;  2LC5 A;  3I5H C;  2LAN A;  1TIZ A;  3R1O A;  3UNW A;  3IF7 A;  4A4B A;  2LMV A;  3VRR A;  4YGD B;  2BEC A;  1FI5 A;  1BR1 B;  1AJ4 A;  2L5X B;  1BOD A;  3FS7 A;  2M1U A;  1A75 A;  2KAY A;  2E6W A;  4QJ5 B;  2AAO A;  1XFW O;  1YX7 A;  1A4P A;  1SY9 A;  5KTY A;  3SIA A;  3D75 A;  3JTD B;  4OKH A;  3TS5 C;  3I5F C;  1SRA A;  4MLW A;  1AK8 A;  1CB1 A;  3OB1 B;  1CM1 A;  2IS9 A;  4PE4 A;  4FTG A;  1KWO C;  1K9U A;  2WCK A;  2WCF A;  1S5G Y;  2B1U A;  4I5K A;  4MZK A;  4PAL A;  3K1E A;  2LVV A;  4N1G A;  3PLF B;  2PVB A;  3EVU A;  3R1V A;  4XJK A;  2BAP A;  3TDI A;  1CDL A;  3HCM A;  2WCL A;  3LK0 A;  4QJ3 B;  5CSI A;  2KI4 C;  4PDZ A;  2BE4 A;  3LK1 A;  1Y1A A;  4CFQ A;  3S0B A;  2JT3 A;  1C7V A;  5HKW A;  1QX5 B;  3DVM A;  4GBA A;  1S6I A;  2Y1N A;  1KSO A;  4OZD A;  3EKJ A;  1AP4 A;  4ETO A;  1S36 A;  2MLF C;  1QAS A;  2SCP A;  4N5X A;  1KSM A;  1QLS A;  3LLE A;  2LUX A;  2AMI A;  1DJI A;  1XK4 A;  4M2O A;  1QIW A;  2QDI A;  4PT1 A;  1IRJ A;  2QAC A;  5AXI A;  1NCX A;  2M0R A;  1DQE A;  1LA0 A;  1DJY A;  2PQL A;  3CYZ A;  5HYD A;  2KFF A;  1CKK A;  1BR4 B;  1IWQ A;  1RTP 1;  3QRX A;  3S0F A;  1YRU B;  1TN4 A;  3WXA A;  4P2Y B;  1XFR A;  2PRU A;  3D0Y A;  4DCK A;  3OGN A;  1OZO A;  1B8L A;  3SIB A;  1NCY A;  1ZFS A;  2F3Z A;  1XK4 C;  4FQO A;  1MXL C;  1SNL A;  1J1E A;  3NSL A;  2KQ6 A;  3B6X A;  5G08 A;  3Q8I A;  3ZNI A;  2K7D A;  2MJW B;  1F55 A;  4ORC B;  2M49 B;  1QXP A;  3JVT C;  3EK4 A;  3L4A A;  3O4Y A;  5FI6 A;  2KI6 D;  2L50 A;  1OE9 B;  3PN7 B;  1QIV A;  1K90 D;  4HSZ A;  3NXA A;  1RFJ A;  3TUY B;  4BY5 A;  1DTL A;  1PSR A;  3DF0 B;  3DXL A;  1S3P A;  1SL7 A;  1B9A A;  2O5G A;  2HET A;  2L2C A;  2LM5 A;  2EC6 C;  4JWQ A;  1F8H A;  1XO5 A;  1CM4 A;  1REC A;  1S6C A;  3BFA A;  3QME A;  5HKY A;  1NUB A;  1IKU A;  4MZL A;  2GGM A;  1ODB A;  2Y5I A;  2LCP A;  1N0Y A;  5EL2 A;  2JWW A;  1JUO A;  2KFH A;  2ZNE A;  3VGO A;  1CMF A;  1SCM B;  1TNX A;  3NHI A;  1B7T Y;  2LP2 A;  1EXR A;  1X02 A;  3ICB A;  4ORA B;  1V1G A;  5HLO A;  2OS8 C;  1TWO A;  3S0E A;  2AUC A;  1EG3 A;  1JBA A;  1QVI Z;  3MSE B;  4I5N B;  2BBN A;  3PAL A;  1WDC C;  3TZ1 A;  2JPT A;  1CFD A;  2BCX A;  2JOJ A;  4GGF A;  1MR8 A;  1BOC A;  3CZ1 A;  4JPZ B;  2KYF A;  1KK8 C;  2L4H A;  3S0G A;  1YUR A;  1FBV A;  2ZND A;  2ERB A;  1S6J A;  2K61 A;  1F4Q A;  5CPV A;  4TNC A;  2LV7 A;  1DJH A;  3CZT X;  3D74 A;  4JQ0 D;  4M2Q A;  4ICB A;  1CTR A;  1CLM A;  1NX2 A;  1GJY A;  1B4C A;  2PSR A;  4E68 A;  2FJY A;  3BUX B;  3WHT B;  4YBH B;  3BOW A;  2WCE A;  2KFG A;  1HQV A;  1QV1 A;  4WQ2 A;  5AAN A;  2NXQ A;  4GGF C;  1LS8 A;  4AOM A;  3I5I C;  3BQ3 A;  2CBL A;  3IQO A;  4PE0 A;  1WRL A;  2YGU A;  4MRX A;  1DC1 A;  3B88 A;  2M1K B;  1G33 A;  3SG3 A;  2M7L A;  3S0D A;  1ZMZ A;  1A03 A;  1UHJ A;  1A29 A;  1DEK A;  2BL0 C;  1AHR A;  2L0P A;  3LCP C;  3I5H B;  1BMO A;  2L5Y A;  2LHI A;  2WND A;  2HF5 A;  2MRD A;  1R6P A;  1W9Z A;  3IVT A;  2L98 A;  1LVC D;  5J3X A;  3GK2 A;  4GAO A;  2KOT A;  4OV2 A;  4PE1 A;  1CDN A;  1IG5 A;  2ISD A;  3CR4 X;  3HX4 A;  1W7J B;  4QJ4 B;  3DD4 A;  5B8I B;  1UHI A;  2LVK A;  1T14 A;  1VRK A;  1NYA A;  1FI6 A;  2HQW A;  4GPL B;  3CGA A;  3DYE A;  3I5G C;  4MN0 A;  5I2O A;  1KK7 Y;  3DY9 A;  4CLN A;  1XFY O;  5ER4 X;  3B7A A;  4MRY A;  1DMO A;  1UHK A;  2H61 A;  1PK0 D;  2I18 A;  2KNE A;  2ZN8 A;  1ORG A;  3CDN A;  1NCZ A;  2I2R E;  1K94 A;  2GTE A;  3D10 A;  4BY4 A;  1LIN A;  4MVF A;  1FPW A;  1FF1 A;  1OZS A;  1DJX A;  1PUL A;  3KHE A;  5PAL A;  1WY9 A;  2JNF A;  4GUK A;  1D1O A;  1UUS A;  2K8M B;  3N7H A;  4F7F A;  3FWB A;  5AEQ A;  2K60 A;  2LNK A;  2GGZ A;  3FE8 A;  2G2B A;  1G8I A;  2QEO A;  1OOG A;  2P71 A;  1SR6 B;  2ZRT A;  1JC2 A;  3NHT A;  2OPO A;  1TCO B;  4MZJ A;  1SCV A;  4MSP A;  1BT6 A;  4PHK A;  2QEV A;  2H61 C;  2KBI A;  1ALW A;  1K8U A;  3CWG A;  1V1F A;  2F3Y A;  4U8D A;  3JTD C;  2O60 A;  4YI8 A;  1TNQ A;  2KHN A;  5JOL A;  5D3O A;  1OSA A;  3BUN B;  1OOF A;  1KQM B;  2JTZ A;  3O6B A;  2CTN A;  3KO0 A;  3VB1 A;  1OMV A;  2F8P A;  2SAS A;  3EG5 B;  1L2O B;  1OOJ A;  1A2X A;  1B8C A;  1OOH A;  1YR5 A;  3PM8 A;  1J7Q A;  4OR9 B;  2KGB C;  1UHN A;  1M63 B;  1KCY A;  3KPX A;  2CT9 A;  2ZFD A;  2LAP A;  1CFP A;  1M45 A;  1UHH A;  3EVV A;  4INW A;  1BF5 A;  3OB2 B;  4FQT A;  1B47 A;  3BUW B;  5DKR A;  1K93 D;  3AAJ A;  5DKQ A;  1OQP A;  1TTX A;  4AQJ A;  3F45 A;  1WRZ A;  1NX0 A;  1NX3 A;  3A8R A;  4GGN A;  4WRI A;  1BLQ A;  2K7B A;  2F33 A;  5I2Q A;  1AJ5 A;  3CZ2 A;  1YX8 A;  1TNP A;  1IJ6 A;  3SG5 A;  5K89 A;  1IGV A;  1CFF A;  2JC2 A;  1DF0 B;  1TNW A;  2OTG B;  2BE6 A;  3K21 A;  2K2A A;  1YTZ C;  3EVR A;  3TDU A;  5AER A;  3NSK A;  2V53 A;  2LLU A;  1J7R A;  2JXL A;  1H4B A;  2MA2 A;  5CSF A;  2MHH A;  2LP3 A;  1NPQ A;  1GQM A;  1PRW A;  1R2U A;  2M97 A;  1XYD A;  1TCF A;  3NSO A;  1QV0 A;  2KPH A;  4HRG A;  1IH0 A;  3DF0 A;  2M8U A;  3GOF A;  1F4O A;  1KFX L;  2CXJ A;  1ZUZ A;  3RLZ A;  1TRF A;  2TN4 A;  2PMY A;  1FW4 A;  1DJW A;  1U5I B;  5KSZ A;  1SMG A;  1DJG A;  2JQ6 A;  1F70 A;  1CDM A;  2WCM A;  4JKT A;  2BKI B;  5DIC A;  4C0L A;  1JWD A;  2Y1M A;  3CZ0 A;  3H4S E;  3KEV A;  1B8R A;  1ALV A;  2LE9 B;  3NGV A;  4R1E A;  2Q4U A;  1SSE B;  4F0Z B;  5BPJ A;  3CAB A;  3TUY C;  2G9B A;  1B7T Z;  1PVA A;  2LVI A;  3AKB A;  1K95 A;  1QX7 A;  1NP8 A;  4PHJ A;  1QWV A;  1NWD A;  3VRQ A;  5HL1 A;  2LUC A;  3OX6 A;  4GNK B;  3SG2 A;  3DVJ A;  1QX2 A;  1Y0V H;  3VRO A;  1PAL A;  3ZWH A;  2EGD A;  4DUQ A;  2FOT A;  2HQ8 A;  1MWN A;  2KDH A;  3BUM B;  4NDD A;  3S0A A;  2FJU B;  2NZ0 A;  4DRW A;  1C3Y A;  1IJ5 A;  2RGI A;  3KF9 A;  1XFX O;  5GQQ C;  4HRE E;  4CPV A;  1QLK A;  1CLL A;  1RK9 A;  4HRH A;  1IIO A;  1NSH A;  1F54 A;  1Y1U A;  3DZT A;  4YGE B;  3SS3 A;  1JF2 A;  3CTN A;  1CFC A;  2P6B B;  3FE9 A;  3WNX B;  2MBX A;  1TUZ A;  1QJT A;  2BCB A;  4PE7 A;  3FIA A;  2JT0 A;  1OW4 A;  3D76 A;  3E3R A;  2WC8 A;  1EG4 A;  2WCB A;  3SG6 A;  3NSI A;  2ZN9 A;  5F6T A;  1NIW A;  1E8A A;  3GK1 A;  5ER5 A;  5I2L A;  3V2L A;  1SBJ A;  2E30 A;  5I94 A;  2PAS A;  1UWO A;  1JFJ A;  2L51 A;  1K2H A;  1DEL A;  4NQG A;  1MXE A;  1J7O A;  1H8B A;  2GV5 A;  2WOR A;  1N65 A;  1KFU L;  2M9G A;  3O78 A;  1J7P A;  2FCE A;  1RRO A;  3SG7 A;  2M7N A;  1Y6W A;  2LVJ A;  3A4U B;  3TS5 B;  3CLN A;  2LMU A;  2JUL A;  3I5F B;  4N1F A;  4USL A;  1SKT A;  4YGB B;  3SS4 A;  1CMG A;  1KWO B;  2BNX A;  2A4J A;  1ZOT B;  1TOP A;  3FE6 A;  1YUT A;  1K9P A;  1RJV A;  2PYQ A;  2QPT A;  3BYA A;  1Z4H A;  2KQY A;  4M2P A;  2KYC A;  4YGA A;  1QS7 A;  1S5G Z;  1A75 B;  2KI4 B;  1DJZ A;  1SYM A;  2BBM A;  4Q04 A;  2BKH B;  1KFX S;  2JT8 A;  3UO9 A;  3OX5 A;  4ORB B;  2KI6 C;  2BCA A;  1J55 A;  1L7Z A;  1XFU O;  4IL1 A;  1B1G A;  3BFB A;  1S26 D;  2KSP A;  1IQ3 A;  2COL B;  3PAT A;  1LKJ A;  1OMR A;  3CS1 A;  2Q91 A;  1PVB A;  2JXC A;  1XFZ O;  2LMT A;  4C0K A;  2I7A A;  4XJK B;  3B87 A;  3M0W A;  4I5L B;  1CDP A;  3R1P A;  1YVH A;  4JD9 A;  2ZRS A;  1YUU A;  1SR6 C;  1W7I B;  2KLE A;  2KGR A;  2MLE C;  2LLT A;  4MEW A;  1BU3 A;  1GGW A;  2R2I A;  1YUS A;  1KQV A;  1M39 A;  3PM2 A;  1DVI A;  2JNX A;  3D77 A;  3R72 A;  4NDC A;  2KBM A;  2WCJ A;  1AVS A;  2CCM A;  3OHM B;  1NX1 A;  2D8N A;  2MAZ A;  1KQM C;  3EK7 A;  5IBW A;  1DGU A;  5FYX A;  3D78 A;  1YRT B;  1ZAC A;  1L2O C;  3RM1 A;  3BFH A;  1MF8 B;  1EJ3 A;  2WCH A;  3JVT B;  1K9K A;  3C1V A;  1DF0 A;  2M29 A;  1LXF C;  5FI7 A;  1J1D A;  1BJF A;  4CID A;  5AFP A;  3D0Y B;  1EL4 A;  3AAK A;  1IQ5 A;  2EHB A;  1Y1X A;  2NCO A;  2EC6 B;  3CR2 A;  2I94 A;  4DS7 A;  3O4X A;  1CNP A;  4AQI A;  3FWC A;  2QEB A;  2WC5 A;  4YI9 A;  4ZCV A;  3BJH A;  2JU0 A;  5DKN A;  1N2D A;  1U5I A;  3EK8 A;  3RZS A;  4I5J A;  2WC6 A;  4INX A;  4PHN A;  5I8N A;  2DOQ A;  3AKA A;  1KFU S;  1HT9 A;  2OTG C;  2QEH A;  2VRG A;  2K2F A;  5HKZ A;  1MQ1 A;  2K7C A;  3DVK A;  3PN7 C;  2Y4Q A;  3L47 A;  3L4L A;  1XA5 A;  1AUI B;  2OS8 B;  3TDZ A;  4OCI A;  1DGV A;  1S1E A;  1WDC B;  1Q80 A;  2JTT A;  3B86 A;  1DT7 B;  1SL8 A;  1GGZ A;  2CNP A;  2JZI A;  2WOS A;  3VRP A;  1KK8 B;  1MHO A;  5HLV A;  4PHM A;  1PSB A;  1OOI X;  3O2P A;  3OP0 A;  4C0J A;  4D1E A;  2KAX A;  4IJ7 A;  1BG1 A;  3SJS A;  1G4Y R;  1F71 A;  1C7W A;  2JPO A;  1JF0 A;  1UUR A;  1C07 A;  1Z2C B;  4A4C A;  1JFK A;  3SS5 A;  1P28 A;  3GK4 X;  3CR5 X;  5D69 A;  4DIR A;  1SCM C;  5TNC A;  1QVI Y;  1SPY A;  1CLB A;  1YVL A;  3PFV A;  4YRU A;  1RWY A;  3LL8 B;  1OMD A;  1EH2 A;  2HPS A;  1TUJ A;  3I5I B;  2PAL A;  4XYN A;  1SL9 A;  2ZKM X;  1SK6 D;  2F2P A;  2F2O A;  3PSR A;  1WLM A;  2H8V A;  4L9M A;  4ZCU A;  4UPG A;  2L2E A;  3OBV A;  1SW8 A;  2K0J A;  2LLS A;  5JJG A;  3D73 A;  1QAT A;  2BL0 B;  2K7O A;  4CFR A;  4OVN F;  3SG4 A;  1WLZ A;  2FCD A;  2P70 A;  4P5O E;  4WQ3 A;  1MUX A;  3BXK A;  5CSJ A;  1QTX A;  3DVE A;  1LA3 A;  5D7F A;  4GFT A;  3BUO B;  4YGC B;  2M3W A;  2NCP A;  3BOW B;  1GM0 A;  4MBE A;  2JRF A;  4NDB A;  2H2K A;  1M46 A;  3PJI A;  3IQQ A;  1JSA A;  2L4I A;  1K96 A;  3I5G B;  1C3Z A;  5KU1 A;  4PCW A;  1XVJ A;  4KYN A;  3VRN A;  1WRK A;  2KAV A;  5FI2 A;  2NLN A;  2KLD A;  1XFV O;  1KK7 Z;  1M31 A; 
#chains in the Genus database with same CATH homology
 5CSN A;  3WHU B;  1UP5 A;  2LHL A;  3EKH A;  2LC5 A;  3I5H C;  2LAN A;  1TIZ A;  4A4B A;  4DIR A;  3IF7 A;  1FI5 A;  2LMV A;  3VRR A;  4YGD B;  2BEC A;  1BR1 B;  1AJ4 A;  2L5X B;  1BOD A;  3FS7 A;  2M1U A;  1A75 A;  2KAY A;  2E6W A;  4QJ5 B;  2AAO A;  1XFW O;  1YX7 A;  1A4P A;  1SY9 A;  5KTY A;  3SIA A;  3JTD B;  4OKH A;  3TS5 C;  3I5F C;  1SRA A;  4MLW A;  1AK8 A;  1CB1 A;  3OB1 B;  1CM1 A;  2IS9 A;  4PE4 A;  4FTG A;  1KWO C;  1K9U A;  2WCF A;  1S5G Y;  2B1U A;  4I5K A;  4MZK A;  4PAL A;  2LVV A;  4N1G A;  3PLF B;  2PVB A;  3EVU A;  4XJK A;  3TDI A;  1CDL A;  3HCM A;  3LK0 A;  5CSI A;  4QJ3 B;  2KI4 C;  4PDZ A;  2BE4 A;  3LK1 A;  1Y1A A;  4CFQ A;  2JT3 A;  1C7V A;  5HKW A;  1QX5 B;  3DVM A;  4GBA A;  1S6I A;  2Y1N A;  1KSO A;  3EKJ A;  1AP4 A;  4ETO A;  1S36 A;  2MLF C;  1QAS A;  2SCP A;  4N5X A;  1KSM A;  1QLS A;  3LLE A;  2LUX A;  2AMI A;  1DJI A;  1XK4 A;  4M2O A;  1QIW A;  1IRJ A;  2QAC A;  5AXI A;  1NCX A;  2M0R A;  1LA0 A;  1DJY A;  5HYD A;  2KFF A;  1CKK A;  1BR4 B;  1IWQ A;  1RTP 1;  3QRX A;  1YRU B;  1TN4 A;  3WXA A;  4P2Y B;  2PRU A;  3D0Y A;  4DCK A;  1OZO A;  1B8L A;  3SIB A;  1NCY A;  1ZFS A;  2F3Z A;  1XK4 C;  4FQO A;  1MXL C;  1SNL A;  1J1E A;  3NSL A;  2KQ6 A;  5G08 A;  3ZNI A;  2K7D A;  2MJW B;  1F55 A;  4ORC B;  2M49 B;  1QXP A;  3JVT C;  3EK4 A;  3O4Y A;  2KI6 D;  2L50 A;  1OE9 B;  3PN7 B;  1QIV A;  1K90 D;  4HSZ A;  3NXA A;  1RFJ A;  3TUY B;  4BY5 A;  1DTL A;  1PSR A;  3DF0 B;  1S3P A;  1SL7 A;  1B9A A;  2O5G A;  2HET A;  2LM5 A;  2EC6 C;  4JWQ A;  1F8H A;  1XO5 A;  1CM4 A;  1REC A;  1S6C A;  5HKY A;  1NUB A;  1IKU A;  4MZL A;  2GGM A;  1ODB A;  2Y5I A;  2LCP A;  1N0Y A;  2JWW A;  1JUO A;  2KFH A;  2ZNE A;  3VGO A;  1CMF A;  1SCM B;  1TNX A;  1B7T Y;  2LP2 A;  1EXR A;  1X02 A;  3ICB A;  4ORA B;  1V1G A;  5HLO A;  2OS8 C;  2AUC A;  1EG3 A;  1JBA A;  1QVI Z;  3MSE B;  4I5N B;  2BBN A;  3PAL A;  1WDC C;  3TZ1 A;  2JPT A;  1CFD A;  2BCX A;  2JOJ A;  4GGF A;  1MR8 A;  1BOC A;  4JPZ B;  2KYF A;  1KK8 C;  2L4H A;  1YUR A;  1FBV A;  2ZND A;  1S6J A;  2K61 A;  1F4Q A;  5CPV A;  4TNC A;  2LV7 A;  1DJH A;  3CZT X;  4JQ0 D;  4M2Q A;  4ICB A;  1CTR A;  1CLM A;  1NX2 A;  1GJY A;  1B4C A;  2PSR A;  4E68 A;  3BUX B;  3WHT B;  4YBH B;  3BOW A;  2WCE A;  2KFG A;  1HQV A;  1QV1 A;  4WQ2 A;  5AAN A;  2NXQ A;  4GGF C;  4AOM A;  3I5I C;  3BQ3 A;  2CBL A;  3IQO A;  4PE0 A;  1WRL A;  4MRX A;  2M1K B;  1G33 A;  3SG3 A;  2M7L A;  1ZMZ A;  1A03 A;  1UHJ A;  1A29 A;  2BL0 C;  2L0P A;  1AHR A;  3LCP C;  3I5H B;  1BMO A;  2LHI A;  2WND A;  2HF5 A;  2MRD A;  1R6P A;  2L98 A;  1LVC D;  5J3X A;  3GK2 A;  4GAO A;  2KOT A;  4OV2 A;  4PE1 A;  1CDN A;  1IG5 A;  2ISD A;  3CR4 X;  3HX4 A;  1W7J B;  4QJ4 B;  3DD4 A;  5B8I B;  1UHI A;  2LVK A;  1VRK A;  1NYA A;  1FI6 A;  2HQW A;  4GPL B;  3CGA A;  3I5G C;  4MN0 A;  5I2O A;  1KK7 Y;  4CLN A;  1DMO A;  1XFY O;  5ER4 X;  4MRY A;  1UHK A;  2H61 A;  1PK0 D;  2I18 A;  2KNE A;  2ZN8 A;  3D10 A;  1JSA A;  1NCZ A;  2I2R E;  1K94 A;  4BY4 A;  1LIN A;  4MVF A;  1FPW A;  1FF1 A;  1OZS A;  1DJX A;  1PUL A;  3KHE A;  5PAL A;  1WY9 A;  2JNF A;  4GUK A;  1D1O A;  1UUS A;  2K8M B;  3FWB A;  5AEQ A;  2LNK A;  2GGZ A;  2G2B A;  1G8I A;  2ZRT A;  1SR6 B;  1JC2 A;  2OPO A;  1TCO B;  4MZJ A;  1SCV A;  4MSP A;  1BT6 A;  4PHK A;  2H61 C;  2KBI A;  1ALW A;  1K8U A;  3CWG A;  1V1F A;  2F3Y A;  4U8D A;  3JTD C;  2O60 A;  4YI8 A;  1TNQ A;  2KHN A;  5JOL A;  1OSA A;  3BUN B;  1KQM B;  2JTZ A;  3O6B A;  2CTN A;  3KO0 A;  1OMV A;  2F8P A;  2SAS A;  1L2O B;  1OOJ A;  1A2X A;  1B8C A;  1YR5 A;  3PM8 A;  1J7Q A;  4OR9 B;  2KGB C;  1UHN A;  1M63 B;  1KCY A;  3KPX A;  2CT9 A;  2ZFD A;  2LAP A;  1CFP A;  1M45 A;  1UHH A;  3EVV A;  1BF5 A;  3OB2 B;  1B47 A;  3BUW B;  5DKR A;  1K93 D;  3AAJ A;  5DKQ A;  1OQP A;  1TTX A;  4AQJ A;  3F45 A;  1WRZ A;  1NX0 A;  1NX3 A;  3A8R A;  4GGN A;  4WRI A;  1BLQ A;  2K7B A;  2F33 A;  5I2Q A;  1AJ5 A;  1YX8 A;  1TNP A;  1IJ6 A;  3SG5 A;  5K89 A;  1IGV A;  1CFF A;  2JC2 A;  1DF0 B;  1TNW A;  2OTG B;  2BE6 A;  3K21 A;  2K2A A;  1YTZ C;  3EVR A;  3TDU A;  5AER A;  3NSK A;  2V53 A;  2LLU A;  1J7R A;  2JXL A;  1H4B A;  2MA2 A;  5CSF A;  2MHH A;  2LP3 A;  1NPQ A;  1GQM A;  1PRW A;  1R2U A;  2M97 A;  1XYD A;  1TCF A;  3NSO A;  1QV0 A;  4HRG A;  1IH0 A;  3DF0 A;  2M8U A;  3GOF A;  1F4O A;  1KFX L;  2CXJ A;  1ZUZ A;  3RLZ A;  1TRF A;  2TN4 A;  2PMY A;  1FW4 A;  1DJW A;  1U5I B;  5KSZ A;  1SMG A;  1DJG A;  2JQ6 A;  1F70 A;  1CDM A;  2BKI B;  4C0L A;  1JWD A;  2Y1M A;  3H4S E;  3KEV A;  4F0Z B;  1B8R A;  1ALV A;  2LE9 B;  4R1E A;  2Q4U A;  5BPJ A;  3TUY C;  2G9B A;  1B7T Z;  1PVA A;  2LVI A;  3AKB A;  1K95 A;  1QX7 A;  1NP8 A;  4PHJ A;  1NWD A;  3VRQ A;  2LUC A;  3OX6 A;  4GNK B;  3SG2 A;  3DVJ A;  1QX2 A;  1Y0V H;  3VRO A;  1PAL A;  3ZWH A;  2EGD A;  4DUQ A;  2FOT A;  2HQ8 A;  1MWN A;  2KDH A;  3BUM B;  4NDD A;  2FJU B;  2NZ0 A;  4DRW A;  1IJ5 A;  2RGI A;  3KF9 A;  1XFX O;  5GQQ C;  4HRE E;  4CPV A;  1QLK A;  1CLL A;  1RK9 A;  4HRH A;  1NSH A;  1F54 A;  1Y1U A;  4YGE B;  1JF2 A;  3CTN A;  1CFC A;  2P6B B;  3WNX B;  2MBX A;  1QJT A;  2BCB A;  4PE7 A;  3FIA A;  2JT0 A;  3E3R A;  2WC8 A;  1EG4 A;  2WCB A;  3SG6 A;  3NSI A;  2ZN9 A;  5F6T A;  1NIW A;  1E8A A;  3GK1 A;  5ER5 A;  5I2L A;  1SBJ A;  2E30 A;  2PAS A;  1UWO A;  1JFJ A;  2L51 A;  1K2H A;  4NQG A;  1MXE A;  1J7O A;  1H8B A;  2GV5 A;  2WOR A;  1N65 A;  1KFU L;  2M9G A;  3O78 A;  1J7P A;  2FCE A;  1RRO A;  3SG7 A;  2M7N A;  1Y6W A;  2LVJ A;  3A4U B;  3TS5 B;  3CLN A;  2LMU A;  2JUL A;  3I5F B;  4N1F A;  4USL A;  1SKT A;  4YGB B;  1CMG A;  1KWO B;  2A4J A;  1ZOT B;  1TOP A;  1YUT A;  1K9P A;  1RJV A;  3BYA A;  2QPT A;  2KQY A;  4M2P A;  4YGA A;  2KYC A;  1QS7 A;  1S5G Z;  1A75 B;  2KI4 B;  1DJZ A;  1SYM A;  2BBM A;  4Q04 A;  2BKH B;  1KFX S;  2JT8 A;  3OX5 A;  4ORB B;  2KI6 C;  2BCA A;  1J55 A;  1L7Z A;  1XFU O;  4IL1 A;  1B1G A;  1S26 D;  2KSP A;  1IQ3 A;  2COL B;  3PAT A;  1LKJ A;  1OMR A;  3CS1 A;  2Q91 A;  1PVB A;  2JXC A;  1XFZ O;  2LMT A;  4C0K A;  2I7A A;  4XJK B;  4I5L B;  3M0W A;  1CDP A;  1YVH A;  2ZRS A;  1YUU A;  1SR6 C;  1W7I B;  2KGR A;  2MLE C;  2LLT A;  4MEW A;  1BU3 A;  1GGW A;  2R2I A;  1YUS A;  1KQV A;  1M39 A;  1DVI A;  2JNX A;  4NDC A;  2KBM A;  1AVS A;  2CCM A;  3OHM B;  1NX1 A;  2D8N A;  2MAZ A;  1KQM C;  3EK7 A;  5IBW A;  1DGU A;  5FYX A;  1YRT B;  1ZAC A;  1L2O C;  3RM1 A;  1MF8 B;  1EJ3 A;  3JVT B;  1K9K A;  3C1V A;  1DF0 A;  2M29 A;  1LXF C;  1J1D A;  1BJF A;  4CID A;  5AFP A;  3D0Y B;  1EL4 A;  3AAK A;  1IQ5 A;  2EHB A;  1Y1X A;  2NCO A;  2EC6 B;  3CR2 A;  2I94 A;  4DS7 A;  1CNP A;  4AQI A;  3FWC A;  4YI9 A;  4ZCV A;  2JU0 A;  5DKN A;  1N2D A;  1U5I A;  3EK8 A;  4I5J A;  4PHN A;  5I8N A;  2DOQ A;  3AKA A;  1KFU S;  1HT9 A;  2OTG C;  2VRG A;  2K2F A;  5HKZ A;  1MQ1 A;  2K7C A;  3DVK A;  3PN7 C;  2Y4Q A;  1XA5 A;  1AUI B;  2OS8 B;  3TDZ A;  4OCI A;  1DGV A;  1S1E A;  1WDC B;  1Q80 A;  2JTT A;  1DT7 B;  1SL8 A;  1GGZ A;  2CNP A;  2JZI A;  2WOS A;  3VRP A;  1KK8 B;  1MHO A;  5HLV A;  4PHM A;  1PSB A;  3O2P A;  3OP0 A;  4C0J A;  4D1E A;  2KAX A;  1BG1 A;  3SJS A;  1G4Y R;  1F71 A;  1C7W A;  1JF0 A;  1UUR A;  1C07 A;  4A4C A;  1JFK A;  3GK4 X;  3CR5 X;  5D69 A;  1SCM C;  5TNC A;  1QVI Y;  1SPY A;  1CLB A;  1YVL A;  3PFV A;  4YRU A;  1RWY A;  3LL8 B;  1OMD A;  1EH2 A;  2HPS A;  3I5I B;  2PAL A;  4XYN A;  1SL9 A;  2ZKM X;  1SK6 D;  2F2P A;  2F2O A;  3PSR A;  1WLM A;  4L9M A;  4ZCU A;  4UPG A;  2L2E A;  1SW8 A;  2K0J A;  2LLS A;  5JJG A;  1QAT A;  2BL0 B;  2K7O A;  4CFR A;  4OVN F;  3SG4 A;  1WLZ A;  2FCD A;  4P5O E;  4WQ3 A;  1MUX A;  3BXK A;  5CSJ A;  1QTX A;  3DVE A;  1LA3 A;  5D7F A;  4GFT A;  3BUO B;  4YGC B;  2M3W A;  2NCP A;  3BOW B;  4MBE A;  2JRF A;  4NDB A;  2H2K A;  1M46 A;  3IQQ A;  2L4I A;  1K96 A;  3I5G B;  5KU1 A;  4PCW A;  1XVJ A;  3VRN A;  1WRK A;  2KAV A;  2NLN A;  1XFV O;  1KK7 Z;  1M31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...