3ICBA

The refined structure of vitamin d-dependent calcium-binding protein from bovine intestine. molecular details, ion binding, and implications for the structure of other calcium-binding proteins
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords CALCIUM-BINDING PROTEIN
publication title The refined structure of vitamin D-dependent calcium-binding protein from bovine intestine. Molecular details, ion binding, and implications for the structure of other calcium-binding proteins.
pubmed rcsb
source organism Bos taurus
total genus 18
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1986-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3icbA00
2FOTA 4XJKB 3BUWB 1CDLA 1DTLA 5GQQC 1YVHA 1DGVA 1RWYA 1NCXA 2NZ0A 1IH0A 1CLLA 1WRLA 4M2PA 4ORAB 1LINA 1QIWA 2KGBC 3KEVA 3AAJA 1AJ5A 1CMFA 2V53A 2CNPA 3IQQA 1A4PA 2JNFA 4AOMA 1J7PA 2FJUB 2GV5A 1JFKA 1IG5A 4YI9A 1EH2A 4U8DA 1B8RA 2ZFDA 1SK6D 4N1FA 4XJKA 2LHLA 1F70A 5TNCA 1Y1XA 1YRTB 1SMGA 5F6TA 2H61C 3LK0A 5DKNA 4HRGA 3FWBA 2FCDA 4XYNA 1X02A 2M8UA 3NXAA 1FW4A 3PM8A 2LVIA 1SCMB 1YUSA 1IJ5A 5ER5A 5D7FA 1RROA 1AJ4A 2JOJA 1DJYA 1GGZA 1MXLC 2BE6A 1S6JA 2G2BA 4PALA 4ORBB 1NX2A 3DVMA 5HYDA 4PHKA 2HPSA 1DJXA 1V1FA 2LVJA 1KFXS 2GGMA 1QIVA 1BODA 2Y4QA 1M45A 2LHIA 1DVIA 1BOCA 4MSPA 2KI6C 4QJ5B 4ICBA 1UWOA 2JT3A 1A29A 1IGVA 1RFJA 1NCYA 3OX6A 4CIDA 1B47A 1EG4A 1J1EA 5CSFA 1E8AA 1SBJA 2P6BB 3H4SE 4GGFA 1H4BA 3JVTC 5DKQA 1J7RA 1S6IA 3C1VA 2CTNA 1VRKA 3CR4X 1UHKA 1A03A 1M46A 1YURA 2KFHA 1XFYO 2PVBA 3OB1B 1L7ZA 1AP4A 4A4BA 3BUMB 4ZCVA 2DOQA 1AVSA 3OP0A 3RM1A 1J55A 5AXIA 1SRAA 2LE9B 1QLKA 4Q04A 2Q91A 1MWNA 1XK4A 1AHRA 3NSOA 1OSAA 2MAZA 2H2KA 4MZLA 1UHIA 1QLSA 1KFUL 2HQ8A 3TUYC 3AAKA 1FI6A 3EK4A 4NDCA 3SG2A 1K9KA 1UHNA 1PALA 3I5IB 1SR6C 1TNQA 2JC2A 4USLA 3WNXB 1KK8C 2KFGA 1LKJA 3D0YB 1ZACA 5HLVA 3RLZA 4DRWA 2LP3A 2M3WA 2NLNA 3EVRA 1DJWA 2JT0A 3BOWB 1S5GY 4N5XA 1WRZA 1HQVA 3LCPC 4PE4A 3TS5C 1ZOTB 2JZIA 2ZRSA 3PALA 4OVNF 3SIAA 3WXAA 4F0ZB 2Y1NA 4YGEB 2KAVA 1DGUA 2EHBA 2LANA 2M1KB 2LVVA 2LP2A 2M1UA 2M7NA 3IQOA 1KK7Y 1S6CA 4YGAA 1R6PA 1BF5A 4PHNA 1WLZA 4CFQA 4OCIA 2LAPA 4CLNA 2KAYA 3BUNB 4MBEA 1BLQA 2PSRA 3M0WA 3OHMB 3TDIA 3D0YA 1ZFSA 1SNLA 3EVVA 5KU1A 4BY4A 4MN0A 3BOWA 1JWDA 1WRKA 1K8UA 3D10A 3O2PA 1CFPA 1L2OC 3K21A 1DF0B 2KOTA 2MLEC 4IL1A 3PN7C 1DJHA 1CLMA 2KDHA 3TZ1A 1IKUA 2LNKA 3HCMA 3GOFA 2CBLA 4AQIA 1QX5B 1XFWO 2L50A 2BE4A 3KF9A 2I94A 3DVEA 3KPXA 4GUKA 2KFFA 4QJ4B 2ZN9A 1MXEA 1LA0A 2JXLA 1JC2A 1FF1A 1KWOC 3SJSA 1YX7A 2VRGA 3VRNA 1SW8A 1XFXO 4YGBB 1CKKA 3I5HC 2IS9A 4DUQA 5G08A 1XO5A 3FIAA 1KQMB 2WORA 2KI4C 2SCPA 2K2AA 1R2UA 1GQMA 1DF0A 2CCMA 1JUOA 2PRUA 5AFPA 1KCYA 1CDMA 3GK4X 5ER4X 1NSHA 1NPQA 4WQ2A 1PVAA 3WHUB 1CFFA 2K7CA 2EGDA 5DKRA 5I2OA 4BY5A 3DD4A 4MEWA 2OS8C 1CM4A 3CLNA 1A75B 3VRRA 1QATA 2WCEA 1WDCB 2ZNDA 3DVKA 4JWQA 2M29A 1FBVA 1OZSA 3I5GB 3O6BA 1S5GZ 1QVIY 5J3XA 2NXQA 2JULA 5AEQA 4WQ3A 2F3YA 2F8PA 4UPGA 2AMIA 3I5FC 5CSNA 3DF0B 2O5GA 2M7LA 4ORCB 5K89A 1YUUA 2LLTA 1KFUS 4D1EA 5HKYA 4PDZA 1S1EA 1OOJA 1DJGA 5HKWA 2GGZA 1AUIB 1PULA 2KBMA 2NCOA 1B7TY 2KI6D 2PALA 1S36A 1A75A 1GJYA 2BCXA 3OB2B 2I18A 4GAOA 3SG3A 4R1EA 1IRJA 3O78A 2A4JA 2EC6C 5HLOA 1NX0A 1PK0D 1UUSA 3A4UB 1OMRA 1TCOB 4NDDA 1QJTA 1NCZA 3GK2A 3VRQA 1K94A 1IWQA 1S26D 3DF0A 1Y6WA 4YGDB 1XA5A 1XFZO 3JTDC 1YR5A 1WLMA 1WY9A 1UHJA 2OTGC 4FTGA 2E30A 1ZMZA 1SKTA 2BKIB 2WCBA 1TNWA 1OMVA 3CWGA 1SL7A 1CFCA 2MHHA 1ZUZA 2CT9A 1QASA 4GGNA 2JRFA 1Y1AA 5KSZA 2Y5IA 2ZKMX 1G33A 3WHTB 1D1OA 2L2EA 2H61A 1C07A 1CDNA 4GNKB 2I7AA 3ZNIA 5I8NA 3CZTX 1NX3A 2HQWA 2HETA 3CR2A 3VRPA 1DT7B 4JPZB 1OE9B 2LUXA 1FI5A 1JF2A 5JOLA 2BL0C 1G8IA 4MVFA 3PFVA 3CR5X 3KHEA 4HREE 2KGRA 1NWDA 4C0JA 2BKHB 1QX2A 1F4QA 4A4CA 1CLBA 2F2PA 2JTZA 1J1DA 4QJ3B 1CB1A 1RJVA 2L51A 3LLEA 1MQ1A 2KNEA 1C7WA 3PLFB 4ZCUA 1QXPA 2G9BA 4YRUA 1LA3A 1M39A 3JVTB 3TDZA 2WOSA 1BJFA 1BR1B 1QVIZ 3AKAA 2WCFA 4YGCB 1G4YR 1TTXA 2JT8A 1N0YA 1DJZA 1EG3A 1RK9A 4PHJA 2JWWA 2LM5A 2ZN8A 4MRYA 5FYXA 1B9AA 2L5XB 1K95A 1F4OA 1UHHA 2O60A 4GBAA 1SCVA 1F54A 1YTZC 1NIWA 2Q4UA 1EL4A 4DS7A 2K7DA 4JQ0D 4MLWA 1TN4A 3TUYB 2F33A 1SPYA 2MRDA 4OR9B 1OMDA 1TRFA 2BCBA 4P2YB 1JSAA 1SY9A 1SR6B 4PCWA 1KK8B 1GGWA 5PALA 1SL8A 3A8RA 1XYDA 3LK1A 1ODBA 1YX8A 2I2RE 3VROA 5CSJA 2K2FA 2MA2A 3SG7A 3CTNA 1B1GA 2L4HA 1UP5A 1YVLA 2WC8A 2KQ6A 3TS5B 1SCMC 2NCPA 4PE1A 1UURA 1YRUB 2KHNA 3AKBA 1QTXA 3CGAA 2MLFC 4YBHB 1MF8B 4L9MA 2LC5A 2LMTA 1CM1A 2R2IA 2Y1MA 4HSZA 4NDBA 3HX4A 1KSMA 3PSRA 1JBAA 1KQVA 1CMGA 4GGFC 4YI8A 3EKHA 1PSBA 3TDUA 1JFJA 2LCPA 3MSEB 1BT6A 1CNPA 2L98A 2M97A 2KYCA 1U5IB 2LMUA 3NSLA 2WNDA 4PE7A 1CTRA 5JJGA 1K90D 1K93D 2E6WA 1KSOA 2F3ZA 2AUCA 2FCEA 3FWCA 5CSIA 2PMYA 3SG6A 1L2OB 1EJ3A 1NYAA 1NX1A 2M9GA 2BECA 1IJ6A 3PN7B 2PASA 1XK4C 3BYAA 3EVUA 3FS7A 2KYFA 2HF5A 3NSKA 2KAXA 2KSPA 1KK7Z 2LMVA 2QPTA 3SG4A 1RECA 4OV2A 1U5IA 2B1UA 2LV7A 3NSIA 4GPLB 1KWOB 4NQGA 2TN4A 3VGOA 4N1GA 5BPJA 2OPOA 3EK7A 3I5HB 2AAOA 4FQOA 1OZOA 1SL9A 1YUTA 2JQ6A 3ICBA 2KI4B 5I2QA 1IQ3A 1HT9A 1XVJA 4PE0A 2RGIA 3LL8B 2L4IA 2KBIA 5HKZA 1V1GA 1Q80A 1TCFA 1N65A 2K7BA 1EXRA 2ZNEA 1B4CA 1ALWA 1SYMA 3IF7A 1QV1A 2BBNA 3KO0A 4MRXA 3EK8A 3I5IC 1B8LA 2OS8B 5CPVA 1K9UA 3QRXA 3BXKA 2LLSA 3ZWHA 1NUBA 5AANA 1NP8A 2SASA 5I2LA 1Y1UA 3O4YA 1M31A 2JPTA 1C7VA 4CFRA 5KTYA 1K9PA 1BU3A 4MZKA 1TNXA 1XFUO 2LLUA 2BCAA 4I5JA 3I5FB 2K7OA 1J7QA 1QS7A 1N2DA 3BUOB 3SG5A 4DCKA 2M0RA 4CPVA 1BMOA 2ZRTA 1DJIA 4M2OA 4GFTA 1MUXA 1J7OA 3DVJA 2BBMA 4I5KA 1F55A 2JNXA 1JF0A 3PATA 4WRIA 1DMOA 1PRWA 5AERA 2EC6B 1CFDA 1B8CA 1CDPA 1TNPA 3BQ3A 2F2OA 2L0PA 1KFXL 1PSRA 5IBWA 1TOPA 1TIZA 1K96A 4E68A 3E3RA 1LVCD 1PVBA 2COLB 4AQJA 2LUCA 1AK8A 3JTDB 1W7JB 1F8HA 1Y0VH 1K2HA 2OTGB 2QACA 4ETOA 4MZJA 4M2QA 3GK1A 4TNCA 3OX5A 4C0KA 4DIRA 1FPWA 2D8NA 1MR8A 1B7TZ 1S3PA 1MHOA 2M49B 4C0LA 1BG1A 1KQMC 1F71A 2KQYA 1RTP1 2MJWB 2JXCA 2ISDA 1QV0A 2BL0B 1IQ5A 2JU0A 5D69A 3EKJA 5B8IB 1H8BA 1W7IB 1LXFC 3BUXB 1OQPA 2LVKA 1ALVA 4PHMA 4I5LB 3CS1A 4P5OE 1XFVO 2CXJA 2K8MB 2K61A 3F45A 2MBXA 3SIBA 4I5NB 4OKHA 1QX7A 1WDCC 1M63B 4HRHA 1A2XA 1BR4B 2K0JA 2JTTA 3I5GC
chains in the Genus database with same CATH superfamily
2FOTA 4XJKB 3BUWB 1CDLA 1DTLA 5GQQC 3PJIA 1YVHA 1DGVA 3CABA 1RWYA 1NCXA 2NZ0A 1IH0A 1CLLA 1WRLA 4M2PA 4ORAB 1LINA 1QIWA 2KGBC 2QEBA 3KEVA 3AAJA 1AJ5A 1CMFA 2V53A 2CNPA 3IQQA 1A4PA 1SSEB 2JNFA 4AOMA 1J7PA 2FJUB 2JPOA 3CZ1A 3S0EA 2GV5A 1JFKA 1IG5A 4YI9A 1EH2A 4U8DA 1B8RA 2ZFDA 1SK6D 3R1PA 4N1FA 4XJKA 2LHLA 1F70A 5TNCA 1XFRA 1Y1XA 1YRTB 1SMGA 5F6TA 2H61C 3LK0A 5DKNA 4HRGA 3FWBA 2WCHA 2FCDA 4XYNA 1X02A 2M8UA 3NXAA 1FW4A 3PM8A 2LVIA 1SCMB 2BAPA 1YUSA 1IJ5A 5ER5A 3SS5A 5D7FA 1RROA 1AJ4A 2JOJA 1DJYA 1GGZA 1MXLC 2BE6A 1S6JA 2G2BA 4PALA 4ORBB 3O4XA 1NX2A 3DVMA 5HYDA 4PHKA 2HPSA 1DJXA 1V1FA 2LVJA 1KFXS 2GGMA 1QIVA 1BODA 2Y4QA 5HL1A 1M45A 2LHIA 1DVIA 1BOCA 1IIOA 4MSPA 2KI6C 4QJ5B 4ICBA 1UWOA 2JT3A 2L5YA 3BFAA 1A29A 3S0GA 1IGVA 1RFJA 1NCYA 3OX6A 4CIDA 1B47A 1EG4A 1J1EA 2WCKA 1E8AA 1SBJA 5CSFA 1OOHA 2P70A 2P6BB 3H4SE 4GGFA 1H4BA 3JVTC 5DKQA 1J7RA 1S6IA 3C1VA 2CTNA 1VRKA 3CR4X 1UHKA 1A03A 1M46A 1YURA 2KFHA 1XFYO 2PVBA 3OB1B 1L7ZA 1AP4A 4A4BA 3BUMB 4ZCVA 2DOQA 1DT7B 1AVSA 3OP0A 3RM1A 1J55A 5AXIA 1SRAA 2LE9B 1QLKA 4Q04A 2Q91A 1MWNA 1XK4A 1AHRA 3NSOA 1OSAA 2MAZA 2H2KA 3K1EA 4MZLA 1UHIA 1QLSA 1KFUL 2HQ8A 3TUYC 3AAKA 1FI6A 3EK4A 3BFBA 4NDCA 3SG2A 1OOIX 1K9KA 1UHNA 1PALA 3I5IB 1SR6C 1TNQA 2JC2A 3S0FA 4USLA 3WNXB 1KK8C 2KFGA 1LKJA 3D0YB 1ZACA 5HLVA 3RLZA 4DRWA 2LP3A 2M3WA 2NLNA 3EVRA 1DJWA 2JT0A 3BOWB 1S5GY 4N5XA 1WRZA 1HQVA 3DYEA 3LCPC 4PE4A 3TS5C 1ZOTB 2JZIA 2ZRSA 3D78A 3PALA 4OVNF 3SIAA 3WXAA 2Y1NA 4YGEB 2KAVA 1DGUA 2EHBA 2LANA 2M1KB 2LVVA 2LP2A 2M1UA 2M7NA 3IQOA 1KK7Y 1TWOA 1S6CA 4YGAA 1R6PA 3CZ2A 3D77A 2FJYA 1BF5A 4PHNA 1WLZA 4CFQA 4OCIA 2LAPA 2KPHA 4CLNA 2KAYA 1W9ZA 3BUNB 4MBEA 1BLQA 2PSRA 3M0WA 3S0AA 3OHMB 3TDIA 3D0YA 1ZFSA 1SNLA 3EVVA 5KU1A 4BY4A 4MN0A 3BOWA 1JWDA 1C3YA 3L4LA 1WRKA 1K8UA 3D10A 3O2PA 1CFPA 1L2OC 3K21A 1DF0B 4PT1A 2KOTA 2MLEC 4IL1A 3PN7C 1DJHA 1CLMA 2KDHA 2PQLA 3TZ1A 1IKUA 2LNKA 3HCMA 3GOFA 2CBLA 4AQIA 1QX5B 1P28A 1XFWO 2L50A 4F7FA 2BE4A 3KF9A 2I94A 3DVEA 3KPXA 4GUKA 2KFFA 4QJ4B 2ZN9A 1MXEA 1LA0A 2JXLA 1JC2A 1FF1A 1KWOC 3SJSA 1YX7A 2VRGA 3VRNA 1SW8A 1XFXO 2QDIA 3CYZA 4YGBB 3I5HC 2IS9A 4DUQA 1CKKA 5G08A 1XO5A 3FIAA 1KQMB 2WORA 2KI4C 2SCPA 2K2AA 1R2UA 1DQEA 1DF0A 1GQMA 5FI7A 2CCMA 1JUOA 2PRUA 5AFPA 1KCYA 2ERBA 1CDMA 3GK4X 5ER4X 1NSHA 1NPQA 3NHTA 4WQ2A 1PVAA 1TUZA 3WHUB 5DICA 1CFFA 2K7CA 4JD9A 2EGDA 5DKRA 5I2OA 4BY5A 3DD4A 4MEWA 2OS8C 1CM4A 3CLNA 1A75B 3VRRA 1QATA 2WCEA 1WDCB 2ZNDA 3DVKA 4JWQA 2M29A 3OBVA 1FBVA 1OZSA 3I5GB 3O6BA 2WC6A 1S5GZ 1QVIY 5J3XA 2NXQA 4INWA 2JULA 5AEQA 4WQ3A 2F3YA 2F8PA 4UPGA 2AMIA 3I5FC 5CSNA 3DF0B 2O5GA 2M7LA 4ORCB 5K89A 3OGNA 1YUUA 2LLTA 1KFUS 4D1EA 5HKYA 4PDZA 1S1EA 1QWVA 1OOJA 1DJGA 5HKWA 2GGZA 1AUIB 1PULA 2KBMA 2NCOA 1B7TY 2KI6D 2PALA 1S36A 1A75A 1GJYA 2BCXA 3OB2B 2I18A 4GAOA 3SG3A 4R1EA 1IRJA 3O78A 2A4JA 2EC6C 5HLOA 1NX0A 1PK0D 1UUSA 3A4UB 1OMRA 1TCOB 4NDDA 1QJTA 1NCZA 3GK2A 3VRQA 1K94A 3S0BA 1IWQA 1S26D 3DF0A 1Y6WA 4YGDB 1XA5A 1XFZO 3JTDC 1YR5A 1WLMA 1WY9A 1UHJA 2OTGC 3D73A 2E30A 4FTGA 1ZMZA 1SKTA 2BKIB 2WCBA 1TNWA 1OMVA 3CWGA 1SL7A 1CFCA 2MHHA 1ZUZA 2CT9A 3B6XA 1QASA 4GGNA 2WC5A 2JRFA 3QMEA 1Y1AA 5KSZA 2Y5IA 2ZKMX 1G33A 3WHTB 1D1OA 2BNXA 2L2EA 4FQTA 3B88A 3B7AA 2H61A 1C07A 1CDNA 4GNKB 2I7AA 3SS4A 3ZNIA 5I8NA 3CZTX 1NX3A 2HQWA 2HETA 3CR2A 3NHIA 4IJ7A 4JPZB 1OE9B 2LUXA 3VRPA 1JF2A 5JOLA 1FI5A 2BL0C 5D3OA 1G8IA 4MVFA 3PFVA 3CR5X 3KHEA 4HREE 2KGRA 3UNWA 1NWDA 4C0JA 2BKHB 1QX2A 1F4QA 4A4CA 1CLBA 2F2PA 2JTZA 1J1DA 4QJ3B 1CB1A 1RJVA 2L51A 3LLEA 1GM0A 1MQ1A 2KNEA 1C7WA 3PLFB 3PM2A 4ZCUA 1QXPA 2G9BA 4YRUA 1LA3A 1M39A 3JVTB 3Q8IA 3TDZA 2WOSA 1BJFA 1BR1B 1QVIZ 3AKAA 5I94A 1LS8A 2WCFA 4YGCB 1G4YR 1TTXA 2JT8A 3B86A 3DXLA 1N0YA 1DJZA 1EG3A 1RK9A 4PHJA 2JWWA 2LM5A 2ZN8A 3IVTA 4MRYA 5FYXA 1B9AA 2L5XB 1DC1A 2WCMA 1K95A 1F4OA 1UHHA 2O60A 4GBAA 1SCVA 1F54A 1TUJA 1NIWA 1YTZC 2Q4UA 3CZ0A 1EL4A 4DS7A 2K7DA 2KLDA 4JQ0D 4MLWA 1TN4A 3TUYB 2F33A 1SPYA 2MRDA 4OR9B 1OMDA 1TRFA 2BCBA 4P2YB 1JSAA 1SY9A 1SR6B 1DELA 4PCWA 1KK8B 1GGWA 5PALA 1SL8A 3A8RA 1XYDA 3D75A 1Z4HA 1ODBA 1YX8A 3LK1A 2I2RE 3VROA 5CSJA 2K2FA 2MA2A 3SG7A 3CTNA 1B1GA 2L4HA 1UP5A 1YVLA 2WC8A 2KQ6A 3TS5B 1SCMC 2NCPA 4PE1A 1UURA 1YRUB 2KHNA 3AKBA 1QTXA 3CGAA 2MLFC 4YBHB 3DZTA 1MF8B 4L9MA 2LC5A 2LMTA 1CM1A 2R2IA 2Y1MA 4HSZA 4NDBA 3HX4A 1KSMA 3PSRA 1JBAA 1KQVA 1CMGA 4GGFC 4YI8A 3EKHA 1PSBA 3TDUA 2KLEA 1JFJA 2LCPA 3MSEB 1BT6A 1CNPA 2L98A 2M97A 2KYCA 1U5IB 2LMUA 3NSLA 3L47A 2WNDA 4PE7A 1CTRA 5JJGA 1K90D 1K93D 2E6WA 1KSOA 2F3ZA 2AUCA 2FCEA 3FWCA 3N7HA 2PMYA 5CSIA 2WCLA 3SG6A 1L2OB 3R72A 1EJ3A 1NYAA 1NX1A 2M9GA 2BECA 1IJ6A 3PN7B 1T14A 2PASA 1XK4C 3BYAA 3EVUA 3FS7A 2KYFA 2HF5A 3NSKA 2KAXA 2KSPA 3D76A 1KK7Z 2LMVA 2QPTA 3SG4A 3L4AA 1RECA 3FE6A 3NGVA 3FE8A 4OV2A 1U5IA 2B1UA 2LV7A 3NSIA 4GPLB 1KWOB 3RZSA 4NQGA 2TN4A 3VGOA 4N1GA 3R1VA 5BPJA 2OPOA 3EK7A 3I5HB 2AAOA 4FQOA 1OZOA 1SL9A 1YUTA 2WCJA 2JQ6A 3D74A 2KI4B 3ICBA 5I2QA 1IQ3A 1HT9A 2L2CA 1XVJA 4PE0A 2RGIA 3LL8B 2L4IA 2KBIA 5HKZA 1V1GA 1Q80A 1TCFA 1N65A 2K7BA 1EXRA 2ZNEA 4KYNA 1B4CA 1ALWA 1SYMA 3IF7A 1QV1A 3UO9A 2BBNA 3KO0A 4MRXA 2YGUA 3BJHA 3EK8A 3I5IC 1B8LA 2OS8B 5CPVA 1K9UA 3R1OA 3QRXA 3BXKA 2LLSA 3ZWHA 1NUBA 5AANA 1NP8A 2SASA 5I2LA 1ORGA 1Y1UA 3O4YA 1M31A 2JPTA 1C7VA 4CFRA 5KTYA 1K9PA 1BU3A 4MZKA 3EG5B 1TNXA 1XFUO 2LLUA 2BCAA 4I5JA 3I5FB 2K7OA 1J7QA 1QS7A 1N2DA 2K60A 3BUOB 3SG5A 4DCKA 1OOGA 2M0RA 4CPVA 1BMOA 2ZRTA 1DJIA 4M2OA 4GFTA 1MUXA 1J7OA 3DVJA 2BBMA 4I5KA 1F55A 2JNXA 1JF0A 1OW4A 2PYQA 3PATA 2QEOA 4WRIA 2H8VA 1DMOA 1PRWA 5AERA 3VB1A 2EC6B 1CFDA 1B8CA 1CDPA 1TNPA 2QEHA 2QEVA 3BQ3A 2F2OA 2L0PA 3S0DA 1KFXL 1PSRA 5IBWA 1TOPA 4OZDA 1TIZA 1K96A 3B87A 1DEKA 4E68A 3E3RA 1C3ZA 1LVCD 1PVBA 2COLB 2LUCA 4AQJA 1AK8A 3JTDB 1W7JB 4INXA 1Y0VH 1F8HA 1K2HA 2OTGB 2QACA 4ETOA 4MZJA 1OOFA 3BFHA 4M2QA 3GK1A 4TNCA 3OX5A 3FE9A 4C0KA 4DIRA 1FPWA 2D8NA 2P71A 1MR8A 1B7TZ 1S3PA 1MHOA 2M49B 4C0LA 1BG1A 1KQMC 1F71A 2KQYA 4F0ZB 1RTP1 2MJWB 3CDNA 2JXCA 5FI2A 2ISDA 1QV0A 5EL2A 2BL0B 1IQ5A 2JU0A 5D69A 3EKJA 2GTEA 5B8IB 1H8BA 1W7IB 1LXFC 3BUXB 5FI6A 1OQPA 2LVKA 1ALVA 3V2LA 4PHMA 4I5LB 3CS1A 4P5OE 1XFVO 2CXJA 2K8MB 2K61A 1Z2CB 3F45A 2MBXA 3SIBA 4I5NB 4OKHA 1QX7A 1WDCC 1M63B 4HRHA 1A2XA 1BR4B 3SS3A 4JKTA 2K0JA 2JTTA 3I5GC 3DY9A
chains in the Genus database with same CATH topology
2FOTA 4XJKB 3BUWB 1CDLA 1DTLA 5GQQC 1YVHA 1DGVA 1RWYA 1NCXA 2NZ0A 1IH0A 1CLLA 1WRLA 4M2PA 4ORAB 1LINA 1QIWA 2KGBC 3KEVA 3AAJA 1AJ5A 1CMFA 2V53A 2CNPA 3IQQA 1A4PA 2JNFA 4AOMA 1J7PA 2FJUB 2GV5A 1JFKA 1IG5A 4YI9A 1EH2A 4U8DA 1B8RA 2ZFDA 1SK6D 4N1FA 4XJKA 2LHLA 1F70A 5TNCA 1Y1XA 1YRTB 1SMGA 5F6TA 2H61C 3LK0A 5DKNA 4HRGA 3FWBA 2FCDA 4XYNA 1X02A 2M8UA 3NXAA 1FW4A 3PM8A 2LVIA 1SCMB 1YUSA 1IJ5A 5ER5A 5D7FA 1RROA 1AJ4A 2JOJA 1DJYA 1GGZA 1MXLC 2BE6A 1S6JA 2G2BA 4PALA 4ORBB 1NX2A 3DVMA 5HYDA 4PHKA 2HPSA 1DJXA 1V1FA 2LVJA 1KFXS 2GGMA 1QIVA 1BODA 2Y4QA 1M45A 2LHIA 1DVIA 1BOCA 4MSPA 2KI6C 4QJ5B 4ICBA 1UWOA 2JT3A 1A29A 1IGVA 1RFJA 1NCYA 3OX6A 4CIDA 1B47A 1EG4A 1J1EA 5CSFA 1E8AA 1SBJA 2P6BB 3H4SE 4GGFA 1H4BA 3JVTC 5DKQA 1J7RA 1S6IA 3C1VA 2CTNA 1VRKA 3CR4X 1UHKA 1A03A 1M46A 1YURA 2KFHA 1XFYO 2PVBA 3OB1B 1L7ZA 1AP4A 4A4BA 3BUMB 4ZCVA 2DOQA 1AVSA 3OP0A 3RM1A 1J55A 5AXIA 1SRAA 2LE9B 1QLKA 4Q04A 2Q91A 1MWNA 1XK4A 1AHRA 3NSOA 1OSAA 2MAZA 2H2KA 4MZLA 1UHIA 1QLSA 1KFUL 2HQ8A 3TUYC 3AAKA 1FI6A 3EK4A 4NDCA 3SG2A 1K9KA 1UHNA 1PALA 3I5IB 1SR6C 1TNQA 2JC2A 4USLA 3WNXB 1KK8C 2KFGA 1LKJA 3D0YB 1ZACA 5HLVA 3RLZA 4DRWA 2LP3A 2M3WA 2NLNA 3EVRA 1DJWA 2JT0A 3BOWB 1S5GY 4N5XA 1WRZA 1HQVA 3LCPC 4PE4A 3TS5C 1ZOTB 2JZIA 2ZRSA 3PALA 4OVNF 3SIAA 3WXAA 4F0ZB 2Y1NA 4YGEB 2KAVA 1DGUA 2EHBA 2LANA 2M1KB 2LVVA 2LP2A 2M1UA 2M7NA 3IQOA 1KK7Y 1S6CA 4YGAA 1R6PA 1BF5A 4PHNA 1WLZA 4CFQA 4OCIA 2LAPA 4CLNA 2KAYA 3BUNB 4MBEA 1BLQA 2PSRA 3M0WA 3OHMB 3TDIA 3D0YA 1ZFSA 1SNLA 3EVVA 5KU1A 4BY4A 4MN0A 3BOWA 1JWDA 1WRKA 1K8UA 3D10A 3O2PA 1CFPA 1L2OC 3K21A 1DF0B 2KOTA 2MLEC 4IL1A 3PN7C 1DJHA 1CLMA 2KDHA 3TZ1A 1IKUA 2LNKA 3HCMA 3GOFA 2CBLA 4AQIA 1QX5B 1XFWO 2L50A 2BE4A 3KF9A 2I94A 3DVEA 3KPXA 4GUKA 2KFFA 4QJ4B 2ZN9A 1MXEA 1LA0A 2JXLA 1JC2A 1FF1A 1KWOC 3SJSA 1YX7A 2VRGA 3VRNA 1SW8A 1XFXO 4YGBB 1CKKA 3I5HC 2IS9A 4DUQA 5G08A 1XO5A 3FIAA 1KQMB 2WORA 2KI4C 2SCPA 2K2AA 1R2UA 1GQMA 1DF0A 2CCMA 1JUOA 2PRUA 5AFPA 1KCYA 1CDMA 3GK4X 5ER4X 1NSHA 1NPQA 4WQ2A 1PVAA 3WHUB 1CFFA 2K7CA 2EGDA 5DKRA 5I2OA 4BY5A 3DD4A 4MEWA 2OS8C 1CM4A 3CLNA 1A75B 3VRRA 1QATA 2WCEA 1WDCB 2ZNDA 3DVKA 4JWQA 2M29A 1FBVA 1OZSA 3I5GB 3O6BA 1S5GZ 1QVIY 5J3XA 2NXQA 2JULA 5AEQA 4WQ3A 2F3YA 2F8PA 4UPGA 2AMIA 3I5FC 5CSNA 3DF0B 2O5GA 2M7LA 4ORCB 5K89A 1YUUA 2LLTA 1KFUS 4D1EA 5HKYA 4PDZA 1S1EA 1OOJA 1DJGA 5HKWA 2GGZA 1AUIB 1PULA 2KBMA 2NCOA 1B7TY 2KI6D 2PALA 1S36A 1A75A 1GJYA 2BCXA 3OB2B 2I18A 4GAOA 3SG3A 4R1EA 1IRJA 3O78A 2A4JA 2EC6C 5HLOA 1NX0A 1PK0D 1UUSA 3A4UB 1OMRA 1TCOB 4NDDA 1QJTA 1NCZA 3GK2A 3VRQA 1K94A 1IWQA 1S26D 3DF0A 1Y6WA 4YGDB 1XA5A 1XFZO 3JTDC 1YR5A 1WLMA 1WY9A 1UHJA 2OTGC 4FTGA 2E30A 1ZMZA 1SKTA 2BKIB 2WCBA 1TNWA 1OMVA 3CWGA 1SL7A 1CFCA 2MHHA 1ZUZA 2CT9A 1QASA 4GGNA 2JRFA 1Y1AA 5KSZA 2Y5IA 2ZKMX 1G33A 3WHTB 1D1OA 2L2EA 2H61A 1C07A 1CDNA 4GNKB 2I7AA 3ZNIA 5I8NA 3CZTX 1NX3A 2HQWA 2HETA 3CR2A 3VRPA 1DT7B 4JPZB 1OE9B 2LUXA 1FI5A 1JF2A 5JOLA 2BL0C 1G8IA 4MVFA 3PFVA 3CR5X 3KHEA 4HREE 2KGRA 1NWDA 4C0JA 2BKHB 1QX2A 1F4QA 4A4CA 1CLBA 2F2PA 2JTZA 1J1DA 4QJ3B 1CB1A 1RJVA 2L51A 3LLEA 1MQ1A 2KNEA 1C7WA 3PLFB 4ZCUA 1QXPA 2G9BA 4YRUA 1LA3A 1M39A 3JVTB 3TDZA 2WOSA 1BJFA 1BR1B 1QVIZ 3AKAA 2WCFA 4YGCB 1G4YR 1TTXA 2JT8A 1N0YA 1DJZA 1EG3A 1RK9A 4PHJA 2JWWA 2LM5A 2ZN8A 4MRYA 5FYXA 1B9AA 2L5XB 1K95A 1F4OA 1UHHA 2O60A 4GBAA 1SCVA 1F54A 1YTZC 1NIWA 2Q4UA 1EL4A 4DS7A 2K7DA 4JQ0D 4MLWA 1TN4A 3TUYB 2F33A 1SPYA 2MRDA 4OR9B 1OMDA 1TRFA 2BCBA 4P2YB 1JSAA 1SY9A 1SR6B 4PCWA 1KK8B 1GGWA 5PALA 1SL8A 3A8RA 1XYDA 3LK1A 1ODBA 1YX8A 2I2RE 3VROA 5CSJA 2K2FA 2MA2A 3SG7A 3CTNA 1B1GA 2L4HA 1UP5A 1YVLA 2WC8A 2KQ6A 3TS5B 1SCMC 2NCPA 4PE1A 1UURA 1YRUB 2KHNA 3AKBA 1QTXA 3CGAA 2MLFC 4YBHB 1MF8B 4L9MA 2LC5A 2LMTA 1CM1A 2R2IA 2Y1MA 4HSZA 4NDBA 3HX4A 1KSMA 3PSRA 1JBAA 1KQVA 1CMGA 4GGFC 4YI8A 3EKHA 1PSBA 3TDUA 1JFJA 2LCPA 3MSEB 1BT6A 1CNPA 2L98A 2M97A 2KYCA 1U5IB 2LMUA 3NSLA 2WNDA 4PE7A 1CTRA 5JJGA 1K90D 1K93D 2E6WA 1KSOA 2F3ZA 2AUCA 2FCEA 3FWCA 5CSIA 2PMYA 3SG6A 1L2OB 1EJ3A 1NYAA 1NX1A 2M9GA 2BECA 1IJ6A 3PN7B 2PASA 1XK4C 3BYAA 3EVUA 3FS7A 2KYFA 2HF5A 3NSKA 2KAXA 2KSPA 1KK7Z 2LMVA 2QPTA 3SG4A 1RECA 4OV2A 1U5IA 2B1UA 2LV7A 3NSIA 4GPLB 1KWOB 4NQGA 2TN4A 3VGOA 4N1GA 5BPJA 2OPOA 3EK7A 3I5HB 2AAOA 4FQOA 1OZOA 1SL9A 1YUTA 2JQ6A 3ICBA 2KI4B 5I2QA 1IQ3A 1HT9A 1XVJA 4PE0A 2RGIA 3LL8B 2L4IA 2KBIA 5HKZA 1V1GA 1Q80A 1TCFA 1N65A 2K7BA 1EXRA 2ZNEA 1B4CA 1ALWA 1SYMA 3IF7A 1QV1A 2BBNA 3KO0A 4MRXA 3EK8A 3I5IC 1B8LA 2OS8B 5CPVA 1K9UA 3QRXA 3BXKA 2LLSA 3ZWHA 1NUBA 5AANA 1NP8A 2SASA 5I2LA 1Y1UA 3O4YA 1M31A 2JPTA 1C7VA 4CFRA 5KTYA 1K9PA 1BU3A 4MZKA 1TNXA 1XFUO 2LLUA 2BCAA 4I5JA 3I5FB 2K7OA 1J7QA 1QS7A 1N2DA 3BUOB 3SG5A 4DCKA 2M0RA 4CPVA 1BMOA 2ZRTA 1DJIA 4M2OA 4GFTA 1MUXA 1J7OA 3DVJA 2BBMA 4I5KA 1F55A 2JNXA 1JF0A 3PATA 4WRIA 1DMOA 1PRWA 5AERA 2EC6B 1CFDA 1B8CA 1CDPA 1TNPA 3BQ3A 2F2OA 2L0PA 1KFXL 1PSRA 5IBWA 1TOPA 1TIZA 1K96A 4E68A 3E3RA 1LVCD 1PVBA 2COLB 4AQJA 2LUCA 1AK8A 3JTDB 1W7JB 1F8HA 1Y0VH 1K2HA 2OTGB 2QACA 4ETOA 4MZJA 4M2QA 3GK1A 4TNCA 3OX5A 4C0KA 4DIRA 1FPWA 2D8NA 1MR8A 1B7TZ 1S3PA 1MHOA 2M49B 4C0LA 1BG1A 1KQMC 1F71A 2KQYA 1RTP1 2MJWB 2JXCA 2ISDA 1QV0A 2BL0B 1IQ5A 2JU0A 5D69A 3EKJA 5B8IB 1H8BA 1W7IB 1LXFC 3BUXB 1OQPA 2LVKA 1ALVA 4PHMA 4I5LB 3CS1A 4P5OE 1XFVO 2CXJA 2K8MB 2K61A 3F45A 2MBXA 3SIBA 4I5NB 4OKHA 1QX7A 1WDCC 1M63B 4HRHA 1A2XA 1BR4B 2K0JA 2JTTA 3I5GC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FOT A;  4XJK B;  3BUW B;  1CDL A;  1DTL A;  5GQQ C;  1YVH A;  1DGV A;  1RWY A;  1NCX A;  2NZ0 A;  1IH0 A;  1CLL A;  1WRL A;  4M2P A;  4ORA B;  1LIN A;  1QIW A;  2KGB C;  3KEV A;  3AAJ A;  1AJ5 A;  1CMF A;  2V53 A;  2CNP A;  3IQQ A;  1A4P A;  2JNF A;  4AOM A;  1J7P A;  2FJU B;  2GV5 A;  1JFK A;  1IG5 A;  4YI9 A;  1EH2 A;  4U8D A;  1B8R A;  2ZFD A;  1SK6 D;  4N1F A;  4XJK A;  2LHL A;  1F70 A;  5TNC A;  1Y1X A;  1YRT B;  1SMG A;  5F6T A;  2H61 C;  3LK0 A;  5DKN A;  4HRG A;  3FWB A;  2FCD A;  4XYN A;  1X02 A;  2M8U A;  3NXA A;  1FW4 A;  3PM8 A;  2LVI A;  1SCM B;  1YUS A;  1IJ5 A;  5ER5 A;  5D7F A;  1RRO A;  1AJ4 A;  2JOJ A;  1DJY A;  1GGZ A;  1MXL C;  2BE6 A;  1S6J A;  2G2B A;  4PAL A;  4ORB B;  1NX2 A;  3DVM A;  5HYD A;  4PHK A;  2HPS A;  1DJX A;  1V1F A;  2LVJ A;  1KFX S;  2GGM A;  1QIV A;  1BOD A;  2Y4Q A;  1M45 A;  2LHI A;  1DVI A;  1BOC A;  4MSP A;  2KI6 C;  4QJ5 B;  4ICB A;  1UWO A;  2JT3 A;  1A29 A;  1IGV A;  1RFJ A;  1NCY A;  3OX6 A;  4CID A;  1B47 A;  1EG4 A;  1J1E A;  5CSF A;  1E8A A;  1SBJ A;  2P6B B;  3H4S E;  4GGF A;  1H4B A;  3JVT C;  5DKQ A;  1J7R A;  1S6I A;  3C1V A;  2CTN A;  1VRK A;  3CR4 X;  1UHK A;  1A03 A;  1M46 A;  1YUR A;  2KFH A;  1XFY O;  2PVB A;  3OB1 B;  1L7Z A;  1AP4 A;  4A4B A;  3BUM B;  4ZCV A;  2DOQ A;  1AVS A;  3OP0 A;  3RM1 A;  1J55 A;  5AXI A;  1SRA A;  2LE9 B;  1QLK A;  4Q04 A;  2Q91 A;  1MWN A;  1XK4 A;  1AHR A;  3NSO A;  1OSA A;  2MAZ A;  2H2K A;  4MZL A;  1UHI A;  1QLS A;  1KFU L;  2HQ8 A;  3TUY C;  3AAK A;  1FI6 A;  3EK4 A;  4NDC A;  3SG2 A;  1K9K A;  1UHN A;  1PAL A;  3I5I B;  1SR6 C;  1TNQ A;  2JC2 A;  4USL A;  3WNX B;  1KK8 C;  2KFG A;  1LKJ A;  3D0Y B;  1ZAC A;  5HLV A;  3RLZ A;  4DRW A;  2LP3 A;  2M3W A;  2NLN A;  3EVR A;  1DJW A;  2JT0 A;  3BOW B;  1S5G Y;  4N5X A;  1WRZ A;  1HQV A;  3LCP C;  4PE4 A;  3TS5 C;  1ZOT B;  2JZI A;  2ZRS A;  3PAL A;  4OVN F;  3SIA A;  3WXA A;  4F0Z B;  2Y1N A;  4YGE B;  2KAV A;  1DGU A;  2EHB A;  2LAN A;  2M1K B;  2LVV A;  2LP2 A;  2M1U A;  2M7N A;  3IQO A;  1KK7 Y;  1S6C A;  4YGA A;  1R6P A;  1BF5 A;  4PHN A;  1WLZ A;  4CFQ A;  4OCI A;  2LAP A;  4CLN A;  2KAY A;  3BUN B;  4MBE A;  1BLQ A;  2PSR A;  3M0W A;  3OHM B;  3TDI A;  3D0Y A;  1ZFS A;  1SNL A;  3EVV A;  5KU1 A;  4BY4 A;  4MN0 A;  3BOW A;  1JWD A;  1WRK A;  1K8U A;  3D10 A;  3O2P A;  1CFP A;  1L2O C;  3K21 A;  1DF0 B;  2KOT A;  2MLE C;  4IL1 A;  3PN7 C;  1DJH A;  1CLM A;  2KDH A;  3TZ1 A;  1IKU A;  2LNK A;  3HCM A;  3GOF A;  2CBL A;  4AQI A;  1QX5 B;  1XFW O;  2L50 A;  2BE4 A;  3KF9 A;  2I94 A;  3DVE A;  3KPX A;  4GUK A;  2KFF A;  4QJ4 B;  2ZN9 A;  1MXE A;  1LA0 A;  2JXL A;  1JC2 A;  1FF1 A;  1KWO C;  3SJS A;  1YX7 A;  2VRG A;  3VRN A;  1SW8 A;  1XFX O;  4YGB B;  1CKK A;  3I5H C;  2IS9 A;  4DUQ A;  5G08 A;  1XO5 A;  3FIA A;  1KQM B;  2WOR A;  2KI4 C;  2SCP A;  2K2A A;  1R2U A;  1GQM A;  1DF0 A;  2CCM A;  1JUO A;  2PRU A;  5AFP A;  1KCY A;  1CDM A;  3GK4 X;  5ER4 X;  1NSH A;  1NPQ A;  4WQ2 A;  1PVA A;  3WHU B;  1CFF A;  2K7C A;  2EGD A;  5DKR A;  5I2O A;  4BY5 A;  3DD4 A;  4MEW A;  2OS8 C;  1CM4 A;  3CLN A;  1A75 B;  3VRR A;  1QAT A;  2WCE A;  1WDC B;  2ZND A;  3DVK A;  4JWQ A;  2M29 A;  1FBV A;  1OZS A;  3I5G B;  3O6B A;  1S5G Z;  1QVI Y;  5J3X A;  2NXQ A;  2JUL A;  5AEQ A;  4WQ3 A;  2F3Y A;  2F8P A;  4UPG A;  2AMI A;  3I5F C;  5CSN A;  3DF0 B;  2O5G A;  2M7L A;  4ORC B;  5K89 A;  1YUU A;  2LLT A;  1KFU S;  4D1E A;  5HKY A;  4PDZ A;  1S1E A;  1OOJ A;  1DJG A;  5HKW A;  2GGZ A;  1AUI B;  1PUL A;  2KBM A;  2NCO A;  1B7T Y;  2KI6 D;  2PAL A;  1S36 A;  1A75 A;  1GJY A;  2BCX A;  3OB2 B;  2I18 A;  4GAO A;  3SG3 A;  4R1E A;  1IRJ A;  3O78 A;  2A4J A;  2EC6 C;  5HLO A;  1NX0 A;  1PK0 D;  1UUS A;  3A4U B;  1OMR A;  1TCO B;  4NDD A;  1QJT A;  1NCZ A;  3GK2 A;  3VRQ A;  1K94 A;  1IWQ A;  1S26 D;  3DF0 A;  1Y6W A;  4YGD B;  1XA5 A;  1XFZ O;  3JTD C;  1YR5 A;  1WLM A;  1WY9 A;  1UHJ A;  2OTG C;  4FTG A;  2E30 A;  1ZMZ A;  1SKT A;  2BKI B;  2WCB A;  1TNW A;  1OMV A;  3CWG A;  1SL7 A;  1CFC A;  2MHH A;  1ZUZ A;  2CT9 A;  1QAS A;  4GGN A;  2JRF A;  1Y1A A;  5KSZ A;  2Y5I A;  2ZKM X;  1G33 A;  3WHT B;  1D1O A;  2L2E A;  2H61 A;  1C07 A;  1CDN A;  4GNK B;  2I7A A;  3ZNI A;  5I8N A;  3CZT X;  1NX3 A;  2HQW A;  2HET A;  3CR2 A;  3VRP A;  1DT7 B;  4JPZ B;  1OE9 B;  2LUX A;  1FI5 A;  1JF2 A;  5JOL A;  2BL0 C;  1G8I A;  4MVF A;  3PFV A;  3CR5 X;  3KHE A;  4HRE E;  2KGR A;  1NWD A;  4C0J A;  2BKH B;  1QX2 A;  1F4Q A;  4A4C A;  1CLB A;  2F2P A;  2JTZ A;  1J1D A;  4QJ3 B;  1CB1 A;  1RJV A;  2L51 A;  3LLE A;  1MQ1 A;  2KNE A;  1C7W A;  3PLF B;  4ZCU A;  1QXP A;  2G9B A;  4YRU A;  1LA3 A;  1M39 A;  3JVT B;  3TDZ A;  2WOS A;  1BJF A;  1BR1 B;  1QVI Z;  3AKA A;  2WCF A;  4YGC B;  1G4Y R;  1TTX A;  2JT8 A;  1N0Y A;  1DJZ A;  1EG3 A;  1RK9 A;  4PHJ A;  2JWW A;  2LM5 A;  2ZN8 A;  4MRY A;  5FYX A;  1B9A A;  2L5X B;  1K95 A;  1F4O A;  1UHH A;  2O60 A;  4GBA A;  1SCV A;  1F54 A;  1YTZ C;  1NIW A;  2Q4U A;  1EL4 A;  4DS7 A;  2K7D A;  4JQ0 D;  4MLW A;  1TN4 A;  3TUY B;  2F33 A;  1SPY A;  2MRD A;  4OR9 B;  1OMD A;  1TRF A;  2BCB A;  4P2Y B;  1JSA A;  1SY9 A;  1SR6 B;  4PCW A;  1KK8 B;  1GGW A;  5PAL A;  1SL8 A;  3A8R A;  1XYD A;  3LK1 A;  1ODB A;  1YX8 A;  2I2R E;  3VRO A;  5CSJ A;  2K2F A;  2MA2 A;  3SG7 A;  3CTN A;  1B1G A;  2L4H A;  1UP5 A;  1YVL A;  2WC8 A;  2KQ6 A;  3TS5 B;  1SCM C;  2NCP A;  4PE1 A;  1UUR A;  1YRU B;  2KHN A;  3AKB A;  1QTX A;  3CGA A;  2MLF C;  4YBH B;  1MF8 B;  4L9M A;  2LC5 A;  2LMT A;  1CM1 A;  2R2I A;  2Y1M A;  4HSZ A;  4NDB A;  3HX4 A;  1KSM A;  3PSR A;  1JBA A;  1KQV A;  1CMG A;  4GGF C;  4YI8 A;  3EKH A;  1PSB A;  3TDU A;  1JFJ A;  2LCP A;  3MSE B;  1BT6 A;  1CNP A;  2L98 A;  2M97 A;  2KYC A;  1U5I B;  2LMU A;  3NSL A;  2WND A;  4PE7 A;  1CTR A;  5JJG A;  1K90 D;  1K93 D;  2E6W A;  1KSO A;  2F3Z A;  2AUC A;  2FCE A;  3FWC A;  5CSI A;  2PMY A;  3SG6 A;  1L2O B;  1EJ3 A;  1NYA A;  1NX1 A;  2M9G A;  2BEC A;  1IJ6 A;  3PN7 B;  2PAS A;  1XK4 C;  3BYA A;  3EVU A;  3FS7 A;  2KYF A;  2HF5 A;  3NSK A;  2KAX A;  2KSP A;  1KK7 Z;  2LMV A;  2QPT A;  3SG4 A;  1REC A;  4OV2 A;  1U5I A;  2B1U A;  2LV7 A;  3NSI A;  4GPL B;  1KWO B;  4NQG A;  2TN4 A;  3VGO A;  4N1G A;  5BPJ A;  2OPO A;  3EK7 A;  3I5H B;  2AAO A;  4FQO A;  1OZO A;  1SL9 A;  1YUT A;  2JQ6 A;  3ICB A;  2KI4 B;  5I2Q A;  1IQ3 A;  1HT9 A;  1XVJ A;  4PE0 A;  2RGI A;  3LL8 B;  2L4I A;  2KBI A;  5HKZ A;  1V1G A;  1Q80 A;  1TCF A;  1N65 A;  2K7B A;  1EXR A;  2ZNE A;  1B4C A;  1ALW A;  1SYM A;  3IF7 A;  1QV1 A;  2BBN A;  3KO0 A;  4MRX A;  3EK8 A;  3I5I C;  1B8L A;  2OS8 B;  5CPV A;  1K9U A;  3QRX A;  3BXK A;  2LLS A;  3ZWH A;  1NUB A;  5AAN A;  1NP8 A;  2SAS A;  5I2L A;  1Y1U A;  3O4Y A;  1M31 A;  2JPT A;  1C7V A;  4CFR A;  5KTY A;  1K9P A;  1BU3 A;  4MZK A;  1TNX A;  1XFU O;  2LLU A;  2BCA A;  4I5J A;  3I5F B;  2K7O A;  1J7Q A;  1QS7 A;  1N2D A;  3BUO B;  3SG5 A;  4DCK A;  2M0R A;  4CPV A;  1BMO A;  2ZRT A;  1DJI A;  4M2O A;  4GFT A;  1MUX A;  1J7O A;  3DVJ A;  2BBM A;  4I5K A;  1F55 A;  2JNX A;  1JF0 A;  3PAT A;  4WRI A;  1DMO A;  1PRW A;  5AER A;  2EC6 B;  1CFD A;  1B8C A;  1CDP A;  1TNP A;  3BQ3 A;  2F2O A;  2L0P A;  1KFX L;  1PSR A;  5IBW A;  1TOP A;  1TIZ A;  1K96 A;  4E68 A;  3E3R A;  1LVC D;  1PVB A;  2COL B;  4AQJ A;  2LUC A;  1AK8 A;  3JTD B;  1W7J B;  1F8H A;  1Y0V H;  1K2H A;  2OTG B;  2QAC A;  4ETO A;  4MZJ A;  4M2Q A;  3GK1 A;  4TNC A;  3OX5 A;  4C0K A;  4DIR A;  1FPW A;  2D8N A;  1MR8 A;  1B7T Z;  1S3P A;  1MHO A;  2M49 B;  4C0L A;  1BG1 A;  1KQM C;  1F71 A;  2KQY A;  1RTP 1;  2MJW B;  2JXC A;  2ISD A;  1QV0 A;  2BL0 B;  1IQ5 A;  2JU0 A;  5D69 A;  3EKJ A;  5B8I B;  1H8B A;  1W7I B;  1LXF C;  3BUX B;  1OQP A;  2LVK A;  1ALV A;  4PHM A;  4I5L B;  3CS1 A;  4P5O E;  1XFV O;  2CXJ A;  2K8M B;  2K61 A;  3F45 A;  2MBX A;  3SIB A;  4I5N B;  4OKH A;  1QX7 A;  1WDC C;  1M63 B;  4HRH A;  1A2X A;  1BR4 B;  2K0J A;  2JTT A;  3I5G C; 
#chains in the Genus database with same CATH topology
 2FOT A;  4XJK B;  3BUW B;  1CDL A;  1DTL A;  5GQQ C;  3PJI A;  1YVH A;  1DGV A;  3CAB A;  1RWY A;  1NCX A;  2NZ0 A;  1IH0 A;  1CLL A;  1WRL A;  4M2P A;  4ORA B;  1LIN A;  1QIW A;  2KGB C;  2QEB A;  3KEV A;  3AAJ A;  1AJ5 A;  1CMF A;  2V53 A;  2CNP A;  3IQQ A;  1A4P A;  1SSE B;  2JNF A;  4AOM A;  1J7P A;  2FJU B;  2JPO A;  3CZ1 A;  3S0E A;  2GV5 A;  1JFK A;  1IG5 A;  4YI9 A;  1EH2 A;  4U8D A;  1B8R A;  2ZFD A;  1SK6 D;  3R1P A;  4N1F A;  4XJK A;  2LHL A;  1F70 A;  5TNC A;  1XFR A;  1Y1X A;  1YRT B;  1SMG A;  5F6T A;  2H61 C;  3LK0 A;  5DKN A;  4HRG A;  3FWB A;  2WCH A;  2FCD A;  4XYN A;  1X02 A;  2M8U A;  3NXA A;  1FW4 A;  3PM8 A;  2LVI A;  1SCM B;  2BAP A;  1YUS A;  1IJ5 A;  5ER5 A;  3SS5 A;  5D7F A;  1RRO A;  1AJ4 A;  2JOJ A;  1DJY A;  1GGZ A;  1MXL C;  2BE6 A;  1S6J A;  2G2B A;  4PAL A;  4ORB B;  3O4X A;  1NX2 A;  3DVM A;  5HYD A;  4PHK A;  2HPS A;  1DJX A;  1V1F A;  2LVJ A;  1KFX S;  2GGM A;  1QIV A;  1BOD A;  2Y4Q A;  5HL1 A;  1M45 A;  2LHI A;  1DVI A;  1BOC A;  1IIO A;  4MSP A;  2KI6 C;  4QJ5 B;  4ICB A;  1UWO A;  2JT3 A;  2L5Y A;  3BFA A;  1A29 A;  3S0G A;  1IGV A;  1RFJ A;  1NCY A;  3OX6 A;  4CID A;  1B47 A;  1EG4 A;  1J1E A;  2WCK A;  1E8A A;  1SBJ A;  5CSF A;  1OOH A;  2P70 A;  2P6B B;  3H4S E;  4GGF A;  1H4B A;  3JVT C;  5DKQ A;  1J7R A;  1S6I A;  3C1V A;  2CTN A;  1VRK A;  3CR4 X;  1UHK A;  1A03 A;  1M46 A;  1YUR A;  2KFH A;  1XFY O;  2PVB A;  3OB1 B;  1L7Z A;  1AP4 A;  4A4B A;  3BUM B;  4ZCV A;  2DOQ A;  1DT7 B;  1AVS A;  3OP0 A;  3RM1 A;  1J55 A;  5AXI A;  1SRA A;  2LE9 B;  1QLK A;  4Q04 A;  2Q91 A;  1MWN A;  1XK4 A;  1AHR A;  3NSO A;  1OSA A;  2MAZ A;  2H2K A;  3K1E A;  4MZL A;  1UHI A;  1QLS A;  1KFU L;  2HQ8 A;  3TUY C;  3AAK A;  1FI6 A;  3EK4 A;  3BFB A;  4NDC A;  3SG2 A;  1OOI X;  1K9K A;  1UHN A;  1PAL A;  3I5I B;  1SR6 C;  1TNQ A;  2JC2 A;  3S0F A;  4USL A;  3WNX B;  1KK8 C;  2KFG A;  1LKJ A;  3D0Y B;  1ZAC A;  5HLV A;  3RLZ A;  4DRW A;  2LP3 A;  2M3W A;  2NLN A;  3EVR A;  1DJW A;  2JT0 A;  3BOW B;  1S5G Y;  4N5X A;  1WRZ A;  1HQV A;  3DYE A;  3LCP C;  4PE4 A;  3TS5 C;  1ZOT B;  2JZI A;  2ZRS A;  3D78 A;  3PAL A;  4OVN F;  3SIA A;  3WXA A;  2Y1N A;  4YGE B;  2KAV A;  1DGU A;  2EHB A;  2LAN A;  2M1K B;  2LVV A;  2LP2 A;  2M1U A;  2M7N A;  3IQO A;  1KK7 Y;  1TWO A;  1S6C A;  4YGA A;  1R6P A;  3CZ2 A;  3D77 A;  2FJY A;  1BF5 A;  4PHN A;  1WLZ A;  4CFQ A;  4OCI A;  2LAP A;  2KPH A;  4CLN A;  2KAY A;  1W9Z A;  3BUN B;  4MBE A;  1BLQ A;  2PSR A;  3M0W A;  3S0A A;  3OHM B;  3TDI A;  3D0Y A;  1ZFS A;  1SNL A;  3EVV A;  5KU1 A;  4BY4 A;  4MN0 A;  3BOW A;  1JWD A;  1C3Y A;  3L4L A;  1WRK A;  1K8U A;  3D10 A;  3O2P A;  1CFP A;  1L2O C;  3K21 A;  1DF0 B;  4PT1 A;  2KOT A;  2MLE C;  4IL1 A;  3PN7 C;  1DJH A;  1CLM A;  2KDH A;  2PQL A;  3TZ1 A;  1IKU A;  2LNK A;  3HCM A;  3GOF A;  2CBL A;  4AQI A;  1QX5 B;  1P28 A;  1XFW O;  2L50 A;  4F7F A;  2BE4 A;  3KF9 A;  2I94 A;  3DVE A;  3KPX A;  4GUK A;  2KFF A;  4QJ4 B;  2ZN9 A;  1MXE A;  1LA0 A;  2JXL A;  1JC2 A;  1FF1 A;  1KWO C;  3SJS A;  1YX7 A;  2VRG A;  3VRN A;  1SW8 A;  1XFX O;  2QDI A;  3CYZ A;  4YGB B;  3I5H C;  2IS9 A;  4DUQ A;  1CKK A;  5G08 A;  1XO5 A;  3FIA A;  1KQM B;  2WOR A;  2KI4 C;  2SCP A;  2K2A A;  1R2U A;  1DQE A;  1DF0 A;  1GQM A;  5FI7 A;  2CCM A;  1JUO A;  2PRU A;  5AFP A;  1KCY A;  2ERB A;  1CDM A;  3GK4 X;  5ER4 X;  1NSH A;  1NPQ A;  3NHT A;  4WQ2 A;  1PVA A;  1TUZ A;  3WHU B;  5DIC A;  1CFF A;  2K7C A;  4JD9 A;  2EGD A;  5DKR A;  5I2O A;  4BY5 A;  3DD4 A;  4MEW A;  2OS8 C;  1CM4 A;  3CLN A;  1A75 B;  3VRR A;  1QAT A;  2WCE A;  1WDC B;  2ZND A;  3DVK A;  4JWQ A;  2M29 A;  3OBV A;  1FBV A;  1OZS A;  3I5G B;  3O6B A;  2WC6 A;  1S5G Z;  1QVI Y;  5J3X A;  2NXQ A;  4INW A;  2JUL A;  5AEQ A;  4WQ3 A;  2F3Y A;  2F8P A;  4UPG A;  2AMI A;  3I5F C;  5CSN A;  3DF0 B;  2O5G A;  2M7L A;  4ORC B;  5K89 A;  3OGN A;  1YUU A;  2LLT A;  1KFU S;  4D1E A;  5HKY A;  4PDZ A;  1S1E A;  1QWV A;  1OOJ A;  1DJG A;  5HKW A;  2GGZ A;  1AUI B;  1PUL A;  2KBM A;  2NCO A;  1B7T Y;  2KI6 D;  2PAL A;  1S36 A;  1A75 A;  1GJY A;  2BCX A;  3OB2 B;  2I18 A;  4GAO A;  3SG3 A;  4R1E A;  1IRJ A;  3O78 A;  2A4J A;  2EC6 C;  5HLO A;  1NX0 A;  1PK0 D;  1UUS A;  3A4U B;  1OMR A;  1TCO B;  4NDD A;  1QJT A;  1NCZ A;  3GK2 A;  3VRQ A;  1K94 A;  3S0B A;  1IWQ A;  1S26 D;  3DF0 A;  1Y6W A;  4YGD B;  1XA5 A;  1XFZ O;  3JTD C;  1YR5 A;  1WLM A;  1WY9 A;  1UHJ A;  2OTG C;  3D73 A;  2E30 A;  4FTG A;  1ZMZ A;  1SKT A;  2BKI B;  2WCB A;  1TNW A;  1OMV A;  3CWG A;  1SL7 A;  1CFC A;  2MHH A;  1ZUZ A;  2CT9 A;  3B6X A;  1QAS A;  4GGN A;  2WC5 A;  2JRF A;  3QME A;  1Y1A A;  5KSZ A;  2Y5I A;  2ZKM X;  1G33 A;  3WHT B;  1D1O A;  2BNX A;  2L2E A;  4FQT A;  3B88 A;  3B7A A;  2H61 A;  1C07 A;  1CDN A;  4GNK B;  2I7A A;  3SS4 A;  3ZNI A;  5I8N A;  3CZT X;  1NX3 A;  2HQW A;  2HET A;  3CR2 A;  3NHI A;  4IJ7 A;  4JPZ B;  1OE9 B;  2LUX A;  3VRP A;  1JF2 A;  5JOL A;  1FI5 A;  2BL0 C;  5D3O A;  1G8I A;  4MVF A;  3PFV A;  3CR5 X;  3KHE A;  4HRE E;  2KGR A;  3UNW A;  1NWD A;  4C0J A;  2BKH B;  1QX2 A;  1F4Q A;  4A4C A;  1CLB A;  2F2P A;  2JTZ A;  1J1D A;  4QJ3 B;  1CB1 A;  1RJV A;  2L51 A;  3LLE A;  1GM0 A;  1MQ1 A;  2KNE A;  1C7W A;  3PLF B;  3PM2 A;  4ZCU A;  1QXP A;  2G9B A;  4YRU A;  1LA3 A;  1M39 A;  3JVT B;  3Q8I A;  3TDZ A;  2WOS A;  1BJF A;  1BR1 B;  1QVI Z;  3AKA A;  5I94 A;  1LS8 A;  2WCF A;  4YGC B;  1G4Y R;  1TTX A;  2JT8 A;  3B86 A;  3DXL A;  1N0Y A;  1DJZ A;  1EG3 A;  1RK9 A;  4PHJ A;  2JWW A;  2LM5 A;  2ZN8 A;  3IVT A;  4MRY A;  5FYX A;  1B9A A;  2L5X B;  1DC1 A;  2WCM A;  1K95 A;  1F4O A;  1UHH A;  2O60 A;  4GBA A;  1SCV A;  1F54 A;  1TUJ A;  1NIW A;  1YTZ C;  2Q4U A;  3CZ0 A;  1EL4 A;  4DS7 A;  2K7D A;  2KLD A;  4JQ0 D;  4MLW A;  1TN4 A;  3TUY B;  2F33 A;  1SPY A;  2MRD A;  4OR9 B;  1OMD A;  1TRF A;  2BCB A;  4P2Y B;  1JSA A;  1SY9 A;  1SR6 B;  1DEL A;  4PCW A;  1KK8 B;  1GGW A;  5PAL A;  1SL8 A;  3A8R A;  1XYD A;  3D75 A;  1Z4H A;  1ODB A;  1YX8 A;  3LK1 A;  2I2R E;  3VRO A;  5CSJ A;  2K2F A;  2MA2 A;  3SG7 A;  3CTN A;  1B1G A;  2L4H A;  1UP5 A;  1YVL A;  2WC8 A;  2KQ6 A;  3TS5 B;  1SCM C;  2NCP A;  4PE1 A;  1UUR A;  1YRU B;  2KHN A;  3AKB A;  1QTX A;  3CGA A;  2MLF C;  4YBH B;  3DZT A;  1MF8 B;  4L9M A;  2LC5 A;  2LMT A;  1CM1 A;  2R2I A;  2Y1M A;  4HSZ A;  4NDB A;  3HX4 A;  1KSM A;  3PSR A;  1JBA A;  1KQV A;  1CMG A;  4GGF C;  4YI8 A;  3EKH A;  1PSB A;  3TDU A;  2KLE A;  1JFJ A;  2LCP A;  3MSE B;  1BT6 A;  1CNP A;  2L98 A;  2M97 A;  2KYC A;  1U5I B;  2LMU A;  3NSL A;  3L47 A;  2WND A;  4PE7 A;  1CTR A;  5JJG A;  1K90 D;  1K93 D;  2E6W A;  1KSO A;  2F3Z A;  2AUC A;  2FCE A;  3FWC A;  3N7H A;  2PMY A;  5CSI A;  2WCL A;  3SG6 A;  1L2O B;  3R72 A;  1EJ3 A;  1NYA A;  1NX1 A;  2M9G A;  2BEC A;  1IJ6 A;  3PN7 B;  1T14 A;  2PAS A;  1XK4 C;  3BYA A;  3EVU A;  3FS7 A;  2KYF A;  2HF5 A;  3NSK A;  2KAX A;  2KSP A;  3D76 A;  1KK7 Z;  2LMV A;  2QPT A;  3SG4 A;  3L4A A;  1REC A;  3FE6 A;  3NGV A;  3FE8 A;  4OV2 A;  1U5I A;  2B1U A;  2LV7 A;  3NSI A;  4GPL B;  1KWO B;  3RZS A;  4NQG A;  2TN4 A;  3VGO A;  4N1G A;  3R1V A;  5BPJ A;  2OPO A;  3EK7 A;  3I5H B;  2AAO A;  4FQO A;  1OZO A;  1SL9 A;  1YUT A;  2WCJ A;  2JQ6 A;  3D74 A;  2KI4 B;  3ICB A;  5I2Q A;  1IQ3 A;  1HT9 A;  2L2C A;  1XVJ A;  4PE0 A;  2RGI A;  3LL8 B;  2L4I A;  2KBI A;  5HKZ A;  1V1G A;  1Q80 A;  1TCF A;  1N65 A;  2K7B A;  1EXR A;  2ZNE A;  4KYN A;  1B4C A;  1ALW A;  1SYM A;  3IF7 A;  1QV1 A;  3UO9 A;  2BBN A;  3KO0 A;  4MRX A;  2YGU A;  3BJH A;  3EK8 A;  3I5I C;  1B8L A;  2OS8 B;  5CPV A;  1K9U A;  3R1O A;  3QRX A;  3BXK A;  2LLS A;  3ZWH A;  1NUB A;  5AAN A;  1NP8 A;  2SAS A;  5I2L A;  1ORG A;  1Y1U A;  3O4Y A;  1M31 A;  2JPT A;  1C7V A;  4CFR A;  5KTY A;  1K9P A;  1BU3 A;  4MZK A;  3EG5 B;  1TNX A;  1XFU O;  2LLU A;  2BCA A;  4I5J A;  3I5F B;  2K7O A;  1J7Q A;  1QS7 A;  1N2D A;  2K60 A;  3BUO B;  3SG5 A;  4DCK A;  1OOG A;  2M0R A;  4CPV A;  1BMO A;  2ZRT A;  1DJI A;  4M2O A;  4GFT A;  1MUX A;  1J7O A;  3DVJ A;  2BBM A;  4I5K A;  1F55 A;  2JNX A;  1JF0 A;  1OW4 A;  2PYQ A;  3PAT A;  2QEO A;  4WRI A;  2H8V A;  1DMO A;  1PRW A;  5AER A;  3VB1 A;  2EC6 B;  1CFD A;  1B8C A;  1CDP A;  1TNP A;  2QEH A;  2QEV A;  3BQ3 A;  2F2O A;  2L0P A;  3S0D A;  1KFX L;  1PSR A;  5IBW A;  1TOP A;  4OZD A;  1TIZ A;  1K96 A;  3B87 A;  1DEK A;  4E68 A;  3E3R A;  1C3Z A;  1LVC D;  1PVB A;  2COL B;  2LUC A;  4AQJ A;  1AK8 A;  3JTD B;  1W7J B;  4INX A;  1Y0V H;  1F8H A;  1K2H A;  2OTG B;  2QAC A;  4ETO A;  4MZJ A;  1OOF A;  3BFH A;  4M2Q A;  3GK1 A;  4TNC A;  3OX5 A;  3FE9 A;  4C0K A;  4DIR A;  1FPW A;  2D8N A;  2P71 A;  1MR8 A;  1B7T Z;  1S3P A;  1MHO A;  2M49 B;  4C0L A;  1BG1 A;  1KQM C;  1F71 A;  2KQY A;  4F0Z B;  1RTP 1;  2MJW B;  3CDN A;  2JXC A;  5FI2 A;  2ISD A;  1QV0 A;  5EL2 A;  2BL0 B;  1IQ5 A;  2JU0 A;  5D69 A;  3EKJ A;  2GTE A;  5B8I B;  1H8B A;  1W7I B;  1LXF C;  3BUX B;  5FI6 A;  1OQP A;  2LVK A;  1ALV A;  3V2L A;  4PHM A;  4I5L B;  3CS1 A;  4P5O E;  1XFV O;  2CXJ A;  2K8M B;  2K61 A;  1Z2C B;  3F45 A;  2MBX A;  3SIB A;  4I5N B;  4OKH A;  1QX7 A;  1WDC C;  1M63 B;  4HRH A;  1A2X A;  1BR4 B;  3SS3 A;  4JKT A;  2K0J A;  2JTT A;  3I5G C;  3DY9 A; 
#chains in the Genus database with same CATH homology
 2FOT A;  4XJK B;  3BUW B;  1CDL A;  1DTL A;  5GQQ C;  1YVH A;  1DGV A;  1RWY A;  1NCX A;  2NZ0 A;  1IH0 A;  1CLL A;  1WRL A;  4M2P A;  4ORA B;  1LIN A;  1QIW A;  2KGB C;  3KEV A;  3AAJ A;  1AJ5 A;  1CMF A;  2V53 A;  2CNP A;  3IQQ A;  1A4P A;  2JNF A;  4AOM A;  1J7P A;  2FJU B;  2GV5 A;  1JFK A;  1IG5 A;  4YI9 A;  1EH2 A;  4U8D A;  1B8R A;  2ZFD A;  1SK6 D;  4N1F A;  4XJK A;  2LHL A;  1F70 A;  5TNC A;  1Y1X A;  1YRT B;  1SMG A;  5F6T A;  2H61 C;  3LK0 A;  5DKN A;  4HRG A;  3FWB A;  2FCD A;  4XYN A;  1X02 A;  2M8U A;  3NXA A;  1FW4 A;  3PM8 A;  2LVI A;  1SCM B;  1YUS A;  1IJ5 A;  5ER5 A;  5D7F A;  1RRO A;  1AJ4 A;  2JOJ A;  1DJY A;  1GGZ A;  1MXL C;  2BE6 A;  1S6J A;  2G2B A;  4PAL A;  4ORB B;  1NX2 A;  3DVM A;  5HYD A;  4PHK A;  2HPS A;  1DJX A;  1V1F A;  2LVJ A;  1KFX S;  2GGM A;  1QIV A;  1BOD A;  2Y4Q A;  1M45 A;  2LHI A;  1DVI A;  1BOC A;  4MSP A;  2KI6 C;  4QJ5 B;  4ICB A;  1UWO A;  2JT3 A;  1A29 A;  1IGV A;  1RFJ A;  1NCY A;  3OX6 A;  4CID A;  1B47 A;  1EG4 A;  1J1E A;  5CSF A;  1E8A A;  1SBJ A;  2P6B B;  3H4S E;  4GGF A;  1H4B A;  3JVT C;  5DKQ A;  1J7R A;  1S6I A;  3C1V A;  2CTN A;  1VRK A;  3CR4 X;  1UHK A;  1A03 A;  1M46 A;  1YUR A;  2KFH A;  1XFY O;  2PVB A;  3OB1 B;  1L7Z A;  1AP4 A;  4A4B A;  3BUM B;  4ZCV A;  2DOQ A;  1AVS A;  3OP0 A;  3RM1 A;  1J55 A;  5AXI A;  1SRA A;  2LE9 B;  1QLK A;  4Q04 A;  2Q91 A;  1MWN A;  1XK4 A;  1AHR A;  3NSO A;  1OSA A;  2MAZ A;  2H2K A;  4MZL A;  1UHI A;  1QLS A;  1KFU L;  2HQ8 A;  3TUY C;  3AAK A;  1FI6 A;  3EK4 A;  4NDC A;  3SG2 A;  1K9K A;  1UHN A;  1PAL A;  3I5I B;  1SR6 C;  1TNQ A;  2JC2 A;  4USL A;  3WNX B;  1KK8 C;  2KFG A;  1LKJ A;  3D0Y B;  1ZAC A;  5HLV A;  3RLZ A;  4DRW A;  2LP3 A;  2M3W A;  2NLN A;  3EVR A;  1DJW A;  2JT0 A;  3BOW B;  1S5G Y;  4N5X A;  1WRZ A;  1HQV A;  3LCP C;  4PE4 A;  3TS5 C;  1ZOT B;  2JZI A;  2ZRS A;  3PAL A;  4OVN F;  3SIA A;  3WXA A;  4F0Z B;  2Y1N A;  4YGE B;  2KAV A;  1DGU A;  2EHB A;  2LAN A;  2M1K B;  2LVV A;  2LP2 A;  2M1U A;  2M7N A;  3IQO A;  1KK7 Y;  1S6C A;  4YGA A;  1R6P A;  1BF5 A;  4PHN A;  1WLZ A;  4CFQ A;  4OCI A;  2LAP A;  4CLN A;  2KAY A;  3BUN B;  4MBE A;  1BLQ A;  2PSR A;  3M0W A;  3OHM B;  3TDI A;  3D0Y A;  1ZFS A;  1SNL A;  3EVV A;  5KU1 A;  4BY4 A;  4MN0 A;  3BOW A;  1JWD A;  1WRK A;  1K8U A;  3D10 A;  3O2P A;  1CFP A;  1L2O C;  3K21 A;  1DF0 B;  2KOT A;  2MLE C;  4IL1 A;  3PN7 C;  1DJH A;  1CLM A;  2KDH A;  3TZ1 A;  1IKU A;  2LNK A;  3HCM A;  3GOF A;  2CBL A;  4AQI A;  1QX5 B;  1XFW O;  2L50 A;  2BE4 A;  3KF9 A;  2I94 A;  3DVE A;  3KPX A;  4GUK A;  2KFF A;  4QJ4 B;  2ZN9 A;  1MXE A;  1LA0 A;  2JXL A;  1JC2 A;  1FF1 A;  1KWO C;  3SJS A;  1YX7 A;  2VRG A;  3VRN A;  1SW8 A;  1XFX O;  4YGB B;  1CKK A;  3I5H C;  2IS9 A;  4DUQ A;  5G08 A;  1XO5 A;  3FIA A;  1KQM B;  2WOR A;  2KI4 C;  2SCP A;  2K2A A;  1R2U A;  1GQM A;  1DF0 A;  2CCM A;  1JUO A;  2PRU A;  5AFP A;  1KCY A;  1CDM A;  3GK4 X;  5ER4 X;  1NSH A;  1NPQ A;  4WQ2 A;  1PVA A;  3WHU B;  1CFF A;  2K7C A;  2EGD A;  5DKR A;  5I2O A;  4BY5 A;  3DD4 A;  4MEW A;  2OS8 C;  1CM4 A;  3CLN A;  1A75 B;  3VRR A;  1QAT A;  2WCE A;  1WDC B;  2ZND A;  3DVK A;  4JWQ A;  2M29 A;  1FBV A;  1OZS A;  3I5G B;  3O6B A;  1S5G Z;  1QVI Y;  5J3X A;  2NXQ A;  2JUL A;  5AEQ A;  4WQ3 A;  2F3Y A;  2F8P A;  4UPG A;  2AMI A;  3I5F C;  5CSN A;  3DF0 B;  2O5G A;  2M7L A;  4ORC B;  5K89 A;  1YUU A;  2LLT A;  1KFU S;  4D1E A;  5HKY A;  4PDZ A;  1S1E A;  1OOJ A;  1DJG A;  5HKW A;  2GGZ A;  1AUI B;  1PUL A;  2KBM A;  2NCO A;  1B7T Y;  2KI6 D;  2PAL A;  1S36 A;  1A75 A;  1GJY A;  2BCX A;  3OB2 B;  2I18 A;  4GAO A;  3SG3 A;  4R1E A;  1IRJ A;  3O78 A;  2A4J A;  2EC6 C;  5HLO A;  1NX0 A;  1PK0 D;  1UUS A;  3A4U B;  1OMR A;  1TCO B;  4NDD A;  1QJT A;  1NCZ A;  3GK2 A;  3VRQ A;  1K94 A;  1IWQ A;  1S26 D;  3DF0 A;  1Y6W A;  4YGD B;  1XA5 A;  1XFZ O;  3JTD C;  1YR5 A;  1WLM A;  1WY9 A;  1UHJ A;  2OTG C;  4FTG A;  2E30 A;  1ZMZ A;  1SKT A;  2BKI B;  2WCB A;  1TNW A;  1OMV A;  3CWG A;  1SL7 A;  1CFC A;  2MHH A;  1ZUZ A;  2CT9 A;  1QAS A;  4GGN A;  2JRF A;  1Y1A A;  5KSZ A;  2Y5I A;  2ZKM X;  1G33 A;  3WHT B;  1D1O A;  2L2E A;  2H61 A;  1C07 A;  1CDN A;  4GNK B;  2I7A A;  3ZNI A;  5I8N A;  3CZT X;  1NX3 A;  2HQW A;  2HET A;  3CR2 A;  3VRP A;  1DT7 B;  4JPZ B;  1OE9 B;  2LUX A;  1FI5 A;  1JF2 A;  5JOL A;  2BL0 C;  1G8I A;  4MVF A;  3PFV A;  3CR5 X;  3KHE A;  4HRE E;  2KGR A;  1NWD A;  4C0J A;  2BKH B;  1QX2 A;  1F4Q A;  4A4C A;  1CLB A;  2F2P A;  2JTZ A;  1J1D A;  4QJ3 B;  1CB1 A;  1RJV A;  2L51 A;  3LLE A;  1MQ1 A;  2KNE A;  1C7W A;  3PLF B;  4ZCU A;  1QXP A;  2G9B A;  4YRU A;  1LA3 A;  1M39 A;  3JVT B;  3TDZ A;  2WOS A;  1BJF A;  1BR1 B;  1QVI Z;  3AKA A;  2WCF A;  4YGC B;  1G4Y R;  1TTX A;  2JT8 A;  1N0Y A;  1DJZ A;  1EG3 A;  1RK9 A;  4PHJ A;  2JWW A;  2LM5 A;  2ZN8 A;  4MRY A;  5FYX A;  1B9A A;  2L5X B;  1K95 A;  1F4O A;  1UHH A;  2O60 A;  4GBA A;  1SCV A;  1F54 A;  1YTZ C;  1NIW A;  2Q4U A;  1EL4 A;  4DS7 A;  2K7D A;  4JQ0 D;  4MLW A;  1TN4 A;  3TUY B;  2F33 A;  1SPY A;  2MRD A;  4OR9 B;  1OMD A;  1TRF A;  2BCB A;  4P2Y B;  1JSA A;  1SY9 A;  1SR6 B;  4PCW A;  1KK8 B;  1GGW A;  5PAL A;  1SL8 A;  3A8R A;  1XYD A;  3LK1 A;  1ODB A;  1YX8 A;  2I2R E;  3VRO A;  5CSJ A;  2K2F A;  2MA2 A;  3SG7 A;  3CTN A;  1B1G A;  2L4H A;  1UP5 A;  1YVL A;  2WC8 A;  2KQ6 A;  3TS5 B;  1SCM C;  2NCP A;  4PE1 A;  1UUR A;  1YRU B;  2KHN A;  3AKB A;  1QTX A;  3CGA A;  2MLF C;  4YBH B;  1MF8 B;  4L9M A;  2LC5 A;  2LMT A;  1CM1 A;  2R2I A;  2Y1M A;  4HSZ A;  4NDB A;  3HX4 A;  1KSM A;  3PSR A;  1JBA A;  1KQV A;  1CMG A;  4GGF C;  4YI8 A;  3EKH A;  1PSB A;  3TDU A;  1JFJ A;  2LCP A;  3MSE B;  1BT6 A;  1CNP A;  2L98 A;  2M97 A;  2KYC A;  1U5I B;  2LMU A;  3NSL A;  2WND A;  4PE7 A;  1CTR A;  5JJG A;  1K90 D;  1K93 D;  2E6W A;  1KSO A;  2F3Z A;  2AUC A;  2FCE A;  3FWC A;  5CSI A;  2PMY A;  3SG6 A;  1L2O B;  1EJ3 A;  1NYA A;  1NX1 A;  2M9G A;  2BEC A;  1IJ6 A;  3PN7 B;  2PAS A;  1XK4 C;  3BYA A;  3EVU A;  3FS7 A;  2KYF A;  2HF5 A;  3NSK A;  2KAX A;  2KSP A;  1KK7 Z;  2LMV A;  2QPT A;  3SG4 A;  1REC A;  4OV2 A;  1U5I A;  2B1U A;  2LV7 A;  3NSI A;  4GPL B;  1KWO B;  4NQG A;  2TN4 A;  3VGO A;  4N1G A;  5BPJ A;  2OPO A;  3EK7 A;  3I5H B;  2AAO A;  4FQO A;  1OZO A;  1SL9 A;  1YUT A;  2JQ6 A;  3ICB A;  2KI4 B;  5I2Q A;  1IQ3 A;  1HT9 A;  1XVJ A;  4PE0 A;  2RGI A;  3LL8 B;  2L4I A;  2KBI A;  5HKZ A;  1V1G A;  1Q80 A;  1TCF A;  1N65 A;  2K7B A;  1EXR A;  2ZNE A;  1B4C A;  1ALW A;  1SYM A;  3IF7 A;  1QV1 A;  2BBN A;  3KO0 A;  4MRX A;  3EK8 A;  3I5I C;  1B8L A;  2OS8 B;  5CPV A;  1K9U A;  3QRX A;  3BXK A;  2LLS A;  3ZWH A;  1NUB A;  5AAN A;  1NP8 A;  2SAS A;  5I2L A;  1Y1U A;  3O4Y A;  1M31 A;  2JPT A;  1C7V A;  4CFR A;  5KTY A;  1K9P A;  1BU3 A;  4MZK A;  1TNX A;  1XFU O;  2LLU A;  2BCA A;  4I5J A;  3I5F B;  2K7O A;  1J7Q A;  1QS7 A;  1N2D A;  3BUO B;  3SG5 A;  4DCK A;  2M0R A;  4CPV A;  1BMO A;  2ZRT A;  1DJI A;  4M2O A;  4GFT A;  1MUX A;  1J7O A;  3DVJ A;  2BBM A;  4I5K A;  1F55 A;  2JNX A;  1JF0 A;  3PAT A;  4WRI A;  1DMO A;  1PRW A;  5AER A;  2EC6 B;  1CFD A;  1B8C A;  1CDP A;  1TNP A;  3BQ3 A;  2F2O A;  2L0P A;  1KFX L;  1PSR A;  5IBW A;  1TOP A;  1TIZ A;  1K96 A;  4E68 A;  3E3R A;  1LVC D;  1PVB A;  2COL B;  4AQJ A;  2LUC A;  1AK8 A;  3JTD B;  1W7J B;  1F8H A;  1Y0V H;  1K2H A;  2OTG B;  2QAC A;  4ETO A;  4MZJ A;  4M2Q A;  3GK1 A;  4TNC A;  3OX5 A;  4C0K A;  4DIR A;  1FPW A;  2D8N A;  1MR8 A;  1B7T Z;  1S3P A;  1MHO A;  2M49 B;  4C0L A;  1BG1 A;  1KQM C;  1F71 A;  2KQY A;  1RTP 1;  2MJW B;  2JXC A;  2ISD A;  1QV0 A;  2BL0 B;  1IQ5 A;  2JU0 A;  5D69 A;  3EKJ A;  5B8I B;  1H8B A;  1W7I B;  1LXF C;  3BUX B;  1OQP A;  2LVK A;  1ALV A;  4PHM A;  4I5L B;  3CS1 A;  4P5O E;  1XFV O;  2CXJ A;  2K8M B;  2K61 A;  3F45 A;  2MBX A;  3SIB A;  4I5N B;  4OKH A;  1QX7 A;  1WDC C;  1M63 B;  4HRH A;  1A2X A;  1BR4 B;  2K0J A;  2JTT A;  3I5G C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...