3ICBA

The refined structure of vitamin d-dependent calcium-binding protein from bovine intestine. molecular details, ion binding, and implications for the structure of other calcium-binding proteins
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
75
structure length
75
Chain Sequence
b'KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALCIUM-BINDING PROTEIN
publication title The refined structure of vitamin D-dependent calcium-binding protein from bovine intestine. Molecular details, ion binding, and implications for the structure of other calcium-binding proteins.
pubmed rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 18
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1986-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3icbA00
3PN7C 1UUSA 2VRGA 4A4BA 3CS1A 1YVLA 2CTNA 2OPOA 3OHMB 1YUSA 1CDNA 2BCXA 1U5IB 1JWDA 1RK9A 3BYAA 3GK1A 2MRDA 1KK7Y 1SL9A 1BOCA 2BBMA 4DRWA 3LLEA 1XFXO 2KSPA 3NXAA 1F4OA 2JZIA 1EJ3A 2L4IA 2Q4UA 3VGOA 5I2LA 3KHEA 1QVIY 5F6TA 1XFYO 3OX5A 1UHIA 2ISDA 2L0PA 1WDCB 1YVHA 1RECA 1WRZA 1KWOB 1JF0A 1NSHA 1N0YA 1IG5A 1SYMA 3BUWB 1IQ3A 2LUCA 2KI4C 4HSZA 3O78A 1F8HA 2BE4A 3I5GB 4PHKA 1FPWA 1JFKA 1G33A 4PALA 3D10A 3FWBA 2F33A 5CSFA 1SL8A 1BR1B 3TS5B 1DJYA 4TNCA 1AJ4A 3VRQA 1RTP1 4I5LB 2MLFC 2PMYA 1Y1AA 4C0JA 1XYDA 1F4QA 2COLB 3TDUA 2JT8A 2ZFDA 4PE1A 4U8DA 3PATA 2LHLA 2JPTA 1JSAA 2G2BA 4MEWA 2AUCA 3KF9A 2WCEA 1EG4A 2K2FA 2L51A 1CFCA 1A75A 4MVFA 1JFJA 1YTZC 2L50A 2L4HA 2M97A 1GJYA 3TUYC 2KQYA 1NX2A 1TTXA 3O2PA 1M31A 1KFXL 1SR6B 4YGAA 1AP4A 1S26D 1DMOA 3AAJA 1EL4A 1IJ5A 3BOWB 2M7LA 3ZWHA 2KOTA 3LCPC 2I7AA 2Y4QA 3OB2B 2QACA 3LL8B 1XA5A 1SPYA 4NDCA 2K8MB 2TN4A 2K7BA 1HT9A 1J7OA 1CLLA 1J7QA 1PRWA 1QXPA 1KK8C 2K7CA 2LP2A 2M3WA 2JNFA 3DVJA 2GGZA 3EVUA 2L5XB 3HCMA 1M39A 1UWOA 3PLFB 4YGCB 3TZ1A 1K96A 5CSNA 2KGBC 1IJ6A 3PN7B 1YX8A 2LLUA 1NX0A 1XFWO 4HRGA 4GNKB 3I5GC 4IL1A 3D0YB 5G08A 1FBVA 1U5IA 1NYAA 3CR5X 2BKIB 2BCBA 2JWWA 1CFFA 4ZCUA 1Q80A 4OKHA 2HETA 1AHRA 2F3ZA 3K21A 1B7TZ 1J1EA 1E8AA 2JULA 3WXAA 1Y1UA 2LAPA 1AVSA 1UP5A 2KHNA 2PVBA 3EVRA 2M9GA 4ETOA 1AJ5A 3MSEB 5I2QA 2LMVA 2KAXA 2KI4B 3OB1B 4MSPA 1BLQA 3EK7A 1YRTB 1ZFSA 3O6BA 1L7ZA 2ZNDA 1SW8A 1SKTA 2KI6C 4C0LA 1EG3A 1IH0A 4NDBA 2G9BA 3AKBA 3VRPA 4ORAB 3DVKA 4GBAA 2KAVA 1J7RA 2OTGC 3RM1A 1WRKA 1MHOA 1UHHA 1LA3A 1PK0D 1M45A 1CMFA 4GPLB 1FW4A 5CSJA 1TNXA 2O60A 2K7DA 2L2EA 1JF2A 1QLSA 1LXFC 1QV1A 1ZACA 1XK4C 2LMTA 1CNPA 3PFVA 5AERA 4OVNF 1YX7A 5AANA 4ORBB 5IBWA 4DIRA 2E6WA 3TUYB 5DKRA 1QIWA 3EK4A 1MXLC 1TCOB 3NSLA 5GQQC 1PVBA 2JQ6A 3BOWA 3BUOB 1DGUA 1BT6A 4P2YB 2KYFA 2NCOA 5D69A 4QJ5B 1AK8A 1SCVA 2F3YA 2JTZA 5HLOA 3RLZA 1A03A 1S3PA 4PHMA 4PCWA 4UPGA 1GGWA 2MA2A 1TRFA 1KK8B 1WY9A 2ZRTA 4GFTA 4PE0A 1F71A 2PRUA 1MUXA 1BODA 4WQ3A 1B47A 3VROA 2LNKA 4P5OE 2KNEA 1NWDA 2MAZA 1W7IB 2A4JA 1RROA 1OZSA 2KBMA 1EH2A 1QATA 3BUXB 1HQVA 2ZN9A 4WRIA 2KGRA 2JNXA 4I5KA 1DT7B 4XJKA 1PULA 2M8UA 1YR5A 2M29A 2ZNEA 2LVJA 5HLVA 5D7FA 2D8NA 3H4SE 3OX6A 3SIBA 1OSAA 3CLNA 3AKAA 1NCZA 3DF0A 3ZNIA 1KQMC 2WNDA 2LC5A 4MLWA 1S5GY 1ZMZA 2LVIA 4NDDA 2KDHA 3TDZA 1S36A 4N1FA 2LCPA 2OTGB 4BY4A 2IS9A 2KFFA 1CTRA 1QLKA 3LK0A 3E3RA 1AUIB 2E30A 3OP0A 3ICBA 4F0ZB 1DF0A 1CMGA 1F55A 2JC2A 1KFXS 1D1OA 1SCMC 3VRRA 4MRYA 4MBEA 1N65A 2Y5IA 1BU3A 5KTYA 1PSBA 3GK2A 4FQOA 2F8PA 1LA0A 1NCYA 2BECA 1K9PA 4OR9B 3IQOA 5HKWA 4AOMA 1V1FA 1IRJA 1NX3A 2H61A 2M7NA 1MF8B 3HX4A 1QX2A 4QJ4B 2QPTA 4CFQA 1WLMA 2JTTA 1KCYA 2KFGA 4CFRA 2B1UA 4WQ2A 1OOJA 2EHBA 5DKNA 2PALA 1QV0A 1CM4A 1B7TY 1ODBA 3CR2A 2K2AA 4AQJA 2HPSA 1ALVA 1NP8A 1ZOTB 1OZOA 1M63B 1UHJA 3EK8A 1A29A 1IGVA 5DKQA 3VRNA 2Q91A 4PHNA 2Y1NA 1IWQA 4XYNA 2DOQA 2BCAA 1NIWA 3EKJA 4JQ0D 2KBIA 1YUUA 2FJUB 2LLSA 1C07A 2K61A 2GV5A 2LANA 1OMDA 1BJFA 4OV2A 1XVJA 1CLMA 3JVTC 1A2XA 1FF1A 1CFPA 2LHIA 1J1DA 1DGVA 2I2RE 3C1VA 5TNCA 1A4PA 1QJTA 2LLTA 2PSRA 1R6PA 3I5HC 4USLA 5B8IB 2EC6C 3F45A 3WNXB 1Y0VH 4GGFC 1H4BA 1RFJA 1KQMB 3EVVA 3LK1A 2O5GA 1OQPA 1Y6WA 3AAKA 2HF5A 5HYDA 4GUKA 3BUNB 1BG1A 1A75B 1NX1A 1VRKA 1DJHA 4HREE 2AAOA 3DVEA 1H8BA 1DJIA 1PVAA 2CBLA 3SIAA 2ZKMX 2K0JA 3GK4X 1TCFA 4PHJA 1C7WA 2I18A 1RWYA 1MQ1A 5I2OA 3A4UB 3KEVA 3PALA 2JXLA 4OCIA 3BUMB 1XK4A 2M1KB 1SCMB 2KYCA 4L9MA 5CSIA 1TIZA 2WC8A 3CGAA 1SRAA 1TNWA 3DD4A 1K94A 4DUQA 4CLNA 5I8NA 3PM8A 4PE4A 3KPXA 4YI8A 1BR4B 4MRXA 1MWNA 3O4YA 4GAOA 1SK6D 1CDLA 1FI5A 1CB1A 1IQ5A 1TOPA 4YGBB 5K89A 3A8RA 4ICBA 1LKJA 1MXEA 2LUXA 3D0YA 4DCKA 1CDPA 2BL0C 4Q04A 2MLEC 4MZJA 1IKUA 1LVCD 4MZKA 1F70A 1KK7Z 4ZCVA 3JTDC 3IF7A 1OMRA 2BE6A 3PSRA 1LINA 1DJGA 3SJSA 1K9UA 1DTLA 1SNLA 4MN0A 2P6BB 1UHNA 2WCFA 3NSOA 2EGDA 1FI6A 3SG5A 1QVIZ 2M49B 2CT9A 5AFPA 1S1EA 1DJXA 5HKZA 3NSIA 1B9AA 2SASA 3SG4A 2NLNA 2V53A 5KSZA 1GQMA 1PALA 5JOLA 1NPQA 1L2OC 2KAYA 4FTGA 5ER4X 3JVTB 4E68A 1C7VA 1CDMA 2NCPA 1K90D 4GGNA 1B4CA 2LM5A 1XO5A 3BQ3A 1NCXA 4M2QA 3I5HB 4JWQA 2OS8C 1QASA 2EC6B 3CR4X 4DS7A 2GGMA 4YGEB 1KQVA 1K9KA 2FOTA 1J55A 5AEQA 1SY9A 1SL7A 2CCMA 1EXRA 4A4CA 2LP3A 2F2OA 1S5GZ 1SMGA 2RGIA 5BPJA 1JBAA 3I5IC 3IQQA 1CLBA 3I5FC 2MHHA 2H61C 4M2OA 1YRUB 1WRLA 2BBNA 5JJGA 1NUBA 5HKYA 2ZRSA 2I94A 2HQWA 3EKHA 4PE7A 3CTNA 4MZLA 3SG2A 4NQGA 4YBHB 2M0RA 3CZTX 5J3XA 1S6IA 1M46A 1DJZA 2ZN8A 4I5NB 4AQIA 3DVMA 2CXJA 3GOFA 2K7OA 1TNQA 4YGDB 4I5JA 3FIAA 2PASA 1OE9B 2MJWB 1K95A 1WLZA 1K8UA 3KO0A 4JPZB 2KQ6A 1WDCC 4PDZA 1KWOC 1UHKA 2WOSA 2KI6D 1MR8A 2JXCA 5CPVA 1XFUO 1G8IA 1K2HA 2JRFA 2JT0A 4N1GA 1QX5B 2BL0B 2LE9B 5AXIA 3SG3A 1QIVA 4YRUA 4QJ3B 4N5XA 1PSRA 4R1EA 4ORCB 1OMVA 1KSOA 3QRXA 5FYXA 1GGZA 3JTDB 3TS5C 1B1GA 5PALA 1SBJA 3NSKA 4XJKB 1CKKA 2LVVA 3BXKA 5ER5A 1CFDA 1YURA 2LMUA 2NXQA 3WHTB 2F2PA 2NZ0A 2WCBA 2MBXA 2JT3A 2KFHA 1XFZO 3DF0B 4BY5A 1B8LA 4CIDA 1KFUL 1N2DA 2AMIA 1CM1A 1X02A 1JC2A 5KU1A 2FCEA 1Y1XA 3WHUB 1BMOA 1UURA 1L2OB 1RJVA 2BKHB 1QX7A 1F54A 1DVIA 1KFUS 1ALWA 3SG6A 2WORA 1SR6C 1DJWA 1B8CA 2LVKA 2CNPA 2JOJA 2OS8B 1K93D 2FCDA 2HQ8A 4D1EA 4CPVA 1XFVO 4HRHA 2Y1MA 1DF0B 1TNPA 1QTXA 4GGFA 1J7PA 1ZUZA 1G4YR 1BF5A 4M2PA 2JU0A 2L98A 2H2KA 4C0KA 1YUTA 1TN4A 2M1UA 3M0WA 3SG7A 1B8RA 1S6JA 1V1GA 1S6CA 3TDIA 2LV7A 2R2IA 1W7JB 1KSMA 1QS7A 4YI9A 3I5IB 1R2UA 3I5FB 3FWCA 1JUOA 2SCPA 3FS7A 3CWGA
chains in the Genus database with same CATH superfamily
3D73A 3PN7C 1UUSA 2VRGA 4A4BA 3CS1A 1YVLA 2CTNA 2OPOA 3OHMB 1YUSA 3B7AA 2BCXA 1U5IB 2H8VA 1CDNA 1RK9A 3BYAA 3GK1A 1JWDA 2MRDA 1KK7Y 1SL9A 1BOCA 2BBMA 4DRWA 3LLEA 1XFXO 2KSPA 3NHIA 3NXAA 1F4OA 2JZIA 1EJ3A 2L4IA 2Q4UA 3VGOA 5I2LA 3KHEA 1QVIY 5F6TA 1XFYO 3OX5A 1UHIA 5FI6A 2L0PA 2ISDA 1WDCB 1YVHA 1RECA 1WRZA 1KWOB 1JF0A 1Z2CB 1NSHA 1N0YA 1IG5A 1SYMA 3BUWB 1IQ3A 2LUCA 2KI4C 4HSZA 3O78A 1F8HA 2BE4A 3I5GB 4KYNA 4PHKA 1JFKA 1G33A 1DC1A 3R72A 4PALA 3D10A 3D78A 2F33A 3FWBA 5CSFA 1SL8A 1OW4A 1BR1B 3B88A 1DJYA 4TNCA 1AJ4A 3TS5B 3VRQA 1RTP1 4I5LB 2MLFC 2PMYA 1Y1AA 4C0JA 3D76A 3L4AA 1XYDA 5DICA 2WC5A 1F4QA 2COLB 2QEOA 1ORGA 3FE8A 3TDUA 2JT8A 2ZFDA 4PE1A 4U8DA 3PATA 2LHLA 2JPTA 1JSAA 2G2BA 4MEWA 3CZ1A 2AUCA 3KF9A 2WCEA 1EG4A 2K2FA 2L51A 1CFCA 1A75A 4MVFA 1JFJA 1YTZC 2L50A 2L4HA 2M97A 1GJYA 3TUYC 2KQYA 1NX2A 1TTXA 3O2PA 1M31A 1KFXL 1SR6B 4YGAA 1AP4A 1S26D 1DMOA 3AAJA 1EL4A 1IJ5A 3BOWB 2M7LA 3ZWHA 2KOTA 3NHTA 2L5YA 3LCPC 2I7AA 3CZ0A 2Y4QA 3OB2B 2QACA 3LL8B 1XA5A 1SPYA 4NDCA 2K8MB 2TN4A 2K7BA 1HT9A 1J7OA 1CLLA 1J7QA 1PRWA 1QXPA 2YGUA 1KK8C 2K7CA 2LP2A 2M3WA 2JNFA 3DVJA 2GGZA 3EVUA 2L5XB 3HCMA 3Q8IA 1M39A 1UWOA 3PLFB 4YGCB 3TZ1A 1K96A 3FE6A 5CSNA 2KGBC 1IJ6A 3UO9A 3PN7B 1YX8A 2LLUA 1NX0A 1XFWO 4HRGA 4GNKB 3I5GC 3S0GA 4IL1A 3D0YB 5G08A 1FBVA 1U5IA 1NYAA 3CR5X 2BKIB 2BCBA 2JWWA 1CFFA 4ZCUA 1Q80A 4OKHA 2HETA 1AHRA 2F3ZA 3K21A 1C3ZA 1B7TZ 1J1EA 1E8AA 1FPWA 2JULA 3WXAA 1Y1UA 2LAPA 1AVSA 1UP5A 2KHNA 2PVBA 3N7HA 3EVRA 2M9GA 4ETOA 1AJ5A 3MSEB 5I2QA 2LMVA 2KAXA 2KI4B 3OB1B 4MSPA 1BLQA 3EK7A 1YRTB 3B87A 1ZFSA 3O6BA 1L7ZA 2ZNDA 1SW8A 1SKTA 2KI6C 4C0LA 1EG3A 1IH0A 5D3OA 4NDBA 2G9BA 3AKBA 3VRPA 4ORAB 3DVKA 4GBAA 2KAVA 1J7RA 2OTGC 3RM1A 3BFHA 1WRKA 1MHOA 1UHHA 1LA3A 1PK0D 1M45A 1CMFA 4GPLB 1FW4A 5CSJA 1TNXA 2O60A 3QMEA 2K7DA 2L2EA 1JF2A 1QLSA 1LXFC 1QV1A 1ZACA 1XK4C 2LMTA 1CNPA 3CABA 3PFVA 5AERA 4OVNF 1YX7A 5AANA 3UNWA 4ORBB 3VB1A 5IBWA 4DIRA 2E6WA 3B86A 3TUYB 5DKRA 1QIWA 3DYEA 1MXLC 1TCOB 3EK4A 3NSLA 1PVBA 5GQQC 2JQ6A 5FI2A 3BOWA 3BUOB 1DGUA 1BT6A 4P2YB 2KYFA 2NCOA 3BJHA 5D69A 4QJ5B 1AK8A 1LS8A 1SCVA 2F3YA 2JTZA 1OOGA 5HLOA 3SG7A 3RLZA 1OOHA 1A03A 3S0AA 1TWOA 1S3PA 4PHMA 4PCWA 4UPGA 1GGWA 2MA2A 1TRFA 1KK8B 4INWA 1WY9A 2ZRTA 2QEHA 4GFTA 4PE0A 2BAPA 2PRUA 1MUXA 1BODA 1F71A 4WQ3A 1B47A 3VROA 2LNKA 4P5OE 2KNEA 1NWDA 2MAZA 3CYZA 1W7IB 2PYQA 2A4JA 1RROA 1OZSA 2KBMA 1EH2A 1QATA 3BUXB 1HQVA 2WCJA 2ZN9A 4WRIA 2KGRA 2JNXA 5HL1A 4I5KA 1DT7B 4XJKA 1PULA 2M8UA 1YR5A 2M29A 2ERBA 2LVJA 2ZNEA 1QWVA 5D7FA 2D8NA 3H4SE 5HLVA 3OX6A 3SIBA 1OSAA 3CLNA 3IVTA 3R1OA 3AKAA 1NCZA 3DF0A 3ZNIA 3B6XA 1KQMC 2WNDA 2LC5A 4MLWA 1S5GY 1ZMZA 2LVIA 3FE9A 4NDDA 2KDHA 3TDZA 1S36A 4N1FA 1P28A 2LCPA 1IIOA 2OTGB 4BY4A 2IS9A 2KFFA 1CTRA 1QLKA 3LK0A 3E3RA 1AUIB 2E30A 2GTEA 3OP0A 3ICBA 4F0ZB 1DF0A 1CMGA 1F55A 2JC2A 1KFXS 1D1OA 1C3YA 1SCMC 3VRRA 3D77A 2WCMA 4MRYA 4MBEA 1N65A 2Y5IA 4F7FA 1GM0A 1BU3A 5KTYA 1PSBA 3GK2A 4FQOA 2F8PA 3L4LA 1LA0A 1NCYA 1K9PA 2BECA 3CZ2A 3IQOA 4OR9B 5HKWA 1V1FA 1IRJA 1NX3A 2H61A 4INXA 4AOMA 2M7NA 1MF8B 3HX4A 1QX2A 4QJ4B 2QPTA 4CFQA 1WLMA 2JTTA 5EL2A 1KCYA 3RZSA 2KFGA 4CFRA 2B1UA 2PQLA 4WQ2A 1OOJA 2EHBA 5DKNA 2PALA 1QV0A 1CM4A 1B7TY 1ODBA 3CR2A 2K2AA 4AQJA 2HPSA 1ALVA 1NP8A 1ZOTB 1OZOA 1M63B 1UHJA 3EK8A 1A29A 3NGVA 1IGVA 1T14A 5DKQA 3VRNA 2Q91A 4PHNA 2Y1NA 1IWQA 4XYNA 2DOQA 2BCAA 1NIWA 3EKJA 4JQ0D 2KBIA 1Z4HA 1YUUA 3DZTA 2FJUB 2LLSA 1C07A 2K61A 2GV5A 2LANA 1OMDA 1BJFA 4OV2A 2KLEA 1XVJA 1CLMA 3JVTC 1A2XA 1FF1A 1CFPA 2LHIA 1J1DA 1DGVA 2I2RE 3C1VA 5TNCA 1A4PA 1QJTA 2LLTA 2PSRA 3K1EA 1R6PA 3I5HC 3SS5A 4USLA 5B8IB 2EC6C 3F45A 1XFRA 3WNXB 1Y0VH 4GGFC 1H4BA 1RFJA 3R1PA 1KQMB 3EVVA 3LK1A 2O5GA 1OQPA 1Y6WA 3AAKA 2HF5A 5HYDA 4GUKA 3BUNB 2KLDA 1BG1A 1A75B 1NX1A 1VRKA 1DJHA 4HREE 2AAOA 3DVEA 1H8BA 1DJIA 1DQEA 1PVAA 2CBLA 3SIAA 5FI7A 2ZKMX 2K0JA 3GK4X 1TCFA 4PHJA 1C7WA 2I18A 1RWYA 1MQ1A 5I2OA 3A4UB 3KEVA 3PALA 2JXLA 4OCIA 3BUMB 1XK4A 2M1KB 1SCMB 2KYCA 4L9MA 5CSIA 1TIZA 2WC8A 3CGAA 1SRAA 1TNWA 3DD4A 1K94A 3BFAA 3D74A 4DUQA 4CLNA 5I8NA 3PM8A 4PE4A 3KPXA 4YI8A 1BR4B 2QEVA 4MRXA 1MWNA 1W9ZA 3O4YA 4GAOA 1SK6D 1CDLA 1FI5A 2P70A 2KPHA 1CB1A 1TUZA 1IQ5A 1TOPA 4YGBB 5K89A 3A8RA 4ICBA 1LKJA 1MXEA 2LUXA 3D0YA 4DCKA 1CDPA 2BL0C 4Q04A 2MLEC 4MZJA 3BFBA 1IKUA 1LVCD 4MZKA 1F70A 1KK7Z 4ZCVA 3JTDC 3IF7A 1OMRA 2BE6A 3PSRA 1LINA 1DJGA 3SJSA 1K9UA 1DTLA 1SNLA 4MN0A 2P6BB 1UHNA 2WCFA 3NSOA 2EGDA 5I94A 1FI6A 3SG5A 1QVIZ 2M49B 2CT9A 5AFPA 1S1EA 1DJXA 5HKZA 3NSIA 1B9AA 2SASA 3SG4A 2NLNA 2V53A 5KSZA 1GQMA 1PALA 5JOLA 1NPQA 1L2OC 2KAYA 4FTGA 5ER4X 3JVTB 4E68A 1C7VA 1CDMA 2NCPA 1K90D 4GGNA 1B4CA 2LM5A 3L47A 1XO5A 3BQ3A 1NCXA 4M2QA 3I5HB 4JWQA 2OS8C 1QASA 2EC6B 3CR4X 4DS7A 2GGMA 4YGEB 1KQVA 1K9KA 2FOTA 1J55A 5AEQA 1SY9A 1SL7A 2CCMA 1EXRA 4A4CA 2LP3A 1SSEB 2F2OA 2K60A 3S0BA 1S5GZ 1SMGA 2RGIA 5BPJA 1TUJA 2L2CA 3PM2A 1JBAA 3I5IC 3IQQA 1CLBA 3I5FC 2MHHA 2H61C 4M2OA 1YRUB 2P71A 1WRLA 2BBNA 5JJGA 4PT1A 1NUBA 5HKYA 2ZRSA 2I94A 3EG5B 2WCLA 2HQWA 2BNXA 3EKHA 3V2LA 4PE7A 3CTNA 4MZLA 2QEBA 3SG2A 4NQGA 4YBHB 2M0RA 3CZTX 5J3XA 1S6IA 1M46A 1DJZA 2ZN8A 3OGNA 4I5NB 4AQIA 3DVMA 2CXJA 2QDIA 3GOFA 2K7OA 1TNQA 4YGDB 4I5JA 2FJYA 3FIAA 2PASA 1OE9B 2MJWB 1K95A 1WLZA 1K8UA 3KO0A 4JPZB 2KQ6A 1OOIX 1WDCC 4PDZA 1KWOC 1UHKA 2WOSA 2KI6D 4JD9A 1MR8A 2JXCA 5CPVA 1XFUO 1G8IA 1K2HA 3SS4A 4JKTA 2JRFA 2JT0A 4N1GA 1QX5B 2BL0B 2LE9B 5AXIA 3SG3A 1QIVA 3D75A 4YRUA 4QJ3B 4N5XA 1PSRA 4R1EA 4ORCB 1OMVA 1KSOA 2WCKA 3QRXA 1GGZA 2WC6A 3JTDB 5FYXA 3TS5C 1B1GA 5PALA 1SBJA 3NSKA 3R1VA 4XJKB 1CKKA 2LVVA 3BXKA 5ER5A 1CFDA 1YURA 2LMUA 2NXQA 3WHTB 2F2PA 2NZ0A 2WCBA 2MBXA 4IJ7A 3PJIA 1DEKA 2JT3A 2KFHA 1XFZO 3DF0B 4BY5A 1B8LA 4CIDA 3SS3A 1KFUL 4OZDA 1N2DA 1X02A 1CM1A 2AMIA 1JC2A 5KU1A 2FCEA 1Y1XA 3DXLA 1BMOA 1UURA 1L2OB 1RJVA 2BKHB 3WHUB 1QX7A 1F54A 1DELA 3S0FA 1DVIA 1KFUS 3O4XA 3OBVA 1ALWA 3SG6A 1OOFA 2WORA 1SR6C 1DJWA 1B8CA 2LVKA 3S0DA 2CNPA 2JOJA 2OS8B 1K93D 2FCDA 2HQ8A 4D1EA 4CPVA 1XFVO 4HRHA 2Y1MA 1DF0B 1TNPA 2JPOA 1QTXA 4GGFA 1J7PA 1ZUZA 1G4YR 4FQTA 1BF5A 4M2PA 2JU0A 3S0EA 2L98A 2H2KA 4C0KA 1YUTA 1TN4A 2M1UA 2WCHA 3CDNA 1B8RA 3M0WA 1S6JA 1V1GA 1S6CA 3DY9A 3TDIA 2LV7A 2R2IA 1W7JB 1KSMA 1QS7A 4YI9A 3I5IB 1R2UA 3I5FB 3FWCA 1JUOA 2SCPA 3FS7A 3CWGA
chains in the Genus database with same CATH topology
3PN7C 1UUSA 2VRGA 4A4BA 3CS1A 1YVLA 2CTNA 2OPOA 3OHMB 1YUSA 1CDNA 2BCXA 1U5IB 1JWDA 1RK9A 3BYAA 3GK1A 2MRDA 1KK7Y 1SL9A 1BOCA 2BBMA 4DRWA 3LLEA 1XFXO 2KSPA 3NXAA 1F4OA 2JZIA 1EJ3A 2L4IA 2Q4UA 3VGOA 5I2LA 3KHEA 1QVIY 5F6TA 1XFYO 3OX5A 1UHIA 2ISDA 2L0PA 1WDCB 1YVHA 1RECA 1WRZA 1KWOB 1JF0A 1NSHA 1N0YA 1IG5A 1SYMA 3BUWB 1IQ3A 2LUCA 2KI4C 4HSZA 3O78A 1F8HA 2BE4A 3I5GB 4PHKA 1FPWA 1JFKA 1G33A 4PALA 3D10A 3FWBA 2F33A 5CSFA 1SL8A 1BR1B 3TS5B 1DJYA 4TNCA 1AJ4A 3VRQA 1RTP1 4I5LB 2MLFC 2PMYA 1Y1AA 4C0JA 1XYDA 1F4QA 2COLB 3TDUA 2JT8A 2ZFDA 4PE1A 4U8DA 3PATA 2LHLA 2JPTA 1JSAA 2G2BA 4MEWA 2AUCA 3KF9A 2WCEA 1EG4A 2K2FA 2L51A 1CFCA 1A75A 4MVFA 1JFJA 1YTZC 2L50A 2L4HA 2M97A 1GJYA 3TUYC 2KQYA 1NX2A 1TTXA 3O2PA 1M31A 1KFXL 1SR6B 4YGAA 1AP4A 1S26D 1DMOA 3AAJA 1EL4A 1IJ5A 3BOWB 2M7LA 3ZWHA 2KOTA 3LCPC 2I7AA 2Y4QA 3OB2B 2QACA 3LL8B 1XA5A 1SPYA 4NDCA 2K8MB 2TN4A 2K7BA 1HT9A 1J7OA 1CLLA 1J7QA 1PRWA 1QXPA 1KK8C 2K7CA 2LP2A 2M3WA 2JNFA 3DVJA 2GGZA 3EVUA 2L5XB 3HCMA 1M39A 1UWOA 3PLFB 4YGCB 3TZ1A 1K96A 5CSNA 2KGBC 1IJ6A 3PN7B 1YX8A 2LLUA 1NX0A 1XFWO 4HRGA 4GNKB 3I5GC 4IL1A 3D0YB 5G08A 1FBVA 1U5IA 1NYAA 3CR5X 2BKIB 2BCBA 2JWWA 1CFFA 4ZCUA 1Q80A 4OKHA 2HETA 1AHRA 2F3ZA 3K21A 1B7TZ 1J1EA 1E8AA 2JULA 3WXAA 1Y1UA 2LAPA 1AVSA 1UP5A 2KHNA 2PVBA 3EVRA 2M9GA 4ETOA 1AJ5A 3MSEB 5I2QA 2LMVA 2KAXA 2KI4B 3OB1B 4MSPA 1BLQA 3EK7A 1YRTB 1ZFSA 3O6BA 1L7ZA 2ZNDA 1SW8A 1SKTA 2KI6C 4C0LA 1EG3A 1IH0A 4NDBA 2G9BA 3AKBA 3VRPA 4ORAB 3DVKA 4GBAA 2KAVA 1J7RA 2OTGC 3RM1A 1WRKA 1MHOA 1UHHA 1LA3A 1PK0D 1M45A 1CMFA 4GPLB 1FW4A 5CSJA 1TNXA 2O60A 2K7DA 2L2EA 1JF2A 1QLSA 1LXFC 1QV1A 1ZACA 1XK4C 2LMTA 1CNPA 3PFVA 5AERA 4OVNF 1YX7A 5AANA 4ORBB 5IBWA 4DIRA 2E6WA 3TUYB 5DKRA 1QIWA 3EK4A 1MXLC 1TCOB 3NSLA 5GQQC 1PVBA 2JQ6A 3BOWA 3BUOB 1DGUA 1BT6A 4P2YB 2KYFA 2NCOA 5D69A 4QJ5B 1AK8A 1SCVA 2F3YA 2JTZA 5HLOA 3RLZA 1A03A 1S3PA 4PHMA 4PCWA 4UPGA 1GGWA 2MA2A 1TRFA 1KK8B 1WY9A 2ZRTA 4GFTA 4PE0A 1F71A 2PRUA 1MUXA 1BODA 4WQ3A 1B47A 3VROA 2LNKA 4P5OE 2KNEA 1NWDA 2MAZA 1W7IB 2A4JA 1RROA 1OZSA 2KBMA 1EH2A 1QATA 3BUXB 1HQVA 2ZN9A 4WRIA 2KGRA 2JNXA 4I5KA 1DT7B 4XJKA 1PULA 2M8UA 1YR5A 2M29A 2ZNEA 2LVJA 5HLVA 5D7FA 2D8NA 3H4SE 3OX6A 3SIBA 1OSAA 3CLNA 3AKAA 1NCZA 3DF0A 3ZNIA 1KQMC 2WNDA 2LC5A 4MLWA 1S5GY 1ZMZA 2LVIA 4NDDA 2KDHA 3TDZA 1S36A 4N1FA 2LCPA 2OTGB 4BY4A 2IS9A 2KFFA 1CTRA 1QLKA 3LK0A 3E3RA 1AUIB 2E30A 3OP0A 3ICBA 4F0ZB 1DF0A 1CMGA 1F55A 2JC2A 1KFXS 1D1OA 1SCMC 3VRRA 4MRYA 4MBEA 1N65A 2Y5IA 1BU3A 5KTYA 1PSBA 3GK2A 4FQOA 2F8PA 1LA0A 1NCYA 2BECA 1K9PA 4OR9B 3IQOA 5HKWA 4AOMA 1V1FA 1IRJA 1NX3A 2H61A 2M7NA 1MF8B 3HX4A 1QX2A 4QJ4B 2QPTA 4CFQA 1WLMA 2JTTA 1KCYA 2KFGA 4CFRA 2B1UA 4WQ2A 1OOJA 2EHBA 5DKNA 2PALA 1QV0A 1CM4A 1B7TY 1ODBA 3CR2A 2K2AA 4AQJA 2HPSA 1ALVA 1NP8A 1ZOTB 1OZOA 1M63B 1UHJA 3EK8A 1A29A 1IGVA 5DKQA 3VRNA 2Q91A 4PHNA 2Y1NA 1IWQA 4XYNA 2DOQA 2BCAA 1NIWA 3EKJA 4JQ0D 2KBIA 1YUUA 2FJUB 2LLSA 1C07A 2K61A 2GV5A 2LANA 1OMDA 1BJFA 4OV2A 1XVJA 1CLMA 3JVTC 1A2XA 1FF1A 1CFPA 2LHIA 1J1DA 1DGVA 2I2RE 3C1VA 5TNCA 1A4PA 1QJTA 2LLTA 2PSRA 1R6PA 3I5HC 4USLA 5B8IB 2EC6C 3F45A 3WNXB 1Y0VH 4GGFC 1H4BA 1RFJA 1KQMB 3EVVA 3LK1A 2O5GA 1OQPA 1Y6WA 3AAKA 2HF5A 5HYDA 4GUKA 3BUNB 1BG1A 1A75B 1NX1A 1VRKA 1DJHA 4HREE 2AAOA 3DVEA 1H8BA 1DJIA 1PVAA 2CBLA 3SIAA 2ZKMX 2K0JA 3GK4X 1TCFA 4PHJA 1C7WA 2I18A 1RWYA 1MQ1A 5I2OA 3A4UB 3KEVA 3PALA 2JXLA 4OCIA 3BUMB 1XK4A 2M1KB 1SCMB 2KYCA 4L9MA 5CSIA 1TIZA 2WC8A 3CGAA 1SRAA 1TNWA 3DD4A 1K94A 4DUQA 4CLNA 5I8NA 3PM8A 4PE4A 3KPXA 4YI8A 1BR4B 4MRXA 1MWNA 3O4YA 4GAOA 1SK6D 1CDLA 1FI5A 1CB1A 1IQ5A 1TOPA 4YGBB 5K89A 3A8RA 4ICBA 1LKJA 1MXEA 2LUXA 3D0YA 4DCKA 1CDPA 2BL0C 4Q04A 2MLEC 4MZJA 1IKUA 1LVCD 4MZKA 1F70A 1KK7Z 4ZCVA 3JTDC 3IF7A 1OMRA 2BE6A 3PSRA 1LINA 1DJGA 3SJSA 1K9UA 1DTLA 1SNLA 4MN0A 2P6BB 1UHNA 2WCFA 3NSOA 2EGDA 1FI6A 3SG5A 1QVIZ 2M49B 2CT9A 5AFPA 1S1EA 1DJXA 5HKZA 3NSIA 1B9AA 2SASA 3SG4A 2NLNA 2V53A 5KSZA 1GQMA 1PALA 5JOLA 1NPQA 1L2OC 2KAYA 4FTGA 5ER4X 3JVTB 4E68A 1C7VA 1CDMA 2NCPA 1K90D 4GGNA 1B4CA 2LM5A 1XO5A 3BQ3A 1NCXA 4M2QA 3I5HB 4JWQA 2OS8C 1QASA 2EC6B 3CR4X 4DS7A 2GGMA 4YGEB 1KQVA 1K9KA 2FOTA 1J55A 5AEQA 1SY9A 1SL7A 2CCMA 1EXRA 4A4CA 2LP3A 2F2OA 1S5GZ 1SMGA 2RGIA 5BPJA 1JBAA 3I5IC 3IQQA 1CLBA 3I5FC 2MHHA 2H61C 4M2OA 1YRUB 1WRLA 2BBNA 5JJGA 1NUBA 5HKYA 2ZRSA 2I94A 2HQWA 3EKHA 4PE7A 3CTNA 4MZLA 3SG2A 4NQGA 4YBHB 2M0RA 3CZTX 5J3XA 1S6IA 1M46A 1DJZA 2ZN8A 4I5NB 4AQIA 3DVMA 2CXJA 3GOFA 2K7OA 1TNQA 4YGDB 4I5JA 3FIAA 2PASA 1OE9B 2MJWB 1K95A 1WLZA 1K8UA 3KO0A 4JPZB 2KQ6A 1WDCC 4PDZA 1KWOC 1UHKA 2WOSA 2KI6D 1MR8A 2JXCA 5CPVA 1XFUO 1G8IA 1K2HA 2JRFA 2JT0A 4N1GA 1QX5B 2BL0B 2LE9B 5AXIA 3SG3A 1QIVA 4YRUA 4QJ3B 4N5XA 1PSRA 4R1EA 4ORCB 1OMVA 1KSOA 3QRXA 5FYXA 1GGZA 3JTDB 3TS5C 1B1GA 5PALA 1SBJA 3NSKA 4XJKB 1CKKA 2LVVA 3BXKA 5ER5A 1CFDA 1YURA 2LMUA 2NXQA 3WHTB 2F2PA 2NZ0A 2WCBA 2MBXA 2JT3A 2KFHA 1XFZO 3DF0B 4BY5A 1B8LA 4CIDA 1KFUL 1N2DA 2AMIA 1CM1A 1X02A 1JC2A 5KU1A 2FCEA 1Y1XA 3WHUB 1BMOA 1UURA 1L2OB 1RJVA 2BKHB 1QX7A 1F54A 1DVIA 1KFUS 1ALWA 3SG6A 2WORA 1SR6C 1DJWA 1B8CA 2LVKA 2CNPA 2JOJA 2OS8B 1K93D 2FCDA 2HQ8A 4D1EA 4CPVA 1XFVO 4HRHA 2Y1MA 1DF0B 1TNPA 1QTXA 4GGFA 1J7PA 1ZUZA 1G4YR 1BF5A 4M2PA 2JU0A 2L98A 2H2KA 4C0KA 1YUTA 1TN4A 2M1UA 3M0WA 3SG7A 1B8RA 1S6JA 1V1GA 1S6CA 3TDIA 2LV7A 2R2IA 1W7JB 1KSMA 1QS7A 4YI9A 3I5IB 1R2UA 3I5FB 3FWCA 1JUOA 2SCPA 3FS7A 3CWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PN7 C;  1UUS A;  2VRG A;  4A4B A;  3CS1 A;  1YVL A;  2CTN A;  2OPO A;  3OHM B;  1YUS A;  1CDN A;  2BCX A;  1U5I B;  1JWD A;  1RK9 A;  3BYA A;  3GK1 A;  2MRD A;  1KK7 Y;  1SL9 A;  1BOC A;  2BBM A;  4DRW A;  3LLE A;  1XFX O;  2KSP A;  3NXA A;  1F4O A;  2JZI A;  1EJ3 A;  2L4I A;  2Q4U A;  3VGO A;  5I2L A;  3KHE A;  1QVI Y;  5F6T A;  1XFY O;  3OX5 A;  1UHI A;  2ISD A;  2L0P A;  1WDC B;  1YVH A;  1REC A;  1WRZ A;  1KWO B;  1JF0 A;  1NSH A;  1N0Y A;  1IG5 A;  1SYM A;  3BUW B;  1IQ3 A;  2LUC A;  2KI4 C;  4HSZ A;  3O78 A;  1F8H A;  2BE4 A;  3I5G B;  4PHK A;  1FPW A;  1JFK A;  1G33 A;  4PAL A;  3D10 A;  3FWB A;  2F33 A;  5CSF A;  1SL8 A;  1BR1 B;  3TS5 B;  1DJY A;  4TNC A;  1AJ4 A;  3VRQ A;  1RTP 1;  4I5L B;  2MLF C;  2PMY A;  1Y1A A;  4C0J A;  1XYD A;  1F4Q A;  2COL B;  3TDU A;  2JT8 A;  2ZFD A;  4PE1 A;  4U8D A;  3PAT A;  2LHL A;  2JPT A;  1JSA A;  2G2B A;  4MEW A;  2AUC A;  3KF9 A;  2WCE A;  1EG4 A;  2K2F A;  2L51 A;  1CFC A;  1A75 A;  4MVF A;  1JFJ A;  1YTZ C;  2L50 A;  2L4H A;  2M97 A;  1GJY A;  3TUY C;  2KQY A;  1NX2 A;  1TTX A;  3O2P A;  1M31 A;  1KFX L;  1SR6 B;  4YGA A;  1AP4 A;  1S26 D;  1DMO A;  3AAJ A;  1EL4 A;  1IJ5 A;  3BOW B;  2M7L A;  3ZWH A;  2KOT A;  3LCP C;  2I7A A;  2Y4Q A;  3OB2 B;  2QAC A;  3LL8 B;  1XA5 A;  1SPY A;  4NDC A;  2K8M B;  2TN4 A;  2K7B A;  1HT9 A;  1J7O A;  1CLL A;  1J7Q A;  1PRW A;  1QXP A;  1KK8 C;  2K7C A;  2LP2 A;  2M3W A;  2JNF A;  3DVJ A;  2GGZ A;  3EVU A;  2L5X B;  3HCM A;  1M39 A;  1UWO A;  3PLF B;  4YGC B;  3TZ1 A;  1K96 A;  5CSN A;  2KGB C;  1IJ6 A;  3PN7 B;  1YX8 A;  2LLU A;  1NX0 A;  1XFW O;  4HRG A;  4GNK B;  3I5G C;  4IL1 A;  3D0Y B;  5G08 A;  1FBV A;  1U5I A;  1NYA A;  3CR5 X;  2BKI B;  2BCB A;  2JWW A;  1CFF A;  4ZCU A;  1Q80 A;  4OKH A;  2HET A;  1AHR A;  2F3Z A;  3K21 A;  1B7T Z;  1J1E A;  1E8A A;  2JUL A;  3WXA A;  1Y1U A;  2LAP A;  1AVS A;  1UP5 A;  2KHN A;  2PVB A;  3EVR A;  2M9G A;  4ETO A;  1AJ5 A;  3MSE B;  5I2Q A;  2LMV A;  2KAX A;  2KI4 B;  3OB1 B;  4MSP A;  1BLQ A;  3EK7 A;  1YRT B;  1ZFS A;  3O6B A;  1L7Z A;  2ZND A;  1SW8 A;  1SKT A;  2KI6 C;  4C0L A;  1EG3 A;  1IH0 A;  4NDB A;  2G9B A;  3AKB A;  3VRP A;  4ORA B;  3DVK A;  4GBA A;  2KAV A;  1J7R A;  2OTG C;  3RM1 A;  1WRK A;  1MHO A;  1UHH A;  1LA3 A;  1PK0 D;  1M45 A;  1CMF A;  4GPL B;  1FW4 A;  5CSJ A;  1TNX A;  2O60 A;  2K7D A;  2L2E A;  1JF2 A;  1QLS A;  1LXF C;  1QV1 A;  1ZAC A;  1XK4 C;  2LMT A;  1CNP A;  3PFV A;  5AER A;  4OVN F;  1YX7 A;  5AAN A;  4ORB B;  5IBW A;  4DIR A;  2E6W A;  3TUY B;  5DKR A;  1QIW A;  3EK4 A;  1MXL C;  1TCO B;  3NSL A;  5GQQ C;  1PVB A;  2JQ6 A;  3BOW A;  3BUO B;  1DGU A;  1BT6 A;  4P2Y B;  2KYF A;  2NCO A;  5D69 A;  4QJ5 B;  1AK8 A;  1SCV A;  2F3Y A;  2JTZ A;  5HLO A;  3RLZ A;  1A03 A;  1S3P A;  4PHM A;  4PCW A;  4UPG A;  1GGW A;  2MA2 A;  1TRF A;  1KK8 B;  1WY9 A;  2ZRT A;  4GFT A;  4PE0 A;  1F71 A;  2PRU A;  1MUX A;  1BOD A;  4WQ3 A;  1B47 A;  3VRO A;  2LNK A;  4P5O E;  2KNE A;  1NWD A;  2MAZ A;  1W7I B;  2A4J A;  1RRO A;  1OZS A;  2KBM A;  1EH2 A;  1QAT A;  3BUX B;  1HQV A;  2ZN9 A;  4WRI A;  2KGR A;  2JNX A;  4I5K A;  1DT7 B;  4XJK A;  1PUL A;  2M8U A;  1YR5 A;  2M29 A;  2ZNE A;  2LVJ A;  5HLV A;  5D7F A;  2D8N A;  3H4S E;  3OX6 A;  3SIB A;  1OSA A;  3CLN A;  3AKA A;  1NCZ A;  3DF0 A;  3ZNI A;  1KQM C;  2WND A;  2LC5 A;  4MLW A;  1S5G Y;  1ZMZ A;  2LVI A;  4NDD A;  2KDH A;  3TDZ A;  1S36 A;  4N1F A;  2LCP A;  2OTG B;  4BY4 A;  2IS9 A;  2KFF A;  1CTR A;  1QLK A;  3LK0 A;  3E3R A;  1AUI B;  2E30 A;  3OP0 A;  3ICB A;  4F0Z B;  1DF0 A;  1CMG A;  1F55 A;  2JC2 A;  1KFX S;  1D1O A;  1SCM C;  3VRR A;  4MRY A;  4MBE A;  1N65 A;  2Y5I A;  1BU3 A;  5KTY A;  1PSB A;  3GK2 A;  4FQO A;  2F8P A;  1LA0 A;  1NCY A;  2BEC A;  1K9P A;  4OR9 B;  3IQO A;  5HKW A;  4AOM A;  1V1F A;  1IRJ A;  1NX3 A;  2H61 A;  2M7N A;  1MF8 B;  3HX4 A;  1QX2 A;  4QJ4 B;  2QPT A;  4CFQ A;  1WLM A;  2JTT A;  1KCY A;  2KFG A;  4CFR A;  2B1U A;  4WQ2 A;  1OOJ A;  2EHB A;  5DKN A;  2PAL A;  1QV0 A;  1CM4 A;  1B7T Y;  1ODB A;  3CR2 A;  2K2A A;  4AQJ A;  2HPS A;  1ALV A;  1NP8 A;  1ZOT B;  1OZO A;  1M63 B;  1UHJ A;  3EK8 A;  1A29 A;  1IGV A;  5DKQ A;  3VRN A;  2Q91 A;  4PHN A;  2Y1N A;  1IWQ A;  4XYN A;  2DOQ A;  2BCA A;  1NIW A;  3EKJ A;  4JQ0 D;  2KBI A;  1YUU A;  2FJU B;  2LLS A;  1C07 A;  2K61 A;  2GV5 A;  2LAN A;  1OMD A;  1BJF A;  4OV2 A;  1XVJ A;  1CLM A;  3JVT C;  1A2X A;  1FF1 A;  1CFP A;  2LHI A;  1J1D A;  1DGV A;  2I2R E;  3C1V A;  5TNC A;  1A4P A;  1QJT A;  2LLT A;  2PSR A;  1R6P A;  3I5H C;  4USL A;  5B8I B;  2EC6 C;  3F45 A;  3WNX B;  1Y0V H;  4GGF C;  1H4B A;  1RFJ A;  1KQM B;  3EVV A;  3LK1 A;  2O5G A;  1OQP A;  1Y6W A;  3AAK A;  2HF5 A;  5HYD A;  4GUK A;  3BUN B;  1BG1 A;  1A75 B;  1NX1 A;  1VRK A;  1DJH A;  4HRE E;  2AAO A;  3DVE A;  1H8B A;  1DJI A;  1PVA A;  2CBL A;  3SIA A;  2ZKM X;  2K0J A;  3GK4 X;  1TCF A;  4PHJ A;  1C7W A;  2I18 A;  1RWY A;  1MQ1 A;  5I2O A;  3A4U B;  3KEV A;  3PAL A;  2JXL A;  4OCI A;  3BUM B;  1XK4 A;  2M1K B;  1SCM B;  2KYC A;  4L9M A;  5CSI A;  1TIZ A;  2WC8 A;  3CGA A;  1SRA A;  1TNW A;  3DD4 A;  1K94 A;  4DUQ A;  4CLN A;  5I8N A;  3PM8 A;  4PE4 A;  3KPX A;  4YI8 A;  1BR4 B;  4MRX A;  1MWN A;  3O4Y A;  4GAO A;  1SK6 D;  1CDL A;  1FI5 A;  1CB1 A;  1IQ5 A;  1TOP A;  4YGB B;  5K89 A;  3A8R A;  4ICB A;  1LKJ A;  1MXE A;  2LUX A;  3D0Y A;  4DCK A;  1CDP A;  2BL0 C;  4Q04 A;  2MLE C;  4MZJ A;  1IKU A;  1LVC D;  4MZK A;  1F70 A;  1KK7 Z;  4ZCV A;  3JTD C;  3IF7 A;  1OMR A;  2BE6 A;  3PSR A;  1LIN A;  1DJG A;  3SJS A;  1K9U A;  1DTL A;  1SNL A;  4MN0 A;  2P6B B;  1UHN A;  2WCF A;  3NSO A;  2EGD A;  1FI6 A;  3SG5 A;  1QVI Z;  2M49 B;  2CT9 A;  5AFP A;  1S1E A;  1DJX A;  5HKZ A;  3NSI A;  1B9A A;  2SAS A;  3SG4 A;  2NLN A;  2V53 A;  5KSZ A;  1GQM A;  1PAL A;  5JOL A;  1NPQ A;  1L2O C;  2KAY A;  4FTG A;  5ER4 X;  3JVT B;  4E68 A;  1C7V A;  1CDM A;  2NCP A;  1K90 D;  4GGN A;  1B4C A;  2LM5 A;  1XO5 A;  3BQ3 A;  1NCX A;  4M2Q A;  3I5H B;  4JWQ A;  2OS8 C;  1QAS A;  2EC6 B;  3CR4 X;  4DS7 A;  2GGM A;  4YGE B;  1KQV A;  1K9K A;  2FOT A;  1J55 A;  5AEQ A;  1SY9 A;  1SL7 A;  2CCM A;  1EXR A;  4A4C A;  2LP3 A;  2F2O A;  1S5G Z;  1SMG A;  2RGI A;  5BPJ A;  1JBA A;  3I5I C;  3IQQ A;  1CLB A;  3I5F C;  2MHH A;  2H61 C;  4M2O A;  1YRU B;  1WRL A;  2BBN A;  5JJG A;  1NUB A;  5HKY A;  2ZRS A;  2I94 A;  2HQW A;  3EKH A;  4PE7 A;  3CTN A;  4MZL A;  3SG2 A;  4NQG A;  4YBH B;  2M0R A;  3CZT X;  5J3X A;  1S6I A;  1M46 A;  1DJZ A;  2ZN8 A;  4I5N B;  4AQI A;  3DVM A;  2CXJ A;  3GOF A;  2K7O A;  1TNQ A;  4YGD B;  4I5J A;  3FIA A;  2PAS A;  1OE9 B;  2MJW B;  1K95 A;  1WLZ A;  1K8U A;  3KO0 A;  4JPZ B;  2KQ6 A;  1WDC C;  4PDZ A;  1KWO C;  1UHK A;  2WOS A;  2KI6 D;  1MR8 A;  2JXC A;  5CPV A;  1XFU O;  1G8I A;  1K2H A;  2JRF A;  2JT0 A;  4N1G A;  1QX5 B;  2BL0 B;  2LE9 B;  5AXI A;  3SG3 A;  1QIV A;  4YRU A;  4QJ3 B;  4N5X A;  1PSR A;  4R1E A;  4ORC B;  1OMV A;  1KSO A;  3QRX A;  5FYX A;  1GGZ A;  3JTD B;  3TS5 C;  1B1G A;  5PAL A;  1SBJ A;  3NSK A;  4XJK B;  1CKK A;  2LVV A;  3BXK A;  5ER5 A;  1CFD A;  1YUR A;  2LMU A;  2NXQ A;  3WHT B;  2F2P A;  2NZ0 A;  2WCB A;  2MBX A;  2JT3 A;  2KFH A;  1XFZ O;  3DF0 B;  4BY5 A;  1B8L A;  4CID A;  1KFU L;  1N2D A;  2AMI A;  1CM1 A;  1X02 A;  1JC2 A;  5KU1 A;  2FCE A;  1Y1X A;  3WHU B;  1BMO A;  1UUR A;  1L2O B;  1RJV A;  2BKH B;  1QX7 A;  1F54 A;  1DVI A;  1KFU S;  1ALW A;  3SG6 A;  2WOR A;  1SR6 C;  1DJW A;  1B8C A;  2LVK A;  2CNP A;  2JOJ A;  2OS8 B;  1K93 D;  2FCD A;  2HQ8 A;  4D1E A;  4CPV A;  1XFV O;  4HRH A;  2Y1M A;  1DF0 B;  1TNP A;  1QTX A;  4GGF A;  1J7P A;  1ZUZ A;  1G4Y R;  1BF5 A;  4M2P A;  2JU0 A;  2L98 A;  2H2K A;  4C0K A;  1YUT A;  1TN4 A;  2M1U A;  3M0W A;  3SG7 A;  1B8R A;  1S6J A;  1V1G A;  1S6C A;  3TDI A;  2LV7 A;  2R2I A;  1W7J B;  1KSM A;  1QS7 A;  4YI9 A;  3I5I B;  1R2U A;  3I5F B;  3FWC A;  1JUO A;  2SCP A;  3FS7 A;  3CWG A; 
#chains in the Genus database with same CATH topology
 3D73 A;  3PN7 C;  1UUS A;  2VRG A;  4A4B A;  3CS1 A;  1YVL A;  2CTN A;  2OPO A;  3OHM B;  1YUS A;  3B7A A;  2BCX A;  1U5I B;  2H8V A;  1CDN A;  1RK9 A;  3BYA A;  3GK1 A;  1JWD A;  2MRD A;  1KK7 Y;  1SL9 A;  1BOC A;  2BBM A;  4DRW A;  3LLE A;  1XFX O;  2KSP A;  3NHI A;  3NXA A;  1F4O A;  2JZI A;  1EJ3 A;  2L4I A;  2Q4U A;  3VGO A;  5I2L A;  3KHE A;  1QVI Y;  5F6T A;  1XFY O;  3OX5 A;  1UHI A;  5FI6 A;  2L0P A;  2ISD A;  1WDC B;  1YVH A;  1REC A;  1WRZ A;  1KWO B;  1JF0 A;  1Z2C B;  1NSH A;  1N0Y A;  1IG5 A;  1SYM A;  3BUW B;  1IQ3 A;  2LUC A;  2KI4 C;  4HSZ A;  3O78 A;  1F8H A;  2BE4 A;  3I5G B;  4KYN A;  4PHK A;  1JFK A;  1G33 A;  1DC1 A;  3R72 A;  4PAL A;  3D10 A;  3D78 A;  2F33 A;  3FWB A;  5CSF A;  1SL8 A;  1OW4 A;  1BR1 B;  3B88 A;  1DJY A;  4TNC A;  1AJ4 A;  3TS5 B;  3VRQ A;  1RTP 1;  4I5L B;  2MLF C;  2PMY A;  1Y1A A;  4C0J A;  3D76 A;  3L4A A;  1XYD A;  5DIC A;  2WC5 A;  1F4Q A;  2COL B;  2QEO A;  1ORG A;  3FE8 A;  3TDU A;  2JT8 A;  2ZFD A;  4PE1 A;  4U8D A;  3PAT A;  2LHL A;  2JPT A;  1JSA A;  2G2B A;  4MEW A;  3CZ1 A;  2AUC A;  3KF9 A;  2WCE A;  1EG4 A;  2K2F A;  2L51 A;  1CFC A;  1A75 A;  4MVF A;  1JFJ A;  1YTZ C;  2L50 A;  2L4H A;  2M97 A;  1GJY A;  3TUY C;  2KQY A;  1NX2 A;  1TTX A;  3O2P A;  1M31 A;  1KFX L;  1SR6 B;  4YGA A;  1AP4 A;  1S26 D;  1DMO A;  3AAJ A;  1EL4 A;  1IJ5 A;  3BOW B;  2M7L A;  3ZWH A;  2KOT A;  3NHT A;  2L5Y A;  3LCP C;  2I7A A;  3CZ0 A;  2Y4Q A;  3OB2 B;  2QAC A;  3LL8 B;  1XA5 A;  1SPY A;  4NDC A;  2K8M B;  2TN4 A;  2K7B A;  1HT9 A;  1J7O A;  1CLL A;  1J7Q A;  1PRW A;  1QXP A;  2YGU A;  1KK8 C;  2K7C A;  2LP2 A;  2M3W A;  2JNF A;  3DVJ A;  2GGZ A;  3EVU A;  2L5X B;  3HCM A;  3Q8I A;  1M39 A;  1UWO A;  3PLF B;  4YGC B;  3TZ1 A;  1K96 A;  3FE6 A;  5CSN A;  2KGB C;  1IJ6 A;  3UO9 A;  3PN7 B;  1YX8 A;  2LLU A;  1NX0 A;  1XFW O;  4HRG A;  4GNK B;  3I5G C;  3S0G A;  4IL1 A;  3D0Y B;  5G08 A;  1FBV A;  1U5I A;  1NYA A;  3CR5 X;  2BKI B;  2BCB A;  2JWW A;  1CFF A;  4ZCU A;  1Q80 A;  4OKH A;  2HET A;  1AHR A;  2F3Z A;  3K21 A;  1C3Z A;  1B7T Z;  1J1E A;  1E8A A;  1FPW A;  2JUL A;  3WXA A;  1Y1U A;  2LAP A;  1AVS A;  1UP5 A;  2KHN A;  2PVB A;  3N7H A;  3EVR A;  2M9G A;  4ETO A;  1AJ5 A;  3MSE B;  5I2Q A;  2LMV A;  2KAX A;  2KI4 B;  3OB1 B;  4MSP A;  1BLQ A;  3EK7 A;  1YRT B;  3B87 A;  1ZFS A;  3O6B A;  1L7Z A;  2ZND A;  1SW8 A;  1SKT A;  2KI6 C;  4C0L A;  1EG3 A;  1IH0 A;  5D3O A;  4NDB A;  2G9B A;  3AKB A;  3VRP A;  4ORA B;  3DVK A;  4GBA A;  2KAV A;  1J7R A;  2OTG C;  3RM1 A;  3BFH A;  1WRK A;  1MHO A;  1UHH A;  1LA3 A;  1PK0 D;  1M45 A;  1CMF A;  4GPL B;  1FW4 A;  5CSJ A;  1TNX A;  2O60 A;  3QME A;  2K7D A;  2L2E A;  1JF2 A;  1QLS A;  1LXF C;  1QV1 A;  1ZAC A;  1XK4 C;  2LMT A;  1CNP A;  3CAB A;  3PFV A;  5AER A;  4OVN F;  1YX7 A;  5AAN A;  3UNW A;  4ORB B;  3VB1 A;  5IBW A;  4DIR A;  2E6W A;  3B86 A;  3TUY B;  5DKR A;  1QIW A;  3DYE A;  1MXL C;  1TCO B;  3EK4 A;  3NSL A;  1PVB A;  5GQQ C;  2JQ6 A;  5FI2 A;  3BOW A;  3BUO B;  1DGU A;  1BT6 A;  4P2Y B;  2KYF A;  2NCO A;  3BJH A;  5D69 A;  4QJ5 B;  1AK8 A;  1LS8 A;  1SCV A;  2F3Y A;  2JTZ A;  1OOG A;  5HLO A;  3SG7 A;  3RLZ A;  1OOH A;  1A03 A;  3S0A A;  1TWO A;  1S3P A;  4PHM A;  4PCW A;  4UPG A;  1GGW A;  2MA2 A;  1TRF A;  1KK8 B;  4INW A;  1WY9 A;  2ZRT A;  2QEH A;  4GFT A;  4PE0 A;  2BAP A;  2PRU A;  1MUX A;  1BOD A;  1F71 A;  4WQ3 A;  1B47 A;  3VRO A;  2LNK A;  4P5O E;  2KNE A;  1NWD A;  2MAZ A;  3CYZ A;  1W7I B;  2PYQ A;  2A4J A;  1RRO A;  1OZS A;  2KBM A;  1EH2 A;  1QAT A;  3BUX B;  1HQV A;  2WCJ A;  2ZN9 A;  4WRI A;  2KGR A;  2JNX A;  5HL1 A;  4I5K A;  1DT7 B;  4XJK A;  1PUL A;  2M8U A;  1YR5 A;  2M29 A;  2ERB A;  2LVJ A;  2ZNE A;  1QWV A;  5D7F A;  2D8N A;  3H4S E;  5HLV A;  3OX6 A;  3SIB A;  1OSA A;  3CLN A;  3IVT A;  3R1O A;  3AKA A;  1NCZ A;  3DF0 A;  3ZNI A;  3B6X A;  1KQM C;  2WND A;  2LC5 A;  4MLW A;  1S5G Y;  1ZMZ A;  2LVI A;  3FE9 A;  4NDD A;  2KDH A;  3TDZ A;  1S36 A;  4N1F A;  1P28 A;  2LCP A;  1IIO A;  2OTG B;  4BY4 A;  2IS9 A;  2KFF A;  1CTR A;  1QLK A;  3LK0 A;  3E3R A;  1AUI B;  2E30 A;  2GTE A;  3OP0 A;  3ICB A;  4F0Z B;  1DF0 A;  1CMG A;  1F55 A;  2JC2 A;  1KFX S;  1D1O A;  1C3Y A;  1SCM C;  3VRR A;  3D77 A;  2WCM A;  4MRY A;  4MBE A;  1N65 A;  2Y5I A;  4F7F A;  1GM0 A;  1BU3 A;  5KTY A;  1PSB A;  3GK2 A;  4FQO A;  2F8P A;  3L4L A;  1LA0 A;  1NCY A;  1K9P A;  2BEC A;  3CZ2 A;  3IQO A;  4OR9 B;  5HKW A;  1V1F A;  1IRJ A;  1NX3 A;  2H61 A;  4INX A;  4AOM A;  2M7N A;  1MF8 B;  3HX4 A;  1QX2 A;  4QJ4 B;  2QPT A;  4CFQ A;  1WLM A;  2JTT A;  5EL2 A;  1KCY A;  3RZS A;  2KFG A;  4CFR A;  2B1U A;  2PQL A;  4WQ2 A;  1OOJ A;  2EHB A;  5DKN A;  2PAL A;  1QV0 A;  1CM4 A;  1B7T Y;  1ODB A;  3CR2 A;  2K2A A;  4AQJ A;  2HPS A;  1ALV A;  1NP8 A;  1ZOT B;  1OZO A;  1M63 B;  1UHJ A;  3EK8 A;  1A29 A;  3NGV A;  1IGV A;  1T14 A;  5DKQ A;  3VRN A;  2Q91 A;  4PHN A;  2Y1N A;  1IWQ A;  4XYN A;  2DOQ A;  2BCA A;  1NIW A;  3EKJ A;  4JQ0 D;  2KBI A;  1Z4H A;  1YUU A;  3DZT A;  2FJU B;  2LLS A;  1C07 A;  2K61 A;  2GV5 A;  2LAN A;  1OMD A;  1BJF A;  4OV2 A;  2KLE A;  1XVJ A;  1CLM A;  3JVT C;  1A2X A;  1FF1 A;  1CFP A;  2LHI A;  1J1D A;  1DGV A;  2I2R E;  3C1V A;  5TNC A;  1A4P A;  1QJT A;  2LLT A;  2PSR A;  3K1E A;  1R6P A;  3I5H C;  3SS5 A;  4USL A;  5B8I B;  2EC6 C;  3F45 A;  1XFR A;  3WNX B;  1Y0V H;  4GGF C;  1H4B A;  1RFJ A;  3R1P A;  1KQM B;  3EVV A;  3LK1 A;  2O5G A;  1OQP A;  1Y6W A;  3AAK A;  2HF5 A;  5HYD A;  4GUK A;  3BUN B;  2KLD A;  1BG1 A;  1A75 B;  1NX1 A;  1VRK A;  1DJH A;  4HRE E;  2AAO A;  3DVE A;  1H8B A;  1DJI A;  1DQE A;  1PVA A;  2CBL A;  3SIA A;  5FI7 A;  2ZKM X;  2K0J A;  3GK4 X;  1TCF A;  4PHJ A;  1C7W A;  2I18 A;  1RWY A;  1MQ1 A;  5I2O A;  3A4U B;  3KEV A;  3PAL A;  2JXL A;  4OCI A;  3BUM B;  1XK4 A;  2M1K B;  1SCM B;  2KYC A;  4L9M A;  5CSI A;  1TIZ A;  2WC8 A;  3CGA A;  1SRA A;  1TNW A;  3DD4 A;  1K94 A;  3BFA A;  3D74 A;  4DUQ A;  4CLN A;  5I8N A;  3PM8 A;  4PE4 A;  3KPX A;  4YI8 A;  1BR4 B;  2QEV A;  4MRX A;  1MWN A;  1W9Z A;  3O4Y A;  4GAO A;  1SK6 D;  1CDL A;  1FI5 A;  2P70 A;  2KPH A;  1CB1 A;  1TUZ A;  1IQ5 A;  1TOP A;  4YGB B;  5K89 A;  3A8R A;  4ICB A;  1LKJ A;  1MXE A;  2LUX A;  3D0Y A;  4DCK A;  1CDP A;  2BL0 C;  4Q04 A;  2MLE C;  4MZJ A;  3BFB A;  1IKU A;  1LVC D;  4MZK A;  1F70 A;  1KK7 Z;  4ZCV A;  3JTD C;  3IF7 A;  1OMR A;  2BE6 A;  3PSR A;  1LIN A;  1DJG A;  3SJS A;  1K9U A;  1DTL A;  1SNL A;  4MN0 A;  2P6B B;  1UHN A;  2WCF A;  3NSO A;  2EGD A;  5I94 A;  1FI6 A;  3SG5 A;  1QVI Z;  2M49 B;  2CT9 A;  5AFP A;  1S1E A;  1DJX A;  5HKZ A;  3NSI A;  1B9A A;  2SAS A;  3SG4 A;  2NLN A;  2V53 A;  5KSZ A;  1GQM A;  1PAL A;  5JOL A;  1NPQ A;  1L2O C;  2KAY A;  4FTG A;  5ER4 X;  3JVT B;  4E68 A;  1C7V A;  1CDM A;  2NCP A;  1K90 D;  4GGN A;  1B4C A;  2LM5 A;  3L47 A;  1XO5 A;  3BQ3 A;  1NCX A;  4M2Q A;  3I5H B;  4JWQ A;  2OS8 C;  1QAS A;  2EC6 B;  3CR4 X;  4DS7 A;  2GGM A;  4YGE B;  1KQV A;  1K9K A;  2FOT A;  1J55 A;  5AEQ A;  1SY9 A;  1SL7 A;  2CCM A;  1EXR A;  4A4C A;  2LP3 A;  1SSE B;  2F2O A;  2K60 A;  3S0B A;  1S5G Z;  1SMG A;  2RGI A;  5BPJ A;  1TUJ A;  2L2C A;  3PM2 A;  1JBA A;  3I5I C;  3IQQ A;  1CLB A;  3I5F C;  2MHH A;  2H61 C;  4M2O A;  1YRU B;  2P71 A;  1WRL A;  2BBN A;  5JJG A;  4PT1 A;  1NUB A;  5HKY A;  2ZRS A;  2I94 A;  3EG5 B;  2WCL A;  2HQW A;  2BNX A;  3EKH A;  3V2L A;  4PE7 A;  3CTN A;  4MZL A;  2QEB A;  3SG2 A;  4NQG A;  4YBH B;  2M0R A;  3CZT X;  5J3X A;  1S6I A;  1M46 A;  1DJZ A;  2ZN8 A;  3OGN A;  4I5N B;  4AQI A;  3DVM A;  2CXJ A;  2QDI A;  3GOF A;  2K7O A;  1TNQ A;  4YGD B;  4I5J A;  2FJY A;  3FIA A;  2PAS A;  1OE9 B;  2MJW B;  1K95 A;  1WLZ A;  1K8U A;  3KO0 A;  4JPZ B;  2KQ6 A;  1OOI X;  1WDC C;  4PDZ A;  1KWO C;  1UHK A;  2WOS A;  2KI6 D;  4JD9 A;  1MR8 A;  2JXC A;  5CPV A;  1XFU O;  1G8I A;  1K2H A;  3SS4 A;  4JKT A;  2JRF A;  2JT0 A;  4N1G A;  1QX5 B;  2BL0 B;  2LE9 B;  5AXI A;  3SG3 A;  1QIV A;  3D75 A;  4YRU A;  4QJ3 B;  4N5X A;  1PSR A;  4R1E A;  4ORC B;  1OMV A;  1KSO A;  2WCK A;  3QRX A;  1GGZ A;  2WC6 A;  3JTD B;  5FYX A;  3TS5 C;  1B1G A;  5PAL A;  1SBJ A;  3NSK A;  3R1V A;  4XJK B;  1CKK A;  2LVV A;  3BXK A;  5ER5 A;  1CFD A;  1YUR A;  2LMU A;  2NXQ A;  3WHT B;  2F2P A;  2NZ0 A;  2WCB A;  2MBX A;  4IJ7 A;  3PJI A;  1DEK A;  2JT3 A;  2KFH A;  1XFZ O;  3DF0 B;  4BY5 A;  1B8L A;  4CID A;  3SS3 A;  1KFU L;  4OZD A;  1N2D A;  1X02 A;  1CM1 A;  2AMI A;  1JC2 A;  5KU1 A;  2FCE A;  1Y1X A;  3DXL A;  1BMO A;  1UUR A;  1L2O B;  1RJV A;  2BKH B;  3WHU B;  1QX7 A;  1F54 A;  1DEL A;  3S0F A;  1DVI A;  1KFU S;  3O4X A;  3OBV A;  1ALW A;  3SG6 A;  1OOF A;  2WOR A;  1SR6 C;  1DJW A;  1B8C A;  2LVK A;  3S0D A;  2CNP A;  2JOJ A;  2OS8 B;  1K93 D;  2FCD A;  2HQ8 A;  4D1E A;  4CPV A;  1XFV O;  4HRH A;  2Y1M A;  1DF0 B;  1TNP A;  2JPO A;  1QTX A;  4GGF A;  1J7P A;  1ZUZ A;  1G4Y R;  4FQT A;  1BF5 A;  4M2P A;  2JU0 A;  3S0E A;  2L98 A;  2H2K A;  4C0K A;  1YUT A;  1TN4 A;  2M1U A;  2WCH A;  3CDN A;  1B8R A;  3M0W A;  1S6J A;  1V1G A;  1S6C A;  3DY9 A;  3TDI A;  2LV7 A;  2R2I A;  1W7J B;  1KSM A;  1QS7 A;  4YI9 A;  3I5I B;  1R2U A;  3I5F B;  3FWC A;  1JUO A;  2SCP A;  3FS7 A;  3CWG A; 
#chains in the Genus database with same CATH homology
 3PN7 C;  1UUS A;  2VRG A;  4A4B A;  3CS1 A;  1YVL A;  2CTN A;  2OPO A;  3OHM B;  1YUS A;  1CDN A;  2BCX A;  1U5I B;  1JWD A;  1RK9 A;  3BYA A;  3GK1 A;  2MRD A;  1KK7 Y;  1SL9 A;  1BOC A;  2BBM A;  4DRW A;  3LLE A;  1XFX O;  2KSP A;  3NXA A;  1F4O A;  2JZI A;  1EJ3 A;  2L4I A;  2Q4U A;  3VGO A;  5I2L A;  3KHE A;  1QVI Y;  5F6T A;  1XFY O;  3OX5 A;  1UHI A;  2ISD A;  2L0P A;  1WDC B;  1YVH A;  1REC A;  1WRZ A;  1KWO B;  1JF0 A;  1NSH A;  1N0Y A;  1IG5 A;  1SYM A;  3BUW B;  1IQ3 A;  2LUC A;  2KI4 C;  4HSZ A;  3O78 A;  1F8H A;  2BE4 A;  3I5G B;  4PHK A;  1FPW A;  1JFK A;  1G33 A;  4PAL A;  3D10 A;  3FWB A;  2F33 A;  5CSF A;  1SL8 A;  1BR1 B;  3TS5 B;  1DJY A;  4TNC A;  1AJ4 A;  3VRQ A;  1RTP 1;  4I5L B;  2MLF C;  2PMY A;  1Y1A A;  4C0J A;  1XYD A;  1F4Q A;  2COL B;  3TDU A;  2JT8 A;  2ZFD A;  4PE1 A;  4U8D A;  3PAT A;  2LHL A;  2JPT A;  1JSA A;  2G2B A;  4MEW A;  2AUC A;  3KF9 A;  2WCE A;  1EG4 A;  2K2F A;  2L51 A;  1CFC A;  1A75 A;  4MVF A;  1JFJ A;  1YTZ C;  2L50 A;  2L4H A;  2M97 A;  1GJY A;  3TUY C;  2KQY A;  1NX2 A;  1TTX A;  3O2P A;  1M31 A;  1KFX L;  1SR6 B;  4YGA A;  1AP4 A;  1S26 D;  1DMO A;  3AAJ A;  1EL4 A;  1IJ5 A;  3BOW B;  2M7L A;  3ZWH A;  2KOT A;  3LCP C;  2I7A A;  2Y4Q A;  3OB2 B;  2QAC A;  3LL8 B;  1XA5 A;  1SPY A;  4NDC A;  2K8M B;  2TN4 A;  2K7B A;  1HT9 A;  1J7O A;  1CLL A;  1J7Q A;  1PRW A;  1QXP A;  1KK8 C;  2K7C A;  2LP2 A;  2M3W A;  2JNF A;  3DVJ A;  2GGZ A;  3EVU A;  2L5X B;  3HCM A;  1M39 A;  1UWO A;  3PLF B;  4YGC B;  3TZ1 A;  1K96 A;  5CSN A;  2KGB C;  1IJ6 A;  3PN7 B;  1YX8 A;  2LLU A;  1NX0 A;  1XFW O;  4HRG A;  4GNK B;  3I5G C;  4IL1 A;  3D0Y B;  5G08 A;  1FBV A;  1U5I A;  1NYA A;  3CR5 X;  2BKI B;  2BCB A;  2JWW A;  1CFF A;  4ZCU A;  1Q80 A;  4OKH A;  2HET A;  1AHR A;  2F3Z A;  3K21 A;  1B7T Z;  1J1E A;  1E8A A;  2JUL A;  3WXA A;  1Y1U A;  2LAP A;  1AVS A;  1UP5 A;  2KHN A;  2PVB A;  3EVR A;  2M9G A;  4ETO A;  1AJ5 A;  3MSE B;  5I2Q A;  2LMV A;  2KAX A;  2KI4 B;  3OB1 B;  4MSP A;  1BLQ A;  3EK7 A;  1YRT B;  1ZFS A;  3O6B A;  1L7Z A;  2ZND A;  1SW8 A;  1SKT A;  2KI6 C;  4C0L A;  1EG3 A;  1IH0 A;  4NDB A;  2G9B A;  3AKB A;  3VRP A;  4ORA B;  3DVK A;  4GBA A;  2KAV A;  1J7R A;  2OTG C;  3RM1 A;  1WRK A;  1MHO A;  1UHH A;  1LA3 A;  1PK0 D;  1M45 A;  1CMF A;  4GPL B;  1FW4 A;  5CSJ A;  1TNX A;  2O60 A;  2K7D A;  2L2E A;  1JF2 A;  1QLS A;  1LXF C;  1QV1 A;  1ZAC A;  1XK4 C;  2LMT A;  1CNP A;  3PFV A;  5AER A;  4OVN F;  1YX7 A;  5AAN A;  4ORB B;  5IBW A;  4DIR A;  2E6W A;  3TUY B;  5DKR A;  1QIW A;  3EK4 A;  1MXL C;  1TCO B;  3NSL A;  5GQQ C;  1PVB A;  2JQ6 A;  3BOW A;  3BUO B;  1DGU A;  1BT6 A;  4P2Y B;  2KYF A;  2NCO A;  5D69 A;  4QJ5 B;  1AK8 A;  1SCV A;  2F3Y A;  2JTZ A;  5HLO A;  3RLZ A;  1A03 A;  1S3P A;  4PHM A;  4PCW A;  4UPG A;  1GGW A;  2MA2 A;  1TRF A;  1KK8 B;  1WY9 A;  2ZRT A;  4GFT A;  4PE0 A;  1F71 A;  2PRU A;  1MUX A;  1BOD A;  4WQ3 A;  1B47 A;  3VRO A;  2LNK A;  4P5O E;  2KNE A;  1NWD A;  2MAZ A;  1W7I B;  2A4J A;  1RRO A;  1OZS A;  2KBM A;  1EH2 A;  1QAT A;  3BUX B;  1HQV A;  2ZN9 A;  4WRI A;  2KGR A;  2JNX A;  4I5K A;  1DT7 B;  4XJK A;  1PUL A;  2M8U A;  1YR5 A;  2M29 A;  2ZNE A;  2LVJ A;  5HLV A;  5D7F A;  2D8N A;  3H4S E;  3OX6 A;  3SIB A;  1OSA A;  3CLN A;  3AKA A;  1NCZ A;  3DF0 A;  3ZNI A;  1KQM C;  2WND A;  2LC5 A;  4MLW A;  1S5G Y;  1ZMZ A;  2LVI A;  4NDD A;  2KDH A;  3TDZ A;  1S36 A;  4N1F A;  2LCP A;  2OTG B;  4BY4 A;  2IS9 A;  2KFF A;  1CTR A;  1QLK A;  3LK0 A;  3E3R A;  1AUI B;  2E30 A;  3OP0 A;  3ICB A;  4F0Z B;  1DF0 A;  1CMG A;  1F55 A;  2JC2 A;  1KFX S;  1D1O A;  1SCM C;  3VRR A;  4MRY A;  4MBE A;  1N65 A;  2Y5I A;  1BU3 A;  5KTY A;  1PSB A;  3GK2 A;  4FQO A;  2F8P A;  1LA0 A;  1NCY A;  2BEC A;  1K9P A;  4OR9 B;  3IQO A;  5HKW A;  4AOM A;  1V1F A;  1IRJ A;  1NX3 A;  2H61 A;  2M7N A;  1MF8 B;  3HX4 A;  1QX2 A;  4QJ4 B;  2QPT A;  4CFQ A;  1WLM A;  2JTT A;  1KCY A;  2KFG A;  4CFR A;  2B1U A;  4WQ2 A;  1OOJ A;  2EHB A;  5DKN A;  2PAL A;  1QV0 A;  1CM4 A;  1B7T Y;  1ODB A;  3CR2 A;  2K2A A;  4AQJ A;  2HPS A;  1ALV A;  1NP8 A;  1ZOT B;  1OZO A;  1M63 B;  1UHJ A;  3EK8 A;  1A29 A;  1IGV A;  5DKQ A;  3VRN A;  2Q91 A;  4PHN A;  2Y1N A;  1IWQ A;  4XYN A;  2DOQ A;  2BCA A;  1NIW A;  3EKJ A;  4JQ0 D;  2KBI A;  1YUU A;  2FJU B;  2LLS A;  1C07 A;  2K61 A;  2GV5 A;  2LAN A;  1OMD A;  1BJF A;  4OV2 A;  1XVJ A;  1CLM A;  3JVT C;  1A2X A;  1FF1 A;  1CFP A;  2LHI A;  1J1D A;  1DGV A;  2I2R E;  3C1V A;  5TNC A;  1A4P A;  1QJT A;  2LLT A;  2PSR A;  1R6P A;  3I5H C;  4USL A;  5B8I B;  2EC6 C;  3F45 A;  3WNX B;  1Y0V H;  4GGF C;  1H4B A;  1RFJ A;  1KQM B;  3EVV A;  3LK1 A;  2O5G A;  1OQP A;  1Y6W A;  3AAK A;  2HF5 A;  5HYD A;  4GUK A;  3BUN B;  1BG1 A;  1A75 B;  1NX1 A;  1VRK A;  1DJH A;  4HRE E;  2AAO A;  3DVE A;  1H8B A;  1DJI A;  1PVA A;  2CBL A;  3SIA A;  2ZKM X;  2K0J A;  3GK4 X;  1TCF A;  4PHJ A;  1C7W A;  2I18 A;  1RWY A;  1MQ1 A;  5I2O A;  3A4U B;  3KEV A;  3PAL A;  2JXL A;  4OCI A;  3BUM B;  1XK4 A;  2M1K B;  1SCM B;  2KYC A;  4L9M A;  5CSI A;  1TIZ A;  2WC8 A;  3CGA A;  1SRA A;  1TNW A;  3DD4 A;  1K94 A;  4DUQ A;  4CLN A;  5I8N A;  3PM8 A;  4PE4 A;  3KPX A;  4YI8 A;  1BR4 B;  4MRX A;  1MWN A;  3O4Y A;  4GAO A;  1SK6 D;  1CDL A;  1FI5 A;  1CB1 A;  1IQ5 A;  1TOP A;  4YGB B;  5K89 A;  3A8R A;  4ICB A;  1LKJ A;  1MXE A;  2LUX A;  3D0Y A;  4DCK A;  1CDP A;  2BL0 C;  4Q04 A;  2MLE C;  4MZJ A;  1IKU A;  1LVC D;  4MZK A;  1F70 A;  1KK7 Z;  4ZCV A;  3JTD C;  3IF7 A;  1OMR A;  2BE6 A;  3PSR A;  1LIN A;  1DJG A;  3SJS A;  1K9U A;  1DTL A;  1SNL A;  4MN0 A;  2P6B B;  1UHN A;  2WCF A;  3NSO A;  2EGD A;  1FI6 A;  3SG5 A;  1QVI Z;  2M49 B;  2CT9 A;  5AFP A;  1S1E A;  1DJX A;  5HKZ A;  3NSI A;  1B9A A;  2SAS A;  3SG4 A;  2NLN A;  2V53 A;  5KSZ A;  1GQM A;  1PAL A;  5JOL A;  1NPQ A;  1L2O C;  2KAY A;  4FTG A;  5ER4 X;  3JVT B;  4E68 A;  1C7V A;  1CDM A;  2NCP A;  1K90 D;  4GGN A;  1B4C A;  2LM5 A;  1XO5 A;  3BQ3 A;  1NCX A;  4M2Q A;  3I5H B;  4JWQ A;  2OS8 C;  1QAS A;  2EC6 B;  3CR4 X;  4DS7 A;  2GGM A;  4YGE B;  1KQV A;  1K9K A;  2FOT A;  1J55 A;  5AEQ A;  1SY9 A;  1SL7 A;  2CCM A;  1EXR A;  4A4C A;  2LP3 A;  2F2O A;  1S5G Z;  1SMG A;  2RGI A;  5BPJ A;  1JBA A;  3I5I C;  3IQQ A;  1CLB A;  3I5F C;  2MHH A;  2H61 C;  4M2O A;  1YRU B;  1WRL A;  2BBN A;  5JJG A;  1NUB A;  5HKY A;  2ZRS A;  2I94 A;  2HQW A;  3EKH A;  4PE7 A;  3CTN A;  4MZL A;  3SG2 A;  4NQG A;  4YBH B;  2M0R A;  3CZT X;  5J3X A;  1S6I A;  1M46 A;  1DJZ A;  2ZN8 A;  4I5N B;  4AQI A;  3DVM A;  2CXJ A;  3GOF A;  2K7O A;  1TNQ A;  4YGD B;  4I5J A;  3FIA A;  2PAS A;  1OE9 B;  2MJW B;  1K95 A;  1WLZ A;  1K8U A;  3KO0 A;  4JPZ B;  2KQ6 A;  1WDC C;  4PDZ A;  1KWO C;  1UHK A;  2WOS A;  2KI6 D;  1MR8 A;  2JXC A;  5CPV A;  1XFU O;  1G8I A;  1K2H A;  2JRF A;  2JT0 A;  4N1G A;  1QX5 B;  2BL0 B;  2LE9 B;  5AXI A;  3SG3 A;  1QIV A;  4YRU A;  4QJ3 B;  4N5X A;  1PSR A;  4R1E A;  4ORC B;  1OMV A;  1KSO A;  3QRX A;  5FYX A;  1GGZ A;  3JTD B;  3TS5 C;  1B1G A;  5PAL A;  1SBJ A;  3NSK A;  4XJK B;  1CKK A;  2LVV A;  3BXK A;  5ER5 A;  1CFD A;  1YUR A;  2LMU A;  2NXQ A;  3WHT B;  2F2P A;  2NZ0 A;  2WCB A;  2MBX A;  2JT3 A;  2KFH A;  1XFZ O;  3DF0 B;  4BY5 A;  1B8L A;  4CID A;  1KFU L;  1N2D A;  2AMI A;  1CM1 A;  1X02 A;  1JC2 A;  5KU1 A;  2FCE A;  1Y1X A;  3WHU B;  1BMO A;  1UUR A;  1L2O B;  1RJV A;  2BKH B;  1QX7 A;  1F54 A;  1DVI A;  1KFU S;  1ALW A;  3SG6 A;  2WOR A;  1SR6 C;  1DJW A;  1B8C A;  2LVK A;  2CNP A;  2JOJ A;  2OS8 B;  1K93 D;  2FCD A;  2HQ8 A;  4D1E A;  4CPV A;  1XFV O;  4HRH A;  2Y1M A;  1DF0 B;  1TNP A;  1QTX A;  4GGF A;  1J7P A;  1ZUZ A;  1G4Y R;  1BF5 A;  4M2P A;  2JU0 A;  2L98 A;  2H2K A;  4C0K A;  1YUT A;  1TN4 A;  2M1U A;  3M0W A;  3SG7 A;  1B8R A;  1S6J A;  1V1G A;  1S6C A;  3TDI A;  2LV7 A;  2R2I A;  1W7J B;  1KSM A;  1QS7 A;  4YI9 A;  3I5I B;  1R2U A;  3I5F B;  3FWC A;  1JUO A;  2SCP A;  3FS7 A;  3CWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...